2INWA

Crystal structure of q83jn9 from shigella flexneri at high resolution. northeast structural genomics consortium target sfr137.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
TLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGGELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative structural protein
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Structural genomics, unknown function
total genus 21
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2inwA01
5I5LA 4R38A 4I38A 2V9AA 2PD7A 2Z6DA 4WF0A 4DJ3A 3E4QA 2WKRA 4EW7A 3C2WA 1V9YA 1DP9A 3UB7A 1T1BA 4GHIA 1TS8A 3C8CA 3EWKA 3VOLA 4NXEA 3MQOA 1XJ3A 4HIAA 3IS2B 1T18A 4F3LA 2D01A 5HD5A 5F69A 3EEHA 5J7EA 4L9EA 1MZUA 4EEUA 4HJ4A 1G28A 3LI9A 3ZQ5A 2V1BA 4WUJA 3CWFA 2QJ5A 3MQQA 3MR0A 4DJ2A 1LSVA 4LLOB 2H28A 5IU1A 1P97A 2D02A 5EFWA 5HWVA 4M4XA 4GS9B 1LSWA 3KX0X 3NHQA 2QWSA 3BY8A 3OLOA 3LI8A 4KUOA 1OTAA 4I3AA 5A8BA 1X0OA 2WKPA 5HZHA 3UMDA 5F68A 2OWJA 4WN5A 3ULFA 3LIDA 2QJ7A 1LSXA 3FG8A 3H82A 2GJ3A 3H7WB 5G4ZA 3LUQA 4HJ3A 4KUKA 3UB6A 1WA9A 4BBUA 1T1AA 2CMNA 3IS2A 2A24B 4JGRA 2W27A 2INWA 4LRZE 3G6OA 2ZOHA 3CLOA 5KIZA 4HP9A 2PDRA 5HDCA 4HP4A 2J80A 4GCZA 5J4EA 1T1CA 1T19A 3UB9A 2ZOIA 2OOLA 5F6AA 1OJ5A 1LL8A 1ODVA 1P0ZA 4EERA 1OT9A 3VE3A 4JGQA 4L9GA 4R70A 5DJTA 1OT6A 3A0VA 5HWWA 1XFNA 2BASA 1GSWA 5J3WA 3LIBA 3SW1A 2QHKA 1OTIA 3K3DA 5AVFA 5G4YA 2W0NA 2L4RA 3BWLA 4MN6A 3E4PA 2WKQA 1OTDA 4EQ1A 2JHEA 4HI4A 3A0RA 3H7WA 2VV8A 3F1NB 4I39A 1TS7A 3NOTC 4E04A 4HNBA 5IS1A 1OJGA 2HV1A 4YWZA 4R3AA 4PKYG 2PD8A 2EA9A 4XT2B 4WL9A 4EXOA 1S67L 5TBMB 1TS6A 2KX6A 1DP8A 2A24A 2PR6A 4I3IA 3LICA 1XJ4A 4B9OA 2M1CA 1V9ZA 3K3CA 2I9VA 2V0WA 4WLAA 1JNUA 4HHDA 3NJAA 1OTBA 1BYWA 3ICYA 2PYRA 5F5YA 4EESA 1S1ZA 1UGUA 3H9WA 3PYPA 3LIFA 1S4RA 1XJ6A 4LRYC 2VV7A 1KOUA 3F1OB 3IBRA 3MJQA 3MFXA 2JN7A 2Z6CA 5AVEA 3FC7A 3GECA 4EEPA 1D7EA 4EETB 3MXQA 3P7NA 1OTEA 4I5SA 3LIEA 3F1NA 2L0WA 4HH2A 4K08A 4HH3A 3UMEA 2L1MA 4LPZA 1Y28A 4MN5A 4BBVA 4H6JB 4XT2A 5TBMA 3A0SA 3GDIA 1N9LA 1S4SA 2PR5A 5HWTA 4GS9A 5DKKA 5HSQA 3BY9A 3H82B 3CAXA 2PYPA 1LT0A 5HDDA 1UWPX 3NOPC 3D72A 3B33A 4KQDA 1DP6A 2VV6A 4HJ6A 1DRMA 3RH8B 4LRXC 4I3JA 1N9NA 3F1PB 3F1OA 3UE6A 1GSXA 4GW9A 3NOUC 1XJ2A 1NWZA 3HJKA 1UWNX 2B02A 1F98A 2YKHA 2P7JA 3UB8A 4NXBA 4HY8A 4GHIB 2K7SA 2QKPA 4H6JA 2R78A 4RQ9A 4F3LB 4L9FA 5DKLA 2OWHA 4HOIA 4JGOA 3PHYA 3LYXA 1S1YA 3RTYA 1GSVA 2V1AA 5HDSA 1TS0A 1EW0A 4NXFA 2ZBBA 4R6LA 4JGPA 4PKYA 5DJUA 3E4OA 2PHYA 3VE4A 2KDKA 1VB6A 5HD3A 2V0UA 2YKFA 3HJIA 1XFQA 2VEAA 2VLGA 4BBTA 1S66L 1N9OA 1D06A 4NXGA 1F9IA 3F1PA 3LIAA 3T50A 4HQAA
chains in the Genus database with same CATH superfamily
5CTMA 3U4LP 2V8CA 4MMNA 4IBXA 2V20A 2W1RA 1XA7A 4IHQA 4E3IA 5EVLA 4EW7A 5FATA 2BG1A 1YQSA 1W7FA 3P09A 3VOLA 1ES4A 3MQOA 4G3KA 1IOUA 2V1ZA 2EXAA 4OPRA 3T1QB 1E25A 4DXCA 3FZCA 4RVAA 3LR5A 5HD5A 4ETXA 3MMHA 3EQVA 5J7EA 2VGJA 1GHPA 4L9EA 3E98A 4CLCA 4EEUA 3C38A 2W3GA 3BFGA 4FCFA 4FH4A 4M3KA 2ZQ8A 3DAVA 4WUJA 4JF5A 2QPNA 4CLCE 5FEFA 3PBSA 1ACFA 3M2KA 2H28A 4RX2A 1W63Q 3TOIA 2M7VA 4KUOA 4X55A 2C5WB 3MXSA 2OWJA 1HZOA 4QWOA 4MLLA 3ZNTA 4OH0A 2WK0A 3LIDA 3T1SA 2XH9A 4X1LA 3FG8A 3CPTA 3OBFA 3H82A 3FPVA 5GLDA 3KYZA 2Y2LA 2GNXA 3V50A 4GDNA 4GZBA 2XA7S 4G3VA 4LV0A 2XDMA 4HJ3A 4KUKA 4JXVA 3UB6A 3LR4A 1PI4A 4JBFA 2CMNA 3IS2A 4WZ4A 2OLVA 1NJ4A 2A24B 4KZ8A 2B5RA 4LRZE 3G6OA 4GOGA 5M18A 1LLBA 5CRFA 2Y91A 3CI6A 3CLOA 5HDCA 4DE2A 2LB9A 2HP6A 1TDLA 3ZHHA 2Y2HA 1TF1A 3IF6B 1BTLA 1T1CA 1YAXA 1S0WA 5IT5A 4PM8A 5FL3A 1BSGA 2OOLA 4X1MA 4PHTA 5FDSA 1ZTUA 4Z9QA 4B4ZA 4CPKA 3LEQA 1K57A 4L9GA 5DJTA 3ZGAB 5FDHA 4FTXA 1H3QA 4R0QA 4IUHA 4NETA 3S7PA 4HEFA 2J9OA 1ES5A 1DY6A 3BFEA 2QHKA 1OTIA 5K5BA 1DJAA 3TW8A 2HDRA 4U0TA 2Y2IA 2Y59A 2VV8A 1ZG4A 1TS7A 4HNBA 5IS1A 1A0KA 4KZ7A 1KDWA 2QYBA 3O88A 4ARZA 3SH9A 1FILA 3HREA 3Q82A 4XT2B 3IH8A 1S67L 3C7VA 2KX6A 2PR6A 4I3IA 4B9OA 2FH5A 1VEUA 2M1CA 1V9ZA 2O9BA 2OLUA 3TE8A 4IVKA 1DJCA 3K3CA 3PBTA 3Q07A 1W63M 3E2KA 1OTBA 1BYWA 2PYRA 5F5YA 4EESA 3WS0A 3A3IA 1UGUA 5F83A 5CTNA 3IXGA 3KO6A 3DWZA 2ZQ7A 3PYPA 2J3TC 1S4RA 4WM9A 1HTZA 2VV7A 5DF9A 4JXGA 3MJQA 3CITA 4UQIS 1IYQA 1CQAA 1L0FA 3GECA 2FZ0A 1YSQA 1D7EA 1O7EA 3HL9A 4AFIA 1K38A 2R9WA 4I5SA 4MBFA 3MFDA 4P6ZS 1FIKA 3IHBA 4KZ9A 4LPZA 5HAPA 1Y28A 4ZJ2A 1Y4OA 1Q2PA 2Y8HA 3W4QA 3ZNYA 3LY4A 1S4SA 2R9XA 4KG2A 3V3SA 1KVMA 2Q9MA 4K91A 4X53A 3BFFA 5EOOA 5E2FA 1MWTA 2O9CA 1CI8A 1EI5A 2ZQ9A 4GDBA 2PRFA 3S7NA 2ZQDA 3UE0A 3O3VA 1PIOA 3GTCA 3JVUA 1LT0A 2P04A 2C6WB 1L2SA 5L07A 1K55A 2WAEA 3QP8A 5HDDA 3T12B 3TG9A 5AQBA 1PI5A 4OOLA 1MPLA 2PT7A 1DP6A 2Y55A 4DKIA 5JYOA 1L0EA 4WMCA 1ONGA 3BEBA 4I3JA 2W1TA 3EOIA 3F1OA 3UE6A 2JKTI 4GW9A 5FI2A 1F5MA 3NOUC 1JWPA 3LCEA 3HJKA 5F1GA 3IX3A 3OPRA 4EV4A 3ZG7B 4LV3A 1HD8A 3VP3A 1G6AA 4QJGA 4LFUA 4NEED 1W8QA 1P9RA 1K25A 2HPBA 3MSHA 2QKPA 2ACGA 1XP4A 2Y4AA 4O8GA 2O99A 2K31A 3JPUA 4E3LA 3BJNA 1PWCA 3PHYA 1BZAA 2A2LA 4UQIM 4Q8IA 3G34A 4CLCB 2XFSA 2DMWA 1EWZA 5FQKA 4JGPA 4WBGA 1DJBA 3HLDA 4PKYA 4OLDA 1NYYA 2PHYA 2KDKA 3VE4A 2PBYA 1PW1A 1D1JA 3HUMA 3HJIA 2VEAA 2V2FF 2VLGA 