4WLAA

Time resolved serial femtosecond crystallography captures high resolution intermediates of pyp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Time-resolved serial crystallography captures high-resolution intermediates of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wlaA00
4MN6A 2KX6A 1T1CA 4HP4A 4F3LB 3NOTC 4BBTA 4R3AA 4EEPA 1T18A 1XJ4A 3F1OA 4GS9B 4R70A 4EESA 1P97A 4JGPA 3LIDA 4EETB 1OT6A 1S67L 1LSVA 1TS0A 3FC7A 2H28A 1XJ2A 3EEHA 4XT2A 5HWVA 2OOLA 3E4PA 4LLOB 1S1ZA 4LRXC 4EEUA 4NXFA 2VEAA 2D01A 4HIAA 1XFNA 4PKYA 5DKLA 1DP6A 1LL8A 3E4OA 2P7JA 3H7WB 1XJ6A 4HOIA 2QJ7A 3F1NB 2PR6A 2WKQA 4KUOA 5DJTA 1OTIA 4HNBA 4HJ3A 3HJKA 5HDCA 2PYPA 1T1AA 5IU1A 2PDRA 5G4YA 4DJ2A 3BY8A 3OLOA 4LPZA 1D06A 4M4XA 3H82A 2EA9A 5J7EA 5G4ZA 1X0OA 4I5SA 3IS2A 3A0RA 4GW9A 2A24B 2HV1A 4RQ9A 3PYPA 3LIAA 3MXQA 2W0NA 1GSVA 4HI4A 1VB6A 3UB8A 4EQ1A 3G6OA 1ODVA 1G28A 1UGUA 2V0UA 3GDIA 5F5YA 3VE4A 1P0ZA 2QHKA 4WF0A 3UB9A 5HD5A 4R6LA 4BBVA 4EXOA 4I3AA 3E4QA 3MQQA 2JHEA 3SW1A 3ICYA 1XFQA 5HZHA 1OTDA 1EW0A 1OTEA 5IS1A 4H6JB 4HP9A 1GSXA 4YWZA 4HJ4A 2D02A 1KOUA 2VV6A 5HD3A 2QWSA 3F1PB 1S1YA 4R38A 3UMEA 3LUQA 3ULFA 3NJAA 3LYXA 3MR0A 1JNUA 2CMNA 1S4RA 3H9WA 4GHIB 3GECA 5DJUA 4B9OA 4HY8A 3B33A 5AVEA 4HJ6A 5KIZA 3NOPC 3LI8A 4K08A 4HQAA 4WLAA 2W27A 3LIBA 2A24A 2OWJA 1XJ3A 1GSWA 2ZOIA 2V0WA 2PD8A 2PR5A 1DP9A 5HWWA 2QJ5A 3P7NA 3A0VA 4MN5A 3K3DA 4I3JA 1TS7A 1S4SA 3NHQA 3C2WA 2GJ3A 2L0WA 3UB6A 3CWFA 4WN5A 1OTAA 4KUKA 2VV7A 1D7EA 3CLOA 1DRMA 3A0SA 4E04A 4BBUA 3VOLA 4WL9A 2Z6CA 4F3LA 2V9AA 1LT0A 1N9LA 5TBMB 4GS9A 3D72A 1UWPX 4DJ3A 4HH2A 4NXBA 1TS6A 4I3IA 1TS8A 3RTYA 1F9IA 2JN7A 4EERA 3F1PA 4HH3A 5DKKA 3MFXA 4I38A 1LSXA 4EW7A 2ZOHA 4L9EA 5J3WA 3RH8B 1BYWA 3HJIA 5J4EA 2J80A 3NOUC 4L9FA 3H7WA 3BWLA 4JGQA 3F1NA 3LIFA 4NXEA 1V9ZA 3KX0X 3LI9A 1OTBA 2K7SA 2V1AA 3BY9A 2VLGA 3MQOA 1OT9A 1T19A 2WKRA 2INWA 3T50A 1DP8A 3LICA 4I39A 5HWTA 4LRZE 1Y28A 4WUJA 5F69A 2I9VA 4JGOA 4HHDA 3F1OB 2Z6DA 4GCZA 1V9YA 3UB7A 2L1MA 3VE3A 3K3CA 3LIEA 3C8CA 4XT2B 1OJGA 1N9NA 2KDKA 5F68A 2PHYA 2OWHA 2B02A 4KQDA 5TBMA 1N9OA 2ZBBA 1NWZA 1S66L 5HDDA 2L4RA 1WA9A 3UE6A 1T1BA 5AVFA 5HSQA 3ZQ5A 5HDSA 2WKPA 3PHYA 4L9GA 2R78A 1LSWA 1MZUA 2YKFA 4H6JA 1F98A 2PD7A 3H82B 2QKPA 1OJ5A 3MJQA 2VV8A 4NXGA 2BASA 2M1CA 3IS2B 3IBRA 4PKYG 1UWNX 5F6AA 2V1BA 5A8BA 3FG8A 4JGRA 5EFWA 4GHIA 3EWKA 4LRYC 3CAXA 5I5LA 3UMDA 2YKHA 2PYRA
chains in the Genus database with same CATH superfamily
1JTDA 4Y15A 5FDHA 2ZC6B 4CJNA 4HP4A 5E43A 4F3LB 4EEPA 5M18A 3F1OA 2A2LA 4BD1A 1ACFA 4R70A 5TFQA 4EESA 3LIDA 2VGKA 4X6TA 4EQIA 1YLWA 4EETB 4IUKA 2EX2A 1RCJA 2Z2LB 3V3SA 2W3FA 4E3OA 1RGYA 3E2LA 3T4LA 3N7WA 2OOLA 2W1TB 4LLOB 3ZGAB 2DNSA 3G31A 4HIAA 5L10A 3E4OA 2P7JA 3JPUA 4OP5A 5CXWA 5CTMA 1XJ6A 4HOIA 5AQ9A 4Z1WA 4PM7A 2PR6A 5DJTA 2C6WB 4A5RA 2H10A 4B88A 3S7PA 2R9XA 3IHAA 1T1AA 5A90A 5IU1A 2PDRA 5G4YA 2XGNA 2XSSA 3OCNA 1JWZA 2B18A 4M4XA 2E8IA 5J7EA 4JXGA 3N4IA 5DFXA 1CQAA 3ZG8B 4OPQA 2A24B 3P98A 1FILA 2V8FA 5CHJA 2XA7S 4S2NC 4FH4A 2JKFA 4B93A 1Y54A 1GSVA 2Y2KA 1PW1A 1NY0A 1VB6A 1PFLA 1NZUA 4IVKA 2H0TA 3UB8A 3S1YA 3HLBA 3ITBA 2V0UA 4C6YA 4L0LA 5F5YA 3VE4A 1P0ZA 1LLBA 2IA2A 4BD0A 4Y0TA 1IKGA 2IWBA 5CGSA 5HD5A 5M19A 5EOEA 2PT7A 2ZC5B 3MS6A 5FATA 3D3OA 3CPTA 3NY4A 4GN2A 3IF6A 2JHEA 4X56A 3IXDA 4BENA 1K4FA 3O88A 2XH9A 4S2OA 1EW0A 1RP5A 4BWIA 4KZ5A 3IX8A 3VFFA 3KSFA 4HP9A 2EWVA 5DF9A 4HJ4A 3FWLA 4BL2A 2D02A 3DAVA 3U4LP 4QY6A 4UA7A 1ONHA 2Y8HA 5KMWA 1G5UA 3LUQA 3LYXA 1JNUA 5AJGA 5HW3A 4F94A 5BOHA 4DDSA 4JLFA 2GX5A 5AVEA 4HJ6A 5KIZA 1BSGA 4GDNA 5FI2A 4K08A 4HQAA 4WLAA 3W4QA 4N92A 3GTCA 3KYEA 2PRFA 3NC8A 5D3OA 4Q8IA 1NXYA 1ALQA 2OAQ1 1OMEA 3MBZA 5GHZA 5HX9A 3HL9A 3Q7VA 4YNRA 2J9PA 1IOUA 1E3UD 4OLGA 5CX7A 5CGXA 4ARZB 3BRMA 4MCWA 1L0GA 2G2WA 2XD1A 4MN5A 2ZMFA 3TRCA 4OONA 1TS7A 4H8RA 3NHQA 3LY4A 2X01A 1JWPA 1L0DA 4FUWA 1KE4A 4OPYA 3IQAA 3OC2A 1HLUP 1STZA 4QPRA 3RJUA 4WZ4A 4IEDA 2OAP1 2HP6A 3A0SA 3MZFA 2NUTC 3V39A 4ME4A 1XPBA 4ZJ1A 1Z09A 4WL9A 2LB5A 4U0TA 3VP2A 5TBMB 1UWPX 4BJPA 5FSRA 1PIOA 1MKMA 2BLSA 4I3IA 2UV0E 4KG5A 2HJEA 3A3JA 3FKWA 1F9IA 5FASA 2JN7A 2OLVA 3F1PA 5DKKA 3MFXA 5FAPA 5TR7A 3BQ8A 2VGLM 2W3HA 4X68A 4NK3A 4S2IA 1NRJA 1BYWA 3HJIA 3G2YA 4QHCA 3NOUC 1LL5A 2A3UA 3S7OA 4KZ4A 3LEZA 1YQSA 5F1GA 1GHIA 3BM6A 2AVXA 1MKIA 2XD5A 3V3RA 3KX0X 4P0MA 1Y4OA 3I7JA 2FFFB 3L7HA 2J8YA 3BFEA 2OV5A 1PWGA 4EWFA 1MWTA 1VETA 3BY9A 4JXWA 1IEMA 3IF6B 2WKRA 2INWA 3TW8A 1FR6A 5G18A 4WEJA 3WS0A 4LRZE 1FCOA 1Y28A 3LCEA 3FV7A 3G2ZA 3N8LA 1G6OA 3ZFZA 2PU2A 2JKTM 4P6ZS 2O9AA 1BULA 4GCZA 3UB7A 4OQHA 4KG2A 4N1HA 4WYYA 4Y13A 3C5AA 4MBFA 5CGWA 3LIEA 3NBLA 3BLSA 4XT2B 1EWZA 4M3KA 2JKGA 3SH7A 4PM5A 2PHYA 1Z6FA 3T4SA 2OWHA 2B02A 2WKHA 2RL3A 4LCMA 1MPLA 4KQDA 1L2SA 3IWOA 1IYQA 1A0KA 2A49A 2XK1A 4PM9A 3ZYTA 3LY3A 4CLCB 1NLZA 5AVFA 4CQHA 4UEYA 5LBRA 3ZQ5A 4MBKA 1IYPA 3BFGA 3FPVA 1MZUA 2QKPA 4DE1A 2VJWA 3CI6A 4QD4A 3MJQA 3T1RA 4NXGA 2J7VA 3UE1A 1K54C 3IBRA 4PKYG 1WE4A 3QP8A 5F6AA 1O07A 5CHUA 3ZNYA 2V1BA 2DRWA 1BUEA 5EFWA 3LR3A 3Q82A 3ZCZA 3UMDA 2NUPC 