2LB9A

Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state (corrected pyrrole ring planarity)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a cyanobacterial phytochrome GAF domain in the red-light-absorbing ground state.
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
molecule tags Transferase
molecule keywords Sensor histidine kinase
total genus 33
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2lb9A00
2VZWA 4YNRA 5LBRA 5HPFA 3HCYA 1VHMA 2VEAA 2KOIA 5I5LA 3LFVA 5HL6A 2W3HA 4O01A 2W3FA 3C2WA 4FOFA 4G3KA 3CI6A 4G3VA 3KSHA 4Q0JA 2M7UA 1TD5A 2XROA 4Q0HA 3IBJA 3MQ0A 3VV4A 2W1TA 1MC0A 2QYBA 3KO6A 5AJGA 2XSSA 4ME4A 4MCWA 5K5BA 1F5MA 5C5KA 5L8MA 2ZMFA 4DMZA 3R4KA 2O9AA 2K31A 3G6OA 2O9CA 4GLQA 2O9BA 2M7VA 2B18A 3W2ZA 2Y8HA 4MN7A 2O0YA 3DBAA 3IBRA 4PAUA 3BJNA 1TF1A 3S7NA 4ETZA 3E98A 4EU0A 3MF0A 4G3WA 3S7PA 2HGVA 4E04A 2LB5A 4R6LA 4Y5FA 3RFBA 4MDZA 1MKMA 2Y79A 1YSPA 2K2NA 4O8GA 3EEAA 3MMHA 2W1TB 3K2NA 3TRCA 4EUVA 5HSQA 4ZRRA 2W3DA 4Y2FA 4YOFA 2XRNA 4LRXC 4LRYC 2KLIA 3D3OA 3NOTC 4Z1WA 3NOUC 4O0PA 2VJWA 3KSIA 3ZQ5A 3NOPC 1ZTUA 4IJGA 5HPIA 1STZA 4CQHA 4ETXA 2O99A 2OOLA 4R70A 5TJJA 2IA2A 2G7UA 3S7OA 4BWIA 2W1RA 4GW9A 3E0YA 4LRZE 3S7QA 3CITA 4RQ9A 2GX5A 4Y3IA 1YSQA 3OBFA 3O5YA 4IUKA 4IUHA 3NHQA 5DFXA 2LB9A 5DFYA 1YKDA 2W3GA 3KSFA 3OOVA 3KSGA 4Q0IA 2W3EA 4QPRA 4DN0A 4MMNA 2VKSA
chains in the Genus database with same CATH superfamily
3PBRA 1AWIA 4BENA 3VE3A 3ZFZA 2RCXA 2EX2A 4FOFA 4X68A 3UO9A 3T4KA 4H6JA 1W7FA 4X1MA 4KZ6A 3QP6A 3G35A 4JGRA 4P87A 4FD8A 1NYMA 3FPWA 4BJPA 2DRWA 2JE5A 1F2KA 4YFMA 2QKPA 2O9BA 4JGOA 2PDRA 5F83A 1QMEA 4JF6A 4CLCB 3N4IA 4OKPA 3ZHHA 1FILA 4E04A 4GHIB 3PBNA 5FI7A 3UE3A 4PM5A 4LV3A 2JN7A 1S6RA 2OV5A 4O8GA 3EEAA 3W4PA 3UB9A 4H8RA 1N9OA 2OAQ1 4ESPA 4EETB 4FSFA 3PBOA 1XJ4A 1LHYA 4O0PA 5AQ7A 1LL9A 2PAVP 3PBQA 3MZDA 2Z6DA 1K6SA 5FEGA 4ZJ1A 1MWTA 4E3LA 3E0YA 4CJNA 3F1OB 3T1QB 4E3NA 1NXYA 4IUKA 4WZ4A 2HJEA 2D02A 3UB5P 3GTCA 1DP8A 4MNRA 2OWHA 2W3GA 3GECA 1JWPA 4N92A 2L4RA 5FSRA 3TSGA 1HZOA 4HJ3A 3H9WA 1JTGA 3HLWA 3NBLA 4NEED 3VFFA 2PBDP 2BLSA 5E43A 3ZDJA 3NECA 2HV1A 2JBFA 1TD5A 3OCNA 1GHIA 1KVLA 5FA7A 2GNXA 1PI4A 4CLCC 4WF0A 3PBTA 3RJUA 4OQGA 4X69A 5CERA 1NRJA 4EBPA 2HDRA 1K54C 3PYPA 4HP4A 1YLZA 1BSGA 3NDGA 3TG9A 5TGFA 1OTBA 3ZVWA 4EXOA 2W3DA 1RGYA 3LR3A 5A93A 4P6ZS 4R3JA 1S0WA 2H0YA 5FQKA 3FG8A 3HUNA 1PW1A 5HWWA 3DWKA 3NOTC 5HD5A 2VJWA 1G68A 2YKFA 5FATA 4IJGA 1GA0A 3UMDA 4X55A 2IA2A 3BY8A 2Z2LB 3DAVA 3VP3A 3O5YA 4WM9A 3UB7A 3E4QA 3G31A 4HHDA 4JXVA 3R7WB 2J80A 1H5XA 1XKZA 2EFUA 3A3JA 3UE0A 2Z6CA 3QP1A 4QB8A 3V39A 1YT4A 3B47A 1H8MA 3CI6A 4ZJ2A 5DF9A 2J3WA 3D9YA 3TOIA 3T4TA 3DTEA 4E6WA 5EECA 3UDIA 2QYBA 1FR1A 1NLZA 4QD4A 1OTEA 5K5BA 4JLFA 5I94A 5L09A 2EX8A 2X71A 3UE1A 1I5QA 4CLCA 1E3UA 3BFDA 1K56D 2I9VA 3MQQA 5FQQA 3T1RA 2WKHA 5TBMB 5FAOA 4WN5A 5EUAA 4MDZA 3UPPA 3E4PA 2WKIA 3DWZA 1PW8A 5HW3A 4YOFA 2HDQA 3P01A 3KYQA 2P08A 3W4OA 2GJ3A 2ZMVA 3CLOA 4KZAA 2Y2MA 4OPYA 4HH2A 5GLBA 1KE3A 3EOIA 3BLMA 4JKTA 2J3TD 2L1MA 1FQGA 4ZTKA 4WYYA 4R70A 4ZDXA 1H8ZA 2ZQDA 3SS5A 4LRZE 4OPQA 4R4SA 2WKRA 2YKHA 5DFXA 2H28A 3MFXA 3P09A 4U3TA 1TEMA 4NXBA 2LB9A 5EFWA 2FFYA 5DFYA 3H7WA 4LENA 1YM1A 2JHEA 2Y2GA 3JVUA 5J7EA 3CWFA 4QPRA 3H82A 1IOUA 2VKSA 1BT5A 4EBLA 4DDYA 3NULA 3CJMA 2VEAA 3U4LP 2BG1A 2XEPA 5HL6A 3VMAA 1NYYA 3IHAA 3IX4A 3LIBA 4Q0HA 3IBJA 2KX6A 3BY9A 1XFQA 3UB8A 4DMZA 2IWCA 2Y59A 3M6BA 1NWZA 1W5DA 1EW0A 3NI9A 1FR6A 3W8KA 3L9KA 1KDWA 4E3IA 3UB6A 4OQIA 5AQAA 5AQBA 3HBRA 4HNBA 1XJ6A 5FDHA 1IELA 3MF0A 1K55C 5KZHA 2P04A 2Y2OA 4EWFA 5DTTA 3A3IA 3JPUA 3MMHA 3NDEA 4DXBA 3BM6A 2G2WA 4GDBA 4OH0A 1S1YA 3E4OA 2MJ6A 1J9MA 4Y7PA 1CI8A 4LPZA 1XX2A 4LRYC 4LLOB 2KLIA 3MBZA 3OLOA 3LY4A 2A3UA 2V0WA 1OTDA 3AGEA 5FQIA 4PM8A 2Y2LA 4S2IA 1K55A 5TFQA 2Q9MA 1KGFA 4F3LB 4II7A 3LI8A 4IBXA 4Y3IA 4P0MA 2WGWA 3LUQA 4GKUA 4IUHA 3BFCA 5AVEA 2Y2KA 2Y2JA 2Y2QA 5FASA 4PHTA 3MR0A 4DN0A 2GZAA 1C3BA 4UA9A 5F69A 5EVLA 5HPFA 3HCYA 1OT6A 1VB6A 4U0TA 3FKWA 4K08A 1DP6A 3LGOA 1IKIA 5IHVA 3FYZA 3OPLA 3A0SA 1E4DA 2W1TA 3VV4A 4K0XA 1F9IA 3SH9A 4WELA 3SS3A 2HZ5A 5JYPA 5GLCA 5C5KA 1IYQA 3LR5A 3CUEC 5CTNA 1JVJA 3QP5A 5E2HA 4ZAMA 1PZOA 3LIAA 5JYOA 1PYYA 4MEZA 3QNBA 4GN2A 4B93A 2INWA 4ETZA 4E3OA 4KUKA 5CXWA 2ZC6B 4DF6A 1XGJA 2EFXA 1S1ZA 3N6IA 4NETA 3P98A 3IXHA 3ZYTA 4OVDA 3SH7A 4LCMA 5A90A 1DY6A 3NY4A 3V67A 2VX8A 5HAPA 2BTFP 3ZVTA 5EVID 1T1AA 3WS4A 1S66L 3A3DA 1L0FA 3B3XA 4MBHA 3IXDA 1M6KA 3DTIA 2ZQCA 5GLDA 3ZG9B 1S4SA 3UN7A 3S4XA 1EROA 1DJAA 1O7EA 1ES3A 2W1RA 3HUOA 4Y15A 1ACFA 3CITA 3HREA 3WWXA 4ARZA 5DTKA 4HBUA 2G2UA 4QU3A 3VP1A 4WMCD 2Z2MB 3DTMA 4A5RA 1YQSA 1BLSA 3KSGA 4FCFA 5J8XA 4WMCA 4YNRA 1K54A 1ESIA 5DKKA 3V3RA 