2LB9A

Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state (corrected pyrrole ring planarity)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a cyanobacterial phytochrome GAF domain in the red-light-absorbing ground state.
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
molecule tags Transferase
molecule keywords Sensor histidine kinase
total genus 33
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2lb9A00
3LFVA 3NHQA 4GW9A 5I5LA 4Y2FA 2QYBA 2LB9A 3NOPC 5LBRA 1YKDA 4ETZA 5DFYA 4Q0IA 3C2WA 5HL6A 2G7UA 3S7NA 3S7PA 2LB5A 3NOTC 2W1TA 2O9BA 2O9CA 3IBRA 3EEAA 5K5BA 4GLQA 3DBAA 3RFBA 3KSGA 1YSPA 2VEAA 4Y5FA 1ZTUA 4G3KA 2VZWA 4LRZE 4MCWA 4CQHA 2K31A 3MQ0A 3ZQ5A 5L8MA 3KO6A 4O0PA 4Y3IA 2O99A 2M7VA 1YSQA 4RQ9A 4Z1WA 3G6OA 3MMHA 3K2NA 4DN0A 3HCYA 4Q0HA 2Y8HA 2W3EA 4ME4A 4O8GA 4MDZA 4DMZA 3OBFA 4EUVA 2W3FA 4IUKA 2VKSA 3CITA 3BJNA 1STZA 2XRNA 1MC0A 3W2ZA 4G3VA 4R70A 1MKMA 3TRCA 1TD5A 3O5YA 3S7OA 4G3WA 2O0YA 2HGVA 4IJGA 4R6LA 4O01A 4PAUA 5DFXA 2VJWA 2Y79A 4Q0JA 4YOFA 3R4KA 4ZRRA 1VHMA 3E98A 5C5KA 2W3HA 4FOFA 3S7QA 3E0YA 5HPIA 2W1TB 2W3GA 5TJJA 1F5MA 4MMNA 2OOLA 3IBJA 2M7UA 4LRXC 3NOUC 2XROA 3D3OA 4E04A 2W1RA 4BWIA 3VV4A 5HSQA 2XSSA 4YNRA 2W3DA 3KSHA 3KSIA 2IA2A 3CI6A 3MF0A 4EU0A 2KOIA 4LRYC 2B18A 3KSFA 4ETXA 1TF1A 4QPRA 4IUHA 4MN7A 2ZMFA 2KLIA 5AJGA 2K2NA 2O9AA 5HPFA 2GX5A 3OOVA
chains in the Genus database with same CATH superfamily
5FAQA 5CRFA 2ZQCA 4GW9A 3M2JA 5TR7A 3VE3A 3VP3A 2V8FA 4HBTA 4OPQA 4OLGA 3PTEA 4U3TA 2Z2LB 5DTSA 1BLPA 2Y91A 4CQHA 3E2LA 3UB9A 3MQ0A 3G2ZA 4Y15A 3LY3A 4BQMA 3VFHA 5FEGA 4UA7A 2ZC7A 4P85A 1ONGA 5E2GA 1YT4A 3G35A 4OQHA 3UB5P 3H9WA 2JKTI 3IX8A 4BBVA 4F94A 3OBFA 5E2FA 2EFXA 1SDNA 2ZC4B 5A93A 5FQJA 2P7JA 3LICA 3O5YA 1K54C 4EV4A 1BTLA 5E43A 1VETA 1WE4A 4QWOA 2OAP1 2Y2PA 3BECA 4Q0JA 4BBTA 1T1BA 1EI5A 1FILA 4JGPA 4DE1A 1ZG4A 3KYZA 2PDRA 2Y59A 5FAPA 4UQIS 4KZ3A 1ODVA 4WZ5C 3BFCA 5F1GA 2MJ6A 4JF6A 1NLYA 3HL9A 1L0DA 3EQUA 1MPLA 3C4PA 3T12B 5DF7A 3KSFA 3CUEA 1TF1A 4HJ3A 3B42A 4CLCB 5DF9A 1K0KA 5AJGA 3IWQA 4MN7A 2HP9A 5E2HA 3T4LA 3HUNA 3UE3A 2Y2JA 4PM5A 1JWZA 4KZ8A 3Q7VA 3R7WA 3OPRA 2PD8A 1DY6A 4B4XA 3S7NA 4EW7A 1BT5A 3ZG9B 4KZBA 4DE0A 2O9CA 1IYQA 3EEAA 1WYBA 1LL5A 4P6BA 1GA0A 2VEAA 2Y2QA 2XR0A 4WMCD 3N4IA 5FDSA 1PI4A 4JF4A 4FH4A 3JVUA 4S2JA 5KSHA 3IF5A 2E8IA 4RQ9A 3CJMA 4HQAA 3G31A 4DN0A 4BD0A 2HPBA 1Y54A 2OWJA 5EOOA 2VGKA 4GHIA 1MWSA 1EW0A 4XT2A 5GLAA 3GV9A 2OSUA 4WEKA 4BENA 3IXDA 4G3WA 2VV8A 3V5MA 1SKFA 3CLOA 5EV0A 3WS1A 4DRTA 1FCMA 4X55A 2ACGA 1I2SA 4S2KA 1WA9A 5CHJA 1L3LA 3CPTA 3Q82A 2DMWA 1OTIA 4B4ZA 4EWFA 2JKTM 3LR5A 4CLCC 2R9XA 1L0EA 2FFYA 4ID4A 2HV1A 4HOIA 4S2NA 4BWIA 1M40A 4PHTA 5HDCA 3VMAA 1MY8A 2HP6A 1LHYA 3VSKA 5EPHA 2ZMAA 5L09A 5M18A 3HLFA 3CPTB 3HVFA 3NOPC 3T4JA 3OPHA 5G18A 1NZOA 4FCFA 4GLQA 3DBAA 3KSGA 4QY5A 3ULFA 2WADA 1YLPA 3MXQA 3PBTA 5FI2A 4X53A 4ARZB 1N9OA 5HW3A 1DP8A 1S67L 4O7DA 5FL3A 4CJNA 3FZCA 1XGJA 1OTDA 1YSQA 4Z1WA 1NRJA 1T1AA 4E6XA 4KZ5A 1N9LA 4EUZA 2OV5A 3IX3A 4WM9A 2G2WA 1YLZA 4I39A 4R70A 3WRZA 4JGQA 1K54A 2ZM2A 2ZC6B 4MEZA 1YMSA 1VETB 5DFXA 4RX2A 2VV7A 3OZHA 2XH9A 4ZRRA 2GJ3A 3E98A 1P97A 1GCEA 2QKPA 4EEUA 4LPZA 2L0WA 1OTEA 3NI9A 4OQ0A 1W63M 1EWZA 4OLDA 2EFUA 4UAAA 4LRXC 3VOLA 4R1GA 5HZHA 4NXFA 2PBYA 2EXBA 5BOHA 2QJ5A 1YLYA 3LEQA 1KGFA 4IUHA 1H8MA 4QY6A 3NDEA 2AVXA 4PKYA 1P0ZA 3UPNA 2E8JA 3DTMA 3F1OA 5TBMA 3DWZA 3GECA 4ZJ3A 1Z6FA 5F6AA 1FR1A 1ACFA 2WGVA 4R4SA 4MCWA 1IOUA 4ZTKA 2XEPA 4P6ZS 2D01A 3KO6A 3EQVA 3ZG0A 3FKVA 1G6OA 1PW8A 1XJ2A 2A2LA 1G28A 3MSHA 1K56A 4FSFA 4HH2A 4KZ6A 3IS2A 4EUVA 1KE4A 3T4SA 3DAVA 1G5UA 1Q2QA 5HAPA 2CC1A 2WKPA 3F1NA 3GR2A 2J3WA 4H6JA 1LI9A 4HBUA 3A0RA 3ZCZA 3SOIA 2A49A 1SCWA 5G4YA 1GSXA 5KZHA 2W3HA 3S7QA 5CHUA 3BY8A 3CAXA 3P01A 3S1YA 5TJJA 4JXVA 4CPKA 4MMNA 3EEHA 4U0TA 4Y7PA 1SKOA 3C30A 5EFWA 3B47A 2ZD8A 4XT2B 3IHAA 3N7WA 1JTDA 3LGOA 3C5AA 3QP5A 3L9KA 2KOIA 3QP1A 4WELA 1PZPA 1DP6A 2Z6DA 4Y0UA 3UDXA 3KX0X 4RYEA 5F1FA 5HWTA 1K56D 3E4OA 5HPFA 5EVIB 1BZAA 2ZQDA 3HUOA 2B5RA 2H0YA 2WZZA 3MKFA 2WAEA 2Y2HA 3VP1A 1X0OA 1PNEA 5LBRA 2J9PA 4WUJA 5M1AA 3S7PA 5L2FA 2P9VB 3UN7A 4OVDA 1MXOA 5GHZA 3ISGA 4Y5FA 3SH7A 2VV6A 5DTKA 3T4TA 5FQQA 1IYOA 3AGDA 1QMFA 1CI8A 4YWZA 2XF3A 4Y3IA 1S6RA 3SH8A 3C38A 3MMHA 3CZDA 1N9BA 1YM1A 1MWRA 3QHYA 3AGFA 1IKGA 2W3EA 3MFXA 3NULA 1STZA 3V3SA 5HDDA 1MKMA 4XUZA 1BLSA 4GN2A 4K0WA 1XP4A 2Y2MA 5DJUA 1MWUA 3HJKA 5HD5A 2I72A 2DRWA 2W1TB 4Y13A 1HD8A 3UE0A 4X1LA 4M3KA 2HDRA 2Q9NA 3DTIA 4BMWA 2XROA 3D3OA 4LGWA 5JYPA 1GHMA 1PZOA 2IA2A 4X68A 3E4QA 4LRYC 1CF0A 4ETXA 2KLIA 3LO7A 1CJFA 4E3NA 4KUOA 4D2OA 2GX5A 3HLDA 4KZAA 5A91A 2JKRI 1S1ZA 3HBRA 5IU1A 5FASA 5IHVA 2PHYA 4NG2A 3IH9A 3S4XA 