4WLAA

Time resolved serial femtosecond crystallography captures high resolution intermediates of pyp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-resolved serial crystallography captures high-resolution intermediates of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wlaA00
1GSVA 2L1MA 1OJGA 5HDCA 1OJ5A 3A0VA 1S4SA 2R78A 2PR5A 4GS9B 5HDSA 3F1NB 3G6OA 3A0SA 3BY9A 2PDRA 3K3DA 3MJQA 1DP8A 1N9LA 1S67L 2PD7A 3D72A 4JGOA 5G4YA 2V0UA 4BBUA 3LIAA 3MQQA 4R38A 3RH8B 2PR6A 5F69A 4JGQA 4R70A 1XJ6A 1F9IA 4GW9A 4KUOA 2WKPA 5F68A 3UMEA 4R3AA 3IS2A 3PHYA 4WL9A 3VE3A 5G4ZA 1D06A 1S1ZA 2P7JA 1BYWA 5DJUA 3H9WA 1XFNA 3F1OA 5J3WA 3H7WA 4WF0A 1LSWA 4L9EA 3H7WB 1T18A 1WA9A 1XFQA 2QWSA 3UB8A 2QJ7A 2V1AA 3F1PA 5DKKA 4HIAA 4EERA 3VOLA 4HJ3A 5J7EA 2L4RA 4HH3A 1X0OA 5HD3A 3FC7A 4HH2A 3BWLA 3UMDA 4NXEA 4BBVA 4DJ2A 2QHKA 4EW7A 4HP4A 4HNBA 3SW1A 3RTYA 3IBRA 4PKYA 1TS7A 2QJ5A 3MQOA 4GCZA 4LLOB 4WN5A 5A8BA 4F3LA 2PYPA 3E4OA 4MN5A 2PHYA 4PKYG 1S4RA 1S1YA 5HWTA 1T19A 1OTDA 4HY8A 3LI9A 5J4EA 5AVEA 3ZQ5A 4HHDA 1LT0A 3PYPA 2Z6CA 2JHEA 3FG8A 4LRYC 4KQDA 4DJ3A 3F1PB 2EA9A 3HJKA 4BBTA 2INWA 4JGRA 5DKLA 3C8CA 4EQ1A 3B33A 2I9VA 2ZOIA 2W0NA 1XJ4A 1LSXA 1OTAA 1F98A 2OOLA 4YWZA 4HQAA 1N9NA 2V9AA 4H6JA 4HOIA 3VE4A 1KOUA 1OTBA 1T1BA 2WKQA 4NXGA 3NOTC 5TBMA 2M1CA 5HSQA 2PYRA 1UWPX 2VLGA 3LICA 4KUKA 4MN6A 2VV8A 2Z6DA 1JNUA 4I3IA 4JGPA 3H82A 5F6AA 5AVFA 1TS6A 2HV1A 1G28A 4I3JA 4R6LA 2V0WA 2WKRA 1OT6A 3LIBA 1V9YA 4HI4A 5HD5A 3MFXA 1DP9A 4NXBA 1T1CA 4RQ9A 2K7SA 5I5LA 4EEPA 1UGUA 2A24A 2VV7A 3LIDA 5HZHA 1MZUA 4L9FA 2OWHA 5F5YA 2D01A 1XJ2A 1TS8A 2ZOHA 1ODVA 1OTEA 1OTIA 3GECA 2V1BA 4HJ4A 3HJIA 4LRXC 4F3LB 4WLAA 3K3CA 3LIFA 2J80A 4XT2A 4GS9A 3UB6A 4B9OA 2KDKA 1OT9A 3EEHA 4I5SA 5IU1A 3BY8A 4WUJA 3MXQA 1EW0A 4EETB 5EFWA 3A0RA 3LUQA 3NJAA 4GHIB 1LSVA 3GDIA 4HJ6A 1TS0A 3LIEA 1DRMA 2VV6A 3F1OB 4I38A 1DP6A 2PD8A 3P7NA 4NXFA 3NHQA 2YKFA 2ZBBA 3NOPC 3ULFA 1UWNX 5HWWA 3UB9A 1LL8A 4LPZA 2JN7A 2OWJA 2BASA 3T50A 2GJ3A 1NWZA 3KX0X 4K08A 2A24B 1GSWA 5HWVA 3CLOA 3E4PA 2VEAA 2W27A 1VB6A 1P0ZA 3E4QA 4L9GA 4I39A 1V9ZA 4XT2B 3UE6A 3OLOA 5HDDA 2QKPA 3UB7A 2B02A 4M4XA 5KIZA 1XJ3A 3CAXA 3IS2B 1GSXA 3H82B 4EESA 5IS1A 3ICYA 2YKHA 3LYXA 4I3AA 4HP9A 1P97A 4EEUA 1T1AA 2CMNA 3NOUC 3LI8A 4E04A 2KX6A 1Y28A 5TBMB 2D02A 2H28A 1D7EA 3EWKA 4EXOA 1N9OA 4H6JB 3C2WA 3F1NA 3CWFA 2L0WA 3MR0A 1S66L 5DJTA 4LRZE 4GHIA
chains in the Genus database with same CATH superfamily
2B5RA 5MC7A 2WZXA 2Q9NA 2PD7A 4O0PA 3SH9A 1XJ6A 3BEBA 2J7VA 4WL9A 4GDBA 3S7NA 3ZG0A 5FEFA 4E6WA 4O8GA 1JVJA 4A5RA 5E2EA 5JYPA 1W8YA 3FKVA 1CEGA 2L4RA 2ZQDA 4QY5A 2DCFA 4JBFA 4DJ2A 4IVIA 3VSKA 4LLOB 2DNSA 3P01A 4WBGA 5CERA 4GKUA 1S6RA 2HJEA 1G6AA 4JF4A 3HLGA 3O86A 3VFHA 1E3UD 3CPTA 5CHMA 5GLBA 1W7FA 1XJ4A 1L2SA 1N9NA 2DRWA 4MN6A 4Y17A 3NBLA 1JNUA 4I3IA 1U60A 2EX8A 4KENB 4GN2A 4Q0IA 4FTXA 5EV0A 5I94A 3Q82A 4L9FA 3S7PA 3OCNA 1KDSA 4X68A 4F3LB 3E2KA 1JTDA 2Y2IA 4Y0TA 3ZG5A 4O7DA 3PBSA 3BM6A 3GV9A 1TS0A 3ULFA 3HLWA 4LPZA 1GSWA 2EFXA 1STZA 1YPRA 1L0GA 4I39A 5EVID 1L0EA 4E04A 3NECA 2DMWA 2ZC7A 3KYQA 3MR0A 1ALQA 1OJGA 5F82A 3UB8A 3BY9A 4IEDA 3MQ0A 5F69A 3G31A 2PU2A 4U0TA 3SS3A 4E3NA 1ONHA 4NG2A 1JTGA 3FV7A 5J3WA 4MN7A 3ZGAB 3R7WB 4E3IA 4DE0A 1YLPA 3BQAA 3W4QA 5CECA 2WADA 3HVFA 4RA7A 2VK3A 3ZVTA 2PHYA 3GMWA 5A90A 4HY8A 3ZQ5A 1CEFA 1IYSA 4KQDA 2EA9A 4QHCA 4EQ1A 2H5SA 5M18A 3B33A 5HFOA 1NJ4A 2OAP1 4GB7A 1MKMA 1KGGA 5F6AA 4OPZA 4QJGA 3O3VA 1DP9A 2HZ5A 4CLCD 1NRFA 5HZHA 1WE4A 2W1TB 4U0XA 2O9BA 1P9WA 2V1BA 4XT2A 1OT9A 2G2WA 3I7JA 3IH8A 3FKWA 4NETA 1M40A 1I2SA 2HDQA 3UPNA 3NHQA 3BLMA 3NY4A 3OZHA 4PM8A 1RGYA 3E4PA 1GA9A 2VEAA 2Y2OA 2Y4AA 3DWZA 4ZJ2A 1K55C 2KOIA 2VKSA 1Z6FA 4HP9A 1W8QA 3VV4A 2IWCA 4FH2A 3IF6C 4LV1A 4HESA 1SCWA 1D1JA 2PR5A 4HJ6A 5EVIC 3UMDA 2V0UA 4KG5A 3GTCA 3IS2A 3HLBA 2JKGA 3GQZA 3PBNA 4JXSA 5DJUA 4HIAA 3LR0A 4OPQA 4EERA 5KMWA 1FIKA 4N92A 5EOEA 3BWLA 4JXWA 5F83A 1PFLA 4PKYA 2HJ9C 1K6RA 1CJFA 3OCLA 3VSLA 1PIOA 1ES2A 3LI9A 1KVLA 2PT7A 4LGWA 2I9VA 2W0NA 1LSXA 2OOLA 5EPHA 4YWZA 4PMAA 4Z9QA 1UWPX 4CLCA 3AGDA 1ESUA 4GZBA 3ITBA 4K0WA 1AXBA 1DJBA 3IX3A 2ZJ9A 2VV7A 2ZQ8A 3FYZA 3RXXA 1XJ2A 1RCJA 3NDEA 1H0MA 3G30A 5CHJA 4LRXC 1XX2A 5HL1A 3Q07A 3KSIA 4IHQA 1IEMA 2PRFA 1Y54A 4WM9A 3GDIA 2FFYA 5HWWA 2ZBBA 3QP5A 1GHPA 3KX0X 4EBNA 3CLOA 2HGVA 2H0TA 1KGEA 1VB6A 3IX4A 3T1QB 5TFQA 1QMFA 4JPMA 1GSXA 4EESA 2XA7M 1IYOA 1P9RA 2H28A 3T4JA 1N4OA 5HAPA 4MLLA 3PBTA 4LRZE 1AWIA 2X71A 3HUNA 3FPWA 4R38A 1FR6A 5EM1A 2ZMAA 1NY0A 3U2AA 3B47A 1GHIA 1ERMA 4R3AA 5FQ9A 1TDLA 3G2YA 5FQJA 3H7WB 3IF6B 1ACFA 5DKKA 1PWCA 2WYXA 4U3TA 4K91A 1C3BA 4F94A 3V3RA 1L0DA 5HWTA 3BQ8A 4GD6A 3L7HA 4JGRA 4LV2A 4R3BA 4UEYA 2OLVA 5CRFA 4BD0A 3CI6A 3T1RA 1YSPA 1VHMA 3D4FA 3BJNA 3H82A 1A0KA 2ZC5B 2V0WA 4PHTA 5EVIA 4DXBA 2HP9A 2XFTA 4MDZA 4DDSA 4FD8A 5IU1A 2W3GA 3MKFA 3A0RA 1DRMA 3IQAA 1EWZA 3TOIA 3RJUA 2BASA 2GJ3A 4WELA 1GA0A 1FSWA 4YFMA 5HDDA 1FOFA 2B02A 4UQIS 5FI6A 3NC8A 4EEUA 1D7EA 3E98A 4ZRRA 1NLYA 1O07A 2VZWA 1CI9A 4OP8A 1S4SA 4KZ7A 3ZG7B 1S67L 3D72A 4DXCA 