1I2WA 4K0XA 2HGVA 4YNRA 1N9OA 2LB5A 1C3BA 1D06A 3SOIA 5L2FA 3B42A 1F9IA 3F1PA 3LIAA 4OQHA 4BENA 5I94A 3IXBA 4OP5A 4HQAA 2RL3A 3KSGA 2IWBA 5I5LA 4R38A 3T4OA 1M6KA 2Q0OA 4WELA 3IF5A 4KZBA 2WKRA 3NBLA 1G5UA 1S6RA 4ZTKA 1DP9A 3UB7A 1TS8A 5FSRA 4JXWA 3BLSA 2JKRI 3E2LA 1P9WA 1JWVA 3BRMA 5GL9A 3IS2B 1T18A 2EX8A 3NC8A 3PBNA 5A92A 4S2LA 3P98A 3HUOA 5C5KA 5F1FA 2K2NA 2D01A 4KQQA 3HLEA 5FASA 5EOEA 3LI9A 3ZQ5A 1WYBA 1NZUA 2WAFA 3LGOA 3I7JA 3VFHA 3BECA 2Y2PA 3CWFA 3MQQA 4DJ2A 1LSVA 4OQIA 3C4PA 2ZJ9A 3SS4A 1P97A 4N9LA 5EFWA 5HWVA 3Q7VA 3NHQA 1K56A 4II7A 3LI8A 4I3AA 1CEGA 1MKIA 2P74A 5F68A 1LHYA 4R3BA 2W3EA 3LO7A 4GN2A 1SKOA 2QJ7A 1LSXA 4PM7A 3PBOA 3OC2A 3EGDC 2WKEA 5EVIC 3MF0A 3L7HA 4ARZB 5EVEA 3ZCZA 3FKWA 4ZJ1A 4YOFA 3IWIA 3T4KA 4JGRA 3VSLA 2ZOHA 1NZOA 5G18A 3VOZA 2ZM0A 4P85A 3QP6A 1G6OA 3G32A 1XXMA 2JBFA 4P6BA 4BL3A 1T19A 1HLUP 1M40A 1KE3A 2VZWA 1YLTA 1LL8A 4KZAA 4MEZA 4S2OA 3U2AA 2GDNA 1YM1A 1BULA 4UA7A 4E3JA 1OT6A 2VX8A 2Z2LB 3A0VA 1XFNA 3OCNA 3ZG8B 1MWUA 3LIBA 2ZC4B 2ZM8A 2W3FA 3ITBA 2J9PA 4U3TA 2W0NA 3NI9A 3WS5A 4MN6A 4R1GA 2WKQA 2EXBA 1OTDA 5HW3A 3H7WA 4I39A 2WADA 4X25A 3NOTC 3IH9A 2X02A 3WS4A 3HUNA 5A91A 2JC7A 4WL9A 4EXOA 2WZXA 5DF7A 1RP5A 4DRTA 2JKGA 4R4SA 5AJGA 5CEBA 2WZZA 3QHYA 1IELA 1YT4A 2I9VA 1J9MA 4HHDA 4C6YA 4DMZA 4DN0A 4X56A 3UPOA 3OZHA 4E3OA 3ICYA 4WZ5C 1MKMA 2Y2GA 5CHMA 3D9YA 5FQIA 2WGIA 3G2YA 1FOFA 5FAOA 3LIFA 3M6BA 4H8RA 3GMWA 1KOUA 2W1TB 3F1OB 3CJMA 2W3HA 3O87A 4B93A 3R4KA 1JWZA 3IHAA 4EU0A 3FC7A 3C4OA 5DFYA 5HPIA 4OKPA 3NCKA 1NRJA 1OTEA 3LIEA 3N8RA 2HDUA 5GLAA 4Q0JA 4K08A 1BLHA 4HH3A 4D2OA 5FQMA 4BBVA 1LI9A 2OV5A 4DDSA 1IYOA 2ZMFA 3SZTA 2HP5A 5HWTA 1K6SA 2ZC3B 5HX9A 5DKKA 5E2EA 5HSQA 2DRWA 1H5XA 2Y2MA 2PYPA 1L0DA 2DNSA 3WWXA 3NECA 1UWPX 1ESIA 2PBDP 4K0WA 1MWSA 4D60A 1K4EA 5FQ9A 3CMZA 4LCLA 2VV6A 3BW6A 4PM9A 4ID4A 4PAUA 1N9NA 3F1PB 3MZDA 4E3KA 1VHMA 1Z09A 3ITAA 1GSXA 3RJUA 1CJFA 1NY0A 3IBJA 4S2NC 2ZC5B 4Y3IA 2V8FA 4NXBA 4HY8A 5EVID 1SDEA 4BMWA 1YMXA 2XA7M 4QPRA 3EEAA 4HBUA 2JKFA 5KSCA 4OPZA 4RQ9A 3V39A 4B88A 4BWIA 3CUEC 4R3JA 2EFXA 2Y2NA 1LI0A 4KQOA 4UA9A 1MWRA 4Q0IA 5DKLA 2OWHA 4QU3A 4FUWA 3GSGA 4OQGA 3LYXA 1S1YA 4KZ6A 3CG5A 4LV2A 5EM1A 2H0TA 4OQ0A 2G2WA 1TVFA 2ZBBA 4GKUA 4NXFA 4R6LA 5FAQA 5HFOA 3NULA 3ISGA 3T4SA 3W8KA 3T4JA 5HD3A 2XROA 2UV0E 1JVJA 3IXDA 4JXSA 4YFMA 2ZQCA 1PZOA 5CERA 4PM6A 1CK3A 4E6XA 5E2HA 2Q9NA 1JTDA 3Q7VB 4BBTA 3VP1A 1E3UD 1G68A 3SH7A 4Y0TA 3GV9A 4KENB 4I38A 3S1YA 4X68A 1NYMA 2PD7A 2Z6DA 4DJ3A 3V3RA 1SKOB 3E4QA 2B18A 4PMAA 3BQ8A 4IBRA 1IKIA 3HLFA 2XEPA 2ZC7A 1T1BA 1PFLA 3EWKA 4NXEA 3IWQA 2NUPC 3ZFZA 1WE4A 1XJ3A 1O07A 1MXOA 1XGIA 5BOHA 4N92A 4KZ3A 1BUEA 3VP2A 3LEZA 2OAQ1 5F69A 3EEHA 3UE3A 4S2PA 2BLSA 4XUXA 1G28A 1K6RA 3PTEA 3UDFA 3R7WA 2QJ5A 1L3LA 3MR0A 4LLOB 3CZDA 4GD6A 3ZYTA 1PWGA 5IU1A 2D02A 4FSFA 3OPLA 4M4XA 1SZVA 1FCNA 4GS9B 2P9VA 3OLOA 1KGEA 3KYEA 3WRZA 1OTAA 3HVFA 3PAGA 5A8BA 3T4QA 3PR6A 3UMDA 1YLWA 3ULFA 1LL9A 4ZBEA 3DTMA 3HLGA 4NK3A 3TSGA 3NY4A 3PBRA 4Y17A 4P0MA 4RX3A 3HLBA 4N9KA 3KSHA 5DVAA 3H7WB 3QNCA 1PYYA 1ES3A 1ZHHB 3LUQA 1GA9A 2ZD8A 1H8YA 4O0PA 2X01A 4FOFA 4IUKA 5GLCA 3DTIA 4BBUA 4P6ZM 1IFQA 3VP4A 2A49A 3MXRA 1GHMA 2RCXA 3T1RA 4E3MA 1SKFA 2VA0A 4R23A 3GVBA 5CX7A 1BLCA 2W27A 4OONA 3RFBA 2H5SA 5HAQA 4GNUA 4XXRA 4HP9A 4FH2A 2PDRA 2VGKA 5MC7A 2J80A 3W2ZA 4WZ5A 2Y2KA 3UB9A 2ZOIA 3M6HA 1OJ5A 3FV7A 2P08A 1ODVA 4WYYA 1P0ZA 4NG2A 1TD5A 1QMFA 1SCWA 4EERA 2WYXA 1VQQA 3G31A 5J8XA 3VE3A 4A5RA 2ZMVA 2WKIA 3UB5P 5HWWA 2BASA 3T4TA 1GSWA 1GHIA 3S7OA 1H8ZA 3SW1A 4QB8A 5AVFA 5G4YA 4YINA 2L4RA 3E4PA 3WRTA 2HDSA 2UWXA 4HI4A 2CC1A 5FA7A 3A0RA 3MKFA 2HJ9C 3DBAA 1VETB 2ZLYA 2HV1A 3UN7A 3M2JA 4PKYG 3EQUA 4PM5A 2EA9A 5L8MA 2XK1A 3L9KA 3KSFA 5EV0A 1TS6A 4E3NA 2ZM2A 3S4XA 1SDNA 4NKPA 5HAIA 2XQZA 2WGVA 4G3WA 2XFTA 5EECA 4JPMA 2VGLS 2EX9A 5EE8A 3RXXA 5EM0A 1XGJA 2KOIA 3JYIA 1KE0A 2B95A 4WEJA 2ZL1A 3IX4A 2EWVA 3MS6A 3NIAA 4Y2FA 5FI7A 5GLBA 4JF6A 1S1ZA 1RGZA 3A3DA 3O5YA 3A3JA 1KDSA 1ERMA 4LRYC 3S22A 4MBHA 4MN7A 4MBKA 1ZKJA 4N1HA 2PU2A 2QZ6A 1FSYA 3IBRA 1OMEA 1I2SA 3MFXA 2JN7A 3BFCA 5F82A 4CLCD 2VJWA 5AVEA 2JCHA 4S2NA 4DDYA 2IA2A 1STZA 1ONHA 3FKVA 5E2GA 4EETB 2KLIA 4UAAA 3F1NA 2L0WA 3IWOA 4DE3A 4HH2A 3UMEA 1KGGA 4MN5A 3C30A 5GHZA 5GHXA 2Y2OA 3B3XA 5CGWA 4BJPA 5TBMA 3A0SA 1K54C 1KE4A 1N9LA 4Y5FA 4GS9A 1XX2A 5DTKA 2PU4A 1HVBA 4S2KA 3NDGA 2OSUA 3A3FA 3BY9A 3T4LA 3CAXA 3P01A 2NUTC 5DF8A 3T1XA 4U0XA 1Q2QA 5AQ9A 5A93A 3NOPC 5U47A 2JE5A 2DCFA 3IF6C 1NLYA 3VOYA 2J7VA 2WKHA 3UDIA 4QY5A 4WEKA 1JTGA 2VK3A 3OPPA 2ZQAA 4KG5A 1H8MA 3DW0A 3JVVA 4HJ6A 4KQRA 1IYSA 2AVXA 2JKTM 3RH8B 4O7DA 1ZG6A 2Y2JA 3VP0A 3BFDA 3EGXC 1YLZA 1F98A 2YKHA 2P7JA 2VGLM 5EVIB 2O0YA 1IKGA 1PRQA 1Z6FA 3G30A 1KVLA 3ZG0A 3GRJA 4JLFA 4H6JA 2R78A 4BD1A 3LY3A 2OAP1 5FQQA 4EWFA 3ZG5A 4LENA 3G35A 5TR7A 1KGFA 3DTEA 3QP2A 3RTYA 1GSVA 2V1AA 2MJ6A 4MCWA 5GHYA 1EW0A 4R4RA 5EUAA 3ZVWA 4EBNA 4FD8A 1Y54A 5DJUA 3AGFA 3E4OA 3R7WB 1VB6A 1BLSA 2HDQA 2V0UA 2IWCA 2HZ5A 5CXWA 4C3QA 4OPYA 4X6TA 2GX5A 1XFQA 3LR3A 1VETA 4HESA 3N4IA 2P9VB 1FCOA 4NXGA 3T50A 1FCMA 3VFFA 2XLNA 