2LB9A

Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state (corrected pyrrole ring planarity)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
b'LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Solution structure of a cyanobacterial phytochrome GAF domain in the red-light-absorbing ground state.
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
molecule tags Transferase
total genus 33
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2lb9A00
3NOUC 4Q0HA 2Y8HA 2O9AA 4BWIA 4Q0IA 2LB9A 4O01A 2K31A 2GX5A 3NHQA 1MC0A 2O99A 3S7NA 5K5BA 3S7PA 4G3KA 3E98A 4EUVA 2O9CA 5I5LA 3S7QA 4IUKA 4ETXA 5HPFA 1STZA 4Y5FA 4EU0A 4Z1WA 3KSFA 4R6LA 1TF1A 4DMZA 2VKSA 3K2NA 2VEAA 3KSIA 3R4KA 5AJGA 4O0PA 5HSQA 4IJGA 4MCWA 2VZWA 2XRNA 2O9BA 3OBFA 5L8MA 5HL6A 2W3GA 4QPRA 4GW9A 2IA2A 4G3WA 5DFXA 2K2NA 2XSSA 2B18A 3C2WA 3KO6A 2W3EA 5HPIA 2KLIA 1ZTUA 3KSHA 3MF0A 2W3HA 2M7VA 4FOFA 2G7UA 2VJWA 3EEAA 5TJJA 4Y3IA 3NOPC 4PAUA 3W2ZA 4O8GA 1YKDA 1TD5A 3DBAA 3IBJA 3MMHA 3KSGA 4DN0A 3TRCA 3LFVA 2M7UA 2XROA 4MN7A 3MQ0A 4YNRA 1VHMA 4IUHA 2W1TA 5LBRA 3BJNA 3CITA 2OOLA 3HCYA 3OOVA 3D3OA 4LRXC 2W3FA 3S7OA 4MMNA 2LB5A 4Y2FA 3G6OA 2QYBA 4G3VA 3IBRA 1YSPA 3RFBA 4MDZA 4ETZA 2KOIA 4ME4A 3CI6A 4CQHA 3O5YA 1YSQA 4YOFA 5DFYA 4Q0JA 4LRYC 2Y79A 2O0YA 2W3DA 3VV4A 2W1TB 1MKMA 4ZRRA 5C5KA 4E04A 4GLQA 2W1RA 3NOTC 2ZMFA 4LRZE 3E0YA 4R70A 4RQ9A 3ZQ5A 2HGVA 1F5MA
chains in the Genus database with same CATH superfamily
3UE6A 5A91A 3H82A 3NHQA 4PM6A 5CX7A 4X6TA 1QMFA 3LI9A 3SH7A 2NUPC 4E3LA 1GA0A 5EVIB 4U3TA 5G18A 4E6XA 3F1OB 5KSHA 4BMWA 4X55A 1MWSA 3NDGA 3R4KA 5HD3A 4MCWA 3T4JA 2XRNA 3WS0A 3FKWA 3H82B 3LR3A 4XT2A 2HPBA 4WMCA 2VGKA 3IWQA 4UA9A 2L0WA 3SS3A 3M2JA 3EEAA 4PKYA 1NYYA 3MXSA 4GZBA 4ZJ3A 1ZG4A 4XT2B 4Y7PA 1FR6A 4GCZA 3VOZA 3MQQA 3T4OA 1GHMA 4YNRA 3B3XA 3SZTA 1QMEA 2WKIA 4LCMA 2R78A 5AQBA 2OLVA 3M6HA 2B5RA 3MKFA 4WELA 3SH9A 3CAXA 2KDKA 2HDRA 3ZNYA 4QWOA 3W4PA 1L0EA 3O3VA 4CQHA 4BBVA 4H6JA 1LI9A 5G4ZA 3ZG0A 3UPNA 1KE4A 5EPHA 4ZRRA 3W8KA 4GLQA 3MKEA 2W1RA 4HIAA 3RXXA 3BM6A 4BD1A 4DDYA 3EQUA 2HDQA 2Y91A 3NOUC 3G32A 4KUOA 1W63Q 2VA0A 3UB9A 3HLGA 3T1RA 4CLCD 2QZ6A 4H6JB 2OAP1 4N92A 4I3JA 5CHJA 3S7QA 4KZ8A 2EX9A 3UE0A 4QY6A 3ZHHA 3S1YA 3HUNA 4Q8IA 4S2PA 2G2WA 5FQKA 2JN7A 1JWVA 1MWUA 2L1MA 2GZAA 5DJUA 5HSQA 4Y0TA 2J9PA 4R3AA 3QP2A 4BBUA 1P97A 3CWFA 2PYPA 5HARA 4IEDA 5DFXA 4RYEA 4LV1A 4EEUA 4EW7A 3D9YA 2JHEA 5TFQA 1E25A 4MBFA 2XK1A 3FPVA 2KLIA 3MSHA 5DF7A 4E3IA 1RP5A 2HP5A 1H0MA 5FQJA 5DF9A 1D06A 3E4OA 4NKPA 4BQMA 1BLSA 5EVID 1S67L 1FR1A 3LFVA 4Z9QA 2INWA 1LSVA 4JXVA 3T1XA 3N8RA 4DE0A 2XD5A 2D01A 4R3JA 3A0SA 2RCXA 4PPRA 3D4FA 2W3FA 3BW6A 3LR4A 4G3VA 5FA7A 4R4SA 2BTFP 3MZFA 2Y2KA 4ME4A 4QHCA 4DXCA 3NJAA 5F6AA 4KZ6A 2ZQCA 4L9FA 2J3TC 3CUEA 1OT9A 3BQAA 1P0ZA 3O87A 2O0YA 2W3DA 4JF5A 4EBPA 3HREA 1PWCA 3UE1A 5FEFA 1GA9A 1CQAA 1IYPA 5CRFA 3W4QA 4UAAA 3C30A 2X02A 4UA6A 4Y17A 5K5BA 2QWSA 3C38A 2JKRM 1WA9A 4HY8A 5AQ9A 4EV4A 5M18A 4QD4A 3LIAA 4EESA 4JXGA 4WN5A 1GSXA 3GECA 3MQOA 3KSIA 1OTIA 3WWXA 1IYSA 2OWHA 3HLFA 1L0GA 1H8ZA 4IVKA 3SS5A 5F69A 2PU2A 3LIFA 3PHYA 2CC1A 4C75A 3DWZA 1D1JA 1ZTUA 2EA9A 4LLOB 3ZG9B 1NYMA 4KQRA 2G7UA 1XJ4A 1G6AA 4I38A 1LI0A 4IVIA 1NZUA 1PNEA 3AGDA 5FATA 1WE4A 4P87A 2XR0A 1OTBA 5A93A 1H8MA 1XPBA 1G5UA 2XROA 3V67A 1TS0A 2QJ5A 1CEGA 2W1TA 1K38A 1YLWA 3IWIA 3ZFZA 1PW8A 4HJ3A 2ZQDA 4IBXA 2ZLYA 3BFCA 2ZC3B 2HDSA 1YLTA 5IU1A 5DFYA 4ID4A 1SKOA 3G2YA 2W1TB 2JKTM 2W27A 5EE8A 4NEED 4A5RA 4OKPA 1T1BA 1EROA 3E0YA 4WEJA 3MR0A 1TEMA 3VSLA 2Z6CA 2JKRI 2FH5A 4S2NC 4N9KA 1HD8A 2E8JA 3JPUA 1IKGA 4DE2A 4QJGA 1SKOB 1DJCA 2YKHA 1XGIA 1OPXA 2HDUA 1W8QA 2ZC7A 1K54C 1GSVA 2DNSA 4QB8A 2Y2LA 5GHZA 4EERA 1CK3A 3LI8A 4IJGA 3ZCZA 4UEYA 3EGDC 5EV0A 4AFIA 3PBOA 5A8BA 3VOLA 5HW3A 3LY3A 1YQSA 4NK3A 2WKRA 2ZBBA 3QP6A 3QP5A 4GKUA 3IBJA 4MEZA 5M19A 2XA7S 4E3KA 4R1GA 1K54A 1RGZA 1YLZA 2LB5A 4Y2FA 5E2GA 3TJZC 4MDZA 4X68A 1PI4A 4MLLA 3CI6A 1O07A 1P9WA 1OJ5A 4OP5A 5HWWA 5GLBA 2JKTI 1YLJA 3S4XA 3BLMA 1MY8A 2V9AA 3NOTC 2VV7A 3DTEA 4PM5A 2Y2QA 5CHMA 3Q1FA 3ZQ5A 4DF6A 2ZOHA 2J3TD 4X53A 1XGJA 5BOHA 5FEGA 1KE3A 3MFXA 1Q2QA 5F83A 3S7PA 4HNBA 4S2MA 4WZ5C 3UB7A 1J3WA 3EEHA 2MJ6A 3PAEA 3VE4A 1MWRA 4CLCC 4HHDA 5AJGA 3OPLA 4WEKA 3UY6A 5HAIA 2WGWA 5GLAA 2C5WB 3FV7A 2A2LA 4Y0UA 4BD0A 3Q82A 5AVEA 5FI6A 1V9ZA 1S4RA 5AVFA 3OCLA 5L10A 3PBRA 5CGSA 5I94A 4OPZA 4GD8A 2WGWB 4F94A 2A3UA 5KMWA 4JGQA 4KQQA 3ZVTA 4MN7A 3SH8A 4OQGA 1S1ZA 2WGVA 1BUEA 4DJ3A 2V0WA 1F9IA 4KUKA 1VHMA 5EVIC 2VLGA 2C6WB 1AXBA 4UA7A 2PD8A 2ZQ9A 4MN6A 3JYIA 3FYZA 1H5XA 2WUQA 3NI9A 1J9MA 2PBDP 4Y15A 1KGGA 1SKFA 1ES4A 2Y79A 1TS8A 1MKMA 4E3OA 3FC7A 5FQQA 4BENA 3U4LP 4Y13A 1HLUP 3UO9A 3PR6A 3ICYA 