2INWA

Crystal structure of q83jn9 from shigella flexneri at high resolution. northeast structural genomics consortium target sfr137.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
TLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGGELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative structural protein
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Shigella flexneri
total genus 21
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2inwA01
1V9ZA 5HWWA 4GCZA 1F98A 4HJ4A 5HWTA 3ZQ5A 1P0ZA 1S1YA 2D01A 3ICYA 2GJ3A 3BWLA 4NXGA 1ODVA 5AVFA 5KIZA 2PD7A 3VOLA 3EEHA 5DKLA 5IU1A 3A0VA 4WUJA 4PKYG 3NOPC 3K3DA 2V1AA 3PYPA 3P7NA 2CMNA 1S4SA 2L0WA 2QJ5A 3VE4A 4HH3A 4WN5A 2BASA 3PHYA 3NJAA 1DP6A 3MQQA 4F3LB 2A24B 3LIAA 4GW9A 1XJ2A 2VEAA 1N9OA 2QKPA 5F5YA 2QHKA 4HI4A 2J80A 3BY8A 3F1OA 2YKFA 4K08A 1OTEA 4GHIA 4I3IA 3LIFA 5J7EA 4R70A 1XFNA 5J4EA 3CWFA 4R3AA 1D06A 3MFXA 2HV1A 2KX6A 3C2WA 1DP9A 5HDSA 4RQ9A 3H82B 1BYWA 4BBVA 1OTDA 3LUQA 1GSWA 4HP9A 3A0SA 4H6JA 4WL9A 4EERA 2H28A 2W0NA 1JNUA 2VV6A 2ZOIA 3HJKA 1Y28A 3CLOA 3UB9A 5TBMA 2R78A 3E4OA 4HP4A 1EW0A 1N9NA 2QWSA 1GSVA 2P7JA 3F1PA 2INWA 4I3AA 4BBUA 2D02A 5HDDA 3K3CA 4JGPA 4YWZA 3EWKA 1OJ5A 4DJ3A 2Z6CA 3H7WB 3B33A 3UB7A 1OT9A 2VV7A 1DRMA 2OWHA 3KX0X 1T1AA 3IS2B 3RH8B 3NOUC 4M4XA 4B9OA 3F1OB 3GECA 4GHIB 3LI8A 1XJ6A 4KUKA 3LYXA 2I9VA 2L4RA 1S67L 4EW7A 2VV8A 4L9FA 4PKYA 1VB6A 3G6OA 3LI9A 3HJIA 4XT2B 1T1BA 4JGQA 5DJUA 3RTYA 5J3WA 1KOUA 4LRXC 4HIAA 5G4ZA 1LSXA 4HNBA 1XJ3A 2VLGA 2WKQA 3OLOA 1LL8A 1TS0A 5TBMB 4E04A 4I39A 1OTBA 5IS1A 2PHYA 2JHEA 2A24A 1V9YA 3E4QA 1OT6A 3F1PB 2WKRA 4DJ2A 1S66L 2OOLA 1MZUA 1UWNX 3GDIA 3MXQA 2Z6DA 4HJ3A 3MR0A 4GS9A 2PR6A 5G4YA 1S1ZA 1G28A 2L1MA 3CAXA 2PD8A 4I38A 3LICA 1GSXA 5HSQA 5F68A 1UWPX 1NWZA 5EFWA 1T19A 5AVEA 3H82A 5HD3A 4JGRA 2YKHA 3VE3A 5HDCA 3LIBA 3A0RA 2PR5A 2PYPA 4LPZA 1D7EA 4I5SA 4LRYC 4EEPA 2M1CA 5I5LA 3SW1A 1N9LA 2KDKA 1TS7A 2ZBBA 3BY9A 5F69A 1LSVA 1TS8A 4R6LA 1LSWA 3D72A 4HOIA 4NXFA 3UB6A 4HJ6A 1OTAA 4NXBA 4EESA 3F1NA 1S4RA 3T50A 1F9IA 4WLAA 3H9WA 2K7SA 3UMDA 2ZOHA 1DP8A 3H7WA 4L9GA 4BBTA 1XJ4A 3NOTC 4H6JB 3IS2A 4KUOA 4R38A 2JN7A 3MJQA 2OWJA 2V9AA 4I3JA 3LIDA 3UB8A 5F6AA 4EQ1A 2B02A 4L9EA 4KQDA 2W27A 4HY8A 3NHQA 4GS9B 3E4PA 4F3LA 3ULFA 1TS6A 4WF0A 4EETB 3LIEA 4LRZE 5HD5A 4HQAA 3C8CA 3FC7A 3UE6A 5DKKA 1P97A 2EA9A 2WKPA 4XT2A 5HZHA 2V1BA 4NXEA 1LT0A 2V0UA 5A8BA 4JGOA 4HH2A 5DJTA 2QJ7A 4HHDA 2PDRA 4EXOA 1T18A 1WA9A 4LLOB 5HWVA 3UMEA 1OJGA 1UGUA 3F1NB 1OTIA 1X0OA 3FG8A 4MN5A 1T1CA 3IBRA 3MQOA 1XFQA 4EEUA 2PYRA 4MN6A 2V0WA
chains in the Genus database with same CATH superfamily
4HJ4A 5HWTA 3V3RA 2D01A 3ICYA 3NC8A 2XA7S 3D9YA 4ARZB 4KZ6A 1JWPA 3BWLA 2VZWA 5CECA 4DE1A 1PW8A 1ERMA 3UO9A 3VOLA 2HPBA 5CTMA 5FQ9A 4ETXA 5DKLA 1PWDA 3LGOA 3G30A 3BJNA 1G68A 4JXWA 3BEBA 2V1AA 1YT4A 3QP2A 2VGLS 3QNCA 3PBOA 1TDGA 3EEAA 4RX2A 4F3LB 1VETA 3VFFA 2ZC7A 1XP4A 4Y13A 1GCEA 2VEAA 2I72A 5M1AA 4E3NA 2QKPA 3LY4A 4JXSA 2WGWB 2QHKA 3IBJA 2O9CA 3GSGA 4OOYA 2IWBA 3JPUA 4CLCD 5J7EA 2HP9A 4GD6A 1KVMA 3IX8A 2Y2PA 5CGSA 2ZC5B 2ZJ9A 3C2WA 1A0KA 1DP9A 4JXGA 3QP1A 1GHMA 4C6YA 2XQZA 4E3JA 4DXBA 1KGFA 4YINA 3H82B 1BYWA 4BBVA 1JWZA 1OTDA 1RGYA 4N1HA 4HP9A 4OLGA 1IKIA 4EERA 4H6JA 2H28A 4E3OA 1JNUA 2VV6A 5CEDA 3MBZA 4LCLA 1GA9A 1H8YA 1FOFA 2VGKA 2ZMFA 1Q2PA 5AQAA 2O0YA 5TR7A 3UB9A 3JVUA 1P9WA 3S1YA 2Y59A 3IF6C 1W79A 3FPVA 3SOIA 4EUZA 4HP4A 4Z1WA 4UA6A 3R7WB 2QWSA 4OKPA 1PFLA 1SDEA 2P7JA 3MXSA 1LL9A 4BBUA 4UAAA 2D02A 5HDDA 4YWZA 1OJ5A 1STZA 1IYSA 5LBRA 3S7QA 4U0XA 1S6RA 5A93A 3UB7A 4OVDA 3OZHA 5FI2A 1DRMA 3KX0X 2V20A 3VOZA 2XA7M 2IA2A 1KGGA 3IF6B 3IWOA 1K57A 4OQGA 5GHXA 3ZG8B 4WMCA 2H10A 3N7WA 3UY6A 5CHUA 3O3VA 3L9KA 2I9VA 3KYEA 2B18A 5DTSA 4NETA 3WWXA 4KG6A 5EVID 3DAVA 2VGLM 3S4XA 4EW7A 4PKYA 4II7A 3G6OA 3LI9A 3RXXA 4XT2B 1YLZA 5FQMA 2XRNA 4P6ZS 1T1BA 3IXHA 3VP1A 4Y2FA 4EBLA 1ES5A 4HIAA 5G4ZA 1LSXA 2ZQAA 4OPYA 2VLGA 3T12B 5TBMB 4XUZA 4E04A 1N4OA 2PT7A 3QP4A 4N9KA 4JBFA 2PHYA 2ZM8A 3N8RA 2JHEA 3LEQA 1K55A 2ZLYA 2A24A 3ITBA 1K56A 1MWSA 3RXWA 1W8QA 3DWKA 1MZUA 2EWWA 4IVIA 5FSRA 2JKTI 1H0MA 2PR6A 4G3WA 4WBGA 1S1ZA 2VX8A 2L1MA 5GHYA 2E8JA 2Y2LA 4I38A 4R3BA 4Z9QA 3UDFA 1GSXA 2C6WB 2OV5A 4PM5A 2IWDA 2VKSA 2WZZA 1ESIA 1TEMA 5AVEA 3SH8A 4JGRA 4UEYA 3QHYA 4RYEA 1U60A 4BENA 4JKTA 1H8ZA 1HTZA 3HLFA 1YSQA 1TF1A 1LLBA 3ZG9B 4EEPA 2B95A 2M1CA 5I5LA 3BRMA 1IYOA 5F69A 3ZNTA 5MC7A 3D72A 3MSHA 1H5XA 1YMXA 1ZG4A 3T4LA 3NDEA 1AWIA 4UQIS 3VV4A 4NXFA 2UWXA 3PR6A 3VSKA 4RVAA 5FI6A 3TOIA 3GV9A 4NXBA 1ZHHB 2M7VA 2JKRM 1S4RA 4JF5A 4K0XA 2Y8HA 4WLAA 1Z6FA 3N6IA 4MBKA 2MJ6A 2K7SA 4Y5FA 2ZOHA 1RP5A 2VGJA 2Y91A 1BLSA 3LR4A 3LY3A 2GDNA 4MBHA 3SH7A 1NY0A 4U0TA 1KE4A 1W7FA 3T4QA 1XJ4A 5GL9A 3S7OA 2LB9A 4GD8A 3G31A 1K54C 2A2LA 5HAQA 1HVBA 5CRFA 4EUVA 5A90A 4DMZA 1NLYA 4X6TA 4EQ1A 5F6AA 4R4SA 4D60A 3NECA 1KVLA 4KZ8A 4KQDA 3E98A 2W27A 4HY8A 4ETZA 2OLVA 3NHQA 4KQRA 1TS6A 4EETB 2H0YA 3BFFA 5DF8A 1FSWA 3LIEA 3KSHA 4HQAA 3C8CA 1CQAA 4LV0A 1O07A 3V50A 3IWQA 1I2WA 1DY6A 5HZHA 4FUWA 5HL6A 2JKRI 5FAQA 3V5MA 