2EWWA 2V9AA 4WF0A 4B4XA 1NRFA 3MBZA 1N4OA 4N1XA 5CGSA 1H0MA 3C2WA 3Q7ZA 1V9YA 2JKRM 2A3UA 4GHIA 5L10A 3C8CA 2XSSA 3BQAA 1L0GA 1FSWA 3HLCA 2XR0A 4UA6A 4ESPA 2H0YA 3C5AA 4HIAA 3V67A 4F3LA 3UPNA 1K0KA 3HLWA 3BYDA 4Z1WA 1MZUA 4HJ4A 2WGWA 3QP1A 4IEDA 2V1BA 2FFFB 2PAVP 4GJ4A 2HP9A 4Y15A 1IEMA 1PNEA 4DE1A 4ZJ3A 3V5MA 5FQJA 3UDXA 2Y79A 3IQAA 1LSWA 1ALQA 3KX0X 5A90A 2QWSA 2XD5A 3BY8A 2G7UA 3E0YA 3B47A 1SHVA 1X0OA 2WKPA 5HZHA 1WYCA 2EFUA 4WN5A 4OP8A 3C7UA 3VV4A 3ZVTA 3HCYA 4PPRA 3BM6A 4E6WA 2GJ3A 5HL1A 5CGXA 4OOMA 1BLPA 5G4ZA 1EROA 2ZMAA 4BQMA 5L09A 1WA9A 4WMCD 1T1AA 4KZ5A 3WS2A 4EBPA 1ERQA 2Z2MB 1YPRA 3FPWA 3S7QA 3AGEA 4Y0UA 3SS3A 3TJZC 2INWA 1PW8A 3PBQA 4JF4A 1XPBA 5KIZA 1GCEA 4HP4A 4OOYA 1BT5A 4GCZA 3UY6A 4Y13A 5J4EA 4DE0A 4CLCC 3OPHA 4L0LA 2E8JA 5F6AA 2ZL1B 3N8LA 4LCMA 3MKEA 5EVIA 4BLMA 1OT9A 1CI9A 4BD0A 4JGQA 4R70A 5CHUA 4HBTA 2EX6A 3QNBA 1K4FA 3ZG9B 2J3WA 3MZEA 5AQAA 5TGFA 3AGDA 1FR6A 5J3WA 1YMSA 3Q1FA 4QD4A 4OLGA 3D4FA 3K3DA 4F94A 3WS1A 5TFQA 2HF6A 3BWLA 4LV1A 1PWDA 4RYEA 4EQ1A 2JHEA 1FR1A 1W5DA 3F1NB 3GQZA 2M7UA 4QHCA 4E04A 1OJGA 1ESUA 1YLJA 4UEYA 2HJEA 1CEFA 4YWZA 3UNWA 4R3AA 5KMWA 3TRCA 3LFVA 3OOVA 1K54A 3SS5A 2PD8A 4S2JA 4EUVA 3LR0A 1AWIA 3FWLA 1YLYA 1VM1A 4UHUA 5TBMB 1FQGA 1CF0A 1DP8A 2ZC6B 2A24A 1RGYA 1E3UA 3LICA 1YKDA 3PXPA 5AQ7A 4P87A 3W4OA 1XJ4A 3IT9A 5DFXA 3O86A 4S2MA 4Q0HA 2V0WA 5D3OA 2IWDA 3IF6A 3MQ0A 4WLAA 1JNUA 2I72A 3NJAA 5TJJA 5M1AA 1ES2A 1MY8A 4ZRRA 3ZDJA 3HBRA 1YLPA 3G4PA 3H9WA 2BTFP 4CQHA 3FYZA 1OPXA 1XJ6A 1J3WA 2WUQA 1K57C 5DTSA 3UE1A 4DF6A 4KG6A 1F2KA 2Z6CA 5FAPA 1GA0A 4MNRA 3IXHA 4Y0OA 2FFYA 4EEPA 4S2IA 4OVDA 3MXQA 3P7NA 4GLQA 5CECA 4ETZA 3GR2A 3G2ZA 5M19A 2G2UA 1NXYA 5KZHA 2L1MA 3W4PA 4H6JB 4XT2A 1K56D 3GDIA 2PR5A 5HL6A 5DTTA 3VSKA 1NLZA 4JKTA 4ZDXA 3CPTB 3H82B 4RA7A 1XKZA 5FI6A 3K2NA 3NDEA 5LBRA 3IX8A 5JYPA 2EX2A 3RXWA 3D72A 4KZ4A 4DXBA 3B33A 4KQDA 4ME4A 4BL2A 5EPHA 4IJGA 1DRMA 3DWKA 2XD1A 4IVIA 5HARA 3DTKA 3VMAA 4LRXC 1IYPA 4MDZA 1I5QA 1PZPA 2XF3A 5IHVA 5HPFA 2E8IA 5KSHA 3BLMA 1TEMA 1E4DA 1MC0A 1XJ2A 1W8YA 1NWZA 4QY6A 5E43A 3CHWP 1UWNX 2X71A 3UPPA 2B02A 2Y2QA 3SH8A 3UB8A 1W79A 3A3EA 1RCJA 2J3TD 4GHIB 4OPQA 2W3DA 1N9BA 2K7SA 2XGNA 3Q81A 4ZAMA 5CEDA 3D3OA 1YSPA 3QP4A 1MBLA 4LGWA 5CHJA 4F3LB 4EBLA 2H10A 4L9FA 2GZAA 1TDGA 2VKSA 4HOIA 4GB7A 4JGOA 3UO9A 5FEGA 4O01A 4XUZA 5HDSA 1TS0A 1ZC2A 2WGWB 3KYQA 3PAEA 1AXBA 1LL5A 3OCLA 3N6IA 2J8YA 1K55C 4GD8A 4EUZA 2XRNA 2YKFA 4X69A 3QP5A 4Y7PA 2QMIA 4CJNA 2O9AA 3CUEA 1S66L 3N7WA 1U60A 3KSIA 3MZFA 1VEUB 4EQIA 4C75A 3N8SA 1QMEA 1XA1A
chains in the Genus database with same CATH topology
3KSGA 2EWWA 5I5LA 4R38A 4I38A 3T4OA 2V9AA 2PD7A 2Z6DA 4WF0A 4DJ3A 4MMNA 4WELA 3E4QA 2B18A 2W1RA 2WKRA 3BQ8A 4IHQA 4EW7A 3C2WA 1V9YA 1DP9A 2JKRM 3UB7A 1T1BA 4GHIA 1TS8A 2XSSA 3BQAA 3C8CA 3EWKA 3VOLA 4NXEA 2JKRI 2NUPC 1P9WA 3MQOA 4G3KA 1XJ3A 1IOUA 4HIAA 3V67A 3IS2B 1T18A 3PBNA 4F3LA 5C5KA 2K2NA 3LR5A 2D01A 5HD5A 4ETXA 3MMHA 2OAQ1 5F69A 3EEHA 3EQVA 5J7EA 3UE3A 4Z1WA 4L9EA 1MZUA 3E98A 4CLCA 4EEUA 3C38A 4HJ4A 1G28A 2W3GA 3LI9A 3ZQ5A 2V1BA 4GJ4A 4WUJA 4CLCE 3CWFA 3R7WA 2QJ5A 3MQQA 3MR0A 3PBSA 4DJ2A 1LSVA 4LLOB 2H28A 3ZYTA 5IU1A 1P97A 2D02A 4FSFA 5EFWA 1W63Q 2Y79A 5HWVA 4M4XA 4GS9B 1LSWA 3KX0X 3NHQA 4II7A 2QWSA 3BY8A 3OLOA 3LI8A 2M7VA 4KUOA 2G7UA 3E0YA 1OTAA 3B47A 4I3AA 5A8BA 1X0OA 3T4QA 2WKPA 3PR6A 3UMDA 5HZHA 5F68A 2OWJA 4WN5A 3ULFA 3VV4A 2W3EA 3LIDA 3HCYA 2QJ7A 1LSXA 3FG8A 3PBOA 3PBRA 3OBFA 3OC2A 3H82A 2GJ3A 3FPVA 3KSHA 3KYZA 2GNXA 3H7WB 3EGDC 2XA7S 4OOMA 4G3VA 1ZHHB 5G4ZA 3LUQA 4HJ3A 4KUKA 4O0PA 3MF0A 3UB6A 4FOFA 3LR4A 4ARZB 4IUKA 1WA9A 4BBUA 4P6ZM 1IFQA 1T1AA 2CMNA 4YOFA 2VA0A 3IS2A 3FPWA 3S7QA 3T4KA 5CX7A 3TJZC 2A24B 4JGRA 2W27A 2INWA 4LRZE 3G6OA 3PBQA 3RFBA 2ZOHA 3CLOA 3CI6A 5KIZA 4HP9A 2PDRA 5HDCA 2LB9A 4HP4A 1G6OA 5MC7A 2J80A 1TF1A 3W2ZA 4GCZA 5J4EA 1T1CA 1YAXA 5IT5A 4CLCC 1T19A 5FL3A 3UB9A 4L0LA 2VZWA 2ZOIA 2OOLA 5F6AA 1OJ5A 1LL8A 4PHTA 2P08A 1ODVA 1ZTUA 1P0ZA 1TD5A 3U2AA 4EERA 1OT9A 3VE3A 4JGQA 2ZMVA 4L9GA 4R70A 5DJTA 1OT6A 2VX8A 3A0VA 5HWWA 1XFNA 2BASA 2J3WA 3OCNA 1H3QA 3T4TA 1GSWA 3S7OA 5J3WA 3LIBA 4IUHA 3S7PA 3SW1A 2W3FA 2QHKA 1OTIA 3K3DA 5AVFA 5G4YA 5K5BA 2W0NA 2HF6A 2L4RA 3BWLA 4MN6A 3E4PA 2WKQA 3TW8A 1OTDA 4EQ1A 2JHEA 4HI4A 3A0RA 3H7WA 2VV8A 3F1NB 4I39A 2HJ9C 1TS7A 3NOTC 2M7UA 3DBAA 4HNBA 4E04A 1OJGA 5IS1A 4UEYA 2HJEA 2QYBA 2HV1A 4YWZA 4R3AA 4ARZA 4PKYG 3TRCA 3LFVA 3OOVA 2PD8A 3EQUA 4EUVA 2EA9A 5L8MA 3LR0A 4XT2B 3KSFA 4WL9A 4EXOA 1S67L 5TBMB 1TS6A 2KX6A 1DP8A 2A24A 2PR6A 4I3IA 4NKPA 3LICA 1YKDA 3PXPA 1XJ4A 5DFXA 4B9OA 2FH5A 4G3WA 5AJGA 2M1CA 1V9ZA 2O9BA 3TE8A 3K3CA 4Q0HA 2I9VA 2V0WA 2VGLS 3MQ0A 3PBTA 1JNUA 4WLAA 1W63M 4HHDA 4DMZA 4DN0A 2KOIA 3NJAA 1OTBA 4WEJA 1BYWA 3ICYA 2EWVA 2PYRA 5TJJA 5F5YA 4Y2FA 1MKMA 4EESA 1S1ZA 4ZRRA 1UGUA 3O5YA 3KO6A 3H9WA 4CQHA 3PYPA 3LIFA 1OPXA 2J3TC 1S4RA 1XJ6A 4LRYC 4MN7A 2VV7A 5DF9A 1KOUA 2W1TB 3F1OB 3IBRA 3MJQA 3CITA 2W3HA 4UQIS 3MFXA 2JN7A 4B93A 2Z6CA 3R4KA 4CLCD 2VJWA 5AVEA 4EU0A 2IA2A 3GECA 3FC7A 2FZ0A 1STZA 1YSQA 1D7EA 5DFYA 4EEPA 5HPIA 