2LB9A

Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state (corrected pyrrole ring planarity)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor histidine kinase
publication title Solution structure of a cyanobacterial phytochrome GAF domain in the red-light-absorbing ground state.
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
total genus 33
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2lb9A00
2M7UA 3G6OA 5C5KA 2O9BA 2KLIA 4GW9A 5HPFA 4R70A 3CI6A 4R6LA 2Y79A 2M7VA 2O0YA 2VKSA 5HL6A 4DMZA 3MF0A 5TJJA 2G7UA 3TRCA 3NOPC 4YNRA 4YOFA 4Y2FA 4Y5FA 4Q0HA 1MKMA 1MC0A 3MQ0A 3NOUC 2HGVA 2VZWA 5DFXA 3S7QA 2W3FA 1STZA 2O9CA 1F5MA 3CITA 4BWIA 2Y8HA 2XRNA 2VJWA 1ZTUA 3KSHA 4ME4A 2KOIA 1YSQA 3NHQA 4IUHA 4CQHA 4MMNA 4MCWA 5I5LA 2K31A 2O99A 3KO6A 2K2NA 3IBJA 3OBFA 4MDZA 3D3OA 5DFYA 5K5BA 3R4KA 3OOVA 4LRZE 3KSIA 4FOFA 4Q0IA 4IUKA 2W1TB 2O9AA 1YKDA 2W3DA 3C2WA 4G3WA 2XROA 2QYBA 3MMHA 5L8MA 2W3EA 3S7OA 3S7NA 3VV4A 4EU0A 3W2ZA 3KSFA 3K2NA 4LRXC 4E04A 5HPIA 2W3GA 2W1RA 4QPRA 4ETXA 2IA2A 3EEAA 1YSPA 2LB9A 3KSGA 2B18A 4EUVA 4Q0JA 4RQ9A 4O8GA 1VHMA 2W1TA 5AJGA 2W3HA 4GLQA 4Y3IA 3S7PA 4ETZA 1TF1A 2ZMFA 3O5YA 3E98A 4O0PA 2LB5A 3BJNA 4IJGA 5HSQA 3ZQ5A 4Z1WA 2XSSA 3HCYA 4ZRRA 4G3VA 2VEAA 3RFBA 4G3KA 2GX5A 3DBAA 3IBRA 4O01A 3LFVA 4PAUA 4MN7A 4LRYC 1TD5A 2OOLA 5LBRA 3NOTC 4DN0A 3E0YA
chains in the Genus database with same CATH superfamily
1YAXA 4NG2A 3FKWA 3MS6A 3O86A 3CLOA 2OLVA 3EQUA 1E4DA 4X68A 3NULA 1XKZA 1AXBA 4B93A 2VV6A 1MBLA 1XJ4A 1Y28A 2W3FA 1V9YA 1ZG4A 1N9OA 2JKRM 1XGIA 1BSGA 2XFSA 4I5SA 1D1JA 4PMAA 4PM8A 3UB8A 1Q2QA 1RP5A 3C4PA 5FEFA 4MN5A 3T12B 2DNSA 3VSLA 5M18A 1N9LA 2QMIA 3D4FA 1SKFA 4GDBA 4JGPA 2PR6A 3EEHA 5FSRA 3M6BA 4I39A 1D06A 3DTKA 3LUQA 4GDNA 2QYBA 2CC1A 4WZ4A 1M6KA 4PKYA 4JGOA 4EU0A 3KSFA 1PRQA 2J3WA 4OPYA 5DF9A 5DKLA 3LY4A 3EEAA 3GDIA 3T1SA 1HTZA 2Y2NA 4ZBEA 1OT6A 3UY6A 3QP6A 3IXDA 5KMWA 4U0TA 3EGXC 1N9NA 3T4TA 1OMEA 2VA0A 3T4KA 1K4FA 4JF6A 4Z1WA 2XSSA 1QMEA 1YMSA 2EX6A 5TR7A 2R9XA 5E2EA 5EM0A 4B4ZA 3LR0A 2OOLA 4UHUA 3TE8A 3OCNA 1FSYA 3V3RA 3WRTA 2JCHA 2DRWA 4M3KA 3NDGA 5DF8A 1ERQA 2PT7A 4Y13A 1XGJA 4RX3A 3W4OA 4JXWA 5A93A 1A0KA 4EBPA 3F1PA 4MEZA 2XA7M 1STZA 3MXQA 1OJGA 3VP1A 4OQHA 3HLGA 4X1MA 3PYPA 4EXOA 4ME4A 2GZAA 2Y2GA 3SW1A 4LFUA 4CJNA 2OAQ1 2XD1A 5GHXA 2MJ6A 3FPVA 5F68A 1FR6A 4PM9A 2V1ZA 4KUOA 4LENA 3RXWA 2ZBBA 2PYPA 4HEFA 5BOHA 1ES3A 5FQQA 5EPHA 1ONHA 4YFMA 3I7JA 3BWLA 3V5MA 3KSGA 3VE3A 3BQAA 4QY5A 2W3HA 2ZQAA 4LV2A 3S7PA 3NECA 4KZ5A 5G4YA 4GS9B 4UQIM 1TF1A 3C8CA 4JF5A 1KGGA 3GECA 1L0FA 3CG5A 3ZQ5A 1IELA 1IKGA 3HCYA 4F94A 4LRYC 2WKIA 1NRFA 1PWGA 4GHIB 5EM1A 3FC7A 3G6OA 1FIKA 5DJTA 3HJIA 3T50A 3OLOA 4QJGA 3PBNA 2PU2A 3UE6A 1CK3A 3QP2A 4S2JA 5HDSA 2E8IA 2P9VB 4EWFA 4IVKA 3VSKA 5HAPA 2I72A 3ZGAB 3HUNA 5AVEA 3N8LA 3G31A 2ZC5B 1MWTA 2K31A 3PXPA 3A0VA 1XA1A 1MWSA 3OBFA 2YKFA 1ES2A 1H8MA 3D3OA 3R4KA 5AQBA 4LRZE 3BRMA 4QWOA 3G2YA 1PFLA 2WKEA 4L0LA 1VQQA 2J8YA 3GMWA 2WAFA 1XJ6A 3CPTB 3W8KA 4HJ3A 2ZM8A 2XROA 2VLGA 1LL5A 5EVEA 5F83A 3SH8A 1SKOB 1HLUP 3NI9A 2Y91A 1YLTA 1PWDA 1NZUA 1KE4A 1JWZA 2BASA 1OTIA 4X53A 2V1BA 1F9IA 4S2PA 1BZAA 2PHYA 4KZ7A 3OPRA 2JBFA 4ZRRA 4Z9QA 1G6AA 3OPHA 3NOTC 3U2AA 5AQ9A 1PIOA 5C5KA 2HPBA 4IBRA 2ZQCA 3O3VA 3TW8A 4HIAA 2ZQ7A 1LT0A 3MF0A 5G4ZA 2G7UA 3BECA 3ZG9B 4YOFA 1PW1A 1ERMA 4MBFA 1KDWA 3CITA 2UWXA 1DJAA 3UB6A 2Y8HA 1GCEA 1LI0A 4RYEA 2C5WB 4BL2A 5FL3A 4ZJ1A 3BFEA 4I38A 4X25A 3U4LP 4L9EA 5FI2A 1EI5A 3P01A 4WMCD 1H8ZA 2AVXA 3NIAA 5E2FA 2W3EA 3S7NA 1YMXA 4P6ZS 2XLNA 1RCJA 4LCMA 2DMWA 2Q0OA 5HFOA 1O7EA 3TSGA 4Q0JA 1CQAA 4MNRA 4K91A 4ETZA 2ZMFA 1UWPX 2QJ5A 1K56A 1L0DA 3KYZA 1JWVA 3O87A 4E3OA 4C75A 1CI9A 5DTSA 4G3KA 3W4PA 4WN5A 1CJFA 3B33A 3F1NA 1XJ3A 1QMFA 1NXYA 1S1YA 1YLPA 2EFUA 3F1PB 5DKKA 4BMWA 2XGNA 3B47A 4RA7A 2O9BA 2KLIA 2X71A 1BLPA 4R70A 3MQOA 2VKSA 5HL6A 5M1AA 1YM1A 3C5AA 4FD8A 4Y2FA 1OPXA 3H7WA 1ALQA 4HI4A 1V9ZA 4O7DA 3E2LA 3ZFZA 2K7SA 3B42A 3Q82A 4ZJ3A 4OH0A 4MCWA 3S22A 1K54C 4NXBA 5K5BA 2ZC3B 3CHWP 4R1GA 5GHYA 1NY0A 3G4PA 2XEPA 3CWFA 4FOFA 3UPNA 4GD6A 1SHVA 1YKDA 2B02A 1ONGA 3G35A 1VM1A 2DCFA 3UMDA 3LI9A 1I2SA 3GTCA 2Q9NA 5KZHA 3MKEA 4KQOA 3OZHA 1IOUA 4JF4A 3VOZA 3EGDC 1XP4A 3H82A 3JVVA 4E3IA 4OP5A 2GNXA 2P74A 2XD5A 3HLFA 2Z6DA 4L9FA 4OONA 4QB8A 4DE2A 1G28A 5EFWA 1F98A 3G34A 2HP9A 3GRJA 1BLCA 4D60A 2VK3A 5E43A 1DJBA 2V0WA 4U3TA 1L0GA 3BM6A 3G32A 3EQVA 4X69A 2KDKA 2A3UA 1MWRA 5TJJA 2NUPC 3RJUA 3TRCA 4GNUA 5GLBA 2W27A 4E3MA 1MKMA 3CMZA 3NOUC 2PDRA 1L0EA 4R23A 1G6OA 4KUKA 4NXGA 3UN7A 2O9CA 2WGWA 2VV7A 4EETB 2Y2LA 3C30A 4UA9A 4FH2A 5HD5A 3BEBA 1I2WA 2KOIA 1YSQA 4IUHA 2J9OA 4P0MA 4B4XA 3SH7A 4HBUA 5CEDA 2HDSA 3QP5A 4LV3A 4HHDA 