3T4JA 4U0XA 1KOUA 2R78A 5DVAA 1Y4OA 1ES5A 3BYDA 1YLTA 3P7NA 2WKEA 1DP9A 1GSWA 1LLBA 2VK3A 4KZ9A 3EQUA 1S67L 2JKTI 2H10A 2XFSA 3IXGA 3HUMA 3MSHA 2W0NA 5FAPA 1BLHA 2EX9A 3C8CA 5L07A 2IWBA 5IS1A 4OPZA 1L3LA 1MZUA 2HGVA 4OPRA 1IKGA 4R6LA 4BMWA 4IVIA 4KZ5A 1J3WA 2IWDA 4B4XA 4DE2A 4K91A 4OLGA 5U47A 3M2JA 4KENB 3S1YA 4E6XA 2WGIA 3D3OA 4S2NA 2EXBA 2PYRA 1OT9A 3MZFA 1T1BA 1XGIA 1MBLA 1TDGA 4GD6A 3CPTB 3S7OA 1G6OA 1OTIA 2P9VB 1DRMA 4GHIA 2OSUA 4OQ0A 2D01A 1YKDA 3ZG7B 5FI6A 3QNCA 1NJ4A 2VGLM 3PBSA 3RXXA 3U2AA 4MBFA 3GVBA 2ZOIA 3Q07A 1E25A 2PR5A 3LIDA 3N7WA 1K0KA 2PBYA 1RP5A 3IF6C 1UGUA 3C30A 3VOYA 3KSHA 3IF5A 3LY3A 1HD8A 4FH2A 4KG2A 4FH4A 2P74A 2FH5A 4GDNA 2ZC3B 3OPRA 4UA6A 4E3KA 1E3UD 4GLQA 3G2YA 4R23A 2JC7A 4EUZA 2OWJA 3Q1FA 3LICA 5CTMA 3EEHA 4C6YA 1TF1A 1MWUA 4LV1A 2FFFB 3A3FA 1P9RA 1FCNA 1MY8A 2VGJA 3T4SA 2HPBA 3BLSA 4IBRA 3UDXA 1PWGA 4JF4A 4JGQA 3TRCA 2OAP1 1T19A 1YLPA 4HESA 1XJ3A 1NRFA 1YPRA 1OTAA 4LGWA 3MXSA 2L0WA 3CHWP 4WZ5A 1NZUA 3FKVA 4UAAA 3ZQ5A 1CEGA 2QJ5A 3CPTA 4JXSA 5CX7A 4ETXA 3LR4A 3N8SA 4GCZA 2J7VA 2B02A 3IWOA 1Z6FA 3F1PA 4RQ9A 5IU1A 1N9NA 2XA7M 3UMEA 1X0OA 2Y2PA 3QP8A 2HDUA 2PD7A 4PM9A 2J3TC 1HVBA 4LCLA 3TJZC 4DJ3A 4S2JA 4EESA 2W3FA 4UEYA 2VGKA 4DKIA 4KG6A 4UA7A 3NIAA 3UY6A 3Q7VA 2XSSA 3KX0X 4GZBA 5L8MA 4CLCE 3AGDA 3NJAA 1PWDA 2O9CA 5GLAA 4X53A 3LIFA 2WUQA 5M1AA 1BLPA 1LL8A 4EQIA 1TS0A 3KYEA 1XA1A 5J3WA 3CZDA 3GRJA 5E2FA 1T18A 1EI5A 2PU4A 3BJNA 5CEBA 2PHYA 4KG5A 3S7PA 5KMWA 3LEZA 1G28A 1N9LA 2EWWA 5M18A 3B42A 4PMAA 4BBVA 4D2OA 4BD0A 4KZBA 1IYPA 1S4RA 4MBKA 5HD3A 1XFNA 1UWPX 1HTZA 1LT0A 2OLVA 1ZHHB 5DF8A 3HLBA 4K0WA 2ZC7A 4JGPA 4I38A 4DRTA 2ZQ8A 3JYIA 4OOYA 5TJJA 2G7UA 1K6RA 4GW9A 3TE8A 2WAFA 4GD8A 2ZMAA 4ZBEA 2WYXA 1EWZA 3OBFA 1LSWA 2XLNA 1W63M 1LSVA 1CF0A 3SS4A 1MPLA 2BASA 1N9BA 5HARA 1BZAA 1ZKJA 5FEFA 1V9YA 3IX8A 4MN6A 4XUXA 2WGWB 1CK3A 1K4FA 1D1JA 3LFVA 4B9OA 1NLYA 5CECA 2WZZA 4RX2A 4RX3A 4Y0TA 4C3QA 5EVIC 5HDSA 1V9ZA 3UE6A 1NZOA 1KE4A 3O3VA 5FDSA 4P6BA 5AJGA 4YWZA 4GB7A 2ZC5B 2PT7A 2DCFA 2JKTM 2ZM2A 2B18A 5EPHA 1K57C 2HF6A 1D06A 3O88A 4LFUA 3BQ8A 2XQZA 1W8YA 1K4EA 3Q7ZA 1I2SA 2DNSA 2XH9A 5HAQA 4HP9A 2RL3A 1KDSA 1PZPA 4S2NC 3CUEA 1NY0A 2WKPA 2NUPC 3ULFA 5CRFA 2XRNA 2A24B 4LRXC 3WS5A 3UPOA 1XPBA 2HDSA 3OCLA 3T12B 1MWRA 5DTSA 3IWQA 2Y2IA 3KSIA 3T4OA 1ZTUA 4O7DA 4NK3A 1YLJA 5TR7A 3GSGA 1ONHA 5EM0A 2E8JA 3SW1A 5A8BA 4UQIM 1YSQA 5D3OA 2ZOHA 2W27A 5GHZA 1JNUA 4I3AA 5HX9A 1XXMA 2ZLYA 5HWTA 1ONGA 3FWLA 1Y54A 1XA7A 1LI0A 2W3HA 3PHYA 2ZC4B 4NXFA 4IHQA 5EV0A 5CHUA 1SKOA 3EWKA 5HWVA 1FCMA 4OP5A 1GA9A 1YAXA 2KDKA 1F5MA 4DE1A 2O9AA 4LV0A 4E3JA 2V1AA 1K56A 4BLMA 3DW0A 1BTLA 2QZ6A 3VOZA 3W2ZA 3VE4A 3K3CA 3GR2A 3IBRA 4R4RA 4PM7A 3E98A 3RTYA 1TS6A 1W63Q 2WAEA 4P85A 1ERMA 2LB5A 3NCKA 1KGGA 1BULA 2PR6A 1MKMA 3H82B 1L0EA 3HJIA 1TS8A 1TVFA 4PPRA 4EBNA 1FSYA 1YLWA 3IH9A 1IYSA 3G4PA 3PR6A 4NXEA 4X1LA 4Z9QA 5KSHA 3BFFA 4Z1WA 5DJTA 3S22A 3E2LA 1GHMA 3OZHA 1GCEA 1GSXA 1L0DA 1SDNA 2Y4AA 2B5RA 2UWXA 1WA9A 3BFEA 4HEFA 3CMZA 2WGVA 5AVFA 1U60A 3Q81A 3MKEA 1K25A 1VM1A 2V8CA 5EOOA 4Q8IA 4EV4A 2EA9A 3A0VA 5FQJA 1LL5A 3R7WA 3OOVA 2W3EA 1WYBA 1YMSA 3VFHA 4I3IA 4OOLA 2ZQ9A 3V50A 2A24A 2Y55A 4S2OA 2PRFA 2M7UA 3MQ0A 3ZNYA 5F68A 1A0KA 3HLGA 3ZG8B 4EERA 4ARZB 5MC7A 1ESUA 4WUJA 3UPNA 4BD1A 4KQQA 4HI4A 4M3KA 4QWOA 3SOIA 1AXBA 3E2KA 2QHKA 1LSXA 1GHPA 3S7NA 4F94A 3ZCZA 4N1XA 4X56A 4BL2A 3OPPA 1JWVA 4GJ4A 3RFBA 3EGDC 5FQMA 2V9AA 5IT5A 1Q2QA 2EWVA 2K2NA 1MWSA 3K2NA 2ZJ9A 1IFQA 3O87A 3C4PA 1YLYA 1ODVA 3OC2A 1K38A 5EOEA 2QPNA 3DTKA 2JCHA 3D4FA 5KIZA 3C7UA 3UNWA 3VP4A 3IS2A 3LEQA 3CG5A 2GDNA 4R1GA 1JTDA 3QP2A 5DF7A 2O99A 1W8QA 4R3BA 2ZD8A 1XP4A 4JBFA 2V0UA 2JKGA 1W79A 4KQDA 4L0LA 3NHQA 4AFIA 3MS6A 2Y91A 3Q82A 1OMEA 4Y0UA 2XDMA 5DKLA 4DJ2A 4B88A 3N8LA 5E2GA 2KOIA 1YMXA 1DJCA 1BUEA 4G3VA 4HOIA 3RXWA 2PU2A 3PTEA 4PM6A 1VQQA 1PIOA 4KZ8A 1DJBA 4MCWA 1N4OA 2CC1A 1P97A 5CGWA 2K7SA 3OPHA 1L0GA 3GMWA 4N9KA 2V2FF 2O0YA 5CGSA 1H8YA 2QWSA 1FCOA 3GQZA 2XD5A 3MFDA 3T1XA 3IF6B 4QY5A 2WADA 2PD8A 4LV2A 2P7JA 3NC8A 4R3AA 2ZQ7A 4HH3A 3VP0A 5EVIA 1WE4A 1YSPA 3W4QA 1VETB 3T1SA 4E3MA 4DXCA 2Y2HA 4Y2FA 4DE0A 1SCWA 4P6ZM 3IS2B 2H0TA 5F5YA 4R38A 3NOUC 3MXRA 4M4XA 4RA7A 4RYEA 5G4ZA 3M6HA 1SDEA 3BEBA 2ZL1A 2A2LA 1STZA 3IHBA 2V1ZA 4JF5A 3FC7A 2VA0A 2UV0E 2GX5A 3PAGA 2OLUA 1Q2PA 4EEPA 3CAXA 3WS0A 4CPKA 4IEDA 2HP6A 4JPMA 4MMNA 2XGNA 1SHVA 5I5LA 1LI9A 2EXAA 3WS1A 2XA7S 4QHCA 4Q0JA 4NXGA 1G6AA 2C6WB 4X25A 2XROA 5GHYA 4R0QA 2H5SA 3JVVA 3KO6A 4XT2A 4ME4A 3BWLA 4EW7A 2ZMFA 5HL1A 3R4KA 5CEDA 5HDCA 2P9VA 3RH8B 3C38A 4HJ4A 4MN7A 4HBTA 5FI2A 2HP9A 1CEFA 4PAUA 3HLFA 2M1CA 4H6JB 2CMNA 4G3WA 3LR0A 2X02A 1TDLA 4Y5FA 5AQ9A 3F1PB 1ERQA 5HSQA 3VP2A 