4WLAA

Time resolved serial femtosecond crystallography captures high resolution intermediates of pyp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Time-resolved serial crystallography captures high-resolution intermediates of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wlaA00
3A0RA 3H82B 2INWA 2M1CA 4EQ1A 3MXQA 3IS2B 2W27A 3D72A 4WUJA 2GJ3A 1TS8A 1OT9A 4I3AA 3EWKA 5HZHA 3UE6A 3UMDA 1NWZA 3EEHA 2PYRA 2I9VA 4HI4A 5HWWA 4LRZE 1T1CA 3NOPC 4JGPA 5AVFA 5TBMB 4XT2A 3G6OA 3LIEA 1XJ3A 4KQDA 4GHIA 1KOUA 5HDCA 4EW7A 4DJ2A 1XFNA 5G4YA 4JGQA 3LIDA 3MQOA 2V1AA 1XFQA 5IU1A 4I3IA 5HWVA 1UGUA 4BBTA 3A0SA 2KDKA 4KUOA 3F1PA 1OJGA 3F1NB 4GHIB 2QJ5A 2CMNA 1TS6A 2L4RA 2H28A 4GS9A 5HD5A 5F6AA 4I38A 1TS0A 5F5YA 5I5LA 1UWNX 3NOTC 3NOUC 1DP9A 4WLAA 4BBUA 3F1PB 4DJ3A 4HNBA 4NXFA 1OTDA 4LLOB 3H82A 4NXGA 4EXOA 1EW0A 4GS9B 3LYXA 3IS2A 4L9GA 5AVEA 4EEPA 3NHQA 4LPZA 3VE4A 2WKRA 2VV6A 1F9IA 2OOLA 5DJUA 3HJKA 4GW9A 2HV1A 4LRYC 2K7SA 2J80A 3LICA 1BYWA 4WL9A 5HDDA 1LL8A 2D01A 5TBMA 2V0WA 3RTYA 1T1BA 1XJ2A 4HH3A 4H6JB 4HHDA 3BWLA 4LRXC 1OTIA 4L9FA 2V1BA 1DP6A 1N9NA 1V9YA 5J4EA 4EESA 2VV7A 5A8BA 1T1AA 4HIAA 4B9OA 2KX6A 2V0UA 1Y28A 1OTBA 4HY8A 1DP8A 3F1NA 5DJTA 1LSVA 3LI9A 3PYPA 5F69A 3P7NA 1LSXA 3HJIA 4HQAA 3UB9A 5J7EA 3MQQA 5HSQA 1V9ZA 1WA9A 2QHKA 1OT6A 3CLOA 3LIAA 3ULFA 3FG8A 1X0OA 1GSWA 4R70A 3BY9A 3UMEA 1F98A 1P97A 5EFWA 1VB6A 3GECA 2EA9A 2ZOHA 1S4RA 1S1YA 3C8CA 4HJ6A 4R6LA 1LT0A 3ZQ5A 4WN5A 4HJ3A 1GSVA 3MJQA 4PKYA 1DRMA 4I39A 2QWSA 3F1OB 4HH2A 3ICYA 2V9AA 4L9EA 5HWTA 4H6JA 1D7EA 2A24B 2WKQA 1OTEA 3C2WA 3PHYA 2PR5A 3KX0X 2VV8A 1T18A 5HDSA 3UB6A 2VLGA 1OTAA 4NXBA 3E4PA 2D02A 2P7JA 5DKLA 2PDRA 3H7WB 3LI8A 1T19A 1XJ6A 2L0WA 4PKYG 1GSXA 2OWJA 3SW1A 1ODVA 4KUKA 4JGRA 3A0VA 3LIBA 1S67L 1UWPX 5J3WA 2PR6A 3CAXA 4YWZA 1TS7A 3MFXA 4GCZA 3FC7A 4MN6A 1G28A 2ZBBA 3UB8A 4NXEA 2Z6CA 1P0ZA 4HJ4A 2JN7A 4F3LB 