1T18A

Early intermediate ie1 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t18A00
2QJ7A 5I5LA 4R70A 2GJ3A 2EA9A 1LSWA 3A0RA 3H7WA 2QJ5A 1XJ6A 3CWFA 4EERA 4WN5A 3LUQA 3MJQA 3MFXA 5AVFA 2PR5A 4PKYG 3FC7A 3LIBA 2PD8A 3K3DA 1TS7A 1DP8A 5F69A 4BBUA 4I3IA 3H9WA 4EW7A 2V1BA 3NOTC 1UWNX 2VEAA 4F3LB 4YWZA 1UWPX 1NWZA 5HZHA 2M1CA 4MN5A 4I39A 3VE3A 5DKLA 1N9NA 4XT2A 1TS6A 3VE4A 1DRMA 1F98A 4HI4A 4JGOA 4KQDA 3T50A 3LICA 5DJTA 3MXQA 5AVEA 3LI8A 5HSQA 1V9ZA 3H7WB 1OTEA 3RTYA 1OTDA 4BBTA 2BASA 3A0SA 3D72A 3EWKA 3IS2A 4K08A 2QWSA 4NXEA 4JGRA 4R6LA 4H6JA 3A0VA 3F1PA 5KIZA 5HWTA 3F1OA 3VOLA 2J80A 3BWLA 2VV7A 3NOPC 1XJ2A 3ICYA 4PKYA 5TBMB 4EEUA 2YKHA 5HDDA 2W27A 2PD7A 4HY8A 2WKRA 4HJ3A 4EETB 4EXOA 1P97A 2WKPA 1G28A 4WUJA 5HDSA 4XT2B 1T1CA 1UGUA 4JGPA 1Y28A 2PYPA 4L9GA 3H82A 3BY8A 3HJIA 2OWJA 2QHKA 4GCZA 2V9AA 4HP4A 2ZOHA 3LI9A 2VLGA 2I9VA 1OJGA 4LPZA 4B9OA 3UB7A 3B33A 2Z6CA 4JGQA 5TBMA 3ULFA 4HP9A 3UB8A 2L1MA 4I5SA 2VV6A 3IS2B 4WLAA 1TS0A 3MQQA 2P7JA 3HJKA 5J3WA 2OOLA 4H6JB 4HNBA 3K3CA 1XFQA 2JHEA 3F1PB 3F1OB 4HQAA 1KOUA 4HJ4A 3NHQA 4DJ3A 3IBRA 1D06A 3P7NA 4L9EA 3UE6A 5HWWA 2PDRA 3NJAA 4LLOB 4WL9A 1MZUA 2D02A 2ZBBA 2L0WA 2V0WA 1D7EA 3E4PA 1LSVA 4HH2A 3CAXA 5F5YA 4HH3A 3F1NA 2HV1A 4MN6A 3ZQ5A 3LIFA 1ODVA 1S4SA 4RQ9A 2A24A 3GDIA 4LRYC 3BY9A 2PYRA 5DKKA 1TS8A 1BYWA 1S1ZA 2V1AA 3H82B 1S66L 5G4ZA 2B02A 4LRXC 4HIAA 5HD5A 1LSXA 5IU1A 5F6AA 3C2WA 5HDCA 4KUKA 4NXBA 5G4YA 4M4XA 1F9IA 4EEPA 1XJ3A 1OT9A 5A8BA 4GHIB 1S67L 3FG8A 1T19A 3E4QA 1X0OA 1GSXA 1WA9A 2CMNA 1OTBA 4NXGA 4GW9A 3SW1A 4DJ2A 4KUOA 1GSWA 2VV8A 5DJUA 4R38A 4I3AA 1OTAA 5F68A 2W0NA 3F1NB 4R3AA 2D01A 2A24B 5J7EA 1T18A 2PR6A 5HD3A 4L9FA 1T1AA 1S4RA 3E4OA 4GS9B 3UMDA 4HJ6A 4GHIA 3LIDA 1LT0A 4WF0A 3KX0X 5EFWA 5J4EA 4NXFA 1N9LA 3MQOA 2INWA 3LIAA 1P0ZA 1DP9A 2YKFA 2V0UA 4BBVA 1S1YA 2L4RA 3UMEA 1VB6A 1OT6A 1V9YA 3PYPA 2PHYA 3C8CA 3PHYA 1T1BA 3UB9A 2K7SA 3G6OA 2QKPA 5HWVA 1OTIA 2KX6A 1OJ5A 4GS9A 4EQ1A 4EESA 3CLOA 2JN7A 4HOIA 4I38A 2H28A 4F3LA 4I3JA 1LL8A 3NOUC 2R78A 3EEHA 3UB6A 1DP6A 1XFNA 1XJ4A 3OLOA 1N9OA 3MR0A 2WKQA 4LRZE 3LYXA 1EW0A 2ZOIA 3LIEA 4HHDA 2OWHA 3GECA 2KDKA 1GSVA 3RH8B 2Z6DA 1JNUA 4E04A 5IS1A
chains in the Genus database with same CATH superfamily
2GJ3A 4LCLA 1LSWA 1NYMA 3A0RA 1MKIA 3CZDA 3H7WA 3W8KA 1MWUA 4U3TA 5C5KA 1XJ6A 3LUQA 1KGFA 3ZYTA 5AVFA 3AGFA 3HLCA 4RA7A 4X53A 3VP2A 2IA2A 4X55A 2PD8A 3IT9A 3E2LA 5JYPA 4YFMA 5FQJA 2V2FF 5E2EA 1XA7A 3NBLA 5FQIA 5HARA 1YLZA 1IKGA 3LY3A 4GZBA 2V1BA 5FQKA 1XX2A 1NWZA 5JYOA 4IVKA 4CJNA 2LB9A 1VM1A 2M1CA 1L3LA 1NY0A 4MN5A 1ERQA 5EVID 2HF6A 1WYBA 5DKLA 1N9NA 4R4RA 1H3QA 1DRMA 1F98A 4DKIA 4GNUA 3GMWA 1EROA 3LICA 5M1AA 2JKFA 2E8JA 1BUEA 4P6ZM 1JWPA 4O01A 3SH9A 3L9KA 1XXMA 4QB8A 3LO7A 4S2IA 3WS2A 3RTYA 3PBNA 1CK3A 3P98A 3U2AA 3MKEA 4IBRA 1TF1A 5HAIA 3T1RA 4B88A 1SZVA 3G35A 2DCFA 4QPRA 5F1FA 2XROA 5A91A 2HDRA 3IXDA 2QWSA 2WGWA 4RX3A 5U47A 4NXEA 4R6LA 3ZG8B 4H6JA 2HDSA 3A0VA 5F83A 2P9VB 3VOLA 4AFIA 3BWLA 5TFQA 1HLUP 2VV7A 3NOPC 3T4SA 2Y55A 1NLZA 4PKYA 1VHMA 4Y13A 4EBLA 1LL9A 1GHIA 3CPTB 1G6AA 2X71A 3FPWA 2WKRA 1SKOA 3V50A 3MZDA 4U0XA 4MNRA 4G3WA 2XD5A 1XGIA 1K6RA 1P97A 3T4KA 4WUJA 4XT2B 5AQ9A 1UGUA 3IF6C 4JGPA 1Y28A 2ZC7A 2PYPA 4LV2A 1EI5A 3UB5P 4DXCA 4R3BA 2OWJA 2QHKA 3A3FA 1WYCA 4M3KA 3FKVA 2ZOHA 3IX4A 1OJGA 3PBSA 4Y0TA 4B9OA 3UB7A 1HVBA 4EBPA 2NUTC 3LEZA 2Y59A 5J3WA 4HNBA 3FYZA 3KSHA 3B42A 3F1PB 1KOUA 3BFCA 4LCMA 1ZG4A 3LFVA 3IBRA 3P7NA 4OP8A 5TR7A 3WS4A 3C4OA 4LLOB 4KZ6A 3NDGA 5CRFA 3QP1A 2ZBBA 2V0WA 3MQ0A 3BFDA 2OV5A 4E3NA 3DWKA 4IHQA 2HV1A 4MN6A 3ZVWA 3AGEA 3ZQ5A 1XP4A 1S4SA 1K4EA 4H8RA 2H0TA 1YM1A 2PYRA 5DKKA 1TS8A 2H5SA 4KZ3A 1W7FA 3UDFA 3AGDA 2XRNA 4EV4A 4ZJ2A 5FAPA 5J8XA 1KE0A 3BFGA 3PAEA 4NXBA 5IT5A 2R9WA 4M4XA 1K54A 5HL1A 2Z2LB 1ONGA 1F9IA 3RFBA 1XJ3A 1A0KA 1M6KA 3MZFA 4PAUA 5AJGA 2ZMAA 3R4KA 1D1JA 2V8FA 4PPRA 2Q9NA 4JXWA 4PM6A 4FOFA 3WS1A 3W4OA 2ZL1B 5CEBA 3IWIA 1WA9A 2CMNA 3I7JA 4NXGA 3IX3A 5HPIA 4UA7A 3C4PA 2ZM8A 2PRFA 2GX5A 3DTKA 3SS5A 3K2NA 4S2NC 3ZNYA 3A3DA 3F1NB 1W8YA 2D01A 1PWDA 3HUMA 1HTZA 1Y4OA 1T18A 4CQHA 2PR6A 4WZ5A 3PBOA 4BD1A 2XDMA 4L9FA 2VGLS 3OOVA 4N9KA 4KZ9A 3LY4A 2HDQA 4GS9B 5GLAA 3BLMA 1LT0A 4WF0A 4CLCE 1KE4A 5EFWA 4IUKA 5L8MA 2R9XA 4Y0UA 5E2GA 3MQOA 4GD8A 3LIAA 1O7EA 1AXBA 1BLPA 4LV1A 5GHZA 3T4OA 2Q0OA 2L4RA 4QY6A 5LBRA 4ARZA 1VB6A 4ZJ1A 4HBUA 1AWIA 4F94A 3U4LP 1IKIA 3A3EA 2A49A 4Q8IA 3UB9A 1ZG6A 2XSSA 4Y15A 1HD8A 2QZ6A 2WKHA 1OJ5A 1ZKJA 2DNSA 2QPNA 2JN7A 3N4IA 4N92A 1FILA 1OPXA 2ZQCA 2H28A 4F3LA 1XKZA 4I3JA 4KQOA 1LL8A 1NZOA 4X6TA 3HL9A 2HGVA 1PWCA 2PAVP 2C5WB 2GDNA 2OSUA 2XEPA 4GJ4A 4OQHA 3IXGA 4WM9A 3LYXA 1TD5A 1EW0A 1Z09A 1KGEA 2ZOIA 4X69A 3QNBA 1YMSA 2FFYA 2Z6DA 2O9BA 1JNUA 1K4FA 2MJ6A 4HBTA 3ZG0A 2XFSA 3PTEA 5I5LA 2PU2A 3S7QA 4PM8A 3WS0A 3Q7ZA 4ZRRA 1GCEA 4NETA 3W2ZA 4NKPA 4EWFA 1XGJA 3D4FA 2QJ5A 3NECA 4KENB 3CWFA 3BYDA 1O07A 1NJ4A 5EVEA 4FH4A 5F1GA 3NY4A 4Y2FA 3JVVA 4Q0HA 1TS7A 1FIKA 1DP8A 3BFEA 3ZG9B 3HVFA 3TOIA 5HPFA 4I3IA 4P0MA 3JVUA 4DDSA 3KYZA 