3HL9A 5M19A 3IT9A 1BYWA 2ZBBA 2JKRI 3H7WB 5F1FA 2NUTC 3C7VA 3A0RA 2WZXA 1MXOA 4WEJA 4XT2B 3NOPC 1TS7A 2B95A 1OJ5A 3F1NB 1F98A 5EVEA 4NG2A 1VEUB 3HVFA 2V1BA 3MZEA 1KVMA 3SH8A 5G18A 3ZG0A 5A92A 5HZHA 3WS2A 3AGFA 4QJGA 5GL9A 4GNUA 3LCEA 3EQVA 3ITBA 3D72A 3KYZA 3T4QA 4S2LA 5TBMA 4PKYA 4O01A 5F82A 4OP8A 5HDDA 1SKOB 5DJUA 1OPXA 3G34A 4ID4A 3G30A 4MN5A 3G6OA 3T50A 4GS9A 3FPVA 3LYXA 1BLCA 4HIAA 3BFGA 3DBAA 1VETA 3HLDA 3UDFA 5EVIB 4S2MA 3VOLA 4EEUA 5HFOA 2QMIA 3IF6A 5CGXA 4BL3A 3PXPA 1P9WA 4N9LA 3C4OA 4HQAA 4Y0OA 2AVXA 2J8YA 1QMFA 3M2KA 4JXGA 4BBTA 4C75A 1RGZA 3O86A 2Y2NA 4KZ7A 4BBUA 3QHYA 3G2ZA 3B33A 4PKYG 2ZL1B 1MKIA 4KZ4A 3EGXC 1KE0A 2JKRM 2XF3A 2XR0A 4BWIA 5KSCA 2J9OA 2DMWA 1CI9A 5FL3A 1PFLA 4L9EA 4DE3A 4OQHA 4WL9A 2ACGA 5J4EA 2ZM8A 1L2SA 2VGLS 1ES2A 1H3QA 4Y17A 3KSFA 4ZJ3A 3BW6A 5F6AA 3ZGAB 1PRQA 2E8IA 2Q9NA 3K3DA 1IEMA 2VZWA 1PNEA 2WK0A 4Y13A 2FZ0A 1VHMA 1Y28A 3MKFA 3BQAA 3LI9A 3MQOA 4DDSA 4EQ1A 2QJ7A 1I2WA 2J9PA 3LO7A 1MC0A 4UHUA 3MJQA 1O07A 3HLEA 1CJFA 4QY6A 2EX6A 2Y8HA 4WZ5C 4GOGA 1D7EA 3VSLA 1PWCA 1ZC2A 3IQAA 2R9WA 1T1CA 3MXQA 4EU0A 1HLUP 4D60A 4HY8A 2HP5A 2VLGA 1ZG4A 4OONA 3V5MA 5G4YA 2W1TB 1FOFA 4EUVA 3A3EA 3GDIA 4XXRA 4OLDA 4B4ZA 4MLLA 4OOMA 5GHXA 4HJ6A 3IH8A 2VV7A 3WRZA 1JWZA 3IXBA 3QP4A 5HAIA 2A49A 3Q7VB 5FQ9A 4L9GA 3F1OA 2X01A 3FV7A 1ES4A 5HPIA 1CQAA 4CQHA 3GV9A 2C5WB 4N1HA 4WLAA 3V3SA 3ZG5A 1ALQA 3S7QA 4S2KA 1KGEA 2XD1A 2VV8A 4L9FA 1H0MA 3G32A 1P0ZA 4I5SA 3N8RA 1PI5A 2V20A 4Q0IA 2I72A 3IWIA 3C5AA 5FAQA 1G5UA 5A91A 3WRTA 5LBRA 2WKQA 5CHMA 3L7HA 4KUOA 1WYCA 3C2WA 4G3KA 1ZG6A 5BOHA 2HJ9C 1VEUA 2JKFA 2PYPA 3F1NA 5EM1A 2XK1A 3ZNTA 2R9XA 3SZTA 4BQMA 2ZQAA 4X6TA 3ISGA 1IYOA 2XFTA 1FSWA 3VSKA 3BRMA 3I7JA 2K31A 4GS9B 3HJKA 4FUWA 4I39A 2M7VA 5L2FA 3HLCA 1GSVA 1XJ2A 4XUZA 4S2PA 4IVKA 2VV6A 5CHJA 4CLCD 4KZ3A 4WBGA 4F3LA 5E2EA 2Y79A 1RCJA 4YINA 1Z09A 4I3JA 4ZRRA 1SZVA 5EE8A 1OJGA 4KQOA 3FZCA 4KQRA 1SKFA 1M40A 4RVAA 2Q0OA 4WEKA 3PAEA 4UQIS 3LIEA 3IX3A 2OOLA 3BECA 4FTXA 5L10A 4JXWA 1K57A 3ITAA 3TW8A 3T4LA 3ICYA 4NKPA 1FIKA 5F1GA 2ZM0A 1UWNX 2V8FA
chains in the Genus database with same CATH topology
2GZAA 5F69A 3PBRA 5HPFA 3HCYA 5I5LA 3LFVA 3VE3A 1OT6A 1VB6A 4B9OA 1NLYA 4FOFA 4K08A 5HDSA 1V9ZA 2XA7S 1DP6A 3T4KA 4Q0JA 4H6JA 4NXGA 3UE6A 2XROA 3A0SA 3VV4A 2W1TA 4JGRA 1F9IA 4WELA 3JVVA 3KO6A 5AJGA 4XT2A 4YWZA 3FPWA 4ME4A 4BJPA 3BWLA 5C5KA 4EW7A 2ZMFA 3LR5A 3R4KA 5HDCA 3CUEC 2PT7A 2QKPA 2O9BA 2JKTM 3RH8B 4JGOA 2B18A 2PDRA 3C38A 3LIAA 4HJ4A 4MN7A 2HF6A 1D06A 4CLCB 3BQ8A 4PAUA 4B93A 2INWA 2M1CA 4ETZA 4H6JB 2CMNA 4KUKA 4G3WA 3LR0A 4E04A 4GHIB 3PBNA 3UE3A 4Y5FA 1S1ZA 2JN7A 3F1PB 4HP9A 4O8GA 3EEAA 3UB9A 5HSQA 3ZYTA 1N9OA 2OAQ1 3ULFA 3CUEA 2WKPA 2NUPC 4EETB 2XRNA 2A24B 4LRXC 3V67A 1BYWA 2ZBBA 2JKRI 2VX8A 3H7WB 2NUTC 3A0RA 4FSFA 4WEJA 3OCLA 1T1AA 3PBOA 1S66L 1XJ4A 4O0PA 4XT2B 3KSIA 3T4OA 3NOPC 1TS7A 1ZTUA 1S4SA 3PBQA 1OJ5A 2Z6DA 3F1NB 1F98A 2W1RA 2V1BA 3E0YA 3F1OB 3SW1A 3CITA 5A8BA 4UQIM 4ARZA 1YSQA 2ZOHA 2W27A 4IUKA 2HJEA 5HZHA 1JNUA 2D02A 4I3AA 1DP8A 2OWHA 2W3GA 3GECA 5HWTA 3KSGA 2L4RA 3EQVA 3D72A 4YNRA 4HJ3A 3H9WA 3KYZA 3T4QA 4NEED 5TBMA 2W3HA 4PKYA 4O01A 3PHYA 5DKKA 3T4JA 4NXFA 4IHQA 1KOUA 2R78A 2HV1A 5HDDA 1TD5A 3P7NA 3OCNA 3EWKA 5DJUA 5HWVA 1OPXA 1DP9A 1YAXA 2KDKA 1GSWA 2GNXA 1F5MA 4CLCC 4MN5A 2O9AA 3EQUA 3G6OA 3T50A 4WF0A 2V1AA 4GS9A 3PBTA 1S67L 3FPVA 3LYXA 2JKTI 3W2ZA 1NRJA 3VE4A 4HIAA 2W0NA 3DBAA 3K3CA 3IBRA 3C8CA 3PYPA 5IS1A 3E98A 4HP4A 3RTYA 1TS6A 3VOLA 1W63Q 1MZUA 4EEUA 2HGVA 2LB5A 4R6LA 4BMWA 2PR6A 1OTBA 1MKMA 3H82B 3PXPA 1P9WA 3HJIA 4EXOA 1TS8A 2W3DA 3LR3A 4HQAA 4P6ZS 4BBTA 3FG8A 3PR6A 4NXEA 5HWWA 5KSHA 3D3OA 3NOTC 4Z1WA 5DJTA 2PYRA 5HD5A 1OT9A 4BBUA 1T1BA 2VJWA 1GSXA 2YKFA 3B33A 4PKYG 3EGXC 4IJGA 2JKRM 3UMDA 2IA2A 1WA9A 3S7OA 4BWIA 1G6OA 1OTIA 1DRMA 5AVFA 2DMWA 3BY8A 5FL3A 4GHIA 4L9EA 4WL9A 5J4EA 3O5YA 3UB7A 3E4QA 4HHDA 2EA9A 3A0VA 2D01A 1YKDA 2VGLS 1H3QA 3R7WB 3KSFA 3R7WA 3BW6A 3OOVA 5F6AA 2J80A 2VGLM 2W3EA 3K3DA 3PBSA 3U2AA 2VZWA 2ZOIA 2PR5A 2FZ0A 1VHMA 3LIDA 1Y28A 2Z6CA 4I3IA 3B47A 4OOLA 1H8MA 3BQAA 3LI9A 3MQOA 4EQ1A 3CI6A 1UGUA 2QJ7A 3C30A 5DF9A 2A24A 3KSHA 2J3WA 3T4TA 2M7UA 3MQ0A 1MC0A 2FH5A 5F68A 2QYBA 1NLZA 3MJQA 1OTEA 4EERA 5K5BA 4ARZB 5MC7A 4WUJA 4GLQA 4HI4A 2Y8HA 2OWJA 3LICA 4CLCA 2QHKA 1D7EA 1LSXA 3EEHA 1T1CA 1TF1A 3S7NA 2I9VA 3MXQA 3MQQA 4EU0A 1P9RA 4HY8A 3T4SA 4GJ4A 2VLGA 5TBMB 3RFBA 3EGDC 4WN5A 2V9AA 4MDZA 5IT5A 2EWVA 3E4PA 2K2NA 4JGQA 5G4YA 2W1TB 3K2NA 3TRCA 1IFQA 4EUVA 2OAP1 3GDIA 1T19A 4YOFA 3P01A 1ODVA 3KYQA 1XJ3A 3OC2A 1OTAA 2P08A 4OOMA 4HJ6A 2GJ3A 2ZMVA 3CLOA 2VV7A 2L0WA 5KIZA 4HH2A 3EOIA 3IS2A 4L9GA 3F1OA 3ZQ5A 2J3TD 2QJ5A 2L1MA 5CX7A 5HPIA 4CQHA 4ETXA 