5CTMA 3S7NA 2L4RA 1NWZA 3E98A 1IKIA 4GB7A 3K3CA 4N1XA 3T4LA 4ETXA 3T12B 2V0UA 3A3DA 3SW1A 2PU4A 5DKKA 2Y59A 2VKSA 3VE3A 2J8YA 4O0PA 3Q7VA 4HP9A 3IH9A 1DJAA 3MS6A 1Q2PA 3VP1A 1ES3A 3HLCA 2IA2A 4G3WA 2ZC6B 3WS5A 3IS2A 4KZ9A 3GSGA 4FH4A 2FFFB 5EFWA 2DCFA 1XXMA 4L0LA 4PAUA 4JGOA 1NY0A 3Q7VB 3G35A 4HP4A 1S4SA 1ZKJA 2M7UA 1NRJA 4EBNA 3I7JA 3IS2B 2BASA 3V39A 3BYDA 3CITA 2OOLA 4S2KA 1OMEA 1UGUA 3LCEA 3LICA 3IXDA 3QHYA 4NXGA 5FL3A 3E4QA 3EQVA 5FASA 2ZM0A 3O86A 2VGLS 1ZG6A 4EQIA 1HTZA 3B42A 1FIKA 4Q0JA 2EX8A 4R3BA 2GJ3A 1N9LA 2Q9MA 2OWJA 3VMAA 3WS4A 4Q0HA 2ZM8A 4I3IA 2ACGA 3A0RA 3F1NA 1SZVA 3BQ8A 4JKTA 1JTGA 5DVAA 3HJKA 4R6LA 3QP4A 2K7SA 1ALQA 3V3RA 4EEPA 2XH9A 1OT6A 4E6WA 4P6ZM 4U0XA 4KZ7A 3T4QA 2XF3A 3KYZA 3CHWP 3F1NB 3V3SA 3VP3A 1DP9A 3UPOA 3GQZA 2ZC5B 2Z2MB 1E3UA 1T18A 4B4XA 3MMHA 1XJ6A 1EWZA 2A49A 2QHKA 4ZBEA 2FFYA 4LV0A 4BBTA 3CUEC 1ONHA 4R23A 1K25A 5EM0A 1ONGA 4GHIA 1PWGA 4E3NA 1PYYA 3IBRA 4O7DA 3WS2A 5A92A 3T4KA 5GHYA 3EOIA 3V5MA 2J3WA 4UHUA 1YSQA 2X71A 4WL9A 1T19A 1NLZA 4EQ1A 1ES5A 2EWWA 1P9RA 5HD5A 2P74A 4GHIB 1DRMA 4FTXA 1DP8A 2V1BA 2AVXA 4B9OA 3JVVA 2V1ZA 1N9NA 3UDFA 1OTDA 4BL3A 5FDSA 3MJQA 4I5SA 5FQIA 4KQDA 4LGWA 4P85A 4OQIA 1JWZA 2Q9NA 3UDXA 2V8FA 3L7HA 4DMZA 3LEQA 3DAVA 4MBHA 2Q0OA 3A3IA 4KZ5A 3IQAA 2BG1A 5FI2A 2IWCA 2W3GA 4GW9A 1LSWA 3FG8A 1YAXA 4F3LA 3KO6A 3FPWA 2W3HA 2H28A 3LIEA 4FOFA 4I3AA 5EECA 2ZQ7A 2PT7A 3PAGA 4FSFA 1MWTA 4NXFA 1TDLA 1XP4A 3HLDA 4S2OA 4F3LB 3VP4A 4EXOA 1SCWA 3LEZA 1MBLA 5GHXA 1Y28A 1LLBA 3UNWA 3NC8A 5L07A 1FSWA 4C3QA 2HP6A 4ZDXA 5J8XA 4YFMA 2VV6A 4XUZA 4K91A 4JF6A 3HBRA 1RGYA 1TDGA 2KOIA 2XGNA 1NRFA 4YOFA 1GHPA 1VM1A 1ZC2A 3UE3A 4IHQA 4E04A 5DKLA 3ZVWA 4UQIS 4RQ9A 2JKGA 1WYBA 4BWIA 1ERQA 1OTAA 1BLCA 5AQAA 4O01A 3S22A 3G4PA 1ZHHB 1G28A 3Q81A 4KG6A 3ZYTA 5FSRA 1E3UD 1SHVA 4GOGA 3QNCA 1OJGA 1KVMA 3GMWA 4HJ6A 3Q7ZA 2QJ7A 4MNRA 1L0FA 1S0WA 1SDNA 1JVJA 3EWKA 4B88A 3HLEA 2ZOIA 2XSSA 1M40A 3PXPA 1BTLA 1K55C 5EVLA 4DE3A 1H8YA 4GD6A 1YMSA 4WBGA 5TJJA 3CMZA 1TVFA 4Y3IA 2R9XA 3DW0A 1TD5A 1LSXA 1VEUA 3IX4A 1VB6A 3C7VA 3AGEA 1E4DA 5LBRA 4OPQA 5KIZA 3KX0X 1XFQA 5GLDA 3ZG8B 4GDNA 1KOUA 3ISGA 3O5YA 1VEUB 1PZPA 2XD1A 2EXBA 1K55A 1BSGA 1XX2A 4LENA 3N6IA 3DTKA 2PYRA 4M3KA 3OPRA 5C5KA 3T50A 4X56A 1U60A 2ZMFA 2IWBA 4PKYG 4DXBA 4RX3A 4HOIA 2XA7M 2PRFA 2PR5A 3DTIA 4DJ2A 1FCMA 2OAQ1 4IBRA 3R7WA 3C7UA 1IOUA 3ITBA 4FH2A 3IWOA 3BLSA 3E2KA 1YM1A 5EOEA 5HZHA 3KSFA 4E3MA 3LYXA 4OQHA 3IT9A 5JYOA 1TS6A 5FDHA 2XEPA 3W4OA 5E2HA 5EM1A 2EFXA 2ZD8A 1BULA 3R7WB 1PW1A 2PDRA 5EUAA 4OOLA 2K2NA 3LO7A 2B18A 5L09A 3C2WA 5HL1A 1MPLA 4S2LA 4PHTA 3WRZA 5DTKA 3LR0A 1X0OA 2Y2MA 2HZ5A 2HJEA 3ZG5A 4QU3A 1CI9A 3NBLA 4RX2A 1YPRA 5HWVA 2WGIA 1Y54A 1IYQA 2VX8A 5CECA 1K57C 2EWVA 1Y4OA 3CJMA 2IWDA 5E43A 3KYEA 3ZNTA 2B02A 1JTDA 3C5AA 1F98A 2PHYA 5DF8A 2W0NA 4HESA 4DE1A 3IX8A 4OQ0A 3BECA 3M6BA 5HFOA 3RJUA 1WYCA 4L9EA 3IHAA 3LUQA 5MC7A 3T1QB 3BWLA 2EX6A 1S66L 5EOOA 2V8CA 1K4EA 1KVLA 5FQ9A 3TE8A 4PM9A 3T1SA 1K57A 2EFUA 3NIAA 1W79A 1S1YA 4C6YA 5L8MA 2PD7A 3TG9A 4NETA 1O7EA 1ODVA 2WKQA 3NY4A 1NLYA 2W3EA 5CXWA 5HPIA 2XFTA 4JLFA 1BZAA 1MZUA 1I5QA 1K6RA 2VJWA 1OTEA 2ZM2A 1W8YA 1KDWA 4WZ4A 5CTNA 1N4OA 5TR7A 4DN0A 1HZOA 3VOYA 5KSCA 1G6OA 4Y0OA 1ESIA 2OLUA 2KX6A 3OPPA 1PRQA 4KG2A 2Y2OA 3UPPA 2QKPA 4IUHA 2XLNA 3HCYA 4LPZA 2Y2IA 3DTMA 3IH8A 2HF6A 4OPRA 5CEBA 2VK3A 5HX9A 3MZDA 1PWDA 2QPNA 5HAPA 3VP0A 1YT4A 5F5YA 5CGWA 3OCNA 4GDBA 3MZEA 4WYYA 3VFFA 2B95A 1K6SA 4R70A 3NCKA 3BFDA 3C4OA 5HWTA 2BLSA 2NUTC 4BLMA 4EETB 1ESUA 2D02A 5A90A 1MC0A 1XFNA 3IXGA 3QP1A 4CLCE 4G3KA 4DKIA 1IFQA 3FWLA 2PBYA 3Q07A 4OONA 1STZA 3P01A 3P09A 4XXRA 3CZDA 4N1HA 2VGLM 3K2NA 3T4TA 5J3WA 3WRTA 1BLHA 2O9BA 2X01A 2RL3A 5FAQA 1FQGA 2H0TA 2JKFA 2ZQ8A 1KGFA 5CGXA 3LGOA 3HVFA 1H3QA 1I2WA 3WS1A 1F2KA 5U47A 2PAVP 3HLBA 1NJ4A 3NECA 4WM9A 4OOMA 1FILA 2J9OA 2YKFA 2ZMAA 4D2OA 3UN7A 5F1FA 1FCOA 2QMIA 4P6ZS 4ESPA 4JPMA 2JC7A 1HVBA 5J7EA 2PR6A 3OOVA 4ZJ2A 4MMNA 2P7JA 4KQOA 3TW8A 2P08A 4LV3A 3OZHA 2H10A 3H9WA 4FD8A 2WKPA 3IXHA 3IHBA 4YWZA 3BFFA 1PFLA 5TGFA 5FAOA 3BFGA 4LRYC 1KDSA 3JVUA 3FZCA 3N8LA 2VGJA 3HJIA 1YLPA 1F5MA 2CMNA 1UWPX 4K0XA 2HJ9C 1JNUA 4Q0IA 2LB9A 4P0MA 2K31A 3DWKA 4HI4A 1LHYA 2H0YA 4JF4A 5I5LA 4FCFA 1W7FA 5FAPA 4Z1WA 4XUXA 2A24A 2H5SA 4HQAA 3F1PA 4CPKA 3BY8A 5DTTA 3OBFA 3CPTA 2JBFA 4L9GA 4PM8A 5CEDA 1K56A 3BFEA 2ZMVA 3TSGA 4MN5A 3SOIA 3KSHA 3MF0A 2M7VA 2A24B 3GDIA 3F1PB 3W2ZA 3RH8B 4CJNA 5CHUA 3DBAA 3CPTB 2XDMA 3N8SA 3B33A 1L0DA 4R0QA 3N7WA 1LL5A 4OH0A 4D60A 3TOIA 2VV8A 3LY4A 4KG5A 3A0VA 2HP9A 1NXYA 2P9VA 4JGRA 4WMCD 2WKHA 1FSYA 4X25A 1CI8A 3UB5P 1YSPA 3RFBA 3IX3A 4PMAA 4NXBA 3BEBA 3PBQA 5DTSA 4WF0A 3G30A 4JBFA 2WK0A 1MXOA 5GLCA 3ULFA 2E8IA 3UMEA 