1T18A

Early intermediate ie1 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t18A00
3B33A 3LIBA 1N9LA 2OWJA 3LICA 4MN5A 2HV1A 2JHEA 3C2WA 4KUKA 2W27A 3A0VA 4RQ9A 3H9WA 3UB7A 3HJIA 4L9FA 1T1BA 4NXEA 1N9OA 2A24A 2VLGA 5EFWA 3NOTC 4NXBA 5J7EA 4K08A 3A0RA 4HJ4A 1UGUA 2BASA 1UWPX 2D01A 4I38A 4WUJA 2L1MA 4EETB 4NXGA 4LPZA 1F9IA 4DJ2A 5F69A 3LYXA 3F1NB 4MN6A 4GHIB 3F1NA 1GSXA 5A8BA 2JN7A 1WA9A 2J80A 2QJ5A 3E4QA 1GSVA 4KQDA 3H82B 2ZBBA 1X0OA 4BBTA 4B9OA 3C8CA 2V0UA 2PD7A 3UB9A 2I9VA 2V9AA 1TS0A 2V1BA 2WKQA 4R3AA 4HIAA 4I5SA 4E04A 3LIFA 1XJ2A 1F98A 3E4PA 4HNBA 2M1CA 5HD5A 2PHYA 2Z6CA 1XJ3A 4WN5A 2VV8A 3LUQA 5IS1A 4EW7A 1LSVA 1DRMA 2B02A 2D02A 1VB6A 1LSWA 4EQ1A 2QHKA 4GS9A 3LI8A 2QWSA 2YKFA 2OWHA 2Z6DA 4EXOA 4LRZE 1T1CA 4H6JA 4GW9A 1TS8A 2QKPA 4I39A 1XJ6A 4HJ6A 2VV6A 4BBUA 3LIAA 4F3LA 2W0NA 2QJ7A 3GECA 4EEPA 4L9EA 3NJAA 3F1PA 2A24B 1TS6A 5J4EA 3MQQA 3OLOA 3NOPC 1V9YA 3K3DA 3EWKA 4PKYA 5HWVA 5IU1A 4GCZA 5HD3A 3UB8A 5HZHA 1S1ZA 3VE4A 4I3JA 3GDIA 4JGQA 2PYRA 3BWLA 1T18A 3FG8A 2INWA 1OT9A 5HWWA 1D7EA 3BY8A 1OTIA 3MFXA 3BY9A 4HY8A 3MXQA 3CWFA 3IS2A 3HJKA 2GJ3A 5HDSA 5HDDA 1MZUA 1T19A 4R38A 3MR0A 3RTYA 4HOIA 1JNUA 3LIEA 4HQAA 2V0WA 4JGRA 4WLAA 2PDRA 5DJTA 4KUOA 3F1OA 3D72A 5F68A 5HSQA 3G6OA 3KX0X 1S66L 3CAXA 3H7WB 4R70A 1P0ZA 1G28A 2PD8A 3H7WA 1Y28A 2PR6A 1S4RA 1OTDA 5I5LA 4WF0A 2L0WA 1GSWA 4LRYC 1XFNA 1S4SA 2H28A 1OJ5A 3PYPA 3VOLA 3LI9A 1DP9A 2EA9A 4GS9B 5F5YA 2WKRA 1XJ4A 5AVEA 3ULFA 5KIZA 4H6JB 1TS7A 3A0SA 2P7JA 4BBVA 4LLOB 1T1AA 4WL9A 5HWTA 5TBMA 3EEHA 3P7NA 4HH2A 4F3LB 3MJQA 3UB6A 2YKHA 2PYPA 5DKKA 4DJ3A 1LT0A 1OT6A 3F1PB 1OTBA 3UE6A 4HP4A 4HJ3A 1D06A 4M4XA 4EERA 1KOUA 1BYWA 4JGPA 2CMNA 2V1AA 1EW0A 2L4RA 2WKPA 1NWZA 3ICYA 4L9GA 3IS2B 3SW1A 2OOLA 5AVFA 4HP9A 4NXFA 1V9ZA 3E4OA 2PR5A 5DJUA 1OJGA 2K7SA 3F1OB 4GHIA 1S1YA 4EEUA 1UWNX 1OTEA 4YWZA 1DP8A 5G4YA 3VE3A 1OTAA 4I3IA 5F6AA 3UMEA 3H82A 4EESA 5G4ZA 4HH3A 4HHDA 1LL8A 5J3WA 4HI4A 3MQOA 1S67L 1DP6A 3K3CA 3LIDA 3UMDA 2VV7A 1LSXA 1XFQA 1P97A 2KX6A 4LRXC 4R6LA 3PHYA 3ZQ5A 4I3AA 3T50A 4XT2B 2VEAA 3NOUC 2ZOHA 4XT2A 5TBMB 4JGOA 2R78A 3FC7A 2KDKA 5HDCA 1N9NA 2ZOIA 3NHQA 5DKLA 1ODVA 4PKYG 3CLOA 3RH8B 3IBRA
chains in the Genus database with same CATH superfamily
3TG9A 1L0EA 5FQJA 5FEGA 4MBHA 4BJPA 2J9PA 4KZ5A 3B33A 3OPHA 3LICA 1L0FA 2VGLM 3IF5A 4HEFA 1RP5A 5CXWA 4RQ9A 4FCFA 3UB7A 1NZOA 1PI4A 1FIKA 3HJIA 4L9FA 3NC8A 4ETZA 2A24A 5EFWA 2Y2KA 2Y79A 5MC7A 3SZTA 1ERQA 4NXBA 3N8LA 3MBZA 4K08A 3PBRA 4E3KA 1UGUA 1ES2A 1UWPX 1ZC2A 1SKOB 2B18A 2D01A 4I38A 5EM1A 2QZ6A 3QP4A 2WZXA 1C3BA 1H0MA 3PBNA 1ZG4A 3MSHA 1CEGA 4Q0HA 4G3WA 5FAOA 4BQMA 2WK0A 3DWKA 1RGYA 4GHIB 3F1NA 3ZG0A 3IWQA 2JN7A 5CGXA 2XROA 1WYBA 5FI7A 3GSGA 4QY5A 1FCOA 2QJ5A 4MDZA 3LO7A 4KQDA 4BWIA 3H82B 3NBLA 3P98A 3ZHHA 4C75A 2EX8A 1S0WA 4KZ3A 3R7WB 4OOLA 4BBTA 3BW6A 4B9OA 1IELA 2V0UA 4UAAA 1TS0A 4ARZB 3M6BA 1ESUA 3S7QA 3WRZA 2VGLS 3KO6A 3DBAA 2C5WB 1NLZA 1U60A 2ZC3B 1YQSA 3HUMA 1BUEA 2ZC6B 1F98A 3N7WA 4YINA 5HPFA 2PBDP 4X55A 3HLFA 3FPWA 3N8SA 2Z6CA 1XJ3A 3EOIA 3LEZA 1H8ZA 1IYSA 2I72A 1LSVA 2OSUA 4GD8A 1VB6A 1LSWA 4S2NA 2YKFA 3G35A 2EWVA 3FYZA 1VETA 3N4IA 1Q2PA 2Y2HA 3BJNA 1OMEA 4OP8A 4MCWA 2XK1A 3QNBA 5E2GA 2VKSA 2Y2PA 2XFTA 2ZQ7A 5M19A 3NY4A 2QPNA 3W4OA 3B42A 4YFMA 1K57C 5FSRA 3K2NA 3HREA 2HJ9C 2QJ7A 4WYYA 4EEPA 3VV4A 2A24B 3LEQA 1K0KA 1BLHA 3Q7VA 4WBGA 5KZHA 2G2UA 1V9YA 3K3DA 1TVFA 4QHCA 5HD3A 3G32A 4DXBA 4LCLA 4KZ8A 3GDIA 1XGIA 5EOOA 3WS1A 2ACGA 5AQ9A 1OT9A 5L8MA 5HWWA 4EBPA 4IBXA 3BY8A 4U0TA 1PFLA 3CZDA 1OTIA 5E2HA 3MFXA 3PBTA 4N92A 4ETXA 3CITA 4KQRA 4IBRA 4K0XA 5FQIA 3HJKA 2GJ3A 3O86A 4JF4A 2XGNA 1T19A 1MZUA 1L0GA 4DMZA 3RTYA 2XF3A 2JBFA 3HLCA 4HQAA 2V0WA 1H5XA 3SOIA 4IVKA 5EECA 3R4KA 5F68A 3E2LA 4BD1A 3CUEC 5HSQA 3CAXA 3H7WB 1IOUA 3WS0A 3DTKA 5GLDA 3MMHA 5TJJA 5IT5A 2V8CA 1OTDA 2P04A 4B4ZA 4S2NC 4WF0A 1PZPA 3QP6A 1GSWA 2OLVA 4FD8A 3IXHA 1QMEA 4EU0A 3B3XA 3LY4A 1HTZA 5E2FA 3LI9A 5DF9A 4R3JA 3G30A 5FEFA 3AGEA 2G7UA 1DP9A 4OQHA 5F1FA 2O9CA 4WM9A 1VETB 4CPKA 1NYMA 1FR1A 5TR7A 2ZQ8A 3A0SA 2WKIA 1IFQA 4DXCA 1Y54A 3OZHA 5A91A 2PT7A 4BD0A 3BEBA 1TDLA 3JVUA 3ZVWA 3EEHA 3P7NA 4BLMA 3MJQA 2YKHA 2PYPA 2WUQA 1ONHA 1EI5A 5DKKA 4DJ3A 5KSHA 1OT6A 2KLIA 3W4PA 5IHVA 3IHAA 3Q7VB 1L3LA 5AQBA 3B47A 4HJ3A 1NRFA 3MZDA 3VFHA 4EERA 4E3OA 3WS4A 3BM6A 5DTTA 2HDUA 4N1HA 3U2AA 1S6RA 1CJFA 3Q07A 1LL5A 4GDBA 2L4RA 2WKPA 1A0KA 5FASA 4LV1A 3UDXA 5AVFA 5FI2A 1YPRA 4F94A 4WZ5C 4Y3IA 3QP2A 2K7SA 4Y17A 3TE8A 4RX2A 3ZNYA 3LGOA 1YKDA 2R9XA 4GZBA 3W4QA 4OOYA 5CHUA 5G4YA 1O07A 3T4KA 2ZMVA 2ZJ9A 1K25A 3VSLA 3KYZA 1PRQA 3W8KA 4KZ9A 4HHDA 1LL8A 3OOVA 3SS5A 4QB8A 3KSIA 4LV0A 1K38A 2QMIA 1GHMA 1DP6A 2BG1A 2VV7A 1TF1A 3SH9A 1BULA 1PWDA 4WELA 5KSCA 3C4PA 3VP0A 1H8MA 1P97A 2KX6A 4LGWA 4GKUA 5F82A 4B88A 1ZHHB 4I3AA 4ESPA 4UA9A 4XT2A 5FDSA 3LY3A 2Y2LA 4QD4A 2R78A 3BFEA 3PXPA 4OPYA 3BQ8A 3NHQA 2M7UA 5DKLA 1ODVA 4PKYG 3RH8B 3IBRA 2X02A 3LIBA 2OWJA 2HV1A 3C2WA 2W1TA 3A0VA 4CLCE 2Y2NA 2HPBA 5EUAA 1LHYA 3LR0A 3KSGA 4EBNA 1EWZA 3NOTC 