2ZLYA 3G35A 3S7OA 3CPTB 2P7JA 3KYEA 1F5MA 1XFNA 3F1OA 1LSWA 4ZDXA 4ETZA 4HBTA 4RYEA 3ZHHA 3EGDC 1E25A 4Z1WA 3HL9A 4CJNA 4BBVA 4KZAA 4HNBA 2R9WA 3T4QA 2X01A 3BYDA 3ZG8B 1ES5A 1S1YA 3DBAA 1NRJA 1W63M 1YMSA 3PYPA 2Z6CA 4LV0A 5FAOA 1Q2QA 3T4TA 3N7WA 4HQAA 4Y0OA 5TBMA 3NOTC 3GRJA 2W3HA 3LICA 4O01A 1KGFA 1OT6A 1K38A 1T1CA 5I5LA 2Z2MB 1H5XA 3CZDA 5E43A 2EWWA 1XA7A 2J9OA 3BFEA 3F1OB 3P7NA 2I72A 5KSCA 5IT5A 1DJAA 1UWNX 3V3SA 2OWJA 5HARA 3ZNTA 4BQMA 4EQIA 5HL6A 1YKDA 3WRTA 1MWSA 1QMEA 2V8FA 3DTIA 3VP0A 3ICYA 2WGWB 3LYXA 2QYBA 2HP5A 4S2IA 5TBMB 2D02A 5GHYA 4Y3IA 3CWFA 2L0WA 3LIBA 5FSRA 2J9PA 4PM7A 4XUZA 4FSFA 4X6TA 3LIAA 2PR6A 1XA1A 4BENA 3H9WA 4WF0A 2K31A 3GR2A 2XROA 5JYOA 1KE0A 1YQSA 4ID4A 3UY6A 1FCOA 1JWPA 4HJ3A 2EXBA 3OOVA 2OLUA 5HD3A 3SZTA 2XSSA 2HDSA 2QJ5A 3EOIA 2W1TA 3ZFZA 4HHDA 3D9YA 3MF0A 3F1PB 3BFCA 2INWA 4Y15A 1PI5A 4XXRA 4H6JA 4Y5FA 1WYBA 2ZQCA 2Y2HA 3WRZA 3IHBA 2VLGA 3ZG9B 1L3LA 2W3DA 4S2OA 3P98A 5DTTA 1LI9A 1BLPA 4EEPA 1UGUA 1TS8A 4MBFA 4ZBEA 1XGIA 2XA7S 4E3JA 4WUJA 3HLCA 1LI0A 1BLHA 4MEZA 4NXFA 4E3LA 1LL9A 2KLIA 2FZ0A 1YLYA 3OPHA 5CGXA 1TF1A 5FL3A 1G68A 3TRCA 3T4OA 4MMNA 1BLCA 4QWOA 3H82B 4EBPA 5GLAA 4K0XA 4IJGA 2EX2A 3LFVA 4OQIA 3KSGA 4KZBA 5KSHA 3MFDA 3VE3A 5J8XA 4GHIA 2RL3A 3OPRA 1IKGA 2P74A 4E3KA 4OQGA 3TJZC 4OOYA 1DP8A 3T1SA 4JGOA 4ZTKA 3E0YA 3EGXC 5CTMA 4S2PA 4EUZA 4EV4A 1JWVA 3UO9A 1T18A 5E2GA 5AJGA 4RX2A 1YMXA 2V1AA 3CITA 4C3QA 1FCMA 1YT4A 3SH8A 2QPNA 2GDNA 2ZM8A 3BECA 5M1AA 1TS7A 4CLCB 3S4XA 2WGVA 3DAVA 3MSHA 2MJ6A 1FILA 4G3KA 1PW1A 1TEMA 4DN0A 2VGKA 1S0WA 2WKRA 4E6XA 1V9YA 5D3OA 2GZAA 3QP1A 2JKRI 3Q7VB 2OWHA 5F5YA 1E4DA 4QD4A 1ODVA 4MBKA 2LB9A 2KDKA 2H10A 4EETB 4OLDA 5DKLA 3WWXA 5TR7A 2ZMFA 5E2HA 3R4KA 1XKZA 1N9BA 3PAGA 4LCMA 1FR1A 4L9GA 4ESPA 3Q81A 3CAXA 2QMIA 2YKHA 1T1AA 2EX9A 3WS5A 2XH9A 3C2WA 3F1NA 5CEDA 2VJWA 1IELA 2AVXA 4GD8A 5HAIA 3NCKA 1OJ5A 5GL9A 3A0VA 4GS9B 3ISGA 3HREA 1JWZA 1K0KA 3IF5A 2G7UA 4C75A 3T4LA 4KUOA 2WKPA 2Y2JA 3PHYA 5EVIB 5G4ZA 1D06A 5M19A 4Y7PA 3SH7A 3BRMA 1CF0A 4OOMA 4HH3A 1SHVA 2ZC4B 5DF7A 4NXEA 3SW1A 1ONGA 3PTEA 2WKIA 3MQOA 4WN5A 3WS1A 3N6IA 1CK3A 2B18A 5DFXA 1VETB 2HPBA 4OPRA 2VGLS 3QNCA 1PRQA 5C5KA 3CJMA 2JC7A 4HOIA 1ES4A 2HF6A 4LENA 5FI7A 3WS4A 4JKTA 4E3MA 3HCYA 1G28A 3EQVA 1IOUA 2Y2PA 5CXWA 3KSFA 3FWLA 3A3DA 4G3VA 2D01A 4BJPA 1DJCA 4OP5A 2VX8A 2J80A 5FQIA 4JLFA 4GHIB 5EFWA 5L2FA 4PM6A 2JCHA 3MZFA 5DFYA 2J3TC 4PPRA 3UN7A 4CPKA 5HWVA 1PWDA 5EE8A 4UA9A 1TVFA 4MBHA 2Q0OA 3UB7A 1XXMA 2XFSA 3Q1FA 4S2JA 2OV5A 1P97A 1HVBA 3BW6A 3O87A 2FH5A 2J3TD 1ZC2A 1LLBA 1W63Q 3OPPA 3T12B 2ZD8A 4B4ZA 4QPRA 2O0YA 1F2KA 3F1NB 3PBOA 2OSUA 3Q7ZA 5FQKA 4IUKA 4BBUA 2C5WB 2EWVA 1MWUA 2WZZA 3VMAA 4DE3A 1M6KA 2BTFP 3G2ZA 5E2FA 3OC2A 2NUPC 5DTSA 3QNBA 4S2KA 2G2UA 1G6OA 2FFFB 3IBRA 5EVLA 3MXRA 3CG5A 3CUEA 1SZVA 4YNRA 2E8IA 4EWFA 5J4EA 3MBZA 5AVEA 1LT0A 4KQRA 5AQBA 4DJ3A 4BD1A 2P9VA 1LL5A 3NIAA 3HUOA 4JXGA 3W4PA 3QHYA 3V67A 1MY8A 3UE0A 1GHMA 5CX7A 2ZM2A 3LR3A 3IH9A 3LO7A 2ZM0A 1TS6A 4WZ5A 4I3JA 1VQQA 2ZQAA 3KYZA 5HD5A 2K2NA 3PR6A 1NXYA 3ZYTA 4Q8IA 1DY6A 5AQAA 3EEHA 4ZAMA 1VEUB 3GVBA 3JVUA 2WUQA 1H3QA 2YKFA 3BFDA 4X56A 5EVEA 5HPIA 2PBDP 4WZ5C 3UE6A 5IHVA 4BWIA 1ZG6A 3KSHA 4M4XA 3JYIA 2BG1A 4S2LA 3NOUC 1K54C 1PZPA 3N8LA 3M6BA 1ESIA 4IBXA 3BFFA 5HDCA 3RXWA 1VM1A 3K3DA 3UDFA 4UA6A 1SKOA 1ES3A 1WA9A 4P87A 2QWSA 4OH0A 2E8JA 1BTLA 3NULA 3FC7A 5CEBA 4HH2A 3A3FA 4RX3A 4HP4A 3LR4A 3ZVWA 3E4OA 1IFQA 3UPPA 1PZOA 1T19A 4EU0A 3W2ZA 2JHEA 2QZ6A 3ZDJA 2GNXA 3KO6A 4BBTA 3O5YA 5K5BA 5L10A 2R9XA 4Y0UA 4GNUA 3MKEA 1VETA 2VGJA 2ZL1B 1ZG4A 2Y2KA 5CGWA 2EXAA 4E3OA 2K7SA 2ZOHA 2GX5A 4MCWA 5DVAA 1EW0A 5EECA 3NJAA 3MZDA 1LSVA 4OQ0A 3LY4A 2PD8A 5TGFA 2JN7A 4K08A 2BLSA 3RFBA 3IXDA 4MNRA 1TDGA 2O99A 1YM1A 2ZMVA 3VP2A 1PWGA 2KX6A 1MBLA 3EWKA 1N9OA 3VP4A 1S66L 3UDIA 5J7EA 4R3JA 3BFGA 3M6HA 4D60A 5HDSA 2O9CA 1J9MA 2PDRA 3MJQA 1G5UA 3IWQA 5F1GA 4GW9A 3TG9A 2V2FF 4DDYA 4P6ZS 1MWRA 1HD8A 4KZ5A 1MC0A 2W3FA 5CHUA 1BUEA 3Q7VA 5HX9A 3M2JA 4JXVA 2QJ7A 3F1PA 1I2WA 2ZQ7A 4LCLA 2WAFA 4N1XA 3PXPA 5FAQA 1Q2PA 4DKIA 2QHKA 4KQOA 5A8BA 1HLUP 1K4FA 4OPYA 2J3WA 4WEKA 4NEED 3UE3A 3A3JA 3IX8A 1YLTA 5CTNA 2V9AA 1RP5A 2A2LA 2Y8HA 4NXGA 2XGNA 1W79A 2PYRA 1RGZA 1SDEA 3LR5A 2HV1A 4Y13A 3MXSA 2V1ZA 2Y55A 3MFXA 2ACGA 2XR0A 3LEZA 5FEGA 5FDHA 5HW3A 3K3CA 2WAEA 4B9OA 3VP1A 2WGWA 3LUQA 4WEJA 2IWDA 4BL3A 5FI2A 2LB5A 4HEFA 1I5QA 1V9ZA 3OLOA 2QKPA 2JKFA 4YOFA 1KE4A 4I3AA 2CMNA 3VOYA 4DMZA 2EX6A 1YAXA 1PW8A 4UA7A 3OBFA 4DRTA 1HZOA 3DTEA 5FQMA 5AQ7A 3QP6A 4BMWA 3JPUA 2R78A 3G32A 1K25A 5LBRA 1PI4A 4R70A 4KG2A 5FQQA 3UMEA 2Y2QA 2XD1A 5EOOA 4B88A 4R23A 1BYWA 4P0MA 4Q0HA 3H7WA 3WS0A 5A93A 4BLMA 5G18A 2J8YA 2XD5A 2XK1A 3M2KA 4WYYA 4DE1A 4EW7A 4N9KA 3PBQA 1W5DA 5BOHA 3R7WA 5TJJA 3SS4A 4P6ZM 4LRYC 3O88A 3JVVA 1OTAA 1K56D 2P9VB 3SS5A 4KZ8A 3VE4A 1OMEA 1KOUA 1PNEA 5HSQA 2VV8A 4QB8A 1CI8A 1O7EA 4R6LA 5L07A 2UWXA 1YSQA 1WYCA 3TE8A 4B93A 3OPLA 1MZUA 4FUWA 3L9KA 2W1RA 3TW8A 1E3UA 1K4EA 1OTEA 4HJ4A 1OTIA 4NK3A 2JKRM 4Q0JA 4D2OA 4II7A 4I38A 1DP6A 3HLFA 4WZ4A 3AGFA 