5M19A 3UPPA 2R78A 4OOLA 2PT7A 1IYPA 3BFEA 5FATA 2PU2A 3IXHA 2HF6A 3SW1A 2HDUA 3PHYA 3IX4A 2EWVA 2INWA 3TE8A 2C5WB 2PYRA 3RXWA 1FSWA 2Y4AA 2QZ6A 4N9LA 4EBLA 1OTAA 5J3WA 2P74A 2QHKA 3ZFZA 4CLCD 3BWLA 4B88A 3UDFA 5EM1A 2XFTA 5CX7A 3DTKA 4XUXA 2WGIA 4MBKA 1TEMA 2VJWA 3Q07A 1K55C 2FH5A 3Q81A 3KYQA 3T1RA 3LIEA 2V8CA 3F1PA 3UB8A 2IWDA 2V0UA 1JVJA 1K57C 3IF6C 5HSQA 3VV4A 3VSLA 2ZBBA 4MN6A 4KQQA 3DWKA 4WZ5A 1CEFA 2B18A 1SDEA 2XFSA 1PW1A 1KE0A 2K2NA 4HY8A 3MXRA 3MFDA 1KOUA 3NC8A 1ERQA 1KDSA 5GHYA 4BL2A 2ZC5B 3BQ8A 4QB8A 3VP2A 5HL6A 2G7UA 1L0FA 4I3AA 2J3TD 1W63Q 2VGLS 3GSGA 2ZL1A 1OT9A 2HZ5A 1LSWA 2XA7M 3LI9A 1EROA 1K38A 3P7NA 5FAOA 3QP4A 4EQ1A 5CXWA 4H6JB 4PM8A 5GHXA 4E3OA 1W8YA 5I94A 2Y2KA 1K57A 4ME4A 4O8GA 3LI8A 1YPRA 2ZOIA 2JHEA 1MKIA 3TRCA 2QMIA 2JKGA 3CHWP 1F98A 1TDGA 3OLOA 3WS5A 4R0QA 4R6LA 1DJAA 3LIBA 1LL9A 5DKKA 1YLWA 1J3WA 4IBRA 4E6WA 2L1MA 3IXGA 1KVLA 1BUEA 5MC7A 4S2PA 2NUPC 4D60A 4PPRA 4QU3A 1KE3A 3I7JA 5FQKA 4N9KA 3GDIA 4E04A 4EESA 2YKFA 4LV0A 4DJ3A 2VLGA 1JWPA 4OQGA 3UNWA 4I5SA 4KZ4A 1PYYA 5FQMA 4WL9A 3S22A 5A90A 3IH8A 3W4OA 4GB7A 1HLUP 1FCNA 1S66L 2IWBA 3A3EA 3M6HA 1V9YA 3WS4A 4HI4A 3L7HA 5F82A 3SS3A 3NHQA 2W27A 3IF6A 1IEMA 1XFNA 3ZDJA 1O07A 4ETZA 1N9NA 2LB5A 3NOTC 1K4FA 2GNXA 1NLZA 2HDSA 5A8BA 1H8YA 3LR4A 4LCLA 4KUKA 4JGOA 1NJ4A 1ZTUA 5FA7A 5GLDA 1JTGA 4NXEA 4EXOA 4EBPA 1FSYA 1XXMA 4S2NC 1ES2A 2JC7A 2ZQ7A 2EX6A 3G6OA 3W8KA 2CMNA 3C7VA 4CLCA 5KMWA 3HCYA 4BBUA 5EOEA 4FH2A 4WLAA 3H82A 4S2LA 1P9WA 1L2SA 3JPUA 2PBDP 3P09A 1CI9A 3IF6B 1W7FA 3NECA 3VOYA 2PU4A 4PM7A 2V2FF 3QP2A 1S1YA 4OOYA 5AQBA 3EGDC 2ZQAA 1C3BA 4MNRA 3EGXC 1XFQA 4FTXA 5F68A 1Y4OA 3ZG5A 2V1ZA 4IHQA 1Q2PA 3A3JA 4PM6A 1F9IA 1VM1A 4LENA 1ZG6A 4K91A 5EVIC 3IWIA 4BJPA 5GL9A 1QMEA 3T4KA 1IFQA 3A3DA 3HLWA 4A5RA 4LV2A 3GQZA 1PRQA 1D1JA 4OH0A 3RXXA 5FI7A 2VX8A 1FQGA 3V3RA 3OOVA 1LT0A 2ZLYA 2ZJ9A 4LV1A 2QYBA 1RGYA 3QP8A 1YKDA 4I38A 4U0XA 4LCMA 3BY9A 3GVBA 4DXCA 1KGEA 3IBRA 1IYSA 4E3IA 1U60A 5JYOA 1G68A 5EUAA 3V67A 2FFFB 1NYYA 2B95A 3LIDA 4G3KA 4M4XA 3A3FA 5J4EA 3Q7VB 4B9OA 2B02A 5FQ9A 4ZBEA 2EA9A 4HIAA 4JKTA 3LIAA 3TOIA 2Y8HA 2R9WA 3FYZA 4S2OA 4I3IA 4OPRA 3CITA 3K3CA 3P98A 5HWWA 2WAFA 3FC7A 2V9AA 1SKOB 4GDNA 4WN5A 4RX3A 4DXBA 2VGLM 1XKZA 1BYWA 3E4PA 1P9RA 2XQZA 2WKIA 3B3XA 1UGUA 3EOIA 5FQIA 1NY0A 2Z6CA 4OOMA 2C6WB 1ALQA 2M7UA 2HDQA 3OPLA 5HL1A 3F1NB 4JBFA 2XSSA 3G32A 1LSVA 1O7EA 1F2KA 3D72A 2ZM8A 4ZJ1A 4N92A 3ZNYA 1N4OA 4HEFA 4DKIA 2O9AA 2QPNA 1YLTA 3FWLA 4R38A 5I5LA 4KG6A 4GJ4A 2LB9A 2OAQ1 2Y2OA 2HJEA 2EXAA 2EX9A 3MZEA 2W1TA 2WZXA 1HTZA 2O9BA 2JE5A 3MQOA 5K5BA 4FUWA 2KX6A 1RGZA 1ES5A 1ZKJA 3ZHHA 4ZAMA 2YKHA 4B93A 3GRJA 2UV0E 1NZUA 4ESPA 1CQAA 4PKYG 5TGFA 1GSWA 5CTNA 2PRFA 3T4QA 2XDMA 4KQRA 2PYPA 3MBZA 3OPPA 3C7UA 3H7WB 3NY4A 4JLFA 3WS2A 1I2WA 5J7EA 3BW6A 3VE4A 1L0GA 1VEUA 4G3VA 4DDYA 4WEJA 2VK3A 3T1QB 1S4SA 2O0YA 1TS0A 1VB6A 2XA7S 2HGVA 4IVIA 4O01A 5FDHA 2W0NA 4NETA 1E4DA 4QHCA 2Q0OA 1H3QA 4DE2A 1V9ZA 1TS7A 1XPBA 5IS1A 1NWZA 5D3OA 3UDIA 5EE8A 3CWFA 1H5XA 1KVMA 1S0WA 2X01A 3OCNA 3KSHA 3TSGA 5HFOA 2ZC3B 3CI6A 4GZBA 1IELA 5G4ZA 3T4OA 4C75A 3ZGAB 3ZNTA 4OP8A 5KSCA 2WKEA 2JN7A 3NJAA 2K31A 4GCZA 3LFVA 2I9VA 5DVAA 4FD8A 3UO9A 2WGWB 5FSRA 1YMXA 3BFDA 4EEPA 5HARA 4Q0IA 3PYPA 2WK0A 2Y55A 4NK3A 4E3MA 2P08A 4X6TA 3V50A 3PXPA 5J8XA 4XXRA 4GS9A 4YINA 4UEYA 5CHMA 5L07A 3QP6A 4UQIM 3T50A 1ONHA 3HLCA 3BLSA 3JVVA 4JXWA 4DMZA 1GSVA 4E3KA 2P04A 4F3LA 3IT9A 2XRNA 1MC0A 1NYMA 3NBLA 1W79A 3LY4A 2NUTC 4WYYA 4X1MA 3BFGA 3U2AA 4KG5A 4S2MA 2J9OA 1HZOA 5DJTA 2VGJA 1KDWA 3M6BA 3PBSA 3MS6A 3CG5A 3ZYTA 1W5DA 3QNCA 3ZVTA 2JBFA 4PMAA 5CERA 1TS6A 3IBJA 5AQ9A 1H8ZA 3CUEC 4GD8A 4DF6A 2Q9MA 1LSXA 3MQQA 2V0WA 2JKFA 4MBFA 1S4RA 1WYCA 3MF0A 4EU0A 5FI6A 3H7WA 4KZ9A 3F1PB 1SZVA 3MR0A 3M2KA 5FEFA 1GHPA 4R4RA 5CGSA 5F69A 2HJ9C 4L9EA 1OJGA 1M6KA 4R3JA 5CEBA 1XJ3A 4S2IA 2QWSA 4OPZA 5EVIA 2M1CA 5AVEA 2D02A 3LEZA 2OLUA 4L0LA 3LYXA 4O0PA 2XD1A 2M7VA 2Y2NA 2P9VA 2EX2A 5EECA 2V20A 3K2NA 1K6RA 3D9YA 4Q0HA 4HJ4A 3SZTA 1DRMA 1ES3A 4NXBA 1E25A 5A92A 3BJNA 3W2ZA 1XA7A 3EWKA 1FOFA 2IWCA 4HJ6A 1XA1A 2L4RA 1HVBA 4NEED 1MZUA 2WKQA 3IHBA 5GLCA 4PAUA 1DP9A 2G2UA 3PAEA 3LCEA 4EERA 1I5QA 1K4EA 2VA0A 4JGRA 4EETB 2Y2IA 1FCOA 3NOUC 1YQSA 3ZG7B 5GLBA 4Y0OA 3IXBA 2W1RA 1RP5A 4KENB 1OPXA 1OT6A 3KSIA 3H82B 1BULA 3GTCA 4QPRA 4IEDA 4ARZA 3LR0A 2QJ7A 2GDNA 1XJ4A 3BM6A 2A24B 3MJQA 3JYIA 4Y2FA 5HDSA 5AQ7A 1ESIA 3WS0A 2OWHA 2ZQ8A 1DJCA 3PBNA 2JCHA 3FV7A 5CEDA 4HNBA 1D7EA 5HX9A 4EQIA 5AVFA 1YAXA 4LRZE 3ITBA 4HH3A 5L8MA 4GKUA 3W4PA 3NIAA 4WMCA 2RL3A 3HREA 4OPYA 2EX8A 3T1SA 2WGWA 2BLSA 1JWVA 1ERMA 1OJ5A 3Q7ZA 5HD3A 4MN5A 1ZC2A 1FIKA 4GOGA 2BG1A 2HP5A 4I3JA 2ZM0A 1LI0A 2J8YA 5E2EA 3UE6A 4UA9A 