2XD5A 2XLNA 1NJ4A 2DRWA 3DBAA 1LT0A 5A92A 4N9LA 5E2FA 4CLCE 2PU2A 5DJTA 3W4QA 2QJ7A 3N8LA 3NIAA 2PU4A 2CC1A 3VOYA 4IUHA 1NRJA 3UMEA 4S2IA 4PM7A 2Q9NA 4MLLA 1OTIA 4KZ5A 2AVXA 4Y0OA 3BECA 4GCZA 3C4OA 4IBRA 3ZQ5A 1YLJA 3IHAA 2NUPC 2GJ3A 4MCWA 4X68A 4O8GA 1ODVA 1FCMA 3V67A 2HDRA 4XUXA 2PD7A 1SKFA 2Y2MA 1NYMA 3CPTA 1PW1A 5HX9A 3A0VA 3KSIA 4O01A 3NOPC 3A3JA 1K6RA 4WEKA 4QHCA 3PAEA 2O9BA 3E2LA 2QJ5A 3VE4A 4HH3A 2BASA 2W1RA 4EQIA 3IH8A 3D4FA 3FWLA 4DE0A 2WKEA 3ZNYA 1N9OA 2XR0A 3P09A 5F5YA 5DVAA 1E3UD 2J80A 3O87A 3F1OA 1GA0A 1OTEA 2W3GA 4IVKA 4I3IA 4CQHA 1W5DA 2JE5A 2GNXA 3IQAA 5J4EA 2XD1A 4R3AA 1K38A 2PBDP 1VEUB 1BT5A 5EOOA 1W63M 5CX7A 1K4EA 2WZXA 5GLDA 2Y2KA 2Y2HA 5L10A 3WS0A 2P9VA 3JVVA 2ZC4B 1S0WA 1PI4A 2W3HA 3A0SA 3BLSA 2ZOIA 2H5SA 2Z2LB 1XX2A 1Y28A 3ZG5A 1IYQA 4MEZA 2XEPA 4X69A 2OAP1 2R78A 1YKDA 3UN7A 3BLMA 5EVIA 4DDYA 3UE1A 1GSVA 5IT5A 4DKIA 3F1PA 4I3AA 1IOUA 3MZEA 2J3TC 3BW6A 4JXVA 5DF9A 3K3CA 3M6BA 2PBYA 3PTEA 4FOFA 3HUMA 3H7WB 4Q0HA 3SS3A 1OT9A 2XFSA 2QPNA 3NCKA 1KDWA 1XGIA 2BG1A 2GZAA 3VP2A 3IS2B 3AGDA 1IELA 2JC7A 2QMIA 3FKWA 3HLCA 2HZ5A 3NY4A 3WRTA 2RL3A 3ZHHA 4L0LA 2OAQ1 3FPWA 2WAFA 3KSGA 5EPHA 3W2ZA 3MXRA 4G3KA 1FCNA 2Z2MB 3LR5A 3UE3A 4CPKA 4BD0A 2Y2OA 4YOFA 4OPZA 1MPLA 1S67L 3N4IA 2ZL1B 4IEDA 4ARZA 1CI8A 1VB6A 1YPRA 2EX8A 3HJIA 4WZ5C 4JGQA 5DTKA 2ZC3B 5J3WA 3E0YA 5D3OA 5CHJA 5EVEA 4E3MA 2K2NA 4PM8A 2XF3A 4QU3A 4BL2A 3Q82A 2WKQA 2PAVP 1LL8A 3PAGA 1TDLA 1TD5A 1YLWA 1BUEA 1K57C 1ZKJA 3CG5A 4GN2A 3MKEA 4UA9A 3FV7A 2Q0OA 5JYOA 2W1TA 1KE3A 3RFBA 1S66L 2M7UA 1XPBA 1XGJA 5DFXA 5JYPA 4FH2A 2Z6DA 3BFDA 5CTNA 3MS6A 3HUNA 3WS5A 1WYCA 4X55A 4GOGA 3LICA 5F68A 5EFWA 1T19A 1PZPA 3DTKA 3H82A 4DE2A 1QMFA 3VE3A 4NG2A 2O9AA 1FQGA 3LIBA 4ID4A 2PYPA 1D7EA 5F83A 4LRYC 3SW1A 4YFMA 1N9LA 1TVFA 4KZ4A 4BD1A 2PRFA 1FR6A 1EI5A 1K55C 1TS8A 3HLBA 1LSWA 1L3LA 5EM0A 3Q7VA 1OTAA 2WADA 1ZC2A 3T1QB 2JKTM 4WZ4A 5FATA 3R7WA 5CERA 2ACGA 4LFUA 2JBFA 1DP8A 4Y0UA 1PIOA 2EX9A 4S2MA 3NOTC 4BMWA 3ISGA 2HJ9C 3O88A 5L07A 1YM1A 3O86A 4IJGA 1FCOA 2JKGA 3Q81A 3LIDA 3UB8A 5KMWA 5KSCA 4OLDA 4R23A 2BTFP 5KSHA 4NKPA 5J8XA 3Q1FA 1AXBA 4UA7A 4OQHA 4LCMA 3E4PA 4DDSA 3BFGA 3ULFA 3LEZA 3ZCZA 1JWVA 3HVFA 3BQAA 3DTIA 3OPPA 4R3JA 1C3BA 2HF6A 3IH9A 3W8KA 3FC7A 3CUEC 4Q0JA 1WE4A 3QP5A 4ZJ3A 1YLPA 2EA9A 4XT2A 5AQBA 2V1BA 3FKVA 3G2YA 2ZQ7A 4B93A 3E2KA 2XH9A 4ZBEA 3ZVTA 5A8BA 4E3LA 3C7VA 4NEED 2HDUA 5EVLA 3VP3A 3EGXC 1LI0A 4EXOA 4YNRA 5GLCA 1T18A 5TGFA 3BM6A 3OBFA 1WA9A 1SKOB 1UGUA 2ZD8A 1PI5A 4R0QA 3IX3A 4OH0A 3LO7A 1BULA 4HBTA 3FG8A 3MQOA 4HESA 2J3TD 4KZ9A 1YMSA 4MBFA 5HWWA 3DW0A 1MXOA 4EBPA 1IYPA 5M18A 2E8IA 5CXWA 4NXGA 3HUOA 2Y2QA 3U4LP 2JCHA 2FZ0A 5GHZA 5AVFA 4Y17A 5G18A 5HAIA 4GKUA 1G6AA 3Q07A 3EEHA 4P87A 5FA7A 4IHQA 2DNSA 4DE3A 3T4KA 5IU1A 4EU0A 1IKGA 4WUJA 3VP0A 2R9WA 1RGZA 4N1XA 4RX3A 3OOVA 2IWCA 3AGFA 3P7NA 2CMNA 1S4SA 3UB5P 5FEGA 1Q2QA 3NULA 4GW9A 3WS2A 1DJBA 4HI4A 3ZVWA 1MWUA 4O0PA 3BY8A 3ITAA 4K08A 2V8FA 4GHIA 2EXBA 3P01A 4AFIA 2P08A 3IHBA 1JVJA 5CGXA 4BL3A 3LIFA 3BFEA 1ZTUA 4K91A 3ZDJA 3CWFA 4P6BA 1D06A 3SZTA 3M2JA 4KG5A 2KX6A 3WS1A 5HDSA 4RQ9A 3D3OA 1HZOA 3SS5A 1NZUA 5A91A 1CJFA 4EBNA 4H8RA 3LUQA 1GSWA 2WGVA 4WMCD 3QNBA 2A3UA 3LCEA 4WL9A 2W0NA 1LI9A 3SS4A 3C5AA 5HFOA 3A3IA 2WKHA 3HJKA 4KQOA 3UPOA 4S2JA 1L0FA 1L0DA 3V3SA 1EW0A 1N9NA 2Y2IA 1XXMA 2VA0A 3CPTB 5E2EA 5FAPA 1K54A 4CLCA 4OPQA 4QWOA 1XA7A 5FASA 3PBRA 4OP5A 5EOEA 2GX5A 1W63Q 4LV1A 2OWHA 2V2FF 1T1AA 4P85A 4Q0IA 2HDQA 4Q8IA 2ZM2A 4KZ3A 4X53A 2V1ZA 4OQIA 2J3WA 1K56D 1DJAA 5HW3A 4M4XA 4ZTKA 5F1FA 4B9OA 2DMWA 3F1OB 4GB7A 1VQQA 4OQ0A 2ZQDA 4FTXA 4E3KA 1XJ6A 4ME4A 3DWZA 4GZBA 4KUKA 4XXRA 1M6KA 3T4SA 5FI7A 3EQUA 2VV8A 2JKFA 3S7NA 4OOLA 1YLTA 2P9VB 4FD8A 4R1GA 3QP6A 2FFFB 2WUQA 5DJUA 3RTYA 4UHUA 3WS4A 5HAPA 4GLQA 4LRXC 2Y4AA 4QPRA 5AQ7A 1YAXA 3CI6A 2G2WA 1XJ3A 3C30A 4LV2A 3OLOA 1PWGA 1TS0A 4I39A 2UV0E 4OP8A 4C75A 4EWFA 2WAEA 2R9XA 1PYYA 1V9YA 5L8MA 3MQ0A 3E4QA 2XFTA 3F1PB 2J8YA 2WKRA 4DJ2A 3DTEA 4PPRA 5FQJA 2OOLA 1J9MA 1ALQA 4X1MA 1EWZA 5L09A 3MXQA 1ACFA 1MBLA 4HJ3A 2HJEA 4GDBA 3MR0A 4GS9A 1CEFA 3NI9A 1G28A 1KGEA 5IHVA 3B3XA 2PD8A 3G32A 4LV3A 5FDHA 1NWZA 3BYDA 3VMAA 3W4PA 2WGIA 4OPRA 5HD3A 3BFCA 5EM1A 5HDCA 4S2NA 1L0GA 4LPZA 1ZG6A 2NUTC 1VETB 3VFHA 5GLAA 1WYBA 2HP6A 3IT9A 5FEFA 4Y0TA 2ZQ9A 4R6LA 4HOIA 5FQQA 4E6WA 4QD4A 3UDIA 4FSFA 3EOIA 3F1NA 3OCLA 3HL9A 3IXDA 3AGEA 4E3IA 4QY6A 3KYQA 4S2OA 1ES4A 3LR0A 1YQSA 1I2SA 2LB5A 4KENB 4M3KA 5EUAA 3UPPA 3VP4A 3H7WA 3FYZA 4U3TA 1XKZA 1CF0A 5E2HA 1BLPA 4HEFA 4ZAMA 1CEGA 4BBTA 1N9BA 2W3EA 2J9PA 4ZJ1A 4IUKA 4H6JB 3IS2A 4KUOA 1JTDA 1G6OA 2JN7A 2W1TB 3MJQA 4A5RA 3KYZA 1GHPA 3EQVA 2B02A 4BJPA 4DXCA 4JLFA 4F3LA 4QB8A 4OOMA 2WGWA 4S2PA 4LRZE 4P0MA 5HD5A 2ZL1A 1ES2A 3MZFA 2G7UA 3UE6A 4WM9A 4Y15A 1P97A 3FZCA 5L2FA 3UDXA 3B47A 1ONHA 3OC2A 3HLDA 3LFVA 4KZAA 4WYYA 4JGOA 1BLCA 4HH2A 3O5YA 2WK0A 4BQMA 3CITA 3MKFA 2A49A 1O7EA 1F5MA 2Q9MA 2PDRA 4GNUA 4B88A 4KG2A 3RJUA 3Q7VB 4LLOB 4X56A 2XK1A 2KLIA 1MKMA 1KDSA 3TW8A 1T1CA 4ESPA 3TE8A 5EE8A 2PYRA 1FR1A 4WZ5A 5HPIA 1V9ZA 2EX6A 4X25A 1F98A 