2HP6A 3B3XA 3UB5P 4LV3A 4CLCE 4OVDA 3FPVA 2C6WB 3QP8A 3DTKA 4QU3A 4IBRA 4X1LA 2IA2A 1Y28A 4UQIM 4H6JB 1IYQA 1SDNA 4GLQA 3CMZA 1GSVA 2Y59A 2Q9MA 2ZC3B 4CQHA 5G4YA 2JKTI 3P09A 3DW0A 3W8KA 1F9IA 4DE2A 3C4OA 4NKPA 4KZ9A 4KZ6A 3A3EA 5GHZA 3N8RA 4OKPA 3B42A 5FDSA 4GCZA 4CLCC 2NUTC 1OPXA 1S4RA 1MPLA 1BZAA 3S22A 1PYYA 4FCFA 2JE5A 4EBLA 2OAQ1 2Y79A 5F1FA 3HJKA 4X55A 3C8CA 4C6YA 2JBFA 3A3IA 3V50A 4LFUA 1OTBA 2Z6DA 2V8CA 2XRNA 4ZJ1A 4R0QA 5A91A 2A24A 3VP3A 3UDXA 3BLSA 1BLSA 4OQHA 2PAVP 2M7UA 4PM9A 4R1GA 5A92A 4HBUA 2VV6A 2O9AA 2M7VA 2JKTM 5FASA 1NWZA 2A24B 3UPOA 4JF5A 3VOZA 4P85A 3NDGA 3V39A 3IS2B 1CQAA 3LI8A 4ME4A 3WS2A 4EXOA 1EROA 4ARZB 4JF6A 5L09A 3S7QA 2L1MA 3G6OA 2W3EA 5GLCA 3MQQA 5KZHA 2WK0A 4GDNA 1YLJA 3G34A 5GHXA 2XLNA 5F68A 4KZ4A 3E2LA 1ERQA 1ZKJA 1XFQA 3LY3A 4G3WA 3C7VA 4H8RA 3SOIA 3VOLA 1BSGA 3V5MA 3TSGA 1K57C 3PBRA 3N4IA 5L8MA 3S1YA 4Y2FA 3UE1A 1MXOA 2PYPA 5FATA 2A49A 4QY6A 4ZJ3A 3FG8A 1MWTA 3C4PA 4PAUA 2WKEA 1TD5A 2A3UA 2HDUA 1GCEA 2WKQA 2M1CA 4KG6A 4KUKA 1Z09A 4DF6A 3EEAA 1K54A 5AVFA 2P04A 3IT9A 4HI4A 4KZ3A 4X25A 3LIDA 1BULA 2X02A 4WLAA 3LIFA 3IF6A 1FSYA 4WMCA 4X69A 3LGOA 3UB6A 2ZC6B 3NOPC 1L0FA 3T50A 1P0ZA 4XT2B 4FH4A 4OLGA 1XJ3A 3LCEA 4N1HA 4EUVA 2H0YA 2XF3A 3IWIA 4M3KA 5DJTA 2PU4A 1XPBA 2V20A 3W4OA 1N9LA 1NLZA 3RH8B 4OONA 2VGLM 4IVKA 1EI5A 3IXHA 4L9EA 1H8ZA 4XUXA 4L0LA 5FA7A 3AGEA 4GOGA 3HLEA 3QP4A 1K6SA 4RVAA 3T4SA 3UNWA 3FZCA 4F3LA 4MN5A 3ZCZA 3CHWP 1YLWA 3HBRA 4OOLA 4R4RA 3N8SA 3QP2A 2ZOIA 5EUAA 2Y2NA 2Y2MA 4AFIA 4B4XA 3MMHA 1K55A 1T1BA 3HLDA 1NYYA 3CUEC 5U47A 1KVMA 3IWOA 3D3OA 4KQQA 1XP4A 2PBYA 3NI9A 4N9LA 1XGJA 3T1XA 3GECA 2WGIA 3HJIA 3HUMA 1SKFA 3VFFA 4GS9A 4I5SA 1ZTUA 2CC1A 4PM5A 1ZHHB 3IXBA 5EM0A 2HDRA 2W27A 3MZEA 1NZUA 2Z2LB 5KIZA 2WKHA 3MS6A 1VEUA 4FOFA 2Y2LA 1J3WA 1IKIA 5HAQA 1IYPA 1KE3A 3ITAA 1H8MA 5DF9A 4ARZA 3DTMA 2Y91A 3A0SA 3C7UA 1MKIA 4JGQA 4YINA 1BT5A 1FCNA 2B95A 1S1ZA 4R4SA 4GJ4A 2UV0E 3G4PA 3K2NA 4UHUA 4IUHA 3IBJA 2VA0A 1NZOA 1X0OA 1HTZA 4X53A 3RTYA 4S2MA 4PKYG 2ZL1A 1KDWA 5CGSA 2XEPA 1OTDA 1FQGA 1NYMA 4UAAA 4X1MA 1K56A 3C38A 1K57A 3ZNYA 3C5AA 1F98A 2EFUA 4S2NC 3PAEA 3U4LP 2ZQ9A 2P08A 4JGPA 4P6BA 4BL2A 3EQUA 4NXBA 4RQ9A 5IS1A 5AQ9A 5FAPA 3C30A 2XQZA 5DF8A 3IHAA 1H8YA 3BY8A 3MXQA 3T4KA 3LEQA 3DWKA 4ETXA 1Y4OA 4S2NA 3LIEA 1SKOB 1LHYA 2XDMA 3UB9A 1LL8A 2IWBA 5HPFA 3E4QA 1YLZA 4WMCD 3GSGA 3IXGA 5DTKA 2RCXA 5GLDA 2Y2GA
chains in the Genus database with same CATH topology
1GSVA 1S4SA 2O0YA 4QPRA 5MC7A 3F1NB 3PBOA 4CQHA 1S67L 2PD7A 4IUKA 3D72A 2EWVA 2JKTI 5G4YA 4BBUA 4O0PA 1XJ6A 1F9IA 3S7OA 4WL9A 3S7NA 2P7JA 1F5MA 1XFNA 3F1OA 1LSWA 4NKPA 4O8GA 4ETZA 3OC2A 3EGDC 2NUPC 4Z1WA 3B42A 2L4RA 4BBVA 4DJ2A 1G6OA 3T4QA 4HNBA 3IBRA 4LLOB 4GCZA 3P01A 4CLCC 2NUTC 3CUEA 1OPXA 4YNRA 1S4RA 2HJEA 1S1YA 5J4EA 3DBAA 1NRJA 1W63M 5AVEA 1LT0A 3PYPA 2Z6CA 4DJ3A 2OAQ1 2Y79A 3HJKA 3C8CA 1XJ4A 3T4TA 4HQAA 3V67A 1N9NA 5TBMA 1OTBA 5CX7A 3NOTC 3LR3A 2W3HA 4MN6A 3LICA 2Z6DA 1JNUA 4I3IA 4O01A 1TS6A 2XRNA 4I3JA 3KYZA 1OT6A 4Q0IA 5HD5A 2K2NA 3PR6A 1T1CA 5I5LA 2A24A 3ZYTA 4L9FA 3S7PA 3OCNA 4F3LB 2M7UA 3EEHA 2EWWA 3PBSA 3JVUA 1TS0A 1H3QA 2VV6A 3F1OB 2O9AA 3ULFA 3P7NA 2YKFA 2M7VA 5IT5A 2JKTM 1UWNX 4LPZA 2OWJA 1NWZA 2A24B 1GSWA 5HPIA 1STZA 5HL6A 3UE6A 4BWIA 4I39A 3KSHA 1YKDA 4M4XA 3IS2B 3ICYA 3LYXA 2QYBA 3NOUC 3LI8A 4E04A 5TBMB 2D02A 2DMWA 4ME4A 4EXOA 3KYQA 4Y3IA 3CWFA 2L0WA 3MR0A 3LIBA 4ARZB 3S7QA 2L1MA 1OJGA 5HDCA 4FSFA 3UB8A 3G6OA 3BY9A 3K3DA 2W3EA 3MQ0A 3LIAA 3MQQA 2PR6A 5F69A 5F68A 3H9WA 5J3WA 4MN7A 4WF0A 2K31A 3R7WB 2XROA 1WA9A 1XFQA 2QWSA 4G3WA 3VOLA 4HJ3A 3BQAA 3OOVA 3FC7A 5HD3A 3PBRA 4HH2A 5L8MA 4HP4A 3LR4A 4Y2FA 2XSSA 2QJ5A 3EOIA 2PYPA 3E4OA 1IFQA 2PHYA 2W1TA 1T19A 4HY8A 4EU0A 3ZQ5A 4HHDA 3W2ZA 2JHEA 3FG8A 3MF0A 4KQDA 3F1PB 2GNXA 2EA9A 3KO6A 4BBTA 2INWA 4EQ1A 3O5YA 5K5BA 3B33A 4PAUA 1TD5A 4H6JA 4Y5FA 2OAP1 2WKQA 2M1CA 2VLGA 4KUKA 1MKMA 2W3DA 5F6AA 3EEAA 5AVFA 2P04A 4HI4A 1DP9A 4CLCD 2K7SA 4EEPA 5HZHA 1UGUA 3LIDA 2W1TB 2O9BA 1TS8A 2ZOHA 1P9WA 2V1BA 4WLAA 3LIFA 4XT2A 2GX5A 1OT9A 2XA7S 4MCWA 4WUJA 1EW0A 3NJAA 1LSVA 4NXFA 2KLIA 3UB6A 2PD8A 2FZ0A 3NHQA 3NOPC 2JN7A 3T50A 4K08A 1TF1A 3E4PA 3RFBA 2VEAA 5FL3A 3TRCA 1P0ZA 4XT2B 3T4OA 4MMNA 2O99A 1XJ3A 2KOIA 2VKSA 3H82B 2ZMVA 4EUVA 4IJGA 4HP9A 3LFVA 3VV4A 2KX6A 3KSGA 3EWKA 5KSHA 1N9OA 1S66L 5DJTA 3VE3A 5J7EA 4GHIA 3TJZC 2PR5A 5HDSA 2O9CA 4HJ6A 2PDRA 3MJQA 3UMDA 1DP8A 1N9LA 4JGOA 2V0UA 1NLZA 3E0YA 3RH8B 3EGXC 2VGLM 4GW9A 3IS2A 4P6ZS 3PBNA 5DJUA 1MC0A 2W3FA 4L9EA 1T18A 5AJGA 2QJ7A 2V1AA 3F1PA 4L0LA 4HIAA 3LR0A 3CITA 4EERA 3PXPA 3BWLA 2QHKA 3T4SA 4PKYA 1TS7A 4KQOA 5A8BA 4F3LA 2HJ9C 4MN5A 3OCLA 2J3WA 4CLCB 4WEKA 3LI9A 4NEED 3UE3A 2MJ6A 2PT7A 4OOLA 2I9VA 2ZOIA 2W0NA 1LSXA 2OOLA 4YWZA 4G3KA 2V9AA 4AFIA 2A2LA 2Y8HA 3MMHA 4NXGA 1T1BA 2PYRA 1UWPX 4CLCA 3CUEC 4DN0A 3LR5A 2HV1A 2WKRA 1V9YA 3MFXA 3D3OA 2GZAA 2VV7A 2JKRI 2OWHA 5F5YA 1XJ2A 1ODVA 3GECA 2LB9A 3HJIA 4LRXC 3K3CA 4GS9A 4B9OA 2KDKA 4I5SA 3KSIA 4IHQA 1ZTUA 4EETB 3LUQA 4WEJA 3GDIA 5DKLA 5HWWA 2ZBBA 1ZHHB 2ZMFA 3KX0X 