4E04A 2ZOIA 3MR0A 5F68A 2PHYA 1S1ZA 2JHEA 1XJ4A 1S4SA 1S66L 3LIFA 4HOIA 4MN5A 1OJ5A 2Z6DA 3BY8A 5KIZA 2B02A 3F1OA 3NJAA 2A24A 3CWFA 2OWHA 2WKPA 4BBVA 2VEAA 4JGOA 4XT2B 4I5SA 3GDIA 4RQ9A 2BASA 1N9LA 4EERA 1JNUA 3H9WA 3H7WA 3OLOA 2QKPA 3VE3A 2QJ7A 4R3AA 3B33A 4K08A 2W0NA 5HD3A 3K3CA 4EEUA 2YKFA 2R78A 1D06A 4M4XA 3IBRA 2PD7A 3RH8B 5DKKA 3E4QA 4EETB 4I3JA 1N9OA 4HP9A 1LSWA 3LUQA 3K3DA 4R38A 2L1MA 4HP4A 4F3LA 2PYPA 2PD8A 3E4OA 5IS1A 2YKHA 3UB7A 1MZUA 5G4ZA 3VOLA 4WF0A 3T50A
chains in the Genus database with same CATH superfamily
3ZNTA 1P9WA 4PMAA 3IWIA 1KGFA 3IS2B 2W27A 2GJ3A 1TS8A 5MC7A 3U2AA 3FV7A 2M7UA 5HZHA 2Y2QA 4OQIA 1GHPA 3MF0A 4HI4A 1K55A 5HWWA 4LRZE 1K25A 4JGPA 5AVFA 3CHWP 5TBMB 1XJ3A 4K0XA 3UO9A 2DCFA 3PTEA 1W63Q 4ZDXA 3AGDA 5AJGA 2WGVA 2IA2A 4EW7A 1D1JA 5HDCA 5CHUA 1KVLA 1XGJA 4RA7A 1A0KA 2WAFA 2Y55A 3LIDA 3T4TA 5DF9A 3MQOA 4GNUA 1BTLA 1KDSA 3FPWA 1H8YA 1CEGA 4DE2A 4ARZA 4BBTA 3IXHA 5AQBA 4RX2A 4OOYA 4JF6A 4E3MA 3PXPA 4DXBA 2P04A 2H28A 1RP5A 3MFDA 4UA6A 4ZRRA 3N4IA 3C4OA 4ZBEA 4Y7PA 1W79A 4WLAA 4BBUA 3CUEC 1MPLA 4E3JA 4A5RA 2Y79A 4NXFA 4NXGA 1IYSA 1K6SA 3LYXA 4L9GA 5DTSA 1CJFA 5EV0A 4P6BA 5CTNA 2Y2PA 4JXVA 5A92A 4LPZA 3VE4A 4Q0JA 2OOLA 3W4QA 4KZ3A 4WZ5C 3HJKA 1G68A 4GW9A 1YLPA 3BFEA 2J80A 5M18A 1BYWA 3UPOA 3SZTA 5HFOA 1G5UA 1T1BA 2HDSA 2W3EA 3IWQA 4H6JB 4HHDA 3IHBA 1AXBA 2V1BA 3RFBA 1MY8A 2O99A 4EU0A 1V9YA 3E2KA 3QP6A 3HLBA 2J9PA 3N7WA 1SHVA 3PAEA 3MXRA 3VFFA 4EV4A 1SCWA 1OTBA 4K0WA 3EEAA 5CX7A 2A3UA 3VP3A 2PBDP 4DE3A 3C30A 1LSXA 1PZPA 3OZHA 3MQQA 1XA1A 1V9ZA 1OT6A 4OLGA 1X0OA 1GSWA 2XDMA 2OV5A 4EBLA 4BL2A 3G35A 3TSGA 3UPNA 3W8KA 4E3OA 4FD8A 1ERQA 5FI7A 4WMCA 2FFYA 3LR5A 1DY6A 2WKHA 4GJ4A 2ZM0A 4BD0A 4FTXA 3VSLA 3DW0A 3BEBA 5TFQA 2JCHA 1SZVA 3VOYA 2IWCA 4Y0UA 3OPPA 1PW8A 2ZD8A 4N92A 1NY0A 1W8YA 2WADA 3DWKA 2VGLS 4QU3A 4JXSA 3F1OB 4Y0OA 3ICYA 3ZDJA 2Y2GA 3L9KA 2A24B 3ZGAB 