2INWA

Crystal structure of q83jn9 from shigella flexneri at high resolution. northeast structural genomics consortium target sfr137.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
TLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGGELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative structural protein
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Structural genomics, unknown function
total genus 21
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2inwA01
3MR0A 2V1AA 3G6OA 4GW9A 5J3WA 5F5YA 3UE6A 3HJKA 4NXFA 3LI8A 5HWVA 2D01A 3BWLA 4KQDA 4H6JA 1WA9A 1X0OA 4F3LA 2A24A 3IS2B 4RQ9A 1OT9A 1T1CA 2VV6A 2GJ3A 1T1BA 1Y28A 4LLOB 4JGOA 2VLGA 2VV8A 1OTDA 4HH2A 4EQ1A 4JGQA 2QKPA 3NOUC 3LUQA 3F1NB 3GECA 3ULFA 4EEPA 2W27A 1OJ5A 5DJUA 1N9LA 4HHDA 3E4QA 2L1MA 1T1AA 3CLOA 1OJGA 5EFWA 5I5LA 4HQAA 4B9OA 3P7NA 2JHEA 1P97A 3RH8B 4BBUA 3FG8A 3PHYA 5HDDA 4MN5A 3ICYA 1OT6A 1F9IA 2KDKA 5DJTA 1S4SA 4HI4A 3ZQ5A 1XJ4A 1D06A 1TS7A 1TS6A 1XFNA 2V0UA 4GHIB 3LYXA 2QJ7A 4EXOA 2INWA 2HV1A 4LPZA 2ZBBA 3H82A 1BYWA 3FC7A 4R6LA 4BBVA 2M1CA 3LICA 4F3LB 4NXEA 1XFQA 4L9EA 4WL9A 1OTBA 3H7WA 4HJ4A 4I5SA 4DJ2A 2V1BA 5TBMB 2WKRA 3OLOA 1V9YA 4MN6A 3B33A 2CMNA 2PR6A 3UB6A 3LIFA 1T19A 4XT2A 4K08A 1GSXA 3VE3A 4LRXC 4JGRA 3H9WA 3NHQA 4HIAA 3KX0X 1DRMA 4I38A 4LRZE 1OTEA 3F1OA 3MJQA 1G28A 3VE4A 1S67L 2P7JA 4EETB 4LRYC 5AVFA 3RTYA 1V9ZA 2K7SA 3EEHA 3MQOA 1XJ6A 5DKLA 3K3CA 2PYPA 2ZOIA 1UWNX 5KIZA 2D02A 3LIAA 4EERA 3UB9A 2J80A 3UMDA 1P0ZA 3H7WB 5DKKA 1JNUA 2OOLA 4R70A 3A0SA 2PDRA 1N9NA 4WUJA 2Z6CA 3EWKA 2V9AA 4I3IA 1TS8A 4L9FA 3IS2A 4I39A 4XT2B 2PD7A 1S1ZA 3LIBA 5HD5A 3LI9A 4PKYA 3BY8A 2WKPA 5G4YA 2OWHA 1D7EA 4R3AA 2QHKA 4H6JB 2B02A 3CWFA 3F1NA 3C8CA 4KUOA 2A24B 3MFXA 3UB8A 2YKHA 2PR5A 4HP9A 1T18A 1VB6A 1XJ3A 2KX6A 4M4XA 4DJ3A 2V0WA 4EEUA 2ZOHA 4EW7A 2W0NA 5A8BA 1OTIA 4I3JA 5AVEA 1DP8A 1S4RA 3E4PA 1UGUA 2JN7A 3A0VA 2YKFA 3IBRA 3LIDA 3E4OA 1LSWA 2PD8A 5J4EA 3F1PA 4WN5A 5IU1A 2I9VA 4GHIA 3PYPA 4I3AA 2EA9A 3CAXA 1S1YA 4GS9A 4EESA 5F68A 1UWPX 3D72A 2QWSA 2VV7A 5J7EA 4HJ3A 5HWTA 4PKYG 2L0WA 4GCZA 5TBMA 1DP6A 3H82B 4BBTA 5F69A 1KOUA 4R38A 3MQQA 5HWWA 4JGPA 1GSWA 4WLAA 2OWJA 3MXQA 5IS1A 1F98A 1ODVA 4NXGA 3UB7A 2Z6DA 2PHYA 3SW1A 5HDSA 3NOPC 3BY9A 2R78A 1LL8A 2BASA 4KUKA 3C2WA 4HY8A 1N9OA 3NOTC 3T50A 3GDIA 4YWZA 3LIEA 4WF0A 5HSQA 3NJAA 4HOIA 1GSVA 2L4RA 3VOLA 3F1PB 1MZUA 3F1OB 3HJIA 1LSVA 2PYRA 2WKQA 1EW0A 3A0RA 5HDCA 4HJ6A 5HZHA 4GS9B 1LSXA 1NWZA 1S66L 1LT0A 4NXBA 3K3DA 4HNBA 2H28A 4HH3A 5G4ZA 2QJ5A 5HD3A 1OTAA 4HP4A 4L9GA 4E04A 1XJ2A 3UMEA 1DP9A 2VEAA 1TS0A 5F6AA
chains in the Genus database with same CATH superfamily
2H0TA 2V1AA 3G6OA 4KG2A 4O7DA 2V20A 3M6HA 3OPPA 4LV0A 3UE6A 1NZOA 2J3TD 3M6BA 5EV0A 4NXFA 1MXOA 4KQDA 3PBQA 4MBFA 4OQGA 4S2OA 3LR5A 5TJJA 3LFVA 5HAQA 1ACFA 3ZNTA 1WYBA 4N1HA 3OPHA 2OAP1 2QKPA 1ONHA 3NOUC 4U3TA 3GECA 5TGFA 1MY8A 1OJ5A 3NDGA 2XSSA 5GHXA 3MKFA 3MKEA 4YFMA 4BENA 1N9LA 1BLPA 3CPTA 1BULA 1ZTUA 1T1AA 5EFWA 3S22A 1TF1A 3MFDA 2JHEA 3FZCA 3FG8A 4PM5A 1YPRA 4GN2A 5HDDA 4BD1A 2RCXA 3IF5A 2KDKA 3OZHA 2WADA 2JE5A 3T4KA 1S4SA 3SS4A 3ZQ5A 1L3LA 1XPBA 1XXMA 3N8SA 1D06A 3W4PA 1HZOA 2P9VB 3T4JA 3VFFA 4GHIB 5HPIA 3LYXA 3V3RA 2HV1A 4LPZA 2ZBBA 4OKPA 1BYWA 1CQAA 1M40A 3MSHA 3IF6A 3IXGA 2M1CA 1DY6A 5HL1A 2R9WA 4WYYA 3H7WA 4KZ7A 1MKIA 1XGJA 1C3BA 3G2ZA 1RCJA 5F83A 4DJ2A 1YKDA 2Y59A 2WKRA 3OLOA 3VSKA 3BFDA 1T19A 3ISGA 2XGNA 4N9KA 4DE3A 2VZWA 3H9WA 3NHQA 5FDHA 5M1AA 4IUKA 3FPVA 3QP2A 3O86A 1K25A 3GMWA 5HL6A 3CJMA 4P6ZM 5J8XA 3Q81A 4LV2A 5EOEA 2IWDA 3IH8A 4ETZA 4JXVA 2Y2IA 3F1OA 1PZOA 1XA1A 1IELA 3VE4A 1ESUA 2IWCA 5EVID 5FAPA 4BLMA 5K5BA 5L10A 3K2NA 2XDMA 3GSGA 3LR4A 3IWQA 3BYDA 4Q0IA 3CUEA 4UA9A 1W5DA 3UO9A 2I72A 2HP6A 2PYPA 2H5SA 1BT5A 4WM9A 4DN0A 3EOIA 4QPRA 2D02A 4KZAA 5EVIC 4FOFA 4EERA 4BWIA 2ACGA 3UB9A 4MMNA 4CLCA 4IBRA 3UMDA 1KE3A 3MS6A 2HDUA 4KZ9A 3MZDA 5FSRA 4WUJA 5M19A 2EX2A 2ZQ8A 1L0EA 2A49A 4L9FA 2G7UA 1K4EA 4S2PA 4DDSA 3IS2A 1KDSA 1L0DA 3SZTA 2PD7A 5HARA 5HD5A 2XF3A 4CLCD 4E3OA 4G3KA 1FILA 4OONA 2WKPA 4QY5A 1IYOA 4X1MA 5GLDA 2QHKA 1TDLA 1EI5A 3CWFA 4MBHA 5AQ7A 4RA7A 2PAVP 4HP9A 1T18A 5DTKA 4OP5A 1IYQA 2B95A 2V0WA 4GD8A 1K54C 2AVXA 2Y2PA 1LHYA 2HDSA 2GDNA 3EQUA 1S4RA 1W8QA 3T4SA 4ZJ3A 3IHAA 2QZ6A 2YKFA 3ZVWA 4EUVA 1H8MA 3OCNA 1CK3A 3RXWA 4P6ZS 2OSUA 2PD8A 3GQZA 2HP5A 2LB5A 3UE3A 5IU1A 2I9VA 3PYPA 4I3AA 4BD0A 5A93A 4YNRA 2FH5A 2Y79A 3R4KA 2KLIA 5F68A 1UWPX 3D72A 4FH2A 5J7EA 3VOZA 4HJ3A 4FD8A 3ZG0A 1JVJA 2Q0OA 4S2NA 4PHTA 5DFXA 4PKYG 5EOOA 3IHBA 2O9BA 5L8MA 3IF6B 4HBTA 5E43A 2Y2MA 2ZM0A 1PZPA 2C5WB 4WLAA 5IS1A 1ODVA 3G34A 1ES5A 1ZKJA 4WEJA 2H10A 1MWUA 1E3UD 3AGFA 2UV0E 2RL3A 5KZHA 5JYOA 3LR3A 1K55A 2XFSA 5EVIB 4GZBA 4KUKA 3GTCA 3T1RA 1S0WA 4HY8A 3W8KA 4ZJ2A 5FASA 1QMEA 3GDIA 2Y2OA 4NKPA 4U0XA 4WF0A 2B5RA 3NULA 1AXBA 3NI9A 3HLGA 4PMAA 1HLUP 2HZ5A 3F1OB 3HJIA 2PYRA 2WKQA 3A0RA 3T4OA 2BTFP 2OLVA 2O9AA 4MLLA 3A3DA 1LSXA 1QMFA 4UAAA 3VP1A 1Y4OA 1S66L 3SH7A 3S7QA 3K3DA 3IBJA 5EM0A 1STZA 3DW0A 2QJ5A 3BM6A 1W79A 1WYCA 1NLZA 1G68A 4L9GA 1XJ2A 