3DWZA 1TS6A 1P0ZA 2L0WA 3IWQA 1UGUA 3UE3A 3HLBA 3S7OA 4OOMA 2JKTI 2PBDP 1VETA 4QPRA 3P98A 5FQKA 1YLWA 1GHIA 3IF6C 1PZPA 2ZQ8A 1K6RA 1S0WA 3V67A 3OPPA 2WYXA 1J9MA 4JGQA 3LCEA 4WL9A 4O0PA 2LB5A 1W5DA 2ZOHA 4N1HA 4R3JA 4G3VA 4PAUA 1I5QA 3JYIA 1PWCA 4P6ZM 5FAPA 3ZNTA 4LV0A 3UB9A 3C7VA 4DN0A 2EWVA 2QZ6A 4OPZA 3Q7VA 4WELA 4WLAA 3CAXA 4N1XA 4R6LA 2Y59A 3GQZA 4X55A 3NOPC 1IKIA 1GHPA 3A3JA 1MC0A 4QHCA 3NC8A 4PHTA 2BG1A 2JHEA 3PAEA 4X6TA 3UO9A 4ARZA 1GSWA 2L4RA 3LI8A 2ZC6B 3UDXA 2EXAA 2Y2HA 2QJ7A 5F6AA 3HLDA 4MMNA 2Y55A 4U0XA 5CTNA 1MKIA 3ZVWA 1FQGA 2G2WA 1YLYA 2INWA 3QNBA 4MN6A 3N8RA 1W8QA 4S2NC 4BENA 4HBTA 3QP8A 2ZJ9A 4I3AA 1FCOA 2ZQDA 3BFCA 3T4LA 5CHMA 4S2KA 4Y17A 4E3KA 4FUWA 1G68A 4EEPA 2VGLM 1YSPA 3F1NB 3IX8A 5CECA 4HQAA 5HAIA 1T1BA 4H6JA 1XPBA 3MZDA 5FDHA 3FPWA 3G30A 1K57C 3WS2A 1JTGA 5HZHA 1H5XA 3TJZC 3ITAA 1S4SA 3LYXA 4OOLA 2VEAA 3IBRA 5EOOA 3H7WB 5EOEA 1E3UA 2NUTC 1LI9A 3NCKA 4JXSA 3IWIA 4JLFA 3BQ8A 4H8RA 5KIZA 1NLYA 1LSXA 4IEDA 3SZTA 4KQRA 1PZOA 3CI6A 5DTTA 3RXXA 4ID4A 2M7VA 5J8XA 2O0YA 1DJCA 4EW7A 1YLJA 3SS4A 2R9WA 3BLMA 1CF0A 1KE0A 4E3LA 1E25A 1T1AA 5CHUA 2V1AA 3MXSA 1F5MA 5CGSA 4N92A 1OTBA 1H3QA 2FFFB 1MXOA 3CUEC 2ZM2A 3IT9A 2XR0A 3NJAA 3CZDA 2QKPA 1TVFA 2JN7A 3BFDA 3H82B 1VEUA 5I94A 1PYYA 2XH9A 4EBNA 1W8YA 2PR5A 4Y15A 1K55C 2Y2QA 3OPLA 1WYCA 4EUVA 4RQ9A 5HDDA 2VGKA 1F2KA 1GSVA 2V8CA 3WWXA 4BBVA 4KZBA 1OTDA 2WADA 5EUAA 2ACGA 3EWKA 4O01A 4HH2A 2WKPA 5A92A 5FI6A 2HJEA 4R3BA 3M6HA 4ZDXA 1HZOA 2OAP1 3TOIA 5E2HA 2M7UA 4DDSA 3LR4A 5JYOA 3ISGA 3IXBA 2WGWB 2WGIA 2P7JA 4LLOB 4DMZA 3LEQA 1W63M 4MLLA 3S1YA 1Z6FA 1S66L 3E4PA 3IHAA 3HJKA 3ZVTA 2W0NA 4IVIA 1L2SA 3M2KA 4ZJ2A 4OOYA 2WZZA 3C38A 5J4EA 3HBRA 1ESIA 4DXBA 1VETB 3WS0A 4I3JA 3KO6A 3C4OA 3T4QA 3DWKA 4GB7A 3B3XA 4KQDA 3MQQA 3RH8B 4ZAMA 4CPKA 4KG6A 4I3IA 4P85A 5EECA 4HY8A 4E04A 2W1RA 5HDCA 1XXMA 1T19A 3PBSA 3FZCA 4KENB 4C6YA 4WM9A 4DDYA 1IYQA 1P9WA 3SS3A 2PAVP 4GZBA 1ES4A 3IS2A 5FATA 4Y0TA 2W1TA 5FEGA 1KVLA 1BLHA 2Y2OA 4KG5A 3Q7VB 1ZC2A 4KZAA 3ZCZA 3ZG8B 3UMEA 4IHQA 4KG2A 2UV0E 3DBAA 3ULFA 2QPNA 3UE1A 3MKFA 4N9LA 1LSVA 2XFTA 4UA7A 5F82A 3V50A 4ARZB 3IH9A 1IYOA 4EQ1A 3FV7A 1FCMA 1FCNA 5F1FA 3LIBA 1TDLA 1K38A 2HZ5A 1P97A 4WZ5C 3PR6A 2JC7A 5TGFA 4XUZA 1HVBA 3R7WA 2EFXA 3MQ0A 2PD8A 2V8FA 4JXGA 4KZ8A 2WUQA 3JPUA 5FAQA 1MWUA 2FFYA 2Y2JA 5GHZA 4HJ6A 1KOUA 2XRNA 2Y2MA 3MXRA 3K3CA 1PNEA 3GVBA 4S2IA 2V20A 3QNCA 3NHQA 2P08A 1WA9A 5IHVA 4Y0OA 1K54A 1NYMA 4MBHA 1KE3A 1M40A 1ZKJA 3OOVA 2ZL1A 4H6JB 2RCXA 4CLCA 4R4SA 3MBZA 3DTMA 3MSHA 3D72A 1H8YA 4ESPA 1ES5A 5GLDA 3UDFA 3QHYA 2C6WB 2XQZA 4OPRA 3LGOA 4FCFA 3LIDA 3BFGA 4E3NA 2V2FF 1VHMA 2KX6A 5AJGA 4L9GA 3MFDA 1YT4A 5EE8A 3O5YA 3ITBA 2Z2LB 3BJNA 3Q07A 1RGZA 2JKRI 2HDRA 5HSQA 1HD8A 4NKPA 2PRFA 5HX9A 5J7EA 4HP4A 2GX5A 2HP5A 2RL3A 3MR0A 4LPZA 4NK3A 4LCLA 1JWPA 1YLZA 4F3LA 3E4QA 1T18A 4GW9A 4FSFA 5HPFA 5CGWA 1LSWA 2EA9A 3AGFA 3E2KA 3LIEA 3S4XA 4QY6A 5CERA 5AVFA 1PI4A 4K0WA 1SCWA 3PBRA 3S7QA 3UE0A 1IYSA 4WBGA 5EVIA 2Y2PA 1ACFA 5HWTA 1VEUB 2OSUA 3HL9A 2VJWA 4NEED 5CTMA 3KSHA 1U60A 1BTLA 4CQHA 4HP9A 4LV1A 4DRTA 3WRZA 3HLEA 4BJPA 3T1XA 1Y54A 3V39A 3Q1FA 2PD7A 4EV4A 2J80A 4B88A 3VE4A 1DY6A 4WF0A 3BW6A 1TS8A 5GLCA 1GSXA 3N4IA 3W2ZA 1Y4OA 4P6BA 3F1OA 5FQIA 4ETXA 3IF6A 3M2JA 2B18A 5DTKA 2X01A 4UAAA 1IEMA 1S6RA 3WS5A 3WS1A 2ZC4B 1PI5A 3BY9A 3FYZA 1ZG6A 3BFFA 4BBTA 4E6WA 1NRJA 4PM6A 3PAGA 4NETA 2A24A 4XT2A 1TD5A 3O88A 3KYEA 3SH9A 1TS7A 3N6IA 3VOYA 4B9OA 1ESUA 2H10A 1NWZA 3C7UA 4YNRA 2EXBA 3HVFA 3A3EA 3ZG0A 1K0KA 2EX9A 3T1RA 3BYDA 1W63Q 3A0RA 3NDEA 3HREA 4GJ4A 1TDGA 2A2LA 4LGWA 5L07A 4CLCE 4AFIA 5AQAA 1IYPA 2D01A 5EVLA 4BL3A 4R3AA 2EX2A 4DE0A 2ZD8A 3A3IA 3EOIA 3UNWA 4K08A 1SZVA 4Q8IA 2EWWA 2BLSA 3KSIA 1NZOA 4S2NA 3LIFA 4QD4A 3IS2B 4Q0IA 3G2ZA 2W1TB 2ZC7A 2IWBA 2IWDA 3Q81A 1K25A 3IX4A 3MMHA 5L8MA 1JVJA 4XXRA 1KDSA 2WKRA 3PHYA 4JKTA 4KQQA 1AWIA 3IXHA 1ZHHB 4HNBA 5KSCA 2LB9A 3UPOA 1XFQA 1RGYA 3P7NA 4HESA 3UB5P 2WZXA 1GA9A 3LR3A 5CXWA 5GLAA 2B95A 1K57A 3VMAA 1WYBA 4GCZA 3LO7A 1TEMA 4ZTKA 4DJ3A 5HW3A 4KZ3A 2G2UA 1FR1A 3VFFA 2M1CA 2Y2IA 1LL9A 4YWZA 4HOIA 4HH3A 4MN7A 3R7WB 3VP4A 1MY8A 4OQIA 3N8SA 1J3WA 5FASA 4X1LA 3OC2A 4R4RA 5IU1A 4WEKA 1K4EA 3A0SA 2JKTM 2J3TD 4WEJA 2JKFA 3UDIA 5DVAA 1GHMA 1C3BA 3MZEA 3ZG7B 1BULA 3IHBA 4XUXA 1DP8A 1O07A 4A5RA 4Y5FA 2Y4AA 2JKGA 3A3FA 4KZ4A 1E3UD 4JGRA 1S4RA 2L1MA 5IT5A 5FDSA 3UPPA 4FTXA 4UA6A 2VZWA 3TG9A 5CEBA 2ZL1B 3K3DA 3V3SA 4BD0A 2PBYA 3CUEA 3W4QA 4CLCB 1XJ2A 1JTDA 1BUEA 2PU4A 1TS0A 4NXEA 3IX3A 3E4OA 3VP0A 3HUOA 3HLWA 1S67L 1OTAA 5TBMA 2R78A 3AGDA 3L7HA 2BTFP 2J3TC 4DF6A 3KX0X 1CEGA 5HARA 2HDUA 1LL8A 1DP6A 2OLUA 4FH4A 5AQ7A 1VB6A 5CRFA 2IA2A 4EESA 1K55A 4EQIA 5CGXA 1H0MA 