3R7WB 4OONA 1XX2A 4E3JA 1LLBA 1T18A 1IKIA 2X02A 3BRMA 2H10A 1ZHHB 1E3UA 1MWTA 3VP0A 2W3GA 5TBMB 1F5MA 5HAIA 1TDLA 4KG2A 1SHVA 3RH8B 3SS4A 1CK3A 3ITAA 4BL3A 2BASA 3OCLA 2X71A 2W3DA 2WUQA 3SH9A 1Z09A 4N1HA 3N8RA 4LLOB 3HLGA 4NKPA 2XGNA 3O87A 3FPVA 2BTFP 2Y2LA 3G34A 5F83A 3HUMA 4X56A 4JXSA 2Y2GA 4MBHA 1YLJA 4GHIB 4IVKA 3A0SA 1BLHA 4R23A 2EWWA 4DJ2A 4GNUA 1BLCA 4DE3A 4E3LA 1PI5A 3FPWA 1JNUA 3FG8A 4Y17A 2XK1A 4F3LB 3BYDA 3HLBA 3PAGA 4Q8IA 4NXGA 2H5SA 4QJGA 3QNBA 1PWGA 4HP9A 3ZVWA 5DF8A 1K55A 1PWCA 4N1XA 4PM9A 3N8SA 2Z2MB 5EM0A 3G4PA 3VFFA 4HP4A 1T1CA 4H8RA 3BFFA 3LR3A 2RCXA 1TD5A 3S7OA 1CEGA 2ZOHA 2A24A 3B33A 3UMEA 3RTYA 3E0YA 2H28A 2PAVP 3N6IA 1Y28A 1UWNX 3LUQA 4JXGA 4LFUA 1NRFA 3G30A 4YNRA 4UHUA 4K0XA 2DCFA 4R3BA 1PWDA 3KYEA 3ICYA 2ZMFA 4ZJ2A 1A0KA 3A3IA 1XJ6A 4OKPA 4P6ZM 5AQAA 1H0MA 3V39A 2WKRA 4X69A 2PR5A 2PR6A 5EVLA 4R3AA 4JPMA 1G6AA 3UB6A 4GD6A 1E3UD 2JKRM 3RFBA 1YSPA 3VOZA 5IT5A 2VZWA 1D06A 4QD4A 3UPOA 3TG9A 3MXSA 3ZQ5A 3F1OB 1TS8A 2O99A 5CGWA 1K25A 3U4LP 4AFIA 3TJZC 3K3DA 4II7A 3MKEA 1LL8A 3N8LA 3MZDA 3O88A 4MDZA 3PR6A 4KQOA 1FR6A 2FZ0A 2VKSA 5L10A 5DKLA 3T1XA 2ZL1B 4Z9QA 4ZDXA 1AXBA 1KGGA 4IJGA 4WBGA 4GDBA 4BLMA 3UY6A 3R4KA 5C5KA 2GZAA 2A3UA 5DTTA 2OOLA 4GS9B 4WF0A 3BQAA 2KDKA 5CTMA 4OQIA 4OP5A 3E2KA 4KQDA 3PBRA 3LIFA 1PIOA 5KIZA 4X25A 3NDGA 3BLMA 1MBLA 2ZQ9A 2XLNA 3W4QA 1DJBA 2XD5A 2H0TA 4K08A 4MLLA 1GA9A 3BEBA 3VP4A 1NXYA 4C6YA 1W8QA 3UB7A 3PBQA 5DFYA 3C2WA 4CLCE 3DTEA 4BD1A 1TVFA 3MZFA 3RJUA 4RVAA 5F5YA 3DW0A 3C8CA 5HWVA 2K7SA 1J9MA 3IQAA 4LV3A 3ZG8B 4C3QA 3SS5A 1OMEA 2OLVA 1UWPX 4HESA 4L9FA 4EBNA 2WKHA 4IBXA 1K6SA 3PBOA 2UWXA 3CMZA 3FKWA 3Q1FA 1AWIA 3D4FA 2W3FA 3IS2B 4IUKA 3G2YA 4KZ7A 4DDSA 3WRTA 3A0VA 1VQQA 3AGEA 1ES4A 4WZ4A 3UMDA 4HHDA 2Y79A 5CGXA 2ZMVA 4YOFA 1RCJA 3O3VA 3C4OA 4P87A 1XGIA 1VHMA 4FOFA 2J3TC 5HPIA 2J80A 3NCKA 3O86A 4Y0TA 3UE1A 2V1BA 5HAQA 2J7VA 4UA6A 4L9GA 1OTBA 1BSGA 2WYXA 5EVID 5CECA 3OC2A 4P0MA 2V1AA 1GHIA 3IWOA 4RA7A 2DNSA 3HLEA 5U47A 1PFLA 4JF5A 3HJIA 1ESUA 1VEUB 1T19A 5TFQA 3GMWA 3WWXA 2PD7A 3TW8A 5EVEA 4YFMA
chains in the Genus database with same CATH topology
1LT0A 4GW9A 2A24B 3MJQA 4Y2FA 1X0OA 2QYBA 5HDSA 5LBRA 1YKDA 4I38A 4WUJA 3S7PA 3VE3A 3BY9A 2OWHA 3PBNA 4HNBA 3IBRA 1D7EA 3V67A 4Y5FA 5AVFA 1YAXA 2VV6A 3LIDA 4G3KA 4M4XA 4LRZE 5J4EA 4CQHA 3T4TA 3UB9A 3MQ0A 4B9OA 4HH3A 5L8MA 4YWZA 4Y3IA 2B02A 2EA9A 4HIAA 3C38A 3MMHA 3LIAA 2Y8HA 1OJ5A 5HD3A 2W3EA 4MN5A 3H9WA 2JKTI 4BBVA 3OBFA 4I3IA 3MFXA 3CITA 3K3CA 1STZA 5HWWA 4I3JA 5HDDA 1MKMA 2P7JA 3LICA 3FC7A 3O5YA 2V9AA 3UE6A 4WN5A 3R7WB 2VGLM 2OAP1 1BYWA 5DJUA 1T18A 4Q0JA 3HJKA 5HD5A 4BBTA 1T1BA 1ZHHB 3E4PA 1P9RA 2W1TB 2W3GA 5TBMB 1F5MA 1UGUA 3EOIA 4JGPA 2Z6CA 4OOMA 3RH8B 3KYZA 2PDRA 4UQIS 2M7UA 4BMWA 1ODVA 2XROA 3D3OA 3F1NB 2BASA 2MJ6A 3OCLA 2XSSA 1NLYA 2W3DA 1LSVA 3EQUA 2IA2A 3D72A 3E4QA 4LLOB 4LRYC 3KSFA 4ETXA 3CUEA 1TF1A 4HJ3A 4NKPA 3B42A 4CLCB 5DF9A 2KLIA 3FPVA 5AJGA 4KUOA 2O9AA 4MN7A 2GX5A 3T4LA 2JKRI 4GHIB 3UE3A 1S1ZA 4R38A 3R7WA 5I5LA 4GJ4A 2LB9A 2OAQ1 3A0SA 2PD8A 5IU1A 2HJEA 3S7NA 4EW7A 2EWWA 2PHYA 4DJ2A 2W1TA 2O9BA 2O9CA 3EEAA 3MQOA 5K5BA 2KX6A 2R78A 2VEAA 3FPWA 4OOLA 1JNUA 2PT7A 3FG8A 2YKHA 4B93A 4F3LB 4NXGA 2HF6A 3SW1A 3PHYA 3JVUA 4PKYG 4HP9A 2EWVA 5KSHA 1GSWA 2INWA 3T4QA 4RQ9A 4HQAA 3TE8A 4DN0A 2PYPA 2PYRA 3H7WB 2OWJA 5J7EA 1OTAA 3BW6A 3VE4A 4HP4A 5J3WA 1T1CA 4GHIA 2QHKA 3LR3A 4G3VA 1EW0A 4XT2A 4CLCD 3BWLA 4WEJA 1TD5A 4WEKA 3S7OA 4G3WA 1S4SA 5CX7A 2O0YA 2VV8A 1TS0A 1VB6A 2XA7S 2HGVA 2A24A 2ZOHA 3B33A 4O01A 3CLOA 2VJWA 3UMEA 2W0NA 1WA9A 2FH5A 3RTYA 3E0YA 2H28A 2DMWA 1OTIA 3KYQA 1H3QA 2JKTM 3LR5A 3LIEA 4CLCC 3F1PA 1V9ZA 1TS7A 5IS1A 1NWZA 3UB8A 2V0UA 1Y28A 2HV1A 1UWNX 4HOIA 3LUQA 3CWFA 5HSQA 4BWIA 3VV4A 2ZBBA 4MN6A 4PHTA 5HDCA 4YNRA 3OCNA 3KSHA 3CI6A 2B18A 5G4ZA 3T4OA 3ICYA 2JN7A 2ZMFA 3NJAA 2K2NA 4HY8A 2K31A 1KOUA 1XJ6A 4GCZA 4P6ZM 3LFVA 2I9VA 3NOPC 2WKRA 3BQ8A 3T4JA 4EEPA 5HL6A 2PR5A 4Q0IA 2G7UA 2PR6A 3PYPA 4I3AA 2J3TD 4R3AA 1W63Q 2VGLS 3UB6A 2P08A 2JKRM 4GLQA 3DBAA 3RFBA 3KSGA 3ULFA 1YSPA 1OT9A 3PXPA 1LSWA 5IT5A 2XA7M 3LI9A 3P7NA 3MXQA 3PBTA 2VZWA 4ARZB 1D06A 4GS9A 4UEYA 1N9OA 1DP8A 3ZQ5A 1S67L 3F1OB 1TS8A 4UQIM 5FL3A 2O99A 4EQ1A 3T50A 4H6JB 4AFIA 1OTDA 1YSQA 3TJZC 4Z1WA 1NRJA 1T1AA 3JVVA 3K3DA 4II7A 1N9LA 1LL8A 4ME4A 4O8GA 4MDZA 4DMZA 1GSVA 3LI8A 3PR6A 4KQOA 2P04A 2FZ0A 2VKSA 4F3LA 2XRNA 1MC0A 2ZOIA 2JHEA 5DKLA 4I39A 4R70A 2NUTC 4JGQA 3TRCA 3U2AA 1F98A 5DJTA 3OLOA 4IJGA 4R6LA 5DFXA 3LIBA 2VV7A 3PBSA 3ZYTA 3R4KA 4ZRRA 5DKKA 2GJ3A 3E98A 1P97A 5C5KA 2QKPA 2L1MA 4EEUA 4LPZA 2L0WA 1OTEA 2GZAA 5MC7A 1W63M 2OOLA 2NUPC 1TS6A 3IBJA 4GS9B 4WF0A 3BQAA 3CUEC 2KDKA 3VOLA 3GDIA 4LRXC 4E04A 5HZHA 