5J7EA 1MWRA 2JCHA 1STZA 4HJ4A 2HP5A 4WUJA 1SDNA 3VFFA 4LCMA 4EETB 4LPZA 2XFSA 2BTFP 2OAQ1 5F69A 3T12B 3LYXA 5TFQA 1LI0A 5HL6A 3G34A 2A3UA 4MNRA 2ZC7A 1AXBA 5FA7A 3T1QB 5EVID 3ISGA 4OKPA 2XEPA 4MN7A 3UY6A 2DCFA 2V8FA 5FQQA 1GSVA 5J8XA 2JKFA 1E4DA 3OPPA 1X0OA 1XX2A 1KE4A 3FKWA 1XPBA 3C8CA 2JC7A 3UB9A 2I9VA 4S2JA 2XLNA 3SS4A 2WKQA 4KG5A 2M7VA 2J9OA 3IXBA 4HIAA 3UO9A 5CTNA 5CRFA 3LIFA 3NECA 1BLSA 1JTDA 1Y4OA 1CI9A 4QPRA 4KG6A 1I5QA 2E8JA 4EQIA 3HLGA 2H0YA 2XD1A 4EUVA 1DRMA 2V2FF 4S2MA 4GS9A 3LI8A 1K4EA 1T1CA 2DRWA 4H6JA 3MF0A 1TS8A 3Q7ZA 2E8IA 2QKPA 4OVDA 1XP4A 2W1TB 4Y5FA 5FQ9A 4S2LA 4PM9A 2ZL1A 4FOFA 4L9EA 3NDGA 4B93A 1TS6A 1VHMA 1FQGA 1FR6A 2Q9MA 1W7FA 2JE5A 3OLOA 3NOPC 3HUOA 3GR2A 2HZ5A 5KMWA 4X6TA 1G6AA 1K57A 4XUZA 5HZHA 4N9KA 4D60A 3VE4A 3PTEA 2IA2A 2PYRA 3BWLA 3FG8A 2OAP1 1YSQA 4Q0IA 4RYEA 3TW8A 3QNCA 4N1XA 1J3WA 1H8YA 5DFXA 4HY8A 1W63Q 3IS2A 1PYYA 5F1GA 5HDDA 5L10A 1BSGA 4R38A 1OPXA 3MR0A 3TJZC 4E3IA 4JGRA 4WLAA 1FOFA 2PDRA 1L0DA 1W79A 2P08A 1K54A 5DJTA 3MXRA 3IBJA 5DF7A 3F1OA 3D72A 2XA7M 4NK3A 2A2LA 2V20A 5CECA 5CGSA 2GNXA 3GTCA 3IF6C 3H7WA 1Y28A 5E2EA 2PR6A 3T4SA 1FCNA 4LRYC 3G2YA 5I94A 1S4SA 3CUEA 2ZM2A 4R3BA 2O99A 3IF6B 4YOFA 5EPHA 2EA9A 4GS9B 2ZMFA 3LR3A 2WKRA 3ULFA 3BFGA 3CI6A 4H6JB 4CLCD 3RFBA 2WZZA 3KYQA 2P7JA 1YM1A 2W3HA 1CI8A 4NETA 5CHJA 1YAXA 1SHVA 2LB9A 1T1AA 5FATA 3HL9A 5TBMA 2K2NA 4JPMA 4HH2A 1IKIA 2ZL1B 1G5UA 2GX5A 2B95A 3PAEA 4WEJA 2Q0OA 3MS6A 4E3LA 2XA7S 4PAUA 5FAQA 4RX3A 1TD5A 4LFUA 3AGDA 4Y0TA 1K55A 1K56D 2Z2MB 4E6XA 3KSHA 2JKRI 2CMNA 4G3VA 3HLWA 1K54C 2HF6A 1XGJA 2HP6A 3KYEA 1NWZA 4JXSA 3ICYA 3IS2B 3VOYA 2OOLA 2W1RA 3CJMA 4NXFA 3A3DA 1P9RA 3E4OA 2J8YA 2XD5A 2RCXA 3SH8A 2WGIA 1RGZA 3F1OB 4UQIM 3PBSA 5TGFA 4EEUA 4KQQA 4LV3A 1UWNX 3TSGA 4PHTA 4YWZA 1MWUA 4H8RA 1Z6FA 3VE3A 1E3UD 1OTAA 4I3IA 1MWSA 4WZ5A 5G4ZA 1SDEA 4HH3A 1PIOA 1VM1A 3IX3A 1I2SA 1KVLA 3S4XA 3DW0A 2Y59A 1N9BA 4CJNA 1YLJA 4GB7A 1BZAA 2VX8A 3LIDA 3JVVA 5EVIC 4HESA 3UMDA 1W8QA 2DMWA 4WZ4A 3UDIA 3EQVA 3VP2A 4LRXC 4HBUA 3T4OA 1TEMA 4R6LA 4UEYA 1KGGA 3ZQ5A 3OC2A 5FL3A 2VEAA 3IWIA 1NXYA 3DTEA 2ZOHA 4QY6A 5TBMB 2J3TD 4PM8A 5HAPA 2EX6A 3FC7A 3M6HA 2WGWA 3I7JA 3WRTA 2Y4AA 1BLCA 4KZ4A 4EBLA 3HLEA 4MLLA 1NYYA 2Y8HA 2ZOIA 2O9AA 3UB5P 4RVAA 1PWGA 2A49A 1JVJA 1K55C 4DKIA 1MKMA 4MN5A 4UQIS 4KUKA 3OPRA 1SKFA 2HJEA 1JWPA 3UPPA 3O3VA 4X1LA 5HAQA 1KDSA 2KOIA 3VSKA 2V1ZA 1W63M 1DJCA 1T1BA 4NXEA 2VLGA 2WYXA 4Y0UA 1YLPA 3T1RA 1QMFA 3UE3A 1HVBA 3CPTA 2BASA 1BT5A 5CGWA 4K0WA 5HW3A 4NXGA 2Z2LB 4MBFA 3T4JA 2EFXA 4X69A 1ZG6A 4KZ7A 4O7DA 4CLCA 1D1JA 4DJ2A 3HUNA 2PU4A 5FI6A 4D2OA 5A8BA 1EROA 1WA9A 4C6YA 4DE2A 2AVXA 3E4QA 3L9KA 5DVAA 4ZJ1A 2Y2IA 5LBRA 3ZVTA 4IHQA 2WKEA 3VMAA 3N8RA 4EWFA 3S7PA 4ZJ2A 3NULA 4S2OA 4S2PA 4Q0JA 2CC1A 3MKEA 2PD7A 4CQHA 1KGFA 3PBQA 2B5RA 2XR0A 4R0QA 4GN2A 3ZG9B 2V1BA 3CHWP 2PBYA 2NUTC 4I5SA 4E04A 1PW1A 3ITAA 1XJ2A 3G2ZA 5GHYA 3LFVA 1K56A 4UHUA 1DJBA 3M2JA 3UPNA 1CK3A 4LENA 4JXGA 4DDSA 4GDNA 2M1CA 1ERMA 1FILA 4WN5A 2VV8A 3M2KA 5HFOA 5IS1A 3LR5A 1YLTA 2B02A 2WGWB 4Q8IA 4EQ1A 1JTGA 2QHKA 3A3FA 1ALQA 2QWSA 3U4LP 4X25A 3D3OA 3EQUA 4R1GA 4EXOA 3IQAA 2H0TA 4O01A 1Q2QA 2Y91A 2RL3A 3QP8A 4OONA 4GW9A 3VP1A 2GZAA 3ZNTA 3UDFA 3V3SA 1IYQA 3Q82A 4LV2A 4MBKA 2VV6A 4O0PA 3ZCZA 1E3UA 1PI5A 3LIAA 3S22A 4OQIA 3WS5A 3LCEA 3GECA 5L07A 4OPRA 3S1YA 1J9MA 3NJAA 4OQGA 3F1PA 4XXRA 4CLCC 5HPIA 2LB5A 1NRJA 2ZQDA 3EGXC 5JYPA 5EM0A 3CMZA 3Q1FA 3CPTB 3PAGA 1BLPA 4NG2A 5HWVA 5IU1A 1MKIA 3UB8A 5CTMA 4KENB 2JKRM 4CLCB 1S1ZA 3UN7A 4I3JA 2NUPC 5M1AA 3ZG7B 4U0XA 2INWA 1MBLA 1KE0A 2OV5A 4ZDXA 1FSYA 2G2WA 2VZWA 3JYIA 3E98A 3VP3A 2WAEA 3CWFA 4P85A 1KVMA 4JBFA 3C7UA 4K91A 2ZMAA 3OCLA 4ZTKA 4HOIA 1JNUA 3BLMA 3LIEA 2ZC4B 4KZ6A 2XH9A 1ZKJA 3NI9A 3G6OA 3KX0X 5GLBA 1S66L 5L09A 3L7HA 1P0ZA 1G28A 3C4OA 3IXGA 5I5LA 1SCWA 5EE8A 5GHZA 2L0WA 4R23A 3DAVA 1XFNA 2JKGA 2VJWA 2H28A 3Q81A 3VOLA 3GQZA 1M40A 3IF6A 1YT4A 4Y15A 1G68A 5F5YA 2HDRA 4E3NA 5FAPA 3UE0A 5HL1A 1XJ4A 5AVEA 5KIZA 2XSSA 5D3OA 2BLSA 4ID4A 5AQAA 4Y2FA 1TS7A 3NDEA 4BBVA 4BL2A 4WMCD 4DF6A 3ITBA 1GHPA 2UWXA 4WL9A 4OLDA 2Y55A 1FSWA 4P87A 5EVLA 3NIAA 5HAIA 3IH8A 3W2ZA 1CQAA 3O5YA 1LT0A 2HGVA 3F1PB 1PWCA 3BFCA 3RJUA 3DWZA 1KGEA 2IWDA 2O0YA 4PM5A 4WEKA 3V5MA 1O7EA 1HD8A 5CX7A 3GVBA 4Y0OA 4GNUA 3BQAA 2K31A 4M4XA 2J3TC 4S2IA 2HDQA 4FH2A 3HBRA 4FSFA 2W3FA 2WADA 4KZAA 5EOEA 3RXXA 2V1AA 3FZCA 4X1MA 1EW0A 1ACFA 2EX2A 4E3MA 2X01A 3SW1A 3OBFA 5M18A 4KQOA 4HP9A 4PPRA 1K6SA 1I2WA 1GA0A 3BRMA 2PR5A 4G3KA 1OJGA 1L2SA 3SH7A 3BLSA 2ZM8A 4NKPA 5FQMA 4JLFA 2FFFB 4ZJ3A 3G4PA 4OH0A 4EV4A 3SS3A 3UMEA 4X53A 3HVFA 1PW8A 2PU2A 2EFUA 1GHIA 5J3WA 3V50A 1DJAA 3RXWA 4HI4A 1NY0A 1S67L 4E3JA 3K3CA 5DFYA 1YSPA 1KDWA 5CHMA 1XA7A 2JKTI 2VA0A 3EGDC 1WE4A 3NCKA 3D9YA 3PHYA 3T50A 3IH9A 3A3IA 3BECA 2DNSA 3NOUC 4ZRRA 2EWWA 5EVIA 3TRCA 4UA7A 1PZOA 2EXAA 5DTSA 3DTMA 3P01A 5A93A 5EV0A 5HDCA 1NJ4A 3VOZA 3CLOA 3FKVA 3IHBA 1MC0A 4FH4A 1HLUP 3FV7A 1YMSA 4JKTA 4GOGA 3MZFA 1N9LA 2XDMA 2JHEA 4IUHA 2EX9A 4C3QA 2W27A 4PM6A 4OP5A 3FPVA 