1N4OA 4D2OA 5HWVA 4MBKA 5CX7A 5FQJA 1KGFA 5MC7A 1IFQA 1PW8A 2FH5A 3HLCA 4Y3IA 4F3LB 5FAOA 1DRMA 1Q2PA 1SDNA 3AGEA 4IJGA 4IBXA 4N9KA 3RFBA 3SOIA 4GN2A 2HJ9C 5U47A 2ZOIA 5FQMA 5EVIB 3GSGA 2H0TA 1YPRA 1LLBA 4YINA 5M19A 4PPRA 3IF5A 2V0UA 3DTIA 4Y0UA 5GL9A 3D9YA 2WKQA 5TFQA 5HL1A 3BY8A 4S2MA 1P9RA 3L9KA 3FG8A 4OKPA 2A49A 3P09A 5L10A 2JE5A 2ZLYA 3VOLA 3GV9A 3F1OB 2YKHA 1CI8A 2K2NA 4JPMA 3ZHHA 3FWLA 5DFYA 3IF6B 2HDQA 4WUJA 2X02A 4EEUA 5CHJA 2O9AA 3C2WA 1EROA 3T4OA 1G5UA 4DJ2A 1WE4A 2B5RA 3VV4A 3ZYTA 4LRXC 5HAQA 4R38A 3PBTA 2W3GA 1MPLA 3MJQA 4DKIA 1NLZA 4EBLA 4JBFA 2A24B 1XX2A 4XT2B 1FSWA 2H28A 5EV0A 2HV1A 1K6SA 4RVAA 3E98A 3IQAA 5JYPA 4BBUA 1D7EA 4GOGA 4HJ4A 4PM5A 4II7A 2HF6A 2ZMAA 4EERA 5F5YA 3HUMA 5L09A 4DE3A 3PBOA 5KSHA 2Q9MA 5F1GA 2V9AA 1JNUA 4WZ5A 1NJ4A 2XK1A 3GR2A 5FI7A 3LIAA 1ODVA 3A3DA 2OV5A 1T1CA 4PM7A 3PTEA 1CEFA 4Q0HA 4WYYA 4OLDA 1OTEA 4KZ6A 4S2OA 3IH8A 3ICYA 5DJUA 5HWWA 5A91A 4JXVA 4BWIA 4DXCA 1ZTUA 4WMCA 4M4XA 1K56D 2IWCA 1BT5A 4UEYA 3LR5A 2OWJA 2O99A 3T1QB 2QHKA 1L3LA 1MZUA 4OLGA 4G3WA 1W7FA 5A90A 5D3OA 1XA7A 3T4SA 5HPIA 4GKUA 1OJ5A 4BLMA 1YQSA 2D02A 2WK0A 3RTYA 3LEZA 3FKVA 3BLSA 4O8GA 4CLCD 4E3JA 1EW0A 2CMNA 4GLQA 1NYYA 5J3WA 4S2LA 2Z2MB 2I9VA 2GDNA 4X56A 2XA7S 2Z6CA 4DE1A 3QP4A 4R0QA 1XFNA 3LFVA 3SS5A 3QP1A 3VP3A 2WGVA 2QWSA 5FQ9A 5A8BA 1DP9A 3E0YA 1S1ZA 2VGLS 4GS9A 4PKYG 3DW0A 2Y79A 4OQ0A 1EWZA 3VP2A 1X0OA 3OCLA 1BLSA 4BQMA 3PBQA 4E6XA 3KYQA 2XDMA 1FOFA 4GHIA 4EUZA 2ZMVA 3JVUA 5F69A 5TBMB 2HGVA 5DFXA 5G18A 4RX2A 2H0YA 3WS4A 4CLCC 5HD3A 2HP6A 2VGJA 4OPQA 3UB7A 5IS1A 4OQGA 2J7VA 1Z09A 5I5LA 2J9PA 2P9VA 4Y7PA 2VX8A 4MDZA 5L2FA 2GJ3A 4UQIS 2XF3A 1GA0A 1SDEA 3LY3A 5E2GA 5EVID 4QU3A 3T4JA 3VFHA 4KZ9A 4GD8A 4IUKA 2W3DA 2OWHA 1LHYA 2VV8A 3DTEA 3LICA 3K2NA 1OT9A 2Y2KA 2E8JA 2FZ0A 3ZG5A 3NY4A 4P87A 2H5SA 4OP8A 4BD1A 3ZDJA 1UWNX 4K0XA 3CPTA 5DF7A 4NXFA 1KGEA 2PYRA 2WKHA 3H9WA 3IWOA 1KVMA 1N9BA 4OVDA 1BYWA 3DAVA 3MZFA 2EX8A 1SKOA 1W79A 4C3QA 2P04A 2WAEA 5FA7A 3IXGA 3N7WA 3CJMA 2ZQ9A 3Q7ZA 1FILA 3MFXA 3ZNYA 5LBRA 2ZM0A 3IBJA 5EVIC 3NBLA
chains in the Genus database with same CATH topology
2M7UA 3LR4A 3A0SA 2JKTM 2J3TD 1YAXA 2O9BA 3B47A 4WEJA 2KLIA 3CLOA 4R70A 3MQOA 2VKSA 2P7JA 4LLOB 5HL6A 4DMZA 3EQUA 1W63M 1DP8A 4Y2FA 4Y5FA 1OPXA 4B93A 1S66L 2VV6A 3H7WA 3E4PA 4JGRA 1S4RA 2L1MA 1XJ4A 3HJKA 5IT5A 2VZWA 1Y28A 4HI4A 2W3FA 2W0NA 1V9YA 3K3DA 1V9ZA 1N9OA 2JKRM 3CUEA 4CLCB 1XJ2A 2K7SA 4I5SA 3B42A 3C38A 5J4EA 1TS0A 4NXEA 5IU1A 3UB8A 3E4OA 4MCWA 4MN5A 4I3JA 3KO6A 1N9LA 1S67L 1OTAA 4NXBA 5TBMA 5K5BA 2R78A 3T4QA 4JGPA 2PR6A 3EEHA 4KQDA 3MQQA 3CWFA 4I39A 1D06A 4FOFA 3LUQA 1YKDA 3RH8B 2J3TC 2B02A 2QYBA 3KX0X 3UMDA 1LL8A 4I3IA 1DP6A 3LI9A 4PKYA 4JGOA 4EU0A 3KSFA 1VB6A 2J3WA 4HY8A 4E04A 2W1RA 5DF9A 5HDCA 2IA2A 3PBSA 1T19A 5DKLA 4EESA 3EEAA 3GDIA 4KQOA 5HWVA 1IOUA 3EGDC 5CX7A 3H82A 1P9WA 3JVVA 1OT6A 2GNXA 1IFQA 3IS2A 5MC7A 2W1TA 2FH5A 4Y3IA 4F3LB 2Z6DA 4L9FA 3EGXC 1N9NA 1DRMA 1G28A 3T4TA 5EFWA 1F98A 2VA0A 3T4KA 3UMEA 4IJGA 4IHQA 4Z1WA 2XSSA 3RFBA 3DBAA 3ULFA 3LR0A 2HJ9C 2OOLA 2ZOIA 1LSVA 2V0WA 3TE8A 4ARZB 4EQ1A 3OCNA 3EQVA 2KDKA 3LIBA 4BMWA 1P97A 3PR6A 5TJJA 2NUPC 2V0UA 2PT7A 3TRCA 2W27A 3R7WA 1MKMA 3MQ0A 2PD8A 3NOUC 2WKQA 3BY8A 2PDRA 1G6OA 3F1PA 2XA7M 4KUKA 4NXGA 1P9RA 1STZA 2O9CA 3MXQA 1OJGA 3FG8A 2VV7A 1KOUA 2XRNA 4HJ6A 4EETB 3K3CA 3PYPA 3C30A 4EXOA 4ME4A 5HD5A 2GZAA 3VOLA 3SW1A 2KOIA 1YSQA 2P08A 3NHQA 4IUHA 1WA9A 2OAQ1 3F1OB 2YKHA 2K2NA 2MJ6A 5DFYA 3FPVA 3OOVA 5F68A 4HHDA 1TS6A 4H6JB 4WUJA 1P0ZA 2L0WA 4CLCA 4EEUA 4KUOA 2O9AA 1UGUA 3C2WA 3T4OA 4DJ2A 2ZBBA 3UE3A 3D72A 2PYPA 3S7OA 3VV4A 4OOMA 2JKTI 4LRXC 3ZYTA 4R38A 3PBTA 2W3GA 4QPRA 3MJQA 1NLZA 3BWLA 3KSGA 2A24B 3LIDA 4XT2B 3VE3A 3BQAA 3V67A 1VHMA 2KX6A 5AJGA 2W3HA 4L9GA 3S7PA 2H28A 4JGQA 2HV1A 5G4YA 4GS9B 1TF1A 3C8CA 3O5YA 4UQIM 4WL9A 3E98A 4O0PA 2LB5A 3BJNA 2JKRI 4BBUA 3GECA 5HSQA 3ZQ5A 4NKPA 1D7EA 2ZOHA 4HJ4A 4II7A 5J7EA 3HCYA 4G3VA 4HP4A 2HF6A 2GX5A 3MR0A 4PAUA 4LRYC 4LPZA 4EERA 5F5YA 4GHIB 4P6ZM 3UB9A 4DN0A 2EWVA 3FC7A 3G6OA 4F3LA 3E4QA 5DJTA 3PBOA 5KSHA 4WELA 4WLAA 1T18A 3HJIA 3CAXA 4FSFA 4GW9A 3OLOA 3T50A 5HPFA 2V9AA 1JNUA 4R6LA 3PBNA 3UE6A 1LSWA 2EA9A 3NOPC 3LIAA 5HDSA 1ODVA 1T1CA 3LIEA 4Q0HA 1MC0A 1OTEA 5AVFA 4PHTA 2JHEA 4ARZA 1GSWA 3ICYA 5DJUA 3PBRA 5HWWA 2L4RA 3S7QA 3LI8A 5HWTA 4BWIA 2VJWA 4NEED 1ZTUA 3KSHA 5AVEA 4M4XA 2QJ7A 5F6AA 4CQHA 4HP9A 4UEYA 4MMNA 3LR5A 2OWJA 2K31A 3PXPA 2O99A 3A0VA 3OBFA 2YKFA 1H8MA 3D3OA 3R4KA 4LRZE 2INWA 4BJPA 4L0LA 4MN6A 2QHKA 1XJ6A 2PD7A 1MZUA 2J80A 4G3WA 4HJ3A 3VE4A 2XROA 2VLGA 4WF0A 3BW6A 1TS8A 4I3AA 1GSXA 3W2ZA 3T4LA 3T4SA 5HPIA 3F1OA 1OJ5A 4ETXA 4EEPA 2VGLM 1YSPA 2D02A 3RTYA 3F1NB 4HQAA 1T1BA 