2XGNA 1K0KA 1P0ZA 1S1YA 3P98A 1Y54A 4B4XA 4ZDXA 3HBRA 2J7VA 5KIZA 3GVBA 3HLWA 3ZGAB 1H3QA 3JYIA 4WELA 3C4PA 2QZ6A 3IXBA 2WKIA 2OLUA 2HDSA 1G5UA 4PKYG 3OPRA 4QJGA 1XA1A 3K3DA 4GDNA 2P74A 3PYPA 1SZVA 3CMZA 2V8CA 2EWVA 2L0WA 1M40A 4ZJ2A 1L2SA 3G34A 4KQQA 4WN5A 3PHYA 3NJAA 3UNWA 1DP6A 2DCFA 3MQQA 1H8MA 2A24B 1E25A 3LIAA 3HLEA 1KE0A 1XJ2A 3IF6A 1JTGA 4DRTA 3CJMA 1MY8A 4Y7PA 1E4DA 4N92A 1SDNA 2YKFA 1YLYA 3T4OA 1NLZA 3TRCA 4FH4A 3T1XA 1HD8A 1XFNA 3OPHA 4R70A 3VSLA 3GMWA 3MFXA 2HV1A 3T4TA 3I7JA 5HPFA 4GJ4A 3UE0A 1K6SA 3TJZC 3EGDC 1BTLA 3W4OA 5CHMA 3IXGA 5FAOA 3TSGA 1SHVA 5FDSA 3GR2A 2FH5A 3CLOA 2G2UA 4KZ7A 1FIKA 2ZM0A 4JPMA 2KOIA 2FFYA 1LL5A 5TBMA 2HGVA 4LENA 1L0EA 4RA7A 2O99A 3NDGA 3E4OA 3KSFA 3UPNA 3V39A 1E3UA 5M19A 2Y79A 2INWA 1MWTA 2XROA 2J9OA 2RCXA 3N8SA 4JGPA 1J3WA 3OPLA 3EWKA 1BZAA 1ES3A 4DJ3A 5GLBA 2Z6CA 3QP8A 3M2KA 4OONA 5TJJA 1ESUA 1P9RA 3B33A 3ZFZA 3OCNA 4MMNA 4NK3A 3DTMA 1NRFA 2VV7A 1LHYA 5HARA 3RH8B 2BLSA 4E6XA 3MMHA 5U47A 1VM1A 3NOUC 2ZMAA 3GECA 1SKOA 4GHIB 4BLMA 3LI8A 2X02A 1ERQA 3CUEA 4JF6A 2EX2A 3LYXA 3GRJA 5BOHA 2L4RA 4FCFA 2EFUA 4L9FA 3ZYTA 4S2LA 3KO6A 4G3VA 5HL1A 3SH9A 5AQ9A 3G35A 3Q7ZA 4CLCC 3WRZA 1NXYA 2VJWA 1KOUA 1VHMA 5CEBA 1Z09A 1BSGA 4DN0A 3LR3A 1YSPA 1Y4OA 4HNBA 1ONGA 2QYBA 4P6ZM 4CJNA 5I94A 3MZDA 1OTBA 3R4KA 5IS1A 3ZG0A 4JF4A 1K25A 1D1JA 3IF5A 5DF7A 1OT6A 2XDMA 4PM9A 4PAUA 4LGWA 2W3DA 3PXPA 2Y55A 1MC0A 1UWNX 1DJCA 4CLCB 3PBSA 3GDIA 3GQZA 5CGWA 3PBQA 3HREA 2K31A 5G4YA 4ZRRA 2P04A 4MN7A 3C7UA 3BQ8A 3K2NA 3M6HA 2Y2JA 1IFQA 5DFYA 4PM6A 3CAXA 3IX4A 1RCJA 5HSQA 1UWPX 1QMEA 2W3FA 3S22A 4S2KA 1BLHA 3IWIA 4QY5A 1OMEA 2YKHA 2WYXA 3A0RA 2PR5A 4I5SA 4IBXA 1PRQA 2HP5A 3CZDA 5F82A 3MF0A 5EECA 1FILA 4B4ZA 2KDKA 2X01A 2ZC6B 1TS7A 4KZBA 2ZBBA 3BY9A 4X1LA 3L7HA 5DTTA 1LSVA 4C3QA 5K5BA 5F1GA 2C5WB 2X71A 3UB6A 3C38A 4HJ6A 3TG9A 4EESA 5C5KA 3T50A 1F9IA 1PWCA 4D2OA 3ZG7B 4PHTA 3H9WA 3PBNA 4R4RA 4UQIM 5TFQA 3UMDA 2ZQ8A 5E43A 5EVIC 2OSUA 1W8YA 5FQIA 1CK3A 2Y2NA 2EXAA 2XSSA 4L9GA 4MDZA 1SCWA 4BWIA 3T4JA 1IEMA 2ZQCA 1PNEA 1PZOA 4R38A 4DF6A 2VK3A 5EV0A 1NYYA 4S2NC 1K4FA 2OWJA 2V9AA 4I3JA 4L9EA 3B42A 2Y2GA 3G4PA 3MFDA 4F94A 5E2GA 1MWRA 3HLGA 4GS9B 4EV4A 4K0WA 5EVIB 3U2AA 1NZOA 5FQKA 4WF0A 5FL3A 3T1SA 1FSYA 3CHWP 3NBLA 1HLUP 4O7DA 1OPXA 1CI9A 2H0TA 5DKKA 2B5RA 4MNRA 2WKPA 4Y3IA 1F2KA 3A3EA 4NXEA 3S7PA 5AJGA 2V0UA 1VEUA 1MKIA 1GHIA 2EFXA 3A3FA 4PMAA 4HHDA 3GTCA 3HCYA 3T1RA 5HWVA 1OJGA 4HBUA 3PBTA 3F1NB 2ZMVA 4WEJA 3G2ZA 1X0OA 4MN5A 1I5QA 3IBRA 1XFQA 4EEUA 4MN6A 3A3DA 5KZHA 2V0WA 1EROA
chains in the Genus database with same CATH topology
1V9ZA 5HWWA 4GCZA 1F98A 4HJ4A 5HWTA 3ZQ5A 1P0ZA 1S1YA 2D01A 3ICYA 2XA7S 4ARZB 2NUPC 2GJ3A 3BWLA 4NXGA 2VZWA 4MCWA 4O8GA 1ODVA 2FZ0A 3V67A 5AVFA 5KIZA 2PD7A 3VOLA 3EEHA 4IHQA 1H3QA 4WELA 4ETXA 5DKLA 3T4KA 5IU1A 4EU0A 3A0VA 4WUJA 3KSIA 4PKYG 4O01A 3NOPC 3BJNA 3K3DA 4WEKA 2V1AA 3PYPA 3OOVA 2O9BA 3P7NA 2CMNA 1S4SA 2EWVA 2L0WA 2VGLS 2QJ5A 3VE4A 4HH3A 3PBOA 4WN5A 2BASA 3PHYA 3EEAA 2W1RA 3NJAA 1DP6A 3MQQA 4F3LB 1H8MA 2A24B 3LIAA 4GW9A 1XJ2A 2VEAA 1N9OA 2QKPA 5F5YA 2QHKA 3IBJA 4HI4A 2J80A 2O9CA 4O0PA 3BY8A 3F1OA 2YKFA 4K08A 1OTEA 2W3GA 4GHIA 3T4OA 3P01A 1NLZA 4I3IA 4AFIA 2P08A 3TRCA 4CQHA 4CLCD 3LIFA 2GNXA 5J7EA 4R70A 1XFNA 1ZTUA 5J4EA 3CWFA 4R3AA 1D06A 3MFXA 2HV1A 2KX6A 3C2WA 1DP9A 5HDSA 3T4TA 1W63M 5HPFA 4RQ9A 3D3OA 5CX7A 4GJ4A 3H82B 1BYWA 3TJZC 4BBVA 1OTDA 3EGDC 3JVVA 3LUQA 1GSWA 4HP9A 2W3HA 3A0SA 4H6JA 4WL9A 4EERA 2H28A 2W0NA 1JNUA 2VV6A 2ZOIA 2FH5A 3HJKA 1Y28A 3CLOA 2ZMFA 2O0YA 4KQOA 2KOIA 3UB9A 3JVUA 5TBMA 2OAP1 1P9WA 2HGVA 2R78A 3FPVA 1YKDA 2O99A 3E4OA 4HP4A 4Z1WA 3KSFA 1EW0A 1N9NA 3R7WB 2QWSA 1GSVA 2VA0A 5IT5A 2P7JA 3F1PA 2Y79A 2INWA 4I3AA 4BBUA 2XROA 1IOUA 2J3TC 3BW6A 5DF9A 2D02A 5HDDA 3K3CA 4JGPA 4YWZA 3EWKA 1OJ5A 1STZA 4DJ3A 2Z6CA 4CLCA 5LBRA 4FOFA 3S7QA 5TJJA 3H7WB 1P9RA 4Q0HA 3B33A 3OCNA 4MMNA 3UB7A 3PBRA 1OT9A 2GX5A 2VV7A 1W63Q 1DRMA 2OWHA 3KX0X 1T1AA 2GZAA 4Q0IA 3IS2B 2XA7M 2IA2A 3RH8B 3MMHA 2J3WA 3NOUC 4M4XA 4B9OA 2DMWA 3F1OB 3GECA 4GHIB 3LI8A 4L0LA 1XJ6A 2OAQ1 3FPWA 3KSGA 3W2ZA 4ME4A 3CUEA 4G3KA 4KUKA 3LR5A 3LYXA 3T4SA 2I9VA 3UE3A 2B18A 4YOFA 2VGLM 2L4RA 1S67L 3EQUA 4EW7A 2VV8A 4L9FA 3ZYTA 3S7NA 4ARZA 4OOLA 4PKYA 3KO6A 1VB6A 4G3VA 4II7A 3G6OA 3LI9A 3HJIA 4XT2B 2XRNA 4P6ZS 1T1BA 4JGQA 5DJUA 3RTYA 5J3WA 4Y2FA 3E0YA 4CLCC 2VJWA 1KOUA 1VHMA 2K2NA 4GLQA 4LRXC 4DN0A 4HIAA 3LR3A 5G4ZA 1LSXA 4QPRA 1YSPA 4HNBA 1YAXA 2QYBA 3CI6A 4P6ZM 1XJ3A 3C30A 2VLGA 2WKQA 3OLOA 1LL8A 1TS0A 5TBMB 4E04A 4I39A 1OTBA 3R4KA 2PT7A 5IS1A 1TD5A 2PHYA 2JHEA 2A24A 1V9YA 5L8MA 3MQ0A 3E4QA 1OT6A 3F1PB 2WKRA 4PAUA 4DJ2A 2W1TA 2W3DA 3RFBA 1S66L 3PXPA 2OOLA 2M7UA 1MZUA 2EWWA 5DFXA 1MC0A 1UWNX 4CLCB 3PBSA 3GDIA 3MXQA 2Z6DA 3PBQA 4HJ3A 2K31A 2HJEA 2JKTI 3MR0A 4GS9A 2PR6A 5G4YA 4G3WA 4ZRRA 2P04A 1S1ZA 2VX8A 4MN7A 3BQ8A 3K2NA 1G28A 1IFQA 5DFYA 2L1MA 3CAXA 2PD8A 4I38A 3LICA 1GSXA 5HSQA 5F68A 1UWPX 2W3FA 1NWZA 5EFWA 2VKSA 1T19A 5AVEA 3H82A 5HD3A 4JGRA 4UEYA 2YKHA 3VE3A 5HDCA 2O9AA 3LIBA 3A0RA 2PR5A 2PYPA 4LPZA 1D7EA 1YSQA 4I5SA 