2INWA

Crystal structure of q83jn9 from shigella flexneri at high resolution. northeast structural genomics consortium target sfr137.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
TLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGGELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Structural genomics, unknown function
molecule keywords Putative structural protein
total genus 21
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2inwA01
4E04A 2V0UA 3GECA 5HDSA 3UB9A 2D02A 4XT2B 2V1AA 3F1OA 4PKYG 4EERA 5HWTA 1WA9A 1S1ZA 4WN5A 4PKYA 4R38A 1OT6A 1P97A 1UWNX 4HIAA 1S66L 4F3LA 1OTEA 2JHEA 1OJGA 1OT9A 2YKFA 2KX6A 3CAXA 1DP9A 3MR0A 3LUQA 4WUJA 2Z6CA 3IS2A 5F6AA 3A0SA 3CLOA 3K3DA 3NHQA 1OJ5A 2GJ3A 3PHYA 4MN6A 3D72A 3PYPA 1S1YA 3OLOA 4HJ6A 1S67L 1LSVA 2A24B 1OTDA 3F1NB 3NOTC 3NOUC 3MQOA 3H9WA 2CMNA 1T18A 2D01A 3RTYA 1S4RA 3C8CA 3LIDA 4YWZA 4KQDA 2ZOHA 5TBMB 3VE4A 1KOUA 1TS8A 1OTBA 5HWVA 3BY9A 2VLGA 3LIAA 5HWWA 2Z6DA 4L9EA 2I9VA 3P7NA 5G4ZA 3EEHA 3MXQA 1JNUA 4WL9A 2W27A 1XJ3A 1T1BA 2M1CA 3IS2B 5F68A 5A8BA 2PD7A 1N9OA 4JGOA 4KUKA 4HHDA 1TS0A 1TS6A 4EEUA 4LLOB 5G4YA 3UB6A 1DRMA 1MZUA 2L4RA 1S4SA 3H82B 2A24A 4HJ4A 3FG8A 4I38A 5EFWA 4I5SA 3CWFA 3ICYA 2QKPA 5I5LA 2H28A 2WKPA 1ODVA 4BBVA 3LIEA 5DJUA 5DKKA 1XJ4A 1GSWA 3F1PA 4HNBA 2PDRA 4HH3A 4HJ3A 2OWHA 4HQAA 1GSVA 1XJ6A 3KX0X 4L9FA 4NXFA 4R70A 1UGUA 4LRZE 1OTIA 2VV7A 4H6JA 4JGQA 4RQ9A 5HDDA 4F3LB 4EXOA 5KIZA 4LPZA 2PR5A 3LIBA 4NXGA 1DP8A 1D06A 3H7WA 3RH8B 2PYPA 3F1OB 1V9ZA 4MN5A 4LRYC 1Y28A 4EESA 3A0RA 1LL8A 1T1AA 3SW1A 2V0WA 3G6OA 4HOIA 2PYRA 1V9YA 4LRXC 2L1MA 2QHKA 2VV6A 2PR6A 5IU1A 3A0VA 5AVFA 3UB8A 1GSXA 1XFQA 3ULFA 1LT0A 3LYXA 1P0ZA 2J80A 4WLAA 4GHIB 5TBMA 2HV1A 3UMEA 3UB7A 2PD8A 3BWLA 3NJAA 3T50A 2KDKA 4R3AA 1XFNA 2BASA 2P7JA 3GDIA 3LI8A 4HP9A 1F98A 2R78A 2WKQA 5DJTA 3VE3A 5HZHA 3E4PA 4KUOA 4I3AA 1NWZA 2VEAA 1OTAA 3E4QA 4DJ3A 2EA9A 1G28A 4HP4A 5DKLA 3UE6A 2B02A 1VB6A 4HH2A 1XJ2A 1BYWA 1LSWA 2OWJA 2V1BA 4HY8A 4M4XA 2PHYA 1N9LA 5HSQA 1T1CA 1X0OA 1EW0A 3MFXA 4I3JA 4I39A 3HJIA 4JGPA 5HD3A 2YKHA 2OOLA 2JN7A 2QJ5A 3LICA 4HI4A 4BBTA 3HJKA 3F1NA 5J3WA 3C2WA 1D7EA 1N9NA 4NXBA 3ZQ5A 2QJ7A 4L9GA 4EW7A 1T19A 3H7WB 3FC7A 5IS1A 3EWKA 2QWSA 5J7EA 2VV8A 3K3CA 4K08A 1F9IA 4H6JB 3LIFA 4GCZA 2INWA 4EEPA 4DJ2A 4XT2A 1LSXA 5HDCA 2V9AA 3B33A 3MJQA 3VOLA 4B9OA 2K7SA 4GS9B 2W0NA 4BBUA 4R6LA 5F69A 5AVEA 4JGRA 4NXEA 1TS7A 2ZOIA 1DP6A 4EQ1A 4GW9A 4GHIA 3NOPC 4WF0A 3IBRA 4EETB 4I3IA 5J4EA 5HD5A 3LI9A 3BY8A 3MQQA 2L0WA 3F1PB 1UWPX 2ZBBA 5F5YA 3UMDA 4GS9A 2WKRA 3E4OA 3H82A
chains in the Genus database with same CATH superfamily
5GLAA 2J3TD 4R38A 3O88A 1S66L 1K25A 2Z6CA 4CLCE 4MN6A 3OPLA 3BFCA 4K0XA 5HWVA 4N1HA 3WS1A 3EEHA 3HREA 3Q7VB 1W5DA 3A3JA 3NCKA 4E3KA 3Q7ZA 5GHYA 4R1GA 1BLPA 1Q2PA 3CG5A 4QWOA 3UN7A 1GSVA 1OTIA 4PM5A 4MBHA 1D06A 1DY6A 3NULA 1T1AA 1LL9A 2DRWA 4MDZA 4HOIA 2QYBA 2L1MA 3A0VA 3M6HA 4CLCB 1NXYA 3EEAA 1W7FA 5EECA 1ONGA 3KYZA 2BTFP 1N9BA 3PBTA 4JXGA 4DN0A 2V1ZA 4OQ0A 2HDUA 2OWJA 5CX7A 4E3LA 1ZKJA 1I2WA 3ZCZA 2OAQ1 2JN7A 1N9NA 5GL9A 1NRJA 4ESPA 5AQ9A 2INWA 3OPRA 4KZ7A 5HDCA 3QP8A 1BLCA 4EQ1A 4GW9A 5E2HA 3NOPC 2M7VA 2BLSA 4BD0A 4G3KA 5CGXA 2V8CA 1UWPX 1CQAA 1JTGA 4XXRA 5AJGA 1H3QA 2EWVA 2D02A 2VKSA 4ZJ3A 4OVDA 4RX2A 5KSHA 1YLTA 3PBSA 3N7WA 4NG2A 3UPNA 3ZVWA 4HBUA 1XP4A 3KYEA 4IUKA 4YWZA 3LIDA 3V3SA 3VE4A 4KZ3A 4Z9QA 2WADA 1RGZA 4L9EA 2I9VA 3V50A 2W27A 4NK3A 3CUEC 3IBJA 1GA0A 1YT4A 3MQ0A 1S4SA 3F1PA 5CTMA 4R70A 3UB9A 1E3UA 4MMNA 1O7EA 4LPZA 4KZ6A 4M3KA 2ZL1A 3SS3A 5EVIC 1GSXA 3ULFA 3G2YA 3BQ8A 4IEDA 5FQ9A 2WKQA 1CI8A 3NIAA 3G34A 1NWZA 3E0YA 4DJ3A 1TEMA 2B02A 4MEZA 2EX2A 1EWZA 4PM9A 1XJ2A 3IT9A 3MBZA 4E3JA 5AQAA 1K4FA 3ZG5A 2YKHA 4CPKA 2R9WA 1M40A 1K38A 2HDRA 1CEGA 3EWKA 1FCMA 1Z6FA 4FH2A 4BL2A 2M7UA 4U3TA 1BSGA 5L07A 1STZA 4NXEA 2OLUA 2ZM0A 3D9YA 3N4IA 3BY8A 4HEFA 1KE4A 4GN2A 2O99A 4GB7A 4GDNA 5F1FA 2ZMVA 2RL3A 1OPXA 3SH7A 4F3LA 3G35A 1OJGA 4S2OA 3UO9A 3AGEA 3IX4A 3F1NB 4OPYA 4C3QA 2Y2QA 1E25A 4Y3IA 1K56D 4E3IA 4BWIA 3IS2B 2EXAA 2O9CA 4KUKA 2EX8A 4GD6A 3PBNA 3ZG9B 3N8LA 2WAFA 1UGUA 3ITAA 1XXMA 3IQAA 2Q9MA 4JBFA 3H7WA 4MN5A 4DRTA 4EESA 1PFLA 3S7OA 4R4SA 4GNUA 2QHKA 1K0KA 1XGJA 1K4EA 1J3WA 4IVKA 4P0MA 4N1XA 2HDQA 4KZ8A 4I3AA 4L0LA 1GHMA 4MCWA 4DF6A 2V1BA 4JGPA 1FILA 2OOLA 3BFEA 4EW7A 3UY6A 5EVEA 1VETB 4EUVA 1F9IA 4KQRA 2Y91A 1ERMA 5FDSA 3DW0A 2W3HA 5EV0A 2ZD8A 2K7SA 3VP0A 2W0NA 4P6BA 3LCEA 4Z1WA 4EETB 1TVFA 4LFUA 5E2FA 5HDSA 4PKYG 3WRTA 4B88A 4OQGA 5F82A 2GNXA 3RFBA 5DTKA 3N8RA 3EQVA 3BFDA 3A0SA 4KZAA 1OJ5A 2A24B 3NOTC 3HLGA 4JXWA 2PAVP 2WAEA 2ZOHA 3CPTB 4YOFA 5FL3A 3VP2A 5F1GA 1N9OA 4PAUA 4EEUA 4S2LA 4UHUA 1XJ4A 4HQAA 2PDRA 4NXFA 2XD1A 1SKFA 5DVAA 3CZDA 2OV5A 3SS5A 4IHQA 5M1AA 3RH8B 3ZNTA 3JYIA 3MKFA 5J8XA 4MBKA 4EQIA 5DFYA 3NJAA 5CGSA 3DWKA 1PNEA 4WM9A 3ZG7B 4WZ5A 3BM6A 5FI7A 4S2NC 2EA9A 1H8YA 3HVFA 3UNWA 1L2SA 1N9LA 3HJIA 1S0WA 3G4PA 1PW1A 1G6OA 1YMXA 1W63M 3PBRA 4K08A 3AGDA 4DJ2A 1GHIA 1H8MA 2XA7S 4X56A 2JKFA 2KOIA 3MZEA 4X68A 5F5YA 3A3FA 3UMDA 5A92A 2WKRA 1L0GA 2ZC3B 