4EW7A 1QMFA 3IHBA 2ACGA 2BG1A 2VEAA 1YT4A 4WMCD 1ERMA 4Y5FA 3IHAA 5DF8A 2RCXA 3VV4A 1YQSA 3G30A 5L2FA 5HZHA 4DE3A 2A2LA 3LR4A 2IWBA 2G7UA 3VFHA 3KYQA 1K25A 4DF6A 4MBFA 3VE3A 1S0WA 5KSHA 4MBHA 1TS6A 3VE4A 5HFOA 3DTMA 3C30A 2FZ0A 4KQQA 5A90A 1H8YA 4GOGA 1E25A 3MXQA 2EFUA 2HZ5A 3LI8A 5DFXA 4UEYA 2HJ9C 1SKOB 4GLQA 1OTDA 4S2LA 3NDEA 4BBTA 5DTTA 2BASA 4LENA 4CLCA 5FATA 3D72A 4B4XA 4EUZA 1BZAA 1CEGA 1JTGA 4IUHA 1N9BA 4BMWA 2WYXA 1W79A 5CX7A 3ZGAB 1GHMA 2UV0E 5KIZA 2Y2LA 3F1OA 3MKFA 4P85A 1Z6FA 1W8QA 3TW8A 2JKRI 3C7UA 1L0DA 2XD1A 2W1TB 3KYEA 1GA0A 1L0FA 1Y54A 4EEUA 4KQRA 1K55C 2FFFB 4UAAA 3PXPA 3BQ8A 4Q0IA 1JVJA 3KSGA 4HY8A 2HPBA 1K57A 5EE8A 4EXOA 5FDSA 4E3MA 3ZNTA 2ZQAA 4NG2A 2K31A 2VGLM 3TSGA 3Q82A 3EGDC 3CHWP 3H82A 1NRJA 2WKEA 4ZDXA 4NEED 1XPBA 3UDXA 3N8LA 3CUEA 4XUXA 2IWDA 4JPMA 2VLGA 4LPZA 4BQMA 1MKMA 2Z6CA 5TBMA 3HCYA 4HP9A 5TJJA 4BD0A 1I2WA 2VV6A 3DW0A 3IH9A 3IS2B 5EVIA 1TS0A 2IWCA 3MQQA 2P7JA 2OAQ1 3MBZA 3IXBA 3K3CA 1XFQA 3BRMA 2JHEA 3B3XA 4EUVA 5EV0A 3MXSA 5DF7A 3NHQA 2EXAA 4C3QA 1IYSA 1OMEA 1DJAA 5CHUA 5FQ9A 1D06A 1CJFA 1VEUA 1NZUA 2VGKA 1JWVA 3L7HA 2D02A 4XUZA 3MMHA 1D7EA 2Y8HA 4ZAMA 1LSVA 3FKWA 3CAXA 4HH2A 2EX6A 2Y2PA 4HH3A 3SH8A 5CHJA 3QHYA 4OOMA 3LIFA 1ODVA 1BT5A 4RQ9A 2GZAA 2Y79A 4OQGA 3BY9A 1BYWA 1S1ZA 5E2HA 4MEZA 2V1AA 2Y2MA 2XGNA 3UNWA 3WRTA 1ZHHB 2B02A 5GLBA 4HIAA 5CERA 1LSXA 4ZBEA 5IU1A 5G4YA 3TG9A 3CMZA 2K2NA 2VGJA 1MWSA 4UA6A 1PZPA 3TRCA 4A5RA 1OT9A 5A8BA 2JE5A 4PM9A 2WUQA 1FQGA 4D60A 1G68A 3IXHA 2EX8A 4JF5A 3E4QA 2J8YA 1ESIA 1JWZA 3D3OA 3A3IA 1Q2QA 3T1QB 4RYEA 1RP5A 5FDHA 3ISGA 2B95A 2FH5A 3N7WA 1GSWA 5EM1A 2VV8A 3QP8A 2VX8A 5DJUA 3ZDJA 5CGSA 3TE8A 3BECA 5F68A 3MS6A 3V3SA 4EQIA 1LI9A 2W0NA 3QP5A 2Y2KA 2VJWA 3O88A 1EWZA 2XQZA 3FPVA 2A24B 4Y7PA 2DRWA 3QP2A 5FQQA 1ES2A 3DBAA 1SCWA 4HJ6A 4GHIA 3LIDA 1JTDA 4ETXA 1PI5A 5FAQA 4E3IA 3KX0X 4IJGA 5EM0A 1N9LA 5CGXA 2INWA 5GHYA 1P0ZA 2NUPC 5CGWA 5GLDA 5EPHA 3V39A 5FI7A 5HAPA 2ZM2A 3C5AA 2PHYA 2XR0A 3ZFZA 4P6BA 1T1BA 3T4TA 1KE3A 4IBXA 2QKPA 2AVXA 4MN7A 5GL9A 2WZXA 5GLCA 1OTIA 3HUOA 3E0YA 1TDGA 1FR1A 2KX6A 4MBKA 4DMZA 4ZTKA 1G6OA 4EESA 3MXRA 3CLOA 5FAOA 3W4QA 1IYQA 2VK3A 5M18A 1DY6A 4PMAA 5D3OA 5F82A 1XJ4A 3EGXC 3OLOA 4OVDA 3MR0A 1W5DA 2WKQA 3S1YA 1MWRA 5E2FA 4CPKA 5HL6A 1ES4A 1GSVA 3RH8B 5HAQA 1RCJA 2EFXA 4BL2A 4R70A 3VP3A 3ZVTA 2EA9A 4FH2A 1S6RA 2HDUA 3C7VA 4Y17A 4WZ4A 3S7NA 3WS5A 4WN5A 4R23A 5AQAA 1TDLA 3MJQA 3D9YA 2PR5A 2EWVA 2I72A 4GDBA 3VMAA 2E8IA 1PW8A 4BBUA 1W63M 4ME4A 2P9VA 4E6WA 3IF6A 4QWOA 4NK3A 4KG2A 3NOTC 1UWNX 3OPHA 3OPLA 3IWQA 1YLWA 1BLSA 3CPTA 3SS3A 1U60A 1BLCA 2WGIA 3M2KA 2OLVA 2EXBA 2ZC4B 4XT2A 4JGOA 2XK1A 3HBRA 2RL3A 4KQDA 3T50A 4PM5A 2WAEA 1N4OA 1Q2PA 4R3JA 4N1XA 1E3UD 2XFTA 1P9WA 1V9ZA 3GTCA 4K91A 3H7WB 1KDSA 3LR3A 5L07A 3S4XA 3A0SA 4DE1A 1IEMA 3UDIA 1FCNA 3OC2A 4L0LA 3EWKA 3O86A 2ZMFA 3T1XA 1K56A 4OP5A 4JXVA 1PNEA 2HJEA 4JGRA 2ZMVA 3WWXA 3G2ZA 2XF3A 3F1PA 3BJNA 3DTIA 4S2KA 2PT7A 5K5BA 5EOOA 1H8ZA 5AQBA 5FA7A 1XJ2A 5TBMB 1MXOA 1IYOA 2YKHA 5HDDA 3UN7A 4GDNA 4E3LA 3VP0A 1I5QA 4HJ3A 4EETB 4OOYA 3BQAA 3RXWA 5FI2A 1FOFA 1T1CA 2W3HA 1YMXA 1G5UA 4OLDA 4B4ZA 3HJIA 3BY8A 5EECA 4X1MA 4UHUA 1DJBA 2XLNA 4WYYA 5KSCA 2V9AA 2W1RA 3QP6A 4Z9QA 3B33A 4OONA 4JGQA 3ULFA 3UB8A 5L09A 4G3VA 4R0QA 3LR0A 4I5SA 2JCHA 3P01A 4WLAA 3MSHA 2VKSA 2WGWB 2M7VA 3WRZA 3N8RA 4UQIS 4H6JB 1PI4A 5FI6A 4S2NA 2OLUA 4HQAA 2WK0A 2CC1A 4PM7A 4WELA 4HJ4A 3CI6A 1IFQA 3V5MA 2HP9A 5HX9A 1BULA 3O5YA 1NRFA 3UE6A 2W3GA 4KZ8A 1YLJA 4R4SA 3NJAA 3O3VA 4YINA 1H5XA 3UE3A 4WL9A 1MZUA 4Y3IA 2L0WA 5DTSA 3LCEA 2Z2MB 4FD8A 2ZD8A 2JKGA 3ITBA 5F5YA 4U0TA 3F1NA 4K0XA 3T12B 3GDIA 4LRYC 4P87A 1P9RA 3DWZA 3O87A 3OPPA 1H8MA 4GKUA 3GQZA 3BLSA 1TVFA 1I2SA 4LV3A 5HD5A 3OBFA 3OPRA 5GHXA 1KGGA 5F6AA 3C2WA 5FQMA 4LV0A 3SOIA 4OPQA 2P04A 1PZOA 4HEFA 4S2PA 3DTEA 1W63Q 2DMWA 4GHIB 5DVAA 1SDEA 1S67L 2XA7S 3FG8A 1ESUA 2W3EA 1NYYA 3T4LA 3CJMA 4OPYA 3EQVA 3FV7A 3E2KA 1KDWA 2ZLYA 3SW1A 2ZC5B 2WAFA 4X1LA 3MZEA 4KUOA 4OH0A 1FSYA 3HLBA 4MLLA 1H0MA 4R38A 4I3AA 4OLGA 2M7UA 2JBFA 1FCMA 3CG5A 4C75A 5L10A 2V1ZA 5HD3A 2H0YA 5FEFA 1T1AA 3E4OA 3IQAA 2J9OA 4LGWA 3PR6A 4KZ5A 2A3UA 5J4EA 4NXFA 3ZCZA 4BENA 1YSQA 1E4DA 4ID4A 2YKFA 2J7VA 2V0UA 3IWOA 2O9CA 1S1YA 3S7PA 2Y2GA 3Q81A 2ZQDA 3GRJA 2Q9MA 3HREA 2O99A 3UMEA 2W3DA 4FCFA 3S22A 3VOYA 4OQ0A 3PHYA 2UWXA 1CEFA 5DF9A 3EEAA 1LI0A 2K7SA 3VSKA 3G6OA 4DRTA 3QP4A 5TGFA 5CEDA 3PBQA 1K54C 1BSGA 1F5MA 3PBRA 1L2SA 3SZTA 1MWTA 1ZTUA 4HOIA 2P08A 3NCKA 3P09A 4MDZA 3V3RA 2R78A 2OAP1 4HESA 1GHPA 3UB6A 1DP6A 1XFNA 1N9OA 3JPUA 3TJZC 2V20A 3IF6B 2WGVA 4FTXA 3LIEA 2OWHA 3HLEA 3LGOA 3RJUA 4JF4A 5CECA 5IS1A 2QJ7A 1FSWA 3R7WA 1LHYA 3BFFA 2GNXA 3GR2A 4GN2A 4WZ5C 4N1HA 4EERA 4ARZB 3G2YA 4R1GA 3MFXA 3A3JA 1VETA 3HUNA 1K55A 2X02A 4PKYG 3FC7A 3LIBA 3K3DA 2EX2A 4UQIM 1IOUA 3CITA 1RGYA 1ALQA 4S2OA 5F69A 4MCWA 1M40A 3IH8A 1CQAA 2Y2IA 3H9WA 3Q7VA 1NLYA 3VOZA 1BTLA 4XXRA 3V67A 4F3LB 5KMWA 4YWZA 2W1TA 1UWPX 2G2UA 3DAVA 1YKDA 3G32A 4I39A 1LL5A 2J3TC 2O9AA 2PU4A 3GVBA 3HLFA 2ZC3B 