1TF1A 2NUTC 4LRYC 4EEPA 3MF0A 2M1CA 5I5LA 3SW1A 1N9LA 2KDKA 1TS7A 2ZBBA 3BY9A 5F69A 1LSVA 1TS8A 4R6LA 1LSWA 5MC7A 3D72A 5K5BA 3T4LA 4HOIA 4UQIS 3VV4A 4NXFA 3UB6A 3C38A 3PR6A 4FSFA 3EOIA 1OTAA 4HJ6A 4NXBA 4EESA 1ZHHB 3F1NA 3OCLA 2M7VA 2JKTM 2JKRM 1S4RA 5C5KA 3T50A 1F9IA 3R7WA 3KYQA 2Y8HA 3LR0A 4PHTA 3H9WA 4WLAA 3PBNA 2MJ6A 2K7SA 4UQIM 3UMDA 4Y5FA 2LB5A 2ZOHA 1DP8A 3LR4A 3H7WA 4L9GA 2XSSA 4MDZA 3T4QA 4BBTA 1XJ4A 3NOTC 3S7OA 2LB9A 2W3EA 4BWIA 3T4JA 4BMWA 4IUKA 2HJ9C 4H6JB 2A2LA 3IS2A 4KUOA 4R38A 4EUVA 1G6OA 2JN7A 4DMZA 2W1TB 3MJQA 4IJGA 1NLYA 2OWJA 3KYZA 2V9AA 4I3JA 3LIDA 3UB8A 5F6AA 4EQ1A 5KSHA 3EQVA 4NKPA 2B02A 4L9EA 4BJPA 4KQDA 3B42A 3E98A 2W27A 4HY8A 4ETZA 3NHQA 4GS9B 3E4PA 4F3LA 3U2AA 3ULFA 1TS6A 4WF0A 4EETB 5FL3A 3BQAA 4OOMA 3LIEA 3KSHA 2HF6A 4LRZE 5HD5A 4HQAA 3C8CA 3FC7A 3CUEC 4Q0JA 2G7UA 3UE6A 1OPXA 5DKKA 1P97A 2EA9A 2WKPA 4XT2A 5HZHA 4Y3IA 3B47A 2V1BA 3OC2A 3LFVA 5HL6A 4NXEA 4B93A 2JKRI 3S7PA 3DBAA 5AJGA 1LT0A 2V0UA 5A8BA 4JGOA 4CLCE 4HH2A 3O5YA 4NEED 3EGXC 3CITA 5DJTA 1F5MA 2QJ7A 4HHDA 2PDRA 4EXOA 4YNRA 1T18A 3HCYA 4IUHA 3OBFA 1WA9A 4LLOB 5HWVA 1NRJA 3UMEA 1OJGA 1UGUA 3PBTA 2KLIA 1MKMA 3F1NB 2ZMVA 1OTIA 4WEJA 1X0OA 3FG8A 4MN5A 3TW8A 1T1CA 3IBRA 3TE8A 3MQOA 1XFQA 2J3TD 4EEUA 2PYRA 4MN6A 2V0WA 5HPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9Z A;  5HWW A;  4GCZ A;  1F98 A;  4HJ4 A;  5HWT A;  3ZQ5 A;  1P0Z A;  1S1Y A;  2D01 A;  3ICY A;  2GJ3 A;  3BWL A;  4NXG A;  1ODV A;  5AVF A;  5KIZ A;  2PD7 A;  3VOL A;  3EEH A;  5DKL A;  5IU1 A;  3A0V A;  4WUJ A;  4PKY G;  3NOP C;  3K3D A;  2V1A A;  3PYP A;  3P7N A;  2CMN A;  1S4S A;  2L0W A;  2QJ5 A;  3VE4 A;  4HH3 A;  4WN5 A;  2BAS A;  3PHY A;  3NJA A;  1DP6 A;  3MQQ A;  4F3L B;  2A24 B;  3LIA A;  4GW9 A;  1XJ2 A;  2VEA A;  1N9O A;  2QKP A;  5F5Y A;  2QHK A;  4HI4 A;  2J80 A;  3BY8 A;  3F1O A;  2YKF A;  4K08 A;  1OTE A;  4GHI A;  4I3I A;  3LIF A;  5J7E A;  4R70 A;  1XFN A;  5J4E A;  3CWF A;  4R3A A;  1D06 A;  3MFX A;  2HV1 A;  2KX6 A;  3C2W A;  1DP9 A;  5HDS A;  4RQ9 A;  3H82 B;  1BYW A;  4BBV A;  1OTD A;  3LUQ A;  1GSW A;  4HP9 A;  3A0S A;  4H6J A;  4WL9 A;  4EER A;  2H28 A;  2W0N A;  1JNU A;  2VV6 A;  2ZOI A;  3HJK A;  1Y28 A;  3CLO A;  3UB9 A;  5TBM A;  2R78 A;  3E4O A;  4HP4 A;  1EW0 A;  1N9N A;  2QWS A;  1GSV A;  2P7J A;  3F1P A;  2INW A;  4I3A A;  4BBU A;  2D02 A;  5HDD A;  3K3C A;  4JGP A;  4YWZ A;  3EWK A;  1OJ5 A;  4DJ3 A;  2Z6C A;  3H7W B;  3B33 A;  3UB7 A;  1OT9 A;  2VV7 A;  1DRM A;  2OWH A;  3KX0 X;  1T1A A;  3IS2 B;  3RH8 B;  3NOU C;  4M4X A;  4B9O A;  3F1O B;  3GEC A;  4GHI B;  3LI8 A;  1XJ6 A;  4KUK A;  3LYX A;  2I9V A;  2L4R A;  1S67 L;  4EW7 A;  2VV8 A;  4L9F A;  4PKY A;  1VB6 A;  3G6O A;  3LI9 A;  3HJI A;  4XT2 B;  1T1B A;  4JGQ A;  5DJU A;  3RTY A;  5J3W A;  1KOU A;  4LRX C;  4HIA A;  5G4Z A;  1LSX A;  4HNB A;  1XJ3 A;  2VLG A;  2WKQ A;  3OLO A;  1LL8 A;  1TS0 A;  5TBM B;  4E04 A;  4I39 A;  1OTB A;  5IS1 A;  2PHY A;  2JHE A;  2A24 A;  1V9Y A;  3E4Q A;  1OT6 A;  3F1P B;  2WKR A;  4DJ2 A;  1S66 L;  2OOL A;  1MZU A;  1UWN X;  3GDI A;  3MXQ A;  2Z6D A;  4HJ3 A;  3MR0 A;  4GS9 A;  2PR6 A;  5G4Y A;  1S1Z A;  1G28 A;  2L1M A;  3CAX A;  2PD8 A;  4I38 A;  3LIC A;  1GSX A;  5HSQ A;  5F68 A;  1UWP X;  1NWZ A;  5EFW A;  1T19 A;  5AVE A;  3H82 A;  5HD3 A;  4JGR A;  2YKH A;  3VE3 A;  5HDC A;  3LIB A;  3A0R A;  2PR5 A;  2PYP A;  4LPZ A;  1D7E A;  4I5S A;  4LRY C;  4EEP A;  2M1C A;  5I5L A;  3SW1 A;  1N9L A;  2KDK A;  1TS7 A;  2ZBB A;  3BY9 A;  5F69 A;  1LSV A;  1TS8 A;  4R6L A;  1LSW A;  3D72 A;  4HOI A;  4NXF A;  3UB6 A;  4HJ6 A;  1OTA A;  4NXB A;  4EES A;  3F1N A;  1S4R A;  3T50 A;  1F9I A;  4WLA A;  3H9W A;  2K7S A;  3UMD A;  2ZOH A;  1DP8 A;  3H7W A;  4L9G A;  4BBT A;  1XJ4 A;  3NOT C;  4H6J B;  3IS2 A;  4KUO A;  4R38 A;  2JN7 A;  3MJQ A;  2OWJ A;  2V9A A;  4I3J A;  3LID A;  3UB8 A;  5F6A A;  4EQ1 A;  2B02 A;  4L9E A;  4KQD A;  2W27 A;  4HY8 A;  3NHQ A;  4GS9 B;  3E4P A;  4F3L A;  3ULF A;  1TS6 A;  4WF0 A;  4EET B;  3LIE A;  4LRZ E;  5HD5 A;  4HQA A;  3C8C A;  3FC7 A;  3UE6 A;  5DKK A;  1P97 A;  2EA9 A;  2WKP A;  4XT2 A;  5HZH A;  2V1B A;  4NXE A;  1LT0 A;  2V0U A;  5A8B A;  4JGO A;  4HH2 A;  5DJT A;  2QJ7 A;  4HHD A;  2PDR A;  4EXO A;  1T18 A;  1WA9 A;  4LLO B;  5HWV A;  3UME A;  1OJG A;  1UGU A;  3F1N B;  1OTI A;  1X0O A;  3FG8 A;  4MN5 A;  1T1C A;  3IBR A;  3MQO A;  1XFQ A;  4EEU A;  2PYR A;  4MN6 A;  2V0W A; 
#chains in the Genus database with same CATH topology
