2INWA

Crystal structure of q83jn9 from shigella flexneri at high resolution. northeast structural genomics consortium target sfr137.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
TLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGGELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Structural genomics, unknown function
molecule keywords Putative structural protein
total genus 21
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2inwA01
2OWHA 2CMNA 1DP9A 3CAXA 2PHYA 3LI9A 3VE3A 4I3AA 4JGOA 4KUKA 3OLOA 2GJ3A 2ZOIA 3CLOA 5IU1A 1MZUA 3H7WB 3BWLA 3MJQA 4PKYA 4L9GA 1TS6A 2V1AA 3F1OB 1S4SA 1XFNA 3LIFA 5EFWA 2OOLA 3UMDA 5DJUA 4BBTA 3C8CA 1P97A 2D01A 1XJ6A 5IS1A 2K7SA 1S67L 3H9WA 4EEPA 1ODVA 3EWKA 4LRXC 1XJ4A 1OT6A 1TS8A 2QJ7A 3BY8A 1OTBA 3LI8A 3LIAA 1T18A 1V9YA 1OJGA 2VV7A 4HOIA 4R6LA 1V9ZA 2M1CA 4XT2B 5DKLA 5AVFA 3H82B 4MN5A 1F98A 5HDSA 5HDDA 2VEAA 1XJ3A 2QJ5A 2INWA 4HQAA 2WKRA 2YKFA 4H6JB 2PYRA 2W0NA 3CWFA 2W27A 5HD5A 1UWNX 3H82A 2PD7A 2YKHA 2QHKA 1LT0A 1LL8A 3E4OA 4GS9A 1UGUA 1OTEA 5HWWA 3C2WA 3MQQA 2V9AA 4JGQA 5J3WA 4JGRA 2L4RA 3K3CA 3LICA 1N9LA 2JHEA 3LIBA 4HHDA 4HNBA 1XJ2A 3D72A 4M4XA 1NWZA 1T1CA 3GDIA 3BY9A 3HJIA 4GHIA 1T1AA 4HJ3A 4MN6A 1EW0A 1OJ5A 1LSWA 5HD3A 5I5LA 3IS2B 4WF0A 2V1BA 2P7JA 4HH2A 1D06A 4B9OA 2KX6A 4BBUA 3H7WA 5HWVA 2Z6DA 4L9EA 5AVEA 2I9VA 4HIAA 3A0SA 2OWJA 2V0UA 1OT9A 2A24A 4YWZA 4EERA 1P0ZA 5A8BA 3FG8A 3B33A 4I39A 2D02A 1GSVA 3NHQA 3PYPA 1TS0A 1OTDA 1N9NA 2JN7A 2PYPA 4I38A 4EESA 5HWTA 3NOPC 4NXEA 5G4ZA 3LYXA 3RH8B 1S66L 2VLGA 3ZQ5A 1UWPX 1T1BA 4WN5A 5G4YA 1D7EA 1S1ZA 3F1NB 1DP8A 4I3IA 3NOTC 4EEUA 4EQ1A 2KDKA 4GS9B 5F5YA 3NOUC 3LIEA 4E04A 2QKPA 4H6JA 1LSXA 3MR0A 3F1PA 3PHYA 4LLOB 1DRMA 2B02A 2PDRA 3P7NA 1LSVA 4R38A 4WUJA 3G6OA 3HJKA 3RTYA 4DJ3A 5KIZA 4NXGA 5DJTA 3F1OA 3K3DA 2BASA 4BBVA 1GSXA 3LUQA 4GCZA 3E4QA 3A0RA 1S4RA 3LIDA 4LRZE 3UB8A 3UMEA 4GHIB 3KX0X 3EEHA 1WA9A 1VB6A 4HJ4A 3UB6A 3VOLA 1JNUA 4LPZA 4GW9A 3T50A 5J7EA 4NXFA 2EA9A 5HSQA 4K08A 2QWSA 4F3LA 4KQDA 3A0VA 2L1MA 3IBRA 4HP9A 5HDCA 4HY8A 1OTAA 1OTIA 2Z6CA 3MQOA 2PR6A 5TBMB 4RQ9A 2V0WA 5F68A 4EW7A 4HH3A 1KOUA 2ZOHA 3SW1A 4R3AA 2HV1A 4HI4A 5F6AA 2VV6A 3GECA 4WL9A 3MFXA 4JGPA 4HJ6A 1S1YA 4EXOA 1G28A 1Y28A 3ULFA 3IS2A 2WKPA 5J4EA 2WKQA 5DKKA 4XT2A 3F1PB 3E4PA 3ICYA 4LRYC 1GSWA 2A24B 1T19A 4I3JA 4HP4A 4KUOA 4NXBA 5TBMA 5F69A 1BYWA 2R78A 1X0OA 1TS7A 4EETB 1N9OA 2PR5A 2J80A 3UB7A 4R70A 5HZHA 4PKYG 3F1NA 2VV8A 3NJAA 4I5SA 3UE6A 2ZBBA 3MXQA 1DP6A 1XFQA 4WLAA 3FC7A 3VE4A 2L0WA 4DJ2A 4F3LB 2PD8A 2H28A 1F9IA 4L9FA 3UB9A
chains in the Genus database with same CATH superfamily
3CAXA 4GZBA 2GJ3A 3OCNA 5U47A 1TS6A 4E3IA 1DY6A 3OC2A 3WS4A 3ZVTA 1CEGA 2JKRI 4N9KA 4K0XA 1XJ3A 1YLWA 2W27A 1K25A 4ZJ2A 2JKGA 3HREA 1OJ5A 3IS2B 3OOVA 4HH2A 1D06A 4EBPA 1XGIA 3IH9A 5HWVA 1IKIA 1MWTA 2H10A 2I9VA 2V0UA 3PBSA 4JKTA 4KQQA 3CZDA 3UPPA 1JVJA 3LY4A 2XA7S 4LV0A 1SDNA 4H6JA 3ZFZA 2IA2A 5HAIA 4Q8IA 3Q07A 4DJ3A 1JTGA 1MXOA 4KZ6A 3OBFA 2ZQCA 2XSSA 1WA9A 3UB6A 3T1XA 5D3OA 3T4TA 1ZHHB 3PBQA 3WS5A 4FCFA 1FR1A 2Q9MA 2QMIA 3MQOA 3W4PA 4EW7A 4X53A 1JWZA 3PR6A 4RYEA 2RL3A 3LR5A 3RJUA 2K2NA 4MBFA 1M6KA 3ZCZA 4E3NA 3BEBA 2ZM8A 3E98A 2Y2HA 3LI9A 3VE3A 4I3AA 1Y54A 2HGVA 4E3KA 1LL9A 5EV0A 4IVKA 2G2WA 2OLUA 1ODVA 2QJ7A 3LIAA 1O07A 3IHBA 2EX9A 3P09A 2DMWA 4QPRA 2V9AA 4LCMA 1BTLA 3IWOA 3BY9A 3NCKA 2KX6A 3W4QA 3A0SA 5CGXA 5A8BA 1DJCA 3FG8A 4DXCA 2PYPA 1ONHA 4NXEA 1LI9A 3F1NB 2HDSA 2W1TB 4LENA 4LV3A 4MEZA 2B95A 2QKPA 3Q82A 3EGDC 4S2KA 2PDRA 4DDYA 1CI8A 2WGWA 4U0XA 2EXBA 2J9PA 5DVAA 3ITAA 4LRZE 3BQAA 5MC7A 1Q2PA 3V50A 3ITBA 3CPTA 4RVAA 4B4XA 3MS6A 1YLTA 2DCFA 3MXRA 4LRYC 4KUOA 5F69A 3UNWA 4E3OA 4OP5A 1MKMA 1YLPA 5HPFA 2PU2A 4S2LA 5F1FA 1N4OA 2L0WA 3NECA 4WM9A 4MDZA 3W4OA 3L7HA 2EXAA 4QWOA 3OLOA 1G6OA 3EQUA 3IHAA 3IXBA 1H5XA 2OOLA 4GNUA 1W79A 5L09A 3C8CA 5CTMA 2WKEA 4R3JA 3LI8A 3BY8A 2M1CA 3PBRA 4WBGA 1MPLA 3VP4A 1IYOA 3OZHA 2YKFA 2HDRA 3Q7VB 1W5DA 1CF0A 3MF0A 3JYIA 2ZMVA 3HUOA 3UB5P 2XFTA 3DWKA 1ONGA 3IBJA 4MN7A 2WYXA 1GHIA 3A3EA 3HVFA 4Z1WA 1K57C 3S7PA 1LSXA 3MR0A 3TRCA 4N9LA 1YSQA 4U0TA 3O3VA 3HLBA 1LI0A 3DWZA 4KQOA 4E3JA 4FUWA 2WZZA 3BFCA 3M2KA 4S2JA 5E43A 3JVVA 3UDFA 3G32A 3DTMA 5HSQA 4WMCD 3A0VA 1K55A 1KOUA 1YSPA 4K0WA 3NBLA 4JLFA 3GTCA 3C4PA 2HJ9C 3N8LA 5E2GA 2BTFP 2JKTM 3I7JA 3HLEA 2XF3A 1K4FA 3DTEA 3TG9A 2BLSA 1RCJA 3LCEA 4GKUA 4CLCB 3MJQA 2I72A 5EFWA 3LR0A 4MMNA 1TD5A 2ZM0A 4Z9QA 1HLUP 3G35A 1S67L 3MZDA 1OT6A 1TF1A 3MMHA 4QD4A 3A3JA 3E2KA 2JKFA 2JKTI 1KGFA 5HFOA 1Z09A 4WZ5C 2Y2NA 4HQAA 2QJ5A 5HW3A 2YKHA 1PNEA 3D72A 3QP8A 3BRMA 1W7FA 3T4SA 1K6RA 1FCMA 5G18A 2Z6DA 3BQ8A 5K5BA 2E8IA 3C7VA 1GSVA 1OTDA 4GDBA 3DBAA 5G4YA 2ZC6B 4KZBA 1DP8A 4Y0UA 4DF6A 5I94A 5EM0A 3LFVA 3NOUC 1ZG4A 1LLBA 4LLOB 4PM6A 5M1AA 1O7EA 4S2NC 1Z6FA 3U4LP 5EE8A 3BFDA 2PBDP 2O9AA 1IELA 3E4QA 1ALQA 1S4RA 3HUMA 1JNUA 1IOUA 4O8GA 2RCXA 1L3LA 3G34A 3QP4A 2EX8A 4WYYA 5F82A 5F6AA 3ZG7B 3KSIA 1VHMA 4ARZA 1YMXA 3IS2A 5DF8A 5J4EA 5DKKA 3F1PB 1GSWA 1T19A 4BD0A 4E6XA 3O87A 3GRJA 1ES5A 4R70A 1DP6A 5AJGA 4HESA 