1L0EA 1KDWA 2OLVA 4PM6A 1BLSA 5JYOA 4YNRA 2Y2KA 2YKFA 3M6BA 4EV4A 3QP2A 1LI0A 5EM1A 4DE3A 1FSWA 1ONHA 3MS6A 2Y2PA 2V8FA 3NY4A 5TBMB 2Y2JA 1KOUA 2VLGA 2FFYA 4JGOA 5KSCA 4LCMA 2C5WB 3O86A 1ERQA 3EGDC 3T12B 4OP5A 4WLAA 4ZJ2A 4LRZE 4F3LB 4CLCA 1DP8A 3F1OB 2XA7M 2KLIA 2GX5A 3VV4A 3LEZA 5IU1A 4LV2A 1PZOA 2HV1A 3VMAA 1KDSA 1YKDA 3T50A 5DKLA 4HP9A 3QP1A 5EVIB 2R78A 1P9WA 2WK0A 3P98A 5EOEA 4KUOA 3HUOA 1OTAA 4KZ4A 3HLBA 4M4XA 2W3EA 2HJEA 1SDEA 3S1YA 1VQQA 2VZWA 3LICA 4NXBA 1BZAA 1MWTA 4RYEA 3VOYA 3VSKA 4S2KA 2EX6A 1GCEA 1CK3A 1IYQA 4EBLA 4WEJA 3MFDA 4D2OA 3Q82A 5FATA 3TOIA 3IWQA 1JWZA 5CGWA 4LV3A 5CHUA 1SHVA 4PKYA 1P97A 3T4KA 5FQQA 2JHEA 5FAOA 4U0XA 5CHMA 3BFGA 3ISGA 4EUZA 1A0KA 3GRJA 3PR6A 2XEPA 3ZNYA 2PRFA 1KVLA 3I7JA 3V39A 3BY9A 5HWWA 2Z6DA 3EGXC 3LR0A 4IJGA 1MWSA 5F68A 1IYOA 3WRZA 1TS0A 2L4RA 1ES3A 1IYSA 2E8JA 2C6WB 2HP9A 1HD8A 4P87A 3T4QA 3CMZA 5E43A 1J9MA 1Y28A 4N9KA 2VGLM 2HDSA 4X6TA 3M2KA 4QD4A 4ZBEA 3O87A 2JKRI 4OP8A 3GSGA 2ZC5B 3EQUA 1ES4A 3OPHA 4DDYA 1NYMA 3UDXA 2WYXA 3PAEA 4D60A 1WYCA 4OOYA 5FQJA 4L9GA 3RJUA 2G7UA 3Q07A 4GCZA 1MC0A 1G5UA 1IKIA 3VP1A 3MJQA 4UQIM 3ZVTA 1DP6A 3RXXA 2XROA 1MKIA 4EWFA 4S2IA 2L0WA 4GS9A 4OQHA 2ZMFA 1L0DA 3NOUC 4PMAA 3TW8A 4PHTA 1F5MA 2WKIA 3IH9A 3IS2A 4PM8A 4R23A 1YLPA 3G32A 4S2PA 3OLOA 4Y5FA 3HLDA 4Q8IA 1SDNA 2OSUA 4EBPA 4UAAA 3LIAA 2A3UA 3P7NA 2NUTC 1YMSA 2G2WA 1TS6A 3FYZA 5DF9A 4KZBA 2ZMAA 5EVLA 5HARA 1ODVA 5FEGA 5CERA 3OPPA 4GLQA 2Y2OA 3E2KA 1LLBA 5GHZA 3KSIA 2XFSA 4UQIS 1K55C 2UV0E 1GHPA 4IUHA 1MY8A 2V0WA 1MKMA 2ZLYA 4KG6A 5EOOA 5AVFA 4P85A 2V20A 1IOUA 4GHIB 3UMEA 3QNCA 5D3OA 2Y8HA 3HLWA 3W2ZA 2ZM2A 3TG9A 2VEAA 4RA7A 1DJCA 3BLMA 3SH9A 1Y4OA 3IWIA 1PW8A 1VEUB 4HI4A 1PI4A 1KVMA 4H6JB 4YINA 5IHVA 4S2JA 2ZOIA 5G18A 3PXPA 2WZZA 4Y15A 3GMWA 4E3MA 4DE2A 4GKUA 2J3WA 5E2EA 1Q2QA 2JKGA 4N92A 4MLLA 1PWGA 1PIOA 2W3GA 1WE4A 4ZJ1A 3UDIA 2WUQA 4ZRRA 1VEUA 5FI6A 3H9WA 1EI5A 3RTYA 3FPVA 3DBAA 1FR6A 1TF1A 1K57A 5CTNA 2XF3A 2XSSA 3D4FA 1RCJA 3W8KA 1AXBA 3ZFZA 4JLFA 2XH9A 2XLNA 3G30A 3LIEA 1GSWA 4HH3A 4L9FA 1KGEA 5EVID 1NJ4A 1ACFA 2PYPA 3PBQA 3NC8A 3QHYA 5U47A 2QZ6A 5TBMA 2PD8A 3TE8A 3VE3A 4DKIA 3E4PA 3ZG0A 1FOFA 3UE6A 1G28A 1LHYA 1KE0A 3CJMA 4HY8A 1X0OA 5AQ7A 1Y54A 5J3WA 3C2WA 3BQAA 1TDLA 4LV1A 4KG5A 2VV8A 1YQSA 3HBRA 3QNBA 4KG2A 4H8RA 3IBRA 1ESIA 4X1LA 1SCWA 4RX3A 4UA9A 2HPBA 4II7A 1HVBA 2E8IA 1FQGA 4E6XA 4DDSA 3ZHHA 1SZVA 4WZ4A 1PWCA 5FQIA 1LI9A 3U2AA 1PI5A 1T18A 5IT5A 1OTBA 3C7VA 4S2NA 5JYPA 3IHBA 3LY3A 1E4DA 2LB9A 3IX8A 2JBFA 3Q1FA 4R3JA 3UB5P 3UB6A 4DE0A 2WKPA 3HUMA 1XJ6A 3OC2A 3QP4A 3HUNA 4EXOA 5CXWA 2Y2NA 4NXGA 2G2UA 3KO6A 4OONA 2QMIA 3BRMA 2J8YA 3G6OA 2WZXA 3FKWA 2HP6A 4FTXA 3FWLA 3KYQA 3LYXA 3UB7A 3JVUA 3DTIA 1ZTUA 4R3AA 2W1TB 4CQHA 2WKEA 3C5AA 2PU2A 3ITBA 3N6IA 2VA0A 3KSGA 2WGVA 4HP4A 1MXOA 2J3TC 1TD5A 3BECA 1FSYA 3NI9A 3W4QA 3MFXA 4BD1A 1JWPA 1YLWA 3C7UA 3UPOA 1HZOA 3HJKA 3L9KA 4OOLA 4P6ZM 5GLBA 2VX8A 4ARZB 3WS5A 3K3CA 2DNSA 4OPRA 3UE1A 3VOLA 4FUWA 4JGRA 5FEFA 3NDEA 3SZTA 3MQQA 4O7DA 2K31A 1I2SA 5FAPA 4JF5A 4E04A 4JXVA 1WA9A 1S1ZA 4HIAA 5IS1A 2AVXA 2HP5A 3QP5A 4MNRA 4LV0A 1RGYA 4QJGA 3VP3A 2J7VA 5FDHA 3UPPA 1W79A 1S4RA 4HESA 1VETA 1VM1A 2O9BA 3NBLA 3TSGA 2W1TA 1VHMA 3LR5A 4ETXA 2J9OA 4HHDA 4LLOB 1BT5A 4HJ4A 5E2GA 1KE3A 2H10A 1CI9A 5DKKA 5EE8A 4OKPA 3VP4A 1ESUA 2GZAA 4KQQA 4LENA 3N8SA 5L09A 3TJZC 5EM0A 2PYRA 4FH4A 2Y2GA 2FH5A 4ID4A 3T4SA 1YPRA 3DWZA 2MJ6A 1NZUA 2KDKA 3GDIA 1F98A 4HBTA 4C6YA 3GV9A 2X01A 5DF7A 4IBXA 3TRCA 1YSQA 4QB8A 3R4KA 4JXSA 1BYWA 5KMWA 5DTSA 4I3JA 1IELA 4CLCC 1LL5A 4UEYA 1XA1A 3IX3A 3MZDA 2QWSA 2PBDP 4WBGA 5J7EA 2CC1A 3PAGA 2Y2LA 1QMEA 4BL3A 3GVBA 1FCOA 1W8QA 1PWDA 2WKHA 3LI9A 4GJ4A 4B93A 2Y2IA 4CLCD 1EROA 1NLZA 3H82A 1G6AA 3F1OA 5M19A 2Y79A 1OT6A 5HPIA 4WUJA 5F6AA 3MXRA 2W1RA 3GQZA 4FD8A 5HZHA 4X69A 4GDBA 2D01A 5GHXA 5A91A 3NDGA 1OMEA 2HZ5A 5GLDA 1TDGA 5A8BA 3EOIA 3VFFA 5FQMA 5G4YA 1DRMA 4I38A 3S7PA 4EBNA 4I5SA 4BBVA 5I5LA 1YAXA 4HNBA 4JF6A 5M18A 2ZQAA 5KIZA 1YSPA 3UE3A 1V9ZA 4Q0IA 4LRYC 4F94A 3A0RA 1MBLA 4O01A 2XRNA 1K54C 1IKGA 3UB8A 4E3NA 5HPFA 1FCNA 4NEED 4B4ZA 2ZC4B 5A90A 1JTDA 5HAPA 2O0YA 1K57C 4OPQA 4WZ5C 3SOIA 3ZDJA 3T4OA 4I39A 3RXWA 3T1QB 3IHAA 1XX2A 3C38A 3FC7A 3P01A 5KZHA 3LIFA 1U60A 1BULA 3P09A 4JPMA 4KZ9A 2GDNA 4WMCA 4B9OA 1CF0A 5HL1A 1H5XA 2Y4AA 3JPUA 2ZQ8A 3W4PA 5DTTA 4XT2B 5GLCA 2V1AA 3BEBA 2QPNA 4NKPA 3ZG8B 1UWNX 3IWOA 1AWIA 3ZYTA 4X53A 2I72A 3B42A 3CAXA 1XPBA 2EX9A 3PHYA 4OPZA 4DXBA 4X55A 2EFXA 1K56A 4ZAMA 4O8GA 3G2ZA 4JF4A 2XD5A 5LBRA 3R7WA 2XDMA 4Y0TA 1MZUA 3ZGAB 3C4OA 4ZDXA 2Y2MA 3ICYA 5DJUA 3IH8A 3A3EA 4HJ3A 2OWHA 3NECA 3S22A 1HTZA 3IF5A 2XFTA 5HDDA 1YLZA 5FA7A 1K54A 1IEMA 5EUAA 1DJBA 1V9YA 3MZFA 2PR6A 3IF6B 1K6SA 1H8ZA 2J80A 4XUZA 1XFNA 2BASA 2ZQ9A 2HF6A 3SS4A 3MKEA 3KSFA 3G31A 4E6WA 4XUXA 1PZPA 4OLDA 1LSWA 2PHYA 1T1CA 1EW0A 2ZC6B 2Y59A 1NRFA 5HD3A 4X1MA 3F1NA 3C4PA 2ZC7A 3H7WB 3WS2A 3BYDA 3AGFA 4WMCD 3CI6A 4EEPA 4XT2A 3DTEA 2ZQDA 2JCHA 3JVVA 1MWUA 4GS9B 2ZQCA 1W63Q 1S6RA 1XA7A 5HW3A 1MWRA 4N9LA 1KGGA 2V0UA 3GECA 5HWTA 4WN5A 4BQMA 5HAIA 4FSFA 2EXBA 