1Y54A 2JKGA 3C2WA 2PAVP 4Q0HA 1W8QA 5TJJA 3P09A 4LCMA 5D3OA 3KX0X 4LGWA 4N9KA 1T18A 3V5MA 1K57C 1FCOA 3OC2A 2VGJA 3D3OA 3I7JA 4KQOA 4C75A 1W7FA 4MLLA 3CI6A 2B18A 4NEED 1K4EA 2K31A 2HDUA 1L2SA 2PDRA 1O07A 2JE5A 3H7WB 3LI8A 2ZLYA 4GB7A 1MC0A 1K6RA 1CI8A 2L0WA 1P9RA 3A3EA 3G2ZA 2V8FA 1IOUA 2BLSA 4YNRA 4IUKA 5I94A 3VFHA 1UWPX 4HEFA 3WWXA 4ESPA 5EM0A 1CEFA 2E8IA 3MKEA 4E3IA 2VGKA 3T4OA 4KG5A 2M7VA 2JKTM 2WYXA 1CF0A 5FSRA 3R7WA 5F1FA 3UB8A 4P6ZS 4HJ4A 2G2WA 3LGOA 4E04A 3V3RA 3MR0A 4UQIM 3T1SA 2MJ6A 3Q7VA 2W3FA 3SS5A 1I5QA 1I2WA 2JHEA 3HREA 2Q0OA 3CPTA 3LIFA 2HF6A 3G32A 3BRMA 4HBUA 1RGYA 1ZKJA 1Q2QA 1OJ5A 5L8MA 4IUHA 3ZG7B 3ZNYA 1JVJA 5EVIB 2OSUA 4E6WA 1ZTUA 3BLSA 2EX9A 5A93A 2W1TA 5AQAA 3ZVTA 2VEAA 4JGOA 4GD8A 1BULA 2J3TC 2C5WB 2JKRI 3UE1A 4KQQA 1AWIA 5EUAA 4PAUA 5EOEA 3VMAA 1WYCA 3IF6B 1E3UA 1JNUA 1GA0A 4KZ6A 3WRTA 2GZAA 1H0MA 5IHVA 4PM6A 3W4PA 2Y2HA 1SKFA 2QKPA 3VE3A 4WMCD 2XEPA 3U4LP 2ZQ7A 3B33A 3FZCA 4R3JA 2E8JA 4OQGA 3WRZA 4XXRA 1YLZA 1XPBA 4C6YA 3K3CA 3S4XA 2YKFA 4LV2A 2W3HA 5GLCA 4EQIA 4DMZA 5IT5A 4OP5A 4OPQA 1LL5A 3TW8A 1D06A 4X1MA 5LBRA 2XQZA 4EETB 3L7HA 1N9OA 2JKRM 3BLMA 2XR0A 1NYMA 3OPLA 4Y2FA 4S2PA 1ES4A 4Y3IA 2PD8A 2YKHA 3FWLA 3UB7A 4WF0A 2OAQ1 1JWPA 3A0RA 5EPHA 5HAIA 2INWA 2M1CA 3MXQA 2FH5A 4OKPA 3Q1FA 4DKIA 5FQIA 1OT9A 2DNSA 5E2FA 3UMDA 4U0TA 1DJCA 4CJNA 2PYRA 2A2LA 4X53A 2I9VA 5FDHA 4KZBA 1YLTA 2IWBA 3Q07A 5CHMA 3UN7A 1DJBA 2QZ6A 3OOVA 4XT2A 5L07A 1XKZA 4KQDA 3N8LA 4UAAA 4RYEA 3T4JA 4DJ2A 3O88A 2HPBA 5G18A 1BLSA 2ZQ8A 4O7DA 5G4YA 1IEMA 4KZAA 4D2OA 4NK3A 2V1AA 3VOZA 3PBSA 3VP2A 4CLCB 3Q7ZA 2Y2JA 5HWVA 1K54C 3T1RA 3A0SA 5HARA 4BWIA 5FQ9A 5CEBA 2J7VA 3HLCA 2ZM8A 4PM8A 2UV0E 5EVIC 2QPNA 1S0WA 2XD1A 1TS6A 2L4RA 1JTDA 4UA7A 5HD5A 4I38A 1GHIA 4LFUA 1KE3A 5F5YA 1EROA 2J9OA 4BENA 3MKFA 4QD4A 3NOTC 2HDQA 1YPRA 3IF6C 1MXOA 3BW6A 1E25A 3KYZA 2PRFA 2PU4A 3H82A 4LLOB 4L0LA 