4NXFA 4EESA 2YKFA 4KQDA 1LSXA 4DJ3A 3MQQA 3PBRA 2VLGA 2V0WA 4I5SA 1S4RA 4WL9A 3LIFA 3MF0A 4EU0A 2QJ5A 5KIZA 1S66L 3H7WA 4IUHA 1H8MA 1V9YA 3F1PB 4HI4A 4PKYA 3MR0A 1P0ZA 4K08A 3NHQA 5F69A 2W27A 2HJ9C 1XFNA 4L9EA 3F1OA 3UB7A 3PBQA 4ETZA 1OJGA 5DFYA 1N9NA 3C2WA 4CLCE 2LB5A 1XJ3A 3NOTC 2GNXA 5TBMA 2QWSA 3GECA 1NLZA 5F5YA 3C8CA 5HWVA 2K7SA 5F6AA 5A8BA 3LR4A 2M1CA 4KUKA 4JGOA 1ZTUA 4MCWA 1IOUA 5AVEA 2D02A 4NXEA 4P6ZS 2D01A 1UWPX 4EXOA 4L0LA 3KO6A 3LYXA 3EQVA 4O0PA 1G6OA 4L9FA 1XJ2A 2A2LA 2M7VA 1G28A 3G6OA 3K2NA 2CMNA 3PBOA 4CLCA 3HCYA 4Q0HA 4BBUA 2PD7A 4WLAA 4HJ4A 4FSFA 1DRMA 4HH2A 3H82A 1P9WA 3IS2A 4NXBA 4EUVA 2W3FA 3IS2B 4IUKA 3BJNA 3W2ZA 3EWKA 3T4SA 4HJ6A 2L4RA 4NEED 3A0VA 2WKPA 3F1NA 2J3WA 4H6JA 1MZUA 2WKQA 3UMDA 4HHDA 3A0RA 4PAUA 1DP9A 2Y79A 1S1YA 2ZMVA 4YOFA 3EGDC 5G4YA 4EERA 1GSXA 1VHMA 2W3HA 4FOFA 3EGXC 3S7QA 2J3TC 1XFQA 3BY8A 3CAXA 3P01A 5F68A 5TJJA 5HPIA 2J80A 2VA0A 4MMNA 2V1BA 4IHQA 4JGRA 3EEHA 4EETB 3NOUC 4L9GA 1F9IA 1OTBA 3C30A 5EFWA 3B47A 3OC2A 2W1RA 4XT2B 2V1AA 1OPXA 1OT6A 4BJPA 3KSIA 3T4KA 1IFQA 3H82B 2KOIA 3HJIA 4WELA 1T19A 4QPRA 4ARZA 3LR0A 1DP6A 2Z6DA 3KX0X 2QJ7A 2VX8A 5HWTA 3E4OA 1XJ4A 5HPFA 3TW8A 3OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFV A;  3NHQ A;  4GW9 A;  5I5L A;  4Y2F A;  2QYB A;  2LB9 A;  3NOP C;  5LBR A;  1YKD A;  4ETZ A;  5DFY A;  4Q0I A;  3C2W A;  5HL6 A;  2G7U A;  3S7N A;  3S7P A;  2LB5 A;  3NOT C;  2W1T A;  2O9B A;  2O9C A;  3IBR A;  3EEA A;  5K5B A;  4GLQ A;  3DBA A;  3RFB A;  3KSG A;  1YSP A;  2VEA A;  4Y5F A;  1ZTU A;  4G3K A;  2VZW A;  4LRZ E;  4MCW A;  4CQH A;  2K31 A;  3MQ0 A;  3ZQ5 A;  5L8M A;  3KO6 A;  4O0P A;  4Y3I A;  2O99 A;  2M7V A;  1YSQ A;  4RQ9 A;  4Z1W A;  3G6O A;  3MMH A;  3K2N A;  4DN0 A;  3HCY A;  4Q0H A;  2Y8H A;  2W3E A;  4ME4 A;  4O8G A;  4MDZ A;  4DMZ A;  3OBF A;  4EUV A;  2W3F A;  4IUK A;  2VKS A;  3CIT A;  3BJN A;  1STZ A;  2XRN A;  1MC0 A;  3W2Z A;  4G3V A;  4R70 A;  1MKM A;  3TRC A;  1TD5 A;  3O5Y A;  3S7O A;  4G3W A;  2O0Y A;  2HGV A;  4IJG A;  4R6L A;  4O01 A;  4PAU A;  5DFX A;  2VJW A;  2Y79 A;  4Q0J A;  4YOF A;  3R4K A;  4ZRR A;  1VHM A;  3E98 A;  5C5K A;  2W3H A;  4FOF A;  3S7Q A;  3E0Y A;  5HPI A;  2W1T B;  2W3G A;  5TJJ A;  1F5M A;  4MMN A;  2OOL A;  3IBJ A;  2M7U A;  4LRX C;  3NOU C;  2XRO A;  3D3O A;  4E04 A;  2W1R A;  4BWI A;  3VV4 A;  5HSQ A;  2XSS A;  4YNR A;  2W3D A;  3KSH A;  3KSI A;  2IA2 A;  3CI6 A;  3MF0 A;  4EU0 A;  2KOI A;  4LRY C;  2B18 A;  3KSF A;  4ETX A;  1TF1 A;  4QPR A;  4IUH A;  4MN7 A;  2ZMF A;  2KLI A;  5AJG A;  2K2N A;  2O9A A;  5HPF A;  2GX5 A;  3OOV A; 
#chains in the Genus database with same CATH topology
 5FAQ A;  5CRF A;  2ZQC A;  4GW9 A;  3M2J A;  5TR7 A;  3VE3 A;  3VP3 A;  2V8F A;  4HBT A;  4OPQ A;  4OLG A;  3PTE A;  4U3T A;  2Z2L B;  5DTS A;  1BLP A;  2Y91 A;  4CQH A;  3E2L A;  3UB9 A;  3MQ0 A;  3G2Z A;  4Y15 A;  3LY3 A;  4BQM A;  3VFH A;  5FEG A;  4UA7 A;  2ZC7 A;  4P85 A;  1ONG A;  5E2G A;  1YT4 A;  3G35 A;  4OQH A;  3UB5 P;  3H9W A;  2JKT I;  3IX8 A;  4BBV A;  4F94 A;  3OBF A;  5E2F A;  2EFX A;  1SDN A;  2ZC4 B;  5A93 A;  5FQJ A;  2P7J A;  3LIC A;  3O5Y A;  1K54 C;  4EV4 A;  1BTL A;  5E43 A;  1VET A;  1WE4 A;  4QWO A;  2OAP 1;  2Y2P A;  3BEC A;  4Q0J A;  4BBT A;  1T1B A;  1EI5 A;  1FIL A;  4JGP A;  4DE1 A;  1ZG4 A;  3KYZ A;  2PDR A;  2Y59 A;  5FAP A;  4UQI S;  4KZ3 A;  1ODV A;  4WZ5 C;  3BFC A;  5F1G A;  2MJ6 A;  4JF6 A;  1NLY A;  3HL9 A;  1L0D A;  3EQU A;  1MPL A;  3C4P A;  3T12 B;  5DF7 A;  3KSF A;  3CUE A;  1TF1 A;  4HJ3 A;  3B42 A;  4CLC B;  5DF9 A;  1K0K A;  5AJG A;  3IWQ A;  4MN7 A;  2HP9 A;  5E2H A;  3T4L A;  3HUN A;  3UE3 A;  2Y2J A;  4PM5 A;  1JWZ A;  4KZ8 A;  3Q7V A;  3R7W A;  3OPR A;  2PD8 A;  1DY6 A;  4B4X A;  3S7N A;  4EW7 A;  1BT5 A;  3ZG9 B;  4KZB A;  4DE0 A;  2O9C A;  1IYQ A;  3EEA A;  1WYB A;  1LL5 A;  4P6B A;  1GA0 A;  2VEA A;  2Y2Q A;  2XR0 A;  4WMC D;  3N4I A;  5FDS A;  1PI4 A;  4JF4 A;  4FH4 A;  3JVU A;  4S2J A;  5KSH A;  3IF5 A;  2E8I A;  4RQ9 A;  3CJM A;  4HQA A;  3G31 A;  4DN0 A;  4BD0 A;  2HPB A;  1Y54 A;  2OWJ A;  5EOO A;  2VGK A;  4GHI A;  1MWS A;  1EW0 A;  4XT2 A;  5GLA A;  3GV9 A;  2OSU A;  4WEK A;  4BEN A;  3IXD A;  4G3W A;  2VV8 A;  3V5M A;  1SKF A;  3CLO A;  5EV0 A;  3WS1 A;  4DRT A;  1FCM A;  4X55 A;  2ACG A;  1I2S A;  4S2K A;  1WA9 A;  5CHJ A;  1L3L A;  3CPT A;  3Q82 A;  2DMW A;  1OTI A;  4B4Z A;  4EWF A;  2JKT M;  3LR5 A;  4CLC C;  2R9X A;  1L0E A;  2FFY A;  4ID4 A;  2HV1 A;  4HOI A;  4S2N A;  4BWI A;  1M40 A;  4PHT A;  5HDC A;  3VMA A;  1MY8 A;  2HP6 A;  1LHY A;  3VSK A;  5EPH A;  2ZMA A;  5L09 A;  5M18 A;  3HLF A;  3CPT B;  3HVF