5L09A 2VEAA 3U4LP 1LLBA 4CLCB 5I94A 5J3WA 3RXXA 1ALQA 4WELA 2VX8A 4XUXA 3HJKA 5CECA 4HEFA 4D60A 1X0OA 3Q7ZA 4WZ4A 3IS2B 4RQ9A 5FEGA 1T1CA 3O3VA 1GCEA 3EEAA 1DJCA 1T1BA 1Y28A 1PFLA 2VV8A 2ZM2A 2JKGA 5BOHA 1OTDA 2B18A 2Y2HA 4HH2A 4N92A 1YQSA 2BG1A 2WKHA 4G3WA 5GLAA 3FV7A 3ULFA 4IBXA 4EEPA 1BTLA 4C75A 2W27A 1KE0A 1IKIA 3WS4A 2XEPA 4A5RA 3V5MA 3I7JA 4HHDA 3E4QA 1FSYA 3ITBA 4MDZA 4RX3A 2QMIA 4OP8A 2W3GA 4CLCE 4B9OA 1IKGA 3BFFA 1P97A 4QWOA 2JCHA 4PM6A 5FAOA 3RH8B 4BBUA 1KE4A 5CGSA 3TOIA 4MN5A 1OT6A 1TDGA 1F9IA 3VV4A 2Y2JA 1DJAA 3ZG7B 1FIKA 4FSFA 3Q82A 3Q1FA 3CI6A 3DWKA 1VEUA 1OMEA 5FQIA 1XFNA 4FCFA 4S2MA 5IHVA 4EXOA 3BJNA 2GZAA 1RGYA 3BQ8A 3TJZC 1E25A 1YMSA 1KGGA 3T4TA 4ZTKA 3PBTA 3Q07A 5E2GA 4JBFA 5CRFA 4F3LB 4NXEA 1XFQA 1K6SA 4F94A 4I5SA 3RFBA 3HL9A 4OVDA 3UE1A 2Y2QA 1PWGA 2LB9A 3IWIA 4MN6A 3BFGA 1CF0A 5HW3A 1K57C 2CMNA 3LIFA 2XR0A 1GSXA 4Y0UA 1LL9A 4WEKA 5CHMA 1YLTA 3IXHA 1L0FA 1WE4A 1JWVA 4CQHA 4E3NA 2ZC4B 3WRZA 3N7WA 3O5YA 3DAVA 2FFFB 3E2KA 3QNCA 1OTEA 3G4PA 3N8LA 3CITA 4B88A 4PM9A 3VFHA 2P7JA 5GLCA 5GHYA 4WZ5C 4EETB 4LRYC 5AVFA 3LEZA 4EU0A 2R9XA 3P01A 2K7SA 5FEFA 3EEHA 4HBUA 1IEMA 3VP0A 2WGVA 2DMWA 1KVLA 2Y4AA 3T1QB 4E3JA 3P09A 4JLFA 2PT7A 3MBZA 1YLPA 3HUOA 2K31A 4P85A 3FPWA 2HF6A 1BUEA 4S2LA 1JNUA 1K0KA 2OOLA 2ZMFA 1Q2QA 2PDRA 3E2LA 2ZM8A 2X71A 3HLFA 4I3IA 3MXRA 1TS8A 2VK3A 4OH0A 4XT2B 3IH9A 1H5XA 1S1ZA 4E6WA 3TSGA 5HFOA 4X53A 1PI4A 1KVMA 4PKYA 3EQVA 1N4OA 2P04A 4OOLA 4G3VA 1CI8A 2OLUA 2XD5A 1U60A 4Y7PA 1TD5A 2NUTC 4R3AA 4WBGA 3G31A 3BW6A 1ERMA 2J3WA 2Y8HA 4RYEA 3C8CA 4KUOA 3MFXA 2Q9NA 4EUZA 2PR5A 5EE8A 3HUNA 5FI6A 4UQIM 2HJ9C 3HREA 5JYPA 2V8FA 2ZOHA 3MZFA 4EW7A 2WZZA 4I3JA 5AVEA 1YMXA 3C5AA 1DP8A 1GHIA 5EVIA 4JXWA 2IA2A 4IJGA 1UGUA 3FWLA 3KSIA 4R4SA 3G2YA 5TFQA 4GNUA 3KSHA 4LCLA 5CTNA 2XFTA 1LSWA 2WUQA 3UDXA 2P08A 5CGXA 3PBOA 3UE0A 4JPMA 1W63M 3CAXA 2ZQCA 5CERA 4DRTA 4DXBA 5HAPA 2EXBA 2QWSA 2VV7A 4IUHA 1I2SA 1K6RA 4Z9QA 1K38A 1VEUB 1IYSA 4X56A 4OPZA 1HD8A 2WKIA 5F1GA 1DP6A 4UEYA 2OAQ1 3G30A 2P74A 1SCWA 3L9KA 5HWWA 4JGPA 4Y2FA 1K54A 4GDBA 3BLMA 4NXGA 3CHWP 3KSFA 5AQBA 3ZGAB 3SW1A 2PU2A 4MBKA 5CX7A 2A3UA 3DTKA 3OPLA 1MPLA 1IOUA 2Y2NA 1IFQA 3IXDA 4P87A 1CEFA 3E0YA 1NY0A 3NY4A 4KZBA 2HP9A 5EPHA 4FUWA 4DMZA 4MN7A 5HSQA 4HOIA 2QPNA 2PRFA 2XK1A 2FFYA 2WGWA 2O0YA 1MZUA 1ERQA 1ZG6A 1K56D 2W3FA 1XKZA 5DVAA 4PPRA 5HDCA 3W2ZA 2VGJA 3CG5A 3MXSA 4HJ6A 5HZHA 4UQIS 2ZL1A 2ZLYA 4ARZB 3ZNYA 2Y2KA 1LT0A 1H0MA 1K4FA 3PBRA 3MQ0A 3JYIA 2H28A 4HH3A 5G4ZA 1NRFA 1JTDA 4S2KA 5TR7A 1NLYA 3UPOA 5HD3A 3C7VA 4HP4A 2XRNA 4Y17A 5IT5A 4E04A 3IWOA 1DP9A 1MKMA 2WZXA 3MR0A 4GW9A 1F5MA 1YSQA 3A3FA 4QB8A 4XXRA 5CHJA 1YAXA 1FOFA 3DTIA 2Y2GA 4JXGA 5AJGA 3VP2A 3MZEA 2ZMVA 5HWVA 5FL3A 2D01A 2JBFA 1NXYA 4H6JA 1WA9A 1VETA 4F3LA 2A24A 1OT9A 2VV6A 1E3UA 2VLGA 2W3EA 4JGOA 5GL9A 1GA9A 2DNSA 2VGLM 4P0MA 4GD6A 4JF6A 1VQQA 3V39A 2W1RA 1G6AA 4IEDA 3JVVA 4E6XA 1KDWA 5FQ9A 2O99A 3T12B 3TW8A 5M18A 3CLOA 4O8GA 5I5LA 1JWZA 5HX9A 4KZ8A 1XX2A 5DTTA 3FYZA 3PHYA 3ZG5A 4B4ZA 3ICYA 1Z09A 3OOVA 2Z2MB 4ETXA 1CI9A 3T1XA 3PBSA 4LFUA 3D4FA 2ZC7A 3QP1A 2ZMAA 1XJ4A 1W7FA 3UDIA 4K0XA 1MWTA 3G32A 4DKIA 4KZ4A 4NK3A 1BLCA 3JVUA 2QJ7A 5E2EA 2INWA 1BSGA 4KENB 4H8RA 2JKTM 3H82A 4B4XA 1GHMA 4Y5FA 4RX2A 4R6LA 5EM1A 2PU4A 3ZCZA 4BBVA 1J3WA 3OPRA 4WL9A 1XP4A 2H0YA 1OTBA 2A2LA 4GB7A 1MWSA 5DTSA 4JKTA 4N9LA 4O0PA 2W1TB 1V9YA 1SKOA 3NBLA 1FCMA 2W3HA 2HJEA 5A92A 4XT2A 4K08A 4JGRA 2GNXA 3KX0X 1Z6FA 5HAIA 1SZVA 5FQQA 3B42A 4LRZE 3ITAA 4KQOA 2HDRA 2GX5A 3ZG8B 1G28A 3PR6A 3PTEA 5DF8A 1ZC2A 1S6RA 3A3JA 2WAEA 1ESIA 3RTYA 2VGLS 1V9ZA 3ZVTA 2WGWB 3MQOA 3LEQA 1XJ6A 4FH4A 3K3CA 3QP5A 3SOIA 1P9WA 2JKFA 2ZL1B 5KIZA 2HGVA 5F82A 3R7WA 1H8YA 4PM8A 2ZQ9A 1K57A 1Y54A 1P0ZA 4PAUA 4IVIA 1L2SA 2V2FF 5FQKA 1O07A 3V3SA 3C4OA 3A0SA 4UA6A 4U0TA 2V9AA 4DF6A 5FI7A 3GRJA 2KOIA 1D1JA 3KYEA 1LL5A 3UB5P 3LI9A 1N9BA 2JKRM 4AFIA 3SH9A 5LBRA 3D9YA 3LY3A 5G4YA 2OWHA 4LV3A 4Q0HA 4H6JB 4WZ5A 1NJ4A 3F1NA 1VETB 2Q9MA 1G5UA 2A24B 3UB8A 1VB6A 1FR6A 2KX6A 3B47A 4M4XA 3TE8A 4DJ3A 1PNEA 3A3IA 5L07A 4QY6A 4KG5A 3LCEA 1CJFA 3TRCA 2W0NA 1YLWA 2JKTI 3HUMA 3UNWA 5A8BA 3ZHHA 1ES4A 5FDSA 2OV5A 4LENA 4B93A 4GKUA 4E3LA 3RJUA 2E8JA 1A0KA 4CPKA 3IBRA 4Y3IA 1PWCA 3E4OA 3IX3A 5J4EA 3NECA 3IXBA 1XA7A 1MC0A 4FTXA 3UDFA 4X6TA 4ARZA 4KQQA 4EESA 2VGKA 3HLEA 4HESA 5KSHA 1PI5A 3S1YA 5CTMA 2HDQA 3AGDA 3DWZA 5KMWA 3VP4A 3BQAA 1KGEA 1YT4A 1NYMA 4DDYA 5HWTA 4R1GA 3KO6A 2EFXA 2L0WA 4GCZA 3P98A 5TBMA 3PBNA 4XUZA 3H82B 1BZAA 1KOUA 4M3KA 1H8ZA 2Y91A 2J3TC 3PXPA 1F98A 1FR1A 3WS5A 3UB7A 1YLJA 3VSLA 1TEMA 2Z6DA 4E3MA 2PHYA 3C30A 1SKOB 3BY9A 4Y15A 1LL8A 1I2WA 2J9OA 2ZC5B 3D3OA 3W4OA 1M6KA 3LGOA 3S7PA 3HLCA 3BFCA 4WMCA 1PYYA 1YSPA 2ZQAA 3T50A 4MCWA 5G18A 4YWZA 1ZHHB 3LIEA 1JTGA 2EWWA 3NJAA 5L2FA 5HPFA 5DF9A 1GSVA 5FA7A 3VOLA 3F1PB 4JF5A 4BQMA 3HBRA 4OLDA 3UY6A 1LSVA 2V8CA 3NC8A 1SDNA 4GJ4A 4OOMA 3HCYA 3DBAA 2IWBA 4S2JA 2DCFA 4GS9B 2JKRI 3GR2A 4R0QA 1PWDA 4WMCD 1MWRA 2ZC6B 4NXBA 3QNBA 4HNBA 3S7OA 5U47A 3QP6A 1LI9A 5FAQA 4P6BA 2EX6A 3LO7A 3QP4A 2Z2LB 5CEDA 3R7WB 3W4QA 2V1ZA 