2B18A 4H6JA 2BASA 1OTIA 4O8GA 2V1BA 1F9IA 4CLCD 1EW0A 2CMNA 4GLQA 3FPWA 5J3WA 2I9VA 2PHYA 3BY9A 5HZHA 2XA7S 2Z6CA 3TJZC 1S4SA 3LYXA 4BBTA 4ZRRA 4OOLA 1NRJA 2VEAA 1XFNA 3IBRA 3LFVA 2A24A 3H7WB 4XT2A 2NUTC 1TD5A 2QWSA 1TS7A 3NOTC 3U2AA 5A8BA 1DP9A 3E0YA 4B9OA 1S1ZA 5C5KA 3TW8A 2VGLS 3BQ8A 4GS9A 4PKYG 5KIZA 1NLYA 1LSXA 3CI6A 4HIAA 1LT0A 2Y79A 2M7VA 2O0YA 1NWZA 3MF0A 4EW7A 5G4ZA 2G7UA 1X0OA 3OCLA 4YNRA 4YOFA 3PBQA 3KYQA 1T1AA 4GHIA 2ZMVA 3JVUA 5F69A 5TBMB 2HGVA 1W63Q 5DFXA 3A0RA 2V1AA 1F5MA 3CITA 4GJ4A 4CLCC 1OTBA 1H3QA 2A2LA 3UB6A 2Y8HA 3CUEC 5HD3A 3UB7A 5IS1A 3NJAA 5FL3A 4CLCE 5I5LA 4AFIA 4I38A 2D01A 2QKPA 4R3AA 2VX8A 4MDZA 2GJ3A 3EOIA 4K08A 4UQIS 2EWWA 2JN7A 3KSIA 3LIFA 3H82B 3T4JA 4L9EA 3IS2B 4Q0IA 4IUKA 2W1TB 2W3DA 2OWHA 3P01A 3MMHA 5L8MA 2VV8A 2W3EA 3S7NA 3LICA 3K2NA 4P6ZS 1OT9A 2WKRA 3PHYA 2PR5A 2FZ0A 1ZHHB 4HNBA 2LB9A 1XFQA 2DMWA 3P7NA 4EUVA 4Q0JA 4RQ9A 3LR3A 5HDDA 1UWNX 4NXFA 2PYRA 4ETZA 1GSVA 3H9WA 2ZMFA 4BBVA 1UWPX 4GCZA 2QJ5A 4DJ3A 1BYWA 3KYZA 1OTDA 2M1CA 4YWZA 4G3KA 2P04A 3EWKA 4HOIA 4O01A 4WN5A 3B33A 3F1NA 4HH3A 4HH2A 4MN7A 2WKPA 3R7WB 1XJ3A 2HJEA 3MFXA 1S1YA 5LBRA 3F1PB 3OC2A 3IBJA 5DKKA 2OAP1 4WEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7U A;  3G6O A;  5C5K A;  2O9B A;  2KLI A;  4GW9 A;  5HPF A;  4R70 A;  3CI6 A;  4R6L A;  2Y79 A;  2M7V A;  2O0Y A;  2VKS A;  5HL6 A;  4DMZ A;  3MF0 A;  5TJJ A;  2G7U A;  3TRC A;  3NOP C;  4YNR A;  4YOF A;  4Y2F A;  4Y5F A;  4Q0H A;  1MKM A;  1MC0 A;  3MQ0 A;  3NOU C;  2HGV A;  2VZW A;  5DFX A;  3S7Q A;  2W3F A;  1STZ A;  2O9C A;  1F5M A;  3CIT A;  4BWI A;  2Y8H A;  2XRN A;  2VJW A;  1ZTU A;  3KSH A;  4ME4 A;  2KOI A;  1YSQ A;  3NHQ A;  4IUH A;  4CQH A;  4MMN A;  4MCW A;  5I5L A;  2K31 A;  2O99 A;  3KO6 A;  2K2N A;  3IBJ A;  3OBF A;  4MDZ A;  3D3O A;  5DFY A;  5K5B A;  3R4K A;  3OOV A;  4LRZ E;  3KSI A;  4FOF A;  4Q0I A;  4IUK A;  2W1T B;  2O9A A;  1YKD A;  2W3D A;  3C2W A;  4G3W A;  2XRO A;  2QYB A;  3MMH A;  5L8M A;  2W3E A;  3S7O A;  3S7N A;  3VV4 A;  4EU0 A;  3W2Z A;  3KSF A;  3K2N A;  4LRX C;  4E04 A;  5HPI A;  2W3G A;  2W1R A;  4QPR A;  4ETX A;  2IA2 A;  3EEA A;  1YSP A;  2LB9 A;  3KSG A;  2B18 A;  4EUV A;  4Q0J A;  4RQ9 A;  4O8G A;  1VHM A;  2W1T A;  5AJG A;  2W3H A;  4GLQ A;  4Y3I A;  3S7P A;  4ETZ A;  1TF1 A;  2ZMF A;  3O5Y A;  3E98 A;  4O0P A;  2LB5 A;  3BJN A;  4IJG A;  5HSQ A;  3ZQ5 A;  4Z1W A;  2XSS A;  3HCY A;  4ZRR A;  4G3V A;  2VEA A;  3RFB A;  4G3K A;  2GX5 A;  3DBA A;  3IBR A;  4O01 A;  3LFV A;  4PAU A;  4MN7 A;  4LRY C;  1TD5 A;  2OOL A;  5LBR A;  3NOT C;  4DN0 A;  3E0Y A; 
#chains in the Genus database with same CATH topology
 1YAX A;  4NG2 A;  3FKW A;  3MS6 A;  3O86 A;  3CLO A;  2OLV A;  3EQU A;  1E4D A;  4X68 A;  3NUL A;  1XKZ A;  1AXB A;  4B93 A;  2VV6 A;  1MBL A;  1XJ4 A;  1Y28 A;  2W3F A;  1V9Y A;  1ZG4 A;  1N9O A;  2JKR M;  1XGI A;  1BSG A;  2XFS A;  4I5S A;  1D1J A;  4PMA A;  4PM8 A;  3UB8 A;  1Q2Q A;  1RP5 A;  3C4P A;  5FEF A;  4MN5 A;  3T12 B;  2DNS A;  3VSL A;  5M18 A;  1N9L A;  2QMI A;  3D4F A;  1SKF A;  4GDB A;  4JGP A;  2PR6 A;  3EEH A;  5FSR A;  3M6B A;  4I39 A;  1D06 A;  3DTK A;  3LUQ A;  4GDN A;  2QYB A;  2CC1 A;  4WZ4 A;  1M6K A;  4PKY A;  4JGO A;  4EU0 A;  3KSF A;  1PRQ A;  2J3W A;  4OPY A;  5DF9 A;  5DKL A;  3LY4 A;  3EEA A;  3GDI A;  3T1S A;  1HTZ A;  2Y2N A;  4ZBE A;  1OT6 A;  3UY6 A;  3QP6 A;  3IXD A;  5KMW A;  4U0T A;  3EGX C;  1N9N A;  3T4T A;  1OME A;  2VA0 A;  3T4K A;  1K4F A;  4JF6 A;  4Z1W A;  2XSS A;  1QME A;  1YMS A;  2EX6 A;  5TR7 A;  2R9X A;  5E2E A;  5EM0 A;  4B4Z A;  3LR0 A;  2OOL A;  4UHU A;  3TE8 A;  3OCN A;  1FSY A;  3V3R A;  3WRT A;  2JCH A;  2DRW A;  4M3K A;  3NDG A;  5DF8 A;  1ERQ A;  2PT7 A;  4Y13 A;  1XGJ A;  4RX3 A;  3W4O A;  4JXW A;  5A93 A;  1A0K A;  4EBP A;  3F1P A;  4MEZ A;  2XA7 M;  1STZ A;  3MXQ A;  1OJG A;  3VP1 A;  4OQH A;  3HLG A;  4X1M A;  3PYP A;  4EXO A;  4ME4 A;  2GZA A;  2Y2G A;  3SW1 A;  4LFU A;  4CJN A;  2OAQ 1;  2XD1 A;  5GHX A;  2MJ6 A;  3FPV A;  5F68 A;  1FR6 A;  4PM9 A;  2V1Z A;  4KUO A;  4LEN A;  3RXW A;  2ZBB A;  2PYP A;  4HEF A;  5BOH A;  1ES3 A;  5FQQ A;  5EPH A;  1ONH A;  4YFM A;  3I7J A;  3BWL A;  3V5M A;  3KSG A;  3VE3 A;  3BQA A;  4QY5 A;  2W3H A;  2ZQA A;  4LV2 A;  3S7P A;  3NEC A;  4KZ5 A;  5G4Y A;  4GS9 B;  4UQI M;  1TF1 A;  3C8C A;  4JF5 A;  1KGG A;  3GEC A;  1L0F A;  3CG5 A;  3ZQ5 A;  1IEL A;  1IKG A;  3HCY A;  4F94 A;  4LRY C;  2WKI A;  1NRF A;  1PWG A;  4GHI B;  5EM1 A;  3FC7 A;  3G6O A;  1FIK A;  5DJT A;  3HJI A;  3T50 A;  3OLO A;  4QJG A;  3PBN A;  2PU2 A;  3UE6 A;  1CK3 A;  3QP2 A;  4S2J A;  5HDS A;  2E8I A;  2P9V B;  