4D60A 1F2KA 3UB9A 3CHWP 4X68A 5F83A 3BWLA 4F94A 2Y55A 2V1AA 1S4SA 3Q1FA 4IBXA 1RGZA 3H9WA 2HP9A 3NC8A 2HZ5A 2V8FA 3MZFA 3PAGA 4MN5A 3NDEA 2HP5A 5TFQA 2LB9A 1MY8A 4DE2A 5HWWA 1LL8A 3K3CA 1PRQA 2ZL1A 4HJ3A 1T1AA 4EUZA 2KOIA 3VP1A 4E6WA 4EUVA 4L9EA 4X25A 4YWZA 3FPVA 4EERA 4PM9A 3PYPA 1TS0A 1G5UA 2XEPA 3CUEA 3LYXA 5M18A 2FFFB 1NRFA 3NY4A 1KGEA 2M7VA 5E2HA 1MC0A 1FCNA 1NLYA 4OPYA 3UE3A 1W8YA 5EECA 4WUJA 1I2SA 5DJTA 5TJJA 1PWGA 1PW8A 5FSRA 3LY3A 3ISGA 3MSHA 1HD8A 4ARZB 5TGFA 3LO7A 1VEUA 4II7A 4KZ7A 5E2FA 3FPWA 2V0WA 2OSUA 4DRTA 2J8YA 4JGPA 2W3HA 4DKIA 2KLIA 1K38A 1XX2A 4P85A 2A3UA 2IWCA 4OP8A 2FZ0A 3DTIA 4JPMA 2OLVA 2O9BA 1GA9A 3OPHA 4A5RA 5FATA 4OQGA 2E8JA 3NJAA 3C30A 4HEFA 5HL1A 3M6BA 2H28A 4LPZA 5HL6A 4OOYA 4JGOA 5HPIA 5IU1A 1P9RA 2W3GA 3F1OB 1XP4A 4ZTKA 3LR3A 5DJUA 3HUNA 4KG2A 4OPZA 3BECA 4BL3A 4NG2A 5FQQA 4HOIA 3VFFA 1ESUA 3WS0A 3T1RA 1U60A 3OPPA 3P01A 1M40A 2WKRA 3R7WA 1H8MA 4X6TA 1RGYA 4DXBA 2WADA 1PI5A 4HNBA 4GHIA 1K56A 3H7WA 4S2MA 4NK3A 3SS5A 2Y2GA 1OT9A 2EFUA 4LGWA 3EEAA 3T4KA 3BJNA 5BOHA 1LHYA 1S66L 3ZYTA 1IYQA 4KQRA 2VGLM 3M2JA 3EOIA 4GS9B 5KZHA 2ZD8A 2C6WB 1EWZA 3MKFA 4S2PA 3UMEA 3G4PA 2ZC7A 1EROA 3PTEA 4JXSA 2EWVA 5FDSA 5FDHA 2VKSA 4PAUA 4KENB 2P74A 1XA1A 4JXGA 3BLMA 3LR4A 2HV1A 1PZOA 5L10A 4O01A 1W63M 1NJ4A 1E3UA 1WYCA 3ICYA 1HTZA 4JXWA 4Y15A 2WK0A 3D9YA 1G68A 1KE4A 1F5MA 5GLBA 5HZHA 4PKYG 4DJ2A 1PWCA 4UA6A 1ES3A 5DTSA 1JTDA 2H0TA 2J3WA 3BM6A 1PW1A 4C3QA 5JYOA 5IS1A 3UPNA 3VP0A 2VJWA 4IUKA 1V9ZA 4XUZA 5DF9A 5FQJA 3WRZA 4B4ZA 1IYPA 3CWFA 5FQKA 1UGUA 1OTEA 2VGJA 1TEMA 2ZQAA 4GLQA 1NWZA 3HLGA 1ZKJA 4LCLA 3IF5A 4ZBEA 2OWJA 2A24A 3E2LA 4GN2A 3IWIA 4N92A 3RH8B 2J3TC 4EEUA 4GD6A 2MJ6A 1ZC2A 4UQIS 2B02A 2JKRM 2VGLS 3G6OA 3HJKA 3UO9A 4GJ4A 3K3DA 1KDSA 2J3TD 3UB8A 4HJ4A 3VOLA 1J3WA 2EX6A 3SH7A 2EA9A 4F3LA 4OVDA 3IX4A 3IBRA 4HP9A 1BT5A 1MKIA 2OAQ1 2QZ6A 4HY8A 4GOGA 2M7UA 2NUTC 2XK1A 3NI9A 4IBRA 3HBRA 2QYBA 2VZWA 3IT9A 5GL9A 1S1YA 3ZGAB 1QMFA 2WKQA 5TBMA 3TSGA 1BYWA 4BQMA 4PMAA 5FQIA 2PR5A 3K2NA 1VETA 3VMAA 4P87A 1OPXA 3BFGA 4YINA 2P08A 2X01A 4N1XA 4NKPA 4CLCC 4L9FA 2CMNA 1H3QA 2XFSA 2ZQDA 2Y59A 4PM7A 5AQ7A 1XJ4A 2WAEA 5G4ZA 1FR6A 2ZQ8A 2VV7A 2EWWA 3S22A 3T4LA 5CTNA 5FI6A 2Y8HA 5FA7A 4OLDA 5HD5A 2QHKA 1CK3A 3IX3A 3C2WA 4JGRA 2JHEA 1EW0A 1C3BA 4NETA 3T4JA 3KYQA 1L0FA 4HIAA 1N9NA 1TDLA 4P6ZS 4CQHA 3HLWA 1IKGA 3NOTC 4FH4A 4E04A 4KZ3A 2FFYA 3OPRA 2BASA 1FILA 4GHIB 1WYBA 4Y5FA 4NXFA 2OV5A 2QWSA 3AGDA 2ZM2A 3KSFA 3VSKA 5TR7A 4OONA 3ZDJA 4HH3A 3QP6A 5CEDA 4GDNA 5EPHA 3MKEA 5J8XA 3W2ZA 2Y2IA 3S7OA 4R3BA 1L2SA 3OPLA 1W8QA 2XRNA 2UV0E 2Q0OA 2VV8A 4I5SA 1XFQA 4Y0OA 3CG5A 1F9IA 5TBMB 4OPRA 2O0YA 2PHYA 5FASA 2K31A 4JXVA 3H7WB 4IVIA 4OKPA 2WGIA 1S6RA 4CPKA 4MBHA 3Q7ZA 1MBLA 1NZUA 1YAXA 3IXGA 5HDSA 3MFDA 4U3TA 4FSFA 5HDDA 2INWA 1VEUB 5DFYA 4FH2A 4OLGA 1CQAA 2P04A 4M4XA 3T4OA 3GDIA 4MN6A 5I5LA 1LSWA 2DRWA 2P7JA 4G3WA 3MQ0A 1ESIA 1VM1A 4X1LA 3G31A 5AQAA 3P98A 2VLGA 4IJGA 4WN5A 5F5YA 2Y4AA 5FI2A 4RA7A 3KSHA 1XXMA 1ERQA 3LEZA 1GHPA 1YLJA 4DE1A 4IUHA 4DE3A 3NULA 1BLSA 1KVLA 3S7NA 4KQDA 1ZG6A 3T4QA 2ZQ7A 1CJFA 1H8YA 3A3IA 2W3DA 2GZAA 1YT4A 3FYZA 4KG6A 2XROA 4WZ5A 3SW1A 5HAQA 3GECA 1G6AA 3E0YA 1NYYA 5FI7A 4IEDA 2PU4A 2A24B 4D2OA 4NXBA 3SH8A 3LEQA 1FIKA 1Y4OA 4EETB 5EM1A 1I5QA 3V5MA 2QPNA 3GMWA 1NY0A 3UE6A 1HVBA 1L0GA 3VE4A 1LL5A 1ES4A 4Y17A 4OH0A 5CGSA 1TVFA 3WS1A 2ZOIA 1L0DA 1XPBA 4Y7PA 3BFEA 2H0YA 5EUAA 3PBOA 5AQBA 3Q7VA 3MZEA 4JF5A 4LRXC 4XT2B 3GR2A 4UAAA 4H8RA 1PFLA 3UPOA 1UWNX 2HP6A 3MQQA 2L4RA 1N9LA 1ZTUA 3HJIA 4PPRA 1HZOA 4B9OA 4CLCD 3S1YA 3TJZC 5A93A 1ES2A 4X1MA 1EI5A 4I39A 3NHQA 5IT5A 1H0MA 4EESA 3SZTA 4ZAMA 3NOPC 1D7EA 4I3IA 2ACGA 4ID4A 2JCHA 2ZC3B 3F1PA 1YMSA 1LSVA 1E3UD 2B5RA 1MWRA 3Q81A 1KE3A 4OQHA 4UEYA 4IHQA 2JE5A 3T1QB 2EFXA 2VK3A 3B42A 3CITA 1OTAA 2Z6CA 1VQQA 1BSGA 4R3AA 4HI4A 2GNXA 4P0MA 2VV6A 2Y2MA 5EVLA 1BLCA 4G3KA 3V39A 4WL9A 3SOIA 2Y2PA 4PM8A 1AXBA 3HL9A 2GX5A 2Y2LA 1Y28A 4KZAA 2VGKA 1YM1A 5DFXA 3KO6A 3UE0A 2R78A 1N9OA 3F1NA 4Q0HA 2ZBBA 3SH9A 2ZMFA 4Y2FA 2GDNA 4OOMA 4UQIM 3SS3A 1SCWA 2X02A 2WGVA 1SKFA 4MLLA 4LV1A 3HLDA 3IWQA 5GHZA 2PD7A 2ZC4B 2ZMAA 4GS9A 4R4SA 3E4OA 4C75A 3SS4A 1DJAA 1JWVA 3O5YA 1K54A 3D4FA 4FOFA 2Y2QA 1PWDA 4L0LA 2P9VB 2XD5A 3FZCA 1XA7A 2JN7A 4DMZA 1YPRA 4G3VA 4KZ8A 4BLMA 4ZRRA 5FAQA 1IFQA 3PAEA 3C4OA 3R7WB 3RFBA 1XKZA 4Q0IA 4R38A 3V3SA 1WE4A 4YFMA 1GSXA 2ZL1B 3GQZA 5AQ9A 2Y2OA 1VB6A 3UDIA 3UN7A 5KSHA 2Z2MB 3IF6B 1GCEA 4K08A 5HDCA 3ZG9B 2ZC5B 2PR6A 3QP2A 4DN0A 2JC7A 4EXOA 2IWBA 4I3JA 2A49A 4HP4A 5CX7A 1TS7A 3DTKA 4P6ZM 1BLPA 5EOEA 3VOYA 1K55C 5DF7A 4R1GA 2B18A 5CECA 4S2OA 4OOLA 4B88A 3FKVA 4L9GA 4X55A 2V20A 3LIFA 3U2AA 3HLCA 3NIAA 1BULA 1T18A 5AVFA 5JYPA 1ACFA 1FSWA 2VX8A 2PYRA 1D1JA 5F1GA 1LT0A 4EU0A 1FQGA 3G30A 1N9BA 4WEJA 4EEPA 2Y79A 3V3RA 4R0QA 3VP2A 4QHCA 5GHXA 3FWLA 2R9WA 3S7QA 3B47A 4WF0A 2WKIA 2Y91A 2PT7A 2WKHA 2G2UA 4KG5A 3VV4A 1FSYA 4XXRA 5CERA 3UDXA 2ZLYA 5DTKA 1A0KA 3GSGA 3KSGA 1IYSA 1NLZA 3RTYA 2IWDA 3G2YA 4YNRA 2JBFA 4BJPA 3KX0X 3EEHA 1K54C 3IF6C 4MNRA 3FKWA 4NEED 3T50A 3CPTB 4PM5A 5CHMA 