2LB5A 3R4KA 3CLOA 2HGVA 2W27A 1VB6A 4L9GA 1V9ZA 3OLOA 2QKPA 5KIZA 3CAXA 1GSXA 4EESA 2XA7M 2YKHA 4YOFA 4FOFA 4I3AA 1T1AA 2CMNA 1P9RA 2H28A 4DMZA 3T4JA 1YAXA 3C2WA 3F1NA 3OBFA 3PBTA 2VJWA 4LRZE 4BMWA 1H8MA 5DF9A 1OJ5A 4ARZA 3A0VA 2R78A 4GS9B 3A0SA 3FPWA 4R38A 5LBRA 2G7UA 4JGQA 4R70A 3U2AA 3B47A 3T4LA 4KUOA 3UMEA 2WKPA 4R3AA 3PHYA 5G4ZA 1D06A 1S1ZA 4GJ4A 1BYWA 4Q0HA 3H7WA 3H7WB 3K2NA 5DKKA 4IUHA 3IBJA 2VA0A 4OOMA 4HH3A 1X0OA 4NXEA 4EW7A 3SW1A 3RTYA 3PBQA 3MQOA 4WN5A 2B18A 4PKYG 3R7WA 5DFXA 5TJJA 5HWTA 1OTDA 4P6ZM 3BQ8A 2VGLS 4LRYC 3JVVA 4JGRA 4UEYA 3C38A 5C5KA 1OTAA 1F98A 4HOIA 3VE4A 1KOUA 2HF6A 3CI6A 1YSPA 2P08A 1VHMA 5HSQA 2VV8A 4JGPA 3BJNA 3H82A 3HCYA 1G28A 4R6LA 3EQVA 1IOUA 2V0WA 4PHTA 3EQUA 3KSFA 4NXBA 1YSQA 4RQ9A 3TE8A 4B93A 5IS1A 1MZUA 4G3VA 2D01A 3C30A 2W1RA 4MDZA 3TW8A 4BJPA 2VX8A 1OTEA 4HJ4A 1OTIA 2J80A 5IU1A 2JKRM 2W3GA 3BY8A 3MXQA 4Q0JA 3T4KA 5EFWA 3A0RA 4GHIB 4II7A 4ETXA 3LIEA 4I38A 1DRMA 1DP6A 5DFYA 2J3TC 3UB9A 1LL8A 5HPFA 2BASA 2GJ3A 5HWVA 4WELA 4CLCE 3FPVA 3E4QA 5HDDA 3UB7A 2B02A 4UQIS 1P97A 4EEUA 2IA2A 1Y28A 3BW6A 1D7EA 2FH5A 2J3TD 3E98A 4UQIM 4H6JB 4ZRRA 1NLYA 2VZWA 1W63Q 4GLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSV A;  2L1M A;  1OJG A;  5HDC A;  1OJ5 A;  3A0V A;  1S4S A;  2R78 A;  2PR5 A;  4GS9 B;  5HDS A;  3F1N B;  3G6O A;  3A0S A;  3BY9 A;  2PDR A;  3K3D A;  3MJQ A;  1DP8 A;  1N9L A;  1S67 L;  2PD7 A;  3D72 A;  4JGO A;  5G4Y A;  2V0U A;  4BBU A;  3LIA A;  3MQQ A;  4R38 A;  3RH8 B;  2PR6 A;  5F69 A;  4JGQ A;  4R70 A;  1XJ6 A;  1F9I A;  4GW9 A;  4KUO A;  2WKP A;  5F68 A;  3UME A;  4R3A A;  3IS2 A;  3PHY A;  4WL9 A;  3VE3 A;  5G4Z A;  1D06 A;  1S1Z A;  2P7J A;  1BYW A;  5DJU A;  3H9W A;  1XFN A;  3F1O A;  5J3W A;  3H7W A;  4WF0 A;  1LSW A;  4L9E A;  3H7W B;  1T18 A;  1WA9 A;  1XFQ A;  2QWS A;  3UB8 A;  2QJ7 A;  2V1A A;  3F1P A;  5DKK A;  4HIA A;  4EER A;  3VOL A;  4HJ3 A;  5J7E A;  2L4R A;  4HH3 A;  1X0O A;  5HD3 A;  3FC7 A;  4HH2 A;  3BWL A;  3UMD A;  4NXE A;  4BBV A;  4DJ2 A;  2QHK A;  4EW7 A;  4HP4 A;  4HNB A;  3SW1 A;  3RTY A;  3IBR A;  4PKY A;  1TS7 A;  2QJ5 A;  3MQO A;  4GCZ A;  4LLO B;  4WN5 A;  5A8B A;  4F3L A;  2PYP A;  3E4O A;  4MN5 A;  2PHY A;  4PKY G;  1S4R A;  1S1Y A;  5HWT A;  1T19 A;  1OTD A;  4HY8 A;  3LI9 A;  5J4E A;  5AVE A;  3ZQ5 A;  4HHD A;  1LT0 A;  3PYP A;  2Z6C A;  2JHE A;  3FG8 A;  4LRY C;  4KQD A;  4DJ3 A;  3F1P B;  2EA9 A;  3HJK A;  4BBT A;  2INW A;  4JGR A;  5DKL A;  3C8C A;  4EQ1 A;  3B33 A;  2I9V A;  2ZOI A;  2W0N A;  1XJ4 A;  1LSX A;  1OTA A;  1F98 A;  2OOL A;  4YWZ A;  4HQA A;  1N9N A;  2V9A A;  4H6J A;  4HOI A;  3VE4 A;  1KOU A;  1OTB A;  1T1B A;  2WKQ A;  4NXG A;  3NOT C;  5TBM A;  2M1C A;  5HSQ A;  2PYR A;  1UWP X;  2VLG A;  3LIC A;  4KUK A;  4MN6 A;  2VV8 A;  2Z6D A;  1JNU A;  4I3I A;  4JGP A;  3H82 A;  5F6A A;  5AVF A;  1TS6 A;  2HV1 A;  1G28 A;  4I3J A;  4R6L A;  2V0W A;  2WKR A;  1OT6 A;  3LIB A;  1V9Y A;  4HI4 A;  5HD5 A;  3MFX A;  1DP9 A;  4NXB A;  1T1C A;  4RQ9 A;  2K7S A;  5I5L A;  4EEP A;  1UGU A;  2A24 A;  2VV7 A;  3LID A;  5HZH A;  1MZU A;  4L9F A;  2OWH A;  5F5Y A;  2D01 A;  1XJ2 A;  1TS8 A;  2ZOH A;  1ODV A;  1OTE A;  1OTI A;  3GEC A;  2V1B A;  4HJ4 A;  3HJI A;  4LRX C;  4F3L B;  4WLA A;  3K3C A;  3LIF A;  2J80 A;  4XT2 A;  4GS9 A;  3UB6 A;  4B9O A;  2KDK A;  1OT9 A;  3EEH A;  4I5S A;  5IU1 A;  3BY8 A;  4WUJ A;  3MXQ A;  1EW0 A;  4EET B;  5EFW A;  3A0R A;  3LUQ A;  3NJA A;  4GHI B;  1LSV A;  3GDI A;  4HJ6 A;  1TS0 A;  3LIE A;  1DRM A;  2VV6 A;  3F1O B;  4I38 A;  1DP6 A;  2PD8 A;  3P7N A;  4NXF A;  3NHQ A;  2YKF A;  2ZBB A;  3NOP C;  3ULF A;  1UWN X;  5HWW A;  3UB9 A;  1LL8 A;  4LPZ A;  2JN7 A;  2OWJ A;  2BAS A;  3T50 A;  2GJ3 A;  1NWZ A;  3KX0 X;  4K08 A;  2A24 B;  1GSW A;  5HWV A;  3CLO A;  3E4P A;  2VEA A;  2W27 A;  1VB6 A;  1P0Z A;  3E4Q A;  4L9G A;  4I39 A;  1V9Z A;  4XT2 B;  3UE6 A;  3OLO A;  5HDD A;  2QKP A;  3UB7 A;  2B02 A;  4M4X A;  5KIZ A;  1XJ3 A;  3CAX A;  3IS2 B;  1GSX A;  3H82 B;  4EES A;  5IS1 A;  3ICY A;  2YKH A;  3LYX A;  4I3A A;  4HP9 A;  1P97 A;  4EEU A;  1T1A A;  2CMN A;  3NOU C;  3LI8 A;  4E04 A;  2KX6 A;  1Y28 A;  5TBM B;  2D02 A;  2H28 A;  1D7E A;  3EWK A;  4EXO A;  1N9O A;  4H6J B;  3C2W A;  3F1N A;  3CWF A;  2L0W A;  3MR0 A;  1S66 L;  5DJT A;  4LRZ E;  4GHI A; 
#chains in the Genus database with same CATH topology