4AFIA 4EETB 3MXQA 3P7NA 2KLIA 4GLQA 1NRJA 1OTEA 4I5SA 3LIEA 3F1NA 4ETZA 2L0WA 4P6ZS 4HH2A 4Q0JA 4K08A 4HH3A 3UMEA 2L1MA 4LPZA 1Y28A 4MN5A 4H6JB 4BBVA 3C30A 2Y8HA 4XT2A 2ZMFA 4BJPA 5TBMA 3A0SA 3GDIA 1N9LA 1S4SA 2PR5A 5HL6A 5HWTA 4Y5FA 4GS9A 5DKKA 2O9CA 5HSQA 3S7NA 1NLZA 3BY9A 3H82B 3T4LA 3JVUA 3CAXA 2PYPA 3P01A 1LT0A 2P04A 3K2NA 2NUTC 5HDDA 5LBRA 1UWPX 3NOPC 1NLYA 3D72A 4WEKA 3B33A 4OOLA 2PT7A 4KQDA 4ME4A 1DP6A 1H8MA 2VV6A 4IJGA 3JVVA 4HJ6A 1DRMA 3BW6A 2JKTM 3RH8B 4LRXC 4MDZA 4PAUA 4I3JA 2W1TA 3EOIA 1N9NA 3F1PB 3F1OA 3UE6A 5HPFA 2JKTI 1VHMA 1GSXA 5KSHA 4GW9A 1F5MA 3NOUC 1MC0A 1XJ2A 1NWZA 3HJKA 3EGXC 1UWNX 3IBJA 4Y3IA 2B02A 1F98A 2YKHA 2P7JA 2VGLM 3UB8A 4NXBA 4HY8A 2O0YA 2J3TD 4GHIB 4NEED 4BMWA 2W3DA 1P9RA 2K7SA 2XA7M 2QKPA 3EEAA 3D3OA 1YSPA 4QPRA 4O8GA 4H6JA 2R78A 4RQ9A 2O99A 2K31A 4BWIA 2OAP1 3BJNA 3CUEC 4F3LB 4KQOA 4L9FA 4Q0IA 2GZAA 5DKLA 2OWHA 2VKSA 4HOIA 4JGOA 3PHYA 4O01A 3LYXA 1S1YA 2A2LA 4UQIM 3RTYA 1GSVA 2V1AA 2MJ6A 5HDSA 4CLCB 4MCWA 2DMWA 1TS0A 1EW0A 4NXFA 2ZBBA 4R6LA 3KYQA 4JGPA 3T4SA 4PKYA 5DJUA 3E4OA 2PHYA 3VE4A 2KDKA 3OCLA 3R7WB 3T4JA 1VB6A 5HD3A 2V0UA 2XROA 2XRNA 2YKFA 3HJIA 2GX5A 1XFQA 2VEAA 3LR3A 2O9AA 2VLGA 3CUEA 2HGVA 4BBTA 4YNRA 1S66L 1N9OA 2LB5A 3KSIA 1D06A 4NXGA 3B42A 1F9IA 3F1PA 3LIAA 3T50A 4HQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5L A;  4R38 A;  4I38 A;  2V9A A;  2PD7 A;  2Z6D A;  4WF0 A;  4DJ3 A;  3E4Q A;  2WKR A;  4EW7 A;  3C2W A;  1V9Y A;  1DP9 A;  3UB7 A;  1T1B A;  4GHI A;  1TS8 A;  3C8C A;  3EWK A;  3VOL A;  4NXE A;  3MQO A;  1XJ3 A;  4HIA A;  3IS2 B;  1T18 A;  4F3L A;  2D01 A;  5HD5 A;  5F69 A;  3EEH A;  5J7E A;  4L9E A;  1MZU A;  4EEU A;  4HJ4 A;  1G28 A;  3LI9 A;  3ZQ5 A;  2V1B A;  4WUJ A;  3CWF A;  2QJ5 A;  3MQQ A;  3MR0 A;  4DJ2 A;  1LSV A;  4LLO B;  2H28 A;  5IU1 A;  1P97 A;  2D02 A;  5EFW A;  5HWV A;  4M4X A;  4GS9 B;  1LSW A;  3KX0 X;  3NHQ A;  2QWS A;  3BY8 A;  3OLO A;  3LI8 A;  4KUO A;  1OTA A;  4I3A A;  5A8B A;  1X0O A;  2WKP A;  5HZH A;  3UMD A;  5F68 A;  2OWJ A;  4WN5 A;  3ULF A;  3LID A;  2QJ7 A;  1LSX A;  3FG8 A;  3H82 A;  2GJ3 A;  3H7W B;  5G4Z A;  3LUQ A;  4HJ3 A;  4KUK A;  3UB6 A;  1WA9 A;  4BBU A;  1T1A A;  2CMN A;  3IS2 A;  2A24 B;  4JGR A;  2W27 A;  2INW A;  4LRZ E;  3G6O A;  2ZOH A;  3CLO A;  5KIZ A;  4HP9 A;  2PDR A;  5HDC A;  4HP4 A;  2J80 A;  4GCZ A;  5J4E A;  1T1C A;  1T19 A;  3UB9 A;  2ZOI A;  2OOL A;  5F6A A;  1OJ5 A;  1LL8 A;  1ODV A;  1P0Z A;  4EER A;  1OT9 A;  3VE3 A;  4JGQ A;  4L9G A;  4R70 A;  5DJT A;  1OT6 A;  3A0V A;  5HWW A;  1XFN A;  2BAS A;  1GSW A;  5J3W A;  3LIB A;  3SW1 A;  2QHK A;  1OTI A;  3K3D A;  5AVF A;  5G4Y A;  2W0N A;  2L4R A;  3BWL A;  4MN6 A;  3E4P A;  2WKQ A;  1OTD A;  4EQ1 A;  2JHE A;  4HI4 A;  3A0R A;  3H7W A;  2VV8 A;  3F1N B;  4I39 A;  1TS7 A;  3NOT C;  4E04 A;  4HNB A;  5IS1 A;  1OJG A;  2HV1 A;  4YWZ A;  4R3A A;  4PKY G;  2PD8 A;  2EA9 A;  4XT2 B;  4WL9 A;  4EXO A;  1S67 L;  5TBM B;  1TS6 A;  2KX6 A;  1DP8 A;  2A24 A;  2PR6 A;  4I3I A;  3LIC A;  1XJ4 A;  4B9O A;  2M1C A;  1V9Z A;  3K3C A;  2I9V A;  2V0W A;  4WLA A;  1JNU A;  4HHD A;  3NJA A;  1OTB A;  1BYW A;  3ICY A;  2PYR A;  5F5Y A;  4EES A;  1S1Z A;  1UGU A;  3H9W A;  3PYP A;  3LIF A;  1S4R A;  1XJ6 A;  4LRY C;  2VV7 A;  1KOU A;  3F1O B;  3IBR A;  3MJQ A;  3MFX A;  2JN7 A;  2Z6C A;  5AVE A;  3FC7 A;  3GEC A;  4EEP A;  1D7E A;  4EET B;  3MXQ A;  3P7N A;  1OTE A;  4I5S A;  3LIE A;  3F1N A;  2L0W A;  4HH2 A;  4K08 A;  4HH3 A;  3UME A;  2L1M A;  4LPZ A;  1Y28 A;  4MN5 A;  4BBV A;  4H6J B;  4XT2 A;  5TBM A;  3A0S A;  3GDI A;  1N9L A;  1S4S A;  2PR5 A;  5HWT A;  4GS9 A;  5DKK A;  5HSQ A;  3BY9 A;  3H82 B;  3CAX A;  2PYP A;  1LT0 A;  5HDD A;  1UWP X;  3NOP C;  3D72 A;  3B33 A;  4KQD A;  1DP6 A;  2VV6 A;  4HJ6 A;  1DRM A;  3RH8 B;  4LRX C;  4I3J A;  1N9N A;  3F1P B;  3F1O A;  3UE6 A;  1GSX A;  4GW9 A;  3NOU C;  1XJ2 A;  1NWZ A;  3HJK A;  1UWN X;  2B02 A;  1F98 A;  2YKH A;  2P7J A;  3UB8 A;  4NXB A;  4HY8 A;  4GHI B;  2K7S A;  2QKP A;  4H6J A;  2R78 A;  4RQ9 A;  4F3L B;  4L9F A;  5DKL A;  2OWH A;  4HOI A;  4JGO A;  3PHY A;  3LYX A;  1S1Y A;  3RTY A;  1GSV A;  2V1A A;  5HDS A;  1TS0 A;  1EW0 A;  4NXF A;  2ZBB A;  4R6L A;  4JGP A;  4PKY A;  5DJU A;  3E4O A;  2PHY A;  3VE4 A;  2KDK A;  1VB6 A;  5HD3 A;  2V0U A;  2YKF A;  3HJI A;  1XFQ A;  2VEA A;  2VLG A;  4BBT A;  1S66 L;  1N9O A;  1D06 A;  4NXG A;  1F9I A;  3F1P A;  3LIA A;  3T50 A;  4HQA A; 
#chains in the Genus database with same CATH topology