4EWF A;  4IVK A;  3VSK A;  5HAP A;  2I72 A;  3ZGA B;  3HUN A;  5AVE A;  3N8L A;  3G31 A;  2ZC5 B;  1MWT A;  2K31 A;  3PXP A;  3A0V A;  1XA1 A;  1MWS A;  3OBF A;  2YKF A;  1ES2 A;  1H8M A;  3D3O A;  3R4K A;  5AQB A;  4LRZ E;  3BRM A;  4QWO A;  3G2Y A;  1PFL A;  2WKE A;  4L0L A;  1VQQ A;  2J8Y A;  3GMW A;  2WAF A;  1XJ6 A;  3CPT B;  3W8K A;  4HJ3 A;  2ZM8 A;  2XRO A;  2VLG A;  1LL5 A;  5EVE A;  5F83 A;  3SH8 A;  1SKO B;  1HLU P;  3NI9 A;  2Y91 A;  1YLT A;  1PWD A;  1NZU A;  1KE4 A;  1JWZ A;  2BAS A;  1OTI A;  4X53 A;  2V1B A;  1F9I A;  4S2P A;  1BZA A;  2PHY A;  4KZ7 A;  3OPR A;  2JBF A;  4ZRR A;  4Z9Q A;  1G6A A;  3OPH A;  3NOT C;  3U2A A;  5AQ9 A;  1PIO A;  5C5K A;  2HPB A;  4IBR A;  2ZQC A;  3O3V A;  3TW8 A;  4HIA A;  2ZQ7 A;  1LT0 A;  3MF0 A;  5G4Z A;  2G7U A;  3BEC A;  3ZG9 B;  4YOF A;  1PW1 A;  1ERM A;  4MBF A;  1KDW A;  3CIT A;  2UWX A;  1DJA A;  3UB6 A;  2Y8H A;  1GCE A;  1LI0 A;  4RYE A;  2C5W B;  4BL2 A;  5FL3 A;  4ZJ1 A;  3BFE A;  4I38 A;  4X25 A;  3U4L P;  4L9E A;  5FI2 A;  1EI5 A;  3P01 A;  4WMC D;  1H8Z A;  2AVX A;  3NIA A;  5E2F A;  2W3E A;  3S7N A;  1YMX A;  4P6Z S;  2XLN A;  1RCJ A;  4LCM A;  2DMW A;  2Q0O A;  5HFO A;  1O7E A;  3TSG A;  4Q0J A;  1CQA A;  4MNR A;  4K91 A;  4ETZ A;  2ZMF A;  1UWP X;  2QJ5 A;  1K56 A;  1L0D A;  3KYZ A;  1JWV A;  3O87 A;  4E3O A;  4C75 A;  1CI9 A;  5DTS A;  4G3K A;  3W4P A;  4WN5 A;  1CJF A;  3B33 A;  3F1N A;  1XJ3 A;  1QMF A;  1NXY A;  1S1Y A;  1YLP A;  2EFU A;  3F1P B;  5DKK A;  4BMW A;  2XGN A;  3B47 A;  4RA7 A;  2O9B A;  2KLI A;  2X71 A;  1BLP A;  4R70 A;  3MQO A;  2VKS A;  5HL6 A;  5M1A A;  1YM1 A;  3C5A A;  4FD8 A;  4Y2F A;  1OPX A;  3H7W A;  1ALQ A;  4HI4 A;  1V9Z A;  4O7D A;  3E2L A;  3ZFZ A;  2K7S A;  3B42 A;  3Q82 A;  4ZJ3 A;  4OH0 A;  4MCW A;  3S22 A;  1K54 C;  4NXB A;  5K5B A;  2ZC3 B;  3CHW P;  4R1G A;  5GHY A;  1NY0 A;  3G4P A;  2XEP A;  3CWF A;  4FOF A;  3UPN A;  4GD6 A;  1SHV A;  1YKD A;  2B02 A;  1ONG A;  3G35 A;  1VM1 A;  2DCF A;  3UMD A;  3LI9 A;  1I2S A;  3GTC A;  2Q9N A;  5KZH A;  3MKE A;  4KQO A;  3OZH A;  1IOU A;  4JF4 A;  3VOZ A;  3EGD C;  1XP4 A;  3H82 A;  3JVV A;  4E3I A;  4OP5 A;  2GNX A;  2P74 A;  2XD5 A;  3HLF A;  2Z6D A;  4L9F A;  4OON A;  4QB8 A;  4DE2 A;  1G28 A;  5EFW A;  1F98 A;  3G34 A;  2HP9 A;  3GRJ A;  1BLC A;  4D60 A;  2VK3 A;  5E43 A;  1DJB A;  2V0W A;  4U3T A;  1L0G A;  3BM6 A;  3G32 A;  3EQV A;  4X69 A;  2KDK A;  2A3U A;  1MWR A;  5TJJ A;  2NUP C;  3RJU A;  3TRC A;  4GNU A;  5GLB A;  2W27 A;  4E3M A;  1MKM A;  3CMZ A;  3NOU C;  2PDR A;  1L0E A;  4R23 A;  1G6O A;  4KUK A;  4NXG A;  3UN7 A;  2O9C A;  2WGW A;  2VV7 A;  4EET B;  2Y2L A;  3C30 A;  4UA9 A;  4FH2 A;  5HD5 A;  3BEB A;  1I2W A;  2KOI A;  1YSQ A;  4IUH A;  2J9O A;  4P0M A;  4B4X A;  3SH7 A;  4HBU A;  5CED A;  2HDS A;  3QP5 A;  4LV3 A;  4HHD A;  3DWZ A;  1TS6 A;  1P0Z A;  2L0W A;  3IWQ A;  1UGU A;  3UE3 A;  3HLB A;  3S7O A;  4OOM A;  2JKT I;  2PBD P;  1VET A;  4QPR A;  3P98 A;  5FQK A;  1YLW A;  1GHI A;  3IF6 C;  1PZP A;  2ZQ8 A;  1K6R A;  1S0W A;  3V67 A;  3OPP A;  2WYX A;  1J9M A;  4JGQ A;  3LCE A;  4WL9 A;  4O0P A;  2LB5 A;  1W5D A;  2ZOH A;  4N1H A;  4R3J A;  4G3V A;  4PAU A;  1I5Q A;  3JYI A;  1PWC A;  4P6Z M;  5FAP A;  3ZNT A;  4LV0 A;  3UB9 A;  3C7V A;  4DN0 A;  2EWV A;  2QZ6 A;  4OPZ A;  3Q7V A;  4WEL A;  4WLA A;  3CAX A;  4N1X A;  4R6L A;  2Y59 A;  3GQZ A;  4X55 A;  3NOP C;  1IKI A;  1GHP A;  3A3J A;  1MC0 A;  4QHC A;  3NC8 A;  4PHT A;  2BG1 A;  2JHE A;  3PAE A;  4X6T A;  3UO9 A;  4ARZ A;  1GSW A;  2L4R A;  3LI8 A;  2ZC6 B;  3UDX A;  2EXA A;  2Y2H A;  2QJ7 A;  5F6A A;  3HLD A;  4MMN A;  2Y55 A;  4U0X A;  5CTN A;  1MKI A;  3ZVW A;  1FQG A;  2G2W A;  1YLY A;  2INW A;  3QNB A;  4MN6 A;  3N8R A;  1W8Q A;  4S2N C;  4BEN A;  4HBT A;  3QP8 A;  2ZJ9 A;  4I3A A;  1FCO A;  2ZQD A;  3BFC A;  3T4L A;  5CHM A;  4S2K A;  4Y17 A;  4E3K A;  4FUW A;  1G68 A;  4EEP A;  2VGL M;  1YSP A;  3F1N B;  3IX8 A;  5CEC A;  4HQA A;  5HAI A;  1T1B A;  4H6J A;  1XPB A;  3MZD A;  5FDH A;  3FPW A;  3G30 A;  1K57 C;  3WS2 A;  1JTG A;  5HZH A;  1H5X A;  3TJZ C;  3ITA A;  1S4S A;  3LYX A;  4OOL A;  2VEA A;  3IBR A;  5EOO A;  3H7W B;  5EOE A;  1E3U A;  2NUT C;  1LI9 A;  3NCK A;  4JXS A;  3IWI A;  4JLF A;  3BQ8 A;  4H8R A;  5KIZ A;  1NLY A;  1LSX A;  4IED A;  3SZT A;  4KQR A;  1PZO A;  3CI6 A;  5DTT A;  3RXX A;  4ID4 A;  2M7V A;  5J8X A;  2O0Y A;  1DJC A;  4EW7 A;  1YLJ A;  3SS4 A;  2R9W A;  3BLM A;  1CF0 A;  1KE0 A;  4E3L A;  1E25 A;  1T1A A;  5CHU A;  2V1A A;  3MXS A;  1F5M A;  5CGS A;  4N92 A;  1OTB A;  1H3Q A;  2FFF B;  1MXO A;  3CUE C;  2ZM2 A;  3IT9 