4MBFA 4CJNA 1OT9A 4R3BA 5L8MA 3K3DA 3S7QA 5TFQA 3WWXA 5FQKA 3PYPA 3LR4A 3CITA 1S67L 1LSVA 1NZOA 3MQOA 3K2NA 3C8CA 4WEKA 3CHWP 3L7HA 4ETZA 4LCLA 3T4TA 4ME4A 1RP5A 2M1CA 2O9AA 1P9RA 2Z2MB 5FASA 1JWVA 3T1RA 3FG8A 2X02A 5HSQA 2QKPA 2RCXA 4BMWA 3FPWA 4BBTA 3KX0X 3GTCA 1L3LA 4BJPA 5DF8A 3LIBA 5L2FA 5FAQA 4Y0OA 4QY5A 3V3RA 1YM1A 1L0FA 4Y7PA 2W3FA 3OCNA 2XGNA 2X71A 4DXCA 2ZJ9A 1O07A 4OLGA 1ES5A 3LEQA 4FOFA 4GZBA 1VB6A 2B5RA 3E98A 3LGOA 4Y17A 3S4XA 4K0WA 2QJ5A 3BLSA 2QJ7A 3HLCA 1T19A 3DTMA 4MN7A 3U4LP 1C3BA 3A3IA 3FKVA 3UE0A 2IWBA 3IF6A 1KGFA 4PPRA 3IXDA 5HL6A 1TS7A 4Y0UA 4GHIA 1ZC2A 4I3IA 1HLUP 5EVIA 5CRFA 2IWDA 3IXBA 3E2LA 4EERA 1CJFA 4FCFA 4K91A 2Y2HA 2VGLS 5TR7A 2Q9NA 3W4OA 2VGJA 3CLOA 3NHQA 4ARZA 2GJ3A 4P6ZS 3WS4A 2ZM8A 3UDFA 5TGFA 3IXGA 4RVAA 2JKTI 3HLFA 2ZQ7A 3MXQA 4WL9A 2IWCA 2WGWB 5CEBA 2Z2LB 3A3DA 3DTKA 4QHCA 3O5YA 4WELA 1E3UD 2B95A 3OOVA 4Y13A 4R4RA 3MSHA 4RQ9A 2BG1A 5A93A 2JKRM 3OBFA 3LY4A 2A49A 4ZTKA 5I94A 1MPLA 1BTLA 1K55A 4LRXC 3MF0A 1XFQA 3D3OA 2HJ9C 4E3OA 5FI2A 1CEFA 3MMHA 2ZL1B 1NLYA 2ACGA 4B4XA 1W8YA 4HH2A 4DE1A 5J4EA 4KQOA 5K5BA 3C30A 2DMWA 2VJWA 1ALQA 3HCYA 2H0YA 3S7NA 5HFOA 5HAQA 1ES2A 2W3DA 1LSXA 3CUEA 4YFMA 1I5QA 2V9AA 2XQZA 3HLEA 4BBUA 1FR1A 1JVJA 5MC7A 4QU3A 2LB5A 4O0PA 2JC7A 3E4OA 3M2JA 4OH0A 3BW6A 2P9VA 3HL9A 3B3XA 3LO7A 1PYYA 2PU4A 3QP6A 1OTEA 3Q81A 2VK3A 1DP9A 3CPTA 4Q0HA 1WYBA 4QY6A 4OQIA 1OTDA 3IXHA 3T1XA 2K2NA 1TS8A 4QPRA 2PT7A 1JNUA 4GOGA 1XJ3A 1F2KA 1T1BA 1H0MA 2PD7A 2J9PA 3T4LA 3FZCA 4NETA 3CWFA 2Q0OA 4U0TA 2H28A 1BLHA 1IFQA 1D1JA 4BLMA 1FIKA 4DMZA 5DFXA 2VV7A 2EFUA 4JGQA 1BUEA 1SKOB 2IA2A 4X25A 3SW1A 2VGKA 3T4JA 3B47A 1LT0A 3FV7A 1P0ZA 3OZHA 4WYYA 1PRQA 3BWLA 1ZG6A 1QMFA 5DJTA 2P7JA 1YLJA 5L10A 2R9XA 3E4QA 4IBRA 1N4OA 2EWWA 2UWXA 1ZHHB 3MXSA 3V5MA 3PBOA 2WGWA 3WS0A 1GA9A 2H5SA 3ZQ5A 1D7EA 5CHJA 4KENB 2H0TA 2NUPC 3GR2A 3Q7VA 4A5RA 5AQBA 3BFFA 4KZ5A 3B33A 4Y2FA 4R6LA 4Q0JA 5TJJA 3LFVA 2P9VB 1G68A 2V2FF 2ZBBA 2B18A 2P74A 1XKZA 1M6KA 2PBYA 5BOHA 5EPHA 2WGIA 3O3VA 2P08A 3MR0A 2KX6A 3LUQA 2DCFA 4G3VA 3D72A 5CEDA 1XGIA 4GD8A 1S1YA 4HJ6A 3OCLA 2CMNA 1YLYA 3R7WB 4KQDA 4LGWA 1NY0A 5G4ZA 2OAP1 5F83A 4JKTA 3DAVA 4EU0A 1NYYA 4R0QA 5EFWA 3H82B 2A24A 1IYPA 5FSRA 4IVIA 3VFHA 4H6JA 2PR5A 2FFFB 2XR0A 4C75A 1DJAA 1LL8A 4OOMA 3T1SA 1SKOA 2FZ0A 2VV6A 1K6RA 3IF6C 1Z09A 4PM7A 5C5KA 3VOZA 4UA6A 4UA7A 2JKTM 2A2LA 3LI8A 2HGVA 3VSLA 3KSHA 3LR3A 3PTEA 1ZG4A 4BENA 3BJNA 3SH8A 5CECA 2XK1A 2P04A 5F69A 5AVEA 5HX9A 4WF0A 2Y55A 4AFIA 5HD5A 4S2MA 4G3WA 3F1PB 3V67A 2JE5A
chains in the Genus database with same CATH topology
2V0UA 3GECA 5HWTA 2J3TD 4WN5A 4II7A 4R38A 1S66L 4FSFA 4YNRA 1OT9A 2YKFA 2Z6CA 4CLCE 5L8MA 3K3DA 3S7QA 4MN6A 3PYPA 3LR4A 3CITA 1S67L 1LSVA 3U2AA 3MQOA 1T18A 3K2NA 3C8CA 4WEKA 5TBMB 5IT5A 1KOUA 1OTBA 4ETZA 5HWVA 2VLGA 3T4TA 4ME4A 3EEHA 2M1CA 2O9AA 1P9RA 2LB9A 4JGOA 3UB6A 3FG8A 5HSQA 2QKPA 3EGDC 2WKPA 4BMWA 3FPWA 4BBTA 4WLAA 1GSVA 1XJ6A 3KX0X 3OC2A 4LRZE 4F3LB 1OTIA 4CLCA 4BJPA 4EXOA 3LIBA 4NXGA 3KO6A 1DP8A 1D06A 3F1OB 2XA7M 1T1AA 2KLIA 2GX5A 3G6OA 4HOIA 4MDZA 3VV4A 2QYBA 2L1MA 5IU1A 3A0VA 4CLCB 3KYQA 3LYXA 3EEAA 2HV1A 3UB7A 3JVUA 2W3FA 3OCNA 1YKDA 3T50A 1ZTUA 3KYZA 4R3AA 5DKLA 2W1TB 4HP9A 4CQHA 2R78A 1P9WA 3PBTA 4KUOA 4DN0A 2VA0A 1OTAA 3KSGA 4HP4A 4FOFA 1VB6A 2J3TC 1TD5A 2OWJA 4M4XA 2W3EA 5CX7A 2HJEA 3E98A 3MFXA 2OAQ1 2JN7A 2QJ5A 2VZWA 3LICA 3HJKA 4NXBA 1N9NA 2QJ7A 4OOLA 1NRJA 1T19A 4P6ZM 2VX8A 4MN7A 4ARZB 3K3CA 2INWA 5HDCA 3VOLA 4WEJA 4JGRA 5HL6A 1TS7A 4EQ1A 4GW9A 4GHIA 3NOPC 2M7VA 4G3KA 4I3IA 3MQQA 1UWPX 2K31A 4E04A 5AJGA 1H3QA 2EWVA 2D02A 2VKSA 4EERA 1WA9A 1S1ZA 4PKYA 1P97A 4HIAA 2VGLS 3T4KA 5KSHA 2JHEA 5IS1A 3PBSA 3CLOA 3NHQA 4ARZA 2GJ3A 4P6ZS 3PR6A 4IUKA 1S4RA 4YWZA 3LIDA 3VE4A 2O9BA 3BY9A 5HWWA 2Z6DA 3EGXC 2JKTI 2I9VA 3LR0A 2W1TA 4IJGA 4L9EA 1VHMA 3MXQA 4WL9A 2W27A 3LR5A 3CUEC 4ETXA 5F68A 4HHDA 1TS0A 3IBJA 4LLOB 3MQ0A 4WELA 3O5YA 2L4RA 1S4SA 4HJ4A 3OOVA 5DKKA 3F1PA 4R70A 3UB9A 4RQ9A 4MMNA 2GZAA 2JKRM 3T4QA 4LPZA 3OBFA 1Y28A 3TJZC 2VGLM 2PYRA 4LRXC 3MF0A 2FH5A 1GSXA 1XFQA 3T4SA 3ULFA 3D3OA 2HJ9C 3BQ8A 2MJ6A 2KDKA 3MMHA 3GDIA 2JKRI 1F98A 2WKQA 1NWZA 1NLYA 3E0YA 4DJ3A 3TRCA 1YSQA 2B02A 3EQUA 3R4KA 4HH2A 1XJ2A 1BYWA 5J4EA 4KQOA 5K5BA 4I3JA 4CLCC 3C30A 2DMWA 2YKHA 2VJWA 3HCYA 4UEYA 3S7NA 4L9GA 3EWKA 2QWSA 5J7EA 2G7UA 4GCZA 1MC0A 2M7UA 2W3DA 1LSXA 3CUEA 2V9AA 3MJQA 4UQIM 1STZA 4BBUA 4NXEA 5MC7A 1DP6A 2XROA 3LI9A 2LB5A 3BY8A 2L0WA 4GJ4A 4O0PA 4B93A 4CLCD 4GS9A 1NLZA 3E4OA 2O99A 3NOUC 3H82A 2ZMFA 3TW8A 3BW6A 4PHTA 1F5MA 2ZMVA 3F1OA 2Y79A 1OT6A 1OPXA 4F3LA 1OTEA 5HPIA 1OJGA 1DP9A 4WUJA 5F6AA 3IS2A 2W1RA 4Q0HA 5HZHA 3OLOA 3F1NB 4Y5FA 1OTDA 2D01A 2K2NA 1TS8A 3LIAA 4Y3IA 4QPRA 2PT7A 3P7NA 2NUTC 1JNUA 4BWIA 1XJ3A 1T1BA 3IS2B 5A8BA 2O9CA 2PD7A 3EOIA 4KUKA 1TS6A 5G4YA 1DRMA 4I38A 5DF9A 3S7PA 3T4LA 3PBNA 4I5SA 3CWFA 4BBVA 5I5LA 1YAXA 2H28A 1ODVA 1IFQA 4HNBA 4DMZA 5DFXA 1UGUA 4GLQA 5KIZA 2VV7A 4JGQA 1YSPA 3H7WA 3KSIA 3UE3A 1V9ZA 4MN5A 4LRYC 2IA2A 4Q0IA 4UQIS 4EESA 3A0RA 4O01A 3SW1A 4IUHA 2XRNA 2V0WA 1MKMA 3S7OA 