2WZZA 4KZ3A 4U0TA 4HH3A 2WAEA 1Z6FA 1YLYA 3HL9A 3PBTA 2P9VB 4FUWA 2HGVA 2J7VA 2V20A 3P98A 1VETA 2Y8HA 4GJ4A 2ZJ9A 4HBUA 4KZBA 1ERMA 2GX5A 2O99A 3T4SA 1LT0A 2Y2NA 3C8CA 4KZ4A 3CLOA 4IUKA 1N9BA 4RA7A 4Y5FA 3NULA 5CERA 3HLWA 2WADA 1XJ3A 4EWFA 1W63M 3FKVA 1DY6A 3VFHA 1TS7A 1V9YA 3RXWA 3SS4A 1VETB 2OV5A 1KGEA 1PZOA 3G2ZA 3CG5A 5HL6A 1AWIA 3PYPA 4NG2A 4QPRA 4B93A 4UQIM 1PIOA 1W5DA 3UMDA 1N9OA 1I2SA 5F1GA 5EVEA 1UWNX 3B47A 2I72A 1S6RA 1YKDA 4N9LA 1GSWA 4GNUA 2ZC4B 5AQ7A 3KSGA 4OLDA 2JE5A 4R38A 3C4PA 4KZAA 2WKEA 2EX2A 3PBNA 1SDEA 2Y2GA 3E2LA 2GDNA 4LCLA 2EXAA 4HH2A 5HDCA 5L2FA 3ZDJA 1XJ2A 5F82A 2OSUA 3IF6C 4GN2A 4OLGA 1VQQA 4OPYA 3G6OA 2G2UA 5GL9A 3ITAA 3IXBA 3HUMA 4B4ZA 4HJ4A 1EW0A 4WUJA 4M4XA 3OC2A 2V1AA 1IYOA 1BLPA 1JWPA 3ZG7B 3MXRA 3GTCA 4DRTA 1K56D 2O9AA 4JXSA 4II7A 1K0KA 5JYPA 1A0KA 5F68A 4EUVA 1ES2A 5J4EA 1L2SA 2O9CA 1Z09A 3G34A 2JCHA 3U2AA 3VSKA 3LIBA 5HDDA 1CJFA 3L9KA 3LR5A 4PM7A 1DJBA 5KZHA 2VEAA 2DMWA 3IF6A 1C3BA 3PTEA 3BY9A 1XKZA 3UDIA 4S2NA 2Z2LB 4H8RA 4JGPA 4X69A 4I39A 3GRJA 3M2KA 3MBZA 1IELA 1NZOA 2FZ0A 4S2JA 4DDSA 3IF6B 4O8GA 1K4FA 3O88A 4K08A 3GR2A 4BJPA 4LV2A 5IT5A 5FI7A 5M1AA 3UB8A 4BL2A 3GVBA 1BYWA 3HUOA 1KE0A 3N4IA 2Z6DA 1T1CA 3LIDA 3D3OA 4LRXC 3S7OA 4P6BA 1DP6A 1FCNA 4RVAA 5IHVA 4ZJ1A 1LL9A 1D7EA 3MFDA 1EI5A 2I9VA 1T1AA 3OPHA 4ARZA 4LFUA 1IEMA 4GS9A 1L3LA 4R4RA 1ACFA 4K0WA 4LRZE 3PBSA 3QP8A 3A3FA 2Y55A 4ZTKA 2V2FF 3QNBA 1PI5A 3EGXC 3H7WA 5E2FA 1G68A 3P7NA 4ARZB 5HPFA 2J80A 4WLAA 4GS9B 4OOYA 4EU0A 2ZL1A 5FQMA 1TF1A 2Y4AA 3GV9A 3K3DA 5HDSA 5E2EA 5G4YA 2GNXA 2ZQAA 1RCJA 3ZGAB 3VP2A 4HEFA 2Y2HA 2VZWA 4S2IA 3H7WB 2Y2PA 5D3OA 1CF0A 1CEFA 4WZ5A 5TBMA 4HBTA 4X1MA 1MKIA 3E4PA 3V50A 1YMXA 4OP8A 2ZL1B 4CLCA 3A3JA 5IS1A 3NOPC 4MBKA 3AGFA 2XFSA 4ZAMA 5HAQA 1XA1A 3TRCA 4KENB 5TBMB 3BRMA 3KYQA 3MQ0A 1FOFA 1BT5A 1GHIA 4YINA 2WYXA 3D72A 4E3JA 4CLCB 3BJNA 4QY5A 2M1CA 2UWXA 2XQZA 3IF5A 2P04A 3NDEA 2QYBA 2WZXA 3RTYA 2Y2JA 4ETZA 4JXWA 1GCEA 2HV1A 2DRWA 1XA7A 4EUZA 3UB6A 4EBLA 2R9WA 4OVDA 3VV4A 1LL8A 3A3EA 5EVIA 3G31A 2UV0E 5DJTA 3MXQA 1M6KA 3F1OA 3OLOA 2WAFA 4X1LA 4NXEA
chains in the Genus database with same CATH topology
2ZOHA 2J3TD 3UE6A 1UWPX 4BWIA 1OTAA 2HJ9C 1JNUA 3H82A 2LB9A 4O01A 2K31A 3NHQA 4Q0IA 3MFXA 5CX7A 3S7PA 4HNBA 3LI9A 4HI4A 1ZHHB 1G28A 3UB7A 5I5LA 3ZYTA 2NUPC 3EEHA 2MJ6A 4Z1WA 3VE4A 3F1OB 5KSHA 4BMWA 4CLCC 2A24A 4HHDA 4HQAA 3F1PA 3R4KA 5AJGA 4WEKA 3BY8A 5HD3A 1OJGA 4MCWA 3T4JA 2XRNA 3OBFA 4HJ6A 3H82B 2QJ7A 3LR3A 2A2LA 4XT2A 3EWKA 4L9GA 2ZOIA 2XSSA 3PXPA 2ZMVA 4MN5A 5AVEA 3KSHA 1V9ZA 3MF0A 2M7VA 2L0WA 2A24B 3GDIA 1S4RA 3EEAA 5AVFA 3F1PB 5TJJA 4Y3IA 3W2ZA 3OCLA 4PKYA 3PBRA 3RH8B 1TD5A 1LSXA 3DBAA 4JGQA 3B33A 4XT2B 4GCZA 4MN7A 3MQQA 3T4OA 4YNRA 1S1ZA 1VB6A 4DJ3A 2V0WA 1F9IA 4KUKA 1VHMA 2R78A 5LBRA 2VV8A 5KIZA 3A0VA 2VLGA 3KX0X 1XFQA 2PD8A 4JGRA 4MN6A 4WELA 3CAXA 2KDKA 1YSPA 3RFBA 4NXBA 1KOUA 3PBQA 4WF0A 4CQHA 3O5YA 4BBVA 4H6JA 5G4ZA 3ULFA 3UMEA 2Y79A 2PYRA 1TS8A 1MKMA 4HH3A 4ZRRA 5C5KA 3T50A 4GLQA 2W1RA 2ZMFA 4HIAA 3FC7A 3PBTA 3EQUA 2HGVA 4PKYG 3NOUC 4HOIA 2Y8HA 2XA7M 3PR6A 1W63Q 4GJ4A 4KUOA 2VA0A 3UB9A 2PR5A 3ICYA 2GX5A 4DJ2A 2O99A 3S7NA 2OAQ1 3R7WA 2L4RA 3T4SA 4H6JB 1LT0A 1NWZA 2OAP1 3E98A 3C8CA 1IOUA 3K3CA 3CLOA 4I3JA 3S7QA 3T4LA 4IUKA 4ETXA 4Y5FA 2V0UA 3SW1A 5HZHA 1XJ3A 3KSFA 5DKKA 3LYXA 1W63M 2VKSA 3VE3A 2JN7A 1TS6A 1TS7A 1V9YA 4O0PA 5DJUA 2L1MA 2GZAA 5HSQA 4HP9A 4R3AA 5HL6A 4BBUA 1P97A 3PYPA 3CWFA 4QPRA 2PYPA 2IA2A 4G3WA 5DFXA 3R7WB 4B93A 4EEUA 4EW7A 2PDRA 4OOLA 2K2NA 2JHEA 2B18A 4UQIM 3UMDA 3IS2A 3C2WA 1N9OA 3FPVA 2KLIA 4PHTA 5EFWA 1UWNX 3B47A 4CLCD 3LR0A 1X0OA 4L0LA 4PAUA 4JGOA 5DF9A 1D06A 1YKDA 3E4OA 4NKPA 1GSWA 2HJEA 4HP4A 1S4SA 1S67L 3KSGA 3LFVA 2M7UA 1NRJA 2INWA 1LSVA 4R38A 3IS2B 3PBNA 5HWVA 2BASA 2D01A 3A0SA 4HH2A 5HDCA 2VX8A 2EWVA 2OOLA 3CITA 1XJ2A 1UGUA 2W3FA 3BW6A 3LICA 3LR4A 4NXGA 5FL3A 3E4QA 3EQVA 3G6OA 4G3VA 2B02A 2VGLS 4ME4A 4HJ4A 3B42A 3NJAA 5F6AA 1F98A 4L9FA 2J3TC 3CUEA 1EW0A 1OT9A 2PHYA 3BQAA 4Q0JA 4WUJA 1P0ZA 2O0YA 2GJ3A 2W3DA 4M4XA 3OC2A 2V1AA 2W0NA 1N9LA 2OWJA 4Q0HA 2O9AA 4L9EA 4II7A 3LUQA 3C30A 4I3IA 5K5BA 2QWSA 3C38A 2JKRM 3A0RA 5F68A 5MC7A 4EUVA 3F1NA 5J4EA 1WA9A 3BWLA 4HY8A 2O9CA 1S66L 3U2AA 3BQ8A 3LIBA 5HDDA 3TE8A 3HJKA 3LIAA 4EESA 4R6LA 4WN5A 3LR5A 1GSXA 2K7SA 3GECA 3MQOA 2VEAA 3KSIA 1OTIA 2DMWA 4EEPA 1OT6A 2OWHA 1S1YA 4P6ZM 3BY9A 3T4QA 5L8MA 2PD7A 3KYZA 4JGPA 5F69A 3F1NB 3LIFA 1ODVA 3PHYA 2WKQA 4I39A 1DP9A 1NLYA 2W3EA 5HPIA 1ZTUA 2EA9A 2FZ0A 1MZUA 4LLOB 2G7UA 2VJWA 1XJ4A 1OTEA 4I38A 4O8GA 4K08A 4BJPA 5IT5A 1T18A 3UB8A 1OTBA 3MMHA 1XJ6A 2QHKA 4DN0A 1H8MA 2XROA 1G6OA 3V67A 1BYWA 1TS0A 2KX6A 4BBTA 3CUEC 2QJ5A 2QKPA 4IUHA 2W1TA 2Z6DA 1T1CA 