2O99A 4R70A 3LR4A 4GCZA 4WLAA 2B02A 2V0UA 3F1PA 4LRZE 3S7QA 4KQDA 2WKRA 4RQ9A 5IU1A 4L0LA 1N9NA 2XA7M 2VV8A 3UMEA 4L9FA 2YKHA 3NHQA 4AFIA 1X0OA 5DFXA 2H28A 3MFXA 4NXBA 2LB9A 1P0ZA 2PD7A 5EFWA 5DFYA 3H7WA 4I5SA 2JHEA 3JVUA 2J3TC 4Q0IA 5J7EA 3CWFA 4QPRA 5DKLA 3H82A 4DJ2A 2VKSA 1IOUA 3TJZC 5LBRA 2VEAA 2WKQA 2KOIA 4DJ3A 5HL6A 4EESA 2W3FA 4KUOA 3C2WA 4G3KA 4UEYA 2HJ9C 4G3VA 2PYPA 4HOIA 3F1NA 3LIBA 4Q0HA 3IBJA 4MN6A 2KX6A 3BY9A 1XFQA 2XSSA 3KX0X 4MCWA 3UB8A 5L8MA 4DMZA 4CLCE 2K31A 1P97A 3NJAA 2K7SA 2O9CA 4GS9B 3HJKA 4I39A 3LIFA 1NWZA 2M7VA 1EW0A 1LL8A 2O0YA 1TS0A 2QWSA 5J3WA 1GSVA 3UB6A 1T18A 1XJ2A 3BJNA 2PD8A 2PHYA 1XJ6A 4HNBA 3MF0A 2P7JA 4R3AA 3S7PA 1G28A 1N9LA 2VV6A 4CLCD 2P04A 2EWWA 4HH3A 4F3LA 2Y79A 1YSPA 3B42A 3MMHA 4I3JA 4ZRRA 1S1YA 3E4OA 2MJ6A 4Y2FA 4BBVA 4LPZA 1OJGA 4KQOA 4LRYC 4P6ZM 1S4RA 3IS2B 4LLOB 5F5YA 5HD3A 1XFNA 1UWPX 2KLIA 4R38A 3OLOA 1LT0A 3NOUC 1ZHHB 4M4XA 2V0WA 5G4ZA 1OTDA 4WEKA 4JGPA 4I38A 2A2LA 4UQIS 1STZA 3LIEA 2OOLA 5TJJA 2G7UA 3FC7A 4GW9A 2VA0A 3TE8A 4F3LB 4II7A 3LI8A 2GX5A 4Y3IA 3OBFA 1LSWA 1W63M 1LSVA 3LUQA 4IUHA 3TW8A 5AVEA 3T4LA 3ICYA 2BASA 4EEPA 4NKPA 3CAXA 1V9YA 1UWNX 4PHTA 3MR0A 4DN0A 4MMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZW A;  4YNR A;  5LBR A;  5HPF A;  3HCY A;  1VHM A;  2VEA A;  2KOI A;  5I5L A;  3LFV A;  5HL6 A;  2W3H A;  4O01 A;  2W3F A;  3C2W A;  4FOF A;  4G3K A;  3CI6 A;  4G3V A;  3KSH A;  4Q0J A;  2M7U A;  1TD5 A;  2XRO A;  4Q0H A;  3IBJ A;  3MQ0 A;  3VV4 A;  2W1T A;  1MC0 A;  2QYB A;  3KO6 A;  5AJG A;  2XSS A;  4ME4 A;  4MCW A;  5K5B A;  1F5M A;  5C5K A;  5L8M A;  2ZMF A;  4DMZ A;  3R4K A;  2O9A A;  2K31 A;  3G6O A;  2O9C A;  4GLQ A;  2O9B A;  2M7V A;  2B18 A;  3W2Z A;  2Y8H A;  4MN7 A;  2O0Y A;  3DBA A;  3IBR A;  4PAU A;  3BJN A;  1TF1 A;  3S7N A;  4ETZ A;  3E98 A;  4EU0 A;  3MF0 A;  4G3W A;  3S7P A;  2HGV A;  4E04 A;  2LB5 A;  4R6L A;  4Y5F A;  3RFB A;  4MDZ A;  1MKM A;  2Y79 A;  1YSP A;  2K2N A;  4O8G A;  3EEA A;  3MMH A;  2W1T B;  3K2N A;  3TRC A;  4EUV A;  5HSQ A;  4ZRR A;  2W3D A;  4Y2F A;  4YOF A;  2XRN A;  4LRX C;  4LRY C;  2KLI A;  3D3O A;  3NOT C;  4Z1W A;  3NOU C;  4O0P A;  2VJW A;  3KSI A;  3ZQ5 A;  3NOP C;  1ZTU A;  4IJG A;  5HPI A;  1STZ A;  4CQH A;  4ETX A;  2O99 A;  2OOL A;  4R70 A;  5TJJ A;  2IA2 A;  2G7U A;  3S7O A;  4BWI A;  2W1R A;  4GW9 A;  3E0Y A;  4LRZ E;  3S7Q A;  3CIT A;  4RQ9 A;  2GX5 A;  4Y3I A;  1YSQ A;  3OBF A;  3O5Y A;  4IUK A;  4IUH A;  3NHQ A;  5DFX A;  2LB9 A;  5DFY A;  1YKD A;  2W3G A;  3KSF A;  3OOV A;  3KSG A;  4Q0I A;  2W3E A;  4QPR A;  4DN0 A;  4MMN A;  2VKS A; 
#chains in the Genus database with same CATH topology
 3PBR A;  1AWI A;  4BEN A;  3VE3 A;  3ZFZ A;  2RCX A;  2EX2 A;  4FOF A;  4X68 A;  3UO9 A;  3T4K A;  4H6J A;  1W7F A;  4X1M A;  4KZ6 A;  3QP6 A;  3G35 A;  4JGR A;  4P87 A;  4FD8 A;  1NYM A;  3FPW A;  4BJP A;  2DRW A;  2JE5 A;  1F2K A;  4YFM A;  2QKP A;  2O9B A;  4JGO A;  2PDR A;  5F83 A;  1QME A;  4JF6 A;  4CLC B;  3N4I A;  4OKP A;  3ZHH A;  1FIL A;  4E04 A;  4GHI B;  3PBN A;  5FI7 A;  3UE3 A;  4PM5 A;  4LV3 A;  2JN7 A;  1S6R A;  2OV5 A;  4O8G A;  3EEA A;  3W4P A;  3UB9 A;  4H8R A;  1N9O A;  2OAQ 1;  4ESP A;  4EET B;  4FSF A;  3PBO A;  1XJ4 A;  1LHY A;  4O0P A;  5AQ7 A;  1LL9 A;  2PAV P;  3PBQ A;  3MZD A;  2Z6D A;  1K6S A;  5FEG A;  4ZJ1 A;  1MWT A;  4E3L A;  3E0Y A;  4CJN A;  3F1O B;  3T1Q B;  4E3N A;  1NXY A;  4IUK A;  4WZ4 A;  2HJE A;  2D02 A;  3UB5 P;  3GTC A;  1DP8 A;  4MNR A;  2OWH A;  2W3G A;  3GEC A;  1JWP A;  4N92 A;  2L4R A;  5FSR A;  3TSG A;  1HZO A;  4HJ3 A;  3H9W A;  1JTG A;  3HLW A;  3NBL A;  4NEE D;  3VFF A;  2PBD P;  2BLS A;  5E43 A;  3ZDJ A;  3NEC A;  2HV1 A;  2JBF A;  1TD5 A;  3OCN A;  1GHI A;  1KVL A;  5FA7 A;  2GNX A;  1PI4 A;  4CLC C;  4WF0 A;  3PBT A;  3RJU A;  4OQG A;  4X69 A;  5CER A;  1NRJ A;  4EBP A;  2HDR A;  1K54 C;  3PYP A;  4HP4 A;  1YLZ A;  1BSG A;  3NDG A;  3TG9 A;  5TGF A;  1OTB A;  3ZVW A;  4EXO A;  2W3D A;  1RGY A;  3LR3 A;  5A93 A;  4P6Z S;  4R3J A;  1S0W A;  2H0Y A;  5FQK A;  3FG8 A;  3HUN A;  1PW1 A;  5HWW A;  3DWK A;  3NOT C;  5HD5 A;  2VJW A;  1G68 A;  2YKF A;  5FAT A;  4IJG A;  1GA0 A;  3UMD A;  4X55 A;  2IA2 A;  3BY8 A;  2Z2L B;  3DAV A;  3VP3 A;  3O5Y A;  4WM9 A;  3UB7 A;  3E4Q A;  3G31 A;  4HHD A;  4JXV A;  3R7W B;  2J80 A;  1H5X A;  1XKZ A;  2EFU A;  3A3J A;  3UE0 A;  2Z6C A;  3QP1 A;  4QB8 A;  3V39 A;  1YT4 A;  3B47 A;  1H8M A;  3CI6 A;  4ZJ2 A;  5DF9 A;  2J3W A;  3D9Y A;  3TOI A;  3T4T A;  3DTE A;  4E6W A;  5EEC A;  3UDI A;  2QYB A;  1FR1 A;  1NLZ A;  4QD4 A;  1OTE A;  5K5B A;  4JLF A;  5I94 A;  5L09 A;  2EX8 A;  2X71 A;  3UE1 