5CXWA 5HARA 1OMEA 3ZVWA 4UHUA 4UA7A 2WZXA 1G28A 2WKPA 2VA0A 1KE0A 1W63Q 4N1HA 4ETXA 1ERMA 3UB7A 2XGNA 1PYYA 3IXHA 3MXQA 3FC7A 4E3MA 2OWHA 5E2EA 4WEKA 3B3XA 3UMDA 4Y13A 4X56A 1L0EA 4UA9A 1P97A 1NZOA 4KUKA 5FL3A 2V1ZA 5GHYA 4XUXA 2DNSA 1P9WA 5KMWA 3N8SA 4AFIA 4HHDA 2PRFA 1AWIA 5C5KA 4FTXA 3VOZA 2XLNA 4CJNA 2X71A 5AVEA 1GHMA 2D02A 4JF6A 5A90A 2HPBA 5HWTA 3V67A 1UWPX 1T1BA 1S1ZA 4BD1A 2Q9NA 1JWPA 1S0WA 3CMZA 4EQ1A 5L07A 1I2WA 3A3DA 2HDUA 1CI9A 4M3KA 3QP5A 4RX3A 4KZ5A 4EWFA 2O9CA 2HJEA 5CHUA 1BZAA 3GVBA 4ZJ3A 4X69A 1MWSA 3O88A 4K91A 3T1SA 4BMWA 4MBKA 2ZOHA 1KGGA 1K6SA 4JF4A 3MXSA 1KVMA 4DDSA 3OCLA 3ZG0A 2J80A 3UY6A 4EV4A 4WLAA 3N7WA 2C5WB 2W3FA 4PKYA 2FH5A 2NUPC 3ZNTA 3ZNYA 2H5SA 4O7DA 1J9MA 2Y2JA 1SKOA 4S2NA 3EWKA 2ZQ9A 1OTBA 3T12B 4R6LA 1NYMA 1OJGA 1XGJA 2HDQA 2J9OA 1E25A 2PAVP 5FAOA 2W0NA 3H82A 3N6IA 3D3OA 4BL2A 1YKDA 5HD3A 2WGWB 3WWXA 4EQIA 3PXPA 1RP5A 1NXYA 2ZJ9A 4MCWA 3QNBA 3VFHA 3C7UA 5GLCA 1SHVA 2V8CA 5EVIA 4OPQA 4LV2A 2KDKA 3CI6A 3LIEA 3G2ZA 1DJBA 3JPUA 3P7NA 5KIZA 3DW0A 3KYEA 1YLZA 4BBVA 4GCZA 1SZVA 3LIDA 3RXXA 2W1RA 3N8RA 5FEFA 1MWUA 5CGWA 4GW9A 3DAVA 4EBNA 4FD8A 1BLHA 2L1MA 1OTIA 1FCOA 4CLCA 3BLSA 3L9KA 3C5AA 4QY5A 3CUEC 5FQ9A 2R9XA 4Q0JA 4Y0TA 2Y2KA 3VP3A 3IF6A 4C6YA 2CC1A 3BW6A 3ZG5A 1YQSA 3E4PA 3PBNA 4ZJ1A 5GLAA 4B93A 4R23A 3QHYA 4ME4A 4EBLA 3O86A 4WELA 2XD1A 3ZG8B 1K0KA 3TE8A 5M19A 1MZUA 3FV7A 1XFNA 3MBZA 4GB7A 4HBTA 1XJ6A 2P9VA 2HF6A 1K56D 4PHTA 3LGOA 3WRTA 5KSCA 5DKLA 2O99A 3H82B 1F98A 2VEAA 1BUEA 1K57A 2BG1A 2W1TA 5HAPA 5FAPA 5J3WA 4JGQA 3LIBA 1XJ2A 1T1CA 5FEGA 4BBUA 4ESPA 1FOFA 2OAP1 2LB5A 1P0ZA 3GV9A 3ZQ5A 3AGFA 2WUQA 2J7VA 4QJGA 1NRJA 4DE0A 5EVID 3RXWA 2WAFA 5L8MA 3VSLA 4NXGA 3LUQA 3M6HA 2EX2A 3A0RA 5GLDA 1PI4A 2AVXA 3IQAA 3N4IA 5J7EA 1QMEA 3TW8A 4ETZA 2Z2LB 1IEMA 4RQ9A 3EQVA 1GA0A 3CJMA 3MFXA 3W8KA 4HJ6A 4OQIA 4OQ0A 3ULFA 5CEBA 4BWIA 4XT2A 4KZ9A 4HBUA 4QY6A 1X0OA 5A91A 3EGXC 2XR0A 3KYZA 1H8ZA 5HX9A 4F3LB 5EVIC 3BYDA 1DP9A 1SDEA 3CLOA 5IHVA 4BBTA 5A92A 2D01A 2K7SA 2PBYA 2XH9A 4QB8A 2G7UA 1TS8A 1V9YA 1CEFA 3JVUA 4H6JB 1VETB 4Y3IA 2A2LA 3BFFA 5CHJA 3LICA 4WMCA 5CRFA 1Q2QA 2V1BA 1KDWA 4KZ4A 4P6BA 2XA7M 3B33A 3R4KA 4I38A 3HCYA 2W3EA 4QU3A 5DTTA 3IH8A 3NDGA 4LFUA 5LBRA 4WZ4A 4E3LA 1K4EA 3PHYA 5EVEA 1DRMA 2XDMA 5L2FA 4O0PA 3F1OA 3C38A 3UE1A 5EOOA 1STZA 4BENA 2V2FF 3S4XA 3WS2A 3PBTA 1TDGA 5F68A 4JBFA 4S2IA 4GD8A 1PIOA 3QNCA 3A3FA 1SKOB 3IXDA 3AGEA 4RX2A 1YLYA 2UWXA 2XQZA 3ZHHA 4ZDXA 1PZPA 3TOIA 3IX8A 4YOFA 1E4DA 3HLFA 3QP1A 5EVIB 4CLCE 5FQMA 2PD8A 4R4RA
chains in the Genus database with same CATH topology
2OWHA 2O0YA 3CAXA 2PHYA 2K31A 2GJ3A 3OCNA 3H7WB 4WEKA 3BWLA 1TS6A 2V1AA 1S4SA 3UMDA 1P97A 3H9WA 3OC2A 4KUKA 5FL3A 2JKRI 1YAXA 4MN5A 5HDSA 1P9WA 5HDDA 4FSFA 1XJ3A 2INWA 5DFYA 2W27A 2LB9A 5HWWA 2P04A 1LL8A 4AFIA 3K3CA 4HHDA 4M4XA 3T4OA 5C5KA 3GDIA 4HJ3A 4MN6A 1T1AA 5I5LA 1OJ5A 1LSWA 3IS2B 3OOVA 2KOIA 2P7JA 1D06A 4G3WA 4HH2A 5HWVA 4EUVA 4L9EA 3MQ0A 2I9VA 5AVEA 2V0UA 4YWZA 3FPVA 3PBSA 4EERA 2D02A 3PYPA 1TS0A 5HWTA 3V67A 3CUEA 3LYXA 2VLGA 4IJGA 1UWPX 1T1BA 2XA7S 4WN5A 1S1ZA 4EQ1A 2M7VA 1MC0A 5F5YA 1NLYA 4H6JA 3UE3A 2IA2A 3KSHA 4WUJA 4DJ3A 5DJTA 5TJJA 3OBFA 2XSSA 1WA9A 3UB6A 4IUHA 2O9CA 2HJEA 3T4TA 1ZHHB 3PBQA 4ARZB 3S7NA 4KQDA 3T4QA 4II7A 2W3DA 2GZAA 3FPWA 3MQOA 4BMWA 2V0WA 4EW7A 2XROA 3SW1A 2ZOHA 3PR6A 3GECA 3E0YA 4JGPA 2W3HA 2KLIA 3LR5A 2K2NA 2A24B 2FZ0A 4NXBA 3OCLA 2O9BA 4EETB 2J80A 3NJAA 3C30A 3E98A 3UE6A 4WLAA 3VE4A 2H28A 4LPZA 5HL6A 3LI9A 3VE3A 4I3AA 4JGOA 5HPIA 2W3FA 2ZOIA 5IU1A 4PKYA 1P9RA 2FH5A 2W3GA 3F1OB 2NUPC 2HGVA 3LR3A 5DJUA 3PBOA 1ODVA 3EWKA 4LRXC 2QJ7A 4HOIA 1OTBA 3LIAA 4R6LA 4XT2B 1OJGA 3P01A 2WKRA 3R7WA 1H8MA 2W0NA 1UWNX 3H82A 2DMWA 4QPRA 3D3OA 3MQQA 2V9AA 2L4RA 1N9LA 4HNBA 1YKDA 1ZTUA 3BY9A 3HJIA 4GHIA 5HD3A 4B9OA 3PXPA 4CLCD 2KX6A 3H7WA 3TJZC 4MCWA 3A0SA 1OT9A 5A8BA 3FG8A 4I39A 3EEAA 3NHQA 3T4KA 2PYPA 3BJNA 5IT5A 4EESA 3NOPC 4NXEA 1S66L 3ZYTA 1D7EA 3F1NB 4I3IA 2VGLM 2KDKA 3EOIA 2W1TB 4GS9B 3CI6A 3LIEA 2QKPA 3EGDC 3F1PA 2PDRA 3P7NA 1LSVA 5KIZA 4BBVA 4GCZA 3LIDA 2W1RA 3BQAA 4LRZE 3UMEA 5MC7A 4UEYA 4GW9A 4IHQA 2EWVA 3B42A 3CITA 2L1MA 2VKSA 4PAUA 1OTAA 1OTIA 4CLCA 2Z6CA 3CUEC 3LR4A 4R3AA 2HV1A 2GNXA 4HI4A 2VV6A 4Q0JA 4G3KA 4WL9A 2GX5A 4O01A 1W63M 1Y28A 3BW6A 5DFXA 3E4PA 3ICYA 4LRYC 4KUOA 3KO6A 3PBNA 5F69A 2R78A 1N9OA 1F5MA 4B93A 1MKMA 5HPFA 5HZHA 4PKYG 3F1NA 4ME4A 4Q0HA 2ZBBA 2ZMFA 2L0WA 4DJ2A 4WELA 4MDZA 4Y2FA 3TE8A 3OLOA 1G6OA 4OOMA 1MZUA 3EQUA 4UQIM 1XFNA 2OOLA 2J3WA 3C8CA 1XJ6A 5IS1A 2HF6A 4PHTA 3LI8A 3BY8A 2VJWA 5DKLA 2O99A 1V9ZA 2M1CA 4IUKA 3H82B 3PBRA 1F98A 5DF9A 2VEAA 2YKFA 3CWFA 2PD7A 2W1TA 4GS9A 3E4OA 1UGUA 1OTEA 5J3WA 4JGQA 3LIBA 1XJ2A 4GLQA 1NWZA 1T1CA 3O5YA 4FOFA 3MF0A 4BBUA 2ZMVA 4L0LA 2OAP1 2OWJA 2A24A 2LB5A 1P0ZA 2JN7A 4DMZA 3IBJA 4G3VA 4MN7A 3RH8B 3ZQ5A 2J3TC 4ZRRA 4EEUA 4Z1WA 1IFQA 2MJ6A 3R7WB 3S7PA 1NRJA 1LSXA 3MR0A 3RFBA 3TRCA 2B02A 1YSQA 4Q0IA 4UQIS 2JKRM 2VGLS 3G6OA 3HJKA 4R38A 5L8MA 4NXGA 4GJ4A 3K3DA 1GSXA 3LUQA 4KQOA 3A0RA 3UB8A 2J3TD 4HJ4A 1VB6A 3VOLA 5KSHA 3JVVA 