A;  2XR0 A;  3NJA A;  3CZD A;  2QKP A;  1TVF A;  2JN7 A;  3BFD A;  3H82 B;  1VEU A;  5I94 A;  1PYY A;  2XH9 A;  4EBN A;  1W8Y A;  2PR5 A;  4Y15 A;  1K55 C;  2Y2Q A;  3OPL A;  1WYC A;  4EUV A;  4RQ9 A;  5HDD A;  2VGK A;  1F2K A;  1GSV A;  2V8C A;  3WWX A;  4BBV A;  4KZB A;  1OTD A;  2WAD A;  5EUA A;  2ACG A;  3EWK A;  4O01 A;  4HH2 A;  2WKP A;  5A92 A;  5FI6 A;  2HJE A;  4R3B A;  3M6H A;  4ZDX A;  1HZO A;  2OAP 1;  3TOI A;  5E2H A;  2M7U A;  4DDS A;  3LR4 A;  5JYO A;  3ISG A;  3IXB A;  2WGW B;  2WGI A;  2P7J A;  4LLO B;  4DMZ A;  3LEQ A;  1W63 M;  4MLL A;  3S1Y A;  1Z6F A;  1S66 L;  3E4P A;  3IHA A;  3HJK A;  3ZVT A;  2W0N A;  4IVI A;  1L2S A;  3M2K A;  4ZJ2 A;  4OOY A;  2WZZ A;  3C38 A;  5J4E A;  3HBR A;  1ESI A;  4DXB A;  1VET B;  3WS0 A;  4I3J A;  3KO6 A;  3C4O A;  3T4Q A;  3DWK A;  4GB7 A;  3B3X A;  4KQD A;  3MQQ A;  3RH8 B;  4ZAM A;  4CPK A;  4KG6 A;  4I3I A;  4P85 A;  5EEC A;  4HY8 A;  4E04 A;  2W1R A;  5HDC A;  1XXM A;  1T19 A;  3PBS A;  3FZC A;  4KEN B;  4C6Y A;  4WM9 A;  4DDY A;  1IYQ A;  1P9W A;  3SS3 A;  2PAV P;  4GZB A;  1ES4 A;  3IS2 A;  5FAT A;  4Y0T A;  2W1T A;  5FEG A;  1KVL A;  1BLH A;  2Y2O A;  4KG5 A;  3Q7V B;  1ZC2 A;  4KZA A;  3ZCZ A;  3ZG8 B;  3UME A;  4IHQ A;  4KG2 A;  2UV0 E;  3DBA A;  3ULF A;  2QPN A;  3UE1 A;  3MKF A;  4N9L A;  1LSV A;  2XFT A;  4UA7 A;  5F82 A;  3V50 A;  4ARZ B;  3IH9 A;  1IYO A;  4EQ1 A;  3FV7 A;  1FCM A;  1FCN A;  5F1F A;  3LIB A;  1TDL A;  1K38 A;  2HZ5 A;  1P97 A;  4WZ5 C;  3PR6 A;  2JC7 A;  5TGF A;  4XUZ A;  1HVB A;  3R7W A;  2EFX A;  3MQ0 A;  2PD8 A;  2V8F A;  4JXG A;  4KZ8 A;  2WUQ A;  3JPU A;  5FAQ A;  1MWU A;  2FFY A;  2Y2J A;  5GHZ A;  4HJ6 A;  1KOU A;  2XRN A;  2Y2M A;  3MXR A;  3K3C A;  1PNE A;  3GVB A;  4S2I A;  2V20 A;  3QNC A;  3NHQ A;  2P08 A;  1WA9 A;  5IHV A;  4Y0O A;  1K54 A;  1NYM A;  4MBH A;  1KE3 A;  1M40 A;  1ZKJ A;  3OOV A;  2ZL1 A;  4H6J B;  2RCX A;  4CLC A;  4R4S A;  3MBZ A;  3DTM A;  3MSH A;  3D72 A;  1H8Y A;  4ESP A;  1ES5 A;  5GLD A;  3UDF A;  3QHY A;  2C6W B;  2XQZ A;  4OPR A;  3LGO A;  4FCF A;  3LID A;  3BFG A;  4E3N A;  2V2F F;  1VHM A;  2KX6 A;  5AJG A;  4L9G A;  3MFD A;  1YT4 A;  5EE8 A;  3O5Y A;  3ITB A;  2Z2L B;  3BJN A;  3Q07 A;  1RGZ A;  2JKR I;  2HDR A;  5HSQ A;  1HD8 A;  4NKP A;  2PRF A;  5HX9 A;  5J7E A;  4HP4 A;  2GX5 A;  2HP5 A;  2RL3 A;  3MR0 A;  4LPZ A;  4NK3 A;  4LCL A;  1JWP A;  1YLZ A;  4F3L A;  3E4Q A;  1T18 A;  4GW9 A;  4FSF A;  5HPF A;  5CGW A;  1LSW A;  2EA9 A;  3AGF A;  3E2K A;  3LIE A;  3S4X A;  4QY6 A;  5CER A;  5AVF A;  1PI4 A;  4K0W A;  1SCW A;  3PBR A;  3S7Q A;  3UE0 A;  1IYS A;  4WBG A;  5EVI A;  2Y2P A;  1ACF A;  5HWT A;  1VEU B;  2OSU A;  3HL9 A;  2VJW A;  4NEE D;  5CTM A;  3KSH A;  1U60 A;  1BTL A;  4CQH A;  4HP9 A;  4LV1 A;  4DRT A;  3WRZ A;  3HLE A;  4BJP A;  3T1X A;  1Y54 A;  3V39 A;  3Q1F A;  2PD7 A;  4EV4 A;  2J80 A;  4B88 A;  3VE4 A;  1DY6 A;  4WF0 A;  3BW6 A;  1TS8 A;  5GLC A;  1GSX A;  3N4I A;  3W2Z A;  1Y4O A;  4P6B A;  3F1O A;  5FQI A;  4ETX A;  3IF6 A;  3M2J A;  2B18 A;  5DTK A;  2X01 A;  4UAA A;  1IEM A;  1S6R A;  3WS5 A;  3WS1 A;  2ZC4 B;  1PI5 A;  3BY9 A;  3FYZ A;  1ZG6 A;  3BFF A;  4BBT A;  4E6W A;  1NRJ A;  4PM6 A;  3PAG A;  4NET A;  2A24 A;  4XT2 A;  1TD5 A;  3O88 A;  3KYE A;  3SH9 A;  1TS7 A;  3N6I A;  3VOY A;  4B9O A;  1ESU A;  2H10 A;  1NWZ A;  3C7U A;  4YNR A;  2EXB A;  3HVF A;  3A3E A;  3ZG0 A;  1K0K A;  2EX9 A;  3T1R A;  3BYD A;  1W63 Q;  3A0R A;  3NDE A;  3HRE A;  4GJ4 A;  1TDG A;  2A2L A;  4LGW A;  5L07 A;  4CLC E;  4AFI A;  5AQA A;  1IYP A;  2D01 A;  5EVL A;  4BL3 A;  4R3A A;  2EX2 A;  4DE0 A;  2ZD8 A;  3A3I A;  3EOI A;  3UNW A;  4K08 A;  1SZV A;  4Q8I A;  2EWW A;  2BLS A;  3KSI A;  1NZO A;  4S2N A;  3LIF A;  4QD4 A;  3IS2 B;  4Q0I A;  3G2Z A;  2W1T B;  2ZC7 A;  2IWB A;  2IWD A;  3Q81 A;  1K25 A;  3IX4 A;  3MMH A;  5L8M A;  1JVJ A;  4XXR A;  1KDS A;  2WKR A;  3PHY A;  4JKT A;  4KQQ A;  1AWI A;  3IXH A;  1ZHH B;  4HNB A;  5KSC A;  2LB9 A;  3UPO A;  1XFQ A;  1RGY A;  3P7N A;  4HES A;  3UB5 P;  2WZX A;  1GA9 A;  3LR3 A;  5CXW A;  5GLA A;  2B95 A;  1K57 A;  3VMA A;  1WYB A;  4GCZ A;  3LO7 A;  1TEM A;  4ZTK A;  4DJ3 A;  5HW3 A;  4KZ3 A;  2G2U A;  1FR1 A;  3VFF A;  2M1C A;  2Y2I A;  1LL9 A;  4YWZ A;  4HOI A;  4HH3 A;  4MN7 A;  3R7W B;  3VP4 A;  1MY8 A;  4OQI A;  3N8S A;  1J3W A;  5FAS A;  4X1L A;  3OC2 A;  4R4R A;  5IU1 A;  4WEK A;  1K4E A;  3A0S A;  2JKT M;  2J3T D;  4WEJ A;  2JKF A;  3UDI A;  5DVA A;  1GHM A;  1C3B A;  3MZE A;  3ZG7 B;  1BUL A;  3IHB A;  4XUX A;  1DP8 A;  1O07 A;  4A5R A;  4Y5F A;  2Y4A A;  2JKG A;  3A3F A;  4KZ4 A;  1E3U