A;  3NOP C;  3T4J A;  3OPH A;  5G18 A;  1NZO A;  4FCF A;  4GLQ A;  3DBA A;  3KSG A;  4QY5 A;  3ULF A;  2WAD A;  1YLP A;  3MXQ A;  3PBT A;  5FI2 A;  4X53 A;  4ARZ B;  1N9O A;  5HW3 A;  1DP8 A;  1S67 L;  4O7D A;  5FL3 A;  4CJN A;  3FZC A;  1XGJ A;  1OTD A;  1YSQ A;  4Z1W A;  1NRJ A;  1T1A A;  4E6X A;  4KZ5 A;  1N9L A;  4EUZ A;  2OV5 A;  3IX3 A;  4WM9 A;  2G2W A;  1YLZ A;  4I39 A;  4R70 A;  3WRZ A;  4JGQ A;  1K54 A;  2ZM2 A;  2ZC6 B;  4MEZ A;  1YMS A;  1VET B;  5DFX A;  4RX2 A;  2VV7 A;  3OZH A;  2XH9 A;  4ZRR A;  2GJ3 A;  3E98 A;  1P97 A;  1GCE A;  2QKP A;  4EEU A;  4LPZ A;  2L0W A;  1OTE A;  3NI9 A;  4OQ0 A;  1W63 M;  1EWZ A;  4OLD A;  2EFU A;  4UAA A;  4LRX C;  3VOL A;  4R1G A;  5HZH A;  4NXF A;  2PBY A;  2EXB A;  5BOH A;  2QJ5 A;  1YLY A;  3LEQ A;  1KGF A;  4IUH A;  1H8M A;  4QY6 A;  3NDE A;  2AVX A;  4PKY A;  1P0Z A;  3UPN A;  2E8J A;  3DTM A;  3F1O A;  5TBM A;  3DWZ A;  3GEC A;  4ZJ3 A;  1Z6F A;  5F6A A;  1FR1 A;  1ACF A;  2WGV A;  4R4S A;  4MCW A;  1IOU A;  4ZTK A;  2XEP A;  4P6Z S;  2D01 A;  3KO6 A;  3EQV A;  3ZG0 A;  3FKV A;  1G6O A;  1PW8 A;  1XJ2 A;  2A2L A;  1G28 A;  3MSH A;  1K56 A;  4FSF A;  4HH2 A;  4KZ6 A;  3IS2 A;  4EUV A;  1KE4 A;  3T4S A;  3DAV A;  1G5U A;  1Q2Q A;  5HAP A;  2CC1 A;  2WKP A;  3F1N A;  3GR2 A;  2J3W A;  4H6J A;  1LI9 A;  4HBU A;  3A0R A;  3ZCZ A;  3SOI A;  2A49 A;  1SCW A;  5G4Y A;  1GSX A;  5KZH A;  2W3H A;  3S7Q A;  5CHU A;  3BY8 A;  3CAX A;  3P01 A;  3S1Y A;  5TJJ A;  4JXV A;  4CPK A;  4MMN A;  3EEH A;  4U0T A;  4Y7P A;  1SKO A;  3C30 A;  5EFW A;  3B47 A;  2ZD8 A;  4XT2 B;  3IHA A;  3N7W A;  1JTD A;  3LGO A;  3C5A A;  3QP5 A;  3L9K A;  2KOI A;  3QP1 A;  4WEL A;  1PZP A;  1DP6 A;  2Z6D A;  4Y0U A;  3UDX A;  3KX0 X;  4RYE A;  5F1F A;  5HWT A;  1K56 D;  3E4O A;  5HPF A;  5EVI B;  1BZA A;  2ZQD A;  3HUO A;  2B5R A;  2H0Y A;  2WZZ A;  3MKF A;  2WAE A;  2Y2H A;  3VP1 A;  1X0O A;  1PNE A;  5LBR A;  2J9P A;  4WUJ A;  5M1A A;  3S7P A;  5L2F A;  2P9V B;  3UN7 A;  4OVD A;  1MXO A;  5GHZ A;  3ISG A;  4Y5F A;  3SH7 A;  2VV6 A;  5DTK A;  3T4T A;  5FQQ A;  1IYO A;  3AGD A;  1QMF A;  1CI8 A;  4YWZ A;  2XF3 A;  4Y3I A;  1S6R A;  3SH8 A;  3C38 A;  3MMH A;  3CZD A;  1N9B A;  1YM1 A;  1MWR A;  3QHY A;  3AGF A;  1IKG A;  2W3E A;  3MFX A;  3NUL A;  1STZ A;  3V3S A;  5HDD A;  1MKM A;  4XUZ A;  1BLS A;  4GN2 A;  4K0W A;  1XP4 A;  2Y2M A;  5DJU A;  1MWU A;  3HJK A;  5HD5 A;  2I72 A;  2DRW A;  2W1T B;  4Y13 A;  1HD8 A;  3UE0 A;  4X1L A;  4M3K A;  2HDR A;  2Q9N A;  3DTI A;  4BMW A;  2XRO A;  3D3O A;  4LGW A;  5JYP A;  1GHM A;  1PZO A;  2IA2 A;  4X68 A;  3E4Q A;  4LRY C;  1CF0 A;  4ETX A;  2KLI A;  3LO7 A;  1CJF A;  4E3N A;  4KUO A;  4D2O A;  2GX5 A;  3HLD A;  4KZA A;  5A91 A;  2JKR I;  1S1Z A;  3HBR A;  5IU1 A;  5FAS A;  5IHV A;  2PHY A;  4NG2 A;  3IH9 A;  3S4X A;  5M19 A;  3UPP A;  2R78 A;  4OOL A;  2PT7 A;  1IYP A;  3BFE A;  5FAT A;  2PU2 A;  3IXH A;  2HF6 A;  3SW1 A;  2HDU A;  3PHY A;  3IX4 A;  2EWV A;  2INW A;  3TE8 A;  2C5W B;  2PYR A;  3RXW A;  1FSW A;  2Y4A A;  2QZ6 A;  4N9L A;  4EBL A;  1OTA A;  5J3W A;  2P74 A;  2QHK A;  3ZFZ A;  4CLC D;  3BWL A;  4B88 A;  3UDF A;  5EM1 A;  2XFT A;  5CX7 A;  3DTK A;  4XUX A;  2WGI A;  4MBK A;  1TEM A;  2VJW A;  3Q07 A;  1K55 C;  2FH5 A;  3Q81 A;  3KYQ A;  3T1R A;  3LIE A;  2V8C A;  3F1P A;  3UB8 A;  2IWD A;  2V0U A;  1JVJ A;  1K57 C;  3IF6 C;  5HSQ A;  3VV4 A;  3VSL A;  2ZBB A;  4MN6 A;  4KQQ A;  3DWK A;  4WZ5 A;  1CEF A;  2B18 A;  1SDE A;  2XFS A;  1PW1 A;  1KE0 A;  2K2N A;  4HY8 A;  3MXR A;  3MFD A;  1KOU A;  3NC8 A;  1ERQ A;  1KDS A;  5GHY A;  4BL2 A;  2ZC5 B;  3BQ8 A;  4QB8 A;  3VP2 A;  5HL6 A;  2G7U A;  1L0F A;  4I3A A;  2J3T D;  1W63 Q;  2VGL S;  3GSG A;  2ZL1 A;  1OT9 A;  2HZ5 A;  1LSW A;  2XA7 M;  3LI9 A;  1ERO A;  1K38 A;  3P7N A;  5FAO A;  3QP4 A;  4EQ1 A;  5CXW A;  4H6J B;  4PM8 A;  5GHX A;  4E3O A;  1W8Y A;  5I94 A;  2Y2K A;  1K57 A;  4ME4 A;  4O8G A;  3LI8 A;  1YPR A;  2ZOI A;  2JHE A;  1MKI A;  3TRC A;  2QMI A;  2JKG A;  3CHW P;  1F98 A;  1TDG A;  3OLO A;  3WS5 A;  4R0Q A;  4R6L A;  1DJA A;  3LIB A;  1LL9 A;  5DKK A;  1YLW A;  1J3W A;  4IBR A;  4E6W A;  2L1M A;  3IXG A;  1KVL A;  1BUE A;  5MC7 A;  4S2P A;  2NUP C;  4D60 A;  4PPR A;  4QU3 A;  1KE3 A;  3I7J A;  5FQK A;  4N9K A;  3GDI A;  4E04 A;  4EES A;  2YKF A;  4LV0 A;  4DJ3 A;  2VLG A;  1JWP A;  4OQG A;  3UNW A;  4I5S A;  4KZ4 A;  1PYY A;  5FQM A;  4WL9 A;  3S22 A;  5A90 A;  3IH8 A;  3W4O A;  4GB7 A;  1HLU P;  1FCN A;  1S66 L;  2IWB A;  3A3E A;  3M6H A;  1V9Y A;  3WS4 A;  4HI4 A;  3L7H A;  5F82 A;  3SS3 A;  3NHQ A;  2W27 A;  3IF6 A;  1IEM A;  1XFN A;  