1TVFA 3HLFA 1VQQA 4HBTA 4X56A 1ZC2A 4FUWA 3WS2A 1VETB 4IBXA 3NHQA 1C3BA 2VV6A 4WELA 4X1LA 3NBLA 4WM9A 2J3WA 2O9BA 1NZUA 2ACGA 3LICA 5HDDA 4EUVA 1LL8A 2D01A 1VEUA 1WE4A 2I72A 1DJAA 2V0WA 1XJ2A 5F1GA 5FQMA 1YQSA 1STZA 5CGSA 3KYQA 1FILA 3BWLA 2C6WB 1DP6A 5K5BA 2O0YA 4CQHA 3MBZA 5J4EA 1BT5A 2VV7A 4PM7A 5A8BA 4HIAA 4B9OA 3ZG8B 2XH9A 2HDRA 4OOLA 1TD5A 2V0UA 4JF5A 4S2MA 5GHYA 3F1NA 3ITBA 3PYPA 5F69A 3HJIA 2P74A 4GZBA 5J7EA 2EX8A 4X69A 3LO7A 2WAEA 3FG8A 1Z6FA 4P0MA 2ZQCA 4UHUA 3T4KA 5L09A 1Y4OA 5E2HA 4DDYA 2ZOHA 3BJNA 3M2JA 1GHMA 2Q9MA 2PU2A 5FQJA 3MZDA 4HJ6A 4CLCC 1VHMA 4H8RA 2OAP1 5FDSA 4LV3A 1GSVA 4XUXA 3MJQA 2K2NA 3B3XA 4S2NA 3TE8A 5HAQA 2H0TA 3K2NA 1DRMA 1W63M 2QWSA 2BG1A 2X71A 4HH2A 2V9AA 3UDXA 5DFXA 1YLJA 2WKQA 4BQMA 3QP1A 3PHYA 2VV8A 4O01A 2EFUA 5HDSA 3LCEA 3D4FA 2VLGA 3UB6A 1OTAA 2V1ZA 4P87A 5F83A 1PI5A 1IYOA 3E4PA 4N1XA 4P85A 1ALQA 1OMEA 2WK0A 4YFMA 3HUNA 2VJWA 5TR7A 4ETXA 2V2FF 3CMZA 4PKYG 1GSXA 4E3NA 2QYBA 3SW1A 5DTTA 5F82A 4MEZA 1YMSA 4JGRA 2W3DA 3WS0A 4GKUA 5J3WA 3C7VA 3B47A 4Z9QA 1H3QA 3B42A 3CAXA 2O9AA 4OPYA 1LL9A 3FYZA 3T12B 3BQAA 2V8CA 3N8RA 3GQZA 4GCZA 1HTZA 4FH2A 3FC7A 3ZFZA 4NXEA 3CJMA 1E4DA 4II7A 1M6KA 2EWVA 3IH8A 5F68A 4Y5FA 1S1ZA 3E0YA 3RXXA 2RCXA 3ZHHA 3T4QA 4U0XA 5KSHA 3NC8A 2HJ9C 2WKEA 3NIAA 1GA9A 3C38A 2Y91A 1G6OA 2Y2KA 4HESA 4IVKA 1KGGA 2XF3A 1H8MA 2BTFP 3JVUA 4ZJ1A 4IEDA 3T1QB 5GL9A 1CI9A 3PBNA 4FOFA 5GLAA 4WEKA 4FCFA 4ME4A 1BLCA 2BASA 3EQUA 2XFSA 1LI0A 3PAGA 2CC1A 4D60A 2AVXA 3ZG0A 2Y2NA 4E3LA 3DTIA 2HP6A 2Y2OA 2XLNA 3IX8A 3WS1A 1PWDA 4ARZB 4R3AA 1FR6A 4K08A 1GCEA 4OOMA 5FAQA 4MBKA 1KE4A 4GDNA 4MN7A 3JPUA 4EEUA 5A91A 3GSGA 3IHAA 4IVIA 2PD7A 3RH8B 5DKKA 1IYQA 4I3JA 4BMWA 4Q0IA 5FA7A 1QMEA 4QY6A 2DRWA 2FFFB 3K3DA 1N9BA 2ZQDA 1FCNA 4HP4A 4F3LA 2PYPA 3E4OA 5CGXA 3Q81A 3C7UA 3T50A 5DVAA 3MQ0A 4EQ1A 1PW1A 3G31A 4DXCA 3O5YA 3UE3A 1MWTA 1BLHA 3MMHA 5A90A 3UE6A 