 4HJ4 A;  5HWT A;  3V3R A;  2D01 A;  3ICY A;  3NC8 A;  2XA7 S;  3D9Y A;  4ARZ B;  4KZ6 A;  1JWP A;  3BWL A;  2VZW A;  5CEC A;  4DE1 A;  1PW8 A;  1ERM A;  3UO9 A;  3VOL A;  2HPB A;  5CTM A;  5FQ9 A;  4ETX A;  5DKL A;  1PWD A;  3LGO A;  3G30 A;  3BJN A;  1G68 A;  4JXW A;  3BEB A;  2V1A A;  1YT4 A;  3QP2 A;  2VGL S;  3QNC A;  3PBO A;  1TDG A;  3EEA A;  4RX2 A;  4F3L B;  1VET A;  3VFF A;  2ZC7 A;  1XP4 A;  4Y13 A;  1GCE A;  2VEA A;  2I72 A;  5M1A A;  4E3N A;  2QKP A;  3LY4 A;  4JXS A;  2WGW B;  2QHK A;  3IBJ A;  2O9C A;  3GSG A;  4OOY A;  2IWB A;  3JPU A;  4CLC D;  5J7E A;  2HP9 A;  4GD6 A;  1KVM A;  3IX8 A;  2Y2P A;  5CGS A;  2ZC5 B;  2ZJ9 A;  3C2W A;  1A0K A;  1DP9 A;  4JXG A;  3QP1 A;  1GHM A;  4C6Y A;  2XQZ A;  4E3J A;  4DXB A;  1KGF A;  4YIN A;  3H82 B;  1BYW A;  4BBV A;  1JWZ A;  1OTD A;  1RGY A;  4N1H A;  4HP9 A;  4OLG A;  1IKI A;  4EER A;  4H6J A;  2H28 A;  4E3O A;  1JNU A;  2VV6 A;  5CED A;  3MBZ A;  4LCL A;  1GA9 A;  1H8Y A;  1FOF A;  2VGK A;  2ZMF A;  1Q2P A;  5AQA A;  2O0Y A;  5TR7 A;  3UB9 A;  3JVU A;  1P9W A;  3S1Y A;  2Y59 A;  3IF6 C;  1W79 A;  3FPV A;  3SOI A;  4EUZ A;  4HP4 A;  4Z1W A;  4UA6 A;  3R7W B;  2QWS A;  4OKP A;  1PFL A;  1SDE A;  2P7J A;  3MXS A;  1LL9 A;  4BBU A;  4UAA A;  2D02 A;  5HDD A;  4YWZ A;  1OJ5 A;  1STZ A;  1IYS A;  5LBR A;  3S7Q A;  4U0X A;  1S6R A;  5A93 A;  3UB7 A;  4OVD A;  3OZH A;  5FI2 A;  1DRM A;  3KX0 X;  2V20 A;  3VOZ A;  2XA7 M;  2IA2 A;  1KGG A;  3IF6 B;  3IWO A;  1K57 A;  4OQG A;  5GHX A;  3ZG8 B;  4WMC A;  2H10 A;  3N7W A;  3UY6 A;  5CHU A;  3O3V A;  3L9K A;  2I9V A;  3KYE A;  2B18 A;  5DTS A;  4NET A;  3WWX A;  4KG6 A;  5EVI D;  3DAV A;  2VGL M;  3S4X A;  4EW7 A;  4PKY A;  4II7 A;  3G6O A;  3LI9 A;  3RXX A;  4XT2 B;  1YLZ A;  5FQM A;  2XRN A;  4P6Z S;  1T1B A;  3IXH A;  3VP1 A;  4Y2F A;  4EBL A;  1ES5 A;  4HIA A;  5G4Z A;  1LSX A;  2ZQA A;  4OPY A;  2VLG A;  3T12 B;  5TBM B;  4XUZ A;  4E04 A;  1N4O A;  2PT7 A;  3QP4 A;  4N9K A;  4JBF A;  2PHY A;  2ZM8 A;  3N8R A;  2JHE A;  3LEQ A;  1K55 A;  2ZLY A;  2A24 A;  3ITB A;  1K56 A;  1MWS A;  3RXW A;  1W8Q A;  3DWK A;  1MZU A;  2EWW A;  4IVI A;  5FSR A;  2JKT I;  1H0M A;  2PR6 A;  4G3W A;  4WBG A;  1S1Z A;  2VX8 A;  2L1M A;  5GHY A;  2E8J A;  2Y2L A;  4I38 A;  4R3B A;  4Z9Q A;  3UDF A;  1GSX A;  2C6W B;  2OV5 A;  4PM5 A;  2IWD A;  2VKS A;  2WZZ A;  1ESI A;  1TEM A;  5AVE A;  3SH8 A;  4JGR A;  4UEY A;  3QHY A;  4RYE A;  1U60 A;  4BEN A;  4JKT A;  1H8Z A;  1HTZ A;  3HLF A;  1YSQ A;  1TF1 A;  1LLB A;  3ZG9 B;  4EEP A;  2B95 A;  2M1C A;  5I5L A;  3BRM A;  1IYO A;  5F69 A;  3ZNT A;  5MC7 A;  3D72 A;  3MSH A;  1H5X A;  1YMX A;  1ZG4 A;  3T4L A;  3NDE A;  1AWI A;  4UQI S;  3VV4 A;  4NXF A;  2UWX A;  3PR6 A;  3VSK A;  4RVA A;  5FI6 A;  3TOI A;  3GV9 A;  4NXB A;  1ZHH B;  2M7V A;  2JKR M;  1S4R A;  4JF5 A;  4K0X A;  2Y8H A;  4WLA A;  1Z6F A;  3N6I A;  4MBK A;  2MJ6 A;  2K7S A;  4Y5F A;  2ZOH A;  1RP5 A;  2VGJ A;  2Y91 A;  1BLS A;  3LR4 A;  3LY3 A;  2GDN A;  4MBH A;  3SH7 A;  1NY0 A;  4U0T A;  1KE4 A;  1W7F A;  3T4Q A;  1XJ4 A;  5GL9 A;  3S7O A;  2LB9 A;  4GD8 A;  3G31 A;  1K54 C;  2A2L A;  5HAQ A;  1HVB A;  5CRF A;  4EUV A;  5A90 A;  4DMZ A;  1NLY A;  4X6T A;  4EQ1 A;  5F6A A;  4R4S A;  4D60 A;  3NEC A;  1KVL A;  4KZ8 A;  4KQD A;  3E98 A;  2W27 A;  4HY8 A;  4ETZ A;  2OLV A;  3NHQ A;  4KQR A;  1TS6 A;  4EET B;  2H0Y A;  3BFF A;  5DF8 A;  1FSW A;  3LIE A;  3KSH A;  4HQA A;  3C8C A;  1CQA A;  4LV0 A;  1O07 A;  3V50 A;  3IWQ A;  1I2W A;  1DY6 A;  5HZH A;  4FUW A;  5HL6 A;  2JKR I;  5FAQ A;  3V5M A;  2XD5 A;  2XLN A;  1NJ4 A;  2DRW A;  3DBA A;  1LT0 A;  5A92 A;  4N9L A;  5E2F A;  4CLC E;  2PU2 A;  5DJT A;  3W4Q A;  2QJ7 A;  3N8L A;  3NIA A;  2PU4 A;  2CC1 A;  3VOY A;  4IUH A;  1NRJ A;  3UME A;  4S2I A;  4PM7 A;  2Q9N A;  4MLL A;  1OTI A;  4KZ5 A;  2AVX A;  4Y0O A;  3BEC A;  4GCZ A;  3C4O A;  4IBR A;  3ZQ5 A;  1YLJ A;  3IHA A;  2NUP C;  2GJ3 A;  4MCW A;  4X68 A;  4O8G A;  1ODV A;  1FCM A;  3V67 A;  2HDR A;  4XUX A;  2PD7 A;  1SKF A;  2Y2M A;  1NYM A;  3CPT A;  1PW1 A;  5HX9 A;  3A0V A;  3KSI A;  4O01 A;  3NOP C;  3A3J A;  1K6R A;  4WEK A;  4QHC A;  3PAE A;  2O9B A;  3E2L A;  2QJ5 A;  3VE4 A;  4HH3 A;  2BAS A;  2W1R A;  4EQI A;  3IH8 A;  3D4F A;  3FWL A;  4DE0 A;  2WKE A;  3ZNY A;  1N9O A;  2XR0 A;  3P09 A;  5F5Y A;  5DVA A;  1E3U D;  2J80 A;  3O87 A;  3F1O A;  1GA0 A;  1OTE A;  2W3G A;  4IVK A;  4I3I A;  4CQH A;  1W5D A;  2JE5 A;  2GNX A;  3IQA A;  5J4E A;  2XD1 A;  4R3A A;  1K38 A;  2PBD P;  1VEU B;  1BT5 A;  5EOO A;  1W63 M;  5CX7 A;  1K4E A;  2WZX A;  5GLD A;  2Y2K A;  2Y2H A;  5L10 A;  3WS0 A;  2P9V A;  3JVV A;  2ZC4 B;  1S0W A;  1PI4 A;  2W3H A;  3A0S A;  3BLS A;  2ZOI A;  2H5S A;  2Z2L B;  1XX2 A;  1Y28 A;  3ZG5 A;  1IYQ A;  4MEZ A;  2XEP A;  4X69 A;  2OAP 1;  2R78 A;  1YKD A;  3UN7 A;  3BLM A;  5EVI A;  4DDY A;  3UE1 A;  1GSV A;  5IT5 A;  4DKI A;  3F1P A;  4I3A A;  1IOU A;  3MZE A;  2J3T C;  3BW6 A;  4JXV A;  5DF9 A;  3K3C A;  3M6B A;  2PBY A;  3PTE A;  4FOF A;  3HUM A;  3H7W B;  4Q0H A;  3SS3 A;  1OT9 A;  2XFS A;  2QPN A;  3NCK A;  1KDW A;  1XGI A;  2BG1 A;  2GZA A;  3VP2 A;  3IS2 B;  3AGD A;  1IEL A;  2JC7 A;  2QMI A;  3FKW A;  3HLC A;  2HZ5 A;  3NY4 A;  3WRT A;  2RL3 A;  3ZHH A;  4L0L A;  2OAQ 1;  3FPW A;  2WAF A;  3KSG A;  5EPH A;  3W2Z A;  3MXR A;  4G3K A;  1FCN A;  2Z2M B;  3LR5 A;  3UE3 A;  4CPK A;  4BD0 A;  2Y2O A;  4YOF A;  4OPZ A;  1MPL A;  1S67 L;  3N4I A;  2ZL1 B;  4IED A;  4ARZ A;  1CI8 A;  1VB6 A;  1YPR