5EVLA 3LR5A 4OOLA 4HI4A 2Y4AA 1L0EA 1WE4A 4S2MA 4OQIA 5DJTA 1RGZA 5CXWA 5AVEA 5DFYA 3Q07A 5CTNA 5DTKA 5HSQA 4UA9A 1FR6A 1OTEA 4DN0A 1ONHA 1K6SA 3OZHA 1CI8A 5IHVA 2ZJ9A 1MC0A 1SHVA 4O8GA 2WZZA 1CF0A 1IYPA 1STZA 1J3WA 4JKTA 3S7OA 4KZ4A 4B93A 3IS2A 1VQQA 2XA7M 4QU3A 4K08A 1GA9A 3G31A 1IELA 3T4QA 4EU0A 4X25A 1DJCA 5I94A 5M19A 5HWTA 2Y2JA 2J80A 3ICYA 1K38A 3FZCA 4N9LA 2O0YA 1PWGA 2W27A 2PD7A 2B5RA 2J9PA 5E43A 2JKTM 1ES3A 5A93A 1YAXA 3SH7A 4E3KA 2WKPA 1G28A 5HDSA 5EUAA 4KZ7A 4OPRA 1PRQA 2EWWA 2XH9A 1MPLA 3QNCA 2PBYA 4LFUA 4L9GA 1YLTA 4FSFA 2JC7A 1C3BA 4Z1WA 3UE1A 3MF0A 3B47A 1L0GA 1TEMA 3ITAA 1MY8A 3NULA 4BJPA 4GCZA 1LLBA 4EBNA 5BOHA 4HP4A 4CLCB 3LI9A 1CI9A 2I9VA 3ZHHA 3PBTA 2L1MA 3LEQA 3MFDA 3ZG7B 3HJKA 4G3KA 4JXGA 2QYBA 2OOLA 2Y2HA 2WKIA 3JYIA 4MMNA 4OPZA 4IEDA 4ESPA 3F1OB 3N8SA 2Y2NA 2VA0A 1HZOA 3UPNA 4DJ3A 4CLCC 4E3JA 2KOIA 1YSPA 2ZC6B 1E3UA 2BLSA 1ZC2A 4L9EA 5HWWA 2PDRA 4II7A 4WEKA 2P74A 1PIOA 3E4PA 3RXXA 3G34A 2ZM0A 4S2JA 4KG5A 4E3OA 3VP4A 3UPOA 2A24A 4DDYA 1SDNA 3NIAA 1QMEA 3UE0A 3H82B 1S66L 5G4ZA 2J3TD 3ZG5A 4P6ZS 4BLMA 4LRXC 3PAGA 3OCNA 4KG6A 5EOEA 3KSFA 5FASA 1K57C 2JKRM 3M2JA 2HP5A 5MC7A 3BW6A 3GSGA 1MBLA 5HDCA 4KUKA 1PW1A 4O0PA 1YPRA 1YLPA 4DXBA 3GV9A 4EEPA 5EVIB 5CHMA 5FL3A 1K56D 5CTMA 4QHCA 4K0WA 4JBFA 4DE0A 4YNRA 3C38A 4IVIA 4E6XA 1BLHA 1KVLA 1K0KA 1T19A 4ETZA 5AQ7A 1X0OA 2EX9A 3CUEC 4KZAA 4BWIA 1GSXA 1SKFA 2G2WA 4JXSA 2WADA 1OTBA 3SS4A 1VEUB 3BEBA 3IX8A 4GW9A 2H10A 4DJ2A 5EVIC 4X68A 3N6IA 2JKTI 2QMIA 4QD4A 5FEGA 1NXYA 2HP6A 3NI9A 1FCOA 4WMCA 4OKPA 1F2KA 3EOIA 1OTAA 1ES5A 4R3AA 3KSIA 1PYYA 3VFFA 3KO6A 4GD6A 4FUWA 3IBJA 5J7EA 3FWLA 1S4RA 3UMDA 5HW3A 3HLGA 4RX2A 5FSRA 2J3WA 2Y91A 2Y2QA 4JLFA 4ZJ3A 4X56A 4Y0OA 2ZL1A 1ACFA 1DP9A 3UPPA 4BBVA 4O7DA 4D2OA 4DE2A 3W4PA 5A92A 3UO9A 3M6HA 2B18A 1XA1A 3VSLA 1OT6A 1V9YA 3IF5A 3PYPA 3T4JA 3C8CA 1J9MA 4QY5A 1YLYA 2PBDP 4Q0JA 4PHTA 4WEJA 4QJGA 4YOFA 3R7WB 4BL3A 5HWVA 4GB7A 2X01A 3EQUA 4GS9A 2BTFP 4EQ1A 3UY6A 2KLIA 4I38A 4KZBA 1VETB 2LB5A 1KVMA 3NC8A 4CLCD 3NOUC 2VZWA 2W3FA 4WBGA 5G18A 3EEHA 3G4PA 3M6BA 3OCLA 3E98A 4RVAA 4JF6A 4LRZE 1PFLA 2C6WB 3BM6A 2ZQ9A 3HLDA 3Q1FA 4C6YA 3Q7VB 4HHDA 2ZQ7A 3VP1A 2ZQ8A 3GECA 3HLWA 2KDKA 3T1SA 2Y2OA 5KZHA 4E04A 2V8CA
chains in the Genus database with same CATH topology
2QJ7A 5I5LA 4R70A 2GJ3A 3S7QA 3R7WA 2EA9A 1LSWA 3A0RA 4ZRRA 3H7WA 2GNXA 3W2ZA 4NKPA 2QJ5A 3S7NA 5C5KA 1XJ6A 3CWFA 4EERA 4WN5A 3LUQA 4ARZB 3MJQA 3ZYTA 3MFXA 5AVFA 2PR5A 2IA2A 4PKYG 2EWVA 3FC7A 3LIBA 2PD8A 4Y2FA 3K3DA 4UQIM 3JVVA 4Q0HA 1TS7A 1IOUA 1DP8A 3CITA 5F69A 4MCWA 5HPFA 4BBUA 1W63M 4ME4A 4I3IA 3JVUA 3KYZA 3H9WA 4EW7A 2V1BA 1NLYA 3NOTC 1UWNX 3V67A 2VEAA 4F3LB 4YWZA 2W1TA 1UWPX 4Y5FA 1NWZA 3VV4A 5HZHA 2LB9A 2A2LA 2M1CA 3LR4A 2G7UA 1YKDA 4MN5A 4I39A 3KYQA 2HF6A 2J3TC 2O9AA 3VE3A 5DKLA 1N9NA 5KSHA 3LR5A 4XT2A 1H3QA 1TS6A 3VE4A 1DRMA 1F98A 4OOLA 4HI4A 4JGOA 3C30A 4KQDA 2FZ0A 3T50A 3LICA 5DJTA 3MXQA 5AVEA 5DFYA 4P6ZM 3LI8A 5DFXA 5HSQA 4UEYA 4O01A 2HJ9C 1P9WA 1V9ZA 3H7WB 1OTEA 3PBNA 4GLQA 3RTYA 1OTDA 4DN0A 3LR3A 3U2AA 1TF1A 4BBTA 2BASA 4CLCA 3A0SA 1MC0A 3D72A 4O8GA 3OC2A 4L0LA 3EWKA 1STZA 4IUHA 4QPRA 2XROA 4BMWA 2ZMFA 3S7OA 4B93A 3IS2A 2XA7M 4K08A 2QWSA 5CX7A 4NXEA 2HJEA 4JGRA 2ZMVA 4R6LA 3T4QA 4EU0A 4H6JA 3A0VA 3F1PA 5KIZA 3BJNA 5HWTA 3F1OA 3VOLA 2PT7A 4AFIA 2J80A 5K5BA 3BWLA 2VV7A 3NOPC 3T4SA 3TW8A 1NLZA 2JKRI 1XJ2A 3ICYA 4PKYA 5TBMB 1VHMA 2W1TB 4EEUA 2YKHA 2O0YA 5HDDA 3PXPA 3BQ8A 4Q0IA 2W27A 3KSGA 2PD7A 4HY8A 3FPWA 2JKTM 2WKRA 1YAXA 4G3WA 4HJ3A 4EETB 4EXOA 1P97A 3BQAA 2WKPA 3T4KA 1G28A 4WUJA 5HDSA 4XT2B 1T1CA 1UGUA 2EWWA 4JGPA 1Y28A 2W3HA 2K31A 2VGLM 2PYPA 4L9GA 3EGDC 3H82A 3BY8A 1NRJA 3HJIA 4FSFA 2OWJA 4Z1WA 3MF0A 4NEED 2QHKA 3B47A 4BJPA 4GCZA 3CUEA 2V9AA 4HP4A 2W1RA 4CLCB 2ZOHA 3LI9A 2VLGA 2I9VA 1OJGA 3PBSA 4LPZA 3PBTA 1MKMA 3UB7A 3B33A 4B9OA 2Z6CA 4JGQA 5TBMA 3HCYA 3ULFA 4HP9A 5TJJA 2L1MA 3UB8A 4G3VA 2NUTC 3LR0A 4I5SA 3P01A 2VV6A 3IS2B 4WLAA 1TS0A 2VKSA 3MQQA 2P7JA 3HJKA 2M7VA 4G3KA 2OAQ1 2QYBA 4UQIS 5J3WA 2OOLA 4H6JB 4HNBA 3K3CA 3KSHA 1XFQA 3B42A 2JHEA 3F1PB 4MMNA 3F1OB 4HQAA 4EUVA 1KOUA 4WELA 2VA0A 4HJ4A 3CI6A 3NHQA 1IFQA 4DJ3A 4CLCC 3LFVA 3IBRA 2KOIA 1YSPA 1D06A 3O5YA 3P7NA 4L9EA 3UE6A 2W3GA 5HWWA 2PDRA 3NJAA 4II7A 4WEKA 4LLOB 3UE3A 4WL9A 1MZUA 2D02A 2ZBBA 2L0WA 3MMHA 4Y3IA 2V0WA 1D7EA 2Y8HA 3MQ0A 3E4PA 1LSVA 4HH2A 3CAXA 5F5YA 4HH3A 3F1NA 2HV1A 4IHQA 4MN6A 4OOMA 3ZQ5A 3LIFA 1ODVA 1S4SA 4RQ9A 2A24A 2GZAA 2Y79A 3GDIA 4LRYC 3BY9A 2PYRA 5DKKA 1TS8A 1P9RA 1BYWA 1S1ZA 2V1AA 3H82B 1S66L 1H8MA 5G4ZA 2J3TD 1ZHHB 2B02A 4P6ZS 4LRXC 2XRNA 4HIAA 3OCNA 3KSFA 5HD5A 1LSXA 2JKRM 3OBFA 5MC7A 3BW6A 5IU1A 5F6AA 3C2WA 5HDCA 4KUKA 4NXBA 5G4YA 4O0PA 5IT5A 4M4XA 1F9IA 2K2NA 2P04A 3RFBA 4EEPA 1XJ3A 3TRCA 4PAUA 1OT9A 5FL3A 5A8BA 5AJGA 1W63Q 3R4KA 2DMWA 4YNRA 4GHIB 3C38A 1S67L 2XA7S 3FG8A 2W3EA 1T19A 3E4QA 4ETZA 3T4LA 1X0OA 4FOFA 3CUEC 4BWIA 1GSXA 3D3OA 3EQVA 1WA9A 2CMNA 1OTBA 4NXGA 4GW9A 5HPIA 3SW1A 2FH5A 4DJ2A 4KUOA 1GSWA 2JKTI 2GX5A 2VV8A 