1CF0A 2VGJA 3H9WA 3GMWA 2X71A 1HZOA 1IEMA 2ZLYA 4X68A 1NLYA 4QJGA 1N9OA 4DE1A 1Z09A 1KE3A 4KG2A 3T1XA 5DF8A 3A0RA 2W3EA 5GLAA 3ZG8B 2L1MA 3C38A 4OPZA 1F9IA 2P9VA 1YLYA 3F1NB 4MN6A 3BYDA 4WMCA 1XA1A 1GSXA 3UPOA 2IWCA 4JF5A 1XKZA 1ES3A 2J80A 3QHYA 5K5BA 2Y2GA 1MXOA 3IXDA 3JPUA 2ZBBA 4P6ZM 4P0MA 5BOHA 1ZTUA 5L2FA 2V9AA 5DTKA 4R3AA 1ES4A 5FQKA 4II7A 1DY6A 2Y2MA 2O9BA 1NZUA 5F83A 1G6OA 2W3DA 4Z9QA 3AGFA 3E4PA 3C30A 2WKHA 4HNBA 3KSFA 3ZGAB 4JF6A 4O8GA 5HD5A 2PHYA 3FWLA 5EVIB 2R9WA 3LUQA 3BFFA 3E2KA 4EW7A 1PNEA 2D02A 3A3JA 4A5RA 2ZC5B 1TDGA 2OWHA 3GV9A 2Z6DA 3T4LA 4LRZE 3D4FA 4AFIA 1K6RA 2IWBA 3IWOA 3V39A 4N9LA 4I39A 1XJ6A 2Q9NA 3ZG5A 3MFDA 2UV0E 4HJ6A 1ONGA 4M3KA 5FDHA 4B4XA 5AQ7A 4BBUA 1IYOA 1MY8A 4F3LA 2W0NA 2VGKA 4DE0A 2ZD8A 3S7OA 4P6ZS 2P74A 5J4EA 3MQQA 3LR4A 1P9WA 3O87A 3ZDJA 3EWKA 3G31A 3MZEA 4PKYA 3UNWA 4GCZA 4Z1WA 3C7VA 4ME4A 5EVEA 3ZFZA 2P9VB 2FZ0A 4IUKA 4JGQA 1T18A 4FTXA 4Y7PA 1H3QA 2EXBA 1D7EA 4OPQA 3BY9A 3MXQA 1IKGA 5HDSA 4IVIA 5U47A 4UA6A 4U3TA 1F2KA 4ZBEA 1YMXA 4OLGA 4KUOA 2HP9A 1W8YA 4S2KA 3OCNA 1ESIA 1YLZA 2ZQAA 4YNRA 4R70A 4DDYA 2PD8A 5HX9A 4Y13A 1F5MA 1S4RA 3E0YA 1RCJA 4QU3A 1LI9A 2ZQ9A 1LLBA 4PMAA 3HCYA 1OJ5A 3T4QA 3PYPA 3HLDA 1M6KA 4IJGA 3PBOA 1IYPA 2JKTM 3QP1A 1BTLA 1LL9A 3IT9A 3S7NA 4KZBA 2OLUA 5JYOA 1SZVA 1MWTA 5A90A 4GJ4A 3V3RA 2Y2QA 2WGVA 5C5KA 2XRNA 2H10A 4LLOB 4MEZA 3MXSA 5HWTA 4BMWA 4F3LB 1VEUA 3WS2A 3CG5A 2QYBA 3UB6A 2W3GA 2J7VA 3QP5A 4ZAMA 5CERA 4DN0A 1OTBA 4OOMA 4R4RA 5CEBA 2C6WB 3O88A 5GL9A 3UE6A 4HP4A 1JWZA 1D06A 1N4OA 5G18A 2MJ6A 1KOUA 1FCMA 1BYWA 2Y2OA 4JGPA 1VQQA 3IX8A 4GD6A 5E43A 5HARA 4BENA 4DE3A 3V67A 4L9GA 4OQ0A 1YLWA 2WAFA 4R4SA 2VK3A 1SKOA 5GHXA 1V9ZA 5DJUA 2HDSA 3P09A 4QWOA 3UE1A 2ZQCA 3TOIA 1GA9A 3GRJA 4RA7A 4GHIA 1S1YA 3A3EA 1OTEA 1DP8A 1K4FA 1CEFA 2PRFA 4XUXA 3EEAA 5F6AA 3T1SA 3H82A 4EESA 4GLQA 3BFDA 3R7WA 3WWXA 2FFYA 4IEDA 5CEDA 1JWVA 2XQZA 2Y2JA 3MQOA 1WYCA 4MMNA 3T4TA 4NEED 4ARZA 2H5SA 3ZYTA 2GDNA 4PM7A 3PR6A 1LSXA 3C5AA 3MKFA 4HBTA 1W5DA 2ZM0A 1XFQA 4JXWA 5GLCA 4E6WA 4BL3A 2FH5A 1MPLA 3N6IA 3DTIA 1GCEA 3IX4A 1XXMA 4XT2B 4X56A 4FUWA 4L0LA 5A92A 1E25A 3HLBA 2PAVP 4JGOA 1VEUB 4JXVA 3VP4A 2KDKA 4EUZA 4DRTA 1ES5A 3MQ0A 5AJGA 1N9NA 2J3WA 3OPLA 4P6BA 1AWIA
chains in the Genus database with same CATH topology
4BJPA 3B33A 3LIBA 1N9LA 1MKMA 2OWJA 3LICA 4MN5A 4UQIS 2HV1A 2JHEA 4IUHA 3C2WA 4KUKA 2W1TA 2VGLM 2HJEA 2W27A 3A0VA 4CLCE 3FPVA 4RQ9A 3H9WA 3UB7A 2KOIA 1W63M 3HJIA 1NLYA 4L9FA 1T1BA 4NXEA 3LR0A 1N9OA 3KSGA 4ETZA 2A24A 2VLGA 5EFWA 5MC7A 2Y79A 3NOTC 4NXBA 5J7EA 1STZA 4K08A 3UE3A 3A0RA 3PBRA 2W3EA 4HJ4A 1UGUA 2BASA 1UWPX 2B18A 2D01A 4I38A 4WUJA 2L1MA 3C38A 4EETB 4NXGA 4LPZA 3T4JA 1F9IA 3PBNA 4CLCA 4Q0HA 4DJ2A 2OAQ1 5F69A 3LYXA 3F1NB 4G3WA 4MN6A 5HL6A 4GHIB 3F1NA 1GSXA 5A8BA 2JN7A 2XROA 1WA9A 2J80A 5K5BA 2QJ5A 3E4QA 4MN7A 4MDZA 1GSVA 5LBRA 4KQDA 4BWIA 3H82B 4IHQA 4P6ZM 2ZBBA 3R7WB 4OOLA 3S7PA 1X0OA 4BBTA 1ZTUA 3BW6A 4B9OA 4Q0JA 3C8CA 2V0UA 2PD7A 3UB9A 2I9VA 4CQHA 2V9AA 3PBQA 1TS0A 4ARZB 2V1BA 2WKQA 4R3AA 2M7VA 3S7QA 2NUTC 4HIAA 4I5SA 4E04A 2VGLS 3KO6A 3DBAA 4II7A 3LIFA 1XJ2A 1NLZA 2O9BA 3LFVA 1F98A 1G6OA 2W3DA 3E4PA 3C30A 4HNBA 3KSFA 5HPFA 4QPRA 3FPWA 2M1CA 4O8GA 5HD5A 2PHYA 2Z6CA 1XJ3A 3EOIA 4WN5A 2VV8A 3LUQA 5IS1A 3LR5A 4EW7A 4EUVA 1LSVA 1DRMA 2B02A 2D02A 1VB6A 1LSWA 4EQ1A 2QHKA 4GS9A 3LI8A 2QWSA 2YKFA 2OWHA 2EWVA 3D3OA 3EQUA 2Z6DA 3T4LA 4EXOA 4LRZE 1T1CA 3BJNA 4O01A 4AFIA 4H6JA 4MCWA 3MF0A 4GW9A 1TS8A 2GZAA 2QKPA 4I39A 2VKSA 1XJ6A 2W1TB 4HJ6A 4Y5FA 2VV6A 4O0PA 4BBUA 3B42A 3LIAA 4F3LA 2W0NA 3K2NA 4FOFA 2HJ9C 2QJ7A 3GECA 4EEPA 4L9EA 3NJAA 3S7OA 3F1PA 4B93A 4P6ZS 3VV4A 2A24B 4CLCC 5HPIA 2LB5A 1TS6A 1VHMA 1NRJA 5J4EA 3MQQA 3EGXC 3OLOA 3NOPC 3LR4A 1P9WA 1V9YA 3K3DA 3EWKA 4PKYA 5HWVA 5IU1A 4GCZA 5HD3A 4Z1WA 3UB8A 5HZHA 2JKRM 4CLCB 1S1ZA 4ME4A 3VE4A 4I3JA 3GDIA 2FZ0A 2NUPC 4IUKA 4JGQA 2IA2A 2PYRA 3BWLA 1T18A 3FG8A 2INWA 1OT9A 2OAP1 5L8MA 1YSQA 1H3QA 5HWWA 4Q0IA 3TW8A 1D7EA 2VZWA 3BY8A 3E98A 1OTIA 3MFXA 5DFXA 3BY9A 3PBTA 4HY8A 3MXQA 4ETXA 3CITA 1W63Q 3CWFA 3IS2A 3HJKA 2GJ3A 5HDSA 5HDDA 1MZUA 1T19A 4R38A 1OPXA 3OCLA 3MR0A 3TJZC 4DMZA 3RTYA 4HOIA 1JNUA 3LIEA 4HQAA 2V0WA 4JGRA 4WLAA 2PDRA 2P08A 5DJTA 4KUOA 3IBJA 3F1OA 3D72A 3R4KA 5F68A 3CUEC 5HSQA 2XA7M 3G6OA 3OCNA 3KX0X 2A2LA 1S66L 3CAXA 3H7WB 4YNRA 1IOUA 2GNXA 4R70A 1P0ZA 1G28A 3MMHA 2PD8A 3H7WA 1Y28A 5TJJA 2PR6A 5IT5A 1F5MA 1S4RA 1OTDA 5I5LA 2P04A 3E0YA 3T4SA 4WF0A 2L0WA 1GSWA 4LRYC 1XFNA 1S4SA 2VJWA 2H28A 3CUEA 3HCYA 1OJ5A 3T4QA 4EU0A 3PYPA 4IJGA 3PBOA 2O99A 2JKTM 3VOLA 3LI9A 4YOFA 5DF9A 2G7UA 1DP9A 2EA9A 3S7NA 4GS9B 2ZMFA 5F5YA 2O9CA 3LR3A 2WKRA 1XJ4A 5AVEA 3ULFA 5KIZA 2XSSA 3CI6A 4H6JB 4CLCD 4GJ4A 4Y2FA 3RFBA 1TS7A 3KYQA 3A0SA 2P7JA 1IFQA 4BBVA 2W3HA 2PT7A 5C5KA 1YAXA 2XRNA 4LLOB 2LB9A 3JVUA 1T1AA 4WL9A 5HWTA 4BMWA 5TBMA 3EEHA 3P7NA 2K2NA 4HH2A 4F3LB 2QYBA 3MJQA 3UB6A 2W3GA 2YKHA 2PYPA 5DKKA 4DJ3A 3W2ZA 2GX5A 5KSHA 3O5YA 1LT0A 1OT6A 2HGVA 3F1PB 2KLIA 4DN0A 4WEJA 1OTBA 4OOMA 2O0YA 3UE6A 