3NECA 1NWZA 2ZQAA 3DAVA 4X55A 4OVDA 4CLCA 4ETZA 3NOPC 2WZZA 4LCLA 1NJ4A 3LIEA 3LEZA 3IBJA 1WYBA 2XA7M 2XD5A 1MWUA 1EI5A 3AGFA 5EVLA 3IT9A 1SKOA 5GLBA 1KOUA 3SH8A 4IJGA 1IFQA 1XFNA 4MCWA 3HL9A 3CUEA 4JGQA 3WS4A 1YLYA 3NDEA 3EGDC 4N9LA 4NETA 1XFQA 2WGWA 5IU1A 4GLQA 5L10A 4R23A 1RCJA 1UGUA 5CERA 2ZMAA 1NLZA 2GDNA 5EVID 5JYOA 3TG9A 3ITAA 4GHIB 1NRJA 4WZ5A 5HL1A 1XX2A 2QJ5A 4PPRA 2CMNA 1K55C 3UDFA 2GNXA 4ID4A 4OQHA 3BECA 5F6AA 3TRCA 4OH0A 4B93A 1TS0A 1L0EA 1UWNX 4UQIS 5CGWA 3NOUC 4AFIA 4GOGA 2LB9A 3DTEA 5FAPA 1YMXA 1MKMA 5FI2A 3FKVA 3F1PB 4DJ3A 3MZEA 2JKFA 4DN0A 1OTDA 2G7UA 2PBYA 4EXOA 4NG2A 1EW0A 2VZWA 4GS9B 4PM5A 3O86A 3IS2A 2EX6A 2ZC5B 4EEPA 5M1AA 5CEDA 3UE0A 2WKRA 1TEMA 2OLVA 1F9IA 3ZYTA 1CQAA 2G2UA 2K7SA 4ZAMA 1JWVA 3KYEA 5EECA 5TBMA 3QNBA 3QP8A 2H10A 4HH3A 5DFYA 3NDGA 3MS6A 5HAPA 3CG5A 3KSIA 4LRXC 1OTIA 4L9FA 1YKDA 2B95A 3JVVA 1N9NA 1H8ZA 1KDWA 4EESA 1T1AA 3LY3A 1IKGA 1PNEA 1PYYA 2NUPC 2J8YA 2KX6A 2P9VB 4ZJ3A 3BFGA 1KE0A 2W3GA 3DTKA 3PBTA 4GN2A 1DP8A 5DJTA 3GRJA 3KSHA 2JC7A 1BUEA 4HQAA 3UB9A 3ZG5A 3VP4A 3OCLA 3O3VA 2QHKA 4UEYA 3CLOA 2WUQA 3LIAA 2ZC3B 3IH9A 4R70A 2H0YA 1PWGA 3SS3A 2VA0A 3BY9A 4Q8IA 4BL3A 2VX8A 2ZC7A 5EFWA 1VB6A 3CZDA 2NUTC 4LENA 2R9XA 2EA9A 3IXDA 1K57A 1S4RA 4YOFA 4CLCD 3R7WB 4XUZA 5M19A 3C8CA 1LT0A 1JWZA 1ES5A 1CK3A 1ESIA 3Q7VB 4WN5A 4G3WA 3VSKA 3WS5A 1J9MA 3CPTB 2Z2LB 4IHQA 2XFTA 2PT7A 1L3LA 3HLGA 3EQVA 2EXAA 1XP4A 3QP4A 3FPVA 5DF8A 3FKWA 3S7PA 4L9EA 4M3KA 4H6JA 5HWTA 1F5MA 1N4OA 1OTEA 4KZ8A 1FCMA 4S2LA 1L0GA 1KGEA 4OONA 2PR5A 3S7NA 4KG6A 5FI6A 3IX4A 4WBGA 4RX3A 4QPRA 1YAXA 2D02A 4S2IA 2P7JA 5EOOA 3A3IA 1T19A 4WEJA 1XJ6A 2OWJA 3BYDA 1ODVA 4KUKA 4LV0A 3LIBA 1S67L 3SH9A 1ERMA 2Y59A 2ZM2A 2O9CA 4JF4A 1KVMA 1PFLA 3HUMA 3IQAA 3V50A 1MBLA 1BLPA 3M6HA 4MN6A 1G28A 5FATA 2Z6CA 1P0ZA 2JN7A 5KMWA 1ACFA 3RJUA 3T4SA 2KOIA 3UY6A 2PHYA 1OPXA 5AQ7A 2WGIA 3BFFA 5FQQA 3IXGA 