3K2NA 2VX8A 5DJUA 3TE8A 3EOIA 4R38A 4I3AA 1OTAA 5F68A 2W0NA 2M7UA 3F1NB 2VJWA 4R3AA 3KSIA 2D01A 3KO6A 3FPVA 2A24B 3IBJA 5J7EA 1T18A 4CQHA 2PR6A 3PBOA 5HD3A 4L9FA 2VGLS 3OOVA 1T1AA 1S4RA 3E4OA 4GS9B 3DBAA 3UMDA 4HJ6A 4GHIA 3LIDA 4ETXA 1LT0A 4WF0A 3PR6A 4CLCE 3KX0X 4IJGA 5EFWA 5J4EA 4IUKA 5L8MA 2J3WA 4NXFA 1N9LA 3MQOA 2INWA 1YSQA 3LIAA 1P0ZA 2NUPC 1DP9A 2YKFA 2V0UA 4BBVA 2O9CA 1S1YA 3S7PA 2B18A 3T4OA 2L4RA 5LBRA 2O99A 3UMEA 4ARZA 1VB6A 1OT6A 2W3DA 1V9YA 3PYPA 3T4JA 2PHYA 3C8CA 3PHYA 5DF9A 4Q0JA 1T1BA 3EEAA 3UB9A 2K7SA 4PHTA 3T4TA 2XSSA 4WEJA 3G6OA 2QKPA 4YOFA 3R7WB 3PBQA 5HWVA 4MN7A 1OTIA 1F5MA 3E0YA 2KX6A 1OJ5A 3EQUA 4GS9A 3PBRA 4DMZA 4EQ1A 1G6OA 4EESA 1ZTUA 3CLOA 2JN7A 4HOIA 2KLIA 4I38A 2P08A 1OPXA 2LB5A 2H28A 4F3LA 4I3JA 4KQOA 1LL8A 4MDZA 4CLCD 3NOUC 2VZWA 2R78A 2W3FA 2OAP1 3EEHA 2HGVA 3UB6A 1DP6A 1XFNA 1XJ4A 3EGXC 3OCLA 3OLOA 3E98A 1N9OA 3MR0A 2WKQA 4GJ4A 4LRZE 3LYXA 1TD5A 1EW0A 3TJZC 2ZOIA 5HL6A 3LIEA 4HHDA 2OWHA 3GECA 2KDKA 1GSVA 3RH8B 2Z6DA 2O9BA 1JNUA 4E04A 5IS1A 2MJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ7 A;  5I5L A;  4R70 A;  2GJ3 A;  2EA9 A;  1LSW A;  3A0R A;  3H7W A;  2QJ5 A;  1XJ6 A;  3CWF A;  4EER A;  4WN5 A;  3LUQ A;  3MJQ A;  3MFX A;  5AVF A;  2PR5 A;  4PKY G;  3FC7 A;  3LIB A;  2PD8 A;  3K3D A;  1TS7 A;  1DP8 A;  5F69 A;  4BBU A;  4I3I A;  3H9W A;  4EW7 A;  2V1B A;  3NOT C;  1UWN X;  2VEA A;  4F3L B;  4YWZ A;  1UWP X;  1NWZ A;  5HZH A;  2M1C A;  4MN5 A;  4I39 A;  3VE3 A;  5DKL A;  1N9N A;  4XT2 A;  1TS6 A;  3VE4 A;  1DRM A;  1F98 A;  4HI4 A;  4JGO A;  4KQD A;  3T50 A;  3LIC A;  5DJT A;  3MXQ A;  5AVE A;  3LI8 A;  5HSQ A;  1V9Z A;  3H7W B;  1OTE A;  3RTY A;  1OTD A;  4BBT A;  2BAS A;  3A0S A;  3D72 A;  3EWK A;  3IS2 A;  4K08 A;  2QWS A;  4NXE A;  4JGR A;  4R6L A;  4H6J A;  3A0V A;  3F1P A;  5KIZ A;  5HWT A;  3F1O A;  3VOL A;  2J80 A;  3BWL A;  2VV7 A;  3NOP C;  1XJ2 A;  3ICY A;  4PKY A;  5TBM B;  4EEU A;  2YKH A;  5HDD A;  2W27 A;  2PD7 A;  4HY8 A;  2WKR A;  4HJ3 A;  4EET B;  4EXO A;  1P97 A;  2WKP A;  1G28 A;  4WUJ A;  5HDS A;  4XT2 B;  1T1C A;  1UGU A;  4JGP A;  1Y28 A;  2PYP A;  4L9G A;  3H82 A;  3BY8 A;  3HJI A;  2OWJ A;  2QHK A;  4GCZ A;  2V9A A;  4HP4 A;  2ZOH A;  3LI9 A;  2VLG A;  2I9V A;  1OJG A;  4LPZ A;  4B9O A;  3UB7 A;  3B33 A;  2Z6C A;  4JGQ A;  5TBM A;  3ULF A;  4HP9 A;  3UB8 A;  2L1M A;  4I5S A;  2VV6 A;  3IS2 B;  4WLA A;  1TS0 A;  3MQQ A;  2P7J A;  3HJK A;  5J3W A;  2OOL A;  4H6J B;  4HNB A;  3K3C A;  1XFQ A;  2JHE A;  3F1P B;  3F1O B;  4HQA A;  1KOU A;  4HJ4 A;  3NHQ A;  4DJ3 A;  3IBR A;  1D06 A;  3P7N A;  4L9E A;  3UE6 A;  5HWW A;  2PDR A;  3NJA A;  4LLO B;  4WL9 A;  1MZU A;  2D02 A;  2ZBB A;  2L0W A;  2V0W A;  1D7E A;  3E4P A;  1LSV A;  4HH2 A;  3CAX A;  5F5Y A;  4HH3 A;  3F1N A;  2HV1 A;  4MN6 A;  3ZQ5 A;  3LIF A;  1ODV A;  1S4S A;  4RQ9 A;  2A24 A;  3GDI A;  4LRY C;  3BY9 A;  2PYR A;  5DKK A;  1TS8 A;  1BYW A;  1S1Z A;  2V1A A;  3H82 B;  1S66 L;  5G4Z A;  2B02 A;  4LRX C;  4HIA A;  5HD5 A;  1LSX A;  5IU1 A;  5F6A A;  3C2W A;  5HDC A;  4KUK A;  4NXB A;  5G4Y A;  4M4X A;  1F9I A;  4EEP A;  1XJ3 A;  1OT9 A;  5A8B A;  4GHI B;  1S67 L;  3FG8 A;  1T19 A;  3E4Q A;  1X0O A;  1GSX A;  1WA9 A;  2CMN A;  1OTB A;  4NXG A;  4GW9 A;  3SW1 A;  4DJ2 A;  4KUO A;  1GSW A;  2VV8 A;  5DJU A;  4R38 A;  4I3A A;  1OTA A;  5F68 A;  2W0N A;  3F1N B;  4R3A A;  2D01 A;  2A24 B;  5J7E A;  1T18 A;  2PR6 A;  5HD3 A;  4L9F A;  1T1A A;  1S4R A;  3E4O A;  4GS9 B;  3UMD A;  4HJ6 A;  4GHI A;  3LID A;  1LT0 A;  4WF0 A;  3KX0 X;  5EFW A;  5J4E A;  4NXF A;  1N9L A;  3MQO A;  2INW A;  3LIA A;  1P0Z A;  1DP9 A;  2YKF A;  2V0U A;  4BBV A;  1S1Y A;  2L4R A;  3UME A;  1VB6 A;  1OT6 A;  1V9Y A;  3PYP A;  2PHY A;  3C8C A;  3PHY A;  1T1B A;  3UB9 A;  2K7S A;  3G6O A;  2QKP A;  5HWV A;  1OTI A;  2KX6 A;  1OJ5 A;  4GS9 A;  4EQ1 A;  4EES A;  3CLO A;  2JN7 A;  4HOI A;  4I38 A;  2H28 A;  4F3L A;  4I3J A;  1LL8 A;  3NOU C;  2R78 A;  3EEH A;  3UB6 A;  1DP6 A;  1XFN A;  1XJ4 A;  3OLO A;  1N9O A;  3MR0 A;  2WKQ A;  4LRZ E;  3LYX A;  1EW0 A;  2ZOI A;  3LIE A;  4HHD A;  2OWH A;  3GEC A;  2KDK A;  1GSV A;  3RH8 B;  2Z6D A;  1JNU A;  4E04 A;  5IS1 A; 
#chains in the Genus database with same CATH topology