A;  2EX8 A;  3HJI A;  4WZ5 C;  4JGQ A;  5DTK A;  2ZC3 B;  5J3W A;  3E0Y A;  5D3O A;  5CHJ A;  5EVE A;  4E3M A;  2K2N A;  4PM8 A;  2XF3 A;  4QU3 A;  4BL2 A;  3Q82 A;  2WKQ A;  2PAV P;  1LL8 A;  3PAG A;  1TDL A;  1TD5 A;  1YLW A;  1BUE A;  1K57 C;  1ZKJ A;  3CG5 A;  4GN2 A;  3MKE A;  4UA9 A;  3FV7 A;  2Q0O A;  5JYO A;  2W1T A;  1KE3 A;  3RFB A;  1S66 L;  2M7U A;  1XPB A;  1XGJ A;  5DFX A;  5JYP A;  4FH2 A;  2Z6D A;  3BFD A;  5CTN A;  3MS6 A;  3HUN A;  3WS5 A;  1WYC A;  4X55 A;  4GOG A;  3LIC A;  5F68 A;  5EFW A;  1T19 A;  1PZP A;  3DTK A;  3H82 A;  4DE2 A;  1QMF A;  3VE3 A;  4NG2 A;  2O9A A;  1FQG A;  3LIB A;  4ID4 A;  2PYP A;  1D7E A;  5F83 A;  4LRY C;  3SW1 A;  4YFM A;  1N9L A;  1TVF A;  4KZ4 A;  4BD1 A;  2PRF A;  1FR6 A;  1EI5 A;  1K55 C;  1TS8 A;  3HLB A;  1LSW A;  1L3L A;  5EM0 A;  3Q7V A;  1OTA A;  2WAD A;  1ZC2 A;  3T1Q B;  2JKT M;  4WZ4 A;  5FAT A;  3R7W A;  5CER A;  2ACG A;  4LFU A;  2JBF A;  1DP8 A;  4Y0U A;  1PIO A;  2EX9 A;  4S2M A;  3NOT C;  4BMW A;  3ISG A;  2HJ9 C;  3O88 A;  5L07 A;  1YM1 A;  3O86 A;  4IJG A;  1FCO A;  2JKG A;  3Q81 A;  3LID A;  3UB8 A;  5KMW A;  5KSC A;  4OLD A;  4R23 A;  2BTF P;  5KSH A;  4NKP A;  5J8X A;  3Q1F A;  1AXB A;  4UA7 A;  4OQH A;  4LCM A;  3E4P A;  4DDS A;  3BFG A;  3ULF A;  3LEZ A;  3ZCZ A;  1JWV A;  3HVF A;  3BQA A;  3DTI A;  3OPP A;  4R3J A;  1C3B A;  2HF6 A;  3IH9 A;  3W8K A;  3FC7 A;  3CUE C;  4Q0J A;  1WE4 A;  3QP5 A;  4ZJ3 A;  1YLP A;  2EA9 A;  4XT2 A;  5AQB A;  2V1B A;  3FKV A;  3G2Y A;  2ZQ7 A;  4B93 A;  3E2K A;  2XH9 A;  4ZBE A;  3ZVT A;  5A8B A;  4E3L A;  3C7V A;  4NEE D;  2HDU A;  5EVL A;  3VP3 A;  3EGX C;  1LI0 A;  4EXO A;  4YNR A;  5GLC A;  1T18 A;  5TGF A;  3BM6 A;  3OBF A;  1WA9 A;  1SKO B;  1UGU A;  2ZD8 A;  1PI5 A;  4R0Q A;  3IX3 A;  4OH0 A;  3LO7 A;  1BUL A;  4HBT A;  3FG8 A;  3MQO A;  4HES A;  2J3T D;  4KZ9 A;  1YMS A;  4MBF A;  5HWW A;  3DW0 A;  1MXO A;  4EBP A;  1IYP A;  5M18 A;  2E8I A;  5CXW A;  4NXG A;  3HUO A;  2Y2Q A;  3U4L P;  2JCH A;  2FZ0 A;  5GHZ A;  5AVF A;  4Y17 A;  5G18 A;  5HAI A;  4GKU A;  1G6A A;  3Q07 A;  3EEH A;  4P87 A;  5FA7 A;  4IHQ A;  2DNS A;  4DE3 A;  3T4K A;  5IU1 A;  4EU0 A;  1IKG A;  4WUJ A;  3VP0 A;  2R9W A;  1RGZ A;  4N1X A;  4RX3 A;  3OOV A;  2IWC A;  3AGF A;  3P7N A;  2CMN A;  1S4S A;  3UB5 P;  5FEG A;  1Q2Q A;  3NUL A;  4GW9 A;  3WS2 A;  1DJB A;  4HI4 A;  3ZVW A;  1MWU A;  4O0P A;  3BY8 A;  3ITA A;  4K08 A;  2V8F A;  4GHI A;  2EXB A;  3P01 A;  4AFI A;  2P08 A;  3IHB A;  1JVJ A;  5CGX A;  4BL3 A;  3LIF A;  3BFE A;  1ZTU A;  4K91 A;  3ZDJ A;  3CWF A;  4P6B A;  1D06 A;  3SZT A;  3M2J A;  4KG5 A;  2KX6 A;  3WS1 A;  5HDS A;  4RQ9 A;  3D3O A;  1HZO A;  3SS5 A;  1NZU A;  5A91 A;  1CJF A;  4EBN A;  4H8R A;  3LUQ A;  1GSW A;  2WGV A;  4WMC D;  3QNB A;  2A3U A;  3LCE A;  4WL9 A;  2W0N A;  1LI9 A;  3SS4 A;  3C5A A;  5HFO A;  3A3I A;  2WKH A;  3HJK A;  4KQO A;  3UPO A;  4S2J A;  1L0F A;  1L0D A;  3V3S A;  1EW0 A;  1N9N A;  2Y2I A;  1XXM A;  2VA0 A;  3CPT B;  5E2E A;  5FAP A;  1K54 A;  4CLC A;  4OPQ A;  4QWO A;  1XA7 A;  5FAS A;  3PBR A;  4OP5 A;  5EOE A;  2GX5 A;  1W63 Q;  4LV1 A;  2OWH A;  2V2F F;  1T1A A;  4P85 A;  4Q0I A;  2HDQ A;  4Q8I A;  2ZM2 A;  4KZ3 A;  4X53 A;  2V1Z A;  4OQI A;  2J3W A;  1K56 D;  1DJA A;  5HW3 A;  4M4X A;  4ZTK A;  5F1F A;  4B9O A;  2DMW A;  3F1O B;  4GB7 A;  1VQQ A;  4OQ0 A;  2ZQD A;  4FTX A;  4E3K A;  1XJ6 A;  4ME4 A;  3DWZ A;  4GZB A;  4KUK A;  4XXR A;  1M6K A;  3T4S A;  5FI7 A;  3EQU A;  2VV8 A;  2JKF A;  3S7N A;  4OOL A;  1YLT A;  2P9V B;  4FD8 A;  4R1G A;  3QP6 A;  2FFF B;  2WUQ A;  5DJU A;  3RTY A;  4UHU A;  3WS4 A;  5HAP A;  4GLQ A;  4LRX C;  2Y4A A;  4QPR A;  5AQ7 A;  1YAX A;  3CI6 A;  2G2W A;  1XJ3 A;  3C30 A;  4LV2 A;  3OLO A;  1PWG A;  1TS0 A;  4I39 A;  2UV0 E;  4OP8 A;  4C75 A;  4EWF A;  2WAE A;  2R9X A;  1PYY A;  1V9Y A;  5L8M A;  3MQ0 A;  3E4Q A;  2XFT A;  3F1P B;  2J8Y A;  2WKR A;  4DJ2 A;  3DTE A;  4PPR A;  5FQJ A;  2OOL A;  1J9M A;  1ALQ A;  4X1M A;  1EWZ A;  5L09 A;  3MXQ A;  1ACF A;  1MBL A;  4HJ3 A;  2HJE A;  4GDB A;  3MR0 A;  4GS9 A;  1CEF A;  3NI9 A;  1G28 A;  1KGE A;  5IHV A;  3B3X A;  2PD8 A;  3G32 A;  4LV3 A;  5FDH A;  1NWZ A;  3BYD A;  3VMA A;  3W4P A;  2WGI A;  4OPR A;  5HD3 A;  3BFC A;  5EM1 A;  5HDC A;  4S2N A;  1L0G A;  4LPZ A;  1ZG6 A;  2NUT C;  1VET B;  3VFH A;  5GLA A;  1WYB A;  2HP6 A;  3IT9 A;  5FEF A;  4Y0T A;  2ZQ9 A;  4R6L A;  4HOI A;  5FQQ A;  4E6W A;  4QD4 A;  3UDI A;  4FSF A;  3EOI A;  3F1N A;  3OCL A;  3HL9 A;  3IXD A;  3AGE A;  4E3I A;  4QY6 A;  3KYQ A;  4S2O A;  1ES4 A;  3LR0 A;  1YQS A;  1I2S A;  2LB5 A;  4KEN B;  4M3K A;  5EUA A;  3UPP A;  3VP4 A;  3H7W A;  3FYZ A;  4U3T A;  1XKZ A;  1CF0 A;  5E2H A;  1BLP A;  4HEF A;  4ZAM A;  1CEG A;  4BBT A;  1N9B A;  2W3E A;  2J9P A;  4ZJ1 A;  4IUK A;  4H6J B;  3IS2 A;  4KUO A;  1JTD A;  1G6O A;  2JN7 A;  2W1T B;  3MJQ A;  4A5R A;  3KYZ A;  1GHP A;  3EQV A;  2B02 A;  4BJP A;  4DXC A;  4JLF A;  4F3L A;  4QB8 A;  4OOM A;  2WGW