1TS0A 5F6AA 4GLQA 4R3BA 5F5YA 4NEED 3V50A 3SS5A 1LI0A 3LI8A 4GOGA 3BWLA 2J8YA 1H3QA 5CGWA 3AGEA 5C5KA 4OPYA 2GJ3A 3CMZA 4DE1A 4LLOB 4KZ6A 4BMWA 3VOYA 1EWZA 3GV9A 3C4PA 3IF6C 2W1TA 4EQ1A 3Q7VA 4JGQA 1XGIA 4QJGA 5EVLA 4BJPA 3LUQA 4JXSA 3F1NB 2M7VA 3BRMA 4II7A 4OQ0A 4UA7A 3OCLA 3WWXA 3G35A 5DJUA 2ZC3B 3CZDA 4E3KA 2G2WA 2L1MA 4PM7A 1OJGA 2XQZA 4HQAA 3P7NA 3V67A 2PBYA 3EGXC 5DF7A 3HLBA 1K56A 2WYXA 4UHUA 4R3JA 2W3DA 2BLSA 3UPPA 3S4XA 3FKWA 2VJWA 1I5QA 2XROA 5DJTA 1F2KA 4HI4A 3ZG9B 5KSCA 3SS3A 4R23A 3B3XA 1TS7A 3L7HA 1TS6A 3U2AA 2V0UA 1PW1A 3JPUA 4KG6A 3QHYA 1O7EA 3FC7A 4GDNA 2QYBA 1JWPA 1TVFA 1BLHA 3DTMA 3CUEC 3LICA 2Y55A 2XA7M 4L9EA 4D2OA 2UWXA 4OOYA 4HJ4A 3KYQA 4ME4A 2V1BA 4S2IA 5TBMB 4N1XA 5A90A 4O01A 3B33A 3BFEA 2CC1A 2JC7A 4CLCC 2PR6A 4NG2A 5FQMA 3UB6A 5D3OA 3UPNA 5CHUA 2MJ6A 5MC7A 3VE3A 4LRXC 5GHZA 2VKSA 3C7UA 3CPTB 4HIAA 4YOFA 1FCNA 1DRMA 1FCOA 3T1SA 4LGWA 4I38A 4X1LA 3VP3A 4K0WA 3HVFA 3WS0A 4EWFA 1NZUA 4X55A 4OPRA 1NYYA 5CXWA 2J9PA 3MJQA 1ES2A 2WK0A 3KYZA 1S67L 4ZJ1A 1SHVA 2FZ0A 1FSWA 2WAFA 2O9CA 4L0LA 1G6OA 4ESPA 4EBNA 4OQHA 4X68A 4C3QA 3N6IA 5DKLA 4C6YA 1J9MA 2C6WB 2ZOIA 1GA0A 3PAGA 5FATA 1UWNX 4ZAMA 3LIAA 3ZFZA 4OQIA 5A91A 1L0GA 2J80A 2EX9A 3H7WB 2NUPC 3FKVA 5DKKA 3WS2A 4KZ5A 4Y0OA 4ZBEA 4R70A 2WGIA 3BEBA 3QP8A 1GHPA 5AQ9A 4ID4A 1N9NA 2ZD8A 2Z6CA 3EWKA 3BLSA 1FQGA 2DRWA 4I39A 1IYPA 3LIBA 5AQAA 3WRTA 4K91A 1HTZA 3BY8A 4EBPA 3SH8A 1P9RA 2E8IA 3LR0A 3M2JA 1D7EA 3O88A 1EROA 3KSGA 1BLSA 4S2NC 4DXCA 2B02A 1E4DA 4E3IA 3OC2A 2YKHA 4JF4A 2XA7S 1XJ3A 4EBLA 3GVBA 3ZDJA 1NRJA 3C38A 3BECA 1PRQA 1W8YA 3Q7VB 4EEUA 1YM1A 3NIAA 3ZYTA 1YLYA 4Z1WA 2VA0A 4R4RA 1OTIA 1VM1A 4EQIA 1PIOA 3E4PA 3MF0A 3HLWA 3NDEA 1OPXA 1MBLA 4Y0TA 2JN7A 4DE2A 5EVEA 1K55C 5EUAA 3A0VA 3EGDC 3LIDA 3IX8A 2EWVA 3F1PA 2P9VA 4WN5A 4Q0JA 4GHIA 4IHQA 1SKFA 4ZDXA 3S7NA 2EA9A 1RGZA 1S1YA 4IVKA 4CJNA 4MNRA 4GS9A 2X01A 2XLNA 5GLBA 1KGFA 1RP5A 4OPQA 2ZQDA 3NCKA 4DE0A 1VHMA 4BBTA 1PW8A 5F69A 4OLGA 4R38A 4BL3A 3MQQA 2ZQ7A 5F1FA 4QHCA 1HVBA 3MMHA 3T4LA 1GSWA 2M7UA 2OWJA 3MXQA 4QD4A 1ONGA 3DTEA 3WS1A 1CEGA 4X25A 5HDSA 3NOPC 2R78A 4X69A 2BASA 3N8RA 3PAEA 1Q2PA 1DJBA 1ES3A 5DFYA 3E98A 2J7VA 2EX8A 2XD1A 3O87A 5CEBA 2G2UA 3C2WA 1ZG4A 4KZ3A 4KQRA 1YLZA 2WKEA 1N9OA 5FQJA 3NOTC 2HPBA 4YINA 4BL2A 5E2FA 3VMAA 1AWIA 3IQAA 2K2NA 2L4RA 5EECA 4MEZA 3LY4A 1EW0A 3IT9A 3UN7A 4RVAA 3M2KA 2X02A 5E2HA 4Q8IA 1NWZA 2PBDP 4EV4A 1W63Q 4QU3A 3TG9A 1SDEA 2Y2LA 2EFUA 5FI2A 2ZJ9A 4LCMA 4Y13A 4NETA 3IX4A 1OTAA 3N4IA 3T4QA 3A3EA 3OBFA 2XH9A 4LV1A 3UMEA 2EXAA 3HLDA 4ZRRA
chains in the Genus database with same CATH topology
3MR0A 2V1AA 1F5MA 3G6OA 4GW9A 4GLQA 5J3WA 5F5YA 1YSQA 4NEED 4WELA 3UE6A 2VX8A 1YAXA 5AJGA 2J3TD 3HJKA 2ZMVA 3LI8A 4NXFA 5HWVA 5FL3A 2D01A 3BWLA 4KQDA 3PBQA 4H6JA 1H3QA 1WA9A 1X0OA 5C5KA 4F3LA 2A24A 3IS2B 4RQ9A 1OT9A 1T1CA 2VV6A 3EEAA 2GJ3A 1T1BA 1Y28A 4LLOB 3LR5A 4JGOA 2VLGA 2W3EA 4BMWA 5TJJA 2VV8A 3LFVA 2W1TA 1OTDA 2B18A 4HH2A 4EQ1A 4JGQA 2OAP1 2QKPA 2VGLM 4BJPA 3NOUC 4G3WA 3LUQA 3F1NB 2M7VA 3GECA 3ULFA 4II7A 4EEPA 2W1RA 2W27A 1OJ5A 3OCLA 2XSSA 5DJUA 1N9LA 4HHDA 3E4QA 3JVVA 2O99A 4MDZA 3TW8A 2L1MA 1ZTUA 1T1AA 3CLOA 1OJGA 4O8GA 2W3GA 5EFWA 5I5LA 4HQAA 4CLCE 4B9OA 1TF1A 3P7NA 3V67A 3EGXC 2JHEA 1P97A 3RH8B 4BBUA 3FG8A 3PHYA 5HDDA 4MN5A 2W3DA 3ICYA 1OT6A 1F9IA 3OOVA 3VV4A 2VJWA 2KDKA 2XROA 5DJTA 4ETXA 3T4KA 3PBSA 1S4SA 4HI4A 3ZQ5A 4FSFA 1XJ4A 3CI6A 1D06A 1TS7A 1TS6A 1XFNA 2V0UA 3U2AA 3T4JA 4GHIB 5HPIA 3JVUA 3LYXA 2QJ7A 4EXOA 3BJNA 2INWA 2GZAA 2HV1A 3BQ8A 3TJZC 4LPZA 2JKTM 2ZBBA 3H82A 1BYWA 4Y5FA 3FC7A 3T4TA 3PBTA 4R6LA 2QYBA 4BBVA 2M1CA 3CUEC 3LICA 4F3LB 2XA7M 4NXEA 1XFQA 4L9EA 4WL9A 1OTBA 3H7WA 2A2LA 4HJ4A 4I5SA 3RFBA 3KYQA 4ME4A 4DJ2A 2V1BA 5TBMB 1YKDA 2LB9A 2WKRA 4O0PA 3OLOA 2W1TB 1V9YA 4MN6A 3B33A 4O01A 2CMNA 4CLCC 2PR6A 3UB6A 2W3HA 3LIFA 2HJEA 1T19A 2MJ6A 4XT2A 4K08A 1GSXA 4WEKA 5MC7A 3VE3A 4LRXC 2VZWA 4JGRA 3H9WA 3NHQA 2VKSA 4IUKA 2GNXA 3FPVA 4HIAA 4YOFA 3KX0X 4CQHA 1DRMA 5HL6A 4I38A 3B42A 3O5YA 4P6ZM 4LRZE 1OTEA 4KQOA 4ETZA 2GX5A 3CITA 3F1OA 3MJQA 1G28A 3PR6A 3VE4A 5K5BA 3KYZA 1S67L 2P7JA 2FZ0A 4EETB 4LRYC 3K2NA 5AVFA 2O9CA 3RTYA 4L0LA 2VGLS 1V9ZA 4EU0A 3P01A 2K7SA 3LR4A 1G6OA 3EEHA 3MQOA 1XJ6A 4Q0IA 5DKLA 3CUEA 3K3CA 2PYPA 2ZOIA 1P9WA 2DMWA 1UWNX 4DN0A 3EOIA 4QPRA 5KIZA 2D02A 3LIAA 2HGVA 4FOFA 3R7WA 2PT7A 4EERA 4BWIA 3UB9A 2K31A 2J80A 3FPWA 4MMNA 4CLCA 3UMDA 1P0ZA 2HF6A 3H7WB 4PAUA 2NUPC 5DKKA 1JNUA 2OOLA 2ZMFA 4R70A 3A0SA 2PDRA 1N9NA 4WUJA 2Z6CA 3EWKA 2V9AA 4I3IA 1TS8A 4L9FA 2G7UA 2KOIA 3IS2A 4I39A 4XT2B 2PD7A 1S1ZA 3LIBA 5HD5A 3LI9A 4CLCD 2JKRM 4AFIA 4PKYA 3EQVA 5LBRA 4G3KA 2P04A 4OOLA 3BY8A 4G3VA 2WKPA 5G4YA 2OWHA 1P9RA 3LR0A 1TD5A 1D7EA 2NUTC 4R3AA 3BW6A 3KSGA 4Q0HA 2QHKA 4H6JB 2J3WA 2Y8HA 2B02A 3CWFA 3F1NA 3OC2A 3C8CA 4KUOA 2A24B 3MFXA 3UB8A 2YKHA 2PR5A 2XA7S 4HP9A 1T18A 1VB6A 1XJ3A 2KX6A 3B47A 4M4XA 3TE8A 4DJ3A 1NRJA 4UQIM 3C38A 2HJ9C 2V0WA 4EEUA 2ZOHA 3ZYTA 4EW7A 4Z1WA 2W0NA 3TRCA 2JKTI 2VA0A 5A8BA 1OTIA 4I3JA 5AVEA 1DP8A 4B93A 3EQUA 1S4RA 3E4PA 2IA2A 3MF0A 4IJGA 3T4SA 