 2GJ3 A;  4LCL A;  1LSW A;  1NYM A;  3A0R A;  1MKI A;  3CZD A;  3H7W A;  3W8K A;  1MWU A;  4U3T A;  5C5K A;  1XJ6 A;  3LUQ A;  1KGF A;  3ZYT A;  5AVF A;  3AGF A;  3HLC A;  4RA7 A;  4X53 A;  3VP2 A;  2IA2 A;  4X55 A;  2PD8 A;  3IT9 A;  3E2L A;  5JYP A;  4YFM A;  5FQJ A;  2V2F F;  5E2E A;  1XA7 A;  3NBL A;  5FQI A;  5HAR A;  1YLZ A;  1IKG A;  3LY3 A;  4GZB A;  2V1B A;  5FQK A;  1XX2 A;  1NWZ A;  5JYO A;  4IVK A;  4CJN A;  2LB9 A;  1VM1 A;  2M1C A;  1L3L A;  1NY0 A;  4MN5 A;  1ERQ A;  5EVI D;  2HF6 A;  1WYB A;  5DKL A;  1N9N A;  4R4R A;  1H3Q A;  1DRM A;  1F98 A;  4DKI A;  4GNU A;  3GMW A;  1ERO A;  3LIC A;  5M1A A;  2JKF A;  2E8J A;  1BUE A;  4P6Z M;  1JWP A;  4O01 A;  3SH9 A;  3L9K A;  1XXM A;  4QB8 A;  3LO7 A;  4S2I A;  3WS2 A;  3RTY A;  3PBN A;  1CK3 A;  3P98 A;  3U2A A;  3MKE A;  4IBR A;  1TF1 A;  5HAI A;  3T1R A;  4B88 A;  1SZV A;  3G35 A;  2DCF A;  4QPR A;  5F1F A;  2XRO A;  5A91 A;  2HDR A;  3IXD A;  2QWS A;  2WGW A;  4RX3 A;  5U47 A;  4NXE A;  4R6L A;  3ZG8 B;  4H6J A;  2HDS A;  3A0V A;  5F83 A;  2P9V B;  3VOL A;  4AFI A;  3BWL A;  5TFQ A;  1HLU P;  2VV7 A;  3NOP C;  3T4S A;  2Y55 A;  1NLZ A;  4PKY A;  1VHM A;  4Y13 A;  4EBL A;  1LL9 A;  1GHI A;  3CPT B;  1G6A A;  2X71 A;  3FPW A;  2WKR A;  1SKO A;  3V50 A;  3MZD A;  4U0X A;  4MNR A;  4G3W A;  2XD5 A;  1XGI A;  1K6R A;  1P97 A;  3T4K A;  4WUJ A;  4XT2 B;  5AQ9 A;  1UGU A;  3IF6 C;  4JGP A;  1Y28 A;  2ZC7 A;  2PYP A;  4LV2 A;  1EI5 A;  3UB5 P;  4DXC A;  4R3B A;  2OWJ A;  2QHK A;  3A3F A;  1WYC A;  4M3K A;  3FKV A;  2ZOH A;  3IX4 A;  1OJG A;  3PBS A;  4Y0T A;  4B9O A;  3UB7 A;  1HVB A;  4EBP A;  2NUT C;  3LEZ A;  2Y59 A;  5J3W A;  4HNB A;  3FYZ A;  3KSH A;  3B42 A;  3F1P B;  1KOU A;  3BFC A;  4LCM A;  1ZG4 A;  3LFV A;  3IBR A;  3P7N A;  4OP8 A;  5TR7 A;  3WS4 A;  3C4O A;  4LLO B;  4KZ6 A;  3NDG A;  5CRF A;  3QP1 A;  2ZBB A;  2V0W A;  3MQ0 A;  3BFD A;  2OV5 A;  4E3N A;  3DWK A;  4IHQ A;  2HV1 A;  4MN6 A;  3ZVW A;  3AGE A;  3ZQ5 A;  1XP4 A;  1S4S A;  1K4E A;  4H8R A;  2H0T A;  1YM1 A;  2PYR A;  5DKK A;  1TS8 A;  2H5S A;  4KZ3 A;  1W7F A;  3UDF A;  3AGD A;  2XRN A;  4EV4 A;  4ZJ2 A;  5FAP A;  5J8X A;  1KE0 A;  3BFG A;  3PAE A;  4NXB A;  5IT5 A;  2R9W A;  4M4X A;  1K54 A;  5HL1 A;  2Z2L B;  1ONG A;  1F9I A;  3RFB A;  1XJ3 A;  1A0K A;  1M6K A;  3MZF A;  4PAU A;  5AJG A;  2ZMA A;  3R4K A;  1D1J A;  2V8F A;  4PPR A;  2Q9N A;  4JXW A;  4PM6 A;  4FOF A;  3WS1 A;  3W4O A;  2ZL1 B;  5CEB A;  3IWI A;  1WA9 A;  2CMN A;  3I7J A;  4NXG A;  3IX3 A;  5HPI A;  4UA7 A;  3C4P A;  2ZM8 A;  2PRF A;  2GX5 A;  3DTK A;  3SS5 A;  3K2N A;  4S2N C;  3ZNY A;  3A3D A;  3F1N B;  1W8Y A;  2D01 A;  1PWD A;  3HUM A;  1HTZ A;  1Y4O A;  1T18 A;  4CQH A;  2PR6 A;  4WZ5 A;  3PBO A;  4BD1 A;  2XDM A;  4L9F A;  2VGL S;  3OOV A;  4N9K A;  4KZ9 A;  3LY4 A;  2HDQ A;  4GS9 B;  5GLA A;  3BLM A;  1LT0 A;  4WF0 A;  4CLC E;  1KE4 A;  5EFW A;  4IUK A;  5L8M A;  2R9X A;  4Y0U A;  5E2G A;  3MQO A;  4GD8 A;  3LIA A;  1O7E A;  1AXB A;  1BLP A;  4LV1 A;  5GHZ A;  3T4O A;  2Q0O A;  2L4R A;  4QY6 A;  5LBR A;  4ARZ A;  1VB6 A;  4ZJ1 A;  4HBU A;  1AWI A;  4F94 A;  3U4L P;  1IKI A;  3A3E A;  2A49 A;  4Q8I A;  3UB9 A;  1ZG6 A;  2XSS A;  4Y15 A;  1HD8 A;  2QZ6 A;  2WKH A;  1OJ5 A;  1ZKJ A;  2DNS A;  2QPN A;  2JN7 A;  3N4I A;  4N92 A;  1FIL A;  1OPX A;  2ZQC A;  2H28 A;  4F3L A;  1XKZ A;  4I3J A;  4KQO A;  1LL8 A;  1NZO A;  4X6T A;  3HL9 A;  2HGV A;  1PWC A;  2PAV P;  2C5W B;  2GDN A;  2OSU A;  2XEP A;  4GJ4 A;  4OQH A;  3IXG A;  4WM9 A;  3LYX A;  1TD5 A;  1EW0 A;  1Z09 A;  1KGE A;  2ZOI A;  4X69 A;  3QNB A;  1YMS A;  2FFY A;  2Z6D A;  2O9B A;  1JNU A;  1K4F A;  2MJ6 A;  4HBT A;  3ZG0 A;  2XFS A;  3PTE A;  5I5L A;  2PU2 A;  3S7Q A;  4PM8 A;  3WS0 A;  3Q7Z A;  4ZRR A;  1GCE A;  4NET A;  3W2Z A;  4NKP A;  4EWF A;  1XGJ A;  3D4F A;  2QJ5 A;  3NEC A;  4KEN B;  3CWF A;  3BYD A;  1O07 A;  1NJ4 A;  5EVE A;  4FH4 A;  5F1G A;  3NY4 A;  4Y2F A;  3JVV A;  4Q0H A;  1TS7 A;  1FIK A;  1DP8 A;  3BFE A;  3ZG9 B;  3HVF A;  3TOI A;  5HPF A;  4I3I A;  4P0M A;  3JVU A;  4DDS A;  3KYZ A;  4EW7 A;  1QMF A;  3IHB A;  2ACG A;  2BG1 A;  2VEA A;  1YT4 A;  4WMC D;  1ERM A;  4Y5F A;  3IHA A;  5DF8 A;  2RCX A;  3VV4 A;  1YQS A;  3G30 A;  5L2F A;  5HZH A;  4DE3 A;  2A2L A;  3LR4 A;  2IWB A;  2G7U A;  3VFH A;  3KYQ A;  1K25 A;  4DF6 A;  4MBF A;  3VE3 A;  1S0W A;  5KSH A;  4MBH A;  1TS6 A;  3VE4 A;  5HFO A;  3DTM A;  3C30 A;  2FZ0 A;  4KQQ A;  5A90 A;  1H8Y A;  4GOG A;  1E25 A;  3MXQ A;  2EFU A;  2HZ5 A;  3LI8 A;  5DFX A;  4UEY A;  2HJ9 C;  1SKO B;  4GLQ A;  1OTD A;  4S2L A;  3NDE A;  4BBT A;  5DTT A;  2BAS A;  4LEN A;  4CLC A;  5FAT A;  3D72 A;  4B4X A;  4EUZ A;  1BZA A;  1CEG A;  1JTG A;  4IUH A;  1N9B A;  4BMW A;  2WYX A;  1W79 A;  5CX7 A;  3ZGA B;  1GHM A;  2UV0 E;  5KIZ A;  2Y2L A;  3F1O A;  3MKF A;  4P85 A;  1Z6F A;  1W8Q A;  3TW8 A;  2JKR I;  3C7U A;  1L0D A;  2XD1 A;  2W1T B;  3KYE A;  1GA0 A;  1L0F A;  1Y54 A;  4EEU A;  4KQR A;  1K55 C;  2FFF B;  4UAA A;  3PXP A;  3BQ8 A;  4Q0I A;  1JVJ A;  3KSG A;  4HY8 A;  2HPB A;  1K57 A;  5EE8 A;  4EXO A;  5FDS A;  4E3M A;  3ZNT A;  2ZQA A;  4NG2 A;  2K31 A;  2VGL M;  3TSG A;  3Q82 A;  3EGD C;  3CHW P;  3H82 A;  1NRJ A;  2WKE A;  4ZDX A;  4NEE D;  1XPB A;  3UDX A;  3N8L A;  3CUE A;  4XUX A;  2IWD A;  4JPM A;  2VLG A;  4LPZ A;  4BQM A;  1MKM A;  2Z6C A;  5TBM A;  3HCY A;  4HP9 A;  5TJJ A;  4BD0 A;  1I2W A;  2VV6 A;  3DW0 A;  3IH9 A;  3IS2 B;  5EVI A;  1TS0 A;  2IWC A;  3MQQ A;  2P7J A;  2OAQ 1;  3MBZ A;  3IXB A;  3K3C A;  1XFQ A;  3BRM A;  2JHE A;  3B3X A;  4EUV A;  5EV0 A;  3MXS A;  5DF7 A;  3NHQ A;  2EXA A;  4C3Q A;  1IYS A;  1OME