1XXMA 1XJ4A 4HOIA 3N6IA 2EWWA 2EX2A 3G4PA 2XROA 3BY8A 1HD8A 2B02A 4NKPA 3F1OA 4MBHA 4K91A 3D9YA 2V20A 1ES2A 3NJAA 5DTKA 5FL3A 2A24A 5EVEA 2A49A 1FIKA 3GTCA 4XT2B 3Q82A 1MKIA 3GDIA 2XK1A 2ZQ9A 4RQ9A 3KSGA 3UB5P 1NRFA 3PR6A 3M2KA 5HPFA 1I2SA 3N8SA 2HP5A 3S7QA 2X01A 4DDSA 4CLCE 3OBFA 5U47A 4Y15A 3V39A 4DF6A 2R9WA 3H7WA 4KZ9A 3OLOA 3DTMA 3LFVA 5CHJA 2QJ7A 2W0NA 4OLDA 1ONHA 1FSYA 4GDBA 3S7OA 3C5AA 1IELA 2P08A 2R78A 3TOIA 4Y13A 3HUOA 4M4XA 3IBRA 4KZ5A 3E4QA 5CTMA 4B4XA 1ZG6A 4HP9A 3TJZC 1U60A 1LSWA 3LUQA 3OCNA 3LR0A 4R38A 1L0FA 2L1MA 1M40A 3ISGA 1QMFA 3S1YA 4OPRA 5G4ZA 2OLUA 5CRFA 4X68A 1FSWA 5J8XA 4F94A 4BD1A 1LHYA 3H82B 2ZL1B 2Y2LA 1K54A 5FQKA 5TGFA 2DMWA 3D72A 4QHCA 4WUJA 3DWZA 1W5DA 4I3AA 3UPPA 3EWKA 4FH4A 5FEGA 4R0QA 1HLUP 3EEHA 3A3DA 5EVIA 2LB5A 1XGIA 4WZ4A 3GV9A 4QWOA 5GHXA 1MWRA 3BQ8A 1T1CA 4Y0TA 1VEUB 2HZ5A 3G6OA 4RVAA 3C4PA 3T4LA 3G30A 1YT4A 3JYIA 5E2EA 2VGLM 3G34A 4GHIA 3EOIA 4YINA 4G3KA 4WYYA 4C3QA 3IF6A 3IWOA 4JLFA 3ZCZA 5DF7A 1ZG4A 1PZOA 4R4SA 5KSCA 3SOIA 1NZOA 4PHTA 2J3TD 4I3IA 1FR1A 2KDKA 3NI9A 2JBFA 1K4FA 4KUOA 3F1PA 4FSFA 1OJGA 3F1NB 1NXYA 1SDEA 4DE0A 3R4KA 1L0DA 4E6XA 3UDIA 4GS9A 1IYPA 1ESUA 4B4ZA 1NYYA 1G6AA 3KO6A 5I5LA 2Z2MB 5GLDA 1DP9A 5KZHA 1YSQA 5BOHA 1PI4A 4MNRA 3MZFA 1YSPA 4HNBA 2FZ0A 2VK3A 3HLEA 1K38A 3ZG9B 3LR4A 5HL6A 1BZAA 1EWZA 4P6ZM 5AVEA 2VKSA 4MBFA 4KENB 4QY5A 2JKTI 2UWXA 3A3FA 1JTGA 5DJUA 3PBOA 4JPMA 2HV1A 4LRYC 2XRNA 2QMIA 4DE1A 2B5RA 2GX5A 4WL9A 2P9VA 5HW3A 1SDNA 3BFDA 3RTYA 3IX3A 3CITA 3E98A 3M6BA 3MXSA 4EWFA 2Y2IA 3QP5A 4G3VA 3S22A 1PWCA 4KZ7A 3BFCA 1J3WA 3SH7A 4ZTKA 5L2FA 4S2OA 4EUZA 4OQ0A 1K56A 1Y28A 3LR3A 4QB8A 4HY8A 1LSVA 3LI9A 1Q2PA 4UA9A 3P7NA 3QHYA 2RL3A 3V67A 4DRTA 5HSQA 1WA9A 1XA7A 4OPZA 3A3JA 3ULFA 3AGEA 1MWSA 3NULA 4R1GA 3IF5A 4X25A 4S2JA 1F98A 4KZ4A 3UMEA 5HPIA 1P97A 3G2YA 3GECA 3O87A 5FEFA 1S1YA 2Q9NA 4R6LA 3ZQ5A 3QP2A 4N1HA 1VETA 