1UGUA 1OPXA 3KSIA 2JN7A 3A0VA 2YKFA 4EUVA 3EGDC 1H8MA 3KSHA 3IBRA 3LIDA 3OCNA 4Y3IA 3E4OA 4P6ZS 1LSWA 2PD8A 2EWVA 2LB5A 3F1PA 5J4EA 4WN5A 3UE3A 4Q0JA 5IU1A 2I9VA 2P08A 4GHIA 3PYPA 4I3AA 1MC0A 4IHQA 3PBOA 3S7NA 2EA9A 1W63M 3CAXA 1S1YA 4YNRA 2FH5A 2Y79A 4GS9A 4ARZA 5KSHA 3R4KA 4EESA 2KLIA 5F68A 1UWPX 3D72A 2QWSA 2VV7A 4IUHA 3BQAA 5J7EA 4HJ3A 5HWTA 3KO6A 4PHTA 5DFXA 2L0WA 4PKYG 4GCZA 5TBMA 1DP6A 3PBNA 4UEYA 2OAQ1 3H82B 1VHMA 4BBTA 2O9BA 5F69A 1KOUA 4R38A 3MQQA 5L8MA 5HWWA 3MMHA 4JGPA 4Y2FA 2J3TC 3T4LA 1GSWA 4WLAA 2M7UA 2OWJA 3MXQA 3PXPA 1F98A 5IS1A 1ODVA 4NXGA 3UB7A 3KSFA 4WEJA 2Z6DA 2PHYA 3SW1A 3C30A 5HDSA 3NOPC 3BY9A 2R78A 1LL8A 2BASA 5CX7A 3D3OA 5DFYA 3E98A 3LR3A 1IOUA 1IFQA 4KUKA 3S7PA 3C2WA 4HY8A 1N9OA 3E0YA 3NOTC 1YSPA 3T50A 4MCWA 3GDIA 4YWZA 1ZHHB 3LIEA 4DMZA 4MN7A 4NKPA 4WF0A 2EWWA 3NJAA 5HSQA 4HOIA 5HPFA 5DF9A 1GSVA 2K2NA 2L4RA 2O0YA 3VOLA 3F1PB 1MZUA 2W3FA 3F1OB 3HJIA 1LSVA 2PYRA 2WKQA 1EW0A 4GJ4A 3A0RA 3HCYA 3DBAA 4OOMA 4HJ6A 5HDCA 3T4OA 3W2ZA 5HZHA 2O9AA 4UQIS 4GS9B 4ARZB 2JKRI 1LSXA 1NWZA 1S66L 1LT0A 4NXBA 3K3DA 3S7QA 3PBRA 1W63Q 4HNBA 3MQ0A 2H28A 4HH3A 3IBJA 5G4ZA 3S7OA 1STZA 2QJ5A 1NLYA 5HD3A 1OTAA 4HP4A 1NLZA 2XRNA 5IT5A 4L9GA 4E04A 1XJ2A 3T4QA 3OBFA 3R7WB 3UMEA 1DP9A 1MKMA 2VEAA 1TS0A 4ZRRA 4CLCB 5F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MR0 A;  2V1A A;  3G6O A;  4GW9 A;  5J3W A;  5F5Y A;  3UE6 A;  3HJK A;  4NXF A;  3LI8 A;  5HWV A;  2D01 A;  3BWL A;  4KQD A;  4H6J A;  1WA9 A;  1X0O A;  4F3L A;  2A24 A;  3IS2 B;  4RQ9 A;  1OT9 A;  1T1C A;  2VV6 A;  2GJ3 A;  1T1B A;  1Y28 A;  4LLO B;  4JGO A;  2VLG A;  2VV8 A;  1OTD A;  4HH2 A;  4EQ1 A;  4JGQ A;  2QKP A;  3NOU C;  3LUQ A;  3F1N B;  3GEC A;  3ULF A;  4EEP A;  2W27 A;  1OJ5 A;  5DJU A;  1N9L A;  4HHD A;  3E4Q A;  2L1M A;  1T1A A;  3CLO A;  1OJG A;  5EFW A;  5I5L A;  4HQA A;  4B9O A;  3P7N A;  2JHE A;  1P97 A;  3RH8 B;  4BBU A;  3FG8 A;  3PHY A;  5HDD A;  4MN5 A;  3ICY A;  1OT6 A;  1F9I A;  2KDK A;  5DJT A;  1S4S A;  4HI4 A;  3ZQ5 A;  1XJ4 A;  1D06 A;  1TS7 A;  1TS6 A;  1XFN A;  2V0U A;  4GHI B;  3LYX A;  2QJ7 A;  4EXO A;  2INW A;  2HV1 A;  4LPZ A;  2ZBB A;  3H82 A;  1BYW A;  3FC7 A;  4R6L A;  4BBV A;  2M1C A;  3LIC A;  4F3L B;  4NXE A;  1XFQ A;  4L9E A;  4WL9 A;  1OTB A;  3H7W A;  4HJ4 A;  4I5S A;  4DJ2 A;  2V1B A;  5TBM B;  2WKR A;  3OLO A;  1V9Y A;  4MN6 A;  3B33 A;  2CMN A;  2PR6 A;  3UB6 A;  3LIF A;  1T19 A;  4XT2 A;  4K08 A;  1GSX A;  3VE3 A;  4LRX C;  4JGR A;  3H9W A;  3NHQ A;  4HIA A;  3KX0 X;  1DRM A;  4I38 A;  4LRZ E;  1OTE A;  3F1O A;  3MJQ A;  1G28 A;  3VE4 A;  1S67 L;  2P7J A;  4EET B;  4LRY C;  5AVF A;  3RTY A;  1V9Z A;  2K7S A;  3EEH A;  3MQO A;  1XJ6 A;  5DKL A;  3K3C A;  2PYP A;  2ZOI A;  1UWN X;  5KIZ A;  2D02 A;  3LIA A;  4EER A;  3UB9 A;  2J80 A;  3UMD A;  1P0Z A;  3H7W B;  5DKK A;  1JNU A;  2OOL A;  4R70 A;  3A0S A;  2PDR A;  1N9N A;  4WUJ A;  2Z6C A;  3EWK A;  2V9A A;  4I3I A;  1TS8 A;  4L9F A;  3IS2 A;  4I39 A;  4XT2 B;  2PD7 A;  1S1Z A;  3LIB A;  5HD5 A;  3LI9 A;  4PKY A;  3BY8 A;  2WKP A;  5G4Y A;  2OWH A;  1D7E A;  4R3A A;  2QHK A;  4H6J B;  2B02 A;  3CWF A;  3F1N A;  3C8C A;  4KUO A;  2A24 B;  3MFX A;  3UB8 A;  2YKH A;  2PR5 A;  4HP9 A;  1T18 A;  1VB6 A;  1XJ3 A;  2KX6 A;  4M4X A;  4DJ3 A;  2V0W A;  4EEU A;  2ZOH A;  4EW7 A;  2W0N A;  5A8B A;  1OTI A;  4I3J A;  5AVE A;  1DP8 A;  1S4R A;  3E4P A;  1UGU A;  2JN7 A;  3A0V A;  2YKF A;  3IBR A;  3LID A;  3E4O A;  1LSW A;  2PD8 A;  5J4E A;  3F1P A;  4WN5 A;  5IU1 A;  2I9V A;  4GHI A;  3PYP A;  4I3A A;  2EA9 A;  3CAX A;  1S1Y A;  4GS9 A;  4EES A;  5F68 A;  1UWP X;  3D72 A;  2QWS A;  2VV7 A;  5J7E A;  4HJ3 A;  5HWT A;  4PKY G;  2L0W A;  4GCZ A;  5TBM A;  1DP6 A;  3H82 B;  4BBT A;  5F69 A;  1KOU A;  4R38 A;  3MQQ A;  5HWW A;  4JGP A;  1GSW A;  4WLA A;  2OWJ A;  3MXQ A;  5IS1 A;  1F98 A;  1ODV A;  4NXG A;  3UB7 A;  2Z6D A;  2PHY A;  3SW1 A;  5HDS A;  3NOP C;  3BY9 A;  2R78 A;  1LL8 A;  2BAS A;  4KUK A;  3C2W A;  4HY8 A;  1N9O A;  3NOT C;  3T50 A;  3GDI A;  4YWZ A;  3LIE A;  4WF0 A;  5HSQ A;  3NJA A;  4HOI A;  1GSV A;  2L4R A;  3VOL A;  3F1P B;  1MZU A;  3F1O B;  3HJI A;  1LSV A;  2PYR A;  2WKQ A;  1EW0 A;  3A0R A;  5HDC A;  4HJ6 A;  5HZH A;  4GS9 B;  1LSX A;  1NWZ A;  1S66 L;  1LT0 A;  4NXB A;  3K3D A;  4HNB A;  2H28 A;  4HH3 A;  5G4Z A;  2QJ5 A;  5HD3 A;  1OTA A;  4HP4 A;  4L9G A;  4E04 A;  1XJ2 A;  3UME A;  1DP9 A;  2VEA A;  1TS0 A;  5F6A A; 
#chains in the Genus database with same CATH topology