A;  1DJA A;  5CHU A;  5FQ9 A;  1D06 A;  1CJF A;  1VEU A;  1NZU A;  2VGK A;  1JWV A;  3L7H A;  2D02 A;  4XUZ A;  3MMH A;  1D7E A;  2Y8H A;  4ZAM A;  1LSV A;  3FKW A;  3CAX A;  4HH2 A;  2EX6 A;  2Y2P A;  4HH3 A;  3SH8 A;  5CHJ A;  3QHY A;  4OOM A;  3LIF A;  1ODV A;  1BT5 A;  4RQ9 A;  2GZA A;  2Y79 A;  4OQG A;  3BY9 A;  1BYW A;  1S1Z A;  5E2H A;  4MEZ A;  2V1A A;  2Y2M A;  2XGN A;  3UNW A;  3WRT A;  1ZHH B;  2B02 A;  5GLB A;  4HIA A;  5CER A;  1LSX A;  4ZBE A;  5IU1 A;  5G4Y A;  3TG9 A;  3CMZ A;  2K2N A;  2VGJ A;  1MWS A;  4UA6 A;  1PZP A;  3TRC A;  4A5R A;  1OT9 A;  5A8B A;  2JE5 A;  4PM9 A;  2WUQ A;  1FQG A;  4D60 A;  1G68 A;  3IXH A;  2EX8 A;  4JF5 A;  3E4Q A;  2J8Y A;  1ESI A;  1JWZ A;  3D3O A;  3A3I A;  1Q2Q A;  3T1Q B;  4RYE A;  1RP5 A;  5FDH A;  3ISG A;  2B95 A;  2FH5 A;  3N7W A;  1GSW A;  5EM1 A;  2VV8 A;  3QP8 A;  2VX8 A;  5DJU A;  3ZDJ A;  5CGS A;  3TE8 A;  3BEC A;  5F68 A;  3MS6 A;  3V3S A;  4EQI A;  1LI9 A;  2W0N A;  3QP5 A;  2Y2K A;  2VJW A;  3O88 A;  1EWZ A;  2XQZ A;  3FPV A;  2A24 B;  4Y7P A;  2DRW A;  3QP2 A;  5FQQ A;  1ES2 A;  3DBA A;  1SCW A;  4HJ6 A;  4GHI A;  3LID A;  1JTD A;  4ETX A;  1PI5 A;  5FAQ A;  4E3I A;  3KX0 X;  4IJG A;  5EM0 A;  1N9L A;  5CGX A;  2INW A;  5GHY A;  1P0Z A;  2NUP C;  5CGW A;  5GLD A;  5EPH A;  3V39 A;  5FI7 A;  5HAP A;  2ZM2 A;  3C5A A;  2PHY A;  2XR0 A;  3ZFZ A;  4P6B A;  1T1B A;  3T4T A;  1KE3 A;  4IBX A;  2QKP A;  2AVX A;  4MN7 A;  5GL9 A;  2WZX A;  5GLC A;  1OTI A;  3HUO A;  3E0Y A;  1TDG A;  1FR1 A;  2KX6 A;  4MBK A;  4DMZ A;  4ZTK A;  1G6O A;  4EES A;  3MXR A;  3CLO A;  5FAO A;  3W4Q A;  1IYQ A;  2VK3 A;  5M18 A;  1DY6 A;  4PMA A;  5D3O A;  5F82 A;  1XJ4 A;  3EGX C;  3OLO A;  4OVD A;  3MR0 A;  1W5D A;  2WKQ A;  3S1Y A;  1MWR A;  5E2F A;  4CPK A;  5HL6 A;  1ES4 A;  1GSV A;  3RH8 B;  5HAQ A;  1RCJ A;  2EFX A;  4BL2 A;  4R70 A;  3VP3 A;  3ZVT A;  2EA9 A;  4FH2 A;  1S6R A;  2HDU A;  3C7V A;  4Y17 A;  4WZ4 A;  3S7N A;  3WS5 A;  4WN5 A;  4R23 A;  5AQA A;  1TDL A;  3MJQ A;  3D9Y A;  2PR5 A;  2EWV A;  2I72 A;  4GDB A;  3VMA A;  2E8I A;  1PW8 A;  4BBU A;  1W63 M;  4ME4 A;  2P9V A;  4E6W A;  3IF6 A;  4QWO A;  4NK3 A;  4KG2 A;  3NOT C;  1UWN X;  3OPH A;  3OPL A;  3IWQ A;  1YLW A;  1BLS A;  3CPT A;  3SS3 A;  1U60 A;  1BLC A;  2WGI A;  3M2K A;  2OLV A;  2EXB A;  2ZC4 B;  4XT2 A;  4JGO A;  2XK1 A;  3HBR A;  2RL3 A;  4KQD A;  3T50 A;  4PM5 A;  2WAE A;  1N4O A;  1Q2P A;  4R3J A;  4N1X A;  1E3U D;  2XFT A;  1P9W A;  1V9Z A;  3GTC A;  4K91 A;  3H7W B;  1KDS A;  3LR3 A;  5L07 A;  3S4X A;  3A0S A;  4DE1 A;  1IEM A;  3UDI A;  1FCN A;  3OC2 A;  4L0L A;  3EWK A;  3O86 A;  2ZMF A;  3T1X A;  1K56 A;  4OP5 A;  4JXV A;  1PNE A;  2HJE A;  4JGR A;  2ZMV A;  3WWX A;  3G2Z A;  2XF3 A;  3F1P A;  3BJN A;  3DTI A;  4S2K A;  2PT7 A;  5K5B A;  5EOO A;  1H8Z A;  5AQB A;  5FA7 A;  1XJ2 A;  5TBM B;  1MXO A;  1IYO A;  2YKH A;  5HDD A;  3UN7 A;  4GDN A;  4E3L A;  3VP0 A;  1I5Q A;  4HJ3 A;  4EET B;  4OOY A;  3BQA A;  3RXW A;  5FI2 A;  1FOF A;  1T1C A;  2W3H A;  1YMX A;  1G5U A;  4OLD A;  4B4Z A;  3HJI A;  3BY8 A;  5EEC A;  4X1M A;  4UHU A;  1DJB A;  2XLN A;  4WYY A;  5KSC A;  2V9A A;  2W1R A;  3QP6 A;  4Z9Q A;  3B33 A;  4OON A;  4JGQ A;  3ULF A;  3UB8 A;  5L09 A;  4G3V A;  4R0Q A;  3LR0 A;  4I5S A;  2JCH A;  3P01 A;  4WLA A;  3MSH A;  2VKS A;  2WGW B;  2M7V A;  3WRZ A;  3N8R A;  4UQI S;  4H6J B;  1PI4 A;  5FI6 A;  4S2N A;  2OLU A;  4HQA A;  2WK0 A;  2CC1 A;  4PM7 A;  4WEL A;  4HJ4 A;  3CI6 A;  1IFQ A;  3V5M A;  2HP9 A;  5HX9 A;  1BUL A;  3O5Y A;  1NRF A;  3UE6 A;  2W3G A;  4KZ8 A;  1YLJ A;  4R4S A;  3NJA A;  3O3V A;  4YIN A;  1H5X A;  3UE3 A;  4WL9 A;  1MZU A;  4Y3I A;  2L0W A;  5DTS A;  3LCE A;  2Z2M B;  4FD8 A;  2ZD8 A;  2JKG A;  3ITB A;  5F5Y A;  4U0T A;  3F1N A;  4K0X A;  3T12 B;  3GDI A;  4LRY C;  4P87 A;  1P9R A;  3DWZ A;  3O87 A;  3OPP A;  1H8M A;  4GKU A;  3GQZ A;  3BLS A;  1TVF A;  1I2S A;  4LV3 A;  5HD5 A;  3OBF A;  3OPR A;  5GHX A;  1KGG A;  5F6A A;  3C2W A;  5FQM A;  4LV0 A;  3SOI A;  4OPQ A;  2P04 A;  1PZO A;  4HEF A;  4S2P A;  3DTE A;  1W63 Q;  2DMW A;  4GHI B;  5DVA A;  1SDE A;  1S67 L;  2XA7 S;  3FG8 A;  1ESU A;  2W3E A;  1NYY A;  3T4L A;  3CJM A;  4OPY A;  3EQV A;  3FV7 A;  3E2K A;  1KDW A;  2ZLY A;  3SW1 A;  2ZC5 B;  2WAF A;  4X1L A;  3MZE A;  4KUO A;  4OH0 A;  1FSY A;  3HLB A;  4MLL A;  1H0M A;  4R38 A;  4I3A A;  4OLG A;  2M7U A;  2JBF A;  1FCM A;  3CG5 A;  4C75 A;  5L10 A;  2V1Z A;  5HD3 A;  2H0Y A;  5FEF A;  1T1A A;  3E4O A;  3IQA A;  2J9O A;  4LGW A;  3PR6 A;  4KZ5 A;  2A3U A;  5J4E A;  4NXF A;  3ZCZ A;  4BEN A;  1YSQ A;  1E4D A;  4ID4 A;  2YKF A;  2J7V A;  2V0U A;  3IWO A;  2O9C A;  1S1Y A;  3S7P A;  2Y2G A;  3Q81 A;  2ZQD A;  3GRJ A;  2Q9M A;  3HRE A;  2O99 A;  3UME A;  2W3D A;  4FCF A;  3S22 A;  3VOY A;  4OQ0 A;  3PHY A;  2UWX A;  1CEF A;  5DF9 A;  3EEA A;  1LI0 A;  2K7S A;  3VSK A;  3G6O A;  4DRT A;  3QP4 A;  5TGF A;  5CED A;  3PBQ A;  