 2B5R A;  5MC7 A;  2WZX A;  2Q9N A;  2PD7 A;  4O0P A;  3SH9 A;  1XJ6 A;  3BEB A;  2J7V A;  4WL9 A;  4GDB A;  3S7N A;  3ZG0 A;  5FEF A;  4E6W A;  4O8G A;  1JVJ A;  4A5R A;  5E2E A;  5JYP A;  1W8Y A;  3FKV A;  1CEG A;  2L4R A;  2ZQD A;  4QY5 A;  2DCF A;  4JBF A;  4DJ2 A;  4IVI A;  3VSK A;  4LLO B;  2DNS A;  3P01 A;  4WBG A;  5CER A;  4GKU A;  1S6R A;  2HJE A;  1G6A A;  4JF4 A;  3HLG A;  3O86 A;  3VFH A;  1E3U D;  3CPT A;  5CHM A;  5GLB A;  1W7F A;  1XJ4 A;  1L2S A;  1N9N A;  2DRW A;  4MN6 A;  4Y17 A;  3NBL A;  1JNU A;  4I3I A;  1U60 A;  2EX8 A;  4KEN B;  4GN2 A;  4Q0I A;  4FTX A;  5EV0 A;  5I94 A;  3Q82 A;  4L9F A;  3S7P A;  3OCN A;  1KDS A;  4X68 A;  4F3L B;  3E2K A;  1JTD A;  2Y2I A;  4Y0T A;  3ZG5 A;  4O7D A;  3PBS A;  3BM6 A;  3GV9 A;  1TS0 A;  3ULF A;  3HLW A;  4LPZ A;  1GSW A;  2EFX A;  1STZ A;  1YPR A;  1L0G A;  4I39 A;  5EVI D;  1L0E A;  4E04 A;  3NEC A;  2DMW A;  2ZC7 A;  3KYQ A;  3MR0 A;  1ALQ A;  1OJG A;  5F82 A;  3UB8 A;  3BY9 A;  4IED A;  3MQ0 A;  5F69 A;  3G31 A;  2PU2 A;  4U0T A;  3SS3 A;  4E3N A;  1ONH A;  4NG2 A;  1JTG A;  3FV7 A;  5J3W A;  4MN7 A;  3ZGA B;  3R7W B;  4E3I A;  4DE0 A;  1YLP A;  3BQA A;  3W4Q A;  5CEC A;  2WAD A;  3HVF A;  4RA7 A;  2VK3 A;  3ZVT A;  2PHY A;  3GMW A;  5A90 A;  4HY8 A;  3ZQ5 A;  1CEF A;  1IYS A;  4KQD A;  2EA9 A;  4QHC A;  4EQ1 A;  2H5S A;  5M18 A;  3B33 A;  5HFO A;  1NJ4 A;  2OAP 1;  4GB7 A;  1MKM A;  1KGG A;  5F6A A;  4OPZ A;  4QJG A;  3O3V A;  1DP9 A;  2HZ5 A;  4CLC D;  1NRF A;  5HZH A;  1WE4 A;  2W1T B;  4U0X A;  2O9B A;  1P9W A;  2V1B A;  4XT2 A;  1OT9 A;  2G2W A;  3I7J A;  3IH8 A;  3FKW A;  4NET A;  1M40 A;  1I2S A;  2HDQ A;  3UPN A;  3NHQ A;  3BLM A;  3NY4 A;  3OZH A;  4PM8 A;  1RGY A;  3E4P A;  1GA9 A;  2VEA A;  2Y2O A;  2Y4A A;  3DWZ A;  4ZJ2 A;  1K55 C;  2KOI A;  2VKS A;  1Z6F A;  4HP9 A;  1W8Q A;  3VV4 A;  2IWC A;  4FH2 A;  3IF6 C;  4LV1 A;  4HES A;  1SCW A;  1D1J A;  2PR5 A;  4HJ6 A;  5EVI C;  3UMD A;  2V0U A;  4KG5 A;  3GTC A;  3IS2 A;  3HLB A;  2JKG A;  3GQZ A;  3PBN A;  4JXS A;  5DJU A;  4HIA A;  3LR0 A;  4OPQ A;  4EER A;  5KMW A;  1FIK A;  4N92 A;  5EOE A;  3BWL A;  4JXW A;  5F83 A;  1PFL A;  4PKY A;  2HJ9 C;  1K6R A;  1CJF A;  3OCL A;  3VSL A;  1PIO A;  1ES2 A;  3LI9 A;  1KVL A;  2PT7 A;  4LGW A;  2I9V A;  2W0N A;  1LSX A;  2OOL A;  5EPH A;  4YWZ A;  4PMA A;  4Z9Q A;  1UWP X;  4CLC A;  3AGD A;  1ESU A;  4GZB A;  3ITB A;  4K0W A;  1AXB A;  1DJB A;  3IX3 A;  2ZJ9 A;  2VV7 A;  2ZQ8 A;  3FYZ A;  3RXX A;  1XJ2 A;  1RCJ A;  3NDE A;  1H0M A;  3G30 A;  5CHJ A;  4LRX C;  1XX2 A;  5HL1 A;  3Q07 A;  3KSI A;  4IHQ A;  1IEM A;  2PRF A;  1Y54 A;  4WM9 A;  3GDI A;  2FFY A;  5HWW A;  2ZBB A;  3QP5 A;  1GHP A;  3KX0 X;  4EBN A;  3CLO A;  2HGV A;  2H0T A;  1KGE A;  1VB6 A;  3IX4 A;  3T1Q B;  5TFQ A;  1QMF A;  4JPM A;  1GSX A;  4EES A;  2XA7 M;  1IYO A;  1P9R A;  2H28 A;  3T4J A;  1N4O A;  5HAP A;  4MLL A;  3PBT A;  4LRZ E;  1AWI A;  2X71 A;  3HUN A;  3FPW A;  4R38 A;  1FR6 A;  5EM1 A;  2ZMA A;  1NY0 A;  3U2A A;  3B47 A;  1GHI A;  1ERM A;  4R3A A;  5FQ9 A;  1TDL A;  3G2Y A;  5FQJ A;  3H7W B;  3IF6 B;  1ACF A;  5DKK A;  1PWC A;  2WYX A;  4U3T A;  4K91 A;  1C3B A;  4F94 A;  3V3R A;  1L0D A;  5HWT A;  3BQ8 A;  4GD6 A;  3L7H A;  4JGR A;  4LV2 A;  4R3B A;  4UEY A;  2OLV A;  5CRF A;  4BD0 A;  3CI6 A;  3T1R A;  1YSP A;  1VHM A;  3D4F A;  3BJN A;  3H82 A;  1A0K A;  2ZC5 B;  2V0W A;  4PHT A;  5EVI A;  4DXB A;  2HP9 A;  2XFT A;  4MDZ A;  4DDS A;  4FD8 A;  5IU1 A;  2W3G A;  3MKF A;  3A0R A;  1DRM A;  3IQA A;  1EWZ A;  3TOI A;  3RJU A;  2BAS A;  2GJ3 A;  4WEL A;  1GA0 A;  1FSW A;  4YFM A;  5HDD A;  1FOF A;  2B02 A;  4UQI S;  5FI6 A;  3NC8 A;  4EEU A;  1D7E A;  3E98 A;  4ZRR A;  1NLY A;  1O07 A;  2VZW A;  1CI9 A;  4OP8 A;  1S4S A;  4KZ7 A;  3ZG7 B;  1S67 L;  3D72 A;  4DXC A;  2ZLY A;  3G35 A;  3S7O A;  3CPT B;  2P7J A;  3KYE A;  1F5M A;  1XFN A;  3F1O A;  1LSW A;  4ZDX A;  4ETZ A;  4HBT A;  4RYE A;  3ZHH A;  3EGD C;  1E25 A;  4Z1W A;  3HL9 A;  4CJN A;  4BBV A;  4KZA A;  4HNB A;  2R9W A;  3T4Q A;  2X01 A;  3BYD A;  3ZG8 B;  1ES5 A;  1S1Y A;  3DBA A;  1NRJ A;  1W63 M;  1YMS A;  3PYP A;  2Z6C A;  4LV0 A;  5FAO A;  1Q2Q A;  3T4T A;  3N7W A;  4HQA A;  4Y0O A;  5TBM A;  3NOT C;  3GRJ A;  2W3H A;  3LIC A;  4O01 A;  1KGF A;  1OT6 A;  1K38 A;  1T1C A;  5I5L A;  2Z2M B;  1H5X A;  3CZD A;  5E43 A;  2EWW A;  1XA7 A;  2J9O A;  3BFE A;  3F1O B;  3P7N A;  2I72 A;  5KSC A;  5IT5 A;  1DJA A;  1UWN X;  3V3S A;  2OWJ A;  5HAR A;  3ZNT A;  4BQM A;  4EQI A;  5HL6 A;  1YKD A;  3WRT A;  1MWS A;  1QME A;  2V8F A;  3DTI A;  3VP0 A;  3ICY A;  2WGW B;  3LYX A;  2QYB A;  2HP5 A;  4S2I A;  5TBM B;  2D02 A;  5GHY A;  4Y3I A;  3CWF A;  2L0W A;  3LIB A;  5FSR A;  2J9P A;  4PM7 A;  4XUZ A;  4FSF A;  4X6T A;  3LIA A;  2PR6 A;  1XA1 A;  4BEN A;  3H9W A;  4WF0 A;  2K31 A;  3GR2 A;  2XRO A;  5JYO A;  1KE0 A;  1YQS A;  4ID4 A;  3UY6 A;  1FCO A;  1JWP A;  4HJ3 A;  2EXB A;  3OOV A;  2OLU A;  5HD3 A;  3SZT A;  2XSS A;  2HDS A;  2QJ5 A;  3EOI A;  2W1T A;  3ZFZ A;  4HHD A;  3D9Y A;  3MF0 A;  3F1P B;  3BFC A;  2INW A;  4Y15 A;  1PI5 A;  4XXR A;  4H6J A;  4Y5F A;  1WYB A;  2ZQC A;  2Y2H A;  3WRZ A;  3IHB A;  2VLG A;  3ZG9 B;  1L3L A;  2W3D A;  4S2O A;  3P98 A;  5DTT A;  1LI9 A;  1BLP A;  4EEP A;  1UGU A;  1TS8 A;  4MBF A;  4ZBE A;  1XGI A;  2XA7 S;  4E3J A;  4WUJ A;  3HLC A;  1LI0 A;  1BLH A;  4MEZ A;  4NXF A;  4E3L A;  1LL9 A;  2KLI A;  2FZ0 A;  1YLY A;  3OPH A;  5CGX A;  1TF1 A;  5FL3 A;  1G68 A;  3TRC A;  3T4O A;  4MMN A;  1BLC A;  4QWO A;  3H82 B;  4EBP A;  5GLA A;  4K0X A;  4IJG