D;  4JGR A;  1S4R A;  2L1M A;  5IT5 A;  5FDS A;  3UPP A;  4FTX A;  4UA6 A;  2VZW A;  3TG9 A;  5CEB A;  2ZL1 B;  3K3D A;  3V3S A;  4BD0 A;  2PBY A;  3CUE A;  3W4Q A;  4CLC B;  1XJ2 A;  1JTD A;  1BUE A;  2PU4 A;  1TS0 A;  4NXE A;  3IX3 A;  3E4O A;  3VP0 A;  3HUO A;  3HLW A;  1S67 L;  1OTA A;  5TBM A;  2R78 A;  3AGD A;  3L7H A;  2BTF P;  2J3T C;  4DF6 A;  3KX0 X;  1CEG A;  5HAR A;  2HDU A;  1LL8 A;  1DP6 A;  2OLU A;  4FH4 A;  5AQ7 A;  1VB6 A;  5CRF A;  2IA2 A;  4EES A;  1K55 A;  4EQI A;  5CGX A;  1H0M A;  1N4O A;  4D2O A;  5HWV A;  4MBK A;  5CX7 A;  5FQJ A;  1KGF A;  5MC7 A;  1IFQ A;  1PW8 A;  2FH5 A;  3HLC A;  4Y3I A;  4F3L B;  5FAO A;  1DRM A;  1Q2P A;  1SDN A;  3AGE A;  4IJG A;  4IBX A;  4N9K A;  3RFB A;  3SOI A;  4GN2 A;  2HJ9 C;  5U47 A;  2ZOI A;  5FQM A;  5EVI B;  3GSG A;  2H0T A;  1YPR A;  1LLB A;  4YIN A;  5M19 A;  4PPR A;  3IF5 A;  2V0U A;  3DTI A;  4Y0U A;  5GL9 A;  3D9Y A;  2WKQ A;  5TFQ A;  5HL1 A;  3BY8 A;  4S2M A;  1P9R A;  3L9K A;  3FG8 A;  4OKP A;  2A49 A;  3P09 A;  5L10 A;  2JE5 A;  2ZLY A;  3VOL A;  3GV9 A;  3F1O B;  2YKH A;  1CI8 A;  2K2N A;  4JPM A;  3ZHH A;  3FWL A;  5DFY A;  3IF6 B;  2HDQ A;  4WUJ A;  2X02 A;  4EEU A;  5CHJ A;  2O9A A;  3C2W A;  1ERO A;  3T4O A;  1G5U A;  4DJ2 A;  1WE4 A;  2B5R A;  3VV4 A;  3ZYT A;  4LRX C;  5HAQ A;  4R38 A;  3PBT A;  2W3G A;  1MPL A;  3MJQ A;  4DKI A;  1NLZ A;  4EBL A;  4JBF A;  2A24 B;  1XX2 A;  4XT2 B;  1FSW A;  2H28 A;  5EV0 A;  2HV1 A;  1K6S A;  4RVA A;  3E98 A;  3IQA A;  5JYP A;  4BBU A;  1D7E A;  4GOG A;  4HJ4 A;  4PM5 A;  4II7 A;  2HF6 A;  2ZMA A;  4EER A;  5F5Y A;  3HUM A;  5L09 A;  4DE3 A;  3PBO A;  5KSH A;  2Q9M A;  5F1G A;  2V9A A;  1JNU A;  4WZ5 A;  1NJ4 A;  2XK1 A;  3GR2 A;  5FI7 A;  3LIA A;  1ODV A;  3A3D A;  2OV5 A;  1T1C A;  4PM7 A;  3PTE A;  1CEF A;  4Q0H A;  4WYY A;  4OLD A;  1OTE A;  4KZ6 A;  4S2O A;  3IH8 A;  3ICY A;  5DJU A;  5HWW A;  5A91 A;  4JXV A;  4BWI A;  4DXC A;  1ZTU A;  4WMC A;  4M4X A;  1K56 D;  2IWC A;  1BT5 A;  4UEY A;  3LR5 A;  2OWJ A;  2O99 A;  3T1Q B;  2QHK A;  1L3L A;  1MZU A;  4OLG A;  4G3W A;  1W7F A;  5A90 A;  5D3O A;  1XA7 A;  3T4S A;  5HPI A;  4GKU A;  1OJ5 A;  4BLM A;  1YQS A;  2D02 A;  2WK0 A;  3RTY A;  3LEZ A;  3FKV A;  3BLS A;  4O8G A;  4CLC D;  4E3J A;  1EW0 A;  2CMN A;  4GLQ A;  1NYY A;  5J3W A;  4S2L A;  2Z2M B;  2I9V A;  2GDN A;  4X56 A;  2XA7 S;  2Z6C A;  4DE1 A;  3QP4 A;  4R0Q A;  1XFN A;  3LFV A;  3SS5 A;  3QP1 A;  3VP3 A;  2WGV A;  2QWS A;  5FQ9 A;  5A8B A;  1DP9 A;  3E0Y A;  1S1Z A;  2VGL S;  4GS9 A;  4PKY G;  3DW0 A;  2Y79 A;  4OQ0 A;  1EWZ A;  3VP2 A;  1X0O A;  3OCL A;  1BLS A;  4BQM A;  3PBQ A;  4E6X A;  3KYQ A;  2XDM A;  1FOF A;  4GHI A;  4EUZ A;  2ZMV A;  3JVU A;  5F69 A;  5TBM B;  2HGV A;  5DFX A;  5G18 A;  4RX2 A;  2H0Y A;  3WS4 A;  4CLC C;  5HD3 A;  2HP6 A;  2VGJ A;  4OPQ A;  3UB7 A;  5IS1 A;  4OQG A;  2J7V A;  1Z09 A;  5I5L A;  2J9P A;  2P9V A;  4Y7P A;  2VX8 A;  4MDZ A;  5L2F A;  2GJ3 A;  4UQI S;  2XF3 A;  1GA0 A;  1SDE A;  3LY3 A;  5E2G A;  5EVI D;  4QU3 A;  3T4J A;  3VFH A;  4KZ9 A;  4GD8 A;  4IUK A;  2W3D A;  2OWH A;  1LHY A;  2VV8 A;  3DTE A;  3LIC A;  3K2N A;  1OT9 A;  2Y2K A;  2E8J A;  2FZ0 A;  3ZG5 A;  3NY4 A;  4P87 A;  2H5S A;  4OP8 A;  4BD1 A;  3ZDJ A;  1UWN X;  4K0X A;  3CPT A;  5DF7 A;  4NXF A;  1KGE A;  2PYR A;  2WKH A;  3H9W A;  3IWO A;  1KVM A;  1N9B A;  4OVD A;  1BYW A;  3DAV A;  3MZF A;  2EX8 A;  1SKO A;  1W79 A;  4C3Q A;  2P04 A;  2WAE A;  5FA7 A;  3IXG A;  3N7W A;  3CJM A;  2ZQ9 A;  3Q7Z A;  1FIL A;  3MFX A;  3ZNY A;  5LBR A;  2ZM0 A;  3IBJ A;  5EVI C;  3NBL A; 
#chains in the Genus database with same CATH homology
 2M7U A;  3LR4 A;  3A0S A;  2JKT M;  2J3T D;  1YAX A;  2O9B A;  3B47 A;  4WEJ A;  2KLI A;  3CLO A;  4R70 A;  3MQO A;  2VKS A;  2P7J A;  4LLO B;  5HL6 A;  4DMZ A;  3EQU A;  1W63 M;  1DP8 A;  4Y2F A;  4Y5F A;  1OPX A;  4B93 A;  1S66 L;  2VV6 A;  3H7W A;  3E4P A;  4JGR A;  1S4R A;  2L1M A;  1XJ4 A;  3HJK A;  5IT5 A;  2VZW A;  1Y28 A;  4HI4 A;  2W3F A;  2W0N A;  1V9Y A;  3K3D A;  1V9Z A;  1N9O A;  2JKR M;  3CUE A;  4CLC B;  1XJ2 A;  2K7S A;  4I5S A;  3B42 A;  3C38 A;  5J4E A;  1TS0 A;  4NXE A;  5IU1 A;  3UB8 A;  3E4O A;  4MCW A;  4MN5 A;  4I3J A;  3KO6 A;  1N9L A;  1S67 L;  1OTA A;  4NXB A;  5TBM A;  5K5B A;  2R78 A;  3T4Q A;  4JGP A;  2PR6 A;  3EEH A;  4KQD A;  3MQQ A;  3CWF A;  4I39 A;  1D06 A;  4FOF A;  3LUQ A;  1YKD A;  3RH8 B;  2J3T C;  2B02 A;  2QYB A;  3KX0 X;  3UMD A;  1LL8 A;  4I3I A;  1DP6 A;  3LI9 A;  4PKY A;  4JGO A;  4EU0 A;  3KSF A;  1VB6 A;  2J3W A;  4HY8 A;  4E04 A;  2W1R A;  5DF9 A;  5HDC A;  2IA2 A;  3PBS A;  