A;  4S2P A;  4LRZ E;  4P0M A;  5HD5 A;  2ZL1 A;  1ES2 A;  3MZF A;  2G7U A;  3UE6 A;  4WM9 A;  4Y15 A;  1P97 A;  3FZC A;  5L2F A;  3UDX A;  3B47 A;  1ONH A;  3OC2 A;  3HLD A;  3LFV A;  4KZA A;  4WYY A;  4JGO A;  1BLC A;  4HH2 A;  3O5Y A;  2WK0 A;  4BQM A;  3CIT A;  3MKF A;  2A49 A;  1O7E A;  1F5M A;  2Q9M A;  2PDR A;  4GNU A;  4B88 A;  4KG2 A;  3RJU A;  3Q7V B;  4LLO B;  4X56 A;  2XK1 A;  2KLI A;  1MKM A;  1KDS A;  3TW8 A;  1T1C A;  4ESP A;  3TE8 A;  5EE8 A;  2PYR A;  1FR1 A;  4WZ5 A;  5HPI A;  1V9Z A;  2EX6 A;  4X25 A;  1F98 A;  2XGN A;  1K0K A;  1P0Z A;  1S1Y A;  3P98 A;  1Y54 A;  4B4X A;  4ZDX A;  3HBR A;  2J7V A;  5KIZ A;  3GVB A;  3HLW A;  3ZGA B;  1H3Q A;  3JYI A;  4WEL A;  3C4P A;  2QZ6 A;  3IXB A;  2WKI A;  2OLU A;  2HDS A;  1G5U A;  4PKY G;  3OPR A;  4QJG A;  1XA1 A;  3K3D A;  4GDN A;  2P74 A;  3PYP A;  1SZV A;  3CMZ A;  2V8C A;  2EWV A;  2L0W A;  1M40 A;  4ZJ2 A;  1L2S A;  3G34 A;  4KQQ A;  4WN5 A;  3PHY A;  3NJA A;  3UNW A;  1DP6 A;  2DCF A;  3MQQ A;  1H8M A;  2A24 B;  1E25 A;  3LIA A;  3HLE A;  1KE0 A;  1XJ2 A;  3IF6 A;  1JTG A;  4DRT A;  3CJM A;  1MY8 A;  4Y7P A;  1E4D A;  4N92 A;  1SDN A;  2YKF A;  1YLY A;  3T4O A;  1NLZ A;  3TRC A;  4FH4 A;  3T1X A;  1HD8 A;  1XFN A;  3OPH A;  4R70 A;  3VSL A;  3GMW A;  3MFX A;  2HV1 A;  3T4T A;  3I7J A;  5HPF A;  4GJ4 A;  3UE0 A;  1K6S A;  3TJZ C;  3EGD C;  1BTL A;  3W4O A;  5CHM A;  3IXG A;  5FAO A;  3TSG A;  1SHV A;  5FDS A;  3GR2 A;  2FH5 A;  3CLO A;  2G2U A;  4KZ7 A;  1FIK A;  2ZM0 A;  4JPM A;  2KOI A;  2FFY A;  1LL5 A;  5TBM A;  2HGV A;  4LEN A;  1L0E A;  4RA7 A;  2O99 A;  3NDG A;  3E4O A;  3KSF A;  3UPN A;  3V39 A;  1E3U A;  5M19 A;  2Y79 A;  2INW A;  1MWT A;  2XRO A;  2J9O A;  2RCX A;  3N8S A;  4JGP A;  1J3W A;  3OPL A;  3EWK A;  1BZA A;  1ES3 A;  4DJ3 A;  5GLB A;  2Z6C A;  3QP8 A;  3M2K A;  4OON A;  5TJJ A;  1ESU A;  1P9R A;  3B33 A;  3ZFZ A;  3OCN A;  4MMN A;  4NK3 A;  3DTM A;  1NRF A;  2VV7 A;  1LHY A;  5HAR A;  3RH8 B;  2BLS A;  4E6X A;  3MMH A;  5U47 A;  1VM1 A;  3NOU C;  2ZMA A;  3GEC A;  1SKO A;  4GHI B;  4BLM A;  3LI8 A;  2X02 A;  1ERQ A;  3CUE A;  4JF6 A;  2EX2 A;  3LYX A;  3GRJ A;  5BOH A;  2L4R A;  4FCF A;  2EFU A;  4L9F A;  3ZYT A;  4S2L A;  3KO6 A;  4G3V A;  5HL1 A;  3SH9 A;  5AQ9 A;  3G35 A;  3Q7Z A;  4CLC C;  3WRZ A;  1NXY A;  2VJW A;  1KOU A;  1VHM A;  5CEB A;  1Z09 A;  1BSG A;  4DN0 A;  3LR3 A;  1YSP A;  1Y4O A;  4HNB A;  1ONG A;  2QYB A;  4P6Z M;  4CJN A;  5I94 A;  3MZD A;  1OTB A;  3R4K A;  5IS1 A;  3ZG0 A;  4JF4 A;  1K25 A;  1D1J A;  3IF5 A;  5DF7 A;  1OT6 A;  2XDM A;  4PM9 A;  4PAU A;  4LGW A;  2W3D A;  3PXP A;  2Y55 A;  1MC0 A;  1UWN X;  1DJC A;  4CLC B;  3PBS A;  3GDI A;  3GQZ A;  5CGW A;  3PBQ A;  3HRE A;  2K31 A;  5G4Y A;  4ZRR A;  2P04 A;  4MN7 A;  3C7U A;  3BQ8 A;  3K2N A;  3M6H A;  2Y2J A;  1IFQ A;  5DFY A;  4PM6 A;  3CAX A;  3IX4 A;  1RCJ A;  5HSQ A;  1UWP X;  1QME A;  2W3F A;  3S22 A;  4S2K A;  1BLH A;  3IWI A;  4QY5 A;  1OME A;  2YKH A;  2WYX A;  3A0R A;  2PR5 A;  4I5S A;  4IBX A;  1PRQ A;  2HP5 A;  3CZD A;  5F82 A;  3MF0 A;  5EEC A;  1FIL A;  4B4Z A;  2KDK A;  2X01 A;  2ZC6 B;  1TS7 A;  4KZB A;  2ZBB A;  3BY9 A;  4X1L A;  3L7H A;  5DTT A;  1LSV A;  4C3Q A;  5K5B A;  5F1G A;  2C5W B;  2X71 A;  3UB6 A;  3C38 A;  4HJ6 A;  3TG9 A;  4EES A;  5C5K A;  3T50 A;  1F9I A;  1PWC A;  4D2O A;  3ZG7 B;  4PHT A;  3H9W A;  3PBN A;  4R4R A;  4UQI M;  5TFQ A;  3UMD A;  2ZQ8 A;  5E43 A;  5EVI C;  2OSU A;  1W8Y A;  5FQI A;  1CK3 A;  2Y2N A;  2EXA A;  2XSS A;  4L9G A;  4MDZ A;  1SCW A;  4BWI A;  3T4J A;  1IEM A;  2ZQC A;  1PNE A;  1PZO A;  4R38 A;  4DF6 A;  2VK3 A;  5EV0 A;  1NYY A;  4S2N C;  1K4F A;  2OWJ A;  2V9A A;  4I3J A;  4L9E A;  3B42 A;  2Y2G A;  3G4P A;  3MFD A;  4F94 A;  5E2G A;  1MWR A;  3HLG A;  4GS9 B;  4EV4 A;  4K0W A;  5EVI B;  3U2A A;  1NZO A;  5FQK A;  4WF0 A;  5FL3 A;  3T1S A;  1FSY A;  3CHW P;  3NBL A;  1HLU P;  4O7D A;  1OPX A;  1CI9 A;  2H0T A;  5DKK A;  2B5R A;  4MNR A;  2WKP A;  4Y3I A;  1F2K A;  3A3E A;  4NXE A;  3S7P A;  5AJG A;  2V0U A;  1VEU A;  1MKI A;  1GHI A;  2EFX A;  3A3F A;  4PMA A;  4HHD A;  3GTC A;  3HCY A;  3T1R A;  5HWV A;  1OJG A;  4HBU A;  3PBT A;  3F1N B;  2ZMV A;  4WEJ A;  3G2Z A;  1X0O A;  4MN5 A;  1I5Q A;  3IBR A;  1XFQ A;  4EEU A;  4MN6 A;  3A3D A;  5KZH A;  2V0W A;  1ERO A; 
#chains in the Genus database with same CATH homology