5FL3A 4Q0JA 5F83A 5E2EA 4G3VA 2VA0A 1XGJA 3OPPA 4RX2A 3ZVWA 1XJ4A 2JC7A 3OBFA 4R1GA 1MY8A 1S67L 1LSVA 4WZ5C 1MWUA 2Y2OA 4UQIM 1XJ2A 3VV4A 2HGVA 4AFIA 1S1ZA 4NXFA 3HLFA 5E2GA 3Q07A 3BJNA 4PKYA 3RFBA 3PBRA 2EFUA 3T1XA 1ESIA 3UE0A 3IXHA 1TDLA 4C75A 4HNBA 3SZTA 4DXBA 4IJGA 1WYCA 2PYPA 4UA9A 1VETB 4DJ2A 3SH9A 3BY8A 3C7VA 1YLZA 4LPZA 4HBTA 2EA9A 3O5YA 4JXSA 4KZ3A 4FH2A 1FSWA 3NIAA 1ERMA 2J3TC 2PAVP 4O8GA 2XLNA 2KLIA 3FPWA 1K25A 3LIAA 1FCMA 2EFXA 3GVBA 5E2FA 5FAOA 5AQAA 1K57C 5EECA 2ACGA 3A3EA 4EQ1A 3G6OA 3VSLA 4Y0UA 1LL9A 5DF8A 3TG9A 2EX9A 2UWXA 1DJCA 2J3TD 1K55A 3AGEA 2QHKA 3HVFA 3UB9A 2Y4AA 3E98A 1BT5A 1QMFA 1XKZA 4I3AA 5GLDA 3IF6C 2OLUA 2Y2NA 4KZ8A 3SW1A 1PZOA 1K4EA 2O0YA 4UHUA 5EM0A 4N9KA 3LGOA 1SKOB 3OOVA 4LV3A 4R4SA 1VEUA 5EVIB 3R7WB 3VMAA 4QY5A 4KZAA 5EPHA 2HPBA 5HD3A 3ITAA 2JE5A 3UMEA 3WRZA 1ZKJA 4K91A 4JXVA 3MXRA 1GCEA 3BLMA 1S0WA 1SCWA 3UY6A 5GLBA 3MMHA 3HLDA 1CJFA 4B9OA 4HY8A 3B33A 5FI7A 5FEFA 2VGLS 3NOPC 3LI8A 3V5MA 5FDSA 3ZHHA 4CLCC 4O01A 3LIBA 2EX8A 3LR0A 2J9OA 2RCXA 2ZOIA 4OQIA 5F1FA 1W79A 3GRJA 1NLYA 2V0WA 4EBPA 1EROA 3S7NA 3DTEA 2PD8A 3O3VA 3UDFA 5J8XA 4XUZA 1DP9A 2ZLYA 2XRNA 1WYBA 3P7NA 1J9MA 1E4DA 3JVUA 4LCLA 1ES4A 2HDQA 1MBLA 3K3DA 1YLTA 1YLYA 4CLCD 1S4SA 5HFOA 2GJ3A 4K0WA 1H8YA 4JF4A 2L0WA 1ZHHB 2V20A 1TD5A 3QNBA 4IHQA 4WN5A 3HLCA 2XFTA 1OTAA 5JYOA 1NRFA 4DXCA 2Y2PA 3A3IA 4KQOA 5GLCA 4E3JA 4OOMA 2WAEA 2K31A 1DRMA 3M6BA 5AQ7A 4MN7A 2ZL1B 1N9LA 3UPOA 3CG5A 2V8CA 4EUZA 4GS9A 3C7UA 3VSKA 4HH2A 4NXBA 1TS6A 3QHYA 4BMWA 2ZQAA 2WGWA 2JKRI 4HH3A 3KO6A 3T4OA 1YSQA 1SDEA 2WGIA 1YT4A 5J4EA 2J80A 2ZC3B 4L9FA 2EX6A 4FSFA 4R0QA 1F5MA 3H7WA 3ISGA 3BWLA 5EV0A 4Y3IA 3F1NA 4NXEA 2X02A 1GHPA 1GA9A 2MJ6A 4WM9A 3BFDA 4JKTA 3P09A 2KOIA 4P87A 2R9WA 4NKPA 4NETA 3LI9A 1IKIA 3MKEA 2P9VB 4O0PA 1G6AA 4Q0HA 4MEZA 4LV1A 4RX3A 3NI9A 2VZWA 4X55A 1L0FA 5CTNA 1OPXA 1MWSA 4I39A 4WELA 5HWTA 3ZG5A 2Y2LA 4WUJA 2QMIA 5F69A 2I9VA 2WK0A 3HLEA 3PXPA 1HTZA 4OKPA 3AGDA 3UB5P 3RXXA 3F1OB 1VEUB 1I5QA 5HAQA 3UPPA 2ZQ8A 2QYBA 3ZNTA 3T12B 2JKTI 4PAUA 1OJGA 4KG6A 3UE3A 5F68A 1LI9A 3BQAA 1ES2A 1PRQA 3Q7ZA 2HP9A 2M7UA 2ZC4B 2XDMA 4Y5FA 1S66L 4BL3A 3BFCA 5HDDA 4ESPA 3G4PA 4XXRA 2WKEA 1NYMA 3MSHA 5HSQA 3N6IA 2O9BA 1I2WA 4DKIA 5TGFA 3B3XA 5HAIA 2JKRM 4L9GA 1W7FA 2WGVA 1F98A 2P74A 5EVIC 4E3NA 2GDNA 1BLPA 3HLWA 4WMCD 2VV8A 3JVVA 3JYIA 1NYYA 3E0YA 3VP3A 1IYSA 1H3QA 3MFDA 5A8BA 3IBJA 1K56A 4JGRA 2GZAA 3Q81A 3VFHA 5C5KA 3IH8A 2ZM2A 4LRYC 1SHVA 2XF3A 1JWVA 5I5LA 5EVID 3BYDA 4G3KA 1MXOA 3OPLA 5F82A 3E2KA 2YKHA 4OLDA 2H0YA 3G30A 3NOTC 4BBTA 3K2NA 4R3AA 1T18A 4MNRA 4GS9B 4JGPA 3SOIA 2Q9NA 3L9KA 1PNEA 3NECA 3CPTB 1TS0A 3FC7A 2H28A 4GKUA 4KZ7A 3EEHA 3D9YA 4DRTA 3DTKA 2IWCA 3E4PA 5EOOA 2HDUA 2VEAA 2D01A 3CZDA 1IYOA 3N8RA 4PHTA 3M6HA 3NCKA 1BLSA 4JBFA 3T4JA 3H7WB 2XA7M 4OPZA 5CERA 5L8MA 3WRTA 3F1NB 3CUEC 4KUOA 1KDWA 1OTIA 4IBXA 3A3FA 3HJKA 1I2SA 2B5RA 4S2PA 2W1RA 1LI0A 3OLOA 1W63M 3KSGA 1D06A 4ZAMA 3OPRA 3H82A 4PMAA 3QP1A 2FZ0A 1X0OA 2ZM0A 3A0RA 4KZ6A 2VKSA 2K2NA 3IS2A 3LFVA 2H5SA 4JF5A 2V1ZA 4RQ9A 2LB9A 1QMEA 3PYPA 5KSCA 3Q7VB 2WUQA 3MXQA 3UO9A 2W0NA 1FQGA 1GA0A 4HI4A 4QU3A 5I94A 4DE0A 3IXGA 5FQ9A 5KSHA 2DCFA 1M40A 5DTTA 5L2FA 1JVJA 3GDIA 1K55C 1CI8A 4D2OA 4KQRA 4WF0A 2CC1A 3IX3A 4UAAA 4R6LA 2Y2QA 4EXOA 3AGFA 3CMZA 1AXBA 4E6XA 3MQQA 3R4KA 5FQKA 4DN0A 3ICYA 4FD8A 1XFQA 4E3IA 5HZHA 4FCFA 1OTDA 3UDXA 3EEAA 2W1TA 1LHYA 5IS1A 4OQ0A 2ZQ9A 4MLLA 4E3KA 1GSXA 3NDGA 1MC0A 4KZBA 1KOUA 3BW6A 1TVFA 4OP8A 5IHVA 1FCNA 5HL6A 1W63Q 3F1PB 5EE8A 1XA7A 1IELA 3NJAA 2CMNA 4DE2A 2E8JA 3T1QB 4N9LA 5HAPA 3GECA 2V2FF 5DJUA 1YAXA 4EU0A 3TSGA 1XA1A 3WS5A 3HUNA 4D60A 3W4PA 3KYQA 4X1LA 3WS2A 3WWXA 2A24A 2WYXA 2Y79A 1H8ZA 3DWKA 1GSWA 5TJJA 2VX8A 5DFYA 4NG2A 5HWWA 1ES3A 3UPNA 3SS3A 4E3LA 3A0VA 5L07A 1E25A 1ZG6A 2ZJ9A 3IH9A 4I3JA 2JBFA 5FA7A 3C2WA 4MDZA 1BLHA 5CEBA 4RYEA 4IBRA 3VP4A 1XXMA 1CEGA 1PWDA 1YPRA 4RVAA 1H5XA 4E04A 3QP2A 3HREA 3T4TA 3DW0A 2V9AA 4OH0A 3PAGA 1LT0A 2FH5A 4S2MA 3D72A 4DJ3A 1VHMA 3VOYA 1AWIA 1PZPA 4BLMA 3PBSA 3DBAA 2HP5A 3PTEA 4EERA 4OQGA 1ES5A 3S4XA 1LSXA 1CEFA 2ZD8A 4X69A 2HZ5A 3N8SA 1KVMA 3OCLA 5JYPA 3C38A 4P6ZM 4EV4A 3HUMA 4IUHA 3A3DA 2QPNA 1K6RA 1ESUA 3LR4A 2HDSA 2ZQCA 3KSHA 1V9ZA 5E2HA 2G2UA 2ZM8A 3V67A 3HLGA 4PM8A 3EOIA 4QB8A 1FSYA 4WZ5A 4E3MA 1OT9A 1T19A 1DP8A 4II7A 1Q2QA 1U60A 3LICA 4ARZA 4HEFA 3EGDC 3VOZA 2WKIA 3PBQA 4JGOA 5EVLA 4HHDA 3CJMA 1V9YA 3M2JA 2DMWA 4N1XA 3VE3A 2EWWA 1KE0A 3HBRA 5CECA 3K3CA 3UDIA 3C8CA 3BFFA 3U2AA 4OOLA 1YKDA 4ZDXA 4R4RA 3WS4A 4JPMA 1L3LA 1M6KA 5K5BA 4FTXA 3RXWA 5MC7A 5IT5A 3IWIA 4P85A 5TBMA 4WEKA 1N9OA 2ZBBA 2ZQ7A 1NWZA 1KGEA 2L4RA 1WA9A 3UE6A 1JTGA 3PBNA 3GR2A 2EXBA 3SH8A 3ZDJA 4GD6A 2W3EA 3PHYA 4B4ZA 2R78A 1LSWA 2YKFA 4DF6A 4H6JA 5EVEA 1YMSA 4WBGA 4LGWA 2VGJA 4GB7A 2P08A 1HD8A 3T4KA 1K57A 2BASA 3KSIA 2B95A 1UWNX 1XP4A 4R3JA 5HARA 3CITA 5FI6A 3T4QA 5KZHA 3NULA 2J3WA 3C4OA 4GHIA 4YINA 4YOFA 3BECA 3EWKA 1KE3A 3CAXA 1G68A 3GQZA 1K6SA 3IF5A 4C3QA 1HVBA 4MN6A 2KX6A 3EQUA 4GOGA 4Q0IA 1T1CA 1P97A 1K56D 4LV0A 3IX4A 1OT6A 