A;  2EX2 A;  3LFV A;  4OQI A;  3KSG A;  4KZB A;  5KSH A;  3MFD A;  3VE3 A;  5J8X A;  4GHI A;  2RL3 A;  3OPR A;  1IKG A;  2P74 A;  4E3K A;  4OQG A;  3TJZ C;  4OOY A;  1DP8 A;  3T1S A;  4JGO A;  4ZTK A;  3E0Y A;  3EGX C;  5CTM A;  4S2P A;  4EUZ A;  4EV4 A;  1JWV A;  3UO9 A;  1T18 A;  5E2G A;  5AJG A;  4RX2 A;  1YMX A;  2V1A A;  3CIT A;  4C3Q A;  1FCM A;  1YT4 A;  3SH8 A;  2QPN A;  2GDN A;  2ZM8 A;  3BEC A;  5M1A A;  1TS7 A;  4CLC B;  3S4X A;  2WGV A;  3DAV A;  3MSH A;  2MJ6 A;  1FIL A;  4G3K A;  1PW1 A;  1TEM A;  4DN0 A;  2VGK A;  1S0W A;  2WKR A;  4E6X A;  1V9Y A;  5D3O A;  2GZA A;  3QP1 A;  2JKR I;  3Q7V B;  2OWH A;  5F5Y A;  1E4D A;  4QD4 A;  1ODV A;  4MBK A;  2LB9 A;  2KDK A;  2H10 A;  4EET B;  4OLD A;  5DKL A;  3WWX A;  5TR7 A;  2ZMF A;  5E2H A;  3R4K A;  1XKZ A;  1N9B A;  3PAG A;  4LCM A;  1FR1 A;  4L9G A;  4ESP A;  3Q81 A;  3CAX A;  2QMI A;  2YKH A;  1T1A A;  2EX9 A;  3WS5 A;  2XH9 A;  3C2W A;  3F1N A;  5CED A;  2VJW A;  1IEL A;  2AVX A;  4GD8 A;  5HAI A;  3NCK A;  1OJ5 A;  5GL9 A;  3A0V A;  4GS9 B;  3ISG A;  3HRE A;  1JWZ A;  1K0K A;  3IF5 A;  2G7U A;  4C75 A;  3T4L A;  4KUO A;  2WKP A;  2Y2J A;  3PHY A;  5EVI B;  5G4Z A;  1D06 A;  5M19 A;  4Y7P A;  3SH7 A;  3BRM A;  1CF0 A;  4OOM A;  4HH3 A;  1SHV A;  2ZC4 B;  5DF7 A;  4NXE A;  3SW1 A;  1ONG A;  3PTE A;  2WKI A;  3MQO A;  4WN5 A;  3WS1 A;  3N6I A;  1CK3 A;  2B18 A;  5DFX A;  1VET B;  2HPB A;  4OPR A;  2VGL S;  3QNC A;  1PRQ A;  5C5K A;  3CJM A;  2JC7 A;  4HOI A;  1ES4 A;  2HF6 A;  4LEN A;  5FI7 A;  3WS4 A;  4JKT A;  4E3M A;  3HCY A;  1G28 A;  3EQV A;  1IOU A;  2Y2P A;  5CXW A;  3KSF A;  3FWL A;  3A3D A;  4G3V A;  2D01 A;  4BJP A;  1DJC A;  4OP5 A;  2VX8 A;  2J80 A;  5FQI A;  4JLF A;  4GHI B;  5EFW A;  5L2F A;  4PM6 A;  2JCH A;  3MZF A;  5DFY A;  2J3T C;  4PPR A;  3UN7 A;  4CPK A;  5HWV A;  1PWD A;  5EE8 A;  4UA9 A;  1TVF A;  4MBH A;  2Q0O A;  3UB7 A;  1XXM A;  2XFS A;  3Q1F A;  4S2J A;  2OV5 A;  1P97 A;  1HVB A;  3BW6 A;  3O87 A;  2FH5 A;  2J3T D;  1ZC2 A;  1LLB A;  1W63 Q;  3OPP A;  3T12 B;  2ZD8 A;  4B4Z A;  4QPR A;  2O0Y A;  1F2K A;  3F1N B;  3PBO A;  2OSU A;  3Q7Z A;  5FQK A;  4IUK A;  4BBU A;  2C5W B;  2EWV A;  1MWU A;  2WZZ A;  3VMA A;  4DE3 A;  1M6K A;  2BTF P;  3G2Z A;  5E2F A;  3OC2 A;  2NUP C;  5DTS A;  3QNB A;  4S2K A;  2G2U A;  1G6O A;  2FFF B;  3IBR A;  5EVL A;  3MXR A;  3CG5 A;  3CUE A;  1SZV A;  4YNR A;  2E8I A;  4EWF A;  5J4E A;  3MBZ A;  5AVE A;  1LT0 A;  4KQR A;  5AQB A;  4DJ3 A;  4BD1 A;  2P9V A;  1LL5 A;  3NIA A;  3HUO A;  4JXG A;  3W4P A;  3QHY A;  3V67 A;  1MY8 A;  3UE0 A;  1GHM A;  5CX7 A;  2ZM2 A;  3LR3 A;  3IH9 A;  3LO7 A;  2ZM0 A;  1TS6 A;  4WZ5 A;  4I3J A;  1VQQ A;  2ZQA A;  3KYZ A;  5HD5 A;  2K2N A;  3PR6 A;  1NXY A;  3ZYT A;  4Q8I A;  1DY6 A;  5AQA A;  3EEH A;  4ZAM A;  1VEU B;  3GVB A;  3JVU A;  2WUQ A;  1H3Q A;  2YKF A;  3BFD A;  4X56 A;  5EVE A;  5HPI A;  2PBD P;  4WZ5 C;  3UE6 A;  5IHV A;  4BWI A;  1ZG6 A;  3KSH A;  4M4X A;  3JYI A;  2BG1 A;  4S2L A;  3NOU C;  1K54 C;  1PZP A;  3N8L A;  3M6B A;  1ESI A;  4IBX A;  3BFF A;  5HDC A;  3RXW A;  1VM1 A;  3K3D A;  3UDF A;  4UA6 A;  1SKO A;  1ES3 A;  1WA9 A;  4P87 A;  2QWS A;  4OH0 A;  2E8J A;  1BTL A;  3NUL A;  3FC7 A;  5CEB A;  4HH2 A;  3A3F A;  4RX3 A;  4HP4 A;  3LR4 A;  3ZVW A;  3E4O A;  1IFQ A;  3UPP A;  1PZO A;  1T19 A;  4EU0 A;  3W2Z A;  2JHE A;  2QZ6 A;  3ZDJ A;  2GNX A;  3KO6 A;  4BBT A;  3O5Y A;  5K5B A;  5L10 A;  2R9X A;  4Y0U A;  4GNU A;  3MKE A;  1VET A;  2VGJ A;  2ZL1 B;  1ZG4 A;  2Y2K A;  5CGW A;  2EXA A;  4E3O A;  2K7S A;  2ZOH A;  2GX5 A;  4MCW A;  5DVA A;  1EW0 A;  5EEC A;  3NJA A;  3MZD A;  1LSV A;  4OQ0 A;  3LY4 A;  2PD8 A;  5TGF A;  2JN7 A;  4K08 A;  2BLS A;  3RFB A;  3IXD A;  4MNR A;  1TDG A;  2O99 A;  1YM1 A;  2ZMV A;  3VP2 A;  1PWG A;  2KX6 A;  1MBL A;  3EWK A;  1N9O A;  3VP4 A;  1S66 L;  3UDI A;  5J7E A;  4R3J A;  3BFG A;  3M6H A;  4D60 A;  5HDS A;  2O9C A;  1J9M A;  2PDR A;  3MJQ A;  1G5U A;  3IWQ A;  5F1G A;  4GW9 A;  3TG9 A;  2V2F F;  4DDY A;  4P6Z S;  1MWR A;  1HD8 A;  4KZ5 A;  1MC0 A;  2W3F A;  5CHU A;  1BUE A;  3Q7V A;  5HX9 A;  3M2J A;  4JXV A;  2QJ7 A;  3F1P A;  1I2W A;  2ZQ7 A;  4LCL A;  2WAF A;  4N1X A;  3PXP A;  5FAQ A;  1Q2P A;  4DKI A;  2QHK A;  4KQO A;  5A8B A;  1HLU P;  1K4F A;  4OPY A;  2J3W A;  4WEK A;  4NEE D;  3UE3 A;  3A3J A;  3IX8 A;  1YLT A;  5CTN A;  2V9A A;  1RP5 A;  2A2L A;  2Y8H A;  4NXG A;  2XGN A;  1W79 A;  2PYR A;  1RGZ A;  1SDE A;  3LR5 A;  2HV1 A;  4Y13 A;  3MXS A;  2V1Z A;  2Y55 A;  3MFX A;  2ACG A;  2XR0 A;  3LEZ A;  5FEG A;  5FDH A;  5HW3 A;  3K3C A;  2WAE A;  4B9O A;  3VP1 A;  2WGW A;  3LUQ A;  4WEJ A;  2IWD A;  4BL3 A;  5FI2 A;  2LB5 A;  4HEF A;  1I5Q A;  1V9Z A;  3OLO A;  2QKP A;  2JKF A;  4YOF A;  1KE4 A;  4I3A A;  2CMN A;  3VOY A;  4DMZ A;  2EX6 A;  1YAX A;  1PW8 A;  4UA7 A;  3OBF A;  4DRT A;  1HZO A;  3DTE A;  5FQM A;  5AQ7 A;  3QP6 A;  4BMW A;  3JPU A;  2R78 A;  3G32 A;  1K25 A;  5LBR A;  1PI4 