3B47A 4HP4A 4HJ3A 1D06A 4WEKA 5CX7A 2MJ6A 2XA7S 3BQAA 4PAUA 2K31A 4M4XA 2J3TC 4EERA 1TD5A 4FSFA 1KOUA 1BYWA 3U2AA 2W3FA 4JGPA 3KSHA 2JKRI 2CMNA 2V1AA 4G3VA 1EW0A 2L4RA 2WKPA 2HF6A 1NWZA 3ICYA 3V67A 4L9GA 3IS2B 3SW1A 2OOLA 3OBFA 4KQOA 2W1RA 5AVFA 4HP9A 4NXFA 1V9ZA 1P9RA 3E4OA 2PR5A 4G3KA 5DJUA 1OJGA 4Y3IA 2K7SA 3TE8A 3F1OB 4NKPA 4UQIM 3PBSA 4GHIA 1YKDA 1S1YA 4EEUA 1UWNX 1OTEA 4PHTA 4YWZA 1DP8A 5G4YA 3VE3A 3T4KA 1OTAA 3EEAA 4I3IA 2ZMVA 5F6AA 3UMEA 3H82A 4EESA 4GLQA 3KYZA 5G4ZA 4HH3A 4HHDA 1LL8A 3R7WA 5J3WA 3OOVA 4HI4A 3MQOA 3KSIA 4MMNA 3T4TA 1S67L 4NEED 4ARZA 1DP6A 3K3CA 5DFYA 1YSPA 3ZYTA 2VX8A 3LIDA 3JVVA 2VV7A 3UMDA 1TF1A 3PR6A 1LSXA 2JKTI 2VA0A 4WELA 1H8MA 2DMWA 1XFQA 1P97A 3EQVA 2KX6A 4LRXC 3EGDC 3T4OA 4R6LA 4UEYA 2FH5A 1ZHHB 3PHYA 3ZQ5A 4I3AA 3T50A 3OC2A 4XT2B 5FL3A 2VEAA 3NOUC 4ZRRA 2ZOHA 4XT2A 2EWWA 4L0LA 5TBMB 2J3TD 4JGOA 3TRCA 2R78A 3FC7A 2KDKA 3PXPA 3P01A 3MQ0A 5HDCA 5AJGA 1N9NA 2J3WA 2Y8HA 2ZOIA 3BQ8A 2O9AA 3NHQA 5DKLA 2M7UA 1ODVA 4PKYG 3CLOA 3RH8B 3IBRA 1MC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B33 A;  3LIB A;  1N9L A;  2OWJ A;  3LIC A;  4MN5 A;  2HV1 A;  2JHE A;  3C2W A;  4KUK A;  2W27 A;  3A0V A;  4RQ9 A;  3H9W A;  3UB7 A;  3HJI A;  4L9F A;  1T1B A;  4NXE A;  1N9O A;  2A24 A;  2VLG A;  5EFW A;  3NOT C;  4NXB A;  5J7E A;  4K08 A;  3A0R A;  4HJ4 A;  1UGU A;  2BAS A;  1UWP X;  2D01 A;  4I38 A;  4WUJ A;  2L1M A;  4EET B;  4NXG A;  4LPZ A;  1F9I A;  4DJ2 A;  5F69 A;  3LYX A;  3F1N B;  4MN6 A;  4GHI B;  3F1N A;  1GSX A;  5A8B A;  2JN7 A;  1WA9 A;  2J80 A;  2QJ5 A;  3E4Q A;  1GSV A;  4KQD A;  3H82 B;  2ZBB A;  1X0O A;  4BBT A;  4B9O A;  3C8C A;  2V0U A;  2PD7 A;  3UB9 A;  2I9V A;  2V9A A;  1TS0 A;  2V1B A;  2WKQ A;  4R3A A;  4HIA A;  4I5S A;  4E04 A;  3LIF A;  1XJ2 A;  1F98 A;  3E4P A;  4HNB A;  2M1C A;  5HD5 A;  2PHY A;  2Z6C A;  1XJ3 A;  4WN5 A;  2VV8 A;  3LUQ A;  5IS1 A;  4EW7 A;  1LSV A;  1DRM A;  2B02 A;  2D02 A;  1VB6 A;  1LSW A;  4EQ1 A;  2QHK A;  4GS9 A;  3LI8 A;  2QWS A;  2YKF A;  2OWH A;  2Z6D A;  4EXO A;  4LRZ E;  1T1C A;  4H6J A;  4GW9 A;  1TS8 A;  2QKP A;  4I39 A;  1XJ6 A;  4HJ6 A;  2VV6 A;  4BBU A;  3LIA A;  4F3L A;  2W0N A;  2QJ7 A;  3GEC A;  4EEP A;  4L9E A;  3NJA A;  3F1P A;  2A24 B;  1TS6 A;  5J4E A;  3MQQ A;  3OLO A;  3NOP C;  1V9Y A;  3K3D A;  3EWK A;  4PKY A;  5HWV A;  5IU1 A;  4GCZ A;  5HD3 A;  3UB8 A;  5HZH A;  1S1Z A;  3VE4 A;  4I3J A;  3GDI A;  4JGQ A;  2PYR A;  3BWL A;  1T18 A;  3FG8 A;  2INW A;  1OT9 A;  5HWW A;  1D7E A;  3BY8 A;  1OTI A;  3MFX A;  3BY9 A;  4HY8 A;  3MXQ A;  3CWF A;  3IS2 A;  3HJK A;  2GJ3 A;  5HDS A;  5HDD A;  1MZU A;  1T19 A;  4R38 A;  3MR0 A;  3RTY A;  4HOI A;  1JNU A;  3LIE A;  4HQA A;  2V0W A;  4JGR A;  4WLA A;  2PDR A;  5DJT A;  4KUO A;  3F1O A;  3D72 A;  5F68 A;  5HSQ A;  3G6O A;  3KX0 X;  1S66 L;  3CAX A;  3H7W B;  4R70 A;  1P0Z A;  1G28 A;  2PD8 A;  3H7W A;  1Y28 A;  2PR6 A;  1S4R A;  1OTD A;  5I5L A;  4WF0 A;  2L0W A;  1GSW A;  4LRY C;  1XFN A;  1S4S A;  2H28 A;  1OJ5 A;  3PYP A;  3VOL A;  3LI9 A;  1DP9 A;  2EA9 A;  4GS9 B;  5F5Y A;  2WKR A;  1XJ4 A;  5AVE A;  3ULF A;  5KIZ A;  4H6J B;  1TS7 A;  3A0S A;  2P7J A;  4BBV A;  4LLO B;  1T1A A;  4WL9 A;  5HWT A;  5TBM A;  3EEH A;  3P7N A;  4HH2 A;  4F3L B;  3MJQ A;  3UB6 A;  2YKH A;  2PYP A;  5DKK A;  4DJ3 A;  1LT0 A;  1OT6 A;  3F1P B;  1OTB A;  3UE6 A;  4HP4 A;  4HJ3 A;  1D06 A;  4M4X A;  4EER A;  1KOU A;  1BYW A;  4JGP A;  2CMN A;  2V1A A;  1EW0 A;  2L4R A;  2WKP A;  1NWZ A;  3ICY A;  4L9G A;  3IS2 B;  3SW1 A;  2OOL A;  5AVF A;  4HP9 A;  4NXF A;  1V9Z A;  3E4O A;  2PR5 A;  5DJU A;  1OJG A;  2K7S A;  3F1O B;  4GHI A;  1S1Y A;  4EEU A;  1UWN X;  1OTE A;  4YWZ A;  1DP8 A;  5G4Y A;  3VE3 A;  1OTA A;  4I3I A;  5F6A A;  3UME A;  3H82 A;  4EES A;  5G4Z A;  4HH3 A;  4HHD A;  1LL8 A;  5J3W A;  4HI4 A;  3MQO A;  1S67 L;  1DP6 A;  3K3C A;  3LID A;  3UMD A;  2VV7 A;  1LSX A;  1XFQ A;  1P97 A;  2KX6 A;  4LRX C;  4R6L A;  3PHY A;  3ZQ5 A;  4I3A A;  3T50 A;  4XT2 B;  2VEA A;  3NOU C;  2ZOH A;  4XT2 A;  5TBM B;  4JGO A;  2R78 A;  3FC7 A;  2KDK A;  5HDC A;  1N9N A;  2ZOI A;  3NHQ A;  5DKL A;  1ODV A;  4PKY G;  3CLO A;  3RH8 B;  3IBR A; 
#chains in the Genus database with same CATH topology