3C4PA 3DTMA 4X1MA 3Q1FA 3IXBA 4GD8A 1ONGA 4XT2A 3WS1A 5HWVA 3EGXC 4IVIA 4LRXC 4EEUA 2W3DA 4LENA 1XFNA 4ZRRA 5DKLA 1DP6A 1LL8A 2QJ7A 4CPKA 2WKQA 2Y59A 2FFYA 2HDRA 4CLCA 3DWZA 3MQ0A 4HJ3A 4KENB 2Y2GA 1PWCA 2Y2IA 5HDCA 3HCYA 4KZ9A 3D4FA 1W8QA 4PM6A 2Z2MB 4UQIS 1J3WA 1W8YA 3BEBA 5DTKA 4UA6A 4ETZA 1PI5A 1SDNA 4U3TA 3W2ZA 5G4ZA 1GHMA 3FYZA 4I5SA 1EI5A 2WZXA 4GW9A 4O7DA 1MWRA 2HV1A 2PU4A 4GJ4A 2XEPA 4B4XA 3B42A 4ZTKA 2EXAA 4GLQA 4S2NA 3PBTA 4E6WA 3MXSA 5DF7A 3CHWP 4PPRA 1K38A 1ODVA 1G28A 1UGUA 3G35A 4LFUA 2OSUA 4DDYA 1CK3A 3S7QA 1BLCA 1IFQA 1CF0A 5CHMA 3EQVA 4BBVA 5FQJA 4EBNA 1FOFA 5EUAA 3E4QA 2ZMAA 2Y2HA 5FQQA 2Y55A 4HBUA 3LR5A 4K0XA 1OTEA 3QP5A 4H6JB 3UN7A 4ZBEA 2XQZA 4X53A 4YWZA 5GHXA 1DJAA 1YLPA 3ZVTA 2VV6A 4Y17A 2WGWB 2QWSA 4Y7PA 4GDBA 2GNXA 1S1YA 4R38A 5CEDA 3PAEA 1O7EA 4MBHA 3O86A 3TJZC 4JF6A 3ULFA 3MR0A 3SS4A 1S4RA 3PR6A 3H9WA 4GHIB 4XUXA 1ERQA 1TEMA 4ZJ3A 1KGGA 1YLJA 3SS5A 1E3UA 4Y2FA 1PI4A 1YM1A 2Y91A 3TOIA 4DMZA 3MF0A 4OPRA 3VP0A 3FZCA 2W27A 4GZBA 1ZTUA 3P01A 2OWJA 5A93A 4Z9QA 5FAQA 1XJ3A 3V50A 1H8MA 4MMNA 3ZG7B 5DVAA 1PW8A 5GL9A 2PR5A 3LEQA 2WZZA 3GV9A 3MKFA 2QJ5A 4QJGA 4R3BA 1PYYA 4G3WA 4OOYA 4P6BA 4QWOA 3T1SA 1XX2A 3UNWA 3M2KA 2WADA 3GMWA 5CRFA 3CWFA 3UB6A 4WMCA 2X71A 4FOFA 4S2LA 5DTSA 1FR1A 4KUKA 3IT9A 2HF6A 3O87A 1FIKA 2VV7A 4U0XA 5AQBA 1D7EA 3CLOA 3OZHA 1NZOA 1HZOA 2IWDA 4BBUA 3VOLA 2M7VA 3KYZA 2Z6CA 4F3LA 1SKOA 4ID4A 5L09A 5EVIA 3R7WA 1P9WA 3ZG9B 1VQQA 1TS8A 1L0EA 3RTYA 1KDSA 2QZ6A 2XR0A 2BTFP 4I38A 1YMXA 4EW7A 2ZOHA 1N9BA 5A91A 4L9EA 5J3WA 3RH8B 5EM1A 4EBLA 4S2JA 2ZC7A 3MZDA 3PBOA 3W4OA 1KVLA 4BQMA 4JGQA 5M1AA 3LIFA 5FQIA 1KGFA 3NDEA 5A92A 3HUOA 5HL1A 3IHBA 2ZQDA 1YSPA 4NEED 4S2KA 1OTBA 2K7SA 2V1AA 1ZG4A 1BZAA 2VLGA 3G34A 3MQOA 2Q9MA 3OPHA 2PBDP 4KQQA 4RA7A 5U47A 2BG1A 1D1JA 2XFSA 2WAFA 2ZMVA 3DTIA 1TF1A 3IWQA 4R23A 2Z6DA 2L1MA 3QP4A 4GNUA 1F2KA 2O99A 1ZC2A 1DY6A 1DJBA 3QNCA 3CUEA 3C30A 1K0KA 1N9NA 2KDKA 2Y2MA 3QP6A 1N4OA 3ZG0A 3LO7A 4OVDA 3FKVA 2ZL1A 4DE3A 1TDGA 2VK3A 3W8KA 1SKFA 4Y0OA 3B47A 1T1BA 1P9RA 1SZVA 5GLAA 2XROA 2W3GA 1NJ4A 1W5DA 3MZEA 1CI9A 2Y2JA 3GSGA 5HDSA 1H0MA 2JCHA 2WKPA 2G7UA 3TE8A 2O9CA 1Q2PA 1S6RA 2PBYA 3G32A 2PD7A 3H82B 4X25A 1OJ5A 1VM1A 5FEGA 4CLCE 5GHYA 2M1CA 3IS2B 4ZJ2A 1K54A 4ETXA 4EUVA 2I72A 5HPFA 1C3BA 3S22A 3FG8A 5FQMA 5HPIA 1BTLA 2P9VA 2Q0OA 4LV2A 4YFMA 3VP1A 2P04A 1XGIA 2C5WB 4HESA 2HJ9C 3T50A 1RGZA 2PYRA
chains in the Genus database with same CATH topology
4MN6A 2KX6A 3EQUA 4Q0IA 1T1CA 4HP4A 4F3LB 4G3VA 2VA0A 3NOTC 4BBTA 3K2NA 4R3AA 4EEPA 1T18A 1XJ4A 3OBFA 3F1OA 2A2LA 4GS9B 4R70A 4EESA 1P97A 4JGPA 3LIDA 4EETB 4IUKA 1OT6A 1S67L 1LSVA 1TS0A 2W3FA 2H28A 3FC7A 4UQIM 1XJ2A 3EEHA 3VV4A 4XT2A 3T4LA 2HGVA 5HWVA 3EGXC 2OOLA 2W1TB 3E4PA 4AFIA 4LLOB 1S1ZA 4LRXC 4EEUA 4NXFA 2VEAA 2W3DA 2D01A 4HIAA 1XFNA 3BJNA 4ZRRA 4PKYA 4PHTA 5DKLA 3RFBA 1DP6A 1LL8A 3E4OA 2P7JA 3PBRA 3T4JA 3H7WB 2XA7M 1XJ6A 4HOIA 5L8MA 2QJ7A 4Z1WA 3F1NB 3CUEC 2PR6A 2WKQA 4KUOA 5DJTA 1OTIA 4CLCA 3MQ0A 4HJ3A 4HNBA 3S7PA 3HJKA 5HDCA 3HCYA 4IJGA 2PYPA 1T1AA 5IU1A 2PDRA 4UQIS 5G4YA 2W1RA 4DJ2A 2XSSA 3OCNA 3BY8A 3OLOA 1W63M 3KSGA 1D06A 4LPZA 4ETZA 2B18A 4M4XA 3H82A 2EA9A 3O5YA 3W2ZA 5J7EA 5G4ZA 2FZ0A 1X0OA 4I5SA 5DFXA 3IS2A 3A0RA 2J3TC 2K2NA 2VKSA 3LFVA 4O8GA 4GW9A 2A24B 2HV1A 4GJ4A 2XA7S 3B42A 4RQ9A 2LB9A 3PYPA 2KLIA 4GLQA 3FPWA 3PBTA 3LIAA 3MXQA 2W0NA 4B93A 1GSVA 4HI4A 1VB6A 3UB8A 4EQ1A 3G6OA 1ODVA 1G28A 1UGUA 5KSHA 2V0UA 3GDIA 4L0LA 2J3TD 5F5YA 3VE4A 1P0ZA 2QHKA 3S7QA 4WF0A 2IA2A 3UB9A 1IFQA 3E98A 5HD5A 4R6LA 3EQVA 4BBVA 4EXOA 2PT7A 4I3AA 3D3OA 3E4QA 3MQQA 3R4KA 4DN0A 2JHEA 3SW1A 3ICYA 1XFQA 5HZHA 2O0YA 3LR5A 1OTDA 1EW0A 4BWIA 3EEAA 1OTEA 2W1TA 5IS1A 3OOVA 4H6JB 3KSFA 4HP9A 1GSXA 3R7WB 2EWVA 4YWZA 5DF9A 1MC0A 4HJ4A 2D02A 1KOUA 3BW6A 2VV6A 5HD3A 2QWSA 5HL6A 2GNXA 1W63Q 3F1PB 1S1YA 4R38A 3UMEA 2Y8HA 3TJZC 3LUQA 3ULFA 3NJAA 3LYXA 3MR0A 1JNUA 2CMNA 1S4RA 5AJGA 3PR6A 3H9WA 4GHIB 3MMHA 3GECA 5DJUA 1YAXA 4B9OA 4HY8A 4Y2FA 2GX5A 3B33A 5AVEA 4HJ6A 4EU0A 5KIZA 2VGLS 3NOPC 3LI8A 4DMZA 3MF0A 4K08A 4HQAA 4WLAA 2W27A 4CLCC 4O01A 3KYQA 3LIBA 3LR0A 1ZTUA 3P01A 2A24A 2OWJA 2Y79A 1XJ3A 1GSWA 2OAQ1 2ZOIA 5TJJA 1H8MA 1NLYA 2V0WA 2VX8A 4MMNA 5DFYA 3S7NA 2PD8A 4YNRA 2PR5A 1IOUA 1DP9A 5HWWA 2QJ5A 2XRNA 5CX7A 3P7NA 3A0VA 3JVUA 4ARZB 4MCWA 4G3WA 4MN5A 2ZMFA 3TRCA 3K3DA 4I3JA 1TS7A 4CLCD 1S4SA 3NHQA 3C2WA 2GJ3A 4MDZA 2L0WA 1ZHHB 1TD5A 3UB6A 3CWFA 4IHQA 4WN5A 4FOFA 1OTAA 3OC2A 4KUKA 2HF6A 1STZA 4QPRA 4KQOA 4OOMA 2OAP1 2VV7A 1D7EA 2K31A 3CLOA 1DRMA 3A0SA 2NUTC 4E04A 4ME4A 4BBUA 3VOLA 3T4TA 4WL9A 2LB5A 4MN7A 2M7VA 3KYZA 2Z6CA 4F3LA 2V9AA 1LT0A 1N9LA 2FH5A 5TBMB 4GS9A 3D72A 1UWPX 3R7WA 4BJPA 4DJ3A 1VHMA 4HH2A 1P9WA 1MKMA 4NXBA 1TS6A 4I3IA 1TS8A 4BMWA 2HJEA 3PBSA 3RTYA 3DBAA 1F9IA 2JN7A 2JKRI 4EERA 3F1PA 4HH3A 5DKKA 3MFXA 4I38A 1LSXA 4EW7A 3BQ8A 2ZOHA 3KO6A 2VGLM 2W3HA 4L9EA 3T4OA 3OCLA 1YSQA 5J3WA 1NRJA 3RH8B 1BYWA 3HJIA 5J4EA 3C38A 2J80A 3NOUC 4P6ZM 4L9FA 3PBOA 4IUHA 3S7OA 4FSFA 1F5MA 3H7WA 3BWLA 4JGQA 4Y3IA 3F1NA 3LIFA 4NXEA 