3ZDJ A;  1O07 A;  4ETZ A;  1N9N A;  2LB5 A;  3NOT C;  1K4F A;  2GNX A;  1NLZ A;  2HDS A;  5A8B A;  1H8Y A;  3LR4 A;  4LCL A;  4KUK A;  4JGO A;  1NJ4 A;  1ZTU A;  5FA7 A;  5GLD A;  1JTG A;  4NXE A;  4EXO A;  4EBP A;  1FSY A;  1XXM A;  4S2N C;  1ES2 A;  2JC7 A;  2ZQ7 A;  2EX6 A;  3G6O A;  3W8K A;  2CMN A;  3C7V A;  4CLC A;  5KMW A;  3HCY A;  4BBU A;  5EOE A;  4FH2 A;  4WLA A;  3H82 A;  4S2L A;  1P9W A;  1L2S A;  3JPU A;  2PBD P;  3P09 A;  1CI9 A;  3IF6 B;  1W7F A;  3NEC A;  3VOY A;  2PU4 A;  4PM7 A;  2V2F F;  3QP2 A;  1S1Y A;  4OOY A;  5AQB A;  3EGD C;  2ZQA A;  1C3B A;  4MNR A;  3EGX C;  1XFQ A;  4FTX A;  5F68 A;  1Y4O A;  3ZG5 A;  2V1Z A;  4IHQ A;  1Q2P A;  3A3J A;  4PM6 A;  1F9I A;  1VM1 A;  4LEN A;  1ZG6 A;  4K91 A;  5EVI C;  3IWI A;  4BJP A;  5GL9 A;  1QME A;  3T4K A;  1IFQ A;  3A3D A;  3HLW A;  4A5R A;  4LV2 A;  3GQZ A;  1PRQ A;  1D1J A;  4OH0 A;  3RXX A;  5FI7 A;  2VX8 A;  1FQG A;  3V3R A;  3OOV A;  1LT0 A;  2ZLY A;  2ZJ9 A;  4LV1 A;  2QYB A;  1RGY A;  3QP8 A;  1YKD A;  4I38 A;  4U0X A;  4LCM A;  3BY9 A;  3GVB A;  4DXC A;  1KGE A;  3IBR A;  1IYS A;  4E3I A;  1U60 A;  5JYO A;  1G68 A;  5EUA A;  3V67 A;  2FFF B;  1NYY A;  2B95 A;  3LID A;  4G3K A;  4M4X A;  3A3F A;  5J4E A;  3Q7V B;  4B9O A;  2B02 A;  5FQ9 A;  4ZBE A;  2EA9 A;  4HIA A;  4JKT A;  3LIA A;  3TOI A;  2Y8H A;  2R9W A;  3FYZ A;  4S2O A;  4I3I A;  4OPR A;  3CIT A;  3K3C A;  3P98 A;  5HWW A;  2WAF A;  3FC7 A;  2V9A A;  1SKO B;  4GDN A;  4WN5 A;  4RX3 A;  4DXB A;  2VGL M;  1XKZ A;  1BYW A;  3E4P A;  1P9R A;  2XQZ A;  2WKI A;  3B3X A;  1UGU A;  3EOI A;  5FQI A;  1NY0 A;  2Z6C A;  4OOM A;  2C6W B;  1ALQ A;  2M7U A;  2HDQ A;  3OPL A;  5HL1 A;  3F1N B;  4JBF A;  2XSS A;  3G32 A;  1LSV A;  1O7E A;  1F2K A;  3D72 A;  2ZM8 A;  4ZJ1 A;  4N92 A;  3ZNY A;  1N4O A;  4HEF A;  4DKI A;  2O9A A;  2QPN A;  1YLT A;  3FWL A;  4R38 A;  5I5L A;  4KG6 A;  4GJ4 A;  2LB9 A;  2OAQ 1;  2Y2O A;  2HJE A;  2EXA A;  2EX9 A;  3MZE A;  2W1T A;  2WZX A;  1HTZ A;  2O9B A;  2JE5 A;  3MQO A;  5K5B A;  4FUW A;  2KX6 A;  1RGZ A;  1ES5 A;  1ZKJ A;  3ZHH A;  4ZAM A;  2YKH A;  4B93 A;  3GRJ A;  2UV0 E;  1NZU A;  4ESP A;  1CQA A;  4PKY G;  5TGF A;  1GSW A;  5CTN A;  2PRF A;  3T4Q A;  2XDM A;  4KQR A;  2PYP A;  3MBZ A;  3OPP A;  3C7U A;  3H7W B;  3NY4 A;  4JLF A;  3WS2 A;  1I2W A;  5J7E A;  3BW6 A;  3VE4 A;  1L0G A;  1VEU A;  4G3V A;  4DDY A;  4WEJ A;  2VK3 A;  3T1Q B;  1S4S A;  2O0Y A;  1TS0 A;  1VB6 A;  2XA7 S;  2HGV A;  4IVI A;  4O01 A;  5FDH A;  2W0N A;  4NET A;  1E4D A;  4QHC A;  2Q0O A;  1H3Q A;  4DE2 A;  1V9Z A;  1TS7 A;  1XPB A;  5IS1 A;  1NWZ A;  5D3O A;  3UDI A;  5EE8 A;  3CWF A;  1H5X A;  1KVM A;  1S0W A;  2X01 A;  3OCN A;  3KSH A;  3TSG A;  5HFO A;  2ZC3 B;  3CI6 A;  4GZB A;  1IEL A;  5G4Z A;  3T4O A;  4C75 A;  3ZGA B;  3ZNT A;  4OP8 A;  5KSC A;  2WKE A;  2JN7 A;  3NJA A;  2K31 A;  4GCZ A;  3LFV A;  2I9V A;  5DVA A;  4FD8 A;  3UO9 A;  2WGW B;  5FSR A;  1YMX A;  3BFD A;  4EEP A;  5HAR A;  4Q0I A;  3PYP A;  2WK0 A;  2Y55 A;  4NK3 A;  4E3M A;  2P08 A;  4X6T A;  3V50 A;  3PXP A;  5J8X A;  4XXR A;  4GS9 A;  4YIN A;  4UEY A;  5CHM A;  5L07 A;  3QP6 A;  4UQI M;  3T50 A;  1ONH A;  3HLC A;  3BLS A;  3JVV A;  4JXW A;  4DMZ A;  1GSV A;  4E3K A;  2P04 A;  4F3L A;  3IT9 A;  2XRN A;  1MC0 A;  1NYM A;  3NBL A;  1W79 A;  3LY4 A;  2NUT C;  4WYY A;  4X1M A;  3BFG A;  3U2A A;  4KG5 A;  4S2M A;  2J9O A;  1HZO A;  5DJT A;  2VGJ A;  1KDW A;  3M6B A;  3PBS A;  3MS6 A;  3CG5 A;  3ZYT A;  1W5D A;  3QNC A;  3ZVT A;  2JBF A;  4PMA A;  5CER A;  1TS6 A;  3IBJ A;  5AQ9 A;  1H8Z A;  3CUE C;  4GD8 A;  4DF6 A;  2Q9M A;  1LSX A;  3MQQ A;  2V0W A;  2JKF A;  4MBF A;  1S4R A;  1WYC A;  3MF0 A;  4EU0 A;  5FI6 A;  3H7W A;  4KZ9 A;  3F1P B;  1SZV A;  3MR0 A;  3M2K A;  5FEF A;  1GHP A;  4R4R A;  5CGS A;  5F69 A;  2HJ9 C;  4L9E A;  1OJG A;  1M6K A;  4R3J A;  5CEB A;  1XJ3 A;  4S2I A;  2QWS A;  4OPZ A;  5EVI A;  2M1C A;  5AVE A;  2D02 A;  3LEZ A;  2OLU A;  4L0L A;  3LYX A;  4O0P A;  2XD1 A;  2M7V A;  2Y2N A;  2P9V A;  2EX2 A;  5EEC A;  2V20 A;  3K2N A;  1K6R A;  3D9Y A;  4Q0H A;  4HJ4 A;  3SZT A;  1DRM A;  1ES3 A;  4NXB A;  1E25 A;  5A92 A;  3BJN A;  3W2Z A;  1XA7 A;  3EWK A;  1FOF A;  2IWC A;  4HJ6 A;  1XA1 A;  2L4R A;  1HVB A;  4NEE D;  1MZU A;  2WKQ A;  3IHB A;  5GLC A;  4PAU A;  1DP9 A;  2G2U A;  3PAE A;  3LCE A;  4EER A;  1I5Q A;  1K4E A;  2VA0 A;  4JGR A;  4EET B;  2Y2I A;  1FCO A;  3NOU C;  1YQS A;  3ZG7 B;  5GLB A;  4Y0O A;  3IXB A;  2W1R A;  1RP5 A;  4KEN B;  1OPX A;  1OT6 A;  3KSI A;  3H82 B;  1BUL A;  3GTC A;  4QPR A;  4IED A;  4ARZ A;  3LR0 A;  2QJ7 A;  2GDN A;  1XJ4 