 3TG9 A;  1L0E A;  5FQJ A;  5FEG A;  4MBH A;  4BJP A;  2J9P A;  4KZ5 A;  3B33 A;  3OPH A;  3LIC A;  1L0F A;  2VGL M;  3IF5 A;  4HEF A;  1RP5 A;  5CXW A;  4RQ9 A;  4FCF A;  3UB7 A;  1NZO A;  1PI4 A;  1FIK A;  3HJI A;  4L9F A;  3NC8 A;  4ETZ A;  2A24 A;  5EFW A;  2Y2K A;  2Y79 A;  5MC7 A;  3SZT A;  1ERQ A;  4NXB A;  3N8L A;  3MBZ A;  4K08 A;  3PBR A;  4E3K A;  1UGU A;  1ES2 A;  1UWP X;  1ZC2 A;  1SKO B;  2B18 A;  2D01 A;  4I38 A;  5EM1 A;  2QZ6 A;  3QP4 A;  2WZX A;  1C3B A;  1H0M A;  3PBN A;  1ZG4 A;  3MSH A;  1CEG A;  4Q0H A;  4G3W A;  5FAO A;  4BQM A;  2WK0 A;  3DWK A;  1RGY A;  4GHI B;  3F1N A;  3ZG0 A;  3IWQ A;  2JN7 A;  5CGX A;  2XRO A;  1WYB A;  5FI7 A;  3GSG A;  4QY5 A;  1FCO A;  2QJ5 A;  4MDZ A;  3LO7 A;  4KQD A;  4BWI A;  3H82 B;  3NBL A;  3P98 A;  3ZHH A;  4C75 A;  2EX8 A;  1S0W A;  4KZ3 A;  3R7W B;  4OOL A;  4BBT A;  3BW6 A;  4B9O A;  1IEL A;  2V0U A;  4UAA A;  1TS0 A;  4ARZ B;  3M6B A;  1ESU A;  3S7Q A;  3WRZ A;  2VGL S;  3KO6 A;  3DBA A;  2C5W B;  1NLZ A;  1U60 A;  2ZC3 B;  1YQS A;  3HUM A;  1BUE A;  2ZC6 B;  1F98 A;  3N7W A;  4YIN A;  5HPF A;  2PBD P;  4X55 A;  3HLF A;  3FPW A;  3N8S A;  2Z6C A;  1XJ3 A;  3EOI A;  3LEZ A;  1H8Z A;  1IYS A;  2I72 A;  1LSV A;  2OSU A;  4GD8 A;  1VB6 A;  1LSW A;  4S2N A;  2YKF A;  3G35 A;  2EWV A;  3FYZ A;  1VET A;  3N4I A;  1Q2P A;  2Y2H A;  3BJN A;  1OME A;  4OP8 A;  4MCW A;  2XK1 A;  3QNB A;  5E2G A;  2VKS A;  2Y2P A;  2XFT A;  2ZQ7 A;  5M19 A;  3NY4 A;  2QPN A;  3W4O A;  3B42 A;  4YFM A;  1K57 C;  5FSR A;  3K2N A;  3HRE A;  2HJ9 C;  2QJ7 A;  4WYY A;  4EEP A;  3VV4 A;  2A24 B;  3LEQ A;  1K0K A;  1BLH A;  3Q7V A;  4WBG A;  5KZH A;  2G2U A;  1V9Y A;  3K3D A;  1TVF A;  4QHC A;  5HD3 A;  3G32 A;  4DXB A;  4LCL A;  4KZ8 A;  3GDI A;  1XGI A;  5EOO A;  3WS1 A;  2ACG A;  5AQ9 A;  1OT9 A;  5L8M A;  5HWW A;  4EBP A;  4IBX A;  3BY8 A;  4U0T A;  1PFL A;  3CZD A;  1OTI A;  5E2H A;  3MFX A;  3PBT A;  4N92 A;  4ETX A;  3CIT A;  4KQR A;  4IBR A;  4K0X A;  5FQI A;  3HJK A;  2GJ3 A;  3O86 A;  4JF4 A;  2XGN A;  1T19 A;  1MZU A;  1L0G A;  4DMZ A;  3RTY A;  2XF3 A;  2JBF A;  3HLC A;  4HQA A;  2V0W A;  1H5X A;  3SOI A;  4IVK A;  5EEC A;  3R4K A;  5F68 A;  3E2L A;  4BD1 A;  3CUE C;  5HSQ A;  3CAX A;  3H7W B;  1IOU A;  3WS0 A;  3DTK A;  5GLD A;  3MMH A;  5TJJ A;  5IT5 A;  2V8C A;  1OTD A;  2P04 A;  4B4Z A;  4S2N C;  4WF0 A;  1PZP A;  3QP6 A;  1GSW A;  2OLV A;  4FD8 A;  3IXH A;  1QME A;  4EU0 A;  3B3X A;  3LY4 A;  1HTZ A;  5E2F A;  3LI9 A;  5DF9 A;  4R3J A;  3G30 A;  5FEF A;  3AGE A;  2G7U A;  1DP9 A;  4OQH A;  5F1F A;  2O9C A;  4WM9 A;  1VET B;  4CPK A;  1NYM A;  1FR1 A;  5TR7 A;  2ZQ8 A;  3A0S A;  2WKI A;  1IFQ A;  4DXC A;  1Y54 A;  3OZH A;  5A91 A;  2PT7 A;  4BD0 A;  3BEB A;  1TDL A;  3JVU A;  3ZVW A;  3EEH A;  3P7N A;  4BLM A;  3MJQ A;  2YKH A;  2PYP A;  2WUQ A;  1ONH A;  1EI5 A;  5DKK A;  4DJ3 A;  5KSH A;  1OT6 A;  2KLI A;  3W4P A;  5IHV A;  3IHA A;  3Q7V B;  1L3L A;  5AQB A;  3B47 A;  4HJ3 A;  1NRF A;  3MZD A;  3VFH A;  4EER A;  4E3O A;  3WS4 A;  3BM6 A;  5DTT A;  2HDU A;  4N1H A;  3U2A A;  1S6R A;  1CJF A;  3Q07 A;  1LL5 A;  4GDB A;  2L4R A;  2WKP A;  1A0K A;  5FAS A;  4LV1 A;  3UDX A;  5AVF A;  5FI2 A;  1YPR A;  4F94 A;  4WZ5 C;  4Y3I A;  3QP2 A;  2K7S A;  4Y17 A;  3TE8 A;  4RX2 A;  3ZNY A;  3LGO A;  1YKD A;  2R9X A;  4GZB A;  3W4Q A;  4OOY A;  5CHU A;  5G4Y A;  1O07 A;  3T4K A;  2ZMV A;  2ZJ9 A;  1K25 A;  3VSL A;  3KYZ A;  1PRQ A;  3W8K A;  4KZ9 A;  4HHD A;  1LL8 A;  3OOV A;  3SS5 A;  4QB8 A;  3KSI A;  4LV0 A;  1K38 A;  2QMI A;  1GHM A;  1DP6 A;  2BG1 A;  2VV7 A;  1TF1 A;  3SH9 A;  1BUL A;  1PWD A;  4WEL A;  5KSC A;  3C4P A;  3VP0 A;  1H8M A;  1P97 A;  2KX6 A;  4LGW A;  4GKU A;  5F82 A;  4B88 A;  1ZHH B;  4I3A A;  4ESP A;  4UA9 A;  4XT2 A;  5FDS A;  3LY3 A;  2Y2L A;  4QD4 A;  2R78 A;  3BFE A;  3PXP A;  4OPY A;  3BQ8 A;  3NHQ A;  2M7U A;  5DKL A;  1ODV A;  4PKY G;  3RH8 B;  3IBR A;  2X02 A;  3LIB A;  2OWJ A;  2HV1 A;  3C2W A;  2W1T A;  3A0V A;  4CLC E;  2Y2N A;  2HPB A;  5EUA A;  1LHY A;  3LR0 A;  3KSG A;  4EBN A;  1EWZ A;  3NOT C;  5J7E A;  1MWR A;  2JCH A;  1STZ A;  4HJ4 A;  2HP5 A;  4WUJ A;  1SDN A;  3VFF A;  4LCM A;  4EET B;  4LPZ A;  2XFS A;  2BTF P;  2OAQ 1;  5F69 A;  3T12 B;  3LYX A;  5TFQ A;  1LI0 A;  5HL6 A;  3G34 A;  2A3U A;  4MNR A;  2ZC7 A;  1AXB A;  5FA7 A;  3T1Q B;  5EVI D;  3ISG A;  4OKP A;  2XEP A;  4MN7 A;  3UY6 A;  2DCF A;  2V8F A;  5FQQ A;  1GSV A;  5J8X A;  2JKF A;  1E4D A;  3OPP A;  1X0O A;  1XX2 A;  1KE4 A;  3FKW A;  1XPB A;  3C8C A;  2JC7 A;  3UB9 A;  2I9V A;  4S2J A;  2XLN A;  3SS4 A;  2WKQ A;  4KG5 A;  2M7V A;  2J9O A;  3IXB A;  4HIA A;  3UO9 A;  5CTN A;  5CRF A;  3LIF A;  3NEC A;  1BLS A;  1JTD A;  1Y4O A;  1CI9 A;  4QPR A;  4KG6 A;  1I5Q A;  2E8J A;  4EQI A;  3HLG A;  2H0Y A;  2XD1 A;  4EUV A;  1DRM A;  2V2F F;  4S2M A;  4GS9 A;  3LI8 A;  1K4E A;  1T1C A;  2DRW A;  4H6J A;  3MF0 A;  1TS8 A;  3Q7Z A;  2E8I A;  2QKP A;  4OVD A;  1XP4 A;  2W1T B;  4Y5F A;  5FQ9 A;  4S2L A;  4PM9 A;  2ZL1 A;  4FOF A;  4L9E A;  3NDG A;  4B93 A;  1TS6 A;  1VHM A;  1FQG A;  1FR6 A;  2Q9M A;  1W7F A;  2JE5 A;  3OLO A;  3NOP C;  3HUO A;  3GR2 A;  2HZ5 A;  5KMW A;  4X6T A;  1G6A A;  1K57 A;  4XUZ A;  5HZH A;  4N9K A;  4D60 A;  3VE4 A;  3PTE A;  2IA2 A;  2PYR A;  3BWL A;  3FG8 A;  2OAP 1;  1YSQ A;  4Q0I A;  4RYE A;  3TW8 A;  3QNC A;  4N1X A;  1J3W A;  1H8Y A;  5DFX A;  4HY8 A;  1W63 Q;  3IS2 A;  1PYY A;  5F1G A;  5HDD A;  5L10 A;  1BSG A;  4R38 A;  1OPX A;  3MR0 A;  3TJZ C;  4E3I A;  4JGR A;  4WLA A;  1FOF A;  2PDR A;  1L0D A;  1W79 A;  2P08 A;  1K54 A;  5DJT A;  3MXR A;  3IBJ A;  5DF7 A;  3F1O A;  3D72 A;  2XA7 