2QHKA 3T4JA 5AVFA 3UB8A 1IOUA 3B47A 1LT0A 5HPFA 1P0ZA 4GHIB 3UMEA 4NEED 3BWLA 5DJTA 2P7JA 2Y8HA 3W2ZA 2O0YA 4I3AA 2VEAA 4L0LA 3E4QA 4MCWA 2EWWA 1ZHHB 2V1BA 3PBOA 3T4OA 4I39A 4JGPA 2OOLA 4HI4A 3ZQ5A 4EW7A 1D7EA 3C38A 3FC7A 3P01A 2NUPC 4EUVA 1F9IA 4H6JB 3LIFA 3B33A 2W3HA 4B9OA 4Y2FA 2K7SA 2W0NA 4R6LA 4Q0JA 2ZOIA 5TJJA 3LFVA 4Z1WA 3PXPA 4EETB 2ZBBA 2B18A 2J3WA 5HDSA 4XT2B 2V1AA 4PKYG 4NKPA 1UWNX 2GNXA 3RFBA 3ZYTA 3B42A 2P08A 3CAXA 3MR0A 2KX6A 3EQVA 3LUQA 2W3GA 3A0SA 3PHYA 4G3VA 1OJ5A 3D72A 1S1YA 4HJ6A 2A24B 4ZRRA 3NOTC 3H9WA 3OCLA 2CMNA 3RTYA 3FPVA 3DBAA 3R7WB 4KQDA 2ZOHA 1TF1A 4O8GA 4YOFA 5FL3A 5G4ZA 2OAP1 2XSSA 1N9OA 5LBRA 3R7WA 4EU0A 4PAUA 4EEUA 1MZUA 5EFWA 3H82B 2A24A 3ICYA 3LIEA 5DJUA 1XJ4A 1GSWA 4HQAA 2PDRA 4HH3A 4HJ3A 2OWHA 4L9FA 4NXFA 4H6JA 5HDDA 2PR5A 4IHQA 3RH8B 2PYPA 3PBQA 1LL8A 4OOMA 1V9YA 2FZ0A 2VV6A 2PR6A 5C5KA 2J80A 5DFYA 5TBMA 2PD8A 3NJAA 2JKTM 3TE8A 2A2LA 1XFNA 2BASA 3LI8A 2HF6A 3VE3A 3E4PA 3KSFA 2HGVA 2EA9A 1G28A 3UE6A 1LSWA 4HY8A 2PHYA 1N9LA 1T1CA 1X0OA 1EW0A 3HJIA 3KSHA 5HD3A 3LR3A 3F1NA 5J3WA 3C2WA 3BQAA 1G6OA 3H7WB 1W63M 2VV8A 3CI6A 3PBRA 4K08A 3BJNA 4EEPA 4DJ2A 4XT2A 1H8MA 3JVVA 2XA7S 4GS9B 2P04A 5F69A 5AVEA 1W63Q 4WF0A 3IBRA 2KOIA 4AFIA 5HD5A 5F5YA 4G3WA 3F1PB 3UMDA 3V67A 2WKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E04 A;  2V0U A;  3GEC A;  5HDS A;  3UB9 A;  2D02 A;  4XT2 B;  2V1A A;  3F1O A;  4PKY G;  4EER A;  5HWT A;  1WA9 A;  1S1Z A;  4WN5 A;  4PKY A;  4R38 A;  1OT6 A;  1P97 A;  1UWN X;  4HIA A;  1S66 L;  4F3L A;  1OTE A;  2JHE A;  1OJG A;  1OT9 A;  2YKF A;  2KX6 A;  3CAX A;  1DP9 A;  3MR0 A;  3LUQ A;  4WUJ A;  2Z6C A;  3IS2 A;  5F6A A;  3A0S A;  3CLO A;  3K3D A;  3NHQ A;  1OJ5 A;  2GJ3 A;  3PHY A;  4MN6 A;  3D72 A;  3PYP A;  1S1Y A;  3OLO A;  4HJ6 A;  1S67 L;  1LSV A;  2A24 B;  1OTD A;  3F1N B;  3NOT C;  3NOU C;  3MQO A;  3H9W A;  2CMN A;  1T18 A;  2D01 A;  3RTY A;  1S4R A;  3C8C A;  3LID A;  4YWZ A;  4KQD A;  2ZOH A;  5TBM B;  3VE4 A;  1KOU A;  1TS8 A;  1OTB A;  5HWV A;  3BY9 A;  2VLG A;  3LIA A;  5HWW A;  2Z6D A;  4L9E A;  2I9V A;  3P7N A;  5G4Z A;  3EEH A;  3MXQ A;  1JNU A;  4WL9 A;  2W27 A;  1XJ3 A;  1T1B A;  2M1C A;  3IS2 B;  5F68 A;  5A8B A;  2PD7 A;  1N9O A;  4JGO A;  4KUK A;  4HHD A;  1TS0 A;  1TS6 A;  4EEU A;  4LLO B;  5G4Y A;  3UB6 A;  1DRM A;  1MZU A;  2L4R A;  1S4S A;  3H82 B;  2A24 A;  4HJ4 A;  3FG8 A;  4I38 A;  5EFW A;  4I5S A;  3CWF A;  3ICY A;  2QKP A;  5I5L A;  2H28 A;  2WKP A;  1ODV A;  4BBV A;  3LIE A;  5DJU A;  5DKK A;  1XJ4 A;  1GSW A;  3F1P A;  4HNB A;  2PDR A;  4HH3 A;  4HJ3 A;  2OWH A;  4HQA A;  1GSV A;  1XJ6 A;  3KX0 X;  4L9F A;  4NXF A;  4R70 A;  1UGU A;  4LRZ E;  1OTI A;  2VV7 A;  4H6J A;  4JGQ A;  4RQ9 A;  5HDD A;  4F3L B;  4EXO A;  5KIZ A;  4LPZ A;  2PR5 A;  3LIB A;  4NXG A;  1DP8 A;  1D06 A;  3H7W A;  3RH8 B;  2PYP A;  3F1O B;  1V9Z A;  4MN5 A;  4LRY C;  1Y28 A;  4EES A;  3A0R A;  1LL8 A;  1T1A A;  3SW1 A;  2V0W A;  3G6O A;  4HOI A;  2PYR A;  1V9Y A;  4LRX C;  2L1M A;  2QHK A;  2VV6 A;  2PR6 A;  5IU1 A;  3A0V A;  5AVF A;  3UB8 A;  1GSX A;  1XFQ A;  3ULF A;  1LT0 A;  3LYX A;  1P0Z A;  2J80 A;  4WLA A;  4GHI B;  5TBM A;  2HV1 A;  3UME A;  3UB7 A;  2PD8 A;  3BWL A;  3NJA A;  3T50 A;  2KDK A;  4R3A A;  1XFN A;  2BAS A;  2P7J A;  3GDI A;  3LI8 A;  4HP9 A;  1F98 A;  2R78 A;  2WKQ A;  5DJT A;  3VE3 A;  5HZH A;  3E4P A;  4KUO A;  4I3A A;  1NWZ A;  2VEA A;  1OTA A;  3E4Q A;  4DJ3 A;  2EA9 A;  1G28 A;  4HP4 A;  5DKL A;  3UE6 A;  2B02 A;  1VB6 A;  4HH2 A;  1XJ2 A;  1BYW A;  1LSW A;  2OWJ A;  2V1B A;  4HY8 A;  4M4X A;  2PHY A;  1N9L A;  5HSQ A;  1T1C A;  1X0O A;  1EW0 A;  3MFX A;  4I3J A;  4I39 A;  3HJI A;  4JGP A;  5HD3 A;  2YKH A;  2OOL A;  2JN7 A;  2QJ5 A;  3LIC A;  4HI4 A;  4BBT A;  3HJK A;  3F1N A;  5J3W A;  3C2W A;  1D7E A;  1N9N A;  4NXB A;  3ZQ5 A;  2QJ7 A;  4L9G A;  4EW7 A;  1T19 A;  3H7W B;  3FC7 A;  5IS1 A;  3EWK A;  2QWS A;  5J7E A;  2VV8 A;  3K3C A;  4K08 A;  1F9I A;  4H6J B;  3LIF A;  4GCZ A;  2INW A;  4EEP A;  4DJ2 A;  4XT2 A;  1LSX A;  5HDC A;  2V9A A;  3B33 A;  3MJQ A;  3VOL A;  4B9O A;  2K7S A;  4GS9 B;  2W0N A;  4BBU A;  4R6L A;  5F69 A;  5AVE A;  4JGR A;  4NXE A;  1TS7 A;  2ZOI A;  1DP6 A;  4EQ1 A;  4GW9 A;  4GHI A;  3NOP C;  4WF0 A;  3IBR A;  4EET B;  4I3I A;  5J4E A;  5HD5 A;  3LI9 A;  3BY8 A;  3MQQ A;  2L0W A;  3F1P B;  1UWP X;  2ZBB A;  5F5Y A;  3UMD A;  4GS9 A;  2WKR A;  3E4O A;  3H82 A; 
#chains in the Genus database with same CATH topology