 2H0T A;  2V1A A;  3G6O A;  4KG2 A;  4O7D A;  2V20 A;  3M6H A;  3OPP A;  4LV0 A;  3UE6 A;  1NZO A;  2J3T D;  3M6B A;  5EV0 A;  4NXF A;  1MXO A;  4KQD A;  3PBQ A;  4MBF A;  4OQG A;  4S2O A;  3LR5 A;  5TJJ A;  3LFV A;  5HAQ A;  1ACF A;  3ZNT A;  1WYB A;  4N1H A;  3OPH A;  2OAP 1;  2QKP A;  1ONH A;  3NOU C;  4U3T A;  3GEC A;  5TGF A;  1MY8 A;  1OJ5 A;  3NDG A;  2XSS A;  5GHX A;  3MKF A;  3MKE A;  4YFM A;  4BEN A;  1N9L A;  1BLP A;  3CPT A;  1BUL A;  1ZTU A;  1T1A A;  5EFW A;  3S22 A;  1TF1 A;  3MFD A;  2JHE A;  3FZC A;  3FG8 A;  4PM5 A;  1YPR A;  4GN2 A;  5HDD A;  4BD1 A;  2RCX A;  3IF5 A;  2KDK A;  3OZH A;  2WAD A;  2JE5 A;  3T4K A;  1S4S A;  3SS4 A;  3ZQ5 A;  1L3L A;  1XPB A;  1XXM A;  3N8S A;  1D06 A;  3W4P A;  1HZO A;  2P9V B;  3T4J A;  3VFF A;  4GHI B;  5HPI A;  3LYX A;  3V3R A;  2HV1 A;  4LPZ A;  2ZBB A;  4OKP A;  1BYW A;  1CQA A;  1M40 A;  3MSH A;  3IF6 A;  3IXG A;  2M1C A;  1DY6 A;  5HL1 A;  2R9W A;  4WYY A;  3H7W A;  4KZ7 A;  1MKI A;  1XGJ A;  1C3B A;  3G2Z A;  1RCJ A;  5F83 A;  4DJ2 A;  1YKD A;  2Y59 A;  2WKR A;  3OLO A;  3VSK A;  3BFD A;  1T19 A;  3ISG A;  2XGN A;  4N9K A;  4DE3 A;  2VZW A;  3H9W A;  3NHQ A;  5FDH A;  5M1A A;  4IUK A;  3FPV A;  3QP2 A;  3O86 A;  1K25 A;  3GMW A;  5HL6 A;  3CJM A;  4P6Z M;  5J8X A;  3Q81 A;  4LV2 A;  5EOE A;  2IWD A;  3IH8 A;  4ETZ A;  4JXV A;  2Y2I A;  3F1O A;  1PZO A;  1XA1 A;  1IEL A;  3VE4 A;  1ESU A;  2IWC A;  5EVI D;  5FAP A;  4BLM A;  5K5B A;  5L10 A;  3K2N A;  2XDM A;  3GSG A;  3LR4 A;  3IWQ A;  3BYD A;  4Q0I A;  3CUE A;  4UA9 A;  1W5D A;  3UO9 A;  2I72 A;  2HP6 A;  2PYP A;  2H5S A;  1BT5 A;  4WM9 A;  4DN0 A;  3EOI A;  4QPR A;  2D02 A;  4KZA A;  5EVI C;  4FOF A;  4EER A;  4BWI A;  2ACG A;  3UB9 A;  4MMN A;  4CLC A;  4IBR A;  3UMD A;  1KE3 A;  3MS6 A;  2HDU A;  4KZ9 A;  3MZD A;  5FSR A;  4WUJ A;  5M19 A;  2EX2 A;  2ZQ8 A;  1L0E A;  2A49 A;  4L9F A;  2G7U A;  1K4E A;  4S2P A;  4DDS A;  3IS2 A;  1KDS A;  1L0D A;  3SZT A;  2PD7 A;  5HAR A;  5HD5 A;  2XF3 A;  4CLC D;  4E3O A;  4G3K A;  1FIL A;  4OON A;  2WKP A;  4QY5 A;  1IYO A;  4X1M A;  5GLD A;  2QHK A;  1TDL A;  1EI5 A;  3CWF A;  4MBH A;  5AQ7 A;  4RA7 A;  2PAV P;  4HP9 A;  1T18 A;  5DTK A;  4OP5 A;  1IYQ A;  2B95 A;  2V0W A;  4GD8 A;  1K54 C;  2AVX A;  2Y2P A;  1LHY A;  2HDS A;  2GDN A;  3EQU A;  1S4R A;  1W8Q A;  3T4S A;  4ZJ3 A;  3IHA A;  2QZ6 A;  2YKF A;  3ZVW A;  4EUV A;  1H8M A;  3OCN A;  1CK3 A;  3RXW A;  4P6Z S;  2OSU A;  2PD8 A;  3GQZ A;  2HP5 A;  2LB5 A;  3UE3 A;  5IU1 A;  2I9V A;  3PYP A;  4I3A A;  4BD0 A;  5A93 A;  4YNR A;  2FH5 A;  2Y79 A;  3R4K A;  2KLI A;  5F68 A;  1UWP X;  3D72 A;  4FH2 A;  5J7E A;  3VOZ A;  4HJ3 A;  4FD8 A;  3ZG0 A;  1JVJ A;  2Q0O A;  4S2N A;  4PHT A;  5DFX A;  4PKY G;  5EOO A;  3IHB A;  2O9B A;  5L8M A;  3IF6 B;  4HBT A;  5E43 A;  2Y2M A;  2ZM0 A;  1PZP A;  2C5W B;  4WLA A;  5IS1 A;  1ODV A;  3G34 A;  1ES5 A;  1ZKJ A;  4WEJ A;  2H10 A;  1MWU A;  1E3U D;  3AGF A;  2UV0 E;  2RL3 A;  5KZH A;  5JYO A;  3LR3 A;  1K55 A;  2XFS A;  5EVI B;  4GZB A;  4KUK A;  3GTC A;  3T1R A;  1S0W A;  4HY8 A;  3W8K A;  4ZJ2 A;  5FAS A;  1QME A;  3GDI A;  2Y2O A;  4NKP A;  4U0X A;  4WF0 A;  2B5R A;  3NUL A;  1AXB A;  3NI9 A;  3HLG A;  4PMA A;  1HLU P;  2HZ5 A;  3F1O B;  3HJI A;  2PYR A;  2WKQ A;  3A0R A;  3T4O A;  2BTF P;  2OLV A;  2O9A A;  4MLL A;  3A3D A;  1LSX A;  1QMF A;  4UAA A;  3VP1 A;  1Y4O A;  1S66 L;  3SH7 A;  3S7Q A;  3K3D A;  3IBJ A;  5EM0 A;  1STZ A;  3DW0 A;  2QJ5 A;  3BM6 A;  1W79 A;  1WYC A;  1NLZ A;  1G68 A;  4L9G A;  1XJ2 A;  5L09 A;  2VEA A;  3U4L P;  1LLB A;  4CLC B;  5I94 A;  5J3W A;  3RXX A;  1ALQ A;  4WEL A;  2VX8 A;  4XUX A;  3HJK A;  5CEC A;  4HEF A;  4D60 A;  1X0O A;  3Q7Z A;  4WZ4 A;  3IS2 B;  4RQ9 A;  5FEG A;  1T1C A;  3O3V A;  1GCE A;  3EEA A;  1DJC A;  1T1B A;  1Y28 A;  1PFL A;  2VV8 A;  2ZM2 A;  2JKG A;  5BOH A;  1OTD A;  2B18 A;  2Y2H A;  4HH2 A;  4N92 A;  1YQS A;  2BG1 A;  2WKH A;  4G3W A;  5GLA A;  3FV7 A;  3ULF A;  4IBX A;  4EEP A;  1BTL A;  4C75 A;  2W27 A;  1KE0 A;  1IKI A;  3WS4 A;  2XEP A;  4A5R A;  3V5M A;  3I7J A;  4HHD A;  3E4Q A;  1FSY A;  3ITB A;  4MDZ A;  4RX3 A;  2QMI A;  4OP8 A;  2W3G A;  4CLC E;  4B9O A;  1IKG A;  3BFF A;  1P97 A;  4QWO A;  2JCH A;  4PM6 A;  5FAO A;  3RH8 B;  4BBU A;  1KE4 A;  5CGS A;  3TOI A;  4MN5 A;  1OT6 A;  1TDG A;  1F9I A;  3VV4 A;  2Y2J A;  1DJA A;  3ZG7 B;  1FIK A;  4FSF A;  3Q82 A;  3Q1F A;  3CI6 A;  3DWK A;  1VEU A;  1OME A;  5FQI A;  1XFN A;  4FCF A;  4S2M A;  5IHV A;  4EXO A;  3BJN A;  2GZA A;  1RGY A;  3BQ8 A;  3TJZ C;  1E25 A;  1YMS A;  1KGG A;  3T4T A;  4ZTK A;  3PBT A;  3Q07 A;  5E2G A;  4JBF A;  5CRF A;  4F3L B;  4NXE A;  1XFQ A;  1K6S A;  4F94 A;  4I5S A;  3RFB A;  3HL9 A;  4OVD A;  3UE1 A;  2Y2Q A;  1PWG A;  2LB9 A;  3IWI A;  4MN6 A;  3BFG A;  1CF0 A;  5HW3 A;  1K57 C;  2CMN A;  3LIF A;  2XR0 A;  1GSX A;  4Y0U A;  1LL9 A;  4WEK A;  5CHM A;  1YLT A;  3IXH A;  1L0F A;  1WE4 A;  1JWV A;  4CQH A;  4E3N A;  2ZC4 B;  3WRZ A;  3N7W A;  3O5Y A;  3DAV A;  2FFF B;  3E2K A;  3QNC A;  1OTE A;  3G4P A;  3N8L A;  3CIT A;  4B88 A;  4PM9 A;  3VFH A;  2P7J A;  5GLC A;  5GHY A;  4WZ5 C;  4EET B;  4LRY C;  5AVF A;  3LEZ A;  4EU0 A;  2R9X A;  3P01 A;  2K7S A;  5FEF A;  3EEH A;  4HBU A;  1IEM A;  3VP0 A;  2WGV A;  2DMW A;  1KVL A;  2Y4A A;  3T1Q B;  4E3J A;  3P09 A;  4JLF A;  2PT7 A;  3MBZ A;  1YLP A;  3HUO A;  2K31 A;  4P85 A;  3FPW A;  2HF6 A;  1BUE A;  4S2L A;  1JNU A;  1K0K A;  2OOL A;  2ZMF A;  1Q2Q A;  2PDR A;  3E2L A;  