A;  3BM6 A;  2A24 B;  3MJQ A;  3JYI A;  4Y2F A;  5HDS A;  5AQ7 A;  1ESI A;  3WS0 A;  2OWH A;  2ZQ8 A;  1DJC A;  3PBN A;  2JCH A;  3FV7 A;  5CED A;  4HNB A;  1D7E A;  5HX9 A;  4EQI A;  5AVF A;  1YAX A;  4LRZ E;  3ITB A;  4HH3 A;  5L8M A;  4GKU A;  3W4P A;  3NIA A;  4WMC A;  2RL3 A;  3HRE A;  4OPY A;  2EX8 A;  3T1S A;  2WGW A;  2BLS A;  1JWV A;  1ERM A;  1OJ5 A;  3Q7Z A;  5HD3 A;  4MN5 A;  1ZC2 A;  1FIK A;  4GOG A;  2BG1 A;  2HP5 A;  4I3J A;  2ZM0 A;  1LI0 A;  2J8Y A;  5E2E A;  3UE6 A;  4UA9 A;  3R7W B;  4OON A;  1XX2 A;  4E3J A;  1LLB A;  1T18 A;  1IKI A;  2X02 A;  3BRM A;  2H10 A;  1ZHH B;  1E3U A;  1MWT A;  3VP0 A;  2W3G A;  5TBM B;  1F5M A;  5HAI A;  1TDL A;  4KG2 A;  1SHV A;  3RH8 B;  3SS4 A;  1CK3 A;  3ITA A;  4BL3 A;  2BAS A;  3OCL A;  2X71 A;  2W3D A;  2WUQ A;  3SH9 A;  1Z09 A;  4N1H A;  3N8R A;  4LLO B;  3HLG A;  4NKP A;  2XGN A;  3O87 A;  3FPV A;  2BTF P;  2Y2L A;  3G34 A;  5F83 A;  3HUM A;  4X56 A;  4JXS A;  2Y2G A;  4MBH A;  1YLJ A;  4GHI B;  4IVK A;  3A0S A;  1BLH A;  4R23 A;  2EWW A;  4DJ2 A;  4GNU A;  1BLC A;  4DE3 A;  4E3L A;  1PI5 A;  3FPW A;  1JNU A;  3FG8 A;  4Y17 A;  2XK1 A;  4F3L B;  3BYD A;  3HLB A;  3PAG A;  4Q8I A;  4NXG A;  2H5S A;  4QJG A;  3QNB A;  1PWG A;  4HP9 A;  3ZVW A;  5DF8 A;  1K55 A;  1PWC A;  4N1X A;  4PM9 A;  3N8S A;  2Z2M B;  5EM0 A;  3G4P A;  3VFF A;  4HP4 A;  1T1C A;  4H8R A;  3BFF A;  3LR3 A;  2RCX A;  1TD5 A;  3S7O A;  1CEG A;  2ZOH A;  2A24 A;  3B33 A;  3UME A;  3RTY A;  3E0Y A;  2H28 A;  2PAV P;  3N6I A;  1Y28 A;  1UWN X;  3LUQ A;  4JXG A;  4LFU A;  1NRF A;  3G30 A;  4YNR A;  4UHU A;  4K0X A;  2DCF A;  4R3B A;  1PWD A;  3KYE A;  3ICY A;  2ZMF A;  4ZJ2 A;  1A0K A;  3A3I A;  1XJ6 A;  4OKP A;  4P6Z M;  5AQA A;  1H0M A;  3V39 A;  2WKR A;  4X69 A;  2PR5 A;  2PR6 A;  5EVL A;  4R3A A;  4JPM A;  1G6A A;  3UB6 A;  4GD6 A;  1E3U D;  2JKR M;  3RFB A;  1YSP A;  3VOZ A;  5IT5 A;  2VZW A;  1D06 A;  4QD4 A;  3UPO A;  3TG9 A;  3MXS A;  3ZQ5 A;  3F1O B;  1TS8 A;  2O99 A;  5CGW A;  1K25 A;  3U4L P;  4AFI A;  3TJZ C;  3K3D A;  4II7 A;  3MKE A;  1LL8 A;  3N8L A;  3MZD A;  3O88 A;  4MDZ A;  3PR6 A;  4KQO A;  1FR6 A;  2FZ0 A;  2VKS A;  5L10 A;  5DKL A;  3T1X A;  2ZL1 B;  4Z9Q A;  4ZDX A;  1AXB A;  1KGG A;  4IJG A;  4WBG A;  4GDB A;  4BLM A;  3UY6 A;  3R4K A;  5C5K A;  2GZA A;  2A3U A;  5DTT A;  2OOL A;  4GS9 B;  4WF0 A;  3BQA A;  2KDK A;  5CTM A;  4OQI A;  4OP5 A;  3E2K A;  4KQD A;  3PBR A;  3LIF A;  1PIO A;  5KIZ A;  4X25 A;  3NDG A;  3BLM A;  1MBL A;  2ZQ9 A;  2XLN A;  3W4Q A;  1DJB A;  2XD5 A;  2H0T A;  4K08 A;  4MLL A;  1GA9 A;  3BEB A;  3VP4 A;  1NXY A;  4C6Y A;  1W8Q A;  3UB7 A;  3PBQ A;  5DFY A;  3C2W A;  4CLC E;  3DTE A;  4BD1 A;  1TVF A;  3MZF A;  3RJU A;  4RVA A;  5F5Y A;  3DW0 A;  3C8C A;  5HWV A;  2K7S A;  1J9M A;  3IQA A;  4LV3 A;  3ZG8 B;  4C3Q A;  3SS5 A;  1OME A;  2OLV A;  1UWP X;  4HES A;  4L9F A;  4EBN A;  2WKH A;  4IBX A;  1K6S A;  3PBO A;  2UWX A;  3CMZ A;  3FKW A;  3Q1F A;  1AWI A;  3D4F A;  2W3F A;  3IS2 B;  4IUK A;  3G2Y A;  4KZ7 A;  4DDS A;  3WRT A;  3A0V A;  1VQQ A;  3AGE A;  1ES4 A;  4WZ4 A;  3UMD A;  4HHD A;  2Y79 A;  5CGX A;  2ZMV A;  4YOF A;  1RCJ A;  3O3V A;  3C4O A;  4P87 A;  1XGI A;  1VHM A;  4FOF A;  2J3T C;  5HPI A;  2J80 A;  3NCK A;  3O86 A;  4Y0T A;  3UE1 A;  2V1B A;  5HAQ A;  2J7V A;  4UA6 A;  4L9G A;  1OTB A;  1BSG A;  2WYX A;  5EVI D;  5CEC A;  3OC2 A;  4P0M A;  2V1A A;  1GHI A;  3IWO A;  4RA7 A;  2DNS A;  3HLE A;  5U47 A;  1PFL A;  4JF5 A;  3HJI A;  1ESU A;  1VEU B;  1T19 A;  5TFQ A;  3GMW A;  3WWX A;  2PD7 A;  3TW8 A;  5EVE A;  4YFM A; 
#chains in the Genus database with same CATH homology
 1LT0 A;  4GW9 A;  2A24 B;  3MJQ A;  4Y2F A;  1X0O A;  2QYB A;  5HDS A;  5LBR A;  1YKD A;  4I38 A;  4WUJ A;  3S7P A;  3VE3 A;  3BY9 A;  2OWH A;  3PBN A;  4HNB A;  3IBR A;  1D7E A;  3V67 A;  4Y5F A;  5AVF A;  1YAX A;  2VV6 A;  3LID A;  4G3K A;  4M4X A;  4LRZ E;  5J4E A;  4CQH A;  3T4T A;  3UB9 A;  3MQ0 A;  4B9O A;  4HH3 A;  5L8M A;  4YWZ A;  4Y3I A;  2B02 A;  2EA9 A;  4HIA A;  3C38 A;  3MMH A;  3LIA A;  2Y8H A;  1OJ5 A;  5HD3 A;  2W3E A;  4MN5 A;  3H9W A;  2JKT I;  4BBV A;  3OBF A;  4I3I A;  3MFX A;  3CIT A;  3K3C A;  1STZ A;  5HWW A;  4I3J A;  5HDD A;  1MKM A;  2P7J A;  3LIC A;  3FC7 A;  3O5Y A;  2V9A A;  3UE6 A;  4WN5 A;  3R7W B;  2VGL M;  2OAP 1;  1BYW A;  5DJU A;  1T18 A;  4Q0J A;  3HJK A;  5HD5 A;  4BBT A;  1T1B A;  1ZHH B;  3E4P A;  1P9R A;  2W1T B;  2W3G A;  5TBM B;  1F5M A;  1UGU A;  3EOI A;  4JGP A;  2Z6C A;  4OOM A;  3RH8 B;  3KYZ A;  2PDR A;  4UQI S;  2M7U A;  4BMW A;  1ODV A;  2XRO A;  3D3O A;  3F1N B;  2BAS A;  