 5GLA A;  2J3T D;  4R38 A;  3O88 A;  1S66 L;  1K25 A;  2Z6C A;  4CLC E;  4MN6 A;  3OPL A;  3BFC A;  4K0X A;  5HWV A;  4N1H A;  3WS1 A;  3EEH A;  3HRE A;  3Q7V B;  1W5D A;  3A3J A;  3NCK A;  4E3K A;  3Q7Z A;  5GHY A;  4R1G A;  1BLP A;  1Q2P A;  3CG5 A;  4QWO A;  3UN7 A;  1GSV A;  1OTI A;  4PM5 A;  4MBH A;  1D06 A;  1DY6 A;  3NUL A;  1T1A A;  1LL9 A;  2DRW A;  4MDZ A;  4HOI A;  2QYB A;  2L1M A;  3A0V A;  3M6H A;  4CLC B;  1NXY A;  3EEA A;  1W7F A;  5EEC A;  1ONG A;  3KYZ A;  2BTF P;  1N9B A;  3PBT A;  4JXG A;  4DN0 A;  2V1Z A;  4OQ0 A;  2HDU A;  2OWJ A;  5CX7 A;  4E3L A;  1ZKJ A;  1I2W A;  3ZCZ A;  2OAQ 1;  2JN7 A;  1N9N A;  5GL9 A;  1NRJ A;  4ESP A;  5AQ9 A;  2INW A;  3OPR A;  4KZ7 A;  5HDC A;  3QP8 A;  1BLC A;  4EQ1 A;  4GW9 A;  5E2H A;  3NOP C;  2M7V A;  2BLS A;  4BD0 A;  4G3K A;  5CGX A;  2V8C A;  1UWP X;  1CQA A;  1JTG A;  4XXR A;  5AJG A;  1H3Q A;  2EWV A;  2D02 A;  2VKS A;  4ZJ3 A;  4OVD A;  4RX2 A;  5KSH A;  1YLT A;  3PBS A;  3N7W A;  4NG2 A;  3UPN A;  3ZVW A;  4HBU A;  1XP4 A;  3KYE A;  4IUK A;  4YWZ A;  3LID A;  3V3S A;  3VE4 A;  4KZ3 A;  4Z9Q A;  2WAD A;  1RGZ A;  4L9E A;  2I9V A;  3V50 A;  2W27 A;  4NK3 A;  3CUE C;  3IBJ A;  1GA0 A;  1YT4 A;  3MQ0 A;  1S4S A;  3F1P A;  5CTM A;  4R70 A;  3UB9 A;  1E3U A;  4MMN A;  1O7E A;  4LPZ A;  4KZ6 A;  4M3K A;  2ZL1 A;  3SS3 A;  5EVI C;  1GSX A;  3ULF A;  3G2Y A;  3BQ8 A;  4IED A;  5FQ9 A;  2WKQ A;  1CI8 A;  3NIA A;  3G34 A;  1NWZ A;  3E0Y A;  4DJ3 A;  1TEM A;  2B02 A;  4MEZ A;  2EX2 A;  1EWZ A;  4PM9 A;  1XJ2 A;  3IT9 A;  3MBZ A;  4E3J A;  5AQA A;  1K4F A;  3ZG5 A;  2YKH A;  4CPK A;  2R9W A;  1M40 A;  1K38 A;  2HDR A;  1CEG A;  3EWK A;  1FCM A;  1Z6F A;  4FH2 A;  4BL2 A;  2M7U A;  4U3T A;  1BSG A;  5L07 A;  1STZ A;  4NXE A;  2OLU A;  2ZM0 A;  3D9Y A;  3N4I A;  3BY8 A;  4HEF A;  1KE4 A;  4GN2 A;  2O99 A;  4GB7 A;  4GDN A;  5F1F A;  2ZMV A;  2RL3 A;  1OPX A;  3SH7 A;  4F3L A;  3G35 A;  1OJG A;  4S2O A;  3UO9 A;  3AGE A;  3IX4 A;  3F1N B;  4OPY A;  4C3Q A;  2Y2Q A;  1E25 A;  4Y3I A;  1K56 D;  4E3I A;  4BWI A;  3IS2 B;  2EXA A;  2O9C A;  4KUK A;  2EX8 A;  4GD6 A;  3PBN A;  3ZG9 B;  3N8L A;  2WAF A;  1UGU A;  3ITA A;  1XXM A;  3IQA A;  2Q9M A;  4JBF A;  3H7W A;  4MN5 A;  4DRT A;  4EES A;  1PFL A;  3S7O A;  4R4S A;  4GNU A;  2QHK A;  1K0K A;  1XGJ A;  1K4E A;  1J3W A;  4IVK A;  4P0M A;  4N1X A;  2HDQ A;  4KZ8 A;  4I3A A;  4L0L A;  1GHM A;  4MCW A;  4DF6 A;  2V1B A;  4JGP A;  1FIL A;  2OOL A;  3BFE A;  4EW7 A;  3UY6 A;  5EVE A;  1VET B;  4EUV A;  1F9I A;  4KQR A;  2Y91 A;  1ERM A;  5FDS A;  3DW0 A;  2W3H A;  5EV0 A;  2ZD8 A;  2K7S A;  3VP0 A;  2W0N A;  4P6B A;  3LCE A;  4Z1W A;  4EET B;  1TVF A;  4LFU A;  5E2F A;  5HDS A;  4PKY G;  3WRT A;  4B88 A;  4OQG A;  5F82 A;  2GNX A;  3RFB A;  5DTK A;  3N8R A;  3EQV A;  3BFD A;  3A0S A;  4KZA A;  1OJ5 A;  2A24 B;  3NOT C;  3HLG A;  4JXW A;  2PAV P;  2WAE A;  2ZOH A;  3CPT B;  4YOF A;  5FL3 A;  3VP2 A;  5F1G A;  1N9O A;  4PAU A;  4EEU A;  4S2L A;  4UHU A;  1XJ4 A;  4HQA A;  2PDR A;  4NXF A;  2XD1 A;  1SKF A;  5DVA A;  3CZD A;  2OV5 A;  3SS5 A;  4IHQ A;  5M1A A;  3RH8 B;  3ZNT A;  3JYI A;  3MKF A;  5J8X A;  4MBK A;  4EQI A;  5DFY A;  3NJA A;  5CGS A;  3DWK A;  1PNE A;  4WM9 A;  3ZG7 B;  4WZ5 A;  3BM6 A;  5FI7 A;  4S2N C;  2EA9 A;  1H8Y A;  3HVF A;  3UNW A;  1L2S A;  1N9L A;  3HJI A;  1S0W A;  3G4P A;  1PW1 A;  1G6O A;  1YMX A;  1W63 M;  3PBR A;  4K08 A;  3AGD A;  4DJ2 A;  1GHI A;  1H8M A;  2XA7 S;  4X56 A;  2JKF A;  2KOI A;  3MZE A;  4X68 A;  5F5Y A;  3A3F A;  3UMD A;  5A92 A;  2WKR A;  1L0G A;  2ZC3 B;  1L0E A;  1KDW A;  2OLV A;  4PM6 A;  1BLS A;  5JYO A;  4YNR A;  2Y2K A;  2YKF A;  3M6B A;  4EV4 A;  3QP2 A;  1LI0 A;  5EM1 A;  4DE3 A;  1FSW A;  1ONH A;  3MS6 A;  2Y2P A;  2V8F A;  3NY4 A;  5TBM B;  2Y2J A;  1KOU A;  2VLG A;  2FFY A;  4JGO A;  5KSC A;  4LCM A;  2C5W B;  3O86 A;  1ERQ A;  3EGD C;  3T12 B;  4OP5 A;  4WLA A;  4ZJ2 A;  4LRZ E;  4F3L B;  4CLC A;  1DP8 A;  3F1O B;  2XA7 M;  2KLI A;  2GX5 A;  3VV4 A;  3LEZ A;  5IU1 A;  4LV2 A;  1PZO A;  2HV1 A;  3VMA A;  1KDS A;  1YKD A;  3T50 A;  5DKL A;  4HP9 A;  3QP1 A;  5EVI B;  2R78 A;  1P9W A;  2WK0 A;  3P98 A;  5EOE A;  4KUO A;  3HUO A;  1OTA A;  4KZ4 A;  3HLB A;  4M4X A;  2W3E A;  2HJE A;  1SDE A;  3S1Y A;  1VQQ A;  2VZW A;  3LIC A;  4NXB A;  1BZA A;  1MWT A;  4RYE A;  3VOY A;  3VSK A;  4S2K A;  2EX6 A;  1GCE A;  1CK3 A;  1IYQ A;  4EBL A;  4WEJ A;  3MFD A;  4D2O A;  3Q82 A;  5FAT A;  3TOI A;  3IWQ A;  1JWZ A;  5CGW A;  4LV3 A;  5CHU A;  1SHV A;  4PKY A;  1P97 A;  3T4K A;  5FQQ A;  2JHE A;  5FAO A;  4U0X A;  5CHM A;  3BFG A;  3ISG A;  4EUZ A;  1A0K A;  3GRJ A;  3PR6 A;  2XEP A;  3ZNY A;  2PRF A;  1KVL A;  3I7J A;  3V39 A;  3BY9 A;  5HWW A;  2Z6D A;  3EGX C;  3LR0 A;  4IJG A;  1MWS A;  5F68 A;  1IYO A;  3WRZ A;  1TS0 A;  2L4R A;  1ES3 A;  1IYS A;  2E8J A;  2C6W B;  2HP9 A;  1HD8 A;  4P87 A;  3T4Q A;  3CMZ A;  5E43 A;  1J9M A;  1Y28 A;  4N9K A;  2VGL M;  2HDS A;  4X6T A;  3M2K A;  4QD4 A;  4ZBE A;  3O87 A;  2JKR I;  4OP8 A;  3GSG A;  2ZC5 B;  3EQU A;  1ES4 A;  3OPH A;  4DDY A;  1NYM A;  3UDX A;  2WYX A;  3PAE A;  4D60 A;  1WYC A;  4OOY A;  5FQJ A;  4L9G A;  3RJU A;  2G7U A;  3Q07 A;  4GCZ A;  1MC0 A;  1G5U A;  1IKI A;  3VP1 A;  3MJQ A;  4UQI M;  3ZVT A;  1DP6 A;  3RXX A;  2XRO A;  1MKI A;  4EWF A;  4S2I A;  2L0W A;  4GS9 A;  4OQH A;  2ZMF A;  1L0D A;  3NOU C;  4PMA A;  3TW8 A;  4PHT A;  1F5M A;  2WKI A;  3IH9 A;  3IS2 A;  4PM8 A;  4R23 A;  1YLP A;  3G32 A;  4S2P A;  3OLO A;  