4LPZA 3HCYA 3LIDA 3D3OA 4LRXC 4GHIA 3S7OA 1DP6A 2HF6A 3IBRA 4HJ3A 3T4KA 3EOIA 1D7EA 2J3WA 1YSQA 2I9VA 4WL9A 5IU1A 1T1AA 5DFYA 1T19A 1NLZA 4ARZA 5F5YA 4EQ1A 2W1TB 2EWWA 4GS9A 3OCNA 2JKTM 2W27A 1P9RA 4NEED 1T1BA 5HD5A 4LRZE 4GHIB 3E0YA 3PBSA 1DRMA 4R70A 1DP8A 4WEJA 2V1BA 3MR0A 4B9OA 3JVVA 5HWTA 2NUTC 2Z6CA 2JKRI 2FH5A 4EETB 3EGXC 1N9NA 3H7WA 2D02A 1MC0A 1XFNA 1OTDA 4CLCE 4G3KA 3MJQA 4I5SA 1IFQA 3P7NA 4KQDA 4ARZB 5HPFA 1STZA 2J80A 3P01A 2YKHA 4WLAA 4GS9B 4EU0A 1TF1A 1OPXA 3K3DA 5HDSA 4DMZA 2VGLM 3K2NA 5G4YA 3T4TA 2GNXA 1GSVA 5J3WA 4EERA 3LI8A 4IJGA 2VZWA 2O9BA 3H7WB 4UEYA 3EGDC 2W3GA 4AFIA 4GW9A 1LSWA 3FG8A 3PBOA 5A8BA 3VOLA 5TBMA 1YAXA 3E4PA 4F3LA 3KO6A 1H3QA 3FPWA 2W3HA 2WKRA 4CLCA 2H28A 3LIEA 4FOFA 5IS1A 2ZBBA 4I3AA 3NOPC 4OOMA 2YKFA 3IBJA 2PT7A 4FSFA 3TRCA 4NXFA 5TBMB 3KYQA 3MQ0A 4P6ZS 2XA7S 4F3LB 4EXOA 5J7EA 3D72A 1Y28A 4CLCB 3BJNA 2PR6A 3OOVA 2M1CA 4MMNA 2P7JA 2P04A 4KQOA 3TW8A 2LB5A 4Y2FA 2P08A 2QYBA 3TJZC 3H9WA 3RTYA 4MDZA 2VV6A 2WKPA 4ETZA 2HV1A 2KOIA 4YWZA 3CI6A 1P9WA 4YOFA 1OJ5A 3UB6A 5HWWA 2JKTI 4LRYC 3JVUA 3VV4A 1LL8A 3UE3A 3HJIA 4IHQA 5DJTA 4E04A 2V9AA 3MXQA 5DKLA 3NOTC 2VV7A 3OLOA 3F1OA 4UQIS 4RQ9A 3ZQ5A 1F5MA 2CMNA 4NXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOU C;  4Q0H A;  2Y8H A;  2O9A A;  4BWI A;  4Q0I A;  2LB9 A;  4O01 A;  2K31 A;  2GX5 A;  3NHQ A;  1MC0 A;  2O99 A;  3S7N A;  5K5B A;  3S7P A;  4G3K A;  3E98 A;  4EUV A;  2O9C A;  5I5L A;  3S7Q A;  4IUK A;  4ETX A;  5HPF A;  1STZ A;  4Y5F A;  4EU0 A;  4Z1W A;  3KSF A;  4R6L A;  1TF1 A;  4DMZ A;  2VKS A;  3K2N A;  2VEA A;  3KSI A;  3R4K A;  5AJG A;  4O0P A;  5HSQ A;  4IJG A;  4MCW A;  2VZW A;  2XRN A;  2O9B A;  3OBF A;  5L8M A;  5HL6 A;  2W3G A;  4QPR A;  4GW9 A;  2IA2 A;  4G3W A;  5DFX A;  2K2N A;  2XSS A;  2B18 A;  3C2W A;  3KO6 A;  2W3E A;  5HPI A;  2KLI A;  1ZTU A;  3KSH A;  3MF0 A;  2W3H A;  2M7V A;  4FOF A;  2G7U A;  2VJW A;  3EEA A;  5TJJ A;  4Y3I A;  3NOP C;  4PAU A;  3W2Z A;  4O8G A;  1YKD A;  1TD5 A;  3DBA A;  3IBJ A;  3MMH A;  3KSG A;  4DN0 A;  3TRC A;  3LFV A;  2M7U A;  2XRO A;  4MN7 A;  3MQ0 A;  4YNR A;  1VHM A;  4IUH A;  2W1T A;  5LBR A;  3BJN A;  3CIT A;  2OOL A;  3HCY A;  3OOV A;  3D3O A;  4LRX C;  2W3F A;  3S7O A;  4MMN A;  2LB5 A;  4Y2F A;  3G6O A;  2QYB A;  4G3V A;  3IBR A;  1YSP A;  3RFB A;  4MDZ A;  4ETZ A;  2KOI A;  4ME4 A;  3CI6 A;  4CQH A;  3O5Y A;  1YSQ A;  4YOF A;  5DFY A;  4Q0J A;  4LRY C;  2Y79 A;  2O0Y A;  2W3D A;  3VV4 A;  2W1T B;  1MKM A;  4ZRR A;  5C5K A;  4E04 A;  4GLQ A;  2W1R A;  3NOT C;  2ZMF A;  4LRZ E;  3E0Y A;  4R70 A;  4RQ9 A;  3ZQ5 A;  2HGV A;  1F5M A; 
#chains in the Genus database with same CATH topology
 3UE6 A;  5A91 A;  3H82 A;  3NHQ A;  4PM6 A;  5CX7 A;  4X6T A;  1QMF A;  3LI9 A;  3SH7 A;  2NUP C;  4E3L A;  1GA0 A;  5EVI B;  4U3T A;  5G18 A;  4E6X A;  3F1O B;  5KSH A;  4BMW A;  4X55 A;  1MWS A;  3NDG A;  3R4K A;  5HD3 A;  4MCW A;  3T4J A;  2XRN A;  3WS0 A;  3FKW A;  3H82 B;  3LR3 A;  4XT2 A;  2HPB A;  4WMC A;  2VGK A;  3IWQ A;  4UA9 A;  2L0W A;  3SS3 A;  3M2J A;  3EEA A;  4PKY A;  1NYY A;  3MXS A;  4GZB A;  4ZJ3 A;  1ZG4 A;  4XT2 B;  4Y7P A;  1FR6 A;  4GCZ A;  3VOZ A;  3MQQ A;  3T4O A;  1GHM A;  4YNR A;  3B3X A;  3SZT A;  1QME A;  2WKI A;  4LCM A;  2R78 A;  5AQB A;  2OLV A;  3M6H A;  2B5R A;  3MKF A;  4WEL A;  3SH9 A;  3CAX A;  2KDK A;  2HDR A;  3ZNY A;  4QWO A;  3W4P A;  1L0E A;  3O3V A;  4CQH A;  4BBV A;  4H6J A;  1LI9 A;  5G4Z A;  3ZG0 A;  3UPN A;  1KE4 A;  5EPH A;  4ZRR A;  3W8K A;  4GLQ A;  3MKE A;  2W1R A;  4HIA A;  3RXX A;  3BM6 A;  4BD1 A;  4DDY A;  3EQU A;  2HDQ A;  2Y91 A;  3NOU C;  3G32 A;  4KUO A;  1W63 Q;  2VA0 A;  3UB9 A;  3HLG A;  3T1R A;  4CLC D;  2QZ6 A;  4H6J B;  2OAP 1;  4N92 A;  4I3J A;  5CHJ A;  3S7Q A;  4KZ8 A;  2EX9 A;  3UE0 A;  4QY6 A;  3ZHH A;  3S1Y A;  3HUN A;  4Q8I A;  4S2P A;  2G2W A;  5FQK A;  2JN7 A;  1JWV A;  1MWU A;  2L1M A;  2GZA A;  5DJU A;  5HSQ A;  4Y0T A;  2J9P A;  4R3A A;  3QP2 A;  4BBU A;  1P97 A;  3CWF A;  2PYP A;  5HAR A;  4IED A;  5DFX A;  4RYE A;  4LV1 A;  4EEU A;  4EW7 A;  3D9Y A;  2JHE A;  5TFQ A;  1E25 A;  4MBF A;  2XK1 A;  3FPV A;  2KLI A;  3MSH A;  5DF7 A;  4E3I A;  1RP5 A;  2HP5 A;  1H0M A;  5FQJ A;  5DF9 A;  1D06 A;  3E4O A;  4NKP A;  4BQM A;  1BLS A;  5EVI D;  1S67 L;  1FR1 A;  3LFV A;  4Z9Q A;  2INW A;  1LSV A;  4JXV A;  3T1X A;  3N8R A;  4DE0 A;  2XD5 A;  2D01 A;  4R3J A;  3A0S A;  2RCX A;  4PPR A;  3D4F A;  2W3F A;  3BW6 A;  3LR4 A;  4G3V A;  5FA7 A;  4R4S A;  2BTF P;  3MZF A;  2Y2K A;  4ME4 A;  4QHC A;  4DXC A;  3NJA A;  5F6A A;  4KZ6 A;  2ZQC A;  4L9F A;  2J3T C;  3CUE A;  1OT9 A;  3BQA A;  1P0Z