 5CTM A;  3U4L P;  2V8C A;  4MMN A;  4IBX A;  2V20 A;  2W1R A;  1XA7 A;  4IHQ A;  4E3I A;  5EVL A;  4EW7 A;  5FAT A;  2BG1 A;  1YQS A;  1W7F A;  3P09 A;  3VOL A;  1ES4 A;  3MQO A;  4G3K A;  1IOU A;  2V1Z A;  2EXA A;  4OPR A;  3T1Q B;  1E25 A;  4DXC A;  3FZC A;  4RVA A;  3LR5 A;  5HD5 A;  4ETX A;  3MMH A;  3EQV A;  5J7E A;  2VGJ A;  1GHP A;  4L9E A;  3E98 A;  4CLC A;  4EEU A;  3C38 A;  2W3G A;  3BFG A;  4FCF A;  4FH4 A;  4M3K A;  2ZQ8 A;  3DAV A;  4WUJ A;  4JF5 A;  2QPN A;  4CLC E;  5FEF A;  3PBS A;  1ACF A;  3M2K A;  2H28 A;  4RX2 A;  1W63 Q;  3TOI A;  2M7V A;  4KUO A;  4X55 A;  2C5W B;  3MXS A;  2OWJ A;  1HZO A;  4QWO A;  4MLL A;  3ZNT A;  4OH0 A;  2WK0 A;  3LID A;  3T1S A;  2XH9 A;  4X1L A;  3FG8 A;  3CPT A;  3OBF A;  3H82 A;  3FPV A;  5GLD A;  3KYZ A;  2Y2L A;  2GNX A;  3V50 A;  4GDN A;  4GZB A;  2XA7 S;  4G3V A;  4LV0 A;  2XDM A;  4HJ3 A;  4KUK A;  4JXV A;  3UB6 A;  3LR4 A;  1PI4 A;  4JBF A;  2CMN A;  3IS2 A;  4WZ4 A;  2OLV A;  1NJ4 A;  2A24 B;  4KZ8 A;  2B5R A;  4LRZ E;  3G6O A;  4GOG A;  5M18 A;  1LLB A;  5CRF A;  2Y91 A;  3CI6 A;  3CLO A;  5HDC A;  4DE2 A;  2LB9 A;  2HP6 A;  1TDL A;  3ZHH A;  2Y2H A;  1TF1 A;  3IF6 B;  1BTL A;  1T1C A;  1YAX A;  1S0W A;  5IT5 A;  4PM8 A;  5FL3 A;  1BSG A;  2OOL A;  4X1M A;  4PHT A;  5FDS A;  1ZTU A;  4Z9Q A;  4B4Z A;  4CPK A;  3LEQ A;  1K57 A;  4L9G A;  5DJT A;  3ZGA B;  5FDH A;  4FTX A;  1H3Q A;  4R0Q A;  4IUH A;  4NET A;  3S7P A;  4HEF A;  2J9O A;  1ES5 A;  1DY6 A;  3BFE A;  2QHK A;  1OTI A;  5K5B A;  1DJA A;  3TW8 A;  2HDR A;  4U0T A;  2Y2I A;  2Y59 A;  2VV8 A;  1ZG4 A;  1TS7 A;  4HNB A;  5IS1 A;  1A0K A;  4KZ7 A;  1KDW A;  2QYB A;  3O88 A;  4ARZ A;  3SH9 A;  1FIL A;  3HRE A;  3Q82 A;  4XT2 B;  3IH8 A;  1S67 L;  3C7V A;  2KX6 A;  2PR6 A;  4I3I A;  4B9O A;  2FH5 A;  1VEU A;  2M1C A;  1V9Z A;  2O9B A;  2OLU A;  3TE8 A;  4IVK A;  1DJC A;  3K3C A;  3PBT A;  3Q07 A;  1W63 M;  3E2K A;  1OTB A;  1BYW A;  2PYR A;  5F5Y A;  4EES A;  3WS0 A;  3A3I A;  1UGU A;  5F83 A;  5CTN A;  3IXG A;  3KO6 A;  3DWZ A;  2ZQ7 A;  3PYP A;  2J3T C;  1S4R A;  4WM9 A;  1HTZ A;  2VV7 A;  5DF9 A;  4JXG A;  3MJQ A;  3CIT A;  4UQI S;  1IYQ A;  1CQA A;  1L0F A;  3GEC A;  2FZ0 A;  1YSQ A;  1D7E A;  1O7E A;  3HL9 A;  4AFI A;  1K38 A;  2R9W A;  4I5S A;  4MBF A;  3MFD A;  4P6Z S;  1FIK A;  3IHB A;  4KZ9 A;  4LPZ A;  5HAP A;  1Y28 A;  4ZJ2 A;  1Y4O A;  1Q2P A;  2Y8H A;  3W4Q A;  3ZNY A;  3LY4 A;  1S4S A;  2R9X A;  4KG2 A;  3V3S A;  1KVM A;  2Q9M A;  4K91 A;  4X53 A;  3BFF A;  5EOO A;  5E2F A;  1MWT A;  2O9C A;  1CI8 A;  1EI5 A;  2ZQ9 A;  4GDB A;  2PRF A;  3S7N A;  2ZQD A;  3UE0 A;  3O3V A;  1PIO A;  3GTC A;  3JVU A;  1LT0 A;  2P04 A;  2C6W B;  1L2S A;  5L07 A;  1K55 A;  2WAE A;  3QP8 A;  5HDD A;  3T12 B;  3TG9 A;  5AQB A;  1PI5 A;  4OOL A;  1MPL A;  2PT7 A;  1DP6 A;  2Y55 A;  4DKI A;  5JYO A;  1L0E A;  4WMC A;  1ONG A;  3BEB A;  4I3J A;  2W1T A;  3EOI A;  3F1O A;  3UE6 A;  2JKT I;  4GW9 A;  5FI2 A;  1F5M A;  3NOU C;  1JWP A;  3LCE A;  3HJK A;  5F1G A;  3IX3 A;  3OPR A;  4EV4 A;  3ZG7 B;  4LV3 A;  1HD8 A;  3VP3 A;  1G6A A;  4QJG A;  4LFU A;  4NEE D;  1W8Q A;  1P9R A;  1K25 A;  2HPB A;  3MSH A;  2QKP A;  2ACG A;  1XP4 A;  2Y4A A;  4O8G A;  2O99 A;  2K31 A;  3JPU A;  4E3L A;  3BJN A;  1PWC A;  3PHY A;  1BZA A;  2A2L A;  4UQI M;  4Q8I A;  3G34 A;  4CLC B;  2XFS A;  2DMW A;  1EWZ A;  5FQK A;  4JGP A;  4WBG A;  1DJB A;  3HLD A;  4PKY A;  4OLD A;  1NYY A;  2PHY A;  2KDK A;  3VE4 A;  2PBY A;  1PW1 A;  1D1J A;  3HUM A;  3HJI A;  2VEA A;  2V2F F;  2VLG A;  1I2W A;  4K0X A;  2HGV A;  4YNR A;  1N9O A;  2LB5 A;  1C3B A;  1D06 A;  3SOI A;  5L2F A;  3B42 A;  1F9I A;  3F1P A;  3LIA A;  4OQH A;  4BEN A;  5I94 A;  3IXB A;  4OP5 A;  4HQA A;  2RL3 A;  3KSG A;  2IWB A;  5I5L A;  4R38 A;  3T4O A;  1M6K A;  2Q0O A;  4WEL A;  3IF5 A;  4KZB A;  2WKR A;  3NBL A;  1G5U A;  1S6R A;  4ZTK A;  1DP9 A;  3UB7 A;  1TS8 A;  5FSR A;  4JXW A;  3BLS A;  2JKR I;  3E2L A;  1P9W A;  1JWV A;  3BRM A;  5GL9 A;  3IS2 B;  1T18 A;  2EX8 A;  3NC8 A;  3PBN A;  5A92 A;  4S2L A;  3P98 A;  3HUO A;  5C5K A;  5F1F A;  2K2N A;  2D01 A;  4KQQ A;  3HLE A;  5FAS A;  5EOE A;  3LI9 A;  3ZQ5 A;  1WYB A;  1NZU A;  2WAF A;  3LGO A;  3I7J A;  3VFH A;  3BEC A;  2Y2P A;  3CWF A;  3MQQ A;  4DJ2 A;  1LSV A;  4OQI A;  3C4P A;  2ZJ9 A;  3SS4 A;  1P97 A;  4N9L A;  5EFW A;  5HWV A;  3Q7V A;  3NHQ A;  1K56 A;  4II7 A;  3LI8 A;  4I3A A;  1CEG A;  1MKI A;  2P74 A;  5F68 A;  1LHY A;  4R3B A;  2W3E A;  3LO7 A;  4GN2 A;  1SKO A;  2QJ7 A;  1LSX A;  4PM7 A;  3PBO A;  3OC2 A;  3EGD C;  2WKE A;  5EVI C;  3MF0 A;  3L7H A;  4ARZ B;  5EVE A;  3ZCZ A;  3FKW A;  4ZJ1 A;  4YOF A;  3IWI A;  3T4K A;  4JGR A;  3VSL A;  2ZOH A;  1NZO A;  5G18 A;  3VOZ A;  2ZM0 A;  4P85 A;  3QP6 A;  1G6O A;  3G32 A;  1XXM A;  2JBF A;  4P6B A;  4BL3 A;  1T19 A;  1HLU P;  1M40 A;  1KE3 A;  2VZW A;  1YLT A;  1LL8 A;  4KZA A;  4MEZ A;  4S2O A;  3U2A A;  2GDN A;  1YM1 A;  1BUL A;  4UA7 A;  4E3J A;  1OT6 A;  2VX8 A;  2Z2L B;  3A0V A;  1XFN A;  3OCN A;  3ZG8 B;  1MWU A;  3LIB A;  2ZC4 B;  2ZM8 A;  2W3F A;  3ITB A;  2J9P A;  4U3T A;  2W0N A;  3NI9 A;  3WS5 A;  4MN6 A;  4R1G A;  2WKQ A;  2EXB A;  1OTD A;  5HW3 A;  3H7W A;  4I39 A;  2WAD A;  4X25 A;  3NOT C;  3IH9 A;  2X02 A;  3WS4 A;  3HUN A;  5A91 A;  2JC7 A;  4WL9 A;  4EXO A;  2WZX A;  5DF7 A;  1RP5 A;  4DRT A;  2JKG A;  4R4S A;  5AJG A;  5CEB A;  2WZZ A;  3QHY A;  1IEL A;  1YT4 A;  2I9V A;  1J9M A;  4HHD A;  4C6Y A;  4DMZ A;  4DN0 A;  4X56 A;  3UPO A;  