4Y5F A;  3HLD A;  4Q8I A;  1SDN A;  2OSU A;  4EBP A;  4UAA A;  3LIA A;  2A3U A;  3P7N A;  2NUT C;  1YMS A;  2G2W A;  1TS6 A;  3FYZ A;  5DF9 A;  4KZB A;  2ZMA A;  5EVL A;  5HAR A;  1ODV A;  5FEG A;  5CER A;  3OPP A;  4GLQ A;  2Y2O A;  3E2K A;  1LLB A;  5GHZ A;  3KSI A;  2XFS A;  4UQI S;  1K55 C;  2UV0 E;  1GHP A;  4IUH A;  1MY8 A;  2V0W A;  1MKM A;  2ZLY A;  4KG6 A;  5EOO A;  5AVF A;  4P85 A;  2V20 A;  1IOU A;  4GHI B;  3UME A;  3QNC A;  5D3O A;  2Y8H A;  3HLW A;  3W2Z A;  2ZM2 A;  3TG9 A;  2VEA A;  4RA7 A;  1DJC A;  3BLM A;  3SH9 A;  1Y4O A;  3IWI A;  1PW8 A;  1VEU B;  4HI4 A;  1PI4 A;  1KVM A;  4H6J B;  4YIN A;  5IHV A;  4S2J A;  2ZOI A;  5G18 A;  3PXP A;  2WZZ A;  4Y15 A;  3GMW A;  4E3M A;  4DE2 A;  4GKU A;  2J3W A;  5E2E A;  1Q2Q A;  2JKG A;  4N92 A;  4MLL A;  1PWG A;  1PIO A;  2W3G A;  1WE4 A;  4ZJ1 A;  3UDI A;  2WUQ A;  4ZRR A;  1VEU A;  5FI6 A;  3H9W A;  1EI5 A;  3RTY A;  3FPV A;  3DBA A;  1FR6 A;  1TF1 A;  1K57 A;  5CTN A;  2XF3 A;  2XSS A;  3D4F A;  1RCJ A;  3W8K A;  1AXB A;  3ZFZ A;  4JLF A;  2XH9 A;  2XLN A;  3G30 A;  3LIE A;  1GSW A;  4HH3 A;  4L9F A;  1KGE A;  5EVI D;  1NJ4 A;  1ACF A;  2PYP A;  3PBQ A;  3NC8 A;  3QHY A;  5U47 A;  2QZ6 A;  5TBM A;  2PD8 A;  3TE8 A;  3VE3 A;  4DKI A;  3E4P A;  3ZG0 A;  1FOF A;  3UE6 A;  1G28 A;  1LHY A;  1KE0 A;  3CJM A;  4HY8 A;  1X0O A;  5AQ7 A;  1Y54 A;  5J3W A;  3C2W A;  3BQA A;  1TDL A;  4LV1 A;  4KG5 A;  2VV8 A;  1YQS A;  3HBR A;  3QNB A;  4KG2 A;  4H8R A;  3IBR A;  1ESI A;  4X1L A;  1SCW A;  4RX3 A;  4UA9 A;  2HPB A;  4II7 A;  1HVB A;  2E8I A;  1FQG A;  4E6X A;  4DDS A;  3ZHH A;  1SZV A;  4WZ4 A;  1PWC A;  5FQI A;  1LI9 A;  3U2A A;  1PI5 A;  1T18 A;  5IT5 A;  1OTB A;  3C7V A;  4S2N A;  5JYP A;  3IHB A;  3LY3 A;  1E4D A;  2LB9 A;  3IX8 A;  2JBF A;  3Q1F A;  4R3J A;  3UB5 P;  3UB6 A;  4DE0 A;  2WKP A;  3HUM A;  1XJ6 A;  3OC2 A;  3QP4 A;  3HUN A;  4EXO A;  5CXW A;  2Y2N A;  4NXG A;  2G2U A;  3KO6 A;  4OON A;  2QMI A;  3BRM A;  2J8Y A;  3G6O A;  2WZX A;  3FKW A;  2HP6 A;  4FTX A;  3FWL A;  3KYQ A;  3LYX A;  3UB7 A;  3JVU A;  3DTI A;  1ZTU A;  4R3A A;  2W1T B;  4CQH A;  2WKE A;  3C5A A;  2PU2 A;  3ITB A;  3N6I A;  2VA0 A;  3KSG A;  2WGV A;  4HP4 A;  1MXO A;  2J3T C;  1TD5 A;  3BEC A;  1FSY A;  3NI9 A;  3W4Q A;  3MFX A;  4BD1 A;  1JWP A;  1YLW A;  3C7U A;  3UPO A;  1HZO A;  3HJK A;  3L9K A;  4OOL A;  4P6Z M;  5GLB A;  2VX8 A;  4ARZ B;  3WS5 A;  3K3C A;  2DNS A;  4OPR A;  3UE1 A;  3VOL A;  4FUW A;  4JGR A;  5FEF A;  3NDE A;  3SZT A;  3MQQ A;  4O7D A;  2K31 A;  1I2S A;  5FAP A;  4JF5 A;  4E04 A;  4JXV A;  1WA9 A;  1S1Z A;  4HIA A;  5IS1 A;  2AVX A;  2HP5 A;  3QP5 A;  4MNR A;  4LV0 A;  1RGY A;  4QJG A;  3VP3 A;  2J7V A;  5FDH A;  3UPP A;  1W79 A;  1S4R A;  4HES A;  1VET A;  1VM1 A;  2O9B A;  3NBL A;  3TSG A;  2W1T A;  1VHM A;  3LR5 A;  4ETX A;  2J9O A;  4HHD A;  4LLO B;  1BT5 A;  4HJ4 A;  5E2G A;  1KE3 A;  2H10 A;  1CI9 A;  5DKK A;  5EE8 A;  4OKP A;  3VP4 A;  1ESU A;  2GZA A;  4KQQ A;  4LEN A;  3N8S A;  5L09 A;  3TJZ C;  5EM0 A;  2PYR A;  4FH4 A;  2Y2G A;  2FH5 A;  4ID4 A;  3T4S A;  1YPR A;  3DWZ A;  2MJ6 A;  1NZU A;  2KDK A;  3GDI A;  1F98 A;  4HBT A;  4C6Y A;  3GV9 A;  2X01 A;  5DF7 A;  4IBX A;  3TRC A;  1YSQ A;  4QB8 A;  3R4K A;  4JXS A;  1BYW A;  5KMW A;  5DTS A;  4I3J A;  1IEL A;  4CLC C;  1LL5 A;  4UEY A;  1XA1 A;  3IX3 A;  3MZD A;  2QWS A;  2PBD P;  4WBG A;  5J7E A;  2CC1 A;  3PAG A;  2Y2L A;  1QME A;  4BL3 A;  3GVB A;  1FCO A;  1W8Q A;  1PWD A;  2WKH A;  3LI9 A;  4GJ4 A;  4B93 A;  2Y2I A;  4CLC D;  1ERO A;  1NLZ A;  3H82 A;  1G6A A;  3F1O A;  5M19 A;  2Y79 A;  1OT6 A;  5HPI A;  4WUJ A;  5F6A A;  3MXR A;  2W1R A;  3GQZ A;  4FD8 A;  5HZH A;  4X69 A;  4GDB A;  2D01 A;  5GHX A;  5A91 A;  3NDG A;  1OME A;  2HZ5 A;  5GLD A;  1TDG A;  5A8B A;  3EOI A;  3VFF A;  5FQM A;  5G4Y A;  1DRM A;  4I38 A;  3S7P A;  4EBN A;  4I5S A;  4BBV A;  5I5L A;  1YAX A;  4HNB A;  4JF6 A;  5M18 A;  2ZQA A;  5KIZ A;  1YSP A;  3UE3 A;  1V9Z A;  4Q0I A;  4LRY C;  4F94 A;  3A0R A;  1MBL A;  4O01 A;  2XRN A;  1K54 C;  1IKG A;  3UB8 A;  4E3N A;  5HPF A;  1FCN A;  4NEE D;  4B4Z A;  2ZC4 B;  5A90 A;  1JTD A;  5HAP A;  2O0Y A;  1K57 C;  4OPQ A;  4WZ5 C;  3SOI A;  3ZDJ A;  3T4O A;  4I39 A;  3RXW A;  3T1Q B;  3IHA A;  1XX2 A;  3C38 A;  3FC7 A;  3P01 A;  5KZH A;  3LIF A;  1U60 A;  1BUL A;  3P09 A;  4JPM A;  4KZ9 A;  2GDN A;  4WMC A;  4B9O A;  1CF0 A;  5HL1 A;  1H5X A;  2Y4A A;  3JPU A;  2ZQ8 A;  3W4P A;  5DTT A;  4XT2 B;  5GLC A;  2V1A A;  3BEB A;  2QPN A;  4NKP A;  3ZG8 B;  1UWN X;  3IWO A;  1AWI A;  3ZYT A;  4X53 A;  2I72 A;  3B42 A;  3CAX A;  1XPB A;  2EX9 A;  3PHY A;  4OPZ A;  4DXB A;  4X55 A;  2EFX A;  1K56 A;  4ZAM A;  4O8G A;  3G2Z A;  4JF4 A;  2XD5 A;  5LBR A;  3R7W A;  2XDM A;  4Y0T A;  1MZU A;  3ZGA B;  3C4O A;  4ZDX A;  2Y2M A;  3ICY A;  5DJU A;  3IH8 A;  3A3E A;  4HJ3 A;  2OWH A;  3NEC A;  3S22 A;  1HTZ A;  3IF5 A;  2XFT A;  5HDD A;  1YLZ A;  5FA7 A;  1K54 A;  1IEM A;  5EUA A;  1DJB A;  1V9Y