M;  4NK3 A;  2A2L A;  2V20 A;  5CEC A;  5CGS A;  2GNX A;  3GTC A;  3IF6 C;  3H7W A;  1Y28 A;  5E2E A;  2PR6 A;  3T4S A;  1FCN A;  4LRY C;  3G2Y A;  5I94 A;  1S4S A;  3CUE A;  2ZM2 A;  4R3B A;  2O99 A;  3IF6 B;  4YOF A;  5EPH A;  2EA9 A;  4GS9 B;  2ZMF A;  3LR3 A;  2WKR A;  3ULF A;  3BFG A;  3CI6 A;  4H6J B;  4CLC D;  3RFB A;  2WZZ A;  3KYQ A;  2P7J A;  1YM1 A;  2W3H A;  1CI8 A;  4NET A;  5CHJ A;  1YAX A;  1SHV A;  2LB9 A;  1T1A A;  5FAT A;  3HL9 A;  5TBM A;  2K2N A;  4JPM A;  4HH2 A;  1IKI A;  2ZL1 B;  1G5U A;  2GX5 A;  2B95 A;  3PAE A;  4WEJ A;  2Q0O A;  3MS6 A;  4E3L A;  2XA7 S;  4PAU A;  5FAQ A;  4RX3 A;  1TD5 A;  4LFU A;  3AGD A;  4Y0T A;  1K55 A;  1K56 D;  2Z2M B;  4E6X A;  3KSH A;  2JKR I;  2CMN A;  4G3V A;  3HLW A;  1K54 C;  2HF6 A;  1XGJ A;  2HP6 A;  3KYE A;  1NWZ A;  4JXS A;  3ICY A;  3IS2 B;  3VOY A;  2OOL A;  2W1R A;  3CJM A;  4NXF A;  3A3D A;  1P9R A;  3E4O A;  2J8Y A;  2XD5 A;  2RCX A;  3SH8 A;  2WGI A;  1RGZ A;  3F1O B;  4UQI M;  3PBS A;  5TGF A;  4EEU A;  4KQQ A;  4LV3 A;  1UWN X;  3TSG A;  4PHT A;  4YWZ A;  1MWU A;  4H8R A;  1Z6F A;  3VE3 A;  1E3U D;  1OTA A;  4I3I A;  1MWS A;  4WZ5 A;  5G4Z A;  1SDE A;  4HH3 A;  1PIO A;  1VM1 A;  3IX3 A;  1I2S A;  1KVL A;  3S4X A;  3DW0 A;  2Y59 A;  1N9B A;  4CJN A;  1YLJ A;  4GB7 A;  1BZA A;  2VX8 A;  3LID A;  3JVV A;  5EVI C;  4HES A;  3UMD A;  1W8Q A;  2DMW A;  4WZ4 A;  3UDI A;  3EQV A;  3VP2 A;  4LRX C;  4HBU A;  3T4O A;  1TEM A;  4R6L A;  4UEY A;  1KGG A;  3ZQ5 A;  3OC2 A;  5FL3 A;  2VEA A;  3IWI A;  1NXY A;  3DTE A;  2ZOH A;  4QY6 A;  5TBM B;  2J3T D;  4PM8 A;  5HAP A;  2EX6 A;  3FC7 A;  3M6H A;  2WGW A;  3I7J A;  3WRT A;  2Y4A A;  1BLC A;  4KZ4 A;  4EBL A;  3HLE A;  4MLL A;  1NYY A;  2Y8H A;  2ZOI A;  2O9A A;  3UB5 P;  4RVA A;  1PWG A;  2A49 A;  1JVJ A;  1K55 C;  4DKI A;  1MKM A;  4MN5 A;  4UQI S;  4KUK A;  3OPR A;  1SKF A;  2HJE A;  1JWP A;  3UPP A;  3O3V A;  4X1L A;  5HAQ A;  1KDS A;  2KOI A;  3VSK A;  2V1Z A;  1W63 M;  1DJC A;  1T1B A;  4NXE A;  2VLG A;  2WYX A;  4Y0U A;  1YLP A;  3T1R A;  1QMF A;  3UE3 A;  1HVB A;  3CPT A;  2BAS A;  1BT5 A;  5CGW A;  4K0W A;  5HW3 A;  4NXG A;  2Z2L B;  4MBF A;  3T4J A;  2EFX A;  4X69 A;  1ZG6 A;  4KZ7 A;  4O7D A;  4CLC A;  1D1J A;  4DJ2 A;  3HUN A;  2PU4 A;  5FI6 A;  4D2O A;  5A8B A;  1ERO A;  1WA9 A;  4C6Y A;  4DE2 A;  2AVX A;  3E4Q A;  3L9K A;  5DVA A;  4ZJ1 A;  2Y2I A;  5LBR A;  3ZVT A;  4IHQ A;  2WKE A;  3VMA A;  3N8R A;  4EWF A;  3S7P A;  4ZJ2 A;  3NUL A;  4S2O A;  4S2P A;  4Q0J A;  2CC1 A;  3MKE A;  2PD7 A;  4CQH A;  1KGF A;  3PBQ A;  2B5R A;  2XR0 A;  4R0Q A;  4GN2 A;  3ZG9 B;  2V1B A;  3CHW P;  2PBY A;  2NUT C;  4I5S A;  4E04 A;  1PW1 A;  3ITA A;  1XJ2 A;  3G2Z A;  5GHY A;  3LFV A;  1K56 A;  4UHU A;  1DJB A;  3M2J A;  3UPN A;  1CK3 A;  4LEN A;  4JXG A;  4DDS A;  4GDN A;  2M1C A;  1ERM A;  1FIL A;  4WN5 A;  2VV8 A;  3M2K A;  5HFO A;  5IS1 A;  3LR5 A;  1YLT A;  2B02 A;  2WGW B;  4Q8I A;  4EQ1 A;  1JTG A;  2QHK A;  3A3F A;  1ALQ A;  2QWS A;  3U4L P;  4X25 A;  3D3O A;  3EQU A;  4R1G A;  4EXO A;  3IQA A;  2H0T A;  4O01 A;  1Q2Q A;  2Y91 A;  2RL3 A;  3QP8 A;  4OON A;  4GW9 A;  3VP1 A;  2GZA A;  3ZNT A;  3UDF A;  3V3S A;  1IYQ A;  3Q82 A;  4LV2 A;  4MBK A;  2VV6 A;  4O0P A;  3ZCZ A;  1E3U A;  1PI5 A;  3LIA A;  3S22 A;  4OQI A;  3WS5 A;  3LCE A;  3GEC A;  5L07 A;  4OPR A;  3S1Y A;  1J9M A;  3NJA A;  4OQG A;  3F1P A;  4XXR A;  4CLC C;  5HPI A;  2LB5 A;  1NRJ A;  2ZQD A;  3EGX C;  5JYP A;  5EM0 A;  3CMZ A;  3Q1F A;  3CPT B;  3PAG A;  1BLP A;  4NG2 A;  5HWV A;  5IU1 A;  1MKI A;  3UB8 A;  5CTM A;  4KEN B;  2JKR M;  4CLC B;  1S1Z A;  3UN7 A;  4I3J A;  2NUP C;  5M1A A;  3ZG7 B;  4U0X A;  2INW A;  1MBL A;  1KE0 A;  2OV5 A;  4ZDX A;  1FSY A;  2G2W A;  2VZW A;  3JYI A;  3E98 A;  3VP3 A;  2WAE A;  3CWF A;  4P85 A;  1KVM A;  4JBF A;  3C7U A;  4K91 A;  2ZMA A;  3OCL A;  4ZTK A;  4HOI A;  1JNU A;  3BLM A;  3LIE A;  2ZC4 B;  4KZ6 A;  2XH9 A;  1ZKJ A;  3NI9 A;  3G6O A;  3KX0 X;  5GLB A;  1S66 L;  5L09 A;  3L7H A;  1P0Z A;  1G28 A;  3C4O A;  3IXG A;  5I5L A;  1SCW A;  5EE8 A;  5GHZ A;  2L0W A;  4R23 A;  3DAV A;  1XFN A;  2JKG A;  2VJW A;  2H28 A;  3Q81 A;  3VOL A;  3GQZ A;  1M40 A;  3IF6 A;  1YT4 A;  4Y15 A;  1G68 A;  5F5Y A;  2HDR A;  4E3N A;  5FAP A;  3UE0 A;  5HL1 A;  1XJ4 A;  5AVE A;  5KIZ A;  2XSS A;  5D3O A;  2BLS A;  4ID4 A;  5AQA A;  4Y2F A;  1TS7 A;  3NDE A;  4BBV A;  4BL2 A;  4WMC D;  4DF6 A;  3ITB A;  1GHP A;  2UWX A;  4WL9 A;  4OLD A;  2Y55 A;  1FSW A;  4P87 A;  5EVL A;  3NIA A;  5HAI A;  3IH8 A;  3W2Z A;  1CQA A;  3O5Y A;  1LT0 A;  2HGV A;  3F1P B;  1PWC A;  3BFC A;  3RJU A;  3DWZ A;  1KGE A;  2IWD A;  2O0Y A;  4PM5 A;  4WEK A;  3V5M A;  1O7E A;  1HD8 A;  5CX7 A;  3GVB A;  4Y0O A;  4GNU A;  3BQA A;  2K31 A;  4M4X A;  2J3T C;  4S2I A;  2HDQ A;  4FH2 A;  3HBR A;  4FSF A;  2W3F A;  2WAD A;  4KZA A;  5EOE A;  3RXX A;  2V1A A;  3FZC A;  4X1M A;  1EW0 A;  1ACF A;  2EX2 A;  4E3M A;  