3OZH A;  4E3O A;  3ICY A;  4WZ5 C;  1MKM A;  2Y2G A;  5CHM A;  3D9Y A;  5FQI A;  2WGI A;  3G2Y A;  1FOF A;  5FAO A;  3LIF A;  3M6B A;  4H8R A;  3GMW A;  1KOU A;  2W1T B;  3F1O B;  3CJM A;  2W3H A;  3O87 A;  4B93 A;  3R4K A;  1JWZ A;  3IHA A;  4EU0 A;  3FC7 A;  3C4O A;  5DFY A;  5HPI A;  4OKP A;  3NCK A;  1NRJ A;  1OTE A;  3LIE A;  3N8R A;  2HDU A;  5GLA A;  4Q0J A;  4K08 A;  1BLH A;  4HH3 A;  4D2O A;  5FQM A;  4BBV A;  1LI9 A;  2OV5 A;  4DDS A;  1IYO A;  2ZMF A;  3SZT A;  2HP5 A;  5HWT A;  1K6S A;  2ZC3 B;  5HX9 A;  5DKK A;  5E2E A;  5HSQ A;  2DRW A;  1H5X A;  2Y2M A;  2PYP A;  1L0D A;  2DNS A;  3WWX A;  3NEC A;  1UWP X;  1ESI A;  2PBD P;  4K0W A;  1MWS A;  4D60 A;  1K4E A;  5FQ9 A;  3CMZ A;  4LCL A;  2VV6 A;  3BW6 A;  4PM9 A;  4ID4 A;  4PAU A;  1N9N A;  3F1P B;  3MZD A;  4E3K A;  1VHM A;  1Z09 A;  3ITA A;  1GSX A;  3RJU A;  1CJF A;  1NY0 A;  3IBJ A;  4S2N C;  2ZC5 B;  4Y3I A;  2V8F A;  4NXB A;  4HY8 A;  5EVI D;  1SDE A;  4BMW A;  1YMX A;  2XA7 M;  4QPR A;  3EEA A;  4HBU A;  2JKF A;  5KSC A;  4OPZ A;  4RQ9 A;  3V39 A;  4B88 A;  4BWI A;  3CUE C;  4R3J A;  2EFX A;  2Y2N A;  1LI0 A;  4KQO A;  4UA9 A;  1MWR A;  4Q0I A;  5DKL A;  2OWH A;  4QU3 A;  4FUW A;  3GSG A;  4OQG A;  3LYX A;  1S1Y A;  4KZ6 A;  3CG5 A;  4LV2 A;  5EM1 A;  2H0T A;  4OQ0 A;  2G2W A;  1TVF A;  2ZBB A;  4GKU A;  4NXF A;  4R6L A;  5FAQ A;  5HFO A;  3NUL A;  3ISG A;  3T4S A;  3W8K A;  3T4J A;  5HD3 A;  2XRO A;  2UV0 E;  1JVJ A;  3IXD A;  4JXS A;  4YFM A;  2ZQC A;  1PZO A;  5CER A;  4PM6 A;  1CK3 A;  4E6X A;  5E2H A;  2Q9N A;  1JTD A;  3Q7V B;  4BBT A;  3VP1 A;  1E3U D;  1G68 A;  3SH7 A;  4Y0T A;  3GV9 A;  4KEN B;  4I38 A;  3S1Y A;  4X68 A;  1NYM A;  2PD7 A;  2Z6D A;  4DJ3 A;  3V3R A;  1SKO B;  3E4Q A;  2B18 A;  4PMA A;  3BQ8 A;  4IBR A;  1IKI A;  3HLF A;  2XEP A;  2ZC7 A;  1T1B A;  1PFL A;  3EWK A;  4NXE A;  3IWQ A;  2NUP C;  3ZFZ A;  1WE4 A;  1XJ3 A;  1O07 A;  1MXO A;  1XGI A;  5BOH A;  4N92 A;  4KZ3 A;  1BUE A;  3VP2 A;  3LEZ A;  2OAQ 1;  5F69 A;  3EEH A;  3UE3 A;  4S2P A;  2BLS A;  4XUX A;  1G28 A;  1K6R A;  3PTE A;  3UDF A;  3R7W A;  2QJ5 A;  1L3L A;  3MR0 A;  4LLO B;  3CZD A;  4GD6 A;  3ZYT A;  1PWG A;  5IU1 A;  2D02 A;  4FSF A;  3OPL A;  4M4X A;  1SZV A;  1FCN A;  4GS9 B;  2P9V A;  3OLO A;  1KGE A;  3KYE A;  3WRZ A;  1OTA A;  3HVF A;  3PAG A;  5A8B A;  3T4Q A;  3PR6 A;  3UMD A;  1YLW A;  3ULF A;  1LL9 A;  4ZBE A;  3DTM A;  3HLG A;  4NK3 A;  3TSG A;  3NY4 A;  3PBR A;  4Y17 A;  4P0M A;  4RX3 A;  3HLB A;  4N9K A;  3KSH A;  5DVA A;  3H7W B;  3QNC A;  1PYY A;  1ES3 A;  1ZHH B;  3LUQ A;  1GA9 A;  2ZD8 A;  1H8Y A;  4O0P A;  2X01 A;  4FOF A;  4IUK A;  5GLC A;  3DTI A;  4BBU A;  4P6Z M;  1IFQ A;  3VP4 A;  2A49 A;  3MXR A;  1GHM A;  2RCX A;  3T1R A;  4E3M A;  1SKF A;  2VA0 A;  4R23 A;  3GVB A;  5CX7 A;  1BLC A;  2W27 A;  4OON A;  3RFB A;  2H5S A;  5HAQ A;  4GNU A;  4XXR A;  4HP9 A;  4FH2 A;  2PDR A;  2VGK A;  5MC7 A;  2J80 A;  3W2Z A;  4WZ5 A;  2Y2K A;  3UB9 A;  2ZOI A;  3M6H A;  1OJ5 A;  3FV7 A;  2P08 A;  1ODV A;  4WYY A;  1P0Z A;  4NG2 A;  1TD5 A;  1QMF A;  1SCW A;  4EER A;  2WYX A;  1VQQ A;  3G31 A;  5J8X A;  3VE3 A;  4A5R A;  2ZMV A;  2WKI A;  3UB5 P;  5HWW A;  2BAS A;  3T4T A;  1GSW A;  1GHI A;  3S7O A;  1H8Z A;  3SW1 A;  4QB8 A;  5AVF A;  5G4Y A;  4YIN A;  2L4R A;  3E4P A;  3WRT A;  2HDS A;  2UWX A;  4HI4 A;  2CC1 A;  5FA7 A;  3A0R A;  3MKF A;  2HJ9 C;  3DBA A;  1VET B;  2ZLY A;  2HV1 A;  3UN7 A;  3M2J A;  4PKY G;  3EQU A;  4PM5 A;  2EA9 A;  5L8M A;  2XK1 A;  3L9K A;  3KSF A;  5EV0 A;  1TS6 A;  4E3N A;  2ZM2 A;  3S4X A;  1SDN A;  4NKP A;  5HAI A;  2XQZ A;  2WGV A;  4G3W A;  2XFT A;  5EEC A;  4JPM A;  2VGL S;  2EX9 A;  5EE8 A;  3RXX A;  5EM0 A;  1XGJ A;  2KOI A;  3JYI A;  1KE0 A;  2B95 A;  4WEJ A;  2ZL1 A;  3IX4 A;  2EWV A;  3MS6 A;  3NIA A;  4Y2F A;  5FI7 A;  5GLB A;  4JF6 A;  1S1Z A;  1RGZ A;  3A3D A;  3O5Y A;  3A3J A;  1KDS A;  1ERM A;  4LRY C;  3S22 A;  4MBH A;  4MN7 A;  4MBK A;  1ZKJ A;  4N1H A;  2PU2 A;  2QZ6 A;  1FSY A;  3IBR A;  1OME A;  1I2S A;  3MFX A;  2JN7 A;  3BFC A;  5F82 A;  4CLC D;  2VJW A;  5AVE A;  2JCH A;  4S2N A;  4DDY A;  2IA2 A;  1STZ A;  1ONH A;  3FKV A;  5E2G A;  4EET B;  2KLI A;  4UAA A;  3F1N A;  2L0W A;  3IWO A;  4DE3 A;  4HH2 A;  3UME A;  1KGG A;  4MN5 A;  3C30 A;  5GHZ A;  5GHX A;  2Y2O A;  3B3X A;  5CGW A;  4BJP A;  5TBM A;  3A0S A;  1K54 C;  1KE4 A;  1N9L A;  4Y5F A;  4GS9 A;  1XX2 A;  5DTK A;  2PU4 A;  1HVB A;  4S2K A;  3NDG A;  2OSU A;  3A3F A;  3BY9 A;  3T4L A;  3CAX A;  3P01 A;  2NUT C;  5DF8 A;  3T1X A;  4U0X A;  1Q2Q A;  5AQ9 A;  5A93 A;  3NOP C;  5U47 A;  2JE5 A;  2DCF A;  3IF6 C;  1NLY A;  3VOY A;  2J7V A;  2WKH A;  3UDI A;  4QY5 A;  4WEK A;  1JTG A;  2VK3 A;  3OPP A;  2ZQA A;  4KG5 A;  1H8M A;  3DW0 A;  3JVV A;  4HJ6 A;  4KQR A;  1IYS A;  2AVX A;  2JKT M;  3RH8 B;  4O7D A;  1ZG6 A;  2Y2J A;  3VP0 A;  3BFD A;  3EGX C;  1YLZ A;  1F98 A;  2YKH A;  2P7J A;  2VGL M;  5EVI B;  2O0Y A;  1IKG A;  1PRQ A;  1Z6F A;  3G30 A;  