5J7EA 2EA9A 5HSQA 4K08A 4F3LA 3A0VA 3IBRA 4HP9A 2OAQ1 3TW8A 5HDCA 4HY8A 4ETZA 2M7UA 2NUTC 2PR6A 4RQ9A 1KOUA 3EQVA 1YSPA 2QYBA 4DN0A 3MFXA 2VZWA 4HJ6A 1S1YA 4EXOA 3ULFA 4BWIA 2WKQA 4XT2A 4I3JA 5CX7A 4HP4A 5TBMA 2HJ9C 1BYWA 1X0OA 3EGXC 1TS7A 2PR5A 3K2NA 2JKTM 3KYZA 1OPXA 4P6ZM 2P08A 4F3LB 4NKPA 4CLCC 2B18A 4L9FA 2CMNA 4OOLA 1DP9A 1H3QA 4CLCB 3CLOA 3MJQA 4L9GA 3LIFA 5EFWA 3LR0A 4MMNA 3U2AA 1TD5A 4BBTA 2D01A 1S67L 2K7SA 1XJ4A 1OT6A 1TS8A 2G7UA 1TF1A 3MMHA 5G4ZA 1T18A 1V9YA 2VV7A 2EWWA 3T4LA 5AVFA 2JKTI 4HQAA 2QJ5A 2VX8A 2Y8HA 3JVUA 2PYRA 4H6JB 4Y3IA 2A2LA 5HD5A 2YKHA 2QHKA 1LT0A 4EU0A 3C2WA 4WEJA 4EEPA 2Y79A 4JGRA 3LICA 2JHEA 3D72A 3S7QA 1EW0A 3B47A 3T4SA 4WF0A 2V1BA 2Z6DA 3T4JA 3BQ8A 3KYQA 4HIAA 5K5BA 2XA7M 2PT7A 3B33A 1GSVA 3R4KA 1OTDA 1N9NA 4I38A 3HCYA 2W3EA 3DBAA 4P6ZS 3VV4A 4CQHA 5G4YA 1DP8A 3NOTC 3LFVA 3NOUC 4E04A 5LBRA 3KSGA 3PHYA 4LLOB 1DRMA 3RTYA 1NLZA 4O0PA 4YNRA 3F1OA 2BASA 2O9AA 3E4QA 1S4RA 3C38A 4BJPA 4GHIB 3KX0X 3EEHA 1STZA 1JNUA 4Y5FA 4NEED 3T50A 4NXFA 2QWSA 1IOUA 4O8GA 3PBTA 3KSFA 5F68A 4HH3A 5F6AA 3KSIA 1VHMA 4ARZA 3W2ZA 1G28A 3IS2A 2WKPA 2VA0A 5J4EA 5DKKA 3S7OA 3F1PB 1GSWA 1T19A 2XRNA 1W63Q 4ETXA 4YOFA 3UB7A 4R70A 2VV8A 4CLCE 4I5SA 3MXQA 1DP6A 5AJGA 1XFQA 3FC7A 2PD8A 1F9IA 5TBMB 3UB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWH A;  2CMN A;  1DP9 A;  3CAX A;  2PHY A;  3LI9 A;  3VE3 A;  4I3A A;  4JGO A;  4KUK A;  3OLO A;  2GJ3 A;  2ZOI A;  3CLO A;  5IU1 A;  1MZU A;  3H7W B;  3BWL A;  3MJQ A;  4PKY A;  4L9G A;  1TS6 A;  2V1A A;  3F1O B;  1S4S A;  1XFN A;  3LIF A;  5EFW A;  2OOL A;  3UMD A;  5DJU A;  4BBT A;  3C8C A;  1P97 A;  2D01 A;  1XJ6 A;  5IS1 A;  2K7S A;  1S67 L;  3H9W A;  4EEP A;  1ODV A;  3EWK A;  4LRX C;  1XJ4 A;  1OT6 A;  1TS8 A;  2QJ7 A;  3BY8 A;  1OTB A;  3LI8 A;  3LIA A;  1T18 A;  1V9Y A;  1OJG A;  2VV7 A;  4HOI A;  4R6L A;  1V9Z A;  2M1C A;  4XT2 B;  5DKL A;  5AVF A;  3H82 B;  4MN5 A;  1F98 A;  5HDS A;  5HDD A;  2VEA A;  1XJ3 A;  2QJ5 A;  2INW A;  4HQA A;  2WKR A;  2YKF A;  4H6J B;  2PYR A;  2W0N A;  3CWF A;  2W27 A;  5HD5 A;  1UWN X;  3H82 A;  2PD7 A;  2YKH A;  2QHK A;  1LT0 A;  1LL8 A;  3E4O A;  4GS9 A;  1UGU A;  1OTE A;  5HWW A;  3C2W A;  3MQQ A;  2V9A A;  4JGQ A;  5J3W A;  4JGR A;  2L4R A;  3K3C A;  3LIC A;  1N9L A;  2JHE A;  3LIB A;  4HHD A;  4HNB A;  1XJ2 A;  3D72 A;  4M4X A;  1NWZ A;  1T1C A;  3GDI A;  3BY9 A;  3HJI A;  4GHI A;  1T1A A;  4HJ3 A;  4MN6 A;  1EW0 A;  1OJ5 A;  1LSW A;  5HD3 A;  5I5L A;  3IS2 B;  4WF0 A;  2V1B A;  2P7J A;  4HH2 A;  1D06 A;  4B9O A;  2KX6 A;  4BBU A;  3H7W A;  5HWV A;  2Z6D A;  4L9E A;  5AVE A;  2I9V A;  4HIA A;  3A0S A;  2OWJ A;  2V0U A;  1OT9 A;  2A24 A;  4YWZ A;  4EER A;  1P0Z A;  5A8B A;  3FG8 A;  3B33 A;  4I39 A;  2D02 A;  1GSV A;  3NHQ A;  3PYP A;  1TS0 A;  1OTD A;  1N9N A;  2JN7 A;  2PYP A;  4I38 A;  4EES A;  5HWT A;  3NOP C;  4NXE A;  5G4Z A;  3LYX A;  3RH8 B;  1S66 L;  2VLG A;  3ZQ5 A;  1UWP X;  1T1B A;  4WN5 A;  5G4Y A;  1D7E A;  1S1Z A;  3F1N B;  1DP8 A;  4I3I A;  3NOT C;  4EEU A;  4EQ1 A;  2KDK A;  4GS9 B;  5F5Y A;  3NOU C;  3LIE A;  4E04 A;  2QKP A;  4H6J A;  1LSX A;  3MR0 A;  3F1P A;  3PHY A;  4LLO B;  1DRM A;  2B02 A;  2PDR A;  3P7N A;  1LSV A;  4R38 A;  4WUJ A;  3G6O A;  3HJK A;  3RTY A;  4DJ3 A;  5KIZ A;  4NXG A;  5DJT A;  3F1O A;  3K3D A;  2BAS A;  4BBV A;  1GSX A;  3LUQ A;  4GCZ A;  3E4Q A;  3A0R A;  1S4R A;  3LID A;  4LRZ E;  3UB8 A;  3UME A;  4GHI B;  3KX0 X;  3EEH A;  1WA9 A;  1VB6 A;  4HJ4 A;  3UB6 A;  3VOL A;  1JNU A;  4LPZ A;  4GW9 A;  3T50 A;  5J7E A;  4NXF A;  2EA9 A;  5HSQ A;  4K08 A;  2QWS A;  4F3L A;  4KQD A;  3A0V A;  2L1M A;  3IBR A;  4HP9 A;  5HDC A;  4HY8 A;  1OTA A;  1OTI A;  2Z6C A;  3MQO A;  2PR6 A;  5TBM B;  4RQ9 A;  2V0W A;  5F68 A;  4EW7 A;  4HH3 A;  1KOU A;  2ZOH A;  3SW1 A;  4R3A A;  2HV1 A;  4HI4 A;  5F6A A;  2VV6 A;  3GEC A;  4WL9 A;  3MFX A;  4JGP A;  4HJ6 A;  1S1Y A;  4EXO A;  1G28 A;  1Y28 A;  3ULF A;  3IS2 A;  2WKP A;  5J4E A;  2WKQ A;  5DKK A;  4XT2 A;  3F1P B;  3E4P A;  3ICY A;  4LRY C;  1GSW A;  2A24 B;  1T19 A;  4I3J A;  4HP4 A;  4KUO A;  4NXB A;  5TBM A;  5F69 A;  1BYW A;  2R78 A;  1X0O A;  1TS7 A;  4EET B;  1N9O A;  2PR5 A;  2J80 A;  3UB7 A;  4R70 A;  5HZH A;  4PKY G;  3F1N A;  2VV8 A;  3NJA A;  4I5S A;  3UE6 A;  2ZBB A;  3MXQ A;  1DP6 A;  1XFQ A;  4WLA A;  3FC7 A;  3VE4 A;  2L0W A;  4DJ2 A;  4F3L B;  2PD8 A;  2H28 A;  1F9I A;  4L9F A;  3UB9 A; 
#chains in the Genus database with same CATH topology