A;  3O87 A;  2O0Y A;  2W3D A;  4JF5 A;  4EBP A;  3HRE A;  1PWC A;  3UE1 A;  5FEF A;  1GA9 A;  1CQA A;  1IYP A;  5CRF A;  3W4Q A;  4UAA A;  3C30 A;  2X02 A;  4UA6 A;  4Y17 A;  5K5B A;  2QWS A;  3C38 A;  2JKR M;  1WA9 A;  4HY8 A;  5AQ9 A;  4EV4 A;  5M18 A;  4QD4 A;  3LIA A;  4EES A;  4JXG A;  4WN5 A;  1GSX A;  3GEC A;  3MQO A;  3KSI A;  1OTI A;  3WWX A;  1IYS A;  2OWH A;  3HLF A;  1L0G A;  1H8Z A;  4IVK A;  3SS5 A;  5F69 A;  2PU2 A;  3LIF A;  3PHY A;  2CC1 A;  4C75 A;  3DWZ A;  1D1J A;  1ZTU A;  2EA9 A;  4LLO B;  3ZG9 B;  1NYM A;  4KQR A;  2G7U A;  1XJ4 A;  1G6A A;  4I38 A;  1LI0 A;  4IVI A;  1NZU A;  1PNE A;  3AGD A;  5FAT A;  1WE4 A;  4P87 A;  2XR0 A;  1OTB A;  5A93 A;  1H8M A;  1XPB A;  1G5U A;  2XRO A;  3V67 A;  1TS0 A;  2QJ5 A;  1CEG A;  2W1T A;  1K38 A;  1YLW A;  3IWI A;  3ZFZ A;  1PW8 A;  4HJ3 A;  2ZQD A;  4IBX A;  2ZLY A;  3BFC A;  2ZC3 B;  2HDS A;  1YLT A;  5IU1 A;  5DFY A;  4ID4 A;  1SKO A;  3G2Y A;  2W1T B;  2JKT M;  2W27 A;  5EE8 A;  4NEE D;  4A5R A;  4OKP A;  1T1B A;  1ERO A;  3E0Y A;  4WEJ A;  3MR0 A;  1TEM A;  3VSL A;  2Z6C A;  2JKR I;  2FH5 A;  4S2N C;  4N9K A;  1HD8 A;  2E8J A;  3JPU A;  1IKG A;  4DE2 A;  4QJG A;  1SKO B;  1DJC A;  2YKH A;  1XGI A;  1OPX A;  2HDU A;  1W8Q A;  2ZC7 A;  1K54 C;  1GSV A;  2DNS A;  4QB8 A;  2Y2L A;  5GHZ A;  4EER A;  1CK3 A;  3LI8 A;  4IJG A;  3ZCZ A;  4UEY A;  3EGD C;  5EV0 A;  4AFI A;  3PBO A;  5A8B A;  3VOL A;  5HW3 A;  3LY3 A;  1YQS A;  4NK3 A;  2WKR A;  2ZBB A;  3QP6 A;  3QP5 A;  4GKU A;  3IBJ A;  4MEZ A;  5M19 A;  2XA7 S;  4E3K A;  4R1G A;  1K54 A;  1RGZ A;  1YLZ A;  2LB5 A;  4Y2F A;  5E2G A;  3TJZ C;  4MDZ A;  4X68 A;  1PI4 A;  4MLL A;  3CI6 A;  1O07 A;  1P9W A;  1OJ5 A;  4OP5 A;  5HWW A;  5GLB A;  2JKT I;  1YLJ A;  3S4X A;  3BLM A;  1MY8 A;  2V9A A;  3NOT C;  2VV7 A;  3DTE A;  4PM5 A;  2Y2Q A;  5CHM A;  3Q1F A;  3ZQ5 A;  4DF6 A;  2ZOH A;  2J3T D;  4X53 A;  1XGJ A;  5BOH A;  5FEG A;  1KE3 A;  3MFX A;  1Q2Q A;  5F83 A;  3S7P A;  4HNB A;  4S2M A;  4WZ5 C;  3UB7 A;  1J3W A;  3EEH A;  2MJ6 A;  3PAE A;  3VE4 A;  1MWR A;  4CLC C;  4HHD A;  5AJG A;  3OPL A;  4WEK A;  3UY6 A;  5HAI A;  2WGW A;  5GLA A;  2C5W B;  3FV7 A;  2A2L A;  4Y0U A;  4BD0 A;  3Q82 A;  5AVE A;  5FI6 A;  1V9Z A;  1S4R A;  5AVF A;  3OCL A;  5L10 A;  3PBR A;  5CGS A;  5I94 A;  4OPZ A;  4GD8 A;  2WGW B;  4F94 A;  2A3U A;  5KMW A;  4JGQ A;  4KQQ A;  3ZVT A;  4MN7 A;  3SH8 A;  4OQG A;  1S1Z A;  2WGV A;  1BUE A;  4DJ3 A;  2V0W A;  1F9I A;  4KUK A;  1VHM A;  5EVI C;  2VLG A;  2C6W B;  1AXB A;  4UA7 A;  2PD8 A;  2ZQ9 A;  4MN6 A;  3JYI A;  3FYZ A;  1H5X A;  2WUQ A;  3NI9 A;  1J9M A;  2PBD P;  4Y15 A;  1KGG A;  1SKF A;  1ES4 A;  2Y79 A;  1TS8 A;  1MKM A;  4E3O A;  3FC7 A;  5FQQ A;  4BEN A;  3U4L P;  4Y13 A;  1HLU P;  3UO9 A;  3PR6 A;  3ICY A;  5CTM A;  3S7N A;  2L4R A;  1NWZ A;  3E98 A;  1IKI A;  4GB7 A;  3K3C A;  4N1X A;  3T4L A;  4ETX A;  3T12 B;  2V0U A;  3A3D A;  3SW1 A;  2PU4 A;  5DKK A;  2Y59 A;  2VKS A;  3VE3 A;  2J8Y A;  4O0P A;  3Q7V A;  4HP9 A;  3IH9 A;  1DJA A;  3MS6 A;  1Q2P A;  3VP1 A;  1ES3 A;  3HLC A;  2IA2 A;  4G3W A;  2ZC6 B;  3WS5 A;  3IS2 A;  4KZ9 A;  3GSG A;  4FH4 A;  2FFF B;  5EFW A;  2DCF A;  1XXM A;  4L0L A;  4PAU A;  4JGO A;  1NY0 A;  3Q7V B;  3G35 A;  4HP4 A;  1S4S A;  1ZKJ A;  2M7U A;  1NRJ A;  4EBN A;  3I7J A;  3IS2 B;  2BAS A;  3V39 A;  3BYD A;  3CIT A;  2OOL A;  4S2K A;  1OME A;  1UGU A;  3LCE A;  3LIC A;  3IXD A;  3QHY A;  4NXG A;  5FL3 A;  3E4Q A;  3EQV A;  5FAS A;  2ZM0 A;  3O86 A;  2VGL S;  1ZG6 A;  4EQI A;  1HTZ A;  3B42 A;  1FIK A;  4Q0J A;  2EX8 A;  4R3B A;  2GJ3 A;  1N9L A;  2Q9M A;  2OWJ A;  3VMA A;  3WS4 A;  4Q0H A;  2ZM8 A;  4I3I A;  2ACG A;  3A0R A;  3F1N A;  1SZV A;  3BQ8 A;  4JKT A;  1JTG A;  5DVA A;  3HJK A;  4R6L A;  3QP4 A;  2K7S A;  1ALQ A;  3V3R A;  4EEP A;  2XH9 A;  1OT6 A;  4E6W A;  4P6Z M;  4U0X A;  4KZ7 A;  3T4Q A;  2XF3 A;  3KYZ A;  3CHW P;  3F1N B;  3V3S A;  3VP3 A;  1DP9 A;  3UPO A;  3GQZ A;  2ZC5 B;  2Z2M B;  1E3U A;  1T18 A;  4B4X A;  3MMH A;  1XJ6 A;  1EWZ A;  2A49 A;  2QHK A;  4ZBE A;  2FFY A;  4LV0 A;  4BBT A;  3CUE C;  1ONH A;  4R23 A;  1K25 A;  5EM0 A;  1ONG A;  4GHI A;  1PWG A;  4E3N A;  1PYY A;  3IBR A;  4O7D A;  3WS2 A;  5A92 A;  3T4K A;  5GHY A;  3EOI A;  3V5M A;  2J3W A;  4UHU A;  1YSQ A;  2X71 A;  4WL9 A;  1T19 A;  1NLZ A;  4EQ1 A;  1ES5 A;  2EWW A;  1P9R A;  5HD5 A;  2P74 A;  4GHI B;  1DRM A;  4FTX A;  1DP8 A;  2V1B A;  2AVX A;  4B9O A;  3JVV A;  2V1Z A;  1N9N A;  3UDF A;  1OTD A;  4BL3 A;  5FDS A;  3MJQ A;  4I5S A;  5FQI A;  4KQD A;  4LGW A;  4P85 A;  4OQI A;  1JWZ A;  2Q9N A;  3UDX A;  2V8F A;  3L7H