1KVL A;  3ZG0 A;  3GRJ A;  4JLF A;  4H6J A;  2R78 A;  4BD1 A;  3LY3 A;  2OAP 1;  5FQQ A;  4EWF A;  3ZG5 A;  4LEN A;  3G35 A;  5TR7 A;  1KGF A;  3DTE A;  3QP2 A;  3RTY A;  1GSV A;  2V1A A;  2MJ6 A;  4MCW A;  5GHY A;  1EW0 A;  4R4R A;  5EUA A;  3ZVW A;  4EBN A;  4FD8 A;  1Y54 A;  5DJU A;  3AGF A;  3E4O A;  3R7W B;  1VB6 A;  1BLS A;  2HDQ A;  2V0U A;  2IWC A;  2HZ5 A;  5CXW A;  4C3Q A;  4OPY A;  4X6T A;  2GX5 A;  1XFQ A;  3LR3 A;  1VET A;  4HES A;  3N4I A;  2P9V B;  1FCO A;  4NXG A;  3T50 A;  1FCM A;  3VFF A;  2XLN A;  2EWW A;  2V9A A;  4WF0 A;  4B4X A;  1NRF A;  3MBZ A;  1N4O A;  4N1X A;  5CGS A;  1H0M A;  3C2W A;  3Q7Z A;  1V9Y A;  2JKR M;  2A3U A;  4GHI A;  5L10 A;  3C8C A;  2XSS A;  3BQA A;  1L0G A;  1FSW A;  3HLC A;  2XR0 A;  4UA6 A;  4ESP A;  2H0Y A;  3C5A A;  4HIA A;  3V67 A;  4F3L A;  3UPN A;  1K0K A;  3HLW A;  3BYD A;  4Z1W A;  1MZU A;  4HJ4 A;  2WGW A;  3QP1 A;  4IED A;  2V1B A;  2FFF B;  2PAV P;  4GJ4 A;  2HP9 A;  4Y15 A;  1IEM A;  1PNE A;  4DE1 A;  4ZJ3 A;  3V5M A;  5FQJ A;  3UDX A;  2Y79 A;  3IQA A;  1LSW A;  1ALQ A;  3KX0 X;  5A90 A;  2QWS A;  2XD5 A;  3BY8 A;  2G7U A;  3E0Y A;  3B47 A;  1SHV A;  1X0O A;  2WKP A;  5HZH A;  1WYC A;  2EFU A;  4WN5 A;  4OP8 A;  3C7U A;  3VV4 A;  3ZVT A;  3HCY A;  4PPR A;  3BM6 A;  4E6W A;  2GJ3 A;  5HL1 A;  5CGX A;  4OOM A;  1BLP A;  5G4Z A;  1ERO A;  2ZMA A;  4BQM A;  5L09 A;  1WA9 A;  4WMC D;  1T1A A;  4KZ5 A;  3WS2 A;  4EBP A;  1ERQ A;  2Z2M B;  1YPR A;  3FPW A;  3S7Q A;  3AGE A;  4Y0U A;  3SS3 A;  3TJZ C;  2INW A;  1PW8 A;  3PBQ A;  4JF4 A;  1XPB A;  5KIZ A;  1GCE A;  4HP4 A;  4OOY A;  1BT5 A;  4GCZ A;  3UY6 A;  4Y13 A;  5J4E A;  4DE0 A;  4CLC C;  3OPH A;  4L0L A;  2E8J A;  5F6A A;  2ZL1 B;  3N8L A;  4LCM A;  3MKE A;  5EVI A;  4BLM A;  1OT9 A;  1CI9 A;  4BD0 A;  4JGQ A;  4R70 A;  5CHU A;  4HBT A;  2EX6 A;  3QNB A;  1K4F A;  3ZG9 B;  2J3W A;  3MZE A;  5AQA A;  5TGF A;  3AGD A;  1FR6 A;  5J3W A;  1YMS A;  3Q1F A;  4QD4 A;  4OLG A;  3D4F A;  3K3D A;  4F94 A;  3WS1 A;  5TFQ A;  2HF6 A;  3BWL A;  4LV1 A;  1PWD A;  4RYE A;  4EQ1 A;  2JHE A;  1FR1 A;  1W5D A;  3F1N B;  3GQZ A;  2M7U A;  4QHC A;  4E04 A;  1OJG A;  1ESU A;  1YLJ A;  4UEY A;  2HJE A;  1CEF A;  4YWZ A;  3UNW A;  4R3A A;  5KMW A;  3TRC A;  3LFV A;  3OOV A;  1K54 A;  3SS5 A;  2PD8 A;  4S2J A;  4EUV A;  3LR0 A;  1AWI A;  3FWL A;  1YLY A;  1VM1 A;  4UHU A;  5TBM B;  1FQG A;  1CF0 A;  1DP8 A;  2ZC6 B;  2A24 A;  1RGY A;  1E3U A;  3LIC A;  1YKD A;  3PXP A;  5AQ7 A;  4P87 A;  3W4O A;  1XJ4 A;  3IT9 A;  5DFX A;  3O86 A;  4S2M A;  4Q0H A;  2V0W A;  5D3O A;  2IWD A;  3IF6 A;  3MQ0 A;  4WLA A;  1JNU A;  2I72 A;  3NJA A;  5TJJ A;  5M1A A;  1ES2 A;  1MY8 A;  4ZRR A;  3ZDJ A;  3HBR A;  1YLP A;  3G4P A;  3H9W A;  2BTF P;  4CQH A;  3FYZ A;  1OPX A;  1XJ6 A;  1J3W A;  2WUQ A;  1K57 C;  5DTS A;  3UE1 A;  4DF6 A;  4KG6 A;  1F2K A;  2Z6C A;  5FAP A;  1GA0 A;  4MNR A;  3IXH A;  4Y0O A;  2FFY A;  4EEP A;  4S2I A;  4OVD A;  3MXQ A;  3P7N A;  4GLQ A;  5CEC A;  4ETZ A;  3GR2 A;  3G2Z A;  5M19 A;  2G2U A;  1NXY A;  5KZH A;  2L1M A;  3W4P A;  4H6J B;  4XT2 A;  1K56 D;  3GDI A;  2PR5 A;  5HL6 A;  5DTT A;  3VSK A;  1NLZ A;  4JKT A;  4ZDX A;  3CPT B;  3H82 B;  4RA7 A;  1XKZ A;  5FI6 A;  3K2N A;  3NDE A;  5LBR A;  3IX8 A;  5JYP A;  2EX2 A;  3RXW A;  3D72 A;  4KZ4 A;  4DXB A;  3B33 A;  4KQD A;  4ME4 A;  4BL2 A;  5EPH A;  4IJG A;  1DRM A;  3DWK A;  2XD1 A;  4IVI A;  5HAR A;  3DTK A;  3VMA A;  4LRX C;  1IYP A;  4MDZ A;  1I5Q A;  1PZP A;  2XF3 A;  5IHV A;  5HPF A;  2E8I A;  5KSH A;  3BLM A;  1TEM A;  1E4D A;  1MC0 A;  1XJ2 A;  1W8Y A;  1NWZ A;  4QY6 A;  5E43 A;  3CHW P;  1UWN X;  2X71 A;  3UPP A;  2B02 A;  2Y2Q A;  3SH8 A;  3UB8 A;  1W79 A;  3A3E A;  1RCJ A;  2J3T D;  4GHI B;  4OPQ A;  2W3D A;  1N9B A;  2K7S A;  2XGN A;  3Q81 A;  4ZAM A;  5CED A;  3D3O A;  1YSP A;  3QP4 A;  1MBL A;  4LGW A;  5CHJ A;  4F3L B;  4EBL A;  2H10 A;  4L9F A;  2GZA A;  1TDG A;  2VKS A;  4HOI A;  4GB7 A;  4JGO A;  3UO9 A;  5FEG A;  4O01 A;  4XUZ A;  5HDS A;  1TS0 A;  1ZC2 A;  2WGW B;  3KYQ A;  3PAE A;  1AXB A;  1LL5 A;  3OCL A;  3N6I A;  2J8Y A;  1K55 C;  4GD8 A;  4EUZ A;  2XRN A;  2YKF A;  4X69 A;  3QP5 A;  4Y7P A;  2QMI A;  4CJN A;  2O9A A;  3CUE A;  1S66 L;  3N7W A;  1U60 A;  3KSI A;  3MZF A;  1VEU B;  4EQI A;  4C75 A;  3N8S A;  1QME A;  1XA1 A; 
#chains in the Genus database with same CATH homology