1K54 C;  1BSG A;  1F5M A;  3PBR A;  1L2S A;  3SZT A;  1MWT A;  1ZTU A;  4HOI A;  2P08 A;  3NCK A;  3P09 A;  4MDZ A;  3V3R A;  2R78 A;  2OAP 1;  4HES A;  1GHP A;  3UB6 A;  1DP6 A;  1XFN A;  1N9O A;  3JPU A;  3TJZ C;  2V20 A;  3IF6 B;  2WGV A;  4FTX A;  3LIE A;  2OWH A;  3HLE A;  3LGO A;  3RJU A;  4JF4 A;  5CEC A;  5IS1 A;  2QJ7 A;  1FSW A;  3R7W A;  1LHY A;  3BFF A;  2GNX A;  3GR2 A;  4GN2 A;  4WZ5 C;  4N1H A;  4EER A;  4ARZ B;  3G2Y A;  4R1G A;  3MFX A;  3A3J A;  1VET A;  3HUN A;  1K55 A;  2X02 A;  4PKY G;  3FC7 A;  3LIB A;  3K3D A;  2EX2 A;  4UQI M;  1IOU A;  3CIT A;  1RGY A;  1ALQ A;  4S2O A;  5F69 A;  4MCW A;  1M40 A;  3IH8 A;  1CQA A;  2Y2I A;  3H9W A;  3Q7V A;  1NLY A;  3VOZ A;  1BTL A;  4XXR A;  3V67 A;  4F3L B;  5KMW A;  4YWZ A;  2W1T A;  1UWP X;  2G2U A;  3DAV A;  1YKD A;  3G32 A;  4I39 A;  1LL5 A;  2J3T C;  2O9A A;  2PU4 A;  3GVB A;  3HLF A;  2ZC3 B;  5EVL A;  3LR5 A;  4OOL A;  4HI4 A;  2Y4A A;  1L0E A;  1WE4 A;  4S2M A;  4OQI A;  5DJT A;  1RGZ A;  5CXW A;  5AVE A;  5DFY A;  3Q07 A;  5CTN A;  5DTK A;  5HSQ A;  4UA9 A;  1FR6 A;  1OTE A;  4DN0 A;  1ONH A;  1K6S A;  3OZH A;  1CI8 A;  5IHV A;  2ZJ9 A;  1MC0 A;  1SHV A;  4O8G A;  2WZZ A;  1CF0 A;  1IYP A;  1STZ A;  1J3W A;  4JKT A;  3S7O A;  4KZ4 A;  4B93 A;  3IS2 A;  1VQQ A;  2XA7 M;  4QU3 A;  4K08 A;  1GA9 A;  3G31 A;  1IEL A;  3T4Q A;  4EU0 A;  4X25 A;  1DJC A;  5I94 A;  5M19 A;  5HWT A;  2Y2J A;  2J80 A;  3ICY A;  1K38 A;  3FZC A;  4N9L A;  2O0Y A;  1PWG A;  2W27 A;  2PD7 A;  2B5R A;  2J9P A;  5E43 A;  2JKT M;  1ES3 A;  5A93 A;  1YAX A;  3SH7 A;  4E3K A;  2WKP A;  1G28 A;  5HDS A;  5EUA A;  4KZ7 A;  4OPR A;  1PRQ A;  2EWW A;  2XH9 A;  1MPL A;  3QNC A;  2PBY A;  4LFU A;  4L9G A;  1YLT A;  4FSF A;  2JC7 A;  1C3B A;  4Z1W A;  3UE1 A;  3MF0 A;  3B47 A;  1L0G A;  1TEM A;  3ITA A;  1MY8 A;  3NUL A;  4BJP A;  4GCZ A;  1LLB A;  4EBN A;  5BOH A;  4HP4 A;  4CLC B;  3LI9 A;  1CI9 A;  2I9V A;  3ZHH A;  3PBT A;  2L1M A;  3LEQ A;  3MFD A;  3ZG7 B;  3HJK A;  4G3K A;  4JXG A;  2QYB A;  2OOL A;  2Y2H A;  2WKI A;  3JYI A;  4MMN A;  4OPZ A;  4IED A;  4ESP A;  3F1O B;  3N8S A;  2Y2N A;  2VA0 A;  1HZO A;  3UPN A;  4DJ3 A;  4CLC C;  4E3J A;  2KOI A;  1YSP A;  2ZC6 B;  1E3U A;  2BLS A;  1ZC2 A;  4L9E A;  5HWW A;  2PDR A;  4II7 A;  4WEK A;  2P74 A;  1PIO A;  3E4P A;  3RXX A;  3G34 A;  2ZM0 A;  4S2J A;  4KG5 A;  4E3O A;  3VP4 A;  3UPO A;  2A24 A;  4DDY A;  1SDN A;  3NIA A;  1QME A;  3UE0 A;  3H82 B;  1S66 L;  5G4Z A;  2J3T D;  3ZG5 A;  4P6Z S;  4BLM A;  4LRX C;  3PAG A;  3OCN A;  4KG6 A;  5EOE A;  3KSF A;  5FAS A;  1K57 C;  2JKR M;  3M2J A;  2HP5 A;  5MC7 A;  3BW6 A;  3GSG A;  1MBL A;  5HDC A;  4KUK A;  1PW1 A;  4O0P A;  1YPR A;  1YLP A;  4DXB A;  3GV9 A;  4EEP A;  5EVI B;  5CHM A;  5FL3 A;  1K56 D;  5CTM A;  4QHC A;  4K0W A;  4JBF A;  4DE0 A;  4YNR A;  3C38 A;  4IVI A;  4E6X A;  1BLH A;  1KVL A;  1K0K A;  1T19 A;  4ETZ A;  5AQ7 A;  1X0O A;  2EX9 A;  3CUE C;  4KZA A;  4BWI A;  1GSX A;  1SKF A;  2G2W A;  4JXS A;  2WAD A;  1OTB A;  3SS4 A;  1VEU B;  3BEB A;  3IX8 A;  4GW9 A;  2H10 A;  4DJ2 A;  5EVI C;  4X68 A;  3N6I A;  2JKT I;  2QMI A;  4QD4 A;  5FEG A;  1NXY A;  2HP6 A;  3NI9 A;  1FCO A;  4WMC A;  4OKP A;  1F2K A;  3EOI A;  1OTA A;  1ES5 A;  4R3A A;  3KSI A;  1PYY A;  3VFF A;  3KO6 A;  4GD6 A;  4FUW A;  3IBJ A;  5J7E A;  3FWL A;  1S4R A;  3UMD A;  5HW3 A;  3HLG A;  4RX2 A;  5FSR A;  2J3W A;  2Y91 A;  2Y2Q A;  4JLF A;  4ZJ3 A;  4X56 A;  4Y0O A;  2ZL1 A;  1ACF A;  1DP9 A;  3UPP A;  4BBV A;  4O7D A;  4D2O A;  4DE2 A;  3W4P A;  5A92 A;  3UO9 A;  3M6H A;  2B18 A;  1XA1 A;  3VSL A;  1OT6 A;  1V9Y A;  3IF5 A;  3PYP A;  3T4J A;  3C8C A;  1J9M A;  4QY5 A;  1YLY A;  2PBD P;  4Q0J A;  4PHT A;  4WEJ A;  4QJG A;  4YOF A;  3R7W B;  4BL3 A;  5HWV A;  4GB7 A;  2X01 A;  3EQU A;  4GS9 A;  2BTF P;  4EQ1 A;  3UY6 A;  2KLI A;  4I38 A;  4KZB A;  1VET B;  2LB5 A;  1KVM A;  3NC8 A;  4CLC D;  3NOU C;  2VZW A;  2W3F A;  4WBG A;  5G18 A;  3EEH A;  3G4P A;  3M6B A;  3OCL A;  3E98 A;  4RVA A;  4JF6 A;  4LRZ E;  1PFL A;  2C6W B;  3BM6 A;  2ZQ9 A;  3HLD A;  3Q1F A;  4C6Y A;  3Q7V B;  4HHD A;  2ZQ7 A;  3VP1 A;  2ZQ8 A;  3GEC A;  3HLW A;  2KDK A;  3T1S A;  2Y2O A;  5KZH A;  4E04 A;  2V8C A; 
#chains in the Genus database with same CATH homology