2X01 A;  3SW1 A;  3OBF A;  5M18 A;  4KQO A;  4HP9 A;  4PPR A;  1K6S A;  1I2W A;  1GA0 A;  3BRM A;  2PR5 A;  4G3K A;  1OJG A;  1L2S A;  3SH7 A;  3BLS A;  2ZM8 A;  4NKP A;  5FQM A;  4JLF A;  2FFF B;  4ZJ3 A;  3G4P A;  4OH0 A;  4EV4 A;  3SS3 A;  3UME A;  4X53 A;  3HVF A;  1PW8 A;  2PU2 A;  2EFU A;  1GHI A;  5J3W A;  3V50 A;  1DJA A;  3RXW A;  4HI4 A;  1NY0 A;  1S67 L;  4E3J A;  3K3C A;  5DFY A;  1YSP A;  1KDW A;  5CHM A;  1XA7 A;  2JKT I;  2VA0 A;  3EGD C;  1WE4 A;  3NCK A;  3D9Y A;  3PHY A;  3T50 A;  3IH9 A;  3A3I A;  3BEC A;  2DNS A;  3NOU C;  4ZRR A;  2EWW A;  5EVI A;  3TRC A;  4UA7 A;  1PZO A;  2EXA A;  5DTS A;  3DTM A;  3P01 A;  5A93 A;  5EV0 A;  5HDC A;  1NJ4 A;  3VOZ A;  3CLO A;  3FKV A;  3IHB A;  1MC0 A;  4FH4 A;  1HLU P;  3FV7 A;  1YMS A;  4JKT A;  4GOG A;  3MZF A;  1N9L A;  2XDM A;  2JHE A;  4IUH A;  2EX9 A;  4C3Q A;  2W27 A;  4PM6 A;  4OP5 A;  3FPV A;  1CF0 A;  2VGJ A;  3H9W A;  3GMW A;  2X71 A;  1HZO A;  1IEM A;  2ZLY A;  4X68 A;  1NLY A;  4QJG A;  1N9O A;  4DE1 A;  1Z09 A;  1KE3 A;  4KG2 A;  3T1X A;  5DF8 A;  3A0R A;  2W3E A;  5GLA A;  3ZG8 B;  2L1M A;  3C38 A;  4OPZ A;  1F9I A;  2P9V A;  1YLY A;  3F1N B;  4MN6 A;  3BYD A;  4WMC A;  1XA1 A;  1GSX A;  3UPO A;  2IWC A;  4JF5 A;  1XKZ A;  1ES3 A;  2J80 A;  3QHY A;  5K5B A;  2Y2G A;  1MXO A;  3IXD A;  3JPU A;  2ZBB A;  4P6Z M;  4P0M A;  5BOH A;  1ZTU A;  5L2F A;  2V9A A;  5DTK A;  4R3A A;  1ES4 A;  5FQK A;  4II7 A;  1DY6 A;  2Y2M A;  2O9B A;  1NZU A;  5F83 A;  1G6O A;  2W3D A;  4Z9Q A;  3AGF A;  3E4P A;  3C30 A;  2WKH A;  4HNB A;  3KSF A;  3ZGA B;  4JF6 A;  4O8G A;  5HD5 A;  2PHY A;  3FWL A;  5EVI B;  2R9W A;  3LUQ A;  3BFF A;  3E2K A;  4EW7 A;  1PNE A;  2D02 A;  3A3J A;  4A5R A;  2ZC5 B;  1TDG A;  2OWH A;  3GV9 A;  2Z6D A;  3T4L A;  4LRZ E;  3D4F A;  4AFI A;  1K6R A;  2IWB A;  3IWO A;  3V39 A;  4N9L A;  4I39 A;  1XJ6 A;  2Q9N A;  3ZG5 A;  3MFD A;  2UV0 E;  4HJ6 A;  1ONG A;  4M3K A;  5FDH A;  4B4X A;  5AQ7 A;  4BBU A;  1IYO A;  1MY8 A;  4F3L A;  2W0N A;  2VGK A;  4DE0 A;  2ZD8 A;  3S7O A;  4P6Z S;  2P74 A;  5J4E A;  3MQQ A;  3LR4 A;  1P9W A;  3O87 A;  3ZDJ A;  3EWK A;  3G31 A;  3MZE A;  4PKY A;  3UNW A;  4GCZ A;  4Z1W A;  3C7V A;  4ME4 A;  5EVE A;  3ZFZ A;  2P9V B;  2FZ0 A;  4IUK A;  4JGQ A;  1T18 A;  4FTX A;  4Y7P A;  1H3Q A;  2EXB A;  1D7E A;  4OPQ A;  3BY9 A;  3MXQ A;  1IKG A;  5HDS A;  4IVI A;  5U47 A;  4UA6 A;  4U3T A;  1F2K A;  4ZBE A;  1YMX A;  4OLG A;  4KUO A;  2HP9 A;  1W8Y A;  4S2K A;  3OCN A;  1ESI A;  1YLZ A;  2ZQA A;  4YNR A;  4R70 A;  4DDY A;  2PD8 A;  5HX9 A;  4Y13 A;  1F5M A;  1S4R A;  3E0Y A;  1RCJ A;  4QU3 A;  1LI9 A;  2ZQ9 A;  1LLB A;  4PMA A;  3HCY A;  1OJ5 A;  3T4Q A;  3PYP A;  3HLD A;  1M6K A;  4IJG A;  3PBO A;  1IYP A;  2JKT M;  3QP1 A;  1BTL A;  1LL9 A;  3IT9 A;  3S7N A;  4KZB A;  2OLU A;  5JYO A;  1SZV A;  1MWT A;  5A90 A;  4GJ4 A;  3V3R A;  2Y2Q A;  2WGV A;  5C5K A;  2XRN A;  2H10 A;  4LLO B;  4MEZ A;  3MXS A;  5HWT A;  4BMW A;  4F3L B;  1VEU A;  3WS2 A;  3CG5 A;  2QYB A;  3UB6 A;  2W3G A;  2J7V A;  3QP5 A;  4ZAM A;  5CER A;  4DN0 A;  1OTB A;  4OOM A;  4R4R A;  5CEB A;  2C6W B;  3O88 A;  5GL9 A;  3UE6 A;  4HP4 A;  1JWZ A;  1D06 A;  1N4O A;  5G18 A;  2MJ6 A;  1KOU A;  1FCM A;  1BYW A;  2Y2O A;  4JGP A;  1VQQ A;  3IX8 A;  4GD6 A;  5E43 A;  5HAR A;  4BEN A;  4DE3 A;  3V67 A;  4L9G A;  4OQ0 A;  1YLW A;  2WAF A;  4R4S A;  2VK3 A;  1SKO A;  5GHX A;  1V9Z A;  5DJU A;  2HDS A;  3P09 A;  4QWO A;  3UE1 A;  2ZQC A;  3TOI A;  1GA9 A;  3GRJ A;  4RA7 A;  4GHI A;  1S1Y A;  3A3E A;  1OTE A;  1DP8 A;  1K4F A;  1CEF A;  2PRF A;  4XUX A;  3EEA A;  5F6A A;  3T1S A;  3H82 A;  4EES A;  4GLQ A;  3BFD A;  3R7W A;  3WWX A;  2FFY A;  4IED A;  5CED A;  1JWV A;  2XQZ A;  2Y2J A;  3MQO A;  1WYC A;  4MMN A;  3T4T A;  4NEE D;  4ARZ A;  2H5S A;  3ZYT A;  2GDN A;  4PM7 A;  3PR6 A;  1LSX A;  3C5A A;  3MKF A;  4HBT A;  1W5D A;  2ZM0 A;  1XFQ A;  4JXW A;  5GLC A;  4E6W A;  4BL3 A;  2FH5 A;  1MPL A;  3N6I A;  3DTI A;  1GCE A;  3IX4 A;  1XXM A;  4XT2 B;  4X56 A;  4FUW A;  4L0L A;  5A92 A;  1E25 A;  3HLB A;  2PAV P;  4JGO A;  1VEU B;  4JXV A;  3VP4 A;  2KDK A;  4EUZ A;  4DRT A;  1ES5 A;  3MQ0 A;  5AJG A;  1N9N A;  2J3W A;  3OPL A;  4P6B A;  1AWI A; 
#chains in the Genus database with same CATH homology