A;  1I5Q A;  4CLC A;  1E3U A;  3BFD A;  1K56 D;  2I9V A;  3MQQ A;  5FQQ A;  3T1R A;  2WKH A;  5TBM B;  5FAO A;  4WN5 A;  5EUA A;  4MDZ A;  3UPP A;  3E4P A;  2WKI A;  3DWZ A;  1PW8 A;  5HW3 A;  4YOF A;  2HDQ A;  3P01 A;  3KYQ A;  2P08 A;  3W4O A;  2GJ3 A;  2ZMV A;  3CLO A;  4KZA A;  2Y2M A;  4OPY A;  4HH2 A;  5GLB A;  1KE3 A;  3EOI A;  3BLM A;  4JKT A;  2J3T D;  2L1M A;  1FQG A;  4ZTK A;  4WYY A;  4R70 A;  4ZDX A;  1H8Z A;  2ZQD A;  3SS5 A;  4LRZ E;  4OPQ A;  4R4S A;  2WKR A;  2YKH A;  5DFX A;  2H28 A;  3MFX A;  3P09 A;  4U3T A;  1TEM A;  4NXB A;  2LB9 A;  5EFW A;  2FFY A;  5DFY A;  3H7W A;  4LEN A;  1YM1 A;  2JHE A;  2Y2G A;  3JVU A;  5J7E A;  3CWF A;  4QPR A;  3H82 A;  1IOU A;  2VKS A;  1BT5 A;  4EBL A;  4DDY A;  3NUL A;  3CJM A;  2VEA A;  3U4L P;  2BG1 A;  2XEP A;  5HL6 A;  3VMA A;  1NYY A;  3IHA A;  3IX4 A;  3LIB A;  4Q0H A;  3IBJ A;  2KX6 A;  3BY9 A;  1XFQ A;  3UB8 A;  4DMZ A;  2IWC A;  2Y59 A;  3M6B A;  1NWZ A;  1W5D A;  1EW0 A;  3NI9 A;  1FR6 A;  3W8K A;  3L9K A;  1KDW A;  4E3I A;  3UB6 A;  4OQI A;  5AQA A;  5AQB A;  3HBR A;  4HNB A;  1XJ6 A;  5FDH A;  1IEL A;  3MF0 A;  1K55 C;  5KZH A;  2P04 A;  2Y2O A;  4EWF A;  5DTT A;  3A3I A;  3JPU A;  3MMH A;  3NDE A;  4DXB A;  3BM6 A;  2G2W A;  4GDB A;  4OH0 A;  1S1Y A;  3E4O A;  2MJ6 A;  1J9M A;  4Y7P A;  1CI8 A;  4LPZ A;  1XX2 A;  4LRY C;  4LLO B;  2KLI A;  3MBZ A;  3OLO A;  3LY4 A;  2A3U A;  2V0W A;  1OTD A;  3AGE A;  5FQI A;  4PM8 A;  2Y2L A;  4S2I A;  1K55 A;  5TFQ A;  2Q9M A;  1KGF A;  4F3L B;  4II7 A;  3LI8 A;  4IBX A;  4Y3I A;  4P0M A;  2WGW A;  3LUQ A;  4GKU A;  4IUH A;  3BFC A;  5AVE A;  2Y2K A;  2Y2J A;  2Y2Q A;  5FAS A;  4PHT A;  3MR0 A;  4DN0 A;  2GZA A;  1C3B A;  4UA9 A;  5F69 A;  5EVL A;  5HPF A;  3HCY A;  1OT6 A;  1VB6 A;  4U0T A;  3FKW A;  4K08 A;  1DP6 A;  3LGO A;  1IKI A;  5IHV A;  3FYZ A;  3OPL A;  3A0S A;  1E4D A;  2W1T A;  3VV4 A;  4K0X A;  1F9I A;  3SH9 A;  4WEL A;  3SS3 A;  2HZ5 A;  5JYP A;  5GLC A;  5C5K A;  1IYQ A;  3LR5 A;  3CUE C;  5CTN A;  1JVJ A;  3QP5 A;  5E2H A;  4ZAM A;  1PZO A;  3LIA A;  5JYO A;  1PYY A;  4MEZ A;  3QNB A;  4GN2 A;  4B93 A;  2INW A;  4ETZ A;  4E3O A;  4KUK A;  5CXW A;  2ZC6 B;  4DF6 A;  1XGJ A;  2EFX A;  1S1Z A;  3N6I A;  4NET A;  3P98 A;  3IXH A;  3ZYT A;  4OVD A;  3SH7 A;  4LCM A;  5A90 A;  1DY6 A;  3NY4 A;  3V67 A;  2VX8 A;  5HAP A;  2BTF P;  3ZVT A;  5EVI D;  1T1A A;  3WS4 A;  1S66 L;  3A3D A;  1L0F A;  3B3X A;  4MBH A;  3IXD A;  1M6K A;  3DTI A;  2ZQC A;  5GLD A;  3ZG9 B;  1S4S A;  3UN7 A;  3S4X A;  1ERO A;  1DJA A;  1O7E A;  1ES3 A;  2W1R A;  3HUO A;  4Y15 A;  1ACF A;  3CIT A;  3HRE A;  3WWX A;  4ARZ A;  5DTK A;  4HBU A;  2G2U A;  4QU3 A;  3VP1 A;  4WMC D;  2Z2M B;  3DTM A;  4A5R A;  1YQS A;  1BLS A;  3KSG A;  4FCF A;  5J8X A;  4WMC A;  4YNR A;  1K54 A;  1ESI A;  5DKK A;  3V3R A;  3T4J A;  4U0X A;  1KOU A;  2R78 A;  5DVA A;  1Y4O A;  1ES5 A;  3BYD A;  1YLT A;  3P7N A;  2WKE A;  1DP9 A;  1GSW A;  1LLB A;  2VK3 A;  4KZ9 A;  3EQU A;  1S67 L;  2JKT I;  2H10 A;  2XFS A;  3IXG A;  3HUM A;  3MSH A;  2W0N A;  5FAP A;  1BLH A;  2EX9 A;  3C8C A;  5L07 A;  2IWB A;  5IS1 A;  4OPZ A;  1L3L A;  1MZU A;  2HGV A;  4OPR A;  1IKG A;  4R6L A;  4BMW A;  4IVI A;  4KZ5 A;  1J3W A;  2IWD A;  4B4X A;  4DE2 A;  4K91 A;  4OLG A;  5U47 A;  3M2J A;  4KEN B;  3S1Y A;  4E6X A;  2WGI A;  3D3O A;  4S2N A;  2EXB A;  2PYR A;  1OT9 A;  3MZF A;  1T1B A;  1XGI A;  1MBL A;  1TDG A;  4GD6 A;  3CPT B;  3S7O A;  1G6O A;  1OTI A;  2P9V B;  1DRM A;  4GHI A;  2OSU A;  4OQ0 A;  2D01 A;  1YKD A;  3ZG7 B;  5FI6 A;  3QNC A;  1NJ4 A;  2VGL M;  3PBS A;  3RXX A;  3U2A A;  4MBF A;  3GVB A;  2ZOI A;  3Q07 A;  1E25 A;  2PR5 A;  3LID A;  3N7W A;  1K0K A;  2PBY A;  1RP5 A;  3IF6 C;  1UGU A;  3C30 A;  3VOY A;  3KSH A;  3IF5 A;  3LY3 A;  1HD8 A;  4FH2 A;  4KG2 A;  4FH4 A;  2P74 A;  2FH5 A;  4GDN A;  2ZC3 B;  3OPR A;  4UA6 A;  4E3K A;  1E3U D;  4GLQ A;  3G2Y A;  4R23 A;  2JC7 A;  4EUZ A;  2OWJ A;  3Q1F A;  3LIC A;  5CTM A;  3EEH A;  4C6Y A;  1TF1 A;  1MWU A;  4LV1 A;  2FFF B;  3A3F A;  1P9R A;  1FCN A;  1MY8 A;  2VGJ A;  3T4S A;  2HPB A;  3BLS A;  4IBR A;  3UDX A;  1PWG A;  4JF4 A;  4JGQ A;  3TRC A;  2OAP 1;  1T19 A;  1YLP A;  4HES A;  1XJ3 A;  1NRF A;  1YPR A;  1OTA A;  4LGW A;  3MXS A;  2L0W A;  3CHW P;  4WZ5 A;  1NZU A;  3FKV A;  4UAA A;  3ZQ5 A;  1CEG A;  2QJ5 A;  3CPT A;  4JXS A;  5CX7 A;  4ETX A;  3LR4 A;  3N8S A;  4GCZ A;  2J7V A;  2B02 A;  3IWO A;  1Z6F A;  3F1P A;  4RQ9 A;  5IU1 A;  1N9N A;  2XA7 M;  3UME A;  1X0O A;  2Y2P A;  3QP8 A;  2HDU A;  2PD7 A;  4PM9 A;  2J3T C;  1HVB A;  4LCL A;  3TJZ C;  4DJ3 A;  4S2J A;  