A;  4DMZ A;  3LEQ A;  3DAV A;  4MBH A;  2Q0O A;  3A3I A;  4KZ5 A;  3IQA A;  2BG1 A;  5FI2 A;  2IWC A;  2W3G A;  4GW9 A;  1LSW A;  3FG8 A;  1YAX A;  4F3L A;  3KO6 A;  3FPW A;  2W3H A;  2H28 A;  3LIE A;  4FOF A;  4I3A A;  5EEC A;  2ZQ7 A;  2PT7 A;  3PAG A;  4FSF A;  1MWT A;  4NXF A;  1TDL A;  1XP4 A;  3HLD A;  4S2O A;  4F3L B;  3VP4 A;  4EXO A;  1SCW A;  3LEZ A;  1MBL A;  5GHX A;  1Y28 A;  1LLB A;  3UNW A;  3NC8 A;  5L07 A;  1FSW A;  4C3Q A;  2HP6 A;  4ZDX A;  5J8X A;  4YFM A;  2VV6 A;  4XUZ A;  4K91 A;  4JF6 A;  3HBR A;  1RGY A;  1TDG A;  2KOI A;  2XGN A;  1NRF A;  4YOF A;  1GHP A;  1VM1 A;  1ZC2 A;  3UE3 A;  4IHQ A;  4E04 A;  5DKL A;  3ZVW A;  4UQI S;  4RQ9 A;  2JKG A;  1WYB A;  4BWI A;  1ERQ A;  1OTA A;  1BLC A;  5AQA A;  4O01 A;  3S22 A;  3G4P A;  1ZHH B;  1G28 A;  3Q81 A;  4KG6 A;  3ZYT A;  5FSR A;  1E3U D;  1SHV A;  4GOG A;  3QNC A;  1OJG A;  1KVM A;  3GMW A;  4HJ6 A;  3Q7Z A;  2QJ7 A;  4MNR A;  1L0F A;  1S0W A;  1SDN A;  1JVJ A;  3EWK A;  4B88 A;  3HLE A;  2ZOI A;  2XSS A;  1M40 A;  3PXP A;  1BTL A;  1K55 C;  5EVL A;  4DE3 A;  1H8Y A;  4GD6 A;  1YMS A;  4WBG A;  5TJJ A;  3CMZ A;  1TVF A;  4Y3I A;  2R9X A;  3DW0 A;  1TD5 A;  1LSX A;  1VEU A;  3IX4 A;  1VB6 A;  3C7V A;  3AGE A;  1E4D A;  5LBR A;  4OPQ A;  5KIZ A;  3KX0 X;  1XFQ A;  5GLD A;  3ZG8 B;  4GDN A;  1KOU A;  3ISG A;  3O5Y A;  1VEU B;  1PZP A;  2XD1 A;  2EXB A;  1K55 A;  1BSG A;  1XX2 A;  4LEN A;  3N6I A;  3DTK A;  2PYR A;  4M3K A;  3OPR A;  5C5K A;  3T50 A;  4X56 A;  1U60 A;  2ZMF A;  2IWB A;  4PKY G;  4DXB A;  4RX3 A;  4HOI A;  2XA7 M;  2PRF A;  2PR5 A;  3DTI A;  4DJ2 A;  1FCM A;  2OAQ 1;  4IBR A;  3R7W A;  3C7U A;  1IOU A;  3ITB A;  4FH2 A;  3IWO A;  3BLS A;  3E2K A;  1YM1 A;  5EOE A;  5HZH A;  3KSF A;  4E3M A;  3LYX A;  4OQH A;  3IT9 A;  5JYO A;  1TS6 A;  5FDH A;  2XEP A;  3W4O A;  5E2H A;  5EM1 A;  2EFX A;  2ZD8 A;  1BUL A;  3R7W B;  1PW1 A;  2PDR A;  5EUA A;  4OOL A;  2K2N A;  3LO7 A;  2B18 A;  5L09 A;  3C2W A;  5HL1 A;  1MPL A;  4S2L A;  4PHT A;  3WRZ A;  5DTK A;  3LR0 A;  1X0O A;  2Y2M A;  2HZ5 A;  2HJE A;  3ZG5 A;  4QU3 A;  1CI9 A;  3NBL A;  4RX2 A;  1YPR A;  5HWV A;  2WGI A;  1Y54 A;  1IYQ A;  2VX8 A;  5CEC A;  1K57 C;  2EWV A;  1Y4O A;  3CJM A;  2IWD A;  5E43 A;  3KYE A;  3ZNT A;  2B02 A;  1JTD A;  3C5A A;  1F98 A;  2PHY A;  5DF8 A;  2W0N A;  4HES A;  4DE1 A;  3IX8 A;  4OQ0 A;  3BEC A;  3M6B A;  5HFO A;  3RJU A;  1WYC A;  4L9E A;  3IHA A;  3LUQ A;  5MC7 A;  3T1Q B;  3BWL A;  2EX6 A;  1S66 L;  5EOO A;  2V8C A;  1K4E A;  1KVL A;  5FQ9 A;  3TE8 A;  4PM9 A;  3T1S A;  1K57 A;  2EFU A;  3NIA A;  1W79 A;  1S1Y A;  4C6Y A;  5L8M A;  2PD7 A;  3TG9 A;  4NET A;  1O7E A;  1ODV A;  2WKQ A;  3NY4 A;  1NLY A;  2W3E A;  5CXW A;  5HPI A;  2XFT A;  4JLF A;  1BZA A;  1MZU A;  1I5Q A;  1K6R A;  2VJW A;  1OTE A;  2ZM2 A;  1W8Y A;  1KDW A;  4WZ4 A;  5CTN A;  1N4O A;  5TR7 A;  4DN0 A;  1HZO A;  3VOY A;  5KSC A;  1G6O A;  4Y0O A;  1ESI A;  2OLU A;  2KX6 A;  3OPP A;  1PRQ A;  4KG2 A;  2Y2O A;  3UPP A;  2QKP A;  4IUH A;  2XLN A;  3HCY A;  4LPZ A;  2Y2I A;  3DTM A;  3IH8 A;  2HF6 A;  4OPR A;  5CEB A;  2VK3 A;  5HX9 A;  3MZD A;  1PWD A;  2QPN A;  5HAP A;  3VP0 A;  1YT4 A;  5F5Y A;  5CGW A;  3OCN A;  4GDB A;  3MZE A;  4WYY A;  3VFF A;  2B95 A;  1K6S A;  4R70 A;  3NCK A;  3BFD A;  3C4O A;  5HWT A;  2BLS A;  2NUT C;  4BLM A;  4EET B;  1ESU A;  2D02 A;  5A90 A;  1MC0 A;  1XFN A;  3IXG A;  3QP1 A;  4CLC E;  4G3K A;  4DKI A;  1IFQ A;  3FWL A;  2PBY A;  3Q07 A;  4OON A;  1STZ A;  3P01 A;  3P09 A;  4XXR A;  3CZD A;  4N1H A;  2VGL M;  3K2N A;  3T4T A;  5J3W A;  3WRT A;  1BLH A;  2O9B A;  2X01 A;  2RL3 A;  5FAQ A;  1FQG A;  2H0T A;  2JKF A;  2ZQ8 A;  1KGF A;  5CGX A;  3LGO A;  3HVF A;  1H3Q A;  1I2W A;  3WS1 A;  1F2K A;  5U47 A;  2PAV P;  3HLB A;  1NJ4 A;  3NEC A;  4WM9 A;  4OOM A;  1FIL A;  2J9O A;  2YKF A;  2ZMA A;  4D2O A;  3UN7 A;  5F1F A;  1FCO A;  2QMI A;  4P6Z S;  4ESP A;  4JPM A;  2JC7 A;  1HVB A;  5J7E A;  2PR6 A;  3OOV A;  4ZJ2 A;  4MMN A;  2P7J A;  4KQO A;  3TW8 A;  2P08 A;  4LV3 A;  3OZH A;  2H10 A;  3H9W A;  4FD8 A;  2WKP A;  3IXH A;  3IHB A;  4YWZ A;  3BFF A;  1PFL A;  5TGF A;  5FAO A;  3BFG A;  4LRY C;  1KDS A;  3JVU A;  3FZC A;  3N8L A;  2VGJ A;  3HJI A;  1YLP A;  1F5M A;  2CMN A;  1UWP X;  4K0X A;  2HJ9 C;  1JNU A;  4Q0I A;  2LB9 A;  4P0M A;  2K31 A;  3DWK A;  4HI4 A;  1LHY A;  2H0Y A;  4JF4 A;  5I5L A;  4FCF A;  1W7F A;  5FAP A;  4Z1W A;  4XUX A;  2A24 A;  2H5S A;  4HQA A;  3F1P A;  4CPK A;  3BY8 A;  5DTT A;  3OBF A;  3CPT A;  2JBF A;  4L9G A;  4PM8 A;  5CED A;  1K56 A;  3BFE A;  2ZMV A;  3TSG A;  4MN5 A;  3SOI A;  3KSH