 4BJP A;  3B33 A;  3LIB A;  1N9L A;  1MKM A;  2OWJ A;  3LIC A;  4MN5 A;  4UQI S;  2HV1 A;  2JHE A;  4IUH A;  3C2W A;  4KUK A;  2W1T A;  2VGL M;  2HJE A;  2W27 A;  3A0V A;  4CLC E;  3FPV A;  4RQ9 A;  3H9W A;  3UB7 A;  2KOI A;  1W63 M;  3HJI A;  1NLY A;  4L9F A;  1T1B A;  4NXE A;  3LR0 A;  1N9O A;  3KSG A;  4ETZ A;  2A24 A;  2VLG A;  5EFW A;  5MC7 A;  2Y79 A;  3NOT C;  4NXB A;  5J7E A;  1STZ A;  4K08 A;  3UE3 A;  3A0R A;  3PBR A;  2W3E A;  4HJ4 A;  1UGU A;  2BAS A;  1UWP X;  2B18 A;  2D01 A;  4I38 A;  4WUJ A;  2L1M A;  3C38 A;  4EET B;  4NXG A;  4LPZ A;  3T4J A;  1F9I A;  3PBN A;  4CLC A;  4Q0H A;  4DJ2 A;  2OAQ 1;  5F69 A;  3LYX A;  3F1N B;  4G3W A;  4MN6 A;  5HL6 A;  4GHI B;  3F1N A;  1GSX A;  5A8B A;  2JN7 A;  2XRO A;  1WA9 A;  2J80 A;  5K5B A;  2QJ5 A;  3E4Q A;  4MN7 A;  4MDZ A;  1GSV A;  5LBR A;  4KQD A;  4BWI A;  3H82 B;  4IHQ A;  4P6Z M;  2ZBB A;  3R7W B;  4OOL A;  3S7P A;  1X0O A;  4BBT A;  1ZTU A;  3BW6 A;  4B9O A;  4Q0J A;  3C8C A;  2V0U A;  2PD7 A;  3UB9 A;  2I9V A;  4CQH A;  2V9A A;  3PBQ A;  1TS0 A;  4ARZ B;  2V1B A;  2WKQ A;  4R3A A;  2M7V A;  3S7Q A;  2NUT C;  4HIA A;  4I5S A;  4E04 A;  2VGL S;  3KO6 A;  3DBA A;  4II7 A;  3LIF A;  1XJ2 A;  1NLZ A;  2O9B A;  3LFV A;  1F98 A;  1G6O A;  2W3D A;  3E4P A;  3C30 A;  4HNB A;  3KSF A;  5HPF A;  4QPR A;  3FPW A;  2M1C A;  4O8G A;  5HD5 A;  2PHY A;  2Z6C A;  1XJ3 A;  3EOI A;  4WN5 A;  2VV8 A;  3LUQ A;  5IS1 A;  3LR5 A;  4EW7 A;  4EUV A;  1LSV A;  1DRM A;  2B02 A;  2D02 A;  1VB6 A;  1LSW A;  4EQ1 A;  2QHK A;  4GS9 A;  3LI8 A;  2QWS A;  2YKF A;  2OWH A;  2EWV A;  3D3O A;  3EQU A;  2Z6D A;  3T4L A;  4EXO A;  4LRZ E;  1T1C A;  3BJN A;  4O01 A;  4AFI A;  4H6J A;  4MCW A;  3MF0 A;  4GW9 A;  1TS8 A;  2GZA A;  2QKP A;  4I39 A;  2VKS A;  1XJ6 A;  2W1T B;  4HJ6 A;  4Y5F A;  2VV6 A;  4O0P A;  4BBU A;  3B42 A;  3LIA A;  4F3L A;  2W0N A;  3K2N A;  4FOF A;  2HJ9 C;  2QJ7 A;  3GEC A;  4EEP A;  4L9E A;  3NJA A;  3S7O A;  3F1P A;  4B93 A;  4P6Z S;  3VV4 A;  2A24 B;  4CLC C;  5HPI A;  2LB5 A;  1TS6 A;  1VHM A;  1NRJ A;  5J4E A;  3MQQ A;  3EGX C;  3OLO A;  3NOP C;  3LR4 A;  1P9W A;  1V9Y A;  3K3D A;  3EWK A;  4PKY A;  5HWV A;  5IU1 A;  4GCZ A;  5HD3 A;  4Z1W A;  3UB8 A;  5HZH A;  2JKR M;  4CLC B;  1S1Z A;  4ME4 A;  3VE4 A;  4I3J A;  3GDI A;  2FZ0 A;  2NUP C;  4IUK A;  4JGQ A;  2IA2 A;  2PYR A;  3BWL A;  1T18 A;  3FG8 A;  2INW A;  1OT9 A;  2OAP 1;  5L8M A;  1YSQ A;  1H3Q A;  5HWW A;  4Q0I A;  3TW8 A;  1D7E A;  2VZW A;  3BY8 A;  3E98 A;  1OTI A;  3MFX A;  5DFX A;  3BY9 A;  3PBT A;  4HY8 A;  3MXQ A;  4ETX A;  3CIT A;  1W63 Q;  3CWF A;  3IS2 A;  3HJK A;  2GJ3 A;  5HDS A;  5HDD A;  1MZU A;  1T19 A;  4R38 A;  1OPX A;  3OCL A;  3MR0 A;  3TJZ C;  4DMZ A;  3RTY A;  4HOI A;  1JNU A;  3LIE A;  4HQA A;  2V0W A;  4JGR A;  4WLA A;  2PDR A;  2P08 A;  5DJT A;  4KUO A;  3IBJ A;  3F1O A;  3D72 A;  3R4K A;  5F68 A;  3CUE C;  5HSQ A;  2XA7 M;  3G6O A;  3OCN A;  3KX0 X;  2A2L A;  1S66 L;  3CAX A;  3H7W B;  4YNR A;  1IOU A;  2GNX A;  4R70 A;  1P0Z A;  1G28 A;  3MMH A;  2PD8 A;  3H7W A;  1Y28 A;  5TJJ A;  2PR6 A;  5IT5 A;  1F5M A;  1S4R A;  1OTD A;  5I5L A;  2P04 A;  3E0Y A;  3T4S A;  4WF0 A;  2L0W A;  1GSW A;  4LRY C;  1XFN A;  1S4S A;  2VJW A;  2H28 A;  3CUE A;  3HCY A;  1OJ5 A;  3T4Q A;  4EU0 A;  3PYP A;  4IJG A;  3PBO A;  2O99 A;  2JKT M;  3VOL A;  3LI9 A;  4YOF A;  5DF9 A;  2G7U A;  1DP9 A;  2EA9 A;  3S7N A;  4GS9 B;  2ZMF A;  5F5Y A;  2O9C A;  3LR3 A;  2WKR A;  1XJ4 A;  5AVE A;  3ULF A;  5KIZ A;  2XSS A;  3CI6 A;  4H6J B;  4CLC D;  4GJ4 A;  4Y2F A;  3RFB A;  1TS7 A;  3KYQ A;  3A0S A;  2P7J A;  1IFQ A;  4BBV A;  2W3H A;  2PT7 A;  5C5K A;  1YAX A;  2XRN A;  4LLO B;  2LB9 A;  3JVU A;  1T1A A;  4WL9 A;  5HWT A;  4BMW A;  5TBM A;  3EEH A;  3P7N A;  2K2N A;  4HH2 A;  4F3L B;  2QYB A;  3MJQ A;  3UB6 A;  2W3G A;  2YKH A;  2PYP A;  5DKK A;  4DJ3 A;  3W2Z A;  2GX5 A;  5KSH A;  3O5Y A;  1LT0 A;  1OT6 A;  2HGV A;  3F1P B;  2KLI A;  4DN0 A;  4WEJ A;  1OTB A;  4OOM A;  2O0Y A;  3UE6 A;  3B47 A;  4HP4 A;  4HJ3 A;  1D06 A;  4WEK A;  5CX7 A;  2MJ6 A;  2XA7 S;  3BQA A;  4PAU A;  2K31 A;  4M4X A;  2J3T C;  4EER A;  1TD5 A;  4FSF A;  1KOU A;  1BYW A;  3U2A A;  2W3F A;  4JGP A;  3KSH A;  2JKR I;  2CMN A;  2V1A A;  4G3V A;  1EW0 A;  2L4R A;  2WKP A;  2HF6 A;  1NWZ A;  3ICY A;  3V67 A;  4L9G A;  3IS2 B;  3SW1 A;  2OOL A;  3OBF A;  4KQO A;  2W1R A;  5AVF A;  4HP9 A;  4NXF A;  1V9Z A;  1P9R A;  3E4O A;  2PR5 A;  4G3K A;  5DJU A;  1OJG A;  4Y3I A;  2K7S A;  3TE8 A;  3F1O B;  4NKP A;  4UQI M;  3PBS A;  4GHI A;  1YKD A;  1S1Y A;  4EEU A;  1UWN X;  1OTE A;  4PHT A;  4YWZ A;  1DP8 A;  5G4Y A;  3VE3 A;  3T4K A;  1OTA A;  3EEA A;  4I3I A;  2ZMV A;  5F6A A;  3UME A;  3H82 A;  4EES A;  4GLQ A;  3KYZ A;  5G4Z A;  4HH3 A;  4HHD A;  1LL8 A;  3R7W A;  5J3W A;  3OOV A;  4HI4 A;  3MQO A;  3KSI A;  4MMN A;  3T4T A;  1S67 L;  4NEE D;  4ARZ A;  1DP6 A;  3K3C A;  5DFY A;  1YSP A;  3ZYT A;  2VX8 A;  3LID A;  3JVV A;  2VV7 A;  3UMD A;  1TF1 A;  3PR6 A;  1LSX A;  2JKT I;  2VA0 A;  4WEL A;  1H8M A;  2DMW A;  1XFQ A;  1P97 A;  3EQV A;  2KX6 A;  4LRX C;  3EGD C;  3T4O A;  4R6L A;  4UEY A;  2FH5 A;  1ZHH B;  3PHY A;  3ZQ5 A;  4I3A A;  3T50 A;  3OC2 A;  4XT2 B;  5FL3 A;  2VEA A;  3NOU C;  4ZRR A;  2ZOH A;  4XT2 A;  2EWW A;  4L0L A;  5TBM B;  2J3T D;  4JGO A;  3TRC A;  2R78 A;  3FC7 A;  2KDK A;  3PXP A;  3P01 A;  3MQ0 A;  5HDC A;  5AJG A;  1N9N A;  2J3W A;  2Y8H A;  2ZOI A;  3BQ8 A;  2O9A A;  3NHQ A;  5DKL A;  2M7U A;  1ODV A;  4PKY G;  3CLO A;  3RH8 B;  3IBR A;  1MC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...