A;  3MZF A;  2PR6 A;  3IF6 B;  1K6S A;  1H8Z A;  2J80 A;  4XUZ A;  1XFN A;  2BAS A;  2ZQ9 A;  2HF6 A;  3SS4 A;  3MKE A;  3KSF A;  3G31 A;  4E6W A;  4XUX A;  1PZP A;  4OLD A;  1LSW A;  2PHY A;  1T1C A;  1EW0 A;  2ZC6 B;  2Y59 A;  1NRF A;  5HD3 A;  4X1M A;  3F1N A;  3C4P A;  2ZC7 A;  3H7W B;  3WS2 A;  3BYD A;  3AGF A;  4WMC D;  3CI6 A;  4EEP A;  4XT2 A;  3DTE A;  2ZQD A;  2JCH A;  3JVV A;  1MWU A;  4GS9 B;  2ZQC A;  1W63 Q;  1S6R A;  1XA7 A;  5HW3 A;  1MWR A;  4N9L A;  1KGG A;  2V0U A;  3GEC A;  5HWT A;  4WN5 A;  4BQM A;  5HAI A;  4FSF A;  2EXB A;  4MBF A;  4CJN A;  1OT9 A;  4R3B A;  5L8M A;  3K3D A;  3S7Q A;  5TFQ A;  3WWX A;  5FQK A;  3PYP A;  3LR4 A;  3CIT A;  1S67 L;  1LSV A;  1NZO A;  3MQO A;  3K2N A;  3C8C A;  4WEK A;  3CHW P;  3L7H A;  4ETZ A;  4LCL A;  3T4T A;  4ME4 A;  1RP5 A;  2M1C A;  2O9A A;  1P9R A;  2Z2M B;  5FAS A;  1JWV A;  3T1R A;  3FG8 A;  2X02 A;  5HSQ A;  2QKP A;  2RCX A;  4BMW A;  3FPW A;  4BBT A;  3KX0 X;  3GTC A;  1L3L A;  4BJP A;  5DF8 A;  3LIB A;  5L2F A;  5FAQ A;  4Y0O A;  4QY5 A;  3V3R A;  1YM1 A;  1L0F A;  4Y7P A;  2W3F A;  3OCN A;  2XGN A;  2X71 A;  4DXC A;  2ZJ9 A;  1O07 A;  4OLG A;  1ES5 A;  3LEQ A;  4FOF A;  4GZB A;  1VB6 A;  2B5R A;  3E98 A;  3LGO A;  4Y17 A;  3S4X A;  4K0W A;  2QJ5 A;  3BLS A;  2QJ7 A;  3HLC A;  1T19 A;  3DTM A;  4MN7 A;  3U4L P;  1C3B A;  3A3I A;  3FKV A;  3UE0 A;  2IWB A;  3IF6 A;  1KGF A;  4PPR A;  3IXD A;  5HL6 A;  1TS7 A;  4Y0U A;  4GHI A;  1ZC2 A;  4I3I A;  1HLU P;  5EVI A;  5CRF A;  2IWD A;  3IXB A;  3E2L A;  4EER A;  1CJF A;  4FCF A;  4K91 A;  2Y2H A;  2VGL S;  5TR7 A;  2Q9N A;  3W4O A;  2VGJ A;  3CLO A;  3NHQ A;  4ARZ A;  2GJ3 A;  4P6Z S;  3WS4 A;  2ZM8 A;  3UDF A;  5TGF A;  3IXG A;  4RVA A;  2JKT I;  3HLF A;  2ZQ7 A;  3MXQ A;  4WL9 A;  2IWC A;  2WGW B;  5CEB A;  2Z2L B;  3A3D A;  3DTK A;  4QHC A;  3O5Y A;  4WEL A;  1E3U D;  2B95 A;  3OOV A;  4Y13 A;  4R4R A;  3MSH A;  4RQ9 A;  2BG1 A;  5A93 A;  2JKR M;  3OBF A;  3LY4 A;  2A49 A;  4ZTK A;  5I94 A;  1MPL A;  1BTL A;  1K55 A;  4LRX C;  3MF0 A;  1XFQ A;  3D3O A;  2HJ9 C;  4E3O A;  5FI2 A;  1CEF A;  3MMH A;  2ZL1 B;  1NLY A;  2ACG A;  4B4X A;  1W8Y A;  4HH2 A;  4DE1 A;  5J4E A;  4KQO A;  5K5B A;  3C30 A;  2DMW A;  2VJW A;  1ALQ A;  3HCY A;  2H0Y A;  3S7N A;  5HFO A;  5HAQ A;  1ES2 A;  2W3D A;  1LSX A;  3CUE A;  4YFM A;  1I5Q A;  2V9A A;  2XQZ A;  3HLE A;  4BBU A;  1FR1 A;  1JVJ A;  5MC7 A;  4QU3 A;  2LB5 A;  4O0P A;  2JC7 A;  3E4O A;  3M2J A;  4OH0 A;  3BW6 A;  2P9V A;  3HL9 A;  3B3X A;  3LO7 A;  1PYY A;  2PU4 A;  3QP6 A;  1OTE A;  3Q81 A;  2VK3 A;  1DP9 A;  3CPT A;  4Q0H A;  1WYB A;  4QY6 A;  4OQI A;  1OTD A;  3IXH A;  3T1X A;  2K2N A;  1TS8 A;  4QPR A;  2PT7 A;  1JNU A;  4GOG A;  1XJ3 A;  1F2K A;  1T1B A;  1H0M A;  2PD7 A;  2J9P A;  3T4L A;  3FZC A;  4NET A;  3CWF A;  2Q0O A;  4U0T A;  2H28 A;  1BLH A;  1IFQ A;  1D1J A;  4BLM A;  1FIK A;  4DMZ A;  5DFX A;  2VV7 A;  2EFU A;  4JGQ A;  1BUE A;  1SKO B;  2IA2 A;  4X25 A;  3SW1 A;  2VGK A;  3T4J A;  3B47 A;  1LT0 A;  3FV7 A;  1P0Z A;  3OZH A;  4WYY A;  1PRQ A;  3BWL A;  1ZG6 A;  1QMF A;  5DJT A;  2P7J A;  1YLJ A;  5L10 A;  2R9X A;  3E4Q A;  4IBR A;  1N4O A;  2EWW A;  2UWX A;  1ZHH B;  3MXS A;  3V5M A;  3PBO A;  2WGW A;  3WS0 A;  1GA9 A;  2H5S A;  3ZQ5 A;  1D7E A;  5CHJ A;  4KEN B;  2H0T A;  2NUP C;  3GR2 A;  3Q7V A;  4A5R A;  5AQB A;  3BFF A;  4KZ5 A;  3B33 A;  4Y2F A;  4R6L A;  4Q0J A;  5TJJ A;  3LFV A;  2P9V B;  1G68 A;  2V2F F;  2ZBB A;  2B18 A;  2P74 A;  1XKZ A;  1M6K A;  2PBY A;  5BOH A;  5EPH A;  2WGI A;  3O3V A;  2P08 A;  3MR0 A;  2KX6 A;  3LUQ A;  2DCF A;  4G3V A;  3D72 A;  5CED A;  1XGI A;  4GD8 A;  1S1Y A;  4HJ6 A;  3OCL A;  2CMN A;  1YLY A;  3R7W B;  4KQD A;  4LGW A;  1NY0 A;  5G4Z A;  2OAP 1;  5F83 A;  4JKT A;  3DAV A;  4EU0 A;  1NYY A;  4R0Q A;  5EFW A;  3H82 B;  2A24 A;  1IYP A;  5FSR A;  4IVI A;  3VFH A;  4H6J A;  2PR5 A;  2FFF B;  2XR0 A;  4C75 A;  1DJA A;  1LL8 A;  4OOM A;  3T1S A;  1SKO A;  2FZ0 A;  2VV6 A;  1K6R A;  3IF6 C;  1Z09 A;  4PM7 A;  5C5K A;  3VOZ A;  4UA6 A;  4UA7 A;  2JKT M;  2A2L A;  3LI8 A;  2HGV A;  3VSL A;  3KSH A;  3LR3 A;  3PTE A;  1ZG4 A;  4BEN A;  3BJN A;  3SH8 A;  5CEC A;  2XK1 A;  2P04 A;  5F69 A;  5AVE A;  5HX9 A;  4WF0 A;  2Y55 A;  4AFI A;  5HD5 A;  4S2M A;  4G3W A;  3F1P B;  3V67 A;  2JE5 A; 
#chains in the Genus database with same CATH homology