A;  3MF0 A;  2M7V A;  2A24 B;  3GDI A;  3F1P B;  3W2Z A;  3RH8 B;  4CJN A;  5CHU A;  3DBA A;  3CPT B;  2XDM A;  3N8S A;  3B33 A;  1L0D A;  4R0Q A;  3N7W A;  1LL5 A;  4OH0 A;  4D60 A;  3TOI A;  2VV8 A;  3LY4 A;  4KG5 A;  3A0V A;  2HP9 A;  1NXY A;  2P9V A;  4JGR A;  4WMC D;  2WKH A;  1FSY A;  4X25 A;  1CI8 A;  3UB5 P;  1YSP A;  3RFB A;  3IX3 A;  4PMA A;  4NXB A;  3BEB A;  3PBQ A;  5DTS A;  4WF0 A;  3G30 A;  4JBF A;  2WK0 A;  1MXO A;  5GLC A;  3ULF A;  2E8I A;  3UME A;  2WZZ A;  4KZ3 A;  4U0T A;  4HH3 A;  2WAE A;  1Z6F A;  1YLY A;  3HL9 A;  3PBT A;  2P9V B;  4FUW A;  2HGV A;  2J7V A;  2V20 A;  3P98 A;  1VET A;  2Y8H A;  4GJ4 A;  2ZJ9 A;  4HBU A;  4KZB A;  1ERM A;  2GX5 A;  2O99 A;  3T4S A;  1LT0 A;  2Y2N A;  3C8C A;  4KZ4 A;  3CLO A;  4IUK A;  1N9B A;  4RA7 A;  4Y5F A;  3NUL A;  5CER A;  3HLW A;  2WAD A;  1XJ3 A;  4EWF A;  1W63 M;  3FKV A;  1DY6 A;  3VFH A;  1TS7 A;  1V9Y A;  3RXW A;  3SS4 A;  1VET B;  2OV5 A;  1KGE A;  1PZO A;  3G2Z A;  3CG5 A;  5HL6 A;  1AWI A;  3PYP A;  4NG2 A;  4QPR A;  4B93 A;  4UQI M;  1PIO A;  1W5D A;  3UMD A;  1N9O A;  1I2S A;  5F1G A;  5EVE A;  1UWN X;  3B47 A;  2I72 A;  1S6R A;  1YKD A;  4N9L A;  1GSW A;  4GNU A;  2ZC4 B;  5AQ7 A;  3KSG A;  4OLD A;  2JE5 A;  4R38 A;  3C4P A;  4KZA A;  2WKE A;  2EX2 A;  3PBN A;  1SDE A;  2Y2G A;  3E2L A;  2GDN A;  4LCL A;  2EXA A;  4HH2 A;  5HDC A;  5L2F A;  3ZDJ A;  1XJ2 A;  5F82 A;  2OSU A;  3IF6 C;  4GN2 A;  4OLG A;  1VQQ A;  4OPY A;  3G6O A;  2G2U A;  5GL9 A;  3ITA A;  3IXB A;  3HUM A;  4B4Z A;  4HJ4 A;  1EW0 A;  4WUJ A;  4M4X A;  3OC2 A;  2V1A A;  1IYO A;  1BLP A;  1JWP A;  3ZG7 B;  3MXR A;  3GTC A;  4DRT A;  1K56 D;  2O9A A;  4JXS A;  4II7 A;  1K0K A;  5JYP A;  1A0K A;  5F68 A;  4EUV A;  1ES2 A;  5J4E A;  1L2S A;  2O9C A;  1Z09 A;  3G34 A;  2JCH A;  3U2A A;  3VSK A;  3LIB A;  5HDD A;  1CJF A;  3L9K A;  3LR5 A;  4PM7 A;  1DJB A;  5KZH A;  2VEA A;  2DMW A;  3IF6 A;  1C3B A;  3PTE A;  3BY9 A;  1XKZ A;  3UDI A;  4S2N A;  2Z2L B;  4H8R A;  4JGP A;  4X69 A;  4I39 A;  3GRJ A;  3M2K A;  3MBZ A;  1IEL A;  1NZO A;  2FZ0 A;  4S2J A;  4DDS A;  3IF6 B;  4O8G A;  1K4F A;  3O88 A;  4K08 A;  3GR2 A;  4BJP A;  4LV2 A;  5IT5 A;  5FI7 A;  5M1A A;  3UB8 A;  4BL2 A;  3GVB A;  1BYW A;  3HUO A;  1KE0 A;  3N4I A;  2Z6D A;  1T1C A;  3LID A;  3D3O A;  4LRX C;  3S7O A;  4P6B A;  1DP6 A;  1FCN A;  4RVA A;  5IHV A;  4ZJ1 A;  1LL9 A;  1D7E A;  3MFD A;  1EI5 A;  2I9V A;  1T1A A;  3OPH A;  4ARZ A;  4LFU A;  1IEM A;  4GS9 A;  1L3L A;  4R4R A;  1ACF A;  4K0W A;  4LRZ E;  3PBS A;  3QP8 A;  3A3F A;  2Y55 A;  4ZTK A;  2V2F F;  3QNB A;  1PI5 A;  3EGX C;  3H7W A;  5E2F A;  1G68 A;  3P7N A;  4ARZ B;  5HPF A;  2J80 A;  4WLA A;  4GS9 B;  4OOY A;  4EU0 A;  2ZL1 A;  5FQM A;  1TF1 A;  2Y4A A;  3GV9 A;  3K3D A;  5HDS A;  5E2E A;  5G4Y A;  2GNX A;  2ZQA A;  1RCJ A;  3ZGA B;  3VP2 A;  4HEF A;  2Y2H A;  2VZW A;  4S2I A;  3H7W B;  2Y2P A;  5D3O A;  1CF0 A;  1CEF A;  4WZ5 A;  5TBM A;  4HBT A;  4X1M A;  1MKI A;  3E4P A;  3V50 A;  1YMX A;  4OP8 A;  2ZL1 B;  4CLC A;  3A3J A;  5IS1 A;  3NOP C;  4MBK A;  3AGF A;  2XFS A;  4ZAM A;  5HAQ A;  1XA1 A;  3TRC A;  4KEN B;  5TBM B;  3BRM A;  3KYQ A;  3MQ0 A;  1FOF A;  1BT5 A;  1GHI A;  4YIN A;  2WYX A;  3D72 A;  4E3J A;  4CLC B;  3BJN A;  4QY5 A;  2M1C A;  2UWX A;  2XQZ A;  3IF5 A;  2P04 A;  3NDE A;  2QYB A;  2WZX A;  3RTY A;  2Y2J A;  4ETZ A;  4JXW A;  1GCE A;  2HV1 A;  2DRW A;  1XA7 A;  4EUZ A;  3UB6 A;  4EBL A;  2R9W A;  4OVD A;  3VV4 A;  1LL8 A;  3A3E A;  5EVI A;  3G31 A;  2UV0 E;  5DJT A;  3MXQ A;  1M6K A;  3F1O A;  3OLO A;  2WAF A;  4X1L A;  4NXE A; 
#chains in the Genus database with same CATH homology
 2ZOH A;  2J3T D;  3UE6 A;  1UWP X;  4BWI A;  1OTA A;  2HJ9 C;  1JNU A;  3H82 A;  2LB9 A;  4O01 A;  2K31 A;  3NHQ A;  4Q0I A;  3MFX A;  5CX7 A;  3S7P A;  4HNB A;  3LI9 A;  4HI4 A;  1ZHH B;  1G28 A;  3UB7 A;  5I5L A;  3ZYT A;  2NUP C;  3EEH A;  2MJ6 A;  4Z1W A;  3VE4 A;  3F1O B;  5KSH A;  4BMW A;  4CLC C;  2A24 A;  4HHD A;  4HQA A;  3F1P A;  3R4K A;  5AJG A;  4WEK A;  3BY8 A;  5HD3 A;  1OJG A;  4MCW A;  3T4J A;  2XRN A;  3OBF A;  4HJ6 A;  3H82 B;  2QJ7 A;  3LR3 A;  2A2L A;  4XT2 A;  3EWK A;  4L9G A;  2ZOI A;  2XSS A;  3PXP A;  2ZMV A;  4MN5 A;  5AVE A;  3KSH A;  1V9Z A;  3MF0 A;  2M7V A;  2L0W A;  2A24 B;  3GDI A;  1S4R A;  3EEA A;  5AVF A;  3F1P B;  5TJJ A;  4Y3I A;  3W2Z A;  3OCL A;  4PKY A;  3PBR A;  3RH8 B;  1TD5 A;  1LSX A;  3DBA A;  4JGQ A;  3B33 A;  4XT2 B;  4GCZ A;  4MN7 A;  3MQQ A;  3T4O A;  4YNR A;  1S1Z A;  1VB6 A;  4DJ3 A;  2V0W A;  1F9I A;  4KUK A;  1VHM A;  2R78 A;  5LBR A;  2VV8 A;  5KIZ A;  3A0V A;  2VLG