1T19 A;  5DKL A;  4EES A;  3EEA A;  3GDI A;  4KQO A;  5HWV A;  1IOU A;  3EGD C;  5CX7 A;  3H82 A;  1P9W A;  3JVV A;  1OT6 A;  2GNX A;  1IFQ A;  3IS2 A;  5MC7 A;  2W1T A;  2FH5 A;  4Y3I A;  4F3L B;  2Z6D A;  4L9F A;  3EGX C;  1N9N A;  1DRM A;  1G28 A;  3T4T A;  5EFW A;  1F98 A;  2VA0 A;  3T4K A;  3UME A;  4IJG A;  4IHQ A;  4Z1W A;  2XSS A;  3RFB A;  3DBA A;  3ULF A;  3LR0 A;  2HJ9 C;  2OOL A;  2ZOI A;  1LSV A;  2V0W A;  3TE8 A;  4ARZ B;  4EQ1 A;  3OCN A;  3EQV A;  2KDK A;  3LIB A;  4BMW A;  1P97 A;  3PR6 A;  5TJJ A;  2NUP C;  2V0U A;  2PT7 A;  3TRC A;  2W27 A;  3R7W A;  1MKM A;  3MQ0 A;  2PD8 A;  3NOU C;  2WKQ A;  3BY8 A;  2PDR A;  1G6O A;  3F1P A;  2XA7 M;  4KUK A;  4NXG A;  1P9R A;  1STZ A;  2O9C A;  3MXQ A;  1OJG A;  3FG8 A;  2VV7 A;  1KOU A;  2XRN A;  4HJ6 A;  4EET B;  3K3C A;  3PYP A;  3C30 A;  4EXO A;  4ME4 A;  5HD5 A;  2GZA A;  3VOL A;  3SW1 A;  2KOI A;  1YSQ A;  2P08 A;  3NHQ A;  4IUH A;  1WA9 A;  2OAQ 1;  3F1O B;  2YKH A;  2K2N A;  2MJ6 A;  5DFY A;  3FPV A;  3OOV A;  5F68 A;  4HHD A;  1TS6 A;  4H6J B;  4WUJ A;  1P0Z A;  2L0W A;  4CLC A;  4EEU A;  4KUO A;  2O9A A;  1UGU A;  3C2W A;  3T4O A;  4DJ2 A;  2ZBB A;  3UE3 A;  3D72 A;  2PYP A;  3S7O A;  3VV4 A;  4OOM A;  2JKT I;  4LRX C;  3ZYT A;  4R38 A;  3PBT A;  2W3G A;  4QPR A;  3MJQ A;  1NLZ A;  3BWL A;  3KSG A;  2A24 B;  3LID A;  4XT2 B;  3VE3 A;  3BQA A;  3V67 A;  1VHM A;  2KX6 A;  5AJG A;  2W3H A;  4L9G A;  3S7P A;  2H28 A;  4JGQ A;  2HV1 A;  5G4Y A;  4GS9 B;  1TF1 A;  3C8C A;  3O5Y A;  4UQI M;  4WL9 A;  3E98 A;  4O0P A;  2LB5 A;  3BJN A;  2JKR I;  4BBU A;  3GEC A;  5HSQ A;  3ZQ5 A;  4NKP A;  1D7E A;  2ZOH A;  4HJ4 A;  4II7 A;  5J7E A;  3HCY A;  4G3V A;  4HP4 A;  2HF6 A;  2GX5 A;  3MR0 A;  4PAU A;  4LRY C;  4LPZ A;  4EER A;  5F5Y A;  4GHI B;  4P6Z M;  3UB9 A;  4DN0 A;  2EWV A;  3FC7 A;  3G6O A;  4F3L A;  3E4Q A;  5DJT A;  3PBO A;  5KSH A;  4WEL A;  4WLA A;  1T18 A;  3HJI A;  3CAX A;  4FSF A;  4GW9 A;  3OLO A;  3T50 A;  5HPF A;  2V9A A;  1JNU A;  4R6L A;  3PBN A;  3UE6 A;  1LSW A;  2EA9 A;  3NOP C;  3LIA A;  5HDS A;  1ODV A;  1T1C A;  3LIE A;  4Q0H A;  1MC0 A;  1OTE A;  5AVF A;  4PHT A;  2JHE A;  4ARZ A;  1GSW A;  3ICY A;  5DJU A;  3PBR A;  5HWW A;  2L4R A;  3S7Q A;  3LI8 A;  5HWT A;  4BWI A;  2VJW A;  4NEE D;  1ZTU A;  3KSH A;  5AVE A;  4M4X A;  2QJ7 A;  5F6A A;  4CQH A;  4HP9 A;  4UEY A;  4MMN A;  3LR5 A;  2OWJ A;  2K31 A;  3PXP A;  2O99 A;  3A0V A;  3OBF A;  2YKF A;  1H8M A;  3D3O A;  3R4K A;  4LRZ E;  2INW A;  4BJP A;  4L0L A;  4MN6 A;  2QHK A;  1XJ6 A;  2PD7 A;  1MZU A;  2J80 A;  4G3W A;  4HJ3 A;  3VE4 A;  2XRO A;  2VLG A;  4WF0 A;  3BW6 A;  1TS8 A;  4I3A A;  1GSX A;  3W2Z A;  3T4L A;  3T4S A;  5HPI A;  3F1O A;  1OJ5 A;  4ETX A;  4EEP A;  2VGL M;  1YSP A;  2D02 A;  3RTY A;  3F1N B;  4HQA A;  1T1B A;  2B18 A;  4H6J A;  2BAS A;  1OTI A;  4O8G A;  2V1B A;  1F9I A;  4CLC D;  1EW0 A;  2CMN A;  4GLQ A;  3FPW A;  5J3W A;  2I9V A;  2PHY A;  3BY9 A;  5HZH A;  2XA7 S;  2Z6C A;  3TJZ C;  1S4S A;  3LYX A;  4BBT A;  4ZRR A;  4OOL A;  1NRJ A;  2VEA A;  1XFN A;  3IBR A;  3LFV A;  2A24 A;  3H7W B;  4XT2 A;  2NUT C;  1TD5 A;  2QWS A;  1TS7 A;  3NOT C;  3U2A A;  5A8B A;  1DP9 A;  3E0Y A;  4B9O A;  1S1Z A;  5C5K A;  3TW8 A;  2VGL S;  3BQ8 A;  4GS9 A;  4PKY G;  5KIZ A;  1NLY A;  1LSX A;  3CI6 A;  4HIA A;  1LT0 A;  2Y79 A;  2M7V A;  2O0Y A;  1NWZ A;  3MF0 A;  4EW7 A;  5G4Z A;  2G7U A;  1X0O A;  3OCL A;  4YNR A;  4YOF A;  3PBQ A;  3KYQ A;  1T1A A;  4GHI A;  2ZMV A;  3JVU A;  5F69 A;  5TBM B;  2HGV A;  1W63 Q;  5DFX A;  3A0R A;  2V1A A;  1F5M A;  3CIT A;  4GJ4 A;  4CLC C;  1OTB A;  1H3Q A;  2A2L A;  3UB6 A;  2Y8H A;  3CUE C;  5HD3 A;  3UB7 A;  5IS1 A;  3NJA A;  5FL3 A;  4CLC E;  5I5L A;  4AFI A;  4I38 A;  2D01 A;  2QKP A;  4R3A A;  2VX8 A;  4MDZ A;  2GJ3 A;  3EOI A;  4K08 A;  4UQI S;  2EWW A;  2JN7 A;  3KSI A;  3LIF A;  3H82 B;  3T4J A;  4L9E A;  3IS2 B;  4Q0I A;  4IUK A;  2W1T B;  2W3D A;  2OWH A;  3P01 A;  3MMH A;  5L8M A;  2VV8 A;  2W3E A;  3S7N A;  3LIC A;  3K2N A;  4P6Z S;  1OT9 A;  2WKR A;  3PHY A;  2PR5 A;  2FZ0 A;  1ZHH B;  4HNB A;  2LB9 A;  1XFQ A;  2DMW A;  3P7N A;  4EUV A;  4Q0J A;  4RQ9 A;  3LR3 A;  5HDD A;  1UWN X;  4NXF A;  2PYR A;  4ETZ A;  1GSV A;  3H9W A;  2ZMF A;  4BBV A;  1UWP X;  4GCZ A;  2QJ5 A;  4DJ3 A;  1BYW A;  3KYZ A;  1OTD A;  2M1C A;  4YWZ A;  4G3K A;  2P04 A;  3EWK A;  4HOI A;  4O01 A;  4WN5 A;  3B33 A;  3F1N A;  4HH3 A;  4HH2 A;  4MN7 A;  2WKP A;  3R7W B;  1XJ3 A;  2HJE A;  3MFX A;  1S1Y A;  5LBR A;  3F1P B;  3OC2 A;  3IBJ A;  5DKK A;  2OAP 1;  4WEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...