 2QJ7 A;  5I5L A;  4R70 A;  2GJ3 A;  3S7Q A;  3R7W A;  2EA9 A;  1LSW A;  3A0R A;  4ZRR A;  3H7W A;  2GNX A;  3W2Z A;  4NKP A;  2QJ5 A;  3S7N A;  5C5K A;  1XJ6 A;  3CWF A;  4EER A;  4WN5 A;  3LUQ A;  4ARZ B;  3MJQ A;  3ZYT A;  3MFX A;  5AVF A;  2PR5 A;  2IA2 A;  4PKY G;  2EWV A;  3FC7 A;  3LIB A;  2PD8 A;  4Y2F A;  3K3D A;  4UQI M;  3JVV A;  4Q0H A;  1TS7 A;  1IOU A;  1DP8 A;  3CIT A;  5F69 A;  4MCW A;  5HPF A;  4BBU A;  1W63 M;  4ME4 A;  4I3I A;  3JVU A;  3KYZ A;  3H9W A;  4EW7 A;  2V1B A;  1NLY A;  3NOT C;  1UWN X;  3V67 A;  2VEA A;  4F3L B;  4YWZ A;  2W1T A;  1UWP X;  4Y5F A;  1NWZ A;  3VV4 A;  5HZH A;  2LB9 A;  2A2L A;  2M1C A;  3LR4 A;  2G7U A;  1YKD A;  4MN5 A;  4I39 A;  3KYQ A;  2HF6 A;  2J3T C;  2O9A A;  3VE3 A;  5DKL A;  1N9N A;  5KSH A;  3LR5 A;  4XT2 A;  1H3Q A;  1TS6 A;  3VE4 A;  1DRM A;  1F98 A;  4OOL A;  4HI4 A;  4JGO A;  3C30 A;  4KQD A;  2FZ0 A;  3T50 A;  3LIC A;  5DJT A;  3MXQ A;  5AVE A;  5DFY A;  4P6Z M;  3LI8 A;  5DFX A;  5HSQ A;  4UEY A;  4O01 A;  2HJ9 C;  1P9W A;  1V9Z A;  3H7W B;  1OTE A;  3PBN A;  4GLQ A;  3RTY A;  1OTD A;  4DN0 A;  3LR3 A;  3U2A A;  1TF1 A;  4BBT A;  2BAS A;  4CLC A;  3A0S A;  1MC0 A;  3D72 A;  4O8G A;  3OC2 A;  4L0L A;  3EWK A;  1STZ A;  4IUH A;  4QPR A;  2XRO A;  4BMW A;  2ZMF A;  3S7O A;  4B93 A;  3IS2 A;  2XA7 M;  4K08 A;  2QWS A;  5CX7 A;  4NXE A;  2HJE A;  4JGR A;  2ZMV A;  4R6L A;  3T4Q A;  4EU0 A;  4H6J A;  3A0V A;  3F1P A;  5KIZ A;  3BJN A;  5HWT A;  3F1O A;  3VOL A;  2PT7 A;  4AFI A;  2J80 A;  5K5B A;  3BWL A;  2VV7 A;  3NOP C;  3T4S A;  3TW8 A;  1NLZ A;  2JKR I;  1XJ2 A;  3ICY A;  4PKY A;  5TBM B;  1VHM A;  2W1T B;  4EEU A;  2YKH A;  2O0Y A;  5HDD A;  3PXP A;  3BQ8 A;  4Q0I A;  2W27 A;  3KSG A;  2PD7 A;  4HY8 A;  3FPW A;  2JKT M;  2WKR A;  1YAX A;  4G3W A;  4HJ3 A;  4EET B;  4EXO A;  1P97 A;  3BQA A;  2WKP A;  3T4K A;  1G28 A;  4WUJ A;  5HDS A;  4XT2 B;  1T1C A;  1UGU A;  2EWW A;  4JGP A;  1Y28 A;  2W3H A;  2K31 A;  2VGL M;  2PYP A;  4L9G A;  3EGD C;  3H82 A;  3BY8 A;  1NRJ A;  3HJI A;  4FSF A;  2OWJ A;  4Z1W A;  3MF0 A;  4NEE D;  2QHK A;  3B47 A;  4BJP A;  4GCZ A;  3CUE A;  2V9A A;  4HP4 A;  2W1R A;  4CLC B;  2ZOH A;  3LI9 A;  2VLG A;  2I9V A;  1OJG A;  3PBS A;  4LPZ A;  3PBT A;  1MKM A;  3UB7 A;  3B33 A;  4B9O A;  2Z6C A;  4JGQ A;  5TBM A;  3HCY A;  3ULF A;  4HP9 A;  5TJJ A;  2L1M A;  3UB8 A;  4G3V A;  2NUT C;  3LR0 A;  4I5S A;  3P01 A;  2VV6 A;  3IS2 B;  4WLA A;  1TS0 A;  2VKS A;  3MQQ A;  2P7J A;  3HJK A;  2M7V A;  4G3K A;  2OAQ 1;  2QYB A;  4UQI S;  5J3W A;  2OOL A;  4H6J B;  4HNB A;  3K3C A;  3KSH A;  1XFQ A;  3B42 A;  2JHE A;  3F1P B;  4MMN A;  3F1O B;  4HQA A;  4EUV A;  1KOU A;  4WEL A;  2VA0 A;  4HJ4 A;  3CI6 A;  3NHQ A;  1IFQ A;  4DJ3 A;  4CLC C;  3LFV A;  3IBR A;  2KOI A;  1YSP A;  1D06 A;  3O5Y A;  3P7N A;  4L9E A;  3UE6 A;  2W3G A;  5HWW A;  2PDR A;  3NJA A;  4II7 A;  4WEK A;  4LLO B;  3UE3 A;  4WL9 A;  1MZU A;  2D02 A;  2ZBB A;  2L0W A;  3MMH A;  4Y3I A;  2V0W A;  1D7E A;  2Y8H A;  3MQ0 A;  3E4P A;  1LSV A;  4HH2 A;  3CAX A;  5F5Y A;  4HH3 A;  3F1N A;  2HV1 A;  4IHQ A;  4MN6 A;  4OOM A;  3ZQ5 A;  3LIF A;  1ODV A;  1S4S A;  4RQ9 A;  2A24 A;  2GZA A;  2Y79 A;  3GDI A;  4LRY C;  3BY9 A;  2PYR A;  5DKK A;  1TS8 A;  1P9R A;  1BYW A;  1S1Z A;  2V1A A;  3H82 B;  1S66 L;  1H8M A;  5G4Z A;  2J3T D;  1ZHH B;  2B02 A;  4P6Z S;  4LRX C;  2XRN A;  4HIA A;  3OCN A;  3KSF A;  5HD5 A;  1LSX A;  2JKR M;  3OBF A;  5MC7 A;  3BW6 A;  5IU1 A;  5F6A A;  3C2W A;  5HDC A;  4KUK A;  4NXB A;  5G4Y A;  4O0P A;  5IT5 A;  4M4X A;  1F9I A;  2K2N A;  2P04 A;  3RFB A;  4EEP A;  1XJ3 A;  3TRC A;  4PAU A;  1OT9 A;  5FL3 A;  5A8B A;  5AJG A;  1W63 Q;  3R4K A;  2DMW A;  4YNR A;  4GHI B;  3C38 A;  1S67 L;  2XA7 S;  3FG8 A;  2W3E A;  1T19 A;  3E4Q A;  4ETZ A;  3T4L A;  1X0O A;  4FOF A;  3CUE C;  4BWI A;  1GSX A;  3D3O A;  3EQV A;  1WA9 A;  2CMN A;  1OTB A;  4NXG A;  4GW9 A;  5HPI A;  3SW1 A;  2FH5 A;  4DJ2 A;  4KUO A;  1GSW A;  2JKT I;  2GX5 A;  2VV8 A;  3K2N A;  2VX8 A;  5DJU A;  3TE8 A;  3EOI A;  4R38 A;  4I3A A;  1OTA A;  5F68 A;  2W0N A;  2M7U A;  3F1N B;  2VJW A;  4R3A A;  3KSI A;  2D01 A;  3KO6 A;  3FPV A;  2A24 B;  3IBJ A;  5J7E A;  1T18 A;  4CQH A;  2PR6 A;  3PBO A;  5HD3 A;  4L9F A;  2VGL S;  3OOV A;  1T1A A;  1S4R A;  3E4O A;  4GS9 B;  3DBA A;  3UMD A;  4HJ6 A;  4GHI A;  3LID A;  4ETX A;  1LT0 A;  4WF0 A;  3PR6 A;  4CLC E;  3KX0 X;  4IJG A;  5EFW A;  5J4E A;  4IUK A;  5L8M A;  2J3W A;  4NXF A;  1N9L A;  3MQO A;  2INW A;  1YSQ A;  3LIA A;  1P0Z A;  2NUP C;  1DP9 A;  2YKF A;  2V0U A;  4BBV A;  2O9C A;  1S1Y A;  3S7P A;  2B18 A;  3T4O A;  2L4R A;  5LBR A;  2O99 A;  3UME A;  4ARZ A;  1VB6 A;  1OT6 A;  2W3D A;  1V9Y A;  3PYP A;  3T4J A;  2PHY A;  3C8C A;  3PHY A;  5DF9 A;  4Q0J A;  1T1B A;  3EEA A;  3UB9 A;  2K7S A;  4PHT A;  3T4T A;  2XSS A;  4WEJ A;  3G6O A;  2QKP A;  4YOF A;  3R7W B;  3PBQ A;  5HWV A;  4MN7 A;  1OTI A;  1F5M A;  3E0Y A;  2KX6 A;  1OJ5 A;  3EQU A;  4GS9 A;  3PBR A;  4DMZ A;  4EQ1 A;  1G6O A;  4EES A;  1ZTU A;  3CLO A;  2JN7 A;  4HOI A;  2KLI A;  4I38 A;  2P08 A;  1OPX A;  2LB5 A;  2H28 A;  4F3L A;  4I3J A;  4KQO A;  1LL8 A;  4MDZ A;  4CLC D;  3NOU C;  2VZW A;  2R78 A;  2W3F A;  2OAP 1;  3EEH A;  2HGV A;  3UB6 A;  1DP6 A;  1XFN A;  1XJ4 A;  3EGX C;  3OCL A;  3OLO A;  3E98 A;  1N9O A;  3MR0 A;  2WKQ A;  4GJ4 A;  4LRZ E;  3LYX A;  1TD5 A;  1EW0 A;  3TJZ C;  2ZOI A;  5HL6 A;  3LIE A;  4HHD A;  2OWH A;  3GEC A;  2KDK A;  1GSV A;  3RH8 B;  2Z6D A;  2O9B A;  1JNU A;  4E04 A;  5IS1 A;  2MJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...