 3KSG A;  2EWW A;  5I5L A;  4R38 A;  4I38 A;  3T4O A;  2V9A A;  2PD7 A;  2Z6D A;  4WF0 A;  4DJ3 A;  4MMN A;  4WEL A;  3E4Q A;  2B18 A;  2W1R A;  2WKR A;  3BQ8 A;  4IHQ A;  4EW7 A;  3C2W A;  1V9Y A;  1DP9 A;  2JKR M;  3UB7 A;  1T1B A;  4GHI A;  1TS8 A;  2XSS A;  3BQA A;  3C8C A;  3EWK A;  3VOL A;  4NXE A;  2JKR I;  2NUP C;  1P9W A;  3MQO A;  4G3K A;  1XJ3 A;  1IOU A;  4HIA A;  3V67 A;  3IS2 B;  1T18 A;  3PBN A;  4F3L A;  5C5K A;  2K2N A;  3LR5 A;  2D01 A;  5HD5 A;  4ETX A;  3MMH A;  2OAQ 1;  5F69 A;  3EEH A;  3EQV A;  5J7E A;  3UE3 A;  4Z1W A;  4L9E A;  1MZU A;  3E98 A;  4CLC A;  4EEU A;  3C38 A;  4HJ4 A;  1G28 A;  2W3G A;  3LI9 A;  3ZQ5 A;  2V1B A;  4GJ4 A;  4WUJ A;  4CLC E;  3CWF A;  3R7W A;  2QJ5 A;  3MQQ A;  3MR0 A;  3PBS A;  4DJ2 A;  1LSV A;  4LLO B;  2H28 A;  3ZYT A;  5IU1 A;  1P97 A;  2D02 A;  4FSF A;  5EFW A;  1W63 Q;  2Y79 A;  5HWV A;  4M4X A;  4GS9 B;  1LSW A;  3KX0 X;  3NHQ A;  4II7 A;  2QWS A;  3BY8 A;  3OLO A;  3LI8 A;  2M7V A;  4KUO A;  2G7U A;  3E0Y A;  1OTA A;  3B47 A;  4I3A A;  5A8B A;  1X0O A;  3T4Q A;  2WKP A;  3PR6 A;  3UMD A;  5HZH A;  5F68 A;  2OWJ A;  4WN5 A;  3ULF A;  3VV4 A;  2W3E A;  3LID A;  3HCY A;  2QJ7 A;  1LSX A;  3FG8 A;  3PBO A;  3PBR A;  3OBF A;  3OC2 A;  3H82 A;  2GJ3 A;  3FPV A;  3KSH A;  3KYZ A;  2GNX A;  3H7W B;  3EGD C;  2XA7 S;  4OOM A;  4G3V A;  1ZHH B;  5G4Z A;  3LUQ A;  4HJ3 A;  4KUK A;  4O0P A;  3MF0 A;  3UB6 A;  4FOF A;  3LR4 A;  4ARZ B;  4IUK A;  1WA9 A;  4BBU A;  4P6Z M;  1IFQ A;  1T1A A;  2CMN A;  4YOF A;  2VA0 A;  3IS2 A;  3FPW A;  3S7Q A;  3T4K A;  5CX7 A;  3TJZ C;  2A24 B;  4JGR A;  2W27 A;  2INW A;  4LRZ E;  3G6O A;  3PBQ A;  3RFB A;  2ZOH A;  3CLO A;  3CI6 A;  5KIZ A;  4HP9 A;  2PDR A;  5HDC A;  2LB9 A;  4HP4 A;  1G6O A;  5MC7 A;  2J80 A;  1TF1 A;  3W2Z A;  4GCZ A;  5J4E A;  1T1C A;  1YAX A;  5IT5 A;  4CLC C;  1T19 A;  5FL3 A;  3UB9 A;  4L0L A;  2VZW A;  2ZOI A;  2OOL A;  5F6A A;  1OJ5 A;  1LL8 A;  4PHT A;  2P08 A;  1ODV A;  1ZTU A;  1P0Z A;  1TD5 A;  3U2A A;  4EER A;  1OT9 A;  3VE3 A;  4JGQ A;  2ZMV A;  4L9G A;  4R70 A;  5DJT A;  1OT6 A;  2VX8 A;  3A0V A;  5HWW A;  1XFN A;  2BAS A;  2J3W A;  3OCN A;  1H3Q A;  3T4T A;  1GSW A;  3S7O A;  5J3W A;  3LIB A;  4IUH A;  3S7P A;  3SW1 A;  2W3F A;  2QHK A;  1OTI A;  3K3D A;  5AVF A;  5G4Y A;  5K5B A;  2W0N A;  2HF6 A;  2L4R A;  3BWL A;  4MN6 A;  3E4P A;  2WKQ A;  3TW8 A;  1OTD A;  4EQ1 A;  2JHE A;  4HI4 A;  3A0R A;  3H7W A;  2VV8 A;  3F1N B;  4I39 A;  2HJ9 C;  1TS7 A;  3NOT C;  2M7U A;  3DBA A;  4HNB A;  4E04 A;  1OJG A;  5IS1 A;  4UEY A;  2HJE A;  2QYB A;  2HV1 A;  4YWZ A;  4R3A A;  4ARZ A;  4PKY G;  3TRC A;  3LFV A;  3OOV A;  2PD8 A;  3EQU A;  4EUV A;  2EA9 A;  5L8M A;  3LR0 A;  4XT2 B;  3KSF A;  4WL9 A;  4EXO A;  1S67 L;  5TBM B;  1TS6 A;  2KX6 A;  1DP8 A;  2A24 A;  2PR6 A;  4I3I A;  4NKP A;  3LIC A;  1YKD A;  3PXP A;  1XJ4 A;  5DFX A;  4B9O A;  2FH5 A;  4G3W A;  5AJG A;  2M1C A;  1V9Z A;  2O9B A;  3TE8 A;  3K3C A;  4Q0H A;  2I9V A;  2V0W A;  2VGL S;  3MQ0 A;  3PBT A;  1JNU A;  4WLA A;  1W63 M;  4HHD A;  4DMZ A;  4DN0 A;  2KOI A;  3NJA A;  1OTB A;  4WEJ A;  1BYW A;  3ICY A;  2EWV A;  2PYR A;  5TJJ A;  5F5Y A;  4Y2F A;  1MKM A;  4EES A;  1S1Z A;  4ZRR A;  1UGU A;  3O5Y A;  3KO6 A;  3H9W A;  4CQH A;  3PYP A;  3LIF A;  1OPX A;  2J3T C;  1S4R A;  1XJ6 A;  4LRY C;  4MN7 A;  2VV7 A;  5DF9 A;  1KOU A;  2W1T B;  3F1O B;  3IBR A;  3MJQ A;  3CIT A;  2W3H A;  4UQI S;  3MFX A;  2JN7 A;  4B93 A;  2Z6C A;  3R4K A;  4CLC D;  2VJW A;  5AVE A;  4EU0 A;  2IA2 A;  3GEC A;  3FC7 A;  2FZ0 A;  1STZ A;  1YSQ A;  1D7E A;  5DFY A;  4EEP A;  5HPI A;  4AFI A;  4EET B;  3MXQ A;  3P7N A;  2KLI A;  4GLQ A;  1NRJ A;  1OTE A;  4I5S A;  3LIE A;  3F1N A;  4ETZ A;  2L0W A;  4P6Z S;  4HH2 A;  4Q0J A;  4K08 A;  4HH3 A;  3UME A;  2L1M A;  4LPZ A;  1Y28 A;  4MN5 A;  4H6J B;  4BBV A;  3C30 A;  2Y8H A;  4XT2 A;  2ZMF A;  4BJP A;  5TBM A;  3A0S A;  3GDI A;  1N9L A;  1S4S A;  2PR5 A;  5HL6 A;  5HWT A;  4Y5F A;  4GS9 A;  5DKK A;  2O9C A;  5HSQ A;  3S7N A;  1NLZ A;  3BY9 A;  3H82 B;  3T4L A;  3JVU A;  3CAX A;  2PYP A;  3P01 A;  1LT0 A;  2P04 A;  3K2N A;  2NUT C;  5HDD A;  5LBR A;  1UWP X;  3NOP C;  1NLY A;  3D72 A;  4WEK A;  3B33 A;  4OOL A;  2PT7 A;  4KQD A;  4ME4 A;  1DP6 A;  1H8M A;  2VV6 A;  4IJG A;  3JVV A;  4HJ6 A;  1DRM A;  3BW6 A;  2JKT M;  3RH8 B;  4LRX C;  4MDZ A;  4PAU A;  4I3J A;  2W1T A;  3EOI A;  1N9N A;  3F1P B;  3F1O A;  3UE6 A;  5HPF A;  2JKT I;  1VHM A;  1GSX A;  5KSH A;  4GW9 A;  1F5M A;  3NOU C;  1MC0 A;  1XJ2 A;  1NWZ A;  3HJK A;  3EGX C;  1UWN X;  3IBJ A;  4Y3I A;  2B02 A;  1F98 A;  2YKH A;  2P7J A;  2VGL M;  3UB8 A;  4NXB A;  4HY8 A;  2O0Y A;  2J3T D;  4GHI B;  4NEE D;  4BMW A;  2W3D A;  1P9R A;  2K7S A;  2XA7 M;  2QKP A;  3EEA A;  3D3O A;  1YSP A;  4QPR A;  4O8G A;  4H6J A;  2R78 A;  4RQ9 A;  2O99 A;  2K31 A;  4BWI A;  2OAP 1;  3BJN A;  3CUE C;  4F3L B;  4KQO A;  4L9F A;  4Q0I A;  2GZA A;  5DKL A;  2OWH A;  2VKS A;  4HOI A;  4JGO A;  3PHY A;  4O01 A;  3LYX A;  1S1Y A;  2A2L A;  4UQI M;  3RTY A;  1GSV A;  2V1A A;  2MJ6 A;  5HDS A;  4CLC B;  4MCW A;  2DMW A;  1TS0 A;  1EW0 A;  4NXF A;  2ZBB A;  4R6L A;  3KYQ A;  4JGP A;  3T4S A;  4PKY A;  5DJU A;  3E4O A;  2PHY A;  3VE4 A;  2KDK A;  3OCL A;  3R7W B;  3T4J A;  1VB6 A;  5HD3 A;  2V0U A;  2XRO A;  2XRN A;  2YKF A;  3HJI A;  2GX5 A;  1XFQ A;  2VEA A;  3LR3 A;  2O9A A;  2VLG A;  3CUE A;  2HGV A;  4BBT A;  4YNR A;  1S66 L;  1N9O A;  2LB5 A;  3KSI A;  1D06 A;  4NXG A;  3B42 A;  1F9I A;  3F1P A;  3LIA A;  3T50 A;  4HQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...