A;  3KX0 X;  1XFQ A;  2PD8 A;  4JGR A;  4MN6 A;  4WEL A;  3CAX A;  2KDK A;  1YSP A;  3RFB A;  4NXB A;  1KOU A;  3PBQ A;  4WF0 A;  4CQH A;  3O5Y A;  4BBV A;  4H6J A;  5G4Z A;  3ULF A;  3UME A;  2Y79 A;  2PYR A;  1TS8 A;  1MKM A;  4HH3 A;  4ZRR A;  5C5K A;  3T50 A;  4GLQ A;  2W1R A;  2ZMF A;  4HIA A;  3FC7 A;  3PBT A;  3EQU A;  2HGV A;  4PKY G;  3NOU C;  4HOI A;  2Y8H A;  2XA7 M;  3PR6 A;  1W63 Q;  4GJ4 A;  4KUO A;  2VA0 A;  3UB9 A;  2PR5 A;  3ICY A;  2GX5 A;  4DJ2 A;  2O99 A;  3S7N A;  2OAQ 1;  3R7W A;  2L4R A;  3T4S A;  4H6J B;  1LT0 A;  1NWZ A;  2OAP 1;  3E98 A;  3C8C A;  1IOU A;  3K3C A;  3CLO A;  4I3J A;  3S7Q A;  3T4L A;  4IUK A;  4ETX A;  4Y5F A;  2V0U A;  3SW1 A;  5HZH A;  1XJ3 A;  3KSF A;  5DKK A;  3LYX A;  1W63 M;  2VKS A;  3VE3 A;  2JN7 A;  1TS6 A;  1TS7 A;  1V9Y A;  4O0P A;  5DJU A;  2L1M A;  2GZA A;  5HSQ A;  4HP9 A;  4R3A A;  5HL6 A;  4BBU A;  1P97 A;  3PYP A;  3CWF A;  4QPR A;  2PYP A;  2IA2 A;  4G3W A;  5DFX A;  3R7W B;  4B93 A;  4EEU A;  4EW7 A;  2PDR A;  4OOL A;  2K2N A;  2JHE A;  2B18 A;  4UQI M;  3UMD A;  3IS2 A;  3C2W A;  1N9O A;  3FPV A;  2KLI A;  4PHT A;  5EFW A;  1UWN X;  3B47 A;  4CLC D;  3LR0 A;  1X0O A;  4L0L A;  4PAU A;  4JGO A;  5DF9 A;  1D06 A;  1YKD A;  3E4O A;  4NKP A;  1GSW A;  2HJE A;  4HP4 A;  1S4S A;  1S67 L;  3KSG A;  3LFV A;  2M7U A;  1NRJ A;  2INW A;  1LSV A;  4R38 A;  3IS2 B;  3PBN A;  5HWV A;  2BAS A;  2D01 A;  3A0S A;  4HH2 A;  5HDC A;  2VX8 A;  2EWV A;  2OOL A;  3CIT A;  1XJ2 A;  1UGU A;  2W3F A;  3BW6 A;  3LIC A;  3LR4 A;  4NXG A;  5FL3 A;  3E4Q A;  3EQV A;  3G6O A;  4G3V A;  2B02 A;  2VGL S;  4ME4 A;  4HJ4 A;  3B42 A;  3NJA A;  5F6A A;  1F98 A;  4L9F A;  2J3T C;  3CUE A;  1EW0 A;  1OT9 A;  2PHY A;  3BQA A;  4Q0J A;  4WUJ A;  1P0Z A;  2O0Y A;  2GJ3 A;  2W3D A;  4M4X A;  3OC2 A;  2V1A A;  2W0N A;  1N9L A;  2OWJ A;  4Q0H A;  2O9A A;  4L9E A;  4II7 A;  3LUQ A;  3C30 A;  4I3I A;  5K5B A;  2QWS A;  3C38 A;  2JKR M;  3A0R A;  5F68 A;  5MC7 A;  4EUV A;  3F1N A;  5J4E A;  1WA9 A;  3BWL A;  4HY8 A;  2O9C A;  1S66 L;  3U2A A;  3BQ8 A;  3LIB A;  5HDD A;  3TE8 A;  3HJK A;  3LIA A;  4EES A;  4R6L A;  4WN5 A;  3LR5 A;  1GSX A;  2K7S A;  3GEC A;  3MQO A;  2VEA A;  3KSI A;  1OTI A;  2DMW A;  4EEP A;  1OT6 A;  2OWH A;  1S1Y A;  4P6Z M;  3BY9 A;  3T4Q A;  5L8M A;  2PD7 A;  3KYZ A;  4JGP A;  5F69 A;  3F1N B;  3LIF A;  1ODV A;  3PHY A;  2WKQ A;  4I39 A;  1DP9 A;  1NLY A;  2W3E A;  5HPI A;  1ZTU A;  2EA9 A;  2FZ0 A;  1MZU A;  4LLO B;  2G7U A;  2VJW A;  1XJ4 A;  1OTE A;  4I38 A;  4O8G A;  4K08 A;  4BJP A;  5IT5 A;  1T18 A;  3UB8 A;  1OTB A;  3MMH A;  1XJ6 A;  2QHK A;  4DN0 A;  1H8M A;  2XRO A;  1G6O A;  3V67 A;  1BYW A;  1TS0 A;  2KX6 A;  4BBT A;  3CUE C;  2QJ5 A;  2QKP A;  4IUH A;  2W1T A;  2Z6D A;  1T1C A;  4LPZ A;  3HCY A;  3LID A;  3D3O A;  4LRX C;  4GHI A;  3S7O A;  1DP6 A;  2HF6 A;  3IBR A;  4HJ3 A;  3T4K A;  3EOI A;  1D7E A;  2J3W A;  1YSQ A;  2I9V A;  4WL9 A;  5IU1 A;  1T1A A;  5DFY A;  1T19 A;  1NLZ A;  4ARZ A;  5F5Y A;  4EQ1 A;  2W1T B;  2EWW A;  4GS9 A;  3OCN A;  2JKT M;  2W27 A;  1P9R A;  4NEE D;  1T1B A;  5HD5 A;  4LRZ E;  4GHI B;  3E0Y A;  3PBS A;  1DRM A;  4R70 A;  1DP8 A;  4WEJ A;  2V1B A;  3MR0 A;  4B9O A;  3JVV A;  5HWT A;  2NUT C;  2Z6C A;  2JKR I;  2FH5 A;  4EET B;  3EGX C;  1N9N A;  3H7W A;  2D02 A;  1MC0 A;  1XFN A;  1OTD A;  4CLC E;  4G3K A;  3MJQ A;  4I5S A;  1IFQ A;  3P7N A;  4KQD A;  4ARZ B;  5HPF A;  1STZ A;  2J80 A;  3P01 A;  2YKH A;  4WLA A;  4GS9 B;  4EU0 A;  1TF1 A;  1OPX A;  3K3D A;  5HDS A;  4DMZ A;  2VGL M;  3K2N A;  5G4Y A;  3T4T A;  2GNX A;  1GSV A;  5J3W A;  4EER A;  3LI8 A;  4IJG A;  2VZW A;  2O9B A;  3H7W B;  4UEY A;  3EGD C;  2W3G A;  4AFI A;  4GW9 A;  1LSW A;  3FG8 A;  3PBO A;  5A8B A;  3VOL A;  5TBM A;  1YAX A;  3E4P A;  4F3L A;  3KO6 A;  1H3Q A;  3FPW A;  2W3H A;  2WKR A;  4CLC A;  2H28 A;  3LIE A;  4FOF A;  5IS1 A;  2ZBB A;  4I3A A;  3NOP C;  4OOM A;  2YKF A;  3IBJ A;  2PT7 A;  4FSF A;  3TRC A;  4NXF A;  5TBM B;  3KYQ A;  3MQ0 A;  4P6Z S;  2XA7 S;  4F3L B;  4EXO A;  5J7E A;  3D72 A;  1Y28 A;  4CLC B;  3BJN A;  2PR6 A;  3OOV A;  2M1C A;  4MMN A;  2P7J A;  2P04 A;  4KQO A;  3TW8 A;  2LB5 A;  4Y2F A;  2P08 A;  2QYB A;  3TJZ C;  3H9W A;  3RTY A;  4MDZ A;  2VV6 A;  2WKP A;  4ETZ A;  2HV1 A;  2KOI A;  4YWZ A;  3CI6 A;  1P9W A;  4YOF A;  1OJ5 A;  3UB6 A;  5HWW A;  2JKT I;  4LRY C;  3JVU A;  3VV4 A;  1LL8 A;  3UE3 A;  3HJI A;  4IHQ A;  5DJT A;  4E04 A;  2V9A A;  3MXQ A;  5DKL A;  3NOT C;  2VV7 A;  3OLO A;  3F1O A;  4UQI S;  4RQ9 A;  3ZQ5 A;  1F5M A;  2CMN A;  4NXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...