 3CAX A;  4GZB A;  2GJ3 A;  3OCN A;  5U47 A;  1TS6 A;  4E3I A;  1DY6 A;  3OC2 A;  3WS4 A;  3ZVT A;  1CEG A;  2JKR I;  4N9K A;  4K0X A;  1XJ3 A;  1YLW A;  2W27 A;  1K25 A;  4ZJ2 A;  2JKG A;  3HRE A;  1OJ5 A;  3IS2 B;  3OOV A;  4HH2 A;  1D06 A;  4EBP A;  1XGI A;  3IH9 A;  5HWV A;  1IKI A;  1MWT A;  2H10 A;  2I9V A;  2V0U A;  3PBS A;  4JKT A;  4KQQ A;  3CZD A;  3UPP A;  1JVJ A;  3LY4 A;  2XA7 S;  4LV0 A;  1SDN A;  4H6J A;  3ZFZ A;  2IA2 A;  5HAI A;  4Q8I A;  3Q07 A;  4DJ3 A;  1JTG A;  1MXO A;  4KZ6 A;  3OBF A;  2ZQC A;  2XSS A;  1WA9 A;  3UB6 A;  3T1X A;  5D3O A;  3T4T A;  1ZHH B;  3PBQ A;  3WS5 A;  4FCF A;  1FR1 A;  2Q9M A;  2QMI A;  3MQO A;  3W4P A;  4EW7 A;  4X53 A;  1JWZ A;  3PR6 A;  4RYE A;  2RL3 A;  3LR5 A;  3RJU A;  2K2N A;  4MBF A;  1M6K A;  3ZCZ A;  4E3N A;  3BEB A;  2ZM8 A;  3E98 A;  2Y2H A;  3LI9 A;  3VE3 A;  4I3A A;  1Y54 A;  2HGV A;  4E3K A;  1LL9 A;  5EV0 A;  4IVK A;  2G2W A;  2OLU A;  1ODV A;  2QJ7 A;  3LIA A;  1O07 A;  3IHB A;  2EX9 A;  3P09 A;  2DMW A;  4QPR A;  2V9A A;  4LCM A;  1BTL A;  3IWO A;  3BY9 A;  3NCK A;  2KX6 A;  3W4Q A;  3A0S A;  5CGX A;  5A8B A;  1DJC A;  3FG8 A;  4DXC A;  2PYP A;  1ONH A;  4NXE A;  1LI9 A;  3F1N B;  2HDS A;  2W1T B;  4LEN A;  4LV3 A;  4MEZ A;  2B95 A;  2QKP A;  3Q82 A;  3EGD C;  4S2K A;  2PDR A;  4DDY A;  1CI8 A;  2WGW A;  4U0X A;  2EXB A;  2J9P A;  5DVA A;  3ITA A;  4LRZ E;  3BQA A;  5MC7 A;  1Q2P A;  3V50 A;  3ITB A;  3CPT A;  4RVA A;  4B4X A;  3MS6 A;  1YLT A;  2DCF A;  3MXR A;  4LRY C;  4KUO A;  5F69 A;  3UNW A;  4E3O A;  4OP5 A;  1MKM A;  1YLP A;  5HPF A;  2PU2 A;  4S2L A;  5F1F A;  1N4O A;  2L0W A;  3NEC A;  4WM9 A;  4MDZ A;  3W4O A;  3L7H A;  2EXA A;  4QWO A;  3OLO A;  1G6O A;  3EQU A;  3IHA A;  3IXB A;  1H5X A;  2OOL A;  4GNU A;  1W79 A;  5L09 A;  3C8C A;  5CTM A;  2WKE A;  4R3J A;  3LI8 A;  3BY8 A;  2M1C A;  3PBR A;  4WBG A;  1MPL A;  3VP4 A;  1IYO A;  3OZH A;  2YKF A;  2HDR A;  3Q7V B;  1W5D A;  1CF0 A;  3MF0 A;  3JYI A;  2ZMV A;  3HUO A;  3UB5 P;  2XFT A;  3DWK A;  1ONG A;  3IBJ A;  4MN7 A;  2WYX A;  1GHI A;  3A3E A;  3HVF A;  4Z1W A;  1K57 C;  3S7P A;  1LSX A;  3MR0 A;  3TRC A;  4N9L A;  1YSQ A;  4U0T A;  3O3V A;  3HLB A;  1LI0 A;  3DWZ A;  4KQO A;  4E3J A;  4FUW A;  2WZZ A;  3BFC A;  3M2K A;  4S2J A;  5E43 A;  3JVV A;  3UDF A;  3G32 A;  3DTM A;  5HSQ A;  4WMC D;  3A0V A;  1K55 A;  1KOU A;  1YSP A;  4K0W A;  3NBL A;  4JLF A;  3GTC A;  3C4P A;  2HJ9 C;  3N8L A;  5E2G A;  2BTF P;  2JKT M;  3I7J A;  3HLE A;  2XF3 A;  1K4F A;  3DTE A;  3TG9 A;  2BLS A;  1RCJ A;  3LCE A;  4GKU A;  4CLC B;  3MJQ A;  2I72 A;  5EFW A;  3LR0 A;  4MMN A;  1TD5 A;  2ZM0 A;  4Z9Q A;  1HLU P;  3G35 A;  1S67 L;  3MZD A;  1OT6 A;  1TF1 A;  3MMH A;  4QD4 A;  3A3J A;  3E2K A;  2JKF A;  2JKT I;  1KGF A;  5HFO A;  1Z09 A;  4WZ5 C;  2Y2N A;  4HQA A;  2QJ5 A;  5HW3 A;  2YKH A;  1PNE A;  3D72 A;  3QP8 A;  3BRM A;  1W7F A;  3T4S A;  1K6R A;  1FCM A;  5G18 A;  2Z6D A;  3BQ8 A;  5K5B A;  2E8I A;  3C7V A;  1GSV A;  1OTD A;  4GDB A;  3DBA A;  5G4Y A;  2ZC6 B;  4KZB A;  1DP8 A;  4Y0U A;  4DF6 A;  5I94 A;  5EM0 A;  3LFV A;  3NOU C;  1ZG4 A;  1LLB A;  4LLO B;  4PM6 A;  5M1A A;  1O7E A;  4S2N C;  1Z6F A;  3U4L P;  5EE8 A;  3BFD A;  2PBD P;  2O9A A;  1IEL A;  3E4Q A;  1ALQ A;  1S4R A;  3HUM A;  1JNU A;  1IOU A;  4O8G A;  2RCX A;  1L3L A;  3G34 A;  3QP4 A;  2EX8 A;  4WYY A;  5F82 A;  5F6A A;  3ZG7 B;  3KSI A;  1VHM A;  4ARZ A;  1YMX A;  3IS2 A;  5DF8 A;  5J4E A;  5DKK A;  3F1P B;  1GSW A;  1T19 A;  4BD0 A;  4E6X A;  3O87 A;  3GRJ A;  1ES5 A;  4R70 A;  1DP6 A;  5AJG A;  4HES A;  4D60 A;  1F2K A;  3UB9 A;  3CHW P;  4X68 A;  5F83 A;  3BWL A;  4F94 A;  2Y55 A;  2V1A A;  1S4S A;  3Q1F A;  4IBX A;  1RGZ A;  3H9W A;  2HP9 A;  3NC8 A;  2HZ5 A;  2V8F A;  3MZF A;  3PAG A;  4MN5 A;  3NDE A;  2HP5 A;  5TFQ A;  2LB9 A;  1MY8 A;  4DE2 A;  5HWW A;  1LL8 A;  3K3C A;  1PRQ A;  2ZL1 A;  4HJ3 A;  1T1A A;  4EUZ A;  2KOI A;  3VP1 A;  4E6W A;  4EUV A;  4L9E A;  4X25 A;  4YWZ A;  3FPV A;  4EER A;  4PM9 A;  3PYP A;  1TS0 A;  1G5U A;  2XEP A;  3CUE A;  3LYX A;  5M18 A;  2FFF B;  1NRF A;  3NY4 A;  1KGE A;  2M7V A;  5E2H A;  1MC0 A;  1FCN A;  1NLY A;  4OPY A;  3UE3 A;  1W8Y A;  5EEC A;  4WUJ A;  1I2S A;  5DJT A;  5TJJ A;  1PWG A;  1PW8 A;  5FSR A;  3LY3 A;  3ISG A;  3MSH A;  1HD8 A;  4ARZ B;  5TGF A;  3LO7 A;  1VEU A;  4II7 A;  4KZ7 A;  5E2F A;  3FPW A;  2V0W A;  2OSU A;  4DRT A;  2J8Y A;  4JGP A;  2W3H A;  4DKI A;  2KLI A;  1K38 A;  1XX2 A;  4P85 A;  2A3U A;  2IWC A;  4OP8 A;  2FZ0 A;  3DTI A;  4JPM A;  2OLV A;  2O9B A;  1GA9 A;  3OPH A;  4A5R A;  5FAT A;  4OQG A;  2E8J A;  3NJA A;  3C30 A;  4HEF A;  5HL1 A;  3M6B A;  2H28 A;  4LPZ A;  5HL6 A;  4OOY A;  4JGO A;  5HPI A;  5IU1 A;  1P9R A;  2W3G A;  3F1O B;  1XP4 A;  4ZTK A;  3LR3 A;  5DJU A;  3HUN A;  4KG2 A;  4OPZ A;  3BEC A;  4BL3 A;  4NG2 A;  5FQQ A;  4HOI A;  3VFF A;  1ESU A;  3WS0 A;  3T1R A;  1U60 A;  3OPP A;  3P01 A;  1M40 A;  2WKR A;  3R7W A;  1H8M A;  4X6T A;  1RGY A;  4DXB A;  2WAD A;  1PI5 A;  4HNB A;  4GHI A;  1K56 A;  3H7W A;  4S2M A;  4NK3 A;  3SS5 A;  2Y2G A;  1OT9 A;  2EFU A;  4LGW A;  3EEA A;  3T4K A;  3BJN A;  5BOH A;  1LHY A;  1S66 L;  3ZYT A;  1IYQ A;  4KQR A;  2VGL M;  3M2J A;  3EOI A;  4GS9 B;  5KZH A;  2ZD8 A;  2C6W B;  1EWZ A;  3MKF A;  4S2P A;  3UME A;  3G4P A;  2ZC7 A;  1ERO A;  3PTE A;  4JXS A;  2EWV A;  5FDS A;  5FDH A;  2VKS A;  4PAU A;  4KEN B;  2P74 A;  1XA1 A;  4JXG A;  3BLM A;  3LR4 A;  2HV1 A;  1PZO A;  5L10 A;  4O01 A;  1W63 M;  1NJ4 A;  