2MJ6A 3LR4A 3KSHA 2KOIA 1V9ZA 1YSPA 3KX0X 4NEED 4NKPA 3V67A 3LI9A 1OTBA 2K7SA 2V1AA 4O0PA 4Q0HA 3BY9A 3EOIA 2VLGA 2VZWA 3MQOA 1OT9A 1T19A 2WKRA 2INWA 3T50A 3TW8A 1DP8A 4WEJA 4II7A 1OPXA 3LICA 4I39A 4WELA 5HWTA 4LRZE 4ARZA 3EGDC 1Y28A 4WUJA 5F69A 3PBQA 2I9VA 1G6OA 3PXPA 2ZMVA 2JKTM 4JGOA 4P6ZS 1TF1A 2O9AA 4HHDA 3F1OB 2Z6DA 4GCZA 1V9YA 3UB7A 2DMWA 2L1MA 2QYBA 3VE3A 2EWWA 2JKTI 3K3CA 2O99A 3LIEA 4PAUA 3C8CA 3CUEA 3C30A 3U2AA 4OOLA 1YKDA 4XT2B 1OJGA 1N9NA 2KDKA 3UE3A 5F68A 2PHYA 3BQAA 3T4SA 5K5BA 2OWHA 2B02A 5MC7A 5IT5A 4KQDA 2M7UA 5TBMA 4WEKA 1N9OA 2ZBBA 1NWZA 4Y5FA 1S66L 3B47A 5HDDA 2L4RA 1WA9A 3UE6A 1T1BA 3ZYTA 1P9RA 2XROA 4CLCB 1NLZA 3PBNA 5AVFA 2W3GA 4CQHA 5HSQA 2O9BA 4UEYA 5LBRA 3ZQ5A 5HDSA 2W3EA 2G7UA 2WKPA 3PHYA 3TE8A 2O9CA 2JKRM 4L9GA 2R78A 1LSWA 1MZUA 2YKFA 3FPVA 4H6JA 1F98A 2PD7A 3H82B 2QKPA 2VJWA 3CI6A 2P08A 3T4KA 1OJ5A 3MJQA 4CLCE 2VV8A 3JVVA 4NXGA 2BASA 2M1CA 3KSIA 3IS2B 3IBRA 3E0YA 4PKYG 1UWNX 4ETXA 4EUVA 5F6AA 2V1BA 5HPFA 1H3QA 3CITA 5A8BA 3IBJA 3T4QA 3FG8A 4JGRA 2J3WA 2GZAA 5EFWA 4GHIA 5C5KA 4YOFA 5HPIA 3EWKA 4LRYC 3LR3A 3CAXA 5I5LA 2P04A 3UMDA 4G3KA 2NUPC 2HJ9C 5FL3A 2YKHA 4Q0JA 2PYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN6 A;  2KX6 A;  1T1C A;  4HP4 A;  4F3L B;  3NOT C;  4BBT A;  4R3A A;  4EEP A;  1T18 A;  1XJ4 A;  3F1O A;  4GS9 B;  4R70 A;  4EES A;  1P97 A;  4JGP A;  3LID A;  4EET B;  1OT6 A;  1S67 L;  1LSV A;  1TS0 A;  3FC7 A;  2H28 A;  1XJ2 A;  3EEH A;  4XT2 A;  5HWV A;  2OOL A;  3E4P A;  4LLO B;  1S1Z A;  4LRX C;  4EEU A;  4NXF A;  2VEA A;  2D01 A;  4HIA A;  1XFN A;  4PKY A;  5DKL A;  1DP6 A;  1LL8 A;  3E4O A;  2P7J A;  3H7W B;  1XJ6 A;  4HOI A;  2QJ7 A;  3F1N B;  2PR6 A;  2WKQ A;  4KUO A;  5DJT A;  1OTI A;  4HNB A;  4HJ3 A;  3HJK A;  5HDC A;  2PYP A;  1T1A A;  5IU1 A;  2PDR A;  5G4Y A;  4DJ2 A;  3BY8 A;  3OLO A;  4LPZ A;  1D06 A;  4M4X A;  3H82 A;  2EA9 A;  5J7E A;  5G4Z A;  1X0O A;  4I5S A;  3IS2 A;  3A0R A;  4GW9 A;  2A24 B;  2HV1 A;  4RQ9 A;  3PYP A;  3LIA A;  3MXQ A;  2W0N A;  1GSV A;  4HI4 A;  1VB6 A;  3UB8 A;  4EQ1 A;  3G6O A;  1ODV A;  1G28 A;  1UGU A;  2V0U A;  3GDI A;  5F5Y A;  3VE4 A;  1P0Z A;  2QHK A;  4WF0 A;  3UB9 A;  5HD5 A;  4R6L A;  4BBV A;  4EXO A;  4I3A A;  3E4Q A;  3MQQ A;  2JHE A;  3SW1 A;  3ICY A;  1XFQ A;  5HZH A;  1OTD A;  1EW0 A;  1OTE A;  5IS1 A;  4H6J B;  4HP9 A;  1GSX A;  4YWZ A;  4HJ4 A;  2D02 A;  1KOU A;  2VV6 A;  5HD3 A;  2QWS A;  3F1P B;  1S1Y A;  4R38 A;  3UME A;  3LUQ A;  3ULF A;  3NJA A;  3LYX A;  3MR0 A;  1JNU A;  2CMN A;  1S4R A;  3H9W A;  4GHI B;  3GEC A;  5DJU A;  4B9O A;  4HY8 A;  3B33 A;  5AVE A;  4HJ6 A;  5KIZ A;  3NOP C;  3LI8 A;  4K08 A;  4HQA A;  4WLA A;  2W27 A;  3LIB A;  2A24 A;  2OWJ A;  1XJ3 A;  1GSW A;  2ZOI A;  2V0W A;  2PD8 A;  2PR5 A;  1DP9 A;  5HWW A;  2QJ5 A;  3P7N A;  3A0V A;  4MN5 A;  3K3D A;  4I3J A;  1TS7 A;  1S4S A;  3NHQ A;  3C2W A;  2GJ3 A;  2L0W A;  3UB6 A;  3CWF A;  4WN5 A;  1OTA A;  4KUK A;  2VV7 A;  1D7E A;  3CLO A;  1DRM A;  3A0S A;  4E04 A;  4BBU A;  3VOL A;  4WL9 A;  2Z6C A;  4F3L A;  2V9A A;  1LT0 A;  1N9L A;  5TBM B;  4GS9 A;  3D72 A;  1UWP X;  4DJ3 A;  4HH2 A;  4NXB A;  1TS6 A;  4I3I A;  1TS8 A;  3RTY A;  1F9I A;  2JN7 A;  4EER A;  3F1P A;  4HH3 A;  5DKK A;  3MFX A;  4I38 A;  1LSX A;  4EW7 A;  2ZOH A;  4L9E A;  5J3W A;  3RH8 B;  1BYW A;  3HJI A;  5J4E A;  2J80 A;  3NOU C;  4L9F A;  3H7W A;  3BWL A;  4JGQ A;  3F1N A;  3LIF A;  4NXE A;  1V9Z A;  3KX0 X;  3LI9 A;  1OTB A;  2K7S A;  2V1A A;  3BY9 A;  2VLG A;  3MQO A;  1OT9 A;  1T19 A;  2WKR A;  2INW A;  3T50 A;  1DP8 A;  3LIC A;  4I39 A;  5HWT A;  4LRZ E;  1Y28 A;  4WUJ A;  5F69 A;  2I9V A;  4JGO A;  4HHD A;  3F1O B;  2Z6D A;  4GCZ A;  1V9Y A;  3UB7 A;  2L1M A;  3VE3 A;  3K3C A;  3LIE A;  3C8C A;  4XT2 B;  1OJG A;  1N9N A;  2KDK A;  5F68 A;  2PHY A;  2OWH A;  2B02 A;  4KQD A;  5TBM A;  1N9O A;  2ZBB A;  1NWZ A;  1S66 L;  5HDD A;  2L4R A;  1WA9 A;  3UE6 A;  1T1B A;  5AVF A;  5HSQ A;  3ZQ5 A;  5HDS A;  2WKP A;  3PHY A;  4L9G A;  2R78 A;  1LSW A;  1MZU A;  2YKF A;  4H6J A;  1F98 A;  2PD7 A;  3H82 B;  2QKP A;  1OJ5 A;  3MJQ A;  2VV8 A;  4NXG A;  2BAS A;  2M1C A;  3IS2 B;  3IBR A;  4PKY G;  1UWN X;  5F6A A;  2V1B A;  5A8B A;  3FG8 A;  4JGR A;  5EFW A;  4GHI A;  3EWK A;  4LRY C;  3CAX A;  5I5L A;  3UMD A;  2YKH A;  2PYR A; 
#chains in the Genus database with same CATH topology