4EES A;  2W3F A;  4UEY A;  2VGK A;  4DKI A;  4KG6 A;  4UA7 A;  3NIA A;  3UY6 A;  3Q7V A;  2XSS A;  3KX0 X;  4GZB A;  5L8M A;  4CLC E;  3AGD A;  3NJA A;  1PWD A;  2O9C A;  5GLA A;  4X53 A;  3LIF A;  2WUQ A;  5M1A A;  1BLP A;  1LL8 A;  4EQI A;  1TS0 A;  3KYE A;  1XA1 A;  5J3W A;  3CZD A;  3GRJ A;  5E2F A;  1T18 A;  1EI5 A;  2PU4 A;  3BJN A;  5CEB A;  2PHY A;  4KG5 A;  3S7P A;  5KMW A;  3LEZ A;  1G28 A;  1N9L A;  2EWW A;  5M18 A;  3B42 A;  4PMA A;  4BBV A;  4D2O A;  4BD0 A;  4KZB A;  1IYP A;  1S4R A;  4MBK A;  5HD3 A;  1XFN A;  1UWP X;  1HTZ A;  1LT0 A;  2OLV A;  1ZHH B;  5DF8 A;  3HLB A;  4K0W A;  2ZC7 A;  4JGP A;  4I38 A;  4DRT A;  2ZQ8 A;  3JYI A;  4OOY A;  5TJJ A;  2G7U A;  1K6R A;  4GW9 A;  3TE8 A;  2WAF A;  4GD8 A;  2ZMA A;  4ZBE A;  2WYX A;  1EWZ A;  3OBF A;  1LSW A;  2XLN A;  1W63 M;  1LSV A;  1CF0 A;  3SS4 A;  1MPL A;  2BAS A;  1N9B A;  5HAR A;  1BZA A;  1ZKJ A;  5FEF A;  1V9Y A;  3IX8 A;  4MN6 A;  4XUX A;  2WGW B;  1CK3 A;  1K4F A;  1D1J A;  3LFV A;  4B9O A;  1NLY A;  5CEC A;  2WZZ A;  4RX2 A;  4RX3 A;  4Y0T A;  4C3Q A;  5EVI C;  5HDS A;  1V9Z A;  3UE6 A;  1NZO A;  1KE4 A;  3O3V A;  5FDS A;  4P6B A;  5AJG A;  4YWZ A;  4GB7 A;  2ZC5 B;  2PT7 A;  2DCF A;  2JKT M;  2ZM2 A;  2B18 A;  5EPH A;  1K57 C;  2HF6 A;  1D06 A;  3O88 A;  4LFU A;  3BQ8 A;  2XQZ A;  1W8Y A;  1K4E A;  3Q7Z A;  1I2S A;  2DNS A;  2XH9 A;  5HAQ A;  4HP9 A;  2RL3 A;  1KDS A;  1PZP A;  4S2N C;  3CUE A;  1NY0 A;  2WKP A;  2NUP C;  3ULF A;  5CRF A;  2XRN A;  2A24 B;  4LRX C;  3WS5 A;  3UPO A;  1XPB A;  2HDS A;  3OCL A;  3T12 B;  1MWR A;  5DTS A;  3IWQ A;  2Y2I A;  3KSI A;  3T4O A;  1ZTU A;  4O7D A;  4NK3 A;  1YLJ A;  5TR7 A;  3GSG A;  1ONH A;  5EM0 A;  2E8J A;  3SW1 A;  5A8B A;  4UQI M;  1YSQ A;  5D3O A;  2ZOH A;  2W27 A;  5GHZ A;  1JNU A;  4I3A A;  5HX9 A;  1XXM A;  2ZLY A;  5HWT A;  1ONG A;  3FWL A;  1Y54 A;  1XA7 A;  1LI0 A;  2W3H A;  3PHY A;  2ZC4 B;  4NXF A;  4IHQ A;  5EV0 A;  5CHU A;  1SKO A;  3EWK A;  5HWV A;  1FCM A;  4OP5 A;  1GA9 A;  1YAX A;  2KDK A;  1F5M A;  4DE1 A;  2O9A A;  4LV0 A;  4E3J A;  2V1A A;  1K56 A;  4BLM A;  3DW0 A;  1BTL A;  2QZ6 A;  3VOZ A;  3W2Z A;  3VE4 A;  3K3C A;  3GR2 A;  3IBR A;  4R4R A;  4PM7 A;  3E98 A;  3RTY A;  1TS6 A;  1W63 Q;  2WAE A;  4P85 A;  1ERM A;  2LB5 A;  3NCK A;  1KGG A;  1BUL A;  2PR6 A;  1MKM A;  3H82 B;  1L0E A;  3HJI A;  1TS8 A;  1TVF A;  4PPR A;  4EBN A;  1FSY A;  1YLW A;  3IH9 A;  1IYS A;  3G4P A;  3PR6 A;  4NXE A;  4X1L A;  4Z9Q A;  5KSH A;  3BFF A;  4Z1W A;  5DJT A;  3S22 A;  3E2L A;  1GHM A;  3OZH A;  1GCE A;  1GSX A;  1L0D A;  1SDN A;  2Y4A A;  2B5R A;  2UWX A;  1WA9 A;  3BFE A;  4HEF A;  3CMZ A;  2WGV A;  5AVF A;  1U60 A;  3Q81 A;  3MKE A;  1K25 A;  1VM1 A;  2V8C A;  5EOO A;  4Q8I A;  4EV4 A;  2EA9 A;  3A0V A;  5FQJ A;  1LL5 A;  3R7W A;  3OOV A;  2W3E A;  1WYB A;  1YMS A;  3VFH A;  4I3I A;  4OOL A;  2ZQ9 A;  3V50 A;  2A24 A;  2Y55 A;  4S2O A;  2PRF A;  2M7U A;  3MQ0 A;  3ZNY A;  5F68 A;  1A0K A;  3HLG A;  3ZG8 B;  4EER A;  4ARZ B;  5MC7 A;  1ESU A;  4WUJ A;  3UPN A;  4BD1 A;  4KQQ A;  4HI4 A;  4M3K A;  4QWO A;  3SOI A;  1AXB A;  3E2K A;  2QHK A;  1LSX A;  1GHP A;  3S7N A;  4F94 A;  3ZCZ A;  4N1X A;  4X56 A;  4BL2 A;  3OPP A;  1JWV A;  4GJ4 A;  3RFB A;  3EGD C;  5FQM A;  2V9A A;  5IT5 A;  1Q2Q A;  2EWV A;  2K2N A;  1MWS A;  3K2N A;  2ZJ9 A;  1IFQ A;  3O87 A;  3C4P A;  1YLY A;  1ODV A;  3OC2 A;  1K38 A;  5EOE A;  2QPN A;  3DTK A;  2JCH A;  3D4F A;  5KIZ A;  3C7U A;  3UNW A;  3VP4 A;  3IS2 A;  3LEQ A;  3CG5 A;  2GDN A;  4R1G A;  1JTD A;  3QP2 A;  5DF7 A;  2O99 A;  1W8Q A;  4R3B A;  2ZD8 A;  1XP4 A;  4JBF A;  2V0U A;  2JKG A;  1W79 A;  4KQD A;  4L0L A;  3NHQ A;  4AFI A;  3MS6 A;  2Y91 A;  3Q82 A;  1OME A;  4Y0U A;  2XDM A;  5DKL A;  4DJ2 A;  4B88 A;  3N8L A;  5E2G A;  2KOI A;  1YMX A;  1DJC A;  1BUE A;  4G3V A;  4HOI A;  3RXW A;  2PU2 A;  3PTE A;  4PM6 A;  1VQQ A;  1PIO A;  4KZ8 A;  1DJB A;  4MCW A;  1N4O A;  2CC1 A;  1P97 A;  5CGW A;  2K7S A;  3OPH A;  1L0G A;  3GMW A;  4N9K A;  2V2F F;  2O0Y A;  5CGS A;  1H8Y A;  2QWS A;  1FCO A;  3GQZ A;  2XD5 A;  3MFD A;  3T1X A;  3IF6 B;  4QY5 A;  2WAD A;  2PD8 A;  4LV2 A;  2P7J A;  3NC8 A;  4R3A A;  2ZQ7 A;  4HH3 A;  3VP0 A;  5EVI A;  1WE4 A;  1YSP A;  3W4Q A;  1VET B;  3T1S A;  4E3M A;  4DXC A;  2Y2H A;  4Y2F A;  4DE0 A;  1SCW A;  4P6Z M;  3IS2 B;  2H0T A;  5F5Y A;  4R38 A;  3NOU C;  3MXR A;  4M4X A;  4RA7 A;  4RYE A;  5G4Z A;  3M6H A;  1SDE A;  3BEB A;  2ZL1 A;  2A2L A;  1STZ A;  3IHB A;  2V1Z A;  4JF5 A;  3FC7 A;  2VA0 A;  2UV0 E;  2GX5 A;  3PAG A;  2OLU A;  1Q2P A;  4EEP A;  3CAX A;  3WS0 A;  4CPK A;  4IED