A;  4R70 A;  4KG2 A;  5FQQ A;  3UME A;  2Y2Q A;  2XD1 A;  5EOO A;  4B88 A;  4R23 A;  1BYW A;  4P0M A;  4Q0H A;  3H7W A;  3WS0 A;  5A93 A;  4BLM A;  5G18 A;  2J8Y A;  2XD5 A;  2XK1 A;  3M2K A;  4WYY A;  4DE1 A;  4EW7 A;  4N9K A;  3PBQ A;  1W5D A;  5BOH A;  3R7W A;  5TJJ A;  3SS4 A;  4P6Z M;  4LRY C;  3O88 A;  3JVV A;  1OTA A;  1K56 D;  2P9V B;  3SS5 A;  4KZ8 A;  3VE4 A;  1OME A;  1KOU A;  1PNE A;  5HSQ A;  2VV8 A;  4QB8 A;  1CI8 A;  1O7E A;  4R6L A;  5L07 A;  2UWX A;  1YSQ A;  1WYC A;  3TE8 A;  4B93 A;  3OPL A;  1MZU A;  4FUW A;  3L9K A;  2W1R A;  3TW8 A;  1E3U A;  1K4E A;  1OTE A;  4HJ4 A;  1OTI A;  4NK3 A;  2JKR M;  4Q0J A;  4D2O A;  4II7 A;  4I38 A;  1DP6 A;  3HLF A;  4WZ4 A;  3AGF A;  2HP6 A;  3B3X A;  3UB5 P;  4LV3 A;  4CLC E;  4OVD A;  3FPV A;  2C6W B;  3QP8 A;  3DTK A;  4QU3 A;  4IBR A;  4X1L A;  2IA2 A;  1Y28 A;  4UQI M;  4H6J B;  1IYQ A;  1SDN A;  4GLQ A;  3CMZ A;  1GSV A;  2Y59 A;  2Q9M A;  2ZC3 B;  4CQH A;  5G4Y A;  2JKT I;  3P09 A;  3DW0 A;  3W8K A;  1F9I A;  4DE2 A;  3C4O A;  4NKP A;  4KZ9 A;  4KZ6 A;  3A3E A;  5GHZ A;  3N8R A;  4OKP A;  3B42 A;  5FDS A;  4GCZ A;  4CLC C;  2NUT C;  1OPX A;  1S4R A;  1MPL A;  1BZA A;  3S22 A;  1PYY A;  4FCF A;  2JE5 A;  4EBL A;  2OAQ 1;  2Y79 A;  5F1F A;  3HJK A;  4X55 A;  3C8C A;  4C6Y A;  2JBF A;  3A3I A;  3V50 A;  4LFU A;  1OTB A;  2Z6D A;  2V8C A;  2XRN A;  4ZJ1 A;  4R0Q A;  5A91 A;  2A24 A;  3VP3 A;  3UDX A;  3BLS A;  1BLS A;  4OQH A;  2PAV P;  2M7U A;  4PM9 A;  4R1G A;  5A92 A;  4HBU A;  2VV6 A;  2O9A A;  2M7V A;  2JKT M;  5FAS A;  1NWZ A;  2A24 B;  3UPO A;  4JF5 A;  3VOZ A;  4P85 A;  3NDG A;  3V39 A;  3IS2 B;  1CQA A;  3LI8 A;  4ME4 A;  3WS2 A;  4EXO A;  1ERO A;  4ARZ B;  4JF6 A;  5L09 A;  3S7Q A;  2L1M A;  3G6O A;  2W3E A;  5GLC A;  3MQQ A;  5KZH A;  2WK0 A;  4GDN A;  1YLJ A;  3G34 A;  5GHX A;  2XLN A;  5F68 A;  4KZ4 A;  3E2L A;  1ERQ A;  1ZKJ A;  1XFQ A;  3LY3 A;  4G3W A;  3C7V A;  4H8R A;  3SOI A;  3VOL A;  1BSG A;  3V5M A;  3TSG A;  1K57 C;  3PBR A;  3N4I A;  5L8M A;  3S1Y A;  4Y2F A;  3UE1 A;  1MXO A;  2PYP A;  5FAT A;  2A49 A;  4QY6 A;  4ZJ3 A;  3FG8 A;  1MWT A;  3C4P A;  4PAU A;  2WKE A;  1TD5 A;  2A3U A;  2HDU A;  1GCE A;  2WKQ A;  2M1C A;  4KG6 A;  4KUK A;  1Z09 A;  4DF6 A;  3EEA A;  1K54 A;  5AVF A;  2P04 A;  3IT9 A;  4HI4 A;  4KZ3 A;  4X25 A;  3LID A;  1BUL A;  2X02 A;  4WLA A;  3LIF A;  3IF6 A;  1FSY A;  4WMC A;  4X69 A;  3LGO A;  3UB6 A;  2ZC6 B;  3NOP C;  1L0F A;  3T50 A;  1P0Z A;  4XT2 B;  4FH4 A;  4OLG A;  1XJ3 A;  3LCE A;  4N1H A;  4EUV A;  2H0Y A;  2XF3 A;  3IWI A;  4M3K A;  5DJT A;  2PU4 A;  1XPB A;  2V20 A;  3W4O A;  1N9L A;  1NLZ A;  3RH8 B;  4OON A;  2VGL M;  4IVK A;  1EI5 A;  3IXH A;  4L9E A;  1H8Z A;  4XUX A;  4L0L A;  5FA7 A;  3AGE A;  4GOG A;  3HLE A;  3QP4 A;  1K6S A;  4RVA A;  3T4S A;  3UNW A;  3FZC A;  4F3L A;  4MN5 A;  3ZCZ A;  3CHW P;  1YLW A;  3HBR A;  4OOL A;  4R4R A;  3N8S A;  3QP2 A;  2ZOI A;  5EUA A;  2Y2N A;  2Y2M A;  4AFI A;  4B4X A;  3MMH A;  1K55 A;  1T1B A;  3HLD A;  1NYY A;  3CUE C;  5U47 A;  1KVM A;  3IWO A;  3D3O A;  4KQQ A;  1XP4 A;  2PBY A;  3NI9 A;  4N9L A;  1XGJ A;  3T1X A;  3GEC A;  2WGI A;  3HJI A;  3HUM A;  1SKF A;  3VFF A;  4GS9 A;  4I5S A;  1ZTU A;  2CC1 A;  4PM5 A;  1ZHH B;  3IXB A;  5EM0 A;  2HDR A;  2W27 A;  3MZE A;  1NZU A;  2Z2L B;  5KIZ A;  2WKH A;  3MS6 A;  1VEU A;  4FOF A;  2Y2L A;  1J3W A;  1IKI A;  5HAQ A;  1IYP A;  1KE3 A;  3ITA A;  1H8M A;  5DF9 A;  4ARZ A;  3DTM A;  2Y91 A;  3A0S A;  3C7U A;  1MKI A;  4JGQ A;  4YIN A;  1BT5 A;  1FCN A;  2B95 A;  1S1Z A;  4R4S A;  4GJ4 A;  2UV0 E;  3G4P A;  3K2N A;  4UHU A;  4IUH A;  3IBJ A;  2VA0 A;  1NZO A;  1X0O A;  1HTZ A;  4X53 A;  3RTY A;  4S2M A;  4PKY G;  2ZL1 A;  1KDW A;  5CGS A;  2XEP A;  1OTD A;  1FQG A;  1NYM A;  4UAA A;  4X1M A;  1K56 A;  3C38 A;  1K57 A;  3ZNY A;  3C5A A;  1F98 A;  2EFU A;  4S2N C;  3PAE A;  3U4L P;  2ZQ9 A;  2P08 A;  4JGP A;  4P6B A;  4BL2 A;  3EQU A;  4NXB A;  4RQ9 A;  5IS1 A;  5AQ9 A;  5FAP A;  3C30 A;  2XQZ A;  5DF8 A;  3IHA A;  1H8Y A;  3BY8 A;  3MXQ A;  3T4K A;  3LEQ A;  3DWK A;  4ETX A;  1Y4O A;  4S2N A;  3LIE A;  1SKO B;  1LHY A;  2XDM A;  3UB9 A;  1LL8 A;  2IWB A;  5HPF A;  3E4Q A;  1YLZ A;  4WMC D;  3GSG A;  3IXG A;  5DTK A;  2RCX A;  5GLD A;  2Y2G A; 
#chains in the Genus database with same CATH homology