 1JTD A;  4Y15 A;  5FDH A;  2ZC6 B;  4CJN A;  4HP4 A;  5E43 A;  4F3L B;  4EEP A;  5M18 A;  3F1O A;  2A2L A;  4BD1 A;  1ACF A;  4R70 A;  5TFQ A;  4EES A;  3LID A;  2VGK A;  4X6T A;  4EQI A;  1YLW A;  4EET B;  4IUK A;  2EX2 A;  1RCJ A;  2Z2L B;  3V3S A;  2W3F A;  4E3O A;  1RGY A;  3E2L A;  3T4L A;  3N7W A;  2OOL A;  2W1T B;  4LLO B;  3ZGA B;  2DNS A;  3G31 A;  4HIA A;  5L10 A;  3E4O A;  2P7J A;  3JPU A;  4OP5 A;  5CXW A;  5CTM A;  1XJ6 A;  4HOI A;  5AQ9 A;  4Z1W A;  4PM7 A;  2PR6 A;  5DJT A;  2C6W B;  4A5R A;  2H10 A;  4B88 A;  3S7P A;  2R9X A;  3IHA A;  1T1A A;  5A90 A;  5IU1 A;  2PDR A;  5G4Y A;  2XGN A;  2XSS A;  3OCN A;  1JWZ A;  2B18 A;  4M4X A;  2E8I A;  5J7E A;  4JXG A;  3N4I A;  5DFX A;  1CQA A;  3ZG8 B;  4OPQ A;  2A24 B;  3P98 A;  1FIL A;  2V8F A;  5CHJ A;  2XA7 S;  4S2N C;  4FH4 A;  2JKF A;  4B93 A;  1Y54 A;  1GSV A;  2Y2K A;  1PW1 A;  1NY0 A;  1VB6 A;  1PFL A;  1NZU A;  4IVK A;  2H0T A;  3UB8 A;  3S1Y A;  3HLB A;  3ITB A;  2V0U A;  4C6Y A;  4L0L A;  5F5Y A;  3VE4 A;  1P0Z A;  1LLB A;  2IA2 A;  4BD0 A;  4Y0T A;  1IKG A;  2IWB A;  5CGS A;  5HD5 A;  5M19 A;  5EOE A;  2PT7 A;  2ZC5 B;  3MS6 A;  5FAT A;  3D3O A;  3CPT A;  3NY4 A;  4GN2 A;  3IF6 A;  2JHE A;  4X56 A;  3IXD A;  4BEN A;  1K4F A;  3O88 A;  2XH9 A;  4S2O A;  1EW0 A;  1RP5 A;  4BWI A;  4KZ5 A;  3IX8 A;  3VFF A;  3KSF A;  4HP9 A;  2EWV A;  5DF9 A;  4HJ4 A;  3FWL A;  4BL2 A;  2D02 A;  3DAV A;  3U4L P;  4QY6 A;  4UA7 A;  1ONH A;  2Y8H A;  5KMW A;  1G5U A;  3LUQ A;  3LYX A;  1JNU A;  5AJG A;  5HW3 A;  4F94 A;  5BOH A;  4DDS A;  4JLF A;  2GX5 A;  5AVE A;  4HJ6 A;  5KIZ A;  1BSG A;  4GDN A;  5FI2 A;  4K08 A;  4HQA A;  4WLA A;  3W4Q A;  4N92 A;  3GTC A;  3KYE A;  2PRF A;  3NC8 A;  5D3O A;  4Q8I A;  1NXY A;  1ALQ A;  2OAQ 1;  1OME A;  3MBZ A;  5GHZ A;  5HX9 A;  3HL9 A;  3Q7V A;  4YNR A;  2J9P A;  1IOU A;  1E3U D;  4OLG A;  5CX7 A;  5CGX A;  4ARZ B;  3BRM A;  4MCW A;  1L0G A;  2G2W A;  2XD1 A;  4MN5 A;  2ZMF A;  3TRC A;  4OON A;  1TS7 A;  4H8R A;  3NHQ A;  3LY4 A;  2X01 A;  1JWP A;  1L0D A;  4FUW A;  1KE4 A;  4OPY A;  3IQA A;  3OC2 A;  1HLU P;  1STZ A;  4QPR A;  3RJU A;  4WZ4 A;  4IED A;  2OAP 1;  2HP6 A;  3A0S A;  3MZF A;  2NUT C;  3V39 A;  4ME4 A;  1XPB A;  4ZJ1 A;  1Z09 A;  4WL9 A;  2LB5 A;  4U0T A;  3VP2 A;  5TBM B;  1UWP X;  4BJP A;  5FSR A;  1PIO A;  1MKM A;  2BLS A;  4I3I A;  2UV0 E;  4KG5 A;  2HJE A;  3A3J A;  3FKW A;  1F9I A;  5FAS A;  2JN7 A;  2OLV A;  3F1P A;  5DKK A;  3MFX A;  5FAP A;  5TR7 A;  3BQ8 A;  2VGL M;  2W3H A;  4X68 A;  4NK3 A;  4S2I A;  1NRJ A;  1BYW A;  3HJI A;  3G2Y A;  4QHC A;  3NOU C;  1LL5 A;  2A3U A;  3S7O A;  4KZ4 A;  3LEZ A;  1YQS A;  5F1G A;  1GHI A;  3BM6 A;  2AVX A;  1MKI A;  2XD5 A;  3V3R A;  3KX0 X;  4P0M A;  1Y4O A;  3I7J A;  2FFF B;  3L7H A;  2J8Y A;  3BFE A;  2OV5 A;  1PWG A;  4EWF A;  1MWT A;  1VET A;  3BY9 A;  4JXW A;  1IEM A;  3IF6 B;  2WKR A;  2INW A;  3TW8 A;  1FR6 A;  5G18 A;  4WEJ A;  3WS0 A;  4LRZ E;  1FCO A;  1Y28 A;  3LCE A;  3FV7 A;  3G2Z A;  3N8L A;  1G6O A;  3ZFZ A;  2PU2 A;  2JKT M;  4P6Z S;  2O9A A;  1BUL A;  4GCZ A;  3UB7 A;  4OQH A;  4KG2 A;  4N1H A;  4WYY A;  4Y13 A;  3C5A A;  4MBF A;  5CGW A;  3LIE A;  3NBL A;  3BLS A;  4XT2 B;  1EWZ A;  4M3K A;  2JKG A;  3SH7 A;  4PM5 A;  2PHY A;  1Z6F A;  3T4S A;  2OWH A;  2B02 A;  2WKH A;  2RL3 A;  4LCM A;  1MPL A;  4KQD A;  1L2S A;  3IWO A;  1IYQ A;  1A0K A;  2A49 A;  2XK1 A;  4PM9 A;  3ZYT A;  3LY3 A;  4CLC B;  1NLZ A;  5AVF A;  4CQH A;  4UEY A;  5LBR A;  3ZQ5 A;  4MBK A;  1IYP A;  3BFG A;  3FPV A;  1MZU A;  2QKP A;  4DE1 A;  2VJW A;  3CI6 A;  4QD4 A;  3MJQ A;  3T1R A;  4NXG A;  2J7V A;  3UE1 A;  1K54 C;  3IBR A;  4PKY G;  1WE4 A;  3QP8 A;  5F6A A;  1O07 A;  5CHU A;  3ZNY A;  2V1B A;  2DRW A;  1BUE A;  5EFW A;  3LR3 A;  3Q82 A;  3ZCZ A;  3UMD A;  2NUP C;  5FL3 A;  4Q0J A;  5F83 A;  5E2E A;  4G3V A;  2VA0 A;  1XGJ A;  3OPP A;  4RX2 A;  3ZVW A;  1XJ4 A;  2JC7 A;  3OBF A;  4R1G A;  1MY8 A;  1S67 L;  1LSV A;  4WZ5 C;  1MWU A;  2Y2O A;  4UQI M;  1XJ2 A;  3VV4 A;  2HGV A;  4AFI A;  1S1Z A;  4NXF A;  3HLF A;  5E2G A;  3Q07 A;  3BJN A;  4PKY A;  3RFB A;  3PBR A;  2EFU A;  3T1X A;  1ESI A;  3UE0 A;  3IXH A;  1TDL A;  4C75 A;  4HNB A;  3SZT A;  4DXB A;  4IJG A;  1WYC A;  2PYP A;  4UA9 A;  1VET B;  4DJ2 A;  3SH9 A;  3BY8 A;  3C7V A;  1YLZ A;  4LPZ A;  4HBT A;  2EA9 A;  3O5Y A;  4JXS A;  4KZ3 A;  4FH2 A;  1FSW A;  3NIA A;  1ERM A;  2J3T C;  2PAV P;  4O8G A;  2XLN A;  2KLI A;  3FPW A;  1K25 A;  3LIA A;  1FCM A;  2EFX A;  3GVB A;  5E2F A;  5FAO A;  5AQA A;  1K57 C;  5EEC A;  2ACG A;  3A3E A;  4EQ1 A;  3G6O A;  3VSL A;  4Y0U A;  1LL9 A;  5DF8 A;  3TG9 A;  2EX9 A;  2UWX A;  1DJC A;  2J3T D;  1K55 A;  3AGE A;  2QHK A;  3HVF A;  3UB9 A;  2Y4A A;  3E98 A;  1BT5 A;  1QMF A;  1XKZ A;  4I3A A;  5GLD A;  3IF6 C;  2OLU A;  2Y2N A;  4KZ8 A;  3SW1 A;  1PZO A;  1K4E A;  2O0Y A;  4UHU A;  5EM0 A;  4N9K A;  3LGO A;  1SKO B;  3OOV A;  4LV3 A;  4R4S A;  1VEU A;  5EVI B;  3R7W B;  3VMA A;  4QY5 A;  4KZA A;  5EPH A;  2HPB A;  5HD3 A;  3ITA A;  2JE5 A;  3UME A;  3WRZ A;  1ZKJ A;  4K91 A;  4JXV A;  3MXR A;  1GCE A;  3BLM A;  1S0W A;  1SCW A;  3UY6 A;  5GLB A;  3MMH A;  3HLD A;  1CJF A;  4B9O A;  4HY8 A;  3B33 A;  5FI7 A;  5FEF A;  2VGL S;  3NOP C;  3LI8 A;  3V5M A;  5FDS A;  3ZHH A;  4CLC C;  4O01 A;  3LIB A;  2EX8 A;  3LR0 A;  2J9O A;  2RCX A;  2ZOI A;  4OQI A;  5F1F A;  1W79 A;  3GRJ A;  1NLY A;  2V0W A;  4EBP A;  1ERO A;  3S7N A;  3DTE A;  2PD8 A;  3O3V A;  3UDF A;  5J8X A;  4XUZ A;  1DP9 A;  2ZLY A;  2XRN A;  1WYB A;  3P7N A;  1J9M A;  1E4D A;  