1E3U A;  1WYC A;  3ICY A;  1HTZ A;  4JXW A;  4Y15 A;  2WK0 A;  3D9Y A;  1G68 A;  1KE4 A;  1F5M A;  5GLB A;  5HZH A;  4PKY G;  4DJ2 A;  1PWC A;  4UA6 A;  1ES3 A;  5DTS A;  1JTD A;  2H0T A;  2J3W A;  3BM6 A;  1PW1 A;  4C3Q A;  5JYO A;  5IS1 A;  3UPN A;  3VP0 A;  2VJW A;  4IUK A;  1V9Z A;  4XUZ A;  5DF9 A;  5FQJ A;  3WRZ A;  4B4Z A;  1IYP A;  3CWF A;  5FQK A;  1UGU A;  1OTE A;  2VGJ A;  1TEM A;  2ZQA A;  4GLQ A;  1NWZ A;  3HLG A;  1ZKJ A;  4LCL A;  3IF5 A;  4ZBE A;  2OWJ A;  2A24 A;  3E2L A;  4GN2 A;  3IWI A;  4N92 A;  3RH8 B;  2J3T C;  4EEU A;  4GD6 A;  2MJ6 A;  1ZC2 A;  4UQI S;  2B02 A;  2JKR M;  2VGL S;  3G6O A;  3HJK A;  3UO9 A;  4GJ4 A;  3K3D A;  1KDS A;  2J3T D;  3UB8 A;  4HJ4 A;  3VOL A;  1J3W A;  2EX6 A;  3SH7 A;  2EA9 A;  4F3L A;  4OVD A;  3IX4 A;  3IBR A;  4HP9 A;  1BT5 A;  1MKI A;  2OAQ 1;  2QZ6 A;  4HY8 A;  4GOG A;  2M7U A;  2NUT C;  2XK1 A;  3NI9 A;  4IBR A;  3HBR A;  2QYB A;  2VZW A;  3IT9 A;  5GL9 A;  1S1Y A;  3ZGA B;  1QMF A;  2WKQ A;  5TBM A;  3TSG A;  1BYW A;  4BQM A;  4PMA A;  5FQI A;  2PR5 A;  3K2N A;  1VET A;  3VMA A;  4P87 A;  1OPX A;  3BFG A;  4YIN A;  2P08 A;  2X01 A;  4N1X A;  4NKP A;  4CLC C;  4L9F A;  2CMN A;  1H3Q A;  2XFS A;  2ZQD A;  2Y59 A;  4PM7 A;  5AQ7 A;  1XJ4 A;  2WAE A;  5G4Z A;  1FR6 A;  2ZQ8 A;  2VV7 A;  2EWW A;  3S22 A;  3T4L A;  5CTN A;  5FI6 A;  2Y8H A;  5FA7 A;  4OLD A;  5HD5 A;  2QHK A;  1CK3 A;  3IX3 A;  3C2W A;  4JGR A;  2JHE A;  1EW0 A;  1C3B A;  4NET A;  3T4J A;  3KYQ A;  1L0F A;  4HIA A;  1N9N A;  1TDL A;  4P6Z S;  4CQH A;  3HLW A;  1IKG A;  3NOT C;  4FH4 A;  4E04 A;  4KZ3 A;  2FFY A;  3OPR A;  2BAS A;  1FIL A;  4GHI B;  1WYB A;  4Y5F A;  4NXF A;  2OV5 A;  2QWS A;  3AGD A;  2ZM2 A;  3KSF A;  3VSK A;  5TR7 A;  4OON A;  3ZDJ A;  4HH3 A;  3QP6 A;  5CED A;  4GDN A;  5EPH A;  3MKE A;  5J8X A;  3W2Z A;  2Y2I A;  3S7O A;  4R3B A;  1L2S A;  3OPL A;  1W8Q A;  2XRN A;  2UV0 E;  2Q0O A;  2VV8 A;  4I5S A;  1XFQ A;  4Y0O A;  3CG5 A;  1F9I A;  5TBM B;  4OPR A;  2O0Y A;  2PHY A;  5FAS A;  2K31 A;  4JXV A;  3H7W B;  4IVI A;  4OKP A;  2WGI A;  1S6R A;  4CPK A;  4MBH A;  3Q7Z A;  1MBL A;  1NZU A;  1YAX A;  3IXG A;  5HDS A;  3MFD A;  4U3T A;  4FSF A;  5HDD A;  2INW A;  1VEU B;  5DFY A;  4FH2 A;  4OLG A;  1CQA A;  2P04 A;  4M4X A;  3T4O A;  3GDI A;  4MN6 A;  5I5L A;  1LSW A;  2DRW A;  2P7J A;  4G3W A;  3MQ0 A;  1ESI A;  1VM1 A;  4X1L A;  3G31 A;  5AQA A;  3P98 A;  2VLG A;  4IJG A;  4WN5 A;  5F5Y A;  2Y4A A;  5FI2 A;  4RA7 A;  3KSH A;  1XXM A;  1ERQ A;  3LEZ A;  1GHP A;  1YLJ A;  4DE1 A;  4IUH A;  4DE3 A;  3NUL A;  1BLS A;  1KVL A;  3S7N A;  4KQD A;  1ZG6 A;  3T4Q A;  2ZQ7 A;  1CJF A;  1H8Y A;  3A3I A;  2W3D A;  2GZA A;  1YT4 A;  3FYZ A;  4KG6 A;  2XRO A;  4WZ5 A;  3SW1 A;  5HAQ A;  3GEC A;  1G6A A;  3E0Y A;  1NYY A;  5FI7 A;  4IED A;  2PU4 A;  2A24 B;  4D2O A;  4NXB A;  3SH8 A;  3LEQ A;  1FIK A;  1Y4O A;  4EET B;  5EM1 A;  1I5Q A;  3V5M A;  2QPN A;  3GMW A;  1NY0 A;  3UE6 A;  1HVB A;  1L0G A;  3VE4 A;  1LL5 A;  1ES4 A;  4Y17 A;  4OH0 A;  5CGS A;  1TVF A;  3WS1 A;  2ZOI A;  1L0D A;  1XPB A;  4Y7P A;  3BFE A;  2H0Y A;  5EUA A;  3PBO A;  5AQB A;  3Q7V A;  3MZE A;  4JF5 A;  4LRX C;  4XT2 B;  3GR2 A;  4UAA A;  4H8R A;  1PFL A;  3UPO A;  1UWN X;  2HP6 A;  3MQQ A;  2L4R A;  1N9L A;  1ZTU A;  3HJI A;  4PPR A;  1HZO A;  4B9O A;  4CLC D;  3S1Y A;  3TJZ C;  5A93 A;  1ES2 A;  4X1M A;  1EI5 A;  4I39 A;  3NHQ A;  5IT5 A;  1H0M A;  4EES A;  3SZT A;  4ZAM A;  3NOP C;  1D7E A;  4I3I A;  2ACG A;  4ID4 A;  2JCH A;  2ZC3 B;  3F1P A;  1YMS A;  1LSV A;  1E3U D;  2B5R A;  1MWR A;  3Q81 A;  1KE3 A;  4OQH A;  4UEY A;  4IHQ A;  2JE5 A;  3T1Q B;  2EFX A;  2VK3 A;  3B42 A;  3CIT A;  1OTA A;  2Z6C A;  1VQQ A;  1BSG A;  4R3A A;  4HI4 A;  2GNX A;  4P0M A;  2VV6 A;  2Y2M A;  5EVL A;  1BLC A;  4G3K A;  3V39 A;  4WL9 A;  3SOI A;  2Y2P A;  4PM8 A;  1AXB A;  3HL9 A;  2GX5 A;  2Y2L A;  1Y28 A;  4KZA A;  2VGK A;  1YM1 A;  5DFX A;  3KO6 A;  3UE0 A;  2R78 A;  1N9O A;  3F1N A;  4Q0H A;  2ZBB A;  3SH9 A;  2ZMF A;  4Y2F A;  2GDN A;  4OOM A;  4UQI M;  3SS3 A;  1SCW A;  2X02 A;  2WGV A;  1SKF A;  4MLL A;  4LV1 A;  3HLD A;  3IWQ A;  5GHZ A;  2PD7 A;  2ZC4 B;  2ZMA A;  4GS9 A;  4R4S A;  3E4O A;  4C75 A;  3SS4 A;  1DJA A;  1JWV A;  3O5Y A;  1K54 A;  3D4F A;  4FOF A;  2Y2Q A;  1PWD A;  4L0L A;  2P9V B;  2XD5 A;  3FZC A;  1XA7 A;  2JN7 A;  4DMZ A;  1YPR A;  4G3V A;  4KZ8 A;  4BLM A;  4ZRR A;  5FAQ A;  1IFQ A;  3PAE A;  3C4O A;  3R7W B;  3RFB A;  1XKZ A;  4Q0I A;  4R38 A;  3V3S A;  1WE4 A;  4YFM A;  1GSX A;  2ZL1 B;  3GQZ A;  5AQ9 A;  2Y2O A;  1VB6 A;  3UDI A;  3UN7 A;  5KSH A;  2Z2M B;  3IF6 B;  1GCE A;  4K08 A;  5HDC A;  3ZG9 B;  2ZC5 B;  2PR6 A;  3QP2 A;  4DN0 A;  2JC7 A;  4EXO A;  2IWB A;  4I3J A;  2A49 A;  4HP4 A;  5CX7 A;  1TS7 A;  3DTK A;  4P6Z M;  1BLP A;  5EOE A;  3VOY A;  1K55 C;  5DF7 A;  4R1G A;  2B18 A;  5CEC A;  4S2O A;  4OOL A;  4B88 A;  3FKV A;  4L9G A;  4X55 A;  2V20 A;  3LIF A;  3U2A A;  3HLC A;  3NIA A;  1BUL A;  1T18 