A;  2HP6 A;  4JPM A;  4MMN A;  2XGN A;  1SHV A;  5I5L A;  1LI9 A;  2EXA A;  3WS1 A;  2XA7 S;  4QHC A;  4Q0J A;  4NXG A;  1G6A A;  2C6W B;  4X25 A;  2XRO A;  5GHY A;  4R0Q A;  2H5S A;  3JVV A;  3KO6 A;  4XT2 A;  4ME4 A;  3BWL A;  4EW7 A;  2ZMF A;  5HL1 A;  3R4K A;  5CED A;  5HDC A;  2P9V A;  3RH8 B;  3C38 A;  4HJ4 A;  4MN7 A;  4HBT A;  5FI2 A;  2HP9 A;  1CEF A;  4PAU A;  3HLF A;  2M1C A;  4H6J B;  2CMN A;  4G3W A;  3LR0 A;  2X02 A;  1TDL A;  4Y5F A;  5AQ9 A;  3F1P B;  1ERQ A;  5HSQ A;  3VP2 A;  3HL9 A;  5M19 A;  3IT9 A;  1BYW A;  2ZBB A;  2JKR I;  3H7W B;  5F1F A;  2NUT C;  3C7V A;  3A0R A;  2WZX A;  1MXO A;  4WEJ A;  4XT2 B;  3NOP C;  1TS7 A;  2B95 A;  1OJ5 A;  3F1N B;  1F98 A;  5EVE A;  4NG2 A;  1VEU B;  3HVF A;  2V1B A;  3MZE A;  1KVM A;  3SH8 A;  5G18 A;  3ZG0 A;  5A92 A;  5HZH A;  3WS2 A;  3AGF A;  4QJG A;  5GL9 A;  4GNU A;  3LCE A;  3EQV A;  3ITB A;  3D72 A;  3KYZ A;  3T4Q A;  4S2L A;  5TBM A;  4PKY A;  4O01 A;  5F82 A;  4OP8 A;  5HDD A;  1SKO B;  5DJU A;  1OPX A;  3G34 A;  4ID4 A;  3G30 A;  4MN5 A;  3G6O A;  3T50 A;  4GS9 A;  3FPV A;  3LYX A;  1BLC A;  4HIA A;  3BFG A;  3DBA A;  1VET A;  3HLD A;  3UDF A;  5EVI B;  4S2M A;  3VOL A;  4EEU A;  5HFO A;  2QMI A;  3IF6 A;  5CGX A;  4BL3 A;  3PXP A;  1P9W A;  4N9L A;  3C4O A;  4HQA A;  4Y0O A;  2AVX A;  2J8Y A;  1QMF A;  3M2K A;  4JXG A;  4BBT A;  4C75 A;  1RGZ A;  3O86 A;  2Y2N A;  4KZ7 A;  4BBU A;  3QHY A;  3G2Z A;  3B33 A;  4PKY G;  2ZL1 B;  1MKI A;  4KZ4 A;  3EGX C;  1KE0 A;  2JKR M;  2XF3 A;  2XR0 A;  4BWI A;  5KSC A;  2J9O A;  2DMW A;  1CI9 A;  5FL3 A;  1PFL A;  4L9E A;  4DE3 A;  4OQH A;  4WL9 A;  2ACG A;  5J4E A;  2ZM8 A;  1L2S A;  2VGL S;  1ES2 A;  1H3Q A;  4Y17 A;  3KSF A;  4ZJ3 A;  3BW6 A;  5F6A A;  3ZGA B;  1PRQ A;  2E8I A;  2Q9N A;  3K3D A;  1IEM A;  2VZW A;  1PNE A;  2WK0 A;  4Y13 A;  2FZ0 A;  1VHM A;  1Y28 A;  3MKF A;  3BQA A;  3LI9 A;  3MQO A;  4DDS A;  4EQ1 A;  2QJ7 A;  1I2W A;  2J9P A;  3LO7 A;  1MC0 A;  4UHU A;  3MJQ A;  1O07 A;  3HLE A;  1CJF A;  4QY6 A;  2EX6 A;  2Y8H A;  4WZ5 C;  4GOG A;  1D7E A;  3VSL A;  1PWC A;  1ZC2 A;  3IQA A;  2R9W A;  1T1C A;  3MXQ A;  4EU0 A;  1HLU P;  4D60 A;  4HY8 A;  2HP5 A;  2VLG A;  1ZG4 A;  4OON A;  3V5M A;  5G4Y A;  2W1T B;  1FOF A;  4EUV A;  3A3E A;  3GDI A;  4XXR A;  4OLD A;  4B4Z A;  4MLL A;  4OOM A;  5GHX A;  4HJ6 A;  3IH8 A;  2VV7 A;  3WRZ A;  1JWZ A;  3IXB A;  3QP4 A;  5HAI A;  2A49 A;  3Q7V B;  5FQ9 A;  4L9G A;  3F1O A;  2X01 A;  3FV7 A;  1ES4 A;  5HPI A;  1CQA A;  4CQH A;  3GV9 A;  2C5W B;  4N1H A;  4WLA A;  3V3S A;  3ZG5 A;  1ALQ A;  3S7Q A;  4S2K A;  1KGE A;  2XD1 A;  2VV8 A;  4L9F A;  1H0M A;  3G32 A;  1P0Z A;  4I5S A;  3N8R A;  1PI5 A;  2V20 A;  4Q0I A;  2I72 A;  3IWI A;  3C5A A;  5FAQ A;  1G5U A;  5A91 A;  3WRT A;  5LBR A;  2WKQ A;  5CHM A;  3L7H A;  4KUO A;  1WYC A;  3C2W A;  4G3K A;  1ZG6 A;  5BOH A;  2HJ9 C;  1VEU A;  2JKF A;  2PYP A;  3F1N A;  5EM1 A;  2XK1 A;  3ZNT A;  2R9X A;  3SZT A;  4BQM A;  2ZQA A;  4X6T A;  3ISG A;  1IYO A;  2XFT A;  1FSW A;  3VSK A;  3BRM A;  3I7J A;  2K31 A;  4GS9 B;  3HJK A;  4FUW A;  4I39 A;  2M7V A;  5L2F A;  3HLC A;  1GSV A;  1XJ2 A;  4XUZ A;  4S2P A;  4IVK A;  2VV6 A;  5CHJ A;  4CLC D;  4KZ3 A;  4WBG A;  4F3L A;  5E2E A;  2Y79 A;  1RCJ A;  4YIN A;  1Z09 A;  4I3J A;  4ZRR A;  1SZV A;  5EE8 A;  1OJG A;  4KQO A;  3FZC A;  4KQR A;  1SKF A;  1M40 A;  4RVA A;  2Q0O A;  4WEK A;  3PAE A;  4UQI S;  3LIE A;  3IX3 A;  2OOL A;  3BEC A;  4FTX A;  5L10 A;  4JXW A;  1K57 A;  3ITA A;  3TW8 A;  3T4L A;  3ICY A;  4NKP A;  1FIK A;  5F1G A;  2ZM0 A;  1UWN X;  2V8F A; 
#chains in the Genus database with same CATH homology
 2GZA A;  5F69 A;  3PBR A;  5HPF A;  3HCY A;  5I5L A;  3LFV A;  3VE3 A;  1OT6 A;  1VB6 A;  4B9O A;  1NLY A;  4FOF A;  4K08 A;  5HDS A;  1V9Z A;  2XA7 S;  1DP6 A;  3T4K A;  4Q0J A;  4H6J A;  4NXG A;  3UE6 A;  2XRO A;  3A0S A;  3VV4 A;  2W1T A;  4JGR A;  1F9I A;  4WEL A;  3JVV A;  3KO6 A;  5AJG A;  4XT2 A;  4YWZ A;  3FPW A;  4ME4 A;  4BJP A;  3BWL A;  5C5K A;  4EW7 A;  2ZMF A;  3LR5 A;  3R4K A;  5HDC A;  3CUE C;  2PT7 A;  2QKP A;  2O9B A;  2JKT M;  3RH8 B;  4JGO A;  2B18 A;  2PDR A;  3C38 A;  3LIA A;  4HJ4 A;  4MN7 A;  2HF6 A;  1D06 A;  4CLC B;  3BQ8 A;  4PAU A;  4B93 A;  2INW A;  2M1C A;  4ETZ A;  4H6J B;  2CMN A;  4KUK A;  4G3W A;  3LR0 A;  4E04 A;  4GHI B;  3PBN A;  3UE3 A;  4Y5F A;  1S1Z A;  2JN7 A;  3F1P B;  4HP9 A;  4O8G A;  3EEA A;  3UB9 A;  5HSQ A;  3ZYT A;  1N9O A;  2OAQ 1;  3ULF A;  3CUE A;  2WKP A;  2NUP C;  4EET B;  2XRN A;  2A24 B;  4LRX C;  3V67 A;  1BYW A;  2ZBB A;  2JKR I;  2VX8 A;  3H7W B;  2NUT C;  3A0R A;  