3JVU A;  4LCL A;  1ES4 A;  2HDQ A;  1MBL A;  3K3D A;  1YLT A;  1YLY A;  4CLC D;  1S4S A;  5HFO A;  2GJ3 A;  4K0W A;  1H8Y A;  4JF4 A;  2L0W A;  1ZHH B;  2V20 A;  1TD5 A;  3QNB A;  4IHQ A;  4WN5 A;  3HLC A;  2XFT A;  1OTA A;  5JYO A;  1NRF A;  4DXC A;  2Y2P A;  3A3I A;  4KQO A;  5GLC A;  4E3J A;  4OOM A;  2WAE A;  2K31 A;  1DRM A;  3M6B A;  5AQ7 A;  4MN7 A;  2ZL1 B;  1N9L A;  3UPO A;  3CG5 A;  2V8C A;  4EUZ A;  4GS9 A;  3C7U A;  3VSK A;  4HH2 A;  4NXB A;  1TS6 A;  3QHY A;  4BMW A;  2ZQA A;  2WGW A;  2JKR I;  4HH3 A;  3KO6 A;  3T4O A;  1YSQ A;  1SDE A;  2WGI A;  1YT4 A;  5J4E A;  2J80 A;  2ZC3 B;  4L9F A;  2EX6 A;  4FSF A;  4R0Q A;  1F5M A;  3H7W A;  3ISG A;  3BWL A;  5EV0 A;  4Y3I A;  3F1N A;  4NXE A;  2X02 A;  1GHP A;  1GA9 A;  2MJ6 A;  4WM9 A;  3BFD A;  4JKT A;  3P09 A;  2KOI A;  4P87 A;  2R9W A;  4NKP A;  4NET A;  3LI9 A;  1IKI A;  3MKE A;  2P9V B;  4O0P A;  1G6A A;  4Q0H A;  4MEZ A;  4LV1 A;  4RX3 A;  3NI9 A;  2VZW A;  4X55 A;  1L0F A;  5CTN A;  1OPX A;  1MWS A;  4I39 A;  4WEL A;  5HWT A;  3ZG5 A;  2Y2L A;  4WUJ A;  2QMI A;  5F69 A;  2I9V A;  2WK0 A;  3HLE A;  3PXP A;  1HTZ A;  4OKP A;  3AGD A;  3UB5 P;  3RXX A;  3F1O B;  1VEU B;  1I5Q A;  5HAQ A;  3UPP A;  2ZQ8 A;  2QYB A;  3ZNT A;  3T12 B;  2JKT I;  4PAU A;  1OJG A;  4KG6 A;  3UE3 A;  5F68 A;  1LI9 A;  3BQA A;  1ES2 A;  1PRQ A;  3Q7Z A;  2HP9 A;  2M7U A;  2ZC4 B;  2XDM A;  4Y5F A;  1S66 L;  4BL3 A;  3BFC A;  5HDD A;  4ESP A;  3G4P A;  4XXR A;  2WKE A;  1NYM A;  3MSH A;  5HSQ A;  3N6I A;  2O9B A;  1I2W A;  4DKI A;  5TGF A;  3B3X A;  5HAI A;  2JKR M;  4L9G A;  1W7F A;  2WGV A;  1F98 A;  2P74 A;  5EVI C;  4E3N A;  2GDN A;  1BLP A;  3HLW A;  4WMC D;  2VV8 A;  3JVV A;  3JYI A;  1NYY A;  3E0Y A;  3VP3 A;  1IYS A;  1H3Q A;  3MFD A;  5A8B A;  3IBJ A;  1K56 A;  4JGR A;  2GZA A;  3Q81 A;  3VFH A;  5C5K A;  3IH8 A;  2ZM2 A;  4LRY C;  1SHV A;  2XF3 A;  1JWV A;  5I5L A;  5EVI D;  3BYD A;  4G3K A;  1MXO A;  3OPL A;  5F82 A;  3E2K A;  2YKH A;  4OLD A;  2H0Y A;  3G30 A;  3NOT C;  4BBT A;  3K2N A;  4R3A A;  1T18 A;  4MNR A;  4GS9 B;  4JGP A;  3SOI A;  2Q9N A;  3L9K A;  1PNE A;  3NEC A;  3CPT B;  1TS0 A;  3FC7 A;  2H28 A;  4GKU A;  4KZ7 A;  3EEH A;  3D9Y A;  4DRT A;  3DTK A;  2IWC A;  3E4P A;  5EOO A;  2HDU A;  2VEA A;  2D01 A;  3CZD A;  1IYO A;  3N8R A;  4PHT A;  3M6H A;  3NCK A;  1BLS A;  4JBF A;  3T4J A;  3H7W B;  2XA7 M;  4OPZ A;  5CER A;  5L8M A;  3WRT A;  3F1N B;  3CUE C;  4KUO A;  1KDW A;  1OTI A;  4IBX A;  3A3F A;  3HJK A;  1I2S A;  2B5R A;  4S2P A;  2W1R A;  1LI0 A;  3OLO A;  1W63 M;  3KSG A;  1D06 A;  4ZAM A;  3OPR A;  3H82 A;  4PMA A;  3QP1 A;  2FZ0 A;  1X0O A;  2ZM0 A;  3A0R A;  4KZ6 A;  2VKS A;  2K2N A;  3IS2 A;  3LFV A;  2H5S A;  4JF5 A;  2V1Z A;  4RQ9 A;  2LB9 A;  1QME A;  3PYP A;  5KSC A;  3Q7V B;  2WUQ A;  3MXQ A;  3UO9 A;  2W0N A;  1FQG A;  1GA0 A;  4HI4 A;  4QU3 A;  5I94 A;  4DE0 A;  3IXG A;  5FQ9 A;  5KSH A;  2DCF A;  1M40 A;  5DTT A;  5L2F A;  1JVJ A;  3GDI A;  1K55 C;  1CI8 A;  4D2O A;  4KQR A;  4WF0 A;  2CC1 A;  3IX3 A;  4UAA A;  4R6L A;  2Y2Q A;  4EXO A;  3AGF A;  3CMZ A;  1AXB A;  4E6X A;  3MQQ A;  3R4K A;  5FQK A;  4DN0 A;  3ICY A;  4FD8 A;  1XFQ A;  4E3I A;  5HZH A;  4FCF A;  1OTD A;  3UDX A;  3EEA A;  2W1T A;  1LHY A;  5IS1 A;  4OQ0 A;  2ZQ9 A;  4MLL A;  4E3K A;  1GSX A;  3NDG A;  1MC0 A;  4KZB A;  1KOU A;  3BW6 A;  1TVF A;  4OP8 A;  5IHV A;  1FCN A;  5HL6 A;  1W63 Q;  3F1P B;  5EE8 A;  1XA7 A;  1IEL A;  3NJA A;  2CMN A;  4DE2 A;  2E8J A;  3T1Q B;  4N9L A;  5HAP A;  3GEC A;  2V2F F;  5DJU A;  1YAX A;  4EU0 A;  3TSG A;  1XA1 A;  3WS5 A;  3HUN A;  4D60 A;  3W4P A;  3KYQ A;  4X1L A;  3WS2 A;  3WWX A;  2A24 A;  2WYX A;  2Y79 A;  1H8Z A;  3DWK A;  1GSW A;  5TJJ A;  2VX8 A;  5DFY A;  4NG2 A;  5HWW A;  1ES3 A;  3UPN A;  3SS3 A;  4E3L A;  3A0V A;  5L07 A;  1E25 A;  1ZG6 A;  2ZJ9 A;  3IH9 A;  4I3J A;  2JBF A;  5FA7 A;  3C2W A;  4MDZ A;  1BLH A;  5CEB A;  4RYE A;  4IBR A;  3VP4 A;  1XXM A;  1CEG A;  1PWD A;  1YPR A;  4RVA A;  1H5X A;  4E04 A;  3QP2 A;  3HRE A;  3T4T A;  3DW0 A;  2V9A A;  4OH0 A;  3PAG A;  1LT0 A;  2FH5 A;  4S2M A;  3D72 A;  4DJ3 A;  1VHM A;  3VOY A;  1AWI A;  1PZP A;  4BLM A;  3PBS A;  3DBA A;  2HP5 A;  3PTE A;  4EER A;  4OQG A;  1ES5 A;  3S4X A;  1LSX A;  1CEF A;  2ZD8 A;  4X69 A;  2HZ5 A;  3N8S A;  1KVM A;  3OCL A;  5JYP A;  3C38 A;  4P6Z M;  4EV4 A;  3HUM A;  4IUH A;  3A3D A;  2QPN A;  1K6R A;  1ESU A;  3LR4 A;  2HDS A;  2ZQC A;  3KSH A;  1V9Z A;  5E2H A;  2G2U A;  2ZM8 A;  3V67 A;  3HLG A;  4PM8 A;  3EOI A;  4QB8 A;  1FSY A;  4WZ5 A;  4E3M A;  1OT9 A;  1T19 A;  1DP8 A;  4II7 A;  1Q2Q A;  1U60 A;  3LIC A;  4ARZ A;  4HEF A;  3EGD C;  3VOZ A;  2WKI A;  3PBQ A;  4JGO A;  5EVL A;  4HHD A;  3CJM A;  1V9Y A;  3M2J A;  2DMW A;  4N1X A;  3VE3 A;  2EWW A;  1KE0 A;  3HBR A;  5CEC A;  3K3C A;  3UDI A;  3C8C A;  3BFF A;  3U2A A;  4OOL A;  1YKD A;  4ZDX A;  4R4R A;  3WS4 A;  4JPM A;  1L3L A;  1M6K A;  5K5B A;  4FTX A;  3RXW A;  5MC7 