2ZM8 A;  2X71 A;  3HLF A;  4I3I A;  3MXR A;  1TS8 A;  2VK3 A;  4OH0 A;  4XT2 B;  3IH9 A;  1H5X A;  1S1Z A;  4E6W A;  3TSG A;  5HFO A;  4X53 A;  1PI4 A;  1KVM A;  4PKY A;  3EQV A;  1N4O A;  2P04 A;  4OOL A;  4G3V A;  1CI8 A;  2OLU A;  2XD5 A;  1U60 A;  4Y7P A;  1TD5 A;  2NUT C;  4R3A A;  4WBG A;  3G31 A;  3BW6 A;  1ERM A;  2J3W A;  2Y8H A;  4RYE A;  3C8C A;  4KUO A;  3MFX A;  2Q9N A;  4EUZ A;  2PR5 A;  5EE8 A;  3HUN A;  5FI6 A;  4UQI M;  2HJ9 C;  3HRE A;  5JYP A;  2V8F A;  2ZOH A;  3MZF A;  4EW7 A;  2WZZ A;  4I3J A;  5AVE A;  1YMX A;  3C5A A;  1DP8 A;  1GHI A;  5EVI A;  4JXW A;  2IA2 A;  4IJG A;  1UGU A;  3FWL A;  3KSI A;  4R4S A;  3G2Y A;  5TFQ A;  4GNU A;  3KSH A;  4LCL A;  5CTN A;  2XFT A;  1LSW A;  2WUQ A;  3UDX A;  2P08 A;  5CGX A;  3PBO A;  3UE0 A;  4JPM A;  1W63 M;  3CAX A;  2ZQC A;  5CER A;  4DRT A;  4DXB A;  5HAP A;  2EXB A;  2QWS A;  2VV7 A;  4IUH A;  1I2S A;  1K6R A;  4Z9Q A;  1K38 A;  1VEU B;  1IYS A;  4X56 A;  4OPZ A;  1HD8 A;  2WKI A;  5F1G A;  1DP6 A;  4UEY A;  2OAQ 1;  3G30 A;  2P74 A;  1SCW A;  3L9K A;  5HWW A;  4JGP A;  4Y2F A;  1K54 A;  4GDB A;  3BLM A;  4NXG A;  3CHW P;  3KSF A;  5AQB A;  3ZGA B;  3SW1 A;  2PU2 A;  4MBK A;  5CX7 A;  2A3U A;  3DTK A;  3OPL A;  1MPL A;  1IOU A;  2Y2N A;  1IFQ A;  3IXD A;  4P87 A;  1CEF A;  3E0Y A;  1NY0 A;  3NY4 A;  4KZB A;  2HP9 A;  5EPH A;  4FUW A;  4DMZ A;  4MN7 A;  5HSQ A;  4HOI A;  2QPN A;  2PRF A;  2XK1 A;  2FFY A;  2WGW A;  2O0Y A;  1MZU A;  1ERQ A;  1ZG6 A;  1K56 D;  2W3F A;  1XKZ A;  5DVA A;  4PPR A;  5HDC A;  3W2Z A;  2VGJ A;  3CG5 A;  3MXS A;  4HJ6 A;  5HZH A;  4UQI S;  2ZL1 A;  2ZLY A;  4ARZ B;  3ZNY A;  2Y2K A;  1LT0 A;  1H0M A;  1K4F A;  3PBR A;  3MQ0 A;  3JYI A;  2H28 A;  4HH3 A;  5G4Z A;  1NRF A;  1JTD A;  4S2K A;  5TR7 A;  1NLY A;  3UPO A;  5HD3 A;  3C7V A;  4HP4 A;  2XRN A;  4Y17 A;  5IT5 A;  4E04 A;  3IWO A;  1DP9 A;  1MKM A;  2WZX A;  3MR0 A;  4GW9 A;  1F5M A;  1YSQ A;  3A3F A;  4QB8 A;  4XXR A;  5CHJ A;  1YAX A;  1FOF A;  3DTI A;  2Y2G A;  4JXG A;  5AJG A;  3VP2 A;  3MZE A;  2ZMV A;  5HWV A;  5FL3 A;  2D01 A;  2JBF A;  1NXY A;  4H6J A;  1WA9 A;  1VET A;  4F3L A;  2A24 A;  1OT9 A;  2VV6 A;  1E3U A;  2VLG A;  2W3E A;  4JGO A;  5GL9 A;  1GA9 A;  2DNS A;  2VGL M;  4P0M A;  4GD6 A;  4JF6 A;  1VQQ A;  3V39 A;  2W1R A;  1G6A A;  4IED A;  3JVV A;  4E6X A;  1KDW A;  5FQ9 A;  2O99 A;  3T12 B;  3TW8 A;  5M18 A;  3CLO A;  4O8G A;  5I5L A;  1JWZ A;  5HX9 A;  4KZ8 A;  1XX2 A;  5DTT A;  3FYZ A;  3PHY A;  3ZG5 A;  4B4Z A;  3ICY A;  1Z09 A;  3OOV A;  2Z2M B;  4ETX A;  1CI9 A;  3T1X A;  3PBS A;  4LFU A;  3D4F A;  2ZC7 A;  3QP1 A;  2ZMA A;  1XJ4 A;  1W7F A;  3UDI A;  4K0X A;  1MWT A;  3G32 A;  4DKI A;  4KZ4 A;  4NK3 A;  1BLC A;  3JVU A;  2QJ7 A;  5E2E A;  2INW A;  1BSG A;  4KEN B;  4H8R A;  2JKT M;  3H82 A;  4B4X A;  1GHM A;  4Y5F A;  4RX2 A;  4R6L A;  5EM1 A;  2PU4 A;  3ZCZ A;  4BBV A;  1J3W A;  3OPR A;  4WL9 A;  1XP4 A;  2H0Y A;  1OTB A;  2A2L A;  4GB7 A;  1MWS A;  5DTS A;  4JKT A;  4N9L A;  4O0P A;  2W1T B;  1V9Y A;  1SKO A;  3NBL A;  1FCM A;  2W3H A;  2HJE A;  5A92 A;  4XT2 A;  4K08 A;  4JGR A;  2GNX A;  3KX0 X;  1Z6F A;  5HAI A;  1SZV A;  5FQQ A;  3B42 A;  4LRZ E;  3ITA A;  4KQO A;  2HDR A;  2GX5 A;  3ZG8 B;  1G28 A;  3PR6 A;  3PTE A;  5DF8 A;  1ZC2 A;  1S6R A;  3A3J A;  2WAE A;  1ESI A;  3RTY A;  2VGL S;  1V9Z A;  3ZVT A;  2WGW B;  3MQO A;  3LEQ A;  1XJ6 A;  4FH4 A;  3K3C A;  3QP5 A;  3SOI A;  1P9W A;  2JKF A;  2ZL1 B;  5KIZ A;  2HGV A;  5F82 A;  3R7W A;  1H8Y A;  4PM8 A;  2ZQ9 A;  1K57 A;  1Y54 A;  1P0Z A;  4PAU A;  4IVI A;  1L2S A;  2V2F F;  5FQK A;  1O07 A;  3V3S A;  3C4O A;  3A0S A;  4UA6 A;  4U0T A;  2V9A A;  4DF6 A;  5FI7 A;  3GRJ A;  2KOI A;  1D1J A;  3KYE A;  1LL5 A;  3UB5 P;  3LI9 A;  1N9B A;  2JKR M;  4AFI A;  3SH9 A;  5LBR A;  3D9Y A;  3LY3 A;  5G4Y A;  2OWH A;  4LV3 A;  4Q0H A;  4H6J B;  4WZ5 A;  1NJ4 A;  3F1N A;  1VET B;  2Q9M A;  1G5U A;  2A24 B;  3UB8 A;  1VB6 A;  1FR6 A;  2KX6 A;  3B47 A;  4M4X A;  3TE8 A;  4DJ3 A;  1PNE A;  3A3I A;  5L07 A;  4QY6 A;  4KG5 A;  3LCE A;  1CJF A;  3TRC A;  2W0N A;  1YLW A;  2JKT I;  3HUM A;  3UNW A;  5A8B A;  3ZHH A;  1ES4 A;  5FDS A;  2OV5 A;  4LEN A;  4B93 A;  4GKU A;  4E3L A;  3RJU A;  2E8J A;  1A0K A;  4CPK A;  3IBR A;  4Y3I A;  1PWC A;  3E4O A;  3IX3 A;  5J4E A;  3NEC A;  3IXB A;  1XA7 A;  1MC0 A;  4FTX A;  3UDF A;  4X6T A;  4ARZ A;  4KQQ A;  4EES A;  2VGK A;  3HLE A;  4HES A;  5KSH A;  1PI5 A;  3S1Y A;  5CTM A;  2HDQ A;  3AGD A;  3DWZ A;  5KMW A;  3VP4 A;  3BQA A;  1KGE A;  1YT4 A;  1NYM A;  4DDY A;  5HWT A;  4R1G A;  3KO6 A;  2EFX A;  2L0W A;  4GCZ A;  3P98 A;  5TBM A;  3PBN A;  4XUZ A;  3H82 B;  1BZA A;  1KOU A;  4M3K A;  1H8Z A;  2Y91 A;  2J3T C;  3PXP A;  1F98 A;  1FR1 A;  3WS5 A;  3UB7 A;  1YLJ A;  3VSL A;  1TEM A;  2Z6D A;  4E3M A;  2PHY A;  3C30 A;  1SKO B;  3BY9 A;  4Y15 A;  1LL8 A;  1I2W A;  2J9O A;  2ZC5 B;  3D3O A;  3W4O A;  1M6K A;  3LGO A;  3S7P A;  3HLC A;  3BFC A;  4WMC A;  1PYY A;  1YSP