 1V9Z A;  5HWW A;  4GCZ A;  1F98 A;  4HJ4 A;  5HWT A;  3ZQ5 A;  1P0Z A;  1S1Y A;  2D01 A;  3ICY A;  2XA7 S;  4ARZ B;  2NUP C;  2GJ3 A;  3BWL A;  4NXG A;  2VZW A;  4MCW A;  4O8G A;  1ODV A;  2FZ0 A;  3V67 A;  5AVF A;  5KIZ A;  2PD7 A;  3VOL A;  3EEH A;  4IHQ A;  1H3Q A;  4WEL A;  4ETX A;  5DKL A;  3T4K A;  5IU1 A;  4EU0 A;  3A0V A;  4WUJ A;  3KSI A;  4PKY G;  4O01 A;  3NOP C;  3BJN A;  3K3D A;  4WEK A;  2V1A A;  3PYP A;  3OOV A;  2O9B A;  3P7N A;  2CMN A;  1S4S A;  2EWV A;  2L0W A;  2VGL S;  2QJ5 A;  3VE4 A;  4HH3 A;  3PBO A;  4WN5 A;  2BAS A;  3PHY A;  3EEA A;  2W1R A;  3NJA A;  1DP6 A;  3MQQ A;  4F3L B;  1H8M A;  2A24 B;  3LIA A;  4GW9 A;  1XJ2 A;  2VEA A;  1N9O A;  2QKP A;  5F5Y A;  2QHK A;  3IBJ A;  4HI4 A;  2J80 A;  2O9C A;  4O0P A;  3BY8 A;  3F1O A;  2YKF A;  4K08 A;  1OTE A;  2W3G A;  4GHI A;  3T4O A;  3P01 A;  1NLZ A;  4I3I A;  4AFI A;  2P08 A;  3TRC A;  4CQH A;  4CLC D;  3LIF A;  2GNX A;  5J7E A;  4R70 A;  1XFN A;  1ZTU A;  5J4E A;  3CWF A;  4R3A A;  1D06 A;  3MFX A;  2HV1 A;  2KX6 A;  3C2W A;  1DP9 A;  5HDS A;  3T4T A;  1W63 M;  5HPF A;  4RQ9 A;  3D3O A;  5CX7 A;  4GJ4 A;  3H82 B;  1BYW A;  3TJZ C;  4BBV A;  1OTD A;  3EGD C;  3JVV A;  3LUQ A;  1GSW A;  4HP9 A;  2W3H A;  3A0S A;  4H6J A;  4WL9 A;  4EER A;  2H28 A;  2W0N A;  1JNU A;  2VV6 A;  2ZOI A;  2FH5 A;  3HJK A;  1Y28 A;  3CLO A;  2ZMF A;  2O0Y A;  4KQO A;  2KOI A;  3UB9 A;  3JVU A;  5TBM A;  2OAP 1;  1P9W A;  2HGV A;  2R78 A;  3FPV A;  1YKD A;  2O99 A;  3E4O A;  4HP4 A;  4Z1W A;  3KSF A;  1EW0 A;  1N9N A;  3R7W B;  2QWS A;  1GSV A;  2VA0 A;  5IT5 A;  2P7J A;  3F1P A;  2Y79 A;  2INW A;  4I3A A;  4BBU A;  2XRO A;  1IOU A;  2J3T C;  3BW6 A;  5DF9 A;  2D02 A;  5HDD A;  3K3C A;  4JGP A;  4YWZ A;  3EWK A;  1OJ5 A;  1STZ A;  4DJ3 A;  2Z6C A;  4CLC A;  5LBR A;  4FOF A;  3S7Q A;  5TJJ A;  3H7W B;  1P9R A;  4Q0H A;  3B33 A;  3OCN A;  4MMN A;  3UB7 A;  3PBR A;  1OT9 A;  2GX5 A;  2VV7 A;  1W63 Q;  1DRM A;  2OWH A;  3KX0 X;  1T1A A;  2GZA A;  4Q0I A;  3IS2 B;  2XA7 M;  2IA2 A;  3RH8 B;  3MMH A;  2J3W A;  3NOU C;  4M4X A;  4B9O A;  2DMW A;  3F1O B;  3GEC A;  4GHI B;  3LI8 A;  4L0L A;  1XJ6 A;  2OAQ 1;  3FPW A;  3KSG A;  3W2Z A;  4ME4 A;  3CUE A;  4G3K A;  4KUK A;  3LR5 A;  3LYX A;  3T4S A;  2I9V A;  3UE3 A;  2B18 A;  4YOF A;  2VGL M;  2L4R A;  1S67 L;  3EQU A;  4EW7 A;  2VV8 A;  4L9F A;  3ZYT A;  3S7N A;  4ARZ A;  4OOL A;  4PKY A;  3KO6 A;  1VB6 A;  4G3V A;  4II7 A;  3G6O A;  3LI9 A;  3HJI A;  4XT2 B;  2XRN A;  4P6Z S;  1T1B A;  4JGQ A;  5DJU A;  3RTY A;  5J3W A;  4Y2F A;  3E0Y A;  4CLC C;  2VJW A;  1KOU A;  1VHM A;  2K2N A;  4GLQ A;  4LRX C;  4DN0 A;  4HIA A;  3LR3 A;  5G4Z A;  1LSX A;  4QPR A;  1YSP A;  4HNB A;  1YAX A;  2QYB A;  3CI6 A;  4P6Z M;  1XJ3 A;  3C30 A;  2VLG A;  2WKQ A;  3OLO A;  1LL8 A;  1TS0 A;  5TBM B;  4E04 A;  4I39 A;  1OTB A;  3R4K A;  2PT7 A;  5IS1 A;  1TD5 A;  2PHY A;  2JHE A;  2A24 A;  1V9Y A;  5L8M A;  3MQ0 A;  3E4Q A;  1OT6 A;  3F1P B;  2WKR A;  4PAU A;  4DJ2 A;  2W1T A;  2W3D A;  3RFB A;  1S66 L;  3PXP A;  2OOL A;  2M7U A;  1MZU A;  2EWW A;  5DFX A;  1MC0 A;  1UWN X;  4CLC B;  3PBS A;  3GDI A;  3MXQ A;  2Z6D A;  3PBQ A;  4HJ3 A;  2K31 A;  2HJE A;  2JKT I;  3MR0 A;  4GS9 A;  2PR6 A;  5G4Y A;  4G3W A;  4ZRR A;  2P04 A;  1S1Z A;  2VX8 A;  4MN7 A;  3BQ8 A;  3K2N A;  1G28 A;  1IFQ A;  5DFY A;  2L1M A;  3CAX A;  2PD8 A;  4I38 A;  3LIC A;  1GSX A;  5HSQ A;  5F68 A;  1UWP X;  2W3F A;  1NWZ A;  5EFW A;  2VKS A;  1T19 A;  5AVE A;  3H82 A;  5HD3 A;  4JGR A;  4UEY A;  2YKH A;  3VE3 A;  5HDC A;  2O9A A;  3LIB A;  3A0R A;  2PR5 A;  2PYP A;  4LPZ A;  1D7E A;  1YSQ A;  4I5S A;  1TF1 A;  2NUT C;  4LRY C;  4EEP A;  3MF0 A;  2M1C A;  5I5L A;  3SW1 A;  1N9L A;  2KDK A;  1TS7 A;  2ZBB A;  3BY9 A;  5F69 A;  1LSV A;  1TS8 A;  4R6L A;  1LSW A;  5MC7 A;  3D72 A;  5K5B A;  3T4L A;  4HOI A;  4UQI S;  3VV4 A;  4NXF A;  3UB6 A;  3C38 A;  3PR6 A;  4FSF A;  3EOI A;  1OTA A;  4HJ6 A;  4NXB A;  4EES A;  1ZHH B;  3F1N A;  3OCL A;  2M7V A;  2JKT M;  2JKR M;  1S4R A;  5C5K A;  3T50 A;  1F9I A;  3R7W A;  3KYQ A;  2Y8H A;  3LR0 A;  4PHT A;  3H9W A;  4WLA A;  3PBN A;  2MJ6 A;  2K7S A;  4UQI M;  3UMD A;  4Y5F A;  2LB5 A;  2ZOH A;  1DP8 A;  3LR4 A;  3H7W A;  4L9G A;  2XSS A;  4MDZ A;  3T4Q A;  4BBT A;  1XJ4 A;  3NOT C;  3S7O A;  2LB9 A;  2W3E A;  4BWI A;  3T4J A;  4BMW A;  4IUK A;  2HJ9 C;  4H6J B;  2A2L A;  3IS2 A;  4KUO A;  4R38 A;  4EUV A;  1G6O A;  2JN7 A;  4DMZ A;  2W1T B;  3MJQ A;  4IJG A;  1NLY A;  2OWJ A;  3KYZ A;  2V9A A;  4I3J A;  3LID A;  3UB8 A;  5F6A A;  4EQ1 A;  5KSH A;  3EQV A;  4NKP A;  2B02 A;  4L9E A;  4BJP A;  4KQD A;  3B42 A;  3E98 A;  2W27 A;  4HY8 A;  4ETZ A;  3NHQ A;  4GS9 B;  3E4P A;  4F3L A;  3U2A A;  3ULF A;  1TS6 A;  4WF0 A;  4EET B;  5FL3 A;  3BQA A;  4OOM A;  3LIE A;  3KSH A;  2HF6 A;  4LRZ E;  5HD5 A;  4HQA A;  3C8C A;  3FC7 A;  3CUE C;  4Q0J A;  2G7U A;  3UE6 A;  1OPX A;  5DKK A;  1P97 A;  2EA9 A;  2WKP A;  4XT2 A;  5HZH A;  4Y3I A;  3B47 A;  2V1B A;  3OC2 A;  3LFV A;  5HL6 A;  4NXE A;  4B93 A;  2JKR I;  3S7P A;  3DBA A;  5AJG A;  1LT0 A;  2V0U A;  5A8B A;  4JGO A;  4CLC E;  4HH2 A;  3O5Y A;  4NEE D;  3EGX C;  3CIT A;  5DJT A;  1F5M A;  2QJ7 A;  4HHD A;  2PDR A;  4EXO A;  4YNR A;  1T18 A;  3HCY A;  4IUH A;  3OBF A;  1WA9 A;  4LLO B;  5HWV A;  1NRJ A;  3UME A;  1OJG A;  1UGU A;  3PBT A;  2KLI A;  1MKM A;  3F1N B;  2ZMV A;  1OTI A;  4WEJ A;  1X0O A;  3FG8 A;  4MN5 A;  3TW8 A;  1T1C A;  3IBR A;  3TE8 A;  3MQO A;  1XFQ A;  2J3T D;  4EEU A;  2PYR A;  4MN6 A;  2V0W A;  5HPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...