A;  5AVF A;  5JYP A;  1ACF A;  1FSW A;  2VX8 A;  2PYR A;  1D1J A;  5F1G A;  1LT0 A;  4EU0 A;  1FQG A;  3G30 A;  1N9B A;  4WEJ A;  4EEP A;  2Y79 A;  3V3R A;  4R0Q A;  3VP2 A;  4QHC A;  5GHX A;  3FWL A;  2R9W A;  3S7Q A;  3B47 A;  4WF0 A;  2WKI A;  2Y91 A;  2PT7 A;  2WKH A;  2G2U A;  4KG5 A;  3VV4 A;  1FSY A;  4XXR A;  5CER A;  3UDX A;  2ZLY A;  5DTK A;  1A0K A;  3GSG A;  3KSG A;  1IYS A;  1NLZ A;  3RTY A;  2IWD A;  3G2Y A;  4YNR A;  2JBF A;  4BJP A;  3KX0 X;  3EEH A;  1K54 C;  3IF6 C;  4MNR A;  3FKW A;  4NEE D;  3T50 A;  3CPT B;  4PM5 A;  5CHM A;  5CXW A;  5HAR A;  1OME A;  3ZVW A;  4UHU A;  4UA7 A;  2WZX A;  1G28 A;  2WKP A;  2VA0 A;  1KE0 A;  1W63 Q;  4N1H A;  4ETX A;  1ERM A;  3UB7 A;  2XGN A;  1PYY A;  3IXH A;  3MXQ A;  3FC7 A;  4E3M A;  2OWH A;  5E2E A;  4WEK A;  3B3X A;  3UMD A;  4Y13 A;  4X56 A;  1L0E A;  4UA9 A;  1P97 A;  1NZO A;  4KUK A;  5FL3 A;  2V1Z A;  5GHY A;  4XUX A;  2DNS A;  1P9W A;  5KMW A;  3N8S A;  4AFI A;  4HHD A;  2PRF A;  1AWI A;  5C5K A;  4FTX A;  3VOZ A;  2XLN A;  4CJN A;  2X71 A;  5AVE A;  1GHM A;  2D02 A;  4JF6 A;  5A90 A;  2HPB A;  5HWT A;  3V67 A;  1UWP X;  1T1B A;  1S1Z A;  4BD1 A;  2Q9N A;  1JWP A;  1S0W A;  3CMZ A;  4EQ1 A;  5L07 A;  1I2W A;  3A3D A;  2HDU A;  1CI9 A;  4M3K A;  3QP5 A;  4RX3 A;  4KZ5 A;  4EWF A;  2O9C A;  2HJE A;  5CHU A;  1BZA A;  3GVB A;  4ZJ3 A;  4X69 A;  1MWS A;  3O88 A;  4K91 A;  3T1S A;  4BMW A;  4MBK A;  2ZOH A;  1KGG A;  1K6S A;  4JF4 A;  3MXS A;  1KVM A;  4DDS A;  3OCL A;  3ZG0 A;  2J80 A;  3UY6 A;  4EV4 A;  4WLA A;  3N7W A;  2C5W B;  2W3F A;  4PKY A;  2FH5 A;  2NUP C;  3ZNT A;  3ZNY A;  2H5S A;  4O7D A;  1J9M A;  2Y2J A;  1SKO A;  4S2N A;  3EWK A;  2ZQ9 A;  1OTB A;  3T12 B;  4R6L A;  1NYM A;  1OJG A;  1XGJ A;  2HDQ A;  2J9O A;  1E25 A;  2PAV P;  5FAO A;  2W0N A;  3H82 A;  3N6I A;  3D3O A;  4BL2 A;  1YKD A;  5HD3 A;  2WGW B;  3WWX A;  4EQI A;  3PXP A;  1RP5 A;  1NXY A;  2ZJ9 A;  4MCW A;  3QNB A;  3VFH A;  3C7U A;  5GLC A;  1SHV A;  2V8C A;  5EVI A;  4OPQ A;  4LV2 A;  2KDK A;  3CI6 A;  3LIE A;  3G2Z A;  1DJB A;  3JPU A;  3P7N A;  5KIZ A;  3DW0 A;  3KYE A;  1YLZ A;  4BBV A;  4GCZ A;  1SZV A;  3LID A;  3RXX A;  2W1R A;  3N8R A;  5FEF A;  1MWU A;  5CGW A;  4GW9 A;  3DAV A;  4EBN A;  4FD8 A;  1BLH A;  2L1M A;  1OTI A;  1FCO A;  4CLC A;  3BLS A;  3L9K A;  3C5A A;  4QY5 A;  3CUE C;  5FQ9 A;  2R9X A;  4Q0J A;  4Y0T A;  2Y2K A;  3VP3 A;  3IF6 A;  4C6Y A;  2CC1 A;  3BW6 A;  3ZG5 A;  1YQS A;  3E4P A;  3PBN A;  4ZJ1 A;  5GLA A;  4B93 A;  4R23 A;  3QHY A;  4ME4 A;  4EBL A;  3O86 A;  4WEL A;  2XD1 A;  3ZG8 B;  1K0K A;  3TE8 A;  5M19 A;  1MZU A;  3FV7 A;  1XFN A;  3MBZ A;  4GB7 A;  4HBT A;  1XJ6 A;  2P9V A;  2HF6 A;  1K56 D;  4PHT A;  3LGO A;  3WRT A;  5KSC A;  5DKL A;  2O99 A;  3H82 B;  1F98 A;  2VEA A;  1BUE A;  1K57 A;  2BG1 A;  2W1T A;  5HAP A;  5FAP A;  5J3W A;  4JGQ A;  3LIB A;  1XJ2 A;  1T1C A;  5FEG A;  4BBU A;  4ESP A;  1FOF A;  2OAP 1;  2LB5 A;  1P0Z A;  3GV9 A;  3ZQ5 A;  3AGF A;  2WUQ A;  2J7V A;  4QJG A;  1NRJ A;  4DE0 A;  5EVI D;  3RXW A;  2WAF A;  5L8M A;  3VSL A;  4NXG A;  3LUQ A;  3M6H A;  2EX2 A;  3A0R A;  5GLD A;  1PI4 A;  2AVX A;  3IQA A;  3N4I A;  5J7E A;  1QME A;  3TW8 A;  4ETZ A;  2Z2L B;  1IEM A;  4RQ9 A;  3EQV A;  1GA0 A;  3CJM A;  3MFX A;  3W8K A;  4HJ6 A;  4OQI A;  4OQ0 A;  3ULF A;  5CEB A;  4BWI A;  4XT2 A;  4KZ9 A;  4HBU A;  4QY6 A;  1X0O A;  5A91 A;  3EGX C;  2XR0 A;  3KYZ A;  1H8Z A;  5HX9 A;  4F3L B;  5EVI C;  3BYD A;  1DP9 A;  1SDE A;  3CLO A;  5IHV A;  4BBT A;  5A92 A;  2D01 A;  2K7S A;  2PBY A;  2XH9 A;  4QB8 A;  2G7U A;  1TS8 A;  1V9Y A;  1CEF A;  3JVU A;  4H6J B;  1VET B;  4Y3I A;  2A2L A;  3BFF A;  5CHJ A;  3LIC A;  4WMC A;  5CRF A;  1Q2Q A;  2V1B A;  1KDW A;  4KZ4 A;  4P6B A;  2XA7 M;  3B33 A;  3R4K A;  4I38 A;  3HCY A;  2W3E A;  4QU3 A;  5DTT A;  3IH8 A;  3NDG A;  4LFU A;  5LBR A;  4WZ4 A;  4E3L A;  1K4E A;  3PHY A;  5EVE A;  1DRM A;  2XDM A;  5L2F A;  4O0P A;  3F1O A;  3C38 A;  3UE1 A;  5EOO A;  1STZ A;  4BEN A;  2V2F F;  3S4X A;  3WS2 A;  3PBT A;  1TDG A;  5F68 A;  4JBF A;  4S2I A;  4GD8 A;  1PIO A;  3QNC A;  3A3F A;  1SKO B;  3IXD A;  3AGE A;  4RX2 A;  1YLY A;  2UWX A;  2XQZ A;  3ZHH A;  4ZDX A;  1PZP A;  3TOI A;  3IX8 A;  4YOF A;  1E4D A;  3HLF A;  3QP1 A;  5EVI B;  4CLC E;  5FQM A;  2PD8 A;  4R4R A; 
#chains in the Genus database with same CATH homology