A;  5IT5 A;  3IWI A;  4P85 A;  5TBM A;  4WEK A;  1N9O A;  2ZBB A;  2ZQ7 A;  1NWZ A;  1KGE A;  2L4R A;  1WA9 A;  3UE6 A;  1JTG A;  3PBN A;  3GR2 A;  2EXB A;  3SH8 A;  3ZDJ A;  4GD6 A;  2W3E A;  3PHY A;  4B4Z A;  2R78 A;  1LSW A;  2YKF A;  4DF6 A;  4H6J A;  5EVE A;  1YMS A;  4WBG A;  4LGW A;  2VGJ A;  4GB7 A;  2P08 A;  1HD8 A;  3T4K A;  1K57 A;  2BAS A;  3KSI A;  2B95 A;  1UWN X;  1XP4 A;  4R3J A;  5HAR A;  3CIT A;  5FI6 A;  3T4Q A;  5KZH A;  3NUL A;  2J3W A;  3C4O A;  4GHI A;  4YIN A;  4YOF A;  3BEC A;  3EWK A;  1KE3 A;  3CAX A;  1G68 A;  3GQZ A;  1K6S A;  3IF5 A;  4C3Q A;  1HVB A;  4MN6 A;  2KX6 A;  3EQU A;  4GOG A;  4Q0I A;  1T1C A;  1P97 A;  1K56 D;  4LV0 A;  3IX4 A;  1OT6 A;  3C4P A;  3DTM A;  4X1M A;  3Q1F A;  3IXB A;  4GD8 A;  1ONG A;  4XT2 A;  3WS1 A;  5HWV A;  3EGX C;  4IVI A;  4LRX C;  4EEU A;  2W3D A;  4LEN A;  1XFN A;  4ZRR A;  5DKL A;  1DP6 A;  1LL8 A;  2QJ7 A;  4CPK A;  2WKQ A;  2Y59 A;  2FFY A;  2HDR A;  4CLC A;  3DWZ A;  3MQ0 A;  4HJ3 A;  4KEN B;  2Y2G A;  1PWC A;  2Y2I A;  5HDC A;  3HCY A;  4KZ9 A;  3D4F A;  1W8Q A;  4PM6 A;  2Z2M B;  4UQI S;  1J3W A;  1W8Y A;  3BEB A;  5DTK A;  4UA6 A;  4ETZ A;  1PI5 A;  1SDN A;  4U3T A;  3W2Z A;  5G4Z A;  1GHM A;  3FYZ A;  4I5S A;  1EI5 A;  2WZX A;  4GW9 A;  4O7D A;  1MWR A;  2HV1 A;  2PU4 A;  4GJ4 A;  2XEP A;  4B4X A;  3B42 A;  4ZTK A;  2EXA A;  4GLQ A;  4S2N A;  3PBT A;  4E6W A;  3MXS A;  5DF7 A;  3CHW P;  4PPR A;  1K38 A;  1ODV A;  1G28 A;  1UGU A;  3G35 A;  4LFU A;  2OSU A;  4DDY A;  1CK3 A;  3S7Q A;  1BLC A;  1IFQ A;  1CF0 A;  5CHM A;  3EQV A;  4BBV A;  5FQJ A;  4EBN A;  1FOF A;  5EUA A;  3E4Q A;  2ZMA A;  2Y2H A;  5FQQ A;  2Y55 A;  4HBU A;  3LR5 A;  4K0X A;  1OTE A;  3QP5 A;  4H6J B;  3UN7 A;  4ZBE A;  2XQZ A;  4X53 A;  4YWZ A;  5GHX A;  1DJA A;  1YLP A;  3ZVT A;  2VV6 A;  4Y17 A;  2WGW B;  2QWS A;  4Y7P A;  4GDB A;  2GNX A;  1S1Y A;  4R38 A;  5CED A;  3PAE A;  1O7E A;  4MBH A;  3O86 A;  3TJZ C;  4JF6 A;  3ULF A;  3MR0 A;  3SS4 A;  1S4R A;  3PR6 A;  3H9W A;  4GHI B;  4XUX A;  1ERQ A;  1TEM A;  4ZJ3 A;  1KGG A;  1YLJ A;  3SS5 A;  1E3U A;  4Y2F A;  1PI4 A;  1YM1 A;  2Y91 A;  3TOI A;  4DMZ A;  3MF0 A;  4OPR A;  3VP0 A;  3FZC A;  2W27 A;  4GZB A;  1ZTU A;  3P01 A;  2OWJ A;  5A93 A;  4Z9Q A;  5FAQ A;  1XJ3 A;  3V50 A;  1H8M A;  4MMN A;  3ZG7 B;  5DVA A;  1PW8 A;  5GL9 A;  2PR5 A;  3LEQ A;  2WZZ A;  3GV9 A;  3MKF A;  2QJ5 A;  4QJG A;  4R3B A;  1PYY A;  4G3W A;  4OOY A;  4P6B A;  4QWO A;  3T1S A;  1XX2 A;  3UNW A;  3M2K A;  2WAD A;  3GMW A;  5CRF A;  3CWF A;  3UB6 A;  4WMC A;  2X71 A;  4FOF A;  4S2L A;  5DTS A;  1FR1 A;  4KUK A;  3IT9 A;  2HF6 A;  3O87 A;  1FIK A;  2VV7 A;  4U0X A;  5AQB A;  1D7E A;  3CLO A;  3OZH A;  1NZO A;  1HZO A;  2IWD A;  4BBU A;  3VOL A;  2M7V A;  3KYZ A;  2Z6C A;  4F3L A;  1SKO A;  4ID4 A;  5L09 A;  5EVI A;  3R7W A;  1P9W A;  3ZG9 B;  1VQQ A;  1TS8 A;  1L0E A;  3RTY A;  1KDS A;  2QZ6 A;  2XR0 A;  2BTF P;  4I38 A;  1YMX A;  4EW7 A;  2ZOH A;  1N9B A;  5A91 A;  4L9E A;  5J3W A;  3RH8 B;  5EM1 A;  4EBL A;  4S2J A;  2ZC7 A;  3MZD A;  3PBO A;  3W4O A;  1KVL A;  4BQM A;  4JGQ A;  5M1A A;  3LIF A;  5FQI A;  1KGF A;  3NDE A;  5A92 A;  3HUO A;  5HL1 A;  3IHB A;  2ZQD A;  1YSP A;  4NEE D;  4S2K A;  1OTB A;  2K7S A;  2V1A A;  1ZG4 A;  1BZA A;  2VLG A;  3G34 A;  3MQO A;  2Q9M A;  3OPH A;  2PBD P;  4KQQ A;  4RA7 A;  5U47 A;  2BG1 A;  1D1J A;  2XFS A;  2WAF A;  2ZMV A;  3DTI A;  1TF1 A;  3IWQ A;  4R23 A;  2Z6D A;  2L1M A;  3QP4 A;  4GNU A;  1F2K A;  2O99 A;  1ZC2 A;  1DY6 A;  1DJB A;  3QNC A;  3CUE A;  3C30 A;  1K0K A;  1N9N A;  2KDK A;  2Y2M A;  3QP6 A;  1N4O A;  3ZG0 A;  3LO7 A;  4OVD A;  3FKV A;  2ZL1 A;  4DE3 A;  1TDG A;  2VK3 A;  3W8K A;  1SKF A;  4Y0O A;  3B47 A;  1T1B A;  1P9R A;  1SZV A;  5GLA A;  2XRO A;  2W3G A;  1NJ4 A;  1W5D A;  3MZE A;  1CI9 A;  2Y2J A;  3GSG A;  5HDS A;  1H0M A;  2JCH A;  2WKP A;  2G7U A;  3TE8 A;  2O9C A;  1Q2P A;  1S6R A;  2PBY A;  3G32 A;  2PD7 A;  3H82 B;  4X25 A;  1OJ5 A;  1VM1 A;  5FEG A;  4CLC E;  5GHY A;  2M1C A;  3IS2 B;  4ZJ2 A;  1K54 A;  4ETX A;  4EUV A;  2I72 A;  5HPF A;  1C3B A;  3S22 A;  3FG8 A;  5FQM A;  5HPI A;  1BTL A;  2P9V A;  2Q0O A;  4LV2 A;  4YFM A;  3VP1 A;  2P04 A;  1XGI A;  2C5W B;  4HES A;  2HJ9 C;  3T50 A;  1RGZ A;  2PYR A; 
#chains in the Genus database with same CATH homology