 2V0U A;  3GEC A;  5HWT A;  2J3T D;  4WN5 A;  4II7 A;  4R38 A;  1S66 L;  4FSF A;  4YNR A;  1OT9 A;  2YKF A;  2Z6C A;  4CLC E;  5L8M A;  3K3D A;  3S7Q A;  4MN6 A;  3PYP A;  3LR4 A;  3CIT A;  1S67 L;  1LSV A;  3U2A A;  3MQO A;  1T18 A;  3K2N A;  3C8C A;  4WEK A;  5TBM B;  5IT5 A;  1KOU A;  1OTB A;  4ETZ A;  5HWV A;  2VLG A;  3T4T A;  4ME4 A;  3EEH A;  2M1C A;  2O9A A;  1P9R A;  2LB9 A;  4JGO A;  3UB6 A;  3FG8 A;  5HSQ A;  2QKP A;  3EGD C;  2WKP A;  4BMW A;  3FPW A;  4BBT A;  4WLA A;  1GSV A;  1XJ6 A;  3KX0 X;  3OC2 A;  4LRZ E;  4F3L B;  1OTI A;  4CLC A;  4BJP A;  4EXO A;  3LIB A;  4NXG A;  3KO6 A;  1DP8 A;  1D06 A;  3F1O B;  2XA7 M;  1T1A A;  2KLI A;  2GX5 A;  3G6O A;  4HOI A;  4MDZ A;  3VV4 A;  2QYB A;  2L1M A;  5IU1 A;  3A0V A;  4CLC B;  3KYQ A;  3LYX A;  3EEA A;  2HV1 A;  3UB7 A;  3JVU A;  2W3F A;  3OCN A;  1YKD A;  3T50 A;  1ZTU A;  3KYZ A;  4R3A A;  5DKL A;  2W1T B;  4HP9 A;  4CQH A;  2R78 A;  1P9W A;  3PBT A;  4KUO A;  4DN0 A;  2VA0 A;  1OTA A;  3KSG A;  4HP4 A;  4FOF A;  1VB6 A;  2J3T C;  1TD5 A;  2OWJ A;  4M4X A;  2W3E A;  5CX7 A;  2HJE A;  3E98 A;  3MFX A;  2OAQ 1;  2JN7 A;  2QJ5 A;  2VZW A;  3LIC A;  3HJK A;  4NXB A;  1N9N A;  2QJ7 A;  4OOL A;  1NRJ A;  1T19 A;  4P6Z M;  2VX8 A;  4MN7 A;  4ARZ B;  3K3C A;  2INW A;  5HDC A;  3VOL A;  4WEJ A;  4JGR A;  5HL6 A;  1TS7 A;  4EQ1 A;  4GW9 A;  4GHI A;  3NOP C;  2M7V A;  4G3K A;  4I3I A;  3MQQ A;  1UWP X;  2K31 A;  4E04 A;  5AJG A;  1H3Q A;  2EWV A;  2D02 A;  2VKS A;  4EER A;  1WA9 A;  1S1Z A;  4PKY A;  1P97 A;  4HIA A;  2VGL S;  3T4K A;  5KSH A;  2JHE A;  5IS1 A;  3PBS A;  3CLO A;  3NHQ A;  4ARZ A;  2GJ3 A;  4P6Z S;  3PR6 A;  4IUK A;  1S4R A;  4YWZ A;  3LID A;  3VE4 A;  2O9B A;  3BY9 A;  5HWW A;  2Z6D A;  3EGX C;  2JKT I;  2I9V A;  3LR0 A;  2W1T A;  4IJG A;  4L9E A;  1VHM A;  3MXQ A;  4WL9 A;  2W27 A;  3LR5 A;  3CUE C;  4ETX A;  5F68 A;  4HHD A;  1TS0 A;  3IBJ A;  4LLO B;  3MQ0 A;  4WEL A;  3O5Y A;  2L4R A;  1S4S A;  4HJ4 A;  3OOV A;  5DKK A;  3F1P A;  4R70 A;  3UB9 A;  4RQ9 A;  4MMN A;  2GZA A;  2JKR M;  3T4Q A;  4LPZ A;  3OBF A;  1Y28 A;  3TJZ C;  2VGL M;  2PYR A;  4LRX C;  3MF0 A;  2FH5 A;  1GSX A;  1XFQ A;  3T4S A;  3ULF A;  3D3O A;  2HJ9 C;  3BQ8 A;  2MJ6 A;  2KDK A;  3MMH A;  3GDI A;  2JKR I;  1F98 A;  2WKQ A;  1NWZ A;  1NLY A;  3E0Y A;  4DJ3 A;  3TRC A;  1YSQ A;  2B02 A;  3EQU A;  3R4K A;  4HH2 A;  1XJ2 A;  1BYW A;  5J4E A;  4KQO A;  5K5B A;  4I3J A;  4CLC C;  3C30 A;  2DMW A;  2YKH A;  2VJW A;  3HCY A;  4UEY A;  3S7N A;  4L9G A;  3EWK A;  2QWS A;  5J7E A;  2G7U A;  4GCZ A;  1MC0 A;  2M7U A;  2W3D A;  1LSX A;  3CUE A;  2V9A A;  3MJQ A;  4UQI M;  1STZ A;  4BBU A;  4NXE A;  5MC7 A;  1DP6 A;  2XRO A;  3LI9 A;  2LB5 A;  3BY8 A;  2L0W A;  4GJ4 A;  4O0P A;  4B93 A;  4CLC D;  4GS9 A;  1NLZ A;  3E4O A;  2O99 A;  3NOU C;  3H82 A;  2ZMF A;  3TW8 A;  3BW6 A;  4PHT A;  1F5M A;  2ZMV A;  3F1O A;  2Y79 A;  1OT6 A;  1OPX A;  4F3L A;  1OTE A;  5HPI A;  1OJG A;  1DP9 A;  4WUJ A;  5F6A A;  3IS2 A;  2W1R A;  4Q0H A;  5HZH A;  3OLO A;  3F1N B;  4Y5F A;  1OTD A;  2D01 A;  2K2N A;  1TS8 A;  3LIA A;  4Y3I A;  4QPR A;  2PT7 A;  3P7N A;  2NUT C;  1JNU A;  4BWI A;  1XJ3 A;  1T1B A;  3IS2 B;  5A8B A;  2O9C A;  2PD7 A;  3EOI A;  4KUK A;  1TS6 A;  5G4Y A;  1DRM A;  4I38 A;  5DF9 A;  3S7P A;  3T4L A;  3PBN A;  4I5S A;  3CWF A;  4BBV A;  5I5L A;  1YAX A;  2H28 A;  1ODV A;  1IFQ A;  4HNB A;  4DMZ A;  5DFX A;  1UGU A;  4GLQ A;  5KIZ A;  2VV7 A;  4JGQ A;  1YSP A;  3H7W A;  3KSI A;  3UE3 A;  1V9Z A;  4MN5 A;  4LRY C;  2IA2 A;  4Q0I A;  4UQI S;  4EES A;  3A0R A;  4O01 A;  3SW1 A;  4IUH A;  2XRN A;  2V0W A;  1MKM A;  3S7O A;  2QHK A;  3T4J A;  5AVF A;  3UB8 A;  1IOU A;  3B47 A;  1LT0 A;  5HPF A;  1P0Z A;  4GHI B;  3UME A;  4NEE D;  3BWL A;  5DJT A;  2P7J A;  2Y8H A;  3W2Z A;  2O0Y A;  4I3A A;  2VEA A;  4L0L A;  3E4Q A;  4MCW A;  2EWW A;  1ZHH B;  2V1B A;  3PBO A;  3T4O A;  4I39 A;  4JGP A;  2OOL A;  4HI4 A;  3ZQ5 A;  4EW7 A;  1D7E A;  3C38 A;  3FC7 A;  3P01 A;  2NUP C;  4EUV A;  1F9I A;  4H6J B;  3LIF A;  3B33 A;  2W3H A;  4B9O A;  4Y2F A;  2K7S A;  2W0N A;  4R6L A;  4Q0J A;  2ZOI A;  5TJJ A;  3LFV A;  4Z1W A;  3PXP A;  4EET B;  2ZBB A;  2B18 A;  2J3W A;  5HDS A;  4XT2 B;  2V1A A;  4PKY G;  4NKP A;  1UWN X;  2GNX A;  3RFB A;  3ZYT A;  3B42 A;  2P08 A;  3CAX A;  3MR0 A;  2KX6 A;  3EQV A;  3LUQ A;  2W3G A;  3A0S A;  3PHY A;  4G3V A;  1OJ5 A;  3D72 A;  1S1Y A;  4HJ6 A;  2A24 B;  4ZRR A;  3NOT C;  3H9W A;  3OCL A;  2CMN A;  3RTY A;  3FPV A;  3DBA A;  3R7W B;  4KQD A;  2ZOH A;  1TF1 A;  4O8G A;  4YOF A;  5FL3 A;  5G4Z A;  2OAP 1;  2XSS A;  1N9O A;  5LBR A;  3R7W A;  4EU0 A;  4PAU A;  4EEU A;  1MZU A;  5EFW A;  3H82 B;  2A24 A;  3ICY A;  3LIE A;  5DJU A;  1XJ4 A;  1GSW A;  4HQA A;  2PDR A;  4HH3 A;  4HJ3 A;  2OWH A;  4L9F A;  4NXF A;  4H6J A;  5HDD A;  2PR5 A;  4IHQ A;  3RH8 B;  2PYP A;  3PBQ A;  1LL8 A;  4OOM A;  1V9Y A;  2FZ0 A;  2VV6 A;  2PR6 A;  5C5K A;  2J80 A;  5DFY A;  5TBM A;  2PD8 A;  3NJA A;  2JKT M;  3TE8 A;  2A2L A;  1XFN A;  2BAS A;  3LI8 A;  2HF6 A;  3VE3 A;  3E4P A;  3KSF A;  2HGV A;  2EA9 A;  1G28 A;  3UE6 A;  1LSW A;  4HY8 A;  2PHY A;  1N9L A;  1T1C A;  1X0O A;  1EW0 A;  3HJI A;  3KSH A;  5HD3 A;  3LR3 A;  3F1N A;  5J3W A;  3C2W A;  3BQA A;  1G6O A;  3H7W B;  1W63 M;  2VV8 A;  3CI6 A;  3PBR A;  4K08 A;  3BJN A;  4EEP A;  4DJ2 A;  4XT2 A;  1H8M A;  3JVV A;  2XA7 S;  4GS9 B;  2P04 A;  5F69 A;  5AVE A;  1W63 Q;  4WF0 A;  3IBR A;  2KOI A;  4AFI A;  5HD5 A;  5F5Y A;  4G3W A;  3F1P B;  3UMD A;  3V67 A;  2WKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...