2MJ6 A;  3OCL A;  2XSS A;  1NLY A;  2W3D A;  1LSV A;  3EQU A;  2IA2 A;  3D72 A;  3E4Q A;  4LLO B;  4LRY C;  3KSF A;  4ETX A;  3CUE A;  1TF1 A;  4HJ3 A;  4NKP A;  3B42 A;  4CLC B;  5DF9 A;  2KLI A;  3FPV A;  5AJG A;  4KUO A;  2O9A A;  4MN7 A;  2GX5 A;  3T4L A;  2JKR I;  4GHI B;  3UE3 A;  1S1Z A;  4R38 A;  3R7W A;  5I5L A;  4GJ4 A;  2LB9 A;  2OAQ 1;  3A0S A;  2PD8 A;  5IU1 A;  2HJE A;  3S7N A;  4EW7 A;  2EWW A;  2PHY A;  4DJ2 A;  2W1T A;  2O9B A;  2O9C A;  3EEA A;  3MQO A;  5K5B A;  2KX6 A;  2R78 A;  2VEA A;  3FPW A;  4OOL A;  1JNU A;  2PT7 A;  3FG8 A;  2YKH A;  4B93 A;  4F3L B;  4NXG A;  2HF6 A;  3SW1 A;  3PHY A;  3JVU A;  4PKY G;  4HP9 A;  2EWV A;  5KSH A;  1GSW A;  2INW A;  3T4Q A;  4RQ9 A;  4HQA A;  3TE8 A;  4DN0 A;  2PYP A;  2PYR A;  3H7W B;  2OWJ A;  5J7E A;  1OTA A;  3BW6 A;  3VE4 A;  4HP4 A;  5J3W A;  1T1C A;  4GHI A;  2QHK A;  3LR3 A;  4G3V A;  1EW0 A;  4XT2 A;  4CLC D;  3BWL A;  4WEJ A;  1TD5 A;  4WEK A;  3S7O A;  4G3W A;  1S4S A;  5CX7 A;  2O0Y A;  2VV8 A;  1TS0 A;  1VB6 A;  2XA7 S;  2HGV A;  2A24 A;  2ZOH A;  3B33 A;  4O01 A;  3CLO A;  2VJW A;  3UME A;  2W0N A;  1WA9 A;  2FH5 A;  3RTY A;  3E0Y A;  2H28 A;  2DMW A;  1OTI A;  3KYQ A;  1H3Q A;  2JKT M;  3LR5 A;  3LIE A;  4CLC C;  3F1P A;  1V9Z A;  1TS7 A;  5IS1 A;  1NWZ A;  3UB8 A;  2V0U A;  1Y28 A;  2HV1 A;  1UWN X;  4HOI A;  3LUQ A;  3CWF A;  5HSQ A;  4BWI A;  3VV4 A;  2ZBB A;  4MN6 A;  4PHT A;  5HDC A;  4YNR A;  3OCN A;  3KSH A;  3CI6 A;  2B18 A;  5G4Z A;  3T4O A;  3ICY A;  2JN7 A;  2ZMF A;  3NJA A;  2K2N A;  4HY8 A;  2K31 A;  1KOU A;  1XJ6 A;  4GCZ A;  4P6Z M;  3LFV A;  2I9V A;  3NOP C;  2WKR A;  3BQ8 A;  3T4J A;  4EEP A;  5HL6 A;  2PR5 A;  4Q0I A;  2G7U A;  2PR6 A;  3PYP A;  4I3A A;  2J3T D;  4R3A A;  1W63 Q;  2VGL S;  3UB6 A;  2P08 A;  2JKR M;  4GLQ A;  3DBA A;  3RFB A;  3KSG A;  3ULF A;  1YSP A;  1OT9 A;  3PXP A;  1LSW A;  5IT5 A;  2XA7 M;  3LI9 A;  3P7N A;  3MXQ A;  3PBT A;  2VZW A;  4ARZ B;  1D06 A;  4GS9 A;  4UEY A;  1N9O A;  1DP8 A;  3ZQ5 A;  1S67 L;  3F1O B;  1TS8 A;  4UQI M;  5FL3 A;  2O99 A;  4EQ1 A;  3T50 A;  4H6J B;  4AFI A;  1OTD A;  1YSQ A;  3TJZ C;  4Z1W A;  1NRJ A;  1T1A A;  3JVV A;  3K3D A;  4II7 A;  1N9L A;  1LL8 A;  4ME4 A;  4O8G A;  4MDZ A;  4DMZ A;  1GSV A;  3LI8 A;  3PR6 A;  4KQO A;  2P04 A;  2FZ0 A;  2VKS A;  4F3L A;  2XRN A;  1MC0 A;  2ZOI A;  2JHE A;  5DKL A;  4I39 A;  4R70 A;  2NUT C;  4JGQ A;  3TRC A;  3U2A A;  1F98 A;  5DJT A;  3OLO A;  4IJG A;  4R6L A;  5DFX A;  3LIB A;  2VV7 A;  3PBS A;  3ZYT A;  3R4K A;  4ZRR A;  5DKK A;  2GJ3 A;  3E98 A;  1P97 A;  5C5K A;  2QKP A;  2L1M A;  4EEU A;  4LPZ A;  2L0W A;  1OTE A;  2GZA A;  5MC7 A;  1W63 M;  2OOL A;  2NUP C;  1TS6 A;  3IBJ A;  4GS9 B;  4WF0 A;  3BQA A;  3CUE C;  2KDK A;  3VOL A;  3GDI A;  4LRX C;  4E04 A;  5HZH A;  4NXF A;  4EES A;  2YKF A;  4KQD A;  1LSX A;  4DJ3 A;  3MQQ A;  3PBR A;  2VLG A;  2V0W A;  4I5S A;  1S4R A;  4WL9 A;  3LIF A;  3MF0 A;  4EU0 A;  2QJ5 A;  5KIZ A;  1S66 L;  3H7W A;  4IUH A;  1H8M A;  1V9Y A;  3F1P B;  4HI4 A;  4PKY A;  3MR0 A;  1P0Z A;  4K08 A;  3NHQ A;  5F69 A;  2W27 A;  2HJ9 C;  1XFN A;  4L9E A;  3F1O A;  3UB7 A;  3PBQ A;  4ETZ A;  1OJG A;  5DFY A;  1N9N A;  3C2W A;  4CLC E;  2LB5 A;  1XJ3 A;  3NOT C;  2GNX A;  5TBM A;  2QWS A;  3GEC A;  1NLZ A;  5F5Y A;  3C8C A;  5HWV A;  2K7S A;  5F6A A;  5A8B A;  3LR4 A;  2M1C A;  4KUK A;  4JGO A;  1ZTU A;  4MCW A;  1IOU A;  5AVE A;  2D02 A;  4NXE A;  4P6Z S;  2D01 A;  1UWP X;  4EXO A;  4L0L A;  3KO6 A;  3LYX A;  3EQV A;  4O0P A;  1G6O A;  4L9F A;  1XJ2 A;  2A2L A;  2M7V A;  1G28 A;  3G6O A;  3K2N A;  2CMN A;  3PBO A;  4CLC A;  3HCY A;  4Q0H A;  4BBU A;  2PD7 A;  4WLA A;  4HJ4 A;  4FSF A;  1DRM A;  4HH2 A;  3H82 A;  1P9W A;  3IS2 A;  4NXB A;  4EUV A;  2W3F A;  3IS2 B;  4IUK A;  3BJN A;  3W2Z A;  3EWK A;  3T4S A;  4HJ6 A;  2L4R A;  4NEE D;  3A0V A;  2WKP A;  3F1N A;  2J3W A;  4H6J A;  1MZU A;  2WKQ A;  3UMD A;  4HHD A;  3A0R A;  4PAU A;  1DP9 A;  2Y79 A;  1S1Y A;  2ZMV A;  4YOF A;  3EGD C;  5G4Y A;  4EER A;  1GSX A;  1VHM A;  2W3H A;  4FOF A;  3EGX C;  3S7Q A;  2J3T C;  1XFQ A;  3BY8 A;  3CAX A;  3P01 A;  5F68 A;  5TJJ A;  5HPI A;  2J80 A;  2VA0 A;  4MMN A;  2V1B A;  4IHQ A;  4JGR A;  3EEH A;  4EET B;  3NOU C;  4L9G A;  1F9I A;  1OTB A;  3C30 A;  5EFW A;  3B47 A;  3OC2 A;  2W1R A;  4XT2 B;  2V1A A;  1OPX A;  1OT6 A;  4BJP A;  3KSI A;  3T4K A;  1IFQ A;  3H82 B;  2KOI A;  3HJI A;  4WEL A;  1T19 A;  4QPR A;  4ARZ A;  3LR0 A;  1DP6 A;  2Z6D A;  3KX0 X;  2QJ7 A;  2VX8 A;  5HWT A;  3E4O A;  1XJ4 A;  5HPF A;  3TW8 A;  3OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...