 4MN6 A;  2KX6 A;  3EQU A;  4Q0I A;  1T1C A;  4HP4 A;  4F3L B;  4G3V A;  2VA0 A;  3NOT C;  4BBT A;  3K2N A;  4R3A A;  4EEP A;  1T18 A;  1XJ4 A;  3OBF A;  3F1O A;  2A2L A;  4GS9 B;  4R70 A;  4EES A;  1P97 A;  4JGP A;  3LID A;  4EET B;  4IUK A;  1OT6 A;  1S67 L;  1LSV A;  1TS0 A;  2W3F A;  2H28 A;  3FC7 A;  4UQI M;  1XJ2 A;  3EEH A;  3VV4 A;  4XT2 A;  3T4L A;  2HGV A;  5HWV A;  3EGX C;  2OOL A;  2W1T B;  3E4P A;  4AFI A;  4LLO B;  1S1Z A;  4LRX C;  4EEU A;  4NXF A;  2VEA A;  2W3D A;  2D01 A;  4HIA A;  1XFN A;  3BJN A;  4ZRR A;  4PKY A;  4PHT A;  5DKL A;  3RFB A;  1DP6 A;  1LL8 A;  3E4O A;  2P7J A;  3PBR A;  3T4J A;  3H7W B;  2XA7 M;  1XJ6 A;  4HOI A;  5L8M A;  2QJ7 A;  4Z1W A;  3F1N B;  3CUE C;  2PR6 A;  2WKQ A;  4KUO A;  5DJT A;  1OTI A;  4CLC A;  3MQ0 A;  4HJ3 A;  4HNB A;  3S7P A;  3HJK A;  5HDC A;  3HCY A;  4IJG A;  2PYP A;  1T1A A;  5IU1 A;  2PDR A;  4UQI S;  5G4Y A;  2W1R A;  4DJ2 A;  2XSS A;  3OCN A;  3BY8 A;  3OLO A;  1W63 M;  3KSG A;  1D06 A;  4LPZ A;  4ETZ A;  2B18 A;  4M4X A;  3H82 A;  2EA9 A;  3O5Y A;  3W2Z A;  5J7E A;  5G4Z A;  2FZ0 A;  1X0O A;  4I5S A;  5DFX A;  3IS2 A;  3A0R A;  2J3T C;  2K2N A;  2VKS A;  3LFV A;  4O8G A;  4GW9 A;  2A24 B;  2HV1 A;  4GJ4 A;  2XA7 S;  3B42 A;  4RQ9 A;  2LB9 A;  3PYP A;  2KLI A;  4GLQ A;  3FPW A;  3PBT A;  3LIA A;  3MXQ A;  2W0N A;  4B93 A;  1GSV A;  4HI4 A;  1VB6 A;  3UB8 A;  4EQ1 A;  3G6O A;  1ODV A;  1G28 A;  1UGU A;  5KSH A;  2V0U A;  3GDI A;  4L0L A;  2J3T D;  5F5Y A;  3VE4 A;  1P0Z A;  2QHK A;  3S7Q A;  4WF0 A;  2IA2 A;  3UB9 A;  1IFQ A;  3E98 A;  5HD5 A;  4R6L A;  3EQV A;  4BBV A;  4EXO A;  2PT7 A;  4I3A A;  3D3O A;  3E4Q A;  3MQQ A;  3R4K A;  4DN0 A;  2JHE A;  3SW1 A;  3ICY A;  1XFQ A;  5HZH A;  2O0Y A;  3LR5 A;  1OTD A;  1EW0 A;  4BWI A;  3EEA A;  1OTE A;  2W1T A;  5IS1 A;  3OOV A;  4H6J B;  3KSF A;  4HP9 A;  1GSX A;  3R7W B;  2EWV A;  4YWZ A;  5DF9 A;  1MC0 A;  4HJ4 A;  2D02 A;  1KOU A;  3BW6 A;  2VV6 A;  5HD3 A;  2QWS A;  5HL6 A;  2GNX A;  1W63 Q;  3F1P B;  1S1Y A;  4R38 A;  3UME A;  2Y8H A;  3TJZ C;  3LUQ A;  3ULF A;  3NJA A;  3LYX A;  3MR0 A;  1JNU A;  2CMN A;  1S4R A;  5AJG A;  3PR6 A;  3H9W A;  4GHI B;  3MMH A;  3GEC A;  5DJU A;  1YAX A;  4B9O A;  4HY8 A;  4Y2F A;  2GX5 A;  3B33 A;  5AVE A;  4HJ6 A;  4EU0 A;  5KIZ A;  2VGL S;  3NOP C;  3LI8 A;  4DMZ A;  3MF0 A;  4K08 A;  4HQA A;  4WLA A;  2W27 A;  4CLC C;  4O01 A;  3KYQ A;  3LIB A;  3LR0 A;  1ZTU A;  3P01 A;  2A24 A;  2OWJ A;  2Y79 A;  1XJ3 A;  1GSW A;  2OAQ 1;  2ZOI A;  5TJJ A;  1H8M A;  1NLY A;  2V0W A;  2VX8 A;  4MMN A;  5DFY A;  3S7N A;  2PD8 A;  4YNR A;  2PR5 A;  1IOU A;  1DP9 A;  5HWW A;  2QJ5 A;  2XRN A;  5CX7 A;  3P7N A;  3A0V A;  3JVU A;  4ARZ B;  4MCW A;  4G3W A;  4MN5 A;  2ZMF A;  3TRC A;  3K3D A;  4I3J A;  1TS7 A;  4CLC D;  1S4S A;  3NHQ A;  3C2W A;  2GJ3 A;  4MDZ A;  2L0W A;  1ZHH B;  1TD5 A;  3UB6 A;  3CWF A;  4IHQ A;  4WN5 A;  4FOF A;  1OTA A;  3OC2 A;  4KUK A;  2HF6 A;  1STZ A;  4QPR A;  4KQO A;  4OOM A;  2OAP 1;  2VV7 A;  1D7E A;  2K31 A;  3CLO A;  1DRM A;  3A0S A;  2NUT C;  4E04 A;  4ME4 A;  4BBU A;  3VOL A;  3T4T A;  4WL9 A;  2LB5 A;  4MN7 A;  2M7V A;  3KYZ A;  2Z6C A;  4F3L A;  2V9A A;  1LT0 A;  1N9L A;  2FH5 A;  5TBM B;  4GS9 A;  3D72 A;  1UWP X;  3R7W A;  4BJP A;  4DJ3 A;  1VHM A;  4HH2 A;  1P9W A;  1MKM A;  4NXB A;  1TS6 A;  4I3I A;  1TS8 A;  4BMW A;  2HJE A;  3PBS A;  3RTY A;  3DBA A;  1F9I A;  2JN7 A;  2JKR I;  4EER A;  3F1P A;  4HH3 A;  5DKK A;  3MFX A;  4I38 A;  1LSX A;  4EW7 A;  3BQ8 A;  2ZOH A;  3KO6 A;  2VGL M;  2W3H A;  4L9E A;  3T4O A;  3OCL A;  1YSQ A;  5J3W A;  1NRJ A;  3RH8 B;  1BYW A;  3HJI A;  5J4E A;  3C38 A;  2J80 A;  3NOU C;  4P6Z M;  4L9F A;  3PBO A;  4IUH A;  3S7O A;  4FSF A;  1F5M A;  3H7W A;  3BWL A;  4JGQ A;  4Y3I A;  3F1N A;  3LIF A;  4NXE A;  2MJ6 A;  3LR4 A;  3KSH A;  2KOI A;  1V9Z A;  1YSP A;  3KX0 X;  4NEE D;  4NKP A;  3V67 A;  3LI9 A;  1OTB A;  2K7S A;  2V1A A;  4O0P A;  4Q0H A;  3BY9 A;  3EOI A;  2VLG A;  2VZW A;  3MQO A;  1OT9 A;  1T19 A;  2WKR A;  2INW A;  3T50 A;  3TW8 A;  1DP8 A;  4WEJ A;  4II7 A;  1OPX A;  3LIC A;  4I39 A;  4WEL A;  5HWT A;  4LRZ E;  4ARZ A;  3EGD C;  1Y28 A;  4WUJ A;  5F69 A;  3PBQ A;  2I9V A;  1G6O A;  3PXP A;  2ZMV A;  2JKT M;  4JGO A;  4P6Z S;  1TF1 A;  2O9A A;  4HHD A;  3F1O B;  2Z6D A;  4GCZ A;  1V9Y A;  3UB7 A;  2DMW A;  2L1M A;  2QYB A;  3VE3 A;  2EWW A;  2JKT I;  3K3C A;  2O99 A;  3LIE A;  4PAU A;  3C8C A;  3CUE A;  3C30 A;  3U2A A;  4OOL A;  1YKD A;  4XT2 B;  1OJG A;  1N9N A;  2KDK A;  3UE3 A;  5F68 A;  2PHY A;  3BQA A;  3T4S A;  5K5B A;  2OWH A;  2B02 A;  5MC7 A;  5IT5 A;  4KQD A;  2M7U A;  5TBM A;  4WEK A;  1N9O A;  2ZBB A;  1NWZ A;  4Y5F A;  1S66 L;  3B47 A;  5HDD A;  2L4R A;  1WA9 A;  3UE6 A;  1T1B A;  3ZYT A;  1P9R A;  2XRO A;  4CLC B;  1NLZ A;  3PBN A;  5AVF A;  2W3G A;  4CQH A;  5HSQ A;  2O9B A;  4UEY A;  5LBR A;  3ZQ5 A;  5HDS A;  2W3E A;  2G7U A;  2WKP A;  3PHY A;  3TE8 A;  2O9C A;  2JKR M;  4L9G A;  2R78 A;  1LSW A;  1MZU A;  2YKF A;  3FPV A;  4H6J A;  1F98 A;  2PD7 A;  3H82 B;  2QKP A;  2VJW A;  3CI6 A;  2P08 A;  3T4K A;  1OJ5 A;  3MJQ A;  4CLC E;  2VV8 A;  3JVV A;  4NXG A;  2BAS A;  2M1C A;  3KSI A;  3IS2 B;  3IBR A;  3E0Y A;  4PKY G;  1UWN X;  4ETX A;  4EUV A;  5F6A A;  2V1B A;  5HPF A;  1H3Q A;  3CIT A;  5A8B A;  3IBJ A;  3T4Q A;  3FG8 A;  4JGR A;  2J3W A;  2GZA A;  5EFW A;  4GHI A;  5C5K A;  4YOF A;  5HPI A;  3EWK A;  4LRY C;  3LR3 A;  3CAX A;  5I5L A;  2P04 A;  3UMD A;  4G3K A;  2NUP C;  2HJ9 C;  5FL3 A;  2YKH A;  4Q0J A;  2PYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...