A;  2ZQA A;  3T50 A;  4MCW A;  5G18 A;  4YWZ A;  1ZHH B;  3LIE A;  1JTG A;  2EWW A;  3NJA A;  5L2F A;  5HPF A;  5DF9 A;  1GSV A;  5FA7 A;  3VOL A;  3F1P B;  4JF5 A;  4BQM A;  3HBR A;  4OLD A;  3UY6 A;  1LSV A;  2V8C A;  3NC8 A;  1SDN A;  4GJ4 A;  4OOM A;  3HCY A;  3DBA A;  2IWB A;  4S2J A;  2DCF A;  4GS9 B;  2JKR I;  3GR2 A;  4R0Q A;  1PWD A;  4WMC D;  1MWR A;  2ZC6 B;  4NXB A;  3QNB A;  4HNB A;  3S7O A;  5U47 A;  3QP6 A;  1LI9 A;  5FAQ A;  4P6B A;  2EX6 A;  3LO7 A;  3QP4 A;  2Z2L B;  5CED A;  3R7W B;  3W4Q A;  2V1Z A;  1TS0 A;  5F6A A;  4GLQ A;  4R3B A;  5F5Y A;  4NEE D;  3V50 A;  3SS5 A;  1LI0 A;  3LI8 A;  4GOG A;  3BWL A;  2J8Y A;  1H3Q A;  5CGW A;  3AGE A;  5C5K A;  4OPY A;  2GJ3 A;  3CMZ A;  4DE1 A;  4LLO B;  4KZ6 A;  4BMW A;  3VOY A;  1EWZ A;  3GV9 A;  3C4P A;  3IF6 C;  2W1T A;  4EQ1 A;  3Q7V A;  4JGQ A;  1XGI A;  4QJG A;  5EVL A;  4BJP A;  3LUQ A;  4JXS A;  3F1N B;  2M7V A;  3BRM A;  4II7 A;  4OQ0 A;  4UA7 A;  3OCL A;  3WWX A;  3G35 A;  5DJU A;  2ZC3 B;  3CZD A;  4E3K A;  2G2W A;  2L1M A;  4PM7 A;  1OJG A;  2XQZ A;  4HQA A;  3P7N A;  3V67 A;  2PBY A;  3EGX C;  5DF7 A;  3HLB A;  1K56 A;  2WYX A;  4UHU A;  4R3J A;  2W3D A;  2BLS A;  3UPP A;  3S4X A;  3FKW A;  2VJW A;  1I5Q A;  2XRO A;  5DJT A;  1F2K A;  4HI4 A;  3ZG9 B;  5KSC A;  3SS3 A;  4R23 A;  3B3X A;  1TS7 A;  3L7H A;  1TS6 A;  3U2A A;  2V0U A;  1PW1 A;  3JPU A;  4KG6 A;  3QHY A;  1O7E A;  3FC7 A;  4GDN A;  2QYB A;  1JWP A;  1TVF A;  1BLH A;  3DTM A;  3CUE C;  3LIC A;  2Y55 A;  2XA7 M;  4L9E A;  4D2O A;  2UWX A;  4OOY A;  4HJ4 A;  3KYQ A;  4ME4 A;  2V1B A;  4S2I A;  5TBM B;  4N1X A;  5A90 A;  4O01 A;  3B33 A;  3BFE A;  2CC1 A;  2JC7 A;  4CLC C;  2PR6 A;  4NG2 A;  5FQM A;  3UB6 A;  5D3O A;  3UPN A;  5CHU A;  2MJ6 A;  5MC7 A;  3VE3 A;  4LRX C;  5GHZ A;  2VKS A;  3C7U A;  3CPT B;  4HIA A;  4YOF A;  1FCN A;  1DRM A;  1FCO A;  3T1S A;  4LGW A;  4I38 A;  4X1L A;  3VP3 A;  4K0W A;  3HVF A;  3WS0 A;  4EWF A;  1NZU A;  4X55 A;  4OPR A;  1NYY A;  5CXW A;  2J9P A;  3MJQ A;  1ES2 A;  2WK0 A;  3KYZ A;  1S67 L;  4ZJ1 A;  1SHV A;  2FZ0 A;  1FSW A;  2WAF A;  2O9C A;  4L0L A;  1G6O A;  4ESP A;  4EBN A;  4OQH A;  4X68 A;  4C3Q A;  3N6I A;  5DKL A;  4C6Y A;  1J9M A;  2C6W B;  2ZOI A;  1GA0 A;  3PAG A;  5FAT A;  1UWN X;  4ZAM A;  3LIA A;  3ZFZ A;  4OQI A;  5A91 A;  1L0G A;  2J80 A;  2EX9 A;  3H7W B;  2NUP C;  3FKV A;  5DKK A;  3WS2 A;  4KZ5 A;  4Y0O A;  4ZBE A;  4R70 A;  2WGI A;  3BEB A;  3QP8 A;  1GHP A;  5AQ9 A;  4ID4 A;  1N9N A;  2ZD8 A;  2Z6C A;  3EWK A;  3BLS A;  1FQG A;  2DRW A;  4I39 A;  1IYP A;  3LIB A;  5AQA A;  3WRT A;  4K91 A;  1HTZ A;  3BY8 A;  4EBP A;  3SH8 A;  1P9R A;  2E8I A;  3LR0 A;  3M2J A;  1D7E A;  3O88 A;  1ERO A;  3KSG A;  1BLS A;  4S2N C;  4DXC A;  2B02 A;  1E4D A;  4E3I A;  3OC2 A;  2YKH A;  4JF4 A;  2XA7 S;  1XJ3 A;  4EBL A;  3GVB A;  3ZDJ A;  1NRJ A;  3C38 A;  3BEC A;  1PRQ A;  1W8Y A;  3Q7V B;  4EEU A;  1YM1 A;  3NIA A;  3ZYT A;  1YLY A;  4Z1W A;  2VA0 A;  4R4R A;  1OTI A;  1VM1 A;  4EQI A;  1PIO A;  3E4P A;  3MF0 A;  3HLW A;  3NDE A;  1OPX A;  1MBL A;  4Y0T A;  2JN7 A;  4DE2 A;  5EVE A;  1K55 C;  5EUA A;  3A0V A;  3EGD C;  3LID A;  3IX8 A;  2EWV A;  3F1P A;  2P9V A;  4WN5 A;  4Q0J A;  4GHI A;  4IHQ A;  1SKF A;  4ZDX A;  3S7N A;  2EA9 A;  1RGZ A;  1S1Y A;  4IVK A;  4CJN A;  4MNR A;  4GS9 A;  2X01 A;  2XLN A;  5GLB A;  1KGF A;  1RP5 A;  4OPQ A;  2ZQD A;  3NCK A;  4DE0 A;  1VHM A;  4BBT A;  1PW8 A;  5F69 A;  4OLG A;  4R38 A;  4BL3 A;  3MQQ A;  2ZQ7 A;  5F1F A;  4QHC A;  1HVB A;  3MMH A;  3T4L A;  1GSW A;  2M7U A;  2OWJ A;  3MXQ A;  4QD4 A;  1ONG A;  3DTE A;  3WS1 A;  1CEG A;  4X25 A;  5HDS A;  3NOP C;  2R78 A;  4X69 A;  2BAS A;  3N8R A;  3PAE A;  1Q2P A;  1DJB A;  1ES3 A;  5DFY A;  3E98 A;  2J7V A;  2EX8 A;  2XD1 A;  3O87 A;  5CEB A;  2G2U A;  3C2W A;  1ZG4 A;  4KZ3 A;  4KQR A;  1YLZ A;  2WKE A;  1N9O A;  5FQJ A;  3NOT C;  2HPB A;  4YIN A;  4BL2 A;  5E2F A;  3VMA A;  1AWI A;  3IQA A;  2K2N A;  2L4R A;  5EEC A;  4MEZ A;  3LY4 A;  1EW0 A;  3IT9 A;  3UN7 A;  4RVA A;  3M2K A;  2X02 A;  5E2H A;  4Q8I A;  1NWZ A;  2PBD P;  4EV4 A;  1W63 Q;  4QU3 A;  3TG9 A;  1SDE A;  2Y2L A;  2EFU A;  5FI2 A;  2ZJ9 A;  4LCM A;  4Y13 A;  4NET A;  3IX4 A;  1OTA A;  3N4I A;  3T4Q A;  3A3E A;  3OBF A;  2XH9 A;  4LV1 A;  3UME A;  2EXA A;  3HLD A;  4ZRR A; 
#chains in the Genus database with same CATH homology