4FSF A;  4WEJ A;  3OCL A;  1T1A A;  3PBO A;  1S66 L;  1XJ4 A;  4O0P A;  4XT2 B;  3KSI A;  3T4O A;  3NOP C;  1TS7 A;  1ZTU A;  1S4S A;  3PBQ A;  1OJ5 A;  2Z6D A;  3F1N B;  1F98 A;  2W1R A;  2V1B A;  3E0Y A;  3F1O B;  3SW1 A;  3CIT A;  5A8B A;  4UQI M;  4ARZ A;  1YSQ A;  2ZOH A;  2W27 A;  4IUK A;  2HJE A;  5HZH A;  1JNU A;  2D02 A;  4I3A A;  1DP8 A;  2OWH A;  2W3G A;  3GEC A;  5HWT A;  3KSG A;  2L4R A;  3EQV A;  3D72 A;  4YNR A;  4HJ3 A;  3H9W A;  3KYZ A;  3T4Q A;  4NEE D;  5TBM A;  2W3H A;  4PKY A;  4O01 A;  3PHY A;  5DKK A;  3T4J A;  4NXF A;  4IHQ A;  1KOU A;  2R78 A;  2HV1 A;  5HDD A;  1TD5 A;  3P7N A;  3OCN A;  3EWK A;  5DJU A;  5HWV A;  1OPX A;  1DP9 A;  1YAX A;  2KDK A;  1GSW A;  2GNX A;  1F5M A;  4CLC C;  4MN5 A;  2O9A A;  3EQU A;  3G6O A;  3T50 A;  4WF0 A;  2V1A A;  4GS9 A;  3PBT A;  1S67 L;  3FPV A;  3LYX A;  2JKT I;  3W2Z A;  1NRJ A;  3VE4 A;  4HIA A;  2W0N A;  3DBA A;  3K3C A;  3IBR A;  3C8C A;  3PYP A;  5IS1 A;  3E98 A;  4HP4 A;  3RTY A;  1TS6 A;  3VOL A;  1W63 Q;  1MZU A;  4EEU A;  2HGV A;  2LB5 A;  4R6L A;  4BMW A;  2PR6 A;  1OTB A;  1MKM A;  3H82 B;  3PXP A;  1P9W A;  3HJI A;  4EXO A;  1TS8 A;  2W3D A;  3LR3 A;  4HQA A;  4P6Z S;  4BBT A;  3FG8 A;  3PR6 A;  4NXE A;  5HWW A;  5KSH A;  3D3O A;  3NOT C;  4Z1W A;  5DJT A;  2PYR A;  5HD5 A;  1OT9 A;  4BBU A;  1T1B A;  2VJW A;  1GSX A;  2YKF A;  3B33 A;  4PKY G;  3EGX C;  4IJG A;  2JKR M;  3UMD A;  2IA2 A;  1WA9 A;  3S7O A;  4BWI A;  1G6O A;  1OTI A;  1DRM A;  5AVF A;  2DMW A;  3BY8 A;  5FL3 A;  4GHI A;  4L9E A;  4WL9 A;  5J4E A;  3O5Y A;  3UB7 A;  3E4Q A;  4HHD A;  2EA9 A;  3A0V A;  2D01 A;  1YKD A;  2VGL S;  1H3Q A;  3R7W B;  3KSF A;  3R7W A;  3BW6 A;  3OOV A;  5F6A A;  2J80 A;  2VGL M;  2W3E A;  3K3D A;  3PBS A;  3U2A A;  2VZW A;  2ZOI A;  2PR5 A;  2FZ0 A;  1VHM A;  3LID A;  1Y28 A;  2Z6C A;  4I3I A;  3B47 A;  4OOL A;  1H8M A;  3BQA A;  3LI9 A;  3MQO A;  4EQ1 A;  3CI6 A;  1UGU A;  2QJ7 A;  3C30 A;  5DF9 A;  2A24 A;  3KSH A;  2J3W A;  3T4T A;  2M7U A;  3MQ0 A;  1MC0 A;  2FH5 A;  5F68 A;  2QYB A;  1NLZ A;  3MJQ A;  1OTE A;  4EER A;  5K5B A;  4ARZ B;  5MC7 A;  4WUJ A;  4GLQ A;  4HI4 A;  2Y8H A;  2OWJ A;  3LIC A;  4CLC A;  2QHK A;  1D7E A;  1LSX A;  3EEH A;  1T1C A;  1TF1 A;  3S7N A;  2I9V A;  3MXQ A;  3MQQ A;  4EU0 A;  1P9R A;  4HY8 A;  3T4S A;  4GJ4 A;  2VLG A;  5TBM B;  3RFB A;  3EGD C;  4WN5 A;  2V9A A;  4MDZ A;  5IT5 A;  2EWV A;  3E4P A;  2K2N A;  4JGQ A;  5G4Y A;  2W1T B;  3K2N A;  3TRC A;  1IFQ A;  4EUV A;  2OAP 1;  3GDI A;  1T19 A;  4YOF A;  3P01 A;  1ODV A;  3KYQ A;  1XJ3 A;  3OC2 A;  1OTA A;  2P08 A;  4OOM A;  4HJ6 A;  2GJ3 A;  2ZMV A;  3CLO A;  2VV7 A;  2L0W A;  5KIZ A;  4HH2 A;  3EOI A;  3IS2 A;  4L9G A;  3F1O A;  3ZQ5 A;  2J3T D;  2QJ5 A;  2L1M A;  5CX7 A;  5HPI A;  4CQH A;  4ETX A;  2O99 A;  4R70 A;  3LR4 A;  4GCZ A;  4WLA A;  2B02 A;  2V0U A;  3F1P A;  4LRZ E;  3S7Q A;  4KQD A;  2WKR A;  4RQ9 A;  5IU1 A;  4L0L A;  1N9N A;  2XA7 M;  2VV8 A;  3UME A;  4L9F A;  2YKH A;  3NHQ A;  4AFI A;  1X0O A;  5DFX A;  2H28 A;  3MFX A;  4NXB A;  2LB9 A;  1P0Z A;  2PD7 A;  5EFW A;  5DFY A;  3H7W A;  4I5S A;  2JHE A;  3JVU A;  2J3T C;  4Q0I A;  5J7E A;  3CWF A;  4QPR A;  5DKL A;  3H82 A;  4DJ2 A;  2VKS A;  1IOU A;  3TJZ C;  5LBR A;  2VEA A;  2WKQ A;  2KOI A;  4DJ3 A;  5HL6 A;  4EES A;  2W3F A;  4KUO A;  3C2W A;  4G3K A;  4UEY A;  2HJ9 C;  4G3V A;  2PYP A;  4HOI A;  3F1N A;  3LIB A;  4Q0H A;  3IBJ A;  4MN6 A;  2KX6 A;  3BY9 A;  1XFQ A;  2XSS A;  3KX0 X;  4MCW A;  3UB8 A;  5L8M A;  4DMZ A;  4CLC E;  2K31 A;  1P97 A;  3NJA A;  2K7S A;  2O9C A;  4GS9 B;  3HJK A;  4I39 A;  3LIF A;  1NWZ A;  2M7V A;  1EW0 A;  1LL8 A;  2O0Y A;  1TS0 A;  2QWS A;  5J3W A;  1GSV A;  3UB6 A;  1T18 A;  1XJ2 A;  3BJN A;  2PD8 A;  2PHY A;  1XJ6 A;  4HNB A;  3MF0 A;  2P7J A;  4R3A A;  3S7P A;  1G28 A;  1N9L A;  2VV6 A;  4CLC D;  2P04 A;  2EWW A;  4HH3 A;  4F3L A;  2Y79 A;  1YSP A;  3B42 A;  3MMH A;  4I3J A;  4ZRR A;  1S1Y A;  3E4O A;  2MJ6 A;  4Y2F A;  4BBV A;  4LPZ A;  1OJG A;  4KQO A;  4LRY C;  4P6Z M;  1S4R A;  3IS2 B;  4LLO B;  5F5Y A;  5HD3 A;  1XFN A;  1UWP X;  2KLI A;  4R38 A;  3OLO A;  1LT0 A;  3NOU C;  1ZHH B;  4M4X A;  2V0W A;  5G4Z A;  1OTD A;  4WEK A;  4JGP A;  4I38 A;  2A2L A;  4UQI S;  1STZ A;  3LIE A;  2OOL A;  5TJJ A;  2G7U A;  3FC7 A;  4GW9 A;  2VA0 A;  3TE8 A;  4F3L B;  4II7 A;  3LI8 A;  2GX5 A;  4Y3I A;  3OBF A;  1LSW A;  1W63 M;  1LSV A;  3LUQ A;  4IUH A;  3TW8 A;  5AVE A;  3T4L A;  3ICY A;  2BAS A;  4EEP A;  4NKP A;  3CAX A;  1V9Y A;  1UWN X;  4PHT A;  3MR0 A;  4DN0 A;  4MMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...