 1GSV A;  1S4S A;  2O0Y A;  4QPR A;  5MC7 A;  3F1N B;  3PBO A;  4CQH A;  1S67 L;  2PD7 A;  4IUK A;  3D72 A;  2EWV A;  2JKT I;  5G4Y A;  4BBU A;  4O0P A;  1XJ6 A;  1F9I A;  3S7O A;  4WL9 A;  3S7N A;  2P7J A;  1F5M A;  1XFN A;  3F1O A;  1LSW A;  4NKP A;  4O8G A;  4ETZ A;  3OC2 A;  3EGD C;  2NUP C;  4Z1W A;  3B42 A;  2L4R A;  4BBV A;  4DJ2 A;  1G6O A;  3T4Q A;  4HNB A;  3IBR A;  4LLO B;  4GCZ A;  3P01 A;  4CLC C;  2NUT C;  3CUE A;  1OPX A;  4YNR A;  1S4R A;  2HJE A;  1S1Y A;  5J4E A;  3DBA A;  1NRJ A;  1W63 M;  5AVE A;  1LT0 A;  3PYP A;  2Z6C A;  4DJ3 A;  2OAQ 1;  2Y79 A;  3HJK A;  3C8C A;  1XJ4 A;  3T4T A;  4HQA A;  3V67 A;  1N9N A;  5TBM A;  1OTB A;  5CX7 A;  3NOT C;  3LR3 A;  2W3H A;  4MN6 A;  3LIC A;  2Z6D A;  1JNU A;  4I3I A;  4O01 A;  1TS6 A;  2XRN A;  4I3J A;  3KYZ A;  1OT6 A;  4Q0I A;  5HD5 A;  2K2N A;  3PR6 A;  1T1C A;  5I5L A;  2A24 A;  3ZYT A;  4L9F A;  3S7P A;  3OCN A;  4F3L B;  2M7U A;  3EEH A;  2EWW A;  3PBS A;  3JVU A;  1TS0 A;  1H3Q A;  2VV6 A;  3F1O B;  2O9A A;  3ULF A;  3P7N A;  2YKF A;  2M7V A;  5IT5 A;  2JKT M;  1UWN X;  4LPZ A;  2OWJ A;  1NWZ A;  2A24 B;  1GSW A;  5HPI A;  1STZ A;  5HL6 A;  3UE6 A;  4BWI A;  4I39 A;  3KSH A;  1YKD A;  4M4X A;  3IS2 B;  3ICY A;  3LYX A;  2QYB A;  3NOU C;  3LI8 A;  4E04 A;  5TBM B;  2D02 A;  2DMW A;  4ME4 A;  4EXO A;  3KYQ A;  4Y3I A;  3CWF A;  2L0W A;  3MR0 A;  3LIB A;  4ARZ B;  3S7Q A;  2L1M A;  1OJG A;  5HDC A;  4FSF A;  3UB8 A;  3G6O A;  3BY9 A;  3K3D A;  2W3E A;  3MQ0 A;  3LIA A;  3MQQ A;  2PR6 A;  5F69 A;  5F68 A;  3H9W A;  5J3W A;  4MN7 A;  4WF0 A;  2K31 A;  3R7W B;  2XRO A;  1WA9 A;  1XFQ A;  2QWS A;  4G3W A;  3VOL A;  4HJ3 A;  3BQA A;  3OOV A;  3FC7 A;  5HD3 A;  3PBR A;  4HH2 A;  5L8M A;  4HP4 A;  3LR4 A;  4Y2F A;  2XSS A;  2QJ5 A;  3EOI A;  2PYP A;  3E4O A;  1IFQ A;  2PHY A;  2W1T A;  1T19 A;  4HY8 A;  4EU0 A;  3ZQ5 A;  4HHD A;  3W2Z A;  2JHE A;  3FG8 A;  3MF0 A;  4KQD A;  3F1P B;  2GNX A;  2EA9 A;  3KO6 A;  4BBT A;  2INW A;  4EQ1 A;  3O5Y A;  5K5B A;  3B33 A;  4PAU A;  1TD5 A;  4H6J A;  4Y5F A;  2OAP 1;  2WKQ A;  2M1C A;  2VLG A;  4KUK A;  1MKM A;  2W3D A;  5F6A A;  3EEA A;  5AVF A;  2P04 A;  4HI4 A;  1DP9 A;  4CLC D;  2K7S A;  4EEP A;  5HZH A;  1UGU A;  3LID A;  2W1T B;  2O9B A;  1TS8 A;  2ZOH A;  1P9W A;  2V1B A;  4WLA A;  3LIF A;  4XT2 A;  2GX5 A;  1OT9 A;  2XA7 S;  4MCW A;  4WUJ A;  1EW0 A;  3NJA A;  1LSV A;  4NXF A;  2KLI A;  3UB6 A;  2PD8 A;  2FZ0 A;  3NHQ A;  3NOP C;  2JN7 A;  3T50 A;  4K08 A;  1TF1 A;  3E4P A;  3RFB A;  2VEA A;  5FL3 A;  3TRC A;  1P0Z A;  4XT2 B;  3T4O A;  4MMN A;  2O99 A;  1XJ3 A;  2KOI A;  2VKS A;  3H82 B;  2ZMV A;  4EUV A;  4IJG A;  4HP9 A;  3LFV A;  3VV4 A;  2KX6 A;  3KSG A;  3EWK A;  5KSH A;  1N9O A;  1S66 L;  5DJT A;  3VE3 A;  5J7E A;  4GHI A;  3TJZ C;  2PR5 A;  5HDS A;  2O9C A;  4HJ6 A;  2PDR A;  3MJQ A;  3UMD A;  1DP8 A;  1N9L A;  4JGO A;  2V0U A;  1NLZ A;  3E0Y A;  3RH8 B;  3EGX C;  2VGL M;  4GW9 A;  3IS2 A;  4P6Z S;  3PBN A;  5DJU A;  1MC0 A;  2W3F A;  4L9E A;  1T18 A;  5AJG A;  2QJ7 A;  2V1A A;  3F1P A;  4L0L A;  4HIA A;  3LR0 A;  3CIT A;  4EER A;  3PXP A;  3BWL A;  2QHK A;  3T4S A;  4PKY A;  1TS7 A;  4KQO A;  5A8B A;  4F3L A;  2HJ9 C;  4MN5 A;  3OCL A;  2J3W A;  4CLC B;  4WEK A;  3LI9 A;  4NEE D;  3UE3 A;  2MJ6 A;  2PT7 A;  4OOL A;  2I9V A;  2ZOI A;  2W0N A;  1LSX A;  2OOL A;  4YWZ A;  4G3K A;  2V9A A;  4AFI A;  2A2L A;  2Y8H A;  3MMH A;  4NXG A;  1T1B A;  2PYR A;  1UWP X;  4CLC A;  3CUE C;  4DN0 A;  3LR5 A;  2HV1 A;  2WKR A;  1V9Y A;  3MFX A;  3D3O A;  2GZA A;  2VV7 A;  2JKR I;  2OWH A;  5F5Y A;  1XJ2 A;  1ODV A;  3GEC A;  2LB9 A;  3HJI A;  4LRX C;  3K3C A;  4GS9 A;  4B9O A;  2KDK A;  4I5S A;  3KSI A;  4IHQ A;  1ZTU A;  4EET B;  3LUQ A;  4WEJ A;  3GDI A;  5DKL A;  5HWW A;  2ZBB A;  1ZHH B;  2ZMF A;  3KX0 X;  2LB5 A;  3R4K A;  3CLO A;  2HGV A;  2W27 A;  1VB6 A;  4L9G A;  1V9Z A;  3OLO A;  2QKP A;  5KIZ A;  3CAX A;  1GSX A;  4EES A;  2XA7 M;  2YKH A;  4YOF A;  4FOF A;  4I3A A;  1T1A A;  2CMN A;  1P9R A;  2H28 A;  4DMZ A;  3T4J A;  1YAX A;  3C2W A;  3F1N A;  3OBF A;  3PBT A;  2VJW A;  4LRZ E;  4BMW A;  1H8M A;  5DF9 A;  1OJ5 A;  4ARZ A;  3A0V A;  2R78 A;  4GS9 B;  3A0S A;  3FPW A;  4R38 A;  5LBR A;  2G7U A;  4JGQ A;  4R70 A;  3U2A A;  3B47 A;  3T4L A;  4KUO A;  3UME A;  2WKP A;  4R3A A;  3PHY A;  5G4Z A;  1D06 A;  1S1Z A;  4GJ4 A;  1BYW A;  4Q0H A;  3H7W A;  3H7W B;  3K2N A;  5DKK A;  4IUH A;  3IBJ A;  2VA0 A;  4OOM A;  4HH3 A;  1X0O A;  4NXE A;  4EW7 A;  3SW1 A;  3RTY A;  3PBQ A;  3MQO A;  4WN5 A;  2B18 A;  4PKY G;  3R7W A;  5DFX A;  5TJJ A;  5HWT A;  1OTD A;  4P6Z M;  3BQ8 A;  2VGL S;  4LRY C;  3JVV A;  4JGR A;  4UEY A;  3C38 A;  5C5K A;  1OTA A;  1F98 A;  4HOI A;  3VE4 A;  1KOU A;  2HF6 A;  3CI6 A;  1YSP A;  2P08 A;  1VHM A;  5HSQ A;  2VV8 A;  4JGP A;  3BJN A;  3H82 A;  3HCY A;  1G28 A;  4R6L A;  3EQV A;  1IOU A;  2V0W A;  4PHT A;  3EQU A;  3KSF A;  4NXB A;  1YSQ A;  4RQ9 A;  3TE8 A;  4B93 A;  5IS1 A;  1MZU A;  4G3V A;  2D01 A;  3C30 A;  2W1R A;  4MDZ A;  3TW8 A;  4BJP A;  2VX8 A;  1OTE A;  4HJ4 A;  1OTI A;  2J80 A;  5IU1 A;  2JKR M;  2W3G A;  3BY8 A;  3MXQ A;  4Q0J A;  3T4K A;  5EFW A;  3A0R A;  4GHI B;  4II7 A;  4ETX A;  3LIE A;  4I38 A;  1DRM A;  1DP6 A;  5DFY A;  2J3T C;  3UB9 A;  1LL8 A;  5HPF A;  2BAS A;  2GJ3 A;  5HWV A;  4WEL A;  4CLC E;  3FPV A;  3E4Q A;  5HDD A;  3UB7 A;  2B02 A;  4UQI S;  1P97 A;  4EEU A;  2IA2 A;  1Y28 A;  3BW6 A;  1D7E A;  2FH5 A;  2J3T D;  3E98 A;  4UQI M;  4H6J B;  4ZRR A;  1NLY A;  2VZW A;  1W63 Q;  4GLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...