 3MR0 A;  2V1A A;  1F5M A;  3G6O A;  4GW9 A;  4GLQ A;  5J3W A;  5F5Y A;  1YSQ A;  4NEE D;  4WEL A;  3UE6 A;  2VX8 A;  1YAX A;  5AJG A;  2J3T D;  3HJK A;  2ZMV A;  3LI8 A;  4NXF A;  5HWV A;  5FL3 A;  2D01 A;  3BWL A;  4KQD A;  3PBQ A;  4H6J A;  1H3Q A;  1WA9 A;  1X0O A;  5C5K A;  4F3L A;  2A24 A;  3IS2 B;  4RQ9 A;  1OT9 A;  1T1C A;  2VV6 A;  3EEA A;  2GJ3 A;  1T1B A;  1Y28 A;  4LLO B;  3LR5 A;  4JGO A;  2VLG A;  2W3E A;  4BMW A;  5TJJ A;  2VV8 A;  3LFV A;  2W1T A;  1OTD A;  2B18 A;  4HH2 A;  4EQ1 A;  4JGQ A;  2OAP 1;  2QKP A;  2VGL M;  4BJP A;  3NOU C;  4G3W A;  3LUQ A;  3F1N B;  2M7V A;  3GEC A;  3ULF A;  4II7 A;  4EEP A;  2W1R A;  2W27 A;  1OJ5 A;  3OCL A;  2XSS A;  5DJU A;  1N9L A;  4HHD A;  3E4Q A;  3JVV A;  2O99 A;  4MDZ A;  3TW8 A;  2L1M A;  1ZTU A;  1T1A A;  3CLO A;  1OJG A;  4O8G A;  2W3G A;  5EFW A;  5I5L A;  4HQA A;  4CLC E;  4B9O A;  1TF1 A;  3P7N A;  3V67 A;  3EGX C;  2JHE A;  1P97 A;  3RH8 B;  4BBU A;  3FG8 A;  3PHY A;  5HDD A;  4MN5 A;  2W3D A;  3ICY A;  1OT6 A;  1F9I A;  3OOV A;  3VV4 A;  2VJW A;  2KDK A;  2XRO A;  5DJT A;  4ETX A;  3T4K A;  3PBS A;  1S4S A;  4HI4 A;  3ZQ5 A;  4FSF A;  1XJ4 A;  3CI6 A;  1D06 A;  1TS7 A;  1TS6 A;  1XFN A;  2V0U A;  3U2A A;  3T4J A;  4GHI B;  5HPI A;  3JVU A;  3LYX A;  2QJ7 A;  4EXO A;  3BJN A;  2INW A;  2GZA A;  2HV1 A;  3BQ8 A;  3TJZ C;  4LPZ A;  2JKT M;  2ZBB A;  3H82 A;  1BYW A;  4Y5F A;  3FC7 A;  3T4T A;  3PBT A;  4R6L A;  2QYB A;  4BBV A;  2M1C A;  3CUE C;  3LIC A;  4F3L B;  2XA7 M;  4NXE A;  1XFQ A;  4L9E A;  4WL9 A;  1OTB A;  3H7W A;  2A2L A;  4HJ4 A;  4I5S A;  3RFB A;  3KYQ A;  4ME4 A;  4DJ2 A;  2V1B A;  5TBM B;  1YKD A;  2LB9 A;  2WKR A;  4O0P A;  3OLO A;  2W1T B;  1V9Y A;  4MN6 A;  3B33 A;  4O01 A;  2CMN A;  4CLC C;  2PR6 A;  3UB6 A;  2W3H A;  3LIF A;  2HJE A;  1T19 A;  2MJ6 A;  4XT2 A;  4K08 A;  1GSX A;  4WEK A;  5MC7 A;  3VE3 A;  4LRX C;  2VZW A;  4JGR A;  3H9W A;  3NHQ A;  2VKS A;  4IUK A;  2GNX A;  3FPV A;  4HIA A;  4YOF A;  3KX0 X;  4CQH A;  1DRM A;  5HL6 A;  4I38 A;  3B42 A;  3O5Y A;  4P6Z M;  4LRZ E;  1OTE A;  4KQO A;  4ETZ A;  2GX5 A;  3CIT A;  3F1O A;  3MJQ A;  1G28 A;  3PR6 A;  3VE4 A;  5K5B A;  3KYZ A;  1S67 L;  2P7J A;  2FZ0 A;  4EET B;  4LRY C;  3K2N A;  5AVF A;  2O9C A;  3RTY A;  4L0L A;  2VGL S;  1V9Z A;  4EU0 A;  3P01 A;  2K7S A;  3LR4 A;  1G6O A;  3EEH A;  3MQO A;  1XJ6 A;  4Q0I A;  5DKL A;  3CUE A;  3K3C A;  2PYP A;  2ZOI A;  1P9W A;  2DMW A;  1UWN X;  4DN0 A;  3EOI A;  4QPR A;  5KIZ A;  2D02 A;  3LIA A;  2HGV A;  4FOF A;  3R7W A;  2PT7 A;  4EER A;  4BWI A;  3UB9 A;  2K31 A;  2J80 A;  3FPW A;  4MMN A;  4CLC A;  3UMD A;  1P0Z A;  2HF6 A;  3H7W B;  4PAU A;  2NUP C;  5DKK A;  1JNU A;  2OOL A;  2ZMF A;  4R70 A;  3A0S A;  2PDR A;  1N9N A;  4WUJ A;  2Z6C A;  3EWK A;  2V9A A;  4I3I A;  1TS8 A;  4L9F A;  2G7U A;  2KOI A;  3IS2 A;  4I39 A;  4XT2 B;  2PD7 A;  1S1Z A;  3LIB A;  5HD5 A;  3LI9 A;  4CLC D;  2JKR M;  4AFI A;  4PKY A;  3EQV A;  5LBR A;  4G3K A;  2P04 A;  4OOL A;  3BY8 A;  4G3V A;  2WKP A;  5G4Y A;  2OWH A;  1P9R A;  3LR0 A;  1TD5 A;  1D7E A;  2NUT C;  4R3A A;  3BW6 A;  3KSG A;  4Q0H A;  2QHK A;  4H6J B;  2J3W A;  2Y8H A;  2B02 A;  3CWF A;  3F1N A;  3OC2 A;  3C8C A;  4KUO A;  2A24 B;  3MFX A;  3UB8 A;  2YKH A;  2PR5 A;  2XA7 S;  4HP9 A;  1T18 A;  1VB6 A;  1XJ3 A;  2KX6 A;  3B47 A;  4M4X A;  3TE8 A;  4DJ3 A;  1NRJ A;  4UQI M;  3C38 A;  2HJ9 C;  2V0W A;  4EEU A;  2ZOH A;  3ZYT A;  4EW7 A;  4Z1W A;  2W0N A;  3TRC A;  2JKT I;  2VA0 A;  5A8B A;  1OTI A;  4I3J A;  5AVE A;  1DP8 A;  4B93 A;  3EQU A;  1S4R A;  3E4P A;  2IA2 A;  3MF0 A;  4IJG A;  3T4S A;  1UGU A;  1OPX A;  3KSI A;  2JN7 A;  3A0V A;  2YKF A;  4EUV A;  3EGD C;  1H8M A;  3KSH A;  3IBR A;  3LID A;  3OCN A;  4Y3I A;  3E4O A;  4P6Z S;  1LSW A;  2PD8 A;  2EWV A;  2LB5 A;  3F1P A;  5J4E A;  4WN5 A;  3UE3 A;  4Q0J A;  5IU1 A;  2I9V A;  2P08 A;  4GHI A;  3PYP A;  4I3A A;  1MC0 A;  4IHQ A;  3PBO A;  3S7N A;  2EA9 A;  1W63 M;  3CAX A;  1S1Y A;  4YNR A;  2FH5 A;  2Y79 A;  4GS9 A;  4ARZ A;  5KSH A;  3R4K A;  4EES A;  2KLI A;  5F68 A;  1UWP X;  3D72 A;  2QWS A;  2VV7 A;  4IUH A;  3BQA A;  5J7E A;  4HJ3 A;  5HWT A;  3KO6 A;  4PHT A;  5DFX A;  2L0W A;  4PKY G;  4GCZ A;  5TBM A;  1DP6 A;  3PBN A;  4UEY A;  2OAQ 1;  3H82 B;  1VHM A;  4BBT A;  2O9B A;  5F69 A;  1KOU A;  4R38 A;  3MQQ A;  5L8M A;  5HWW A;  3MMH A;  4JGP A;  4Y2F A;  2J3T C;  3T4L A;  1GSW A;  4WLA A;  2M7U A;  2OWJ A;  3MXQ A;  3PXP A;  1F98 A;  5IS1 A;  1ODV A;  4NXG A;  3UB7 A;  3KSF A;  4WEJ A;  2Z6D A;  2PHY A;  3SW1 A;  3C30 A;  5HDS A;  3NOP C;  3BY9 A;  2R78 A;  1LL8 A;  2BAS A;  5CX7 A;  3D3O A;  5DFY A;  3E98 A;  3LR3 A;  1IOU A;  1IFQ A;  4KUK A;  3S7P A;  3C2W A;  4HY8 A;  1N9O A;  3E0Y A;  3NOT C;  1YSP A;  3T50 A;  4MCW A;  3GDI A;  4YWZ A;  1ZHH B;  3LIE A;  4DMZ A;  4MN7 A;  4NKP A;  4WF0 A;  2EWW A;  3NJA A;  5HSQ A;  4HOI A;  5HPF A;  5DF9 A;  1GSV A;  2K2N A;  2L4R A;  2O0Y A;  3VOL A;  3F1P B;  1MZU A;  2W3F A;  3F1O B;  3HJI A;  1LSV A;  2PYR A;  2WKQ A;  1EW0 A;  4GJ4 A;  3A0R A;  3HCY A;  3DBA A;  4OOM A;  4HJ6 A;  5HDC A;  3T4O A;  3W2Z A;  5HZH A;  2O9A A;  4UQI S;  4GS9 B;  4ARZ B;  2JKR I;  1LSX A;  1NWZ A;  1S66 L;  1LT0 A;  4NXB A;  3K3D A;  3S7Q A;  3PBR A;  1W63 Q;  4HNB A;  3MQ0 A;  2H28 A;  4HH3 A;  3IBJ A;  5G4Z A;  3S7O A;  1STZ A;  2QJ5 A;  1NLY A;  5HD3 A;  1OTA A;  4HP4 A;  1NLZ A;  2XRN A;  5IT5 A;  4L9G A;  4E04 A;  1XJ2 A;  3T4Q A;  3OBF A;  3R7W B;  3UME A;  1DP9 A;  1MKM A;  2VEA A;  1TS0 A;  4ZRR A;  4CLC B;  5F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...