 2OWH A;  2O0Y A;  3CAX A;  2PHY A;  2K31 A;  2GJ3 A;  3OCN A;  3H7W B;  4WEK A;  3BWL A;  1TS6 A;  2V1A A;  1S4S A;  3UMD A;  1P97 A;  3H9W A;  3OC2 A;  4KUK A;  5FL3 A;  2JKR I;  1YAX A;  4MN5 A;  5HDS A;  1P9W A;  5HDD A;  4FSF A;  1XJ3 A;  2INW A;  5DFY A;  2W27 A;  2LB9 A;  5HWW A;  2P04 A;  1LL8 A;  4AFI A;  3K3C A;  4HHD A;  4M4X A;  3T4O A;  5C5K A;  3GDI A;  4HJ3 A;  4MN6 A;  1T1A A;  5I5L A;  1OJ5 A;  1LSW A;  3IS2 B;  3OOV A;  2KOI A;  2P7J A;  1D06 A;  4G3W A;  4HH2 A;  5HWV A;  4EUV A;  4L9E A;  3MQ0 A;  2I9V A;  5AVE A;  2V0U A;  4YWZ A;  3FPV A;  3PBS A;  4EER A;  2D02 A;  3PYP A;  1TS0 A;  5HWT A;  3V67 A;  3CUE A;  3LYX A;  2VLG A;  4IJG A;  1UWP X;  1T1B A;  2XA7 S;  4WN5 A;  1S1Z A;  4EQ1 A;  2M7V A;  1MC0 A;  5F5Y A;  1NLY A;  4H6J A;  3UE3 A;  2IA2 A;  3KSH A;  4WUJ A;  4DJ3 A;  5DJT A;  5TJJ A;  3OBF A;  2XSS A;  1WA9 A;  3UB6 A;  4IUH A;  2O9C A;  2HJE A;  3T4T A;  1ZHH B;  3PBQ A;  4ARZ B;  3S7N A;  4KQD A;  3T4Q A;  4II7 A;  2W3D A;  2GZA A;  3FPW A;  3MQO A;  4BMW A;  2V0W A;  4EW7 A;  2XRO A;  3SW1 A;  2ZOH A;  3PR6 A;  3GEC A;  3E0Y A;  4JGP A;  2W3H A;  2KLI A;  3LR5 A;  2K2N A;  2A24 B;  2FZ0 A;  4NXB A;  3OCL A;  2O9B A;  4EET B;  2J80 A;  3NJA A;  3C30 A;  3E98 A;  3UE6 A;  4WLA A;  3VE4 A;  2H28 A;  4LPZ A;  5HL6 A;  3LI9 A;  3VE3 A;  4I3A A;  4JGO A;  5HPI A;  2W3F A;  2ZOI A;  5IU1 A;  4PKY A;  1P9R A;  2FH5 A;  2W3G A;  3F1O B;  2NUP C;  2HGV A;  3LR3 A;  5DJU A;  3PBO A;  1ODV A;  3EWK A;  4LRX C;  2QJ7 A;  4HOI A;  1OTB A;  3LIA A;  4R6L A;  4XT2 B;  1OJG A;  3P01 A;  2WKR A;  3R7W A;  1H8M A;  2W0N A;  1UWN X;  3H82 A;  2DMW A;  4QPR A;  3D3O A;  3MQQ A;  2V9A A;  2L4R A;  1N9L A;  4HNB A;  1YKD A;  1ZTU A;  3BY9 A;  3HJI A;  4GHI A;  5HD3 A;  4B9O A;  3PXP A;  4CLC D;  2KX6 A;  3H7W A;  3TJZ C;  4MCW A;  3A0S A;  1OT9 A;  5A8B A;  3FG8 A;  4I39 A;  3EEA A;  3NHQ A;  3T4K A;  2PYP A;  3BJN A;  5IT5 A;  4EES A;  3NOP C;  4NXE A;  1S66 L;  3ZYT A;  1D7E A;  3F1N B;  4I3I A;  2VGL M;  2KDK A;  3EOI A;  2W1T B;  4GS9 B;  3CI6 A;  3LIE A;  2QKP A;  3EGD C;  3F1P A;  2PDR A;  3P7N A;  1LSV A;  5KIZ A;  4BBV A;  4GCZ A;  3LID A;  2W1R A;  3BQA A;  4LRZ E;  3UME A;  5MC7 A;  4UEY A;  4GW9 A;  4IHQ A;  2EWV A;  3B42 A;  3CIT A;  2L1M A;  2VKS A;  4PAU A;  1OTA A;  1OTI A;  4CLC A;  2Z6C A;  3CUE C;  3LR4 A;  4R3A A;  2HV1 A;  2GNX A;  4HI4 A;  2VV6 A;  4Q0J A;  4G3K A;  4WL9 A;  2GX5 A;  4O01 A;  1W63 M;  1Y28 A;  3BW6 A;  5DFX A;  3E4P A;  3ICY A;  4LRY C;  4KUO A;  3KO6 A;  3PBN A;  5F69 A;  2R78 A;  1N9O A;  1F5M A;  4B93 A;  1MKM A;  5HPF A;  5HZH A;  4PKY G;  3F1N A;  4ME4 A;  4Q0H A;  2ZBB A;  2ZMF A;  2L0W A;  4DJ2 A;  4WEL A;  4MDZ A;  4Y2F A;  3TE8 A;  3OLO A;  1G6O A;  4OOM A;  1MZU A;  3EQU A;  4UQI M;  1XFN A;  2OOL A;  2J3W A;  3C8C A;  1XJ6 A;  5IS1 A;  2HF6 A;  4PHT A;  3LI8 A;  3BY8 A;  2VJW A;  5DKL A;  2O99 A;  1V9Z A;  2M1C A;  4IUK A;  3H82 B;  3PBR A;  1F98 A;  5DF9 A;  2VEA A;  2YKF A;  3CWF A;  2PD7 A;  2W1T A;  4GS9 A;  3E4O A;  1UGU A;  1OTE A;  5J3W A;  4JGQ A;  3LIB A;  1XJ2 A;  4GLQ A;  1NWZ A;  1T1C A;  3O5Y A;  4FOF A;  3MF0 A;  4BBU A;  2ZMV A;  4L0L A;  2OAP 1;  2OWJ A;  2A24 A;  2LB5 A;  1P0Z A;  2JN7 A;  4DMZ A;  3IBJ A;  4G3V A;  4MN7 A;  3RH8 B;  3ZQ5 A;  2J3T C;  4ZRR A;  4EEU A;  4Z1W A;  1IFQ A;  2MJ6 A;  3R7W B;  3S7P A;  1NRJ A;  1LSX A;  3MR0 A;  3RFB A;  3TRC A;  2B02 A;  1YSQ A;  4Q0I A;  4UQI S;  2JKR M;  2VGL S;  3G6O A;  3HJK A;  4R38 A;  5L8M A;  4NXG A;  4GJ4 A;  3K3D A;  1GSX A;  3LUQ A;  4KQO A;  3A0R A;  3UB8 A;  2J3T D;  4HJ4 A;  1VB6 A;  3VOL A;  5KSH A;  3JVV A;  5J7E A;  2EA9 A;  5HSQ A;  4K08 A;  4F3L A;  3A0V A;  3IBR A;  4HP9 A;  2OAQ 1;  3TW8 A;  5HDC A;  4HY8 A;  4ETZ A;  2M7U A;  2NUT C;  2PR6 A;  4RQ9 A;  1KOU A;  3EQV A;  1YSP A;  2QYB A;  4DN0 A;  3MFX A;  2VZW A;  4HJ6 A;  1S1Y A;  4EXO A;  3ULF A;  4BWI A;  2WKQ A;  4XT2 A;  4I3J A;  5CX7 A;  4HP4 A;  5TBM A;  2HJ9 C;  1BYW A;  1X0O A;  3EGX C;  1TS7 A;  2PR5 A;  3K2N A;  2JKT M;  3KYZ A;  1OPX A;  4P6Z M;  2P08 A;  4F3L B;  4NKP A;  4CLC C;  2B18 A;  4L9F A;  2CMN A;  4OOL A;  1DP9 A;  1H3Q A;  4CLC B;  3CLO A;  3MJQ A;  4L9G A;  3LIF A;  5EFW A;  3LR0 A;  4MMN A;  3U2A A;  1TD5 A;  4BBT A;  2D01 A;  1S67 L;  2K7S A;  1XJ4 A;  1OT6 A;  1TS8 A;  2G7U A;  1TF1 A;  3MMH A;  5G4Z A;  1T18 A;  1V9Y A;  2VV7 A;  2EWW A;  3T4L A;  5AVF A;  2JKT I;  4HQA A;  2QJ5 A;  2VX8 A;  2Y8H A;  3JVU A;  2PYR A;  4H6J B;  4Y3I A;  2A2L A;  5HD5 A;  2YKH A;  2QHK A;  1LT0 A;  4EU0 A;  3C2W A;  4WEJ A;  4EEP A;  2Y79 A;  4JGR A;  3LIC A;  2JHE A;  3D72 A;  3S7Q A;  1EW0 A;  3B47 A;  3T4S A;  4WF0 A;  2V1B A;  2Z6D A;  3T4J A;  3BQ8 A;  3KYQ A;  4HIA A;  5K5B A;  2XA7 M;  2PT7 A;  3B33 A;  1GSV A;  3R4K A;  1OTD A;  1N9N A;  4I38 A;  3HCY A;  2W3E A;  3DBA A;  4P6Z S;  3VV4 A;  4CQH A;  5G4Y A;  1DP8 A;  3NOT C;  3LFV A;  3NOU C;  4E04 A;  5LBR A;  3KSG A;  3PHY A;  4LLO B;  1DRM A;  3RTY A;  1NLZ A;  4O0P A;  4YNR A;  3F1O A;  2BAS A;  2O9A A;  3E4Q A;  1S4R A;  3C38 A;  4BJP A;  4GHI B;  3KX0 X;  3EEH A;  1STZ A;  1JNU A;  4Y5F A;  4NEE D;  3T50 A;  4NXF A;  2QWS A;  1IOU A;  4O8G A;  3PBT A;  3KSF A;  5F68 A;  4HH3 A;  5F6A A;  3KSI A;  1VHM A;  4ARZ A;  3W2Z A;  1G28 A;  3IS2 A;  2WKP A;  2VA0 A;  5J4E A;  5DKK A;  3S7O A;  3F1P B;  1GSW A;  1T19 A;  2XRN A;  1W63 Q;  4ETX A;  4YOF A;  3UB7 A;  4R70 A;  2VV8 A;  4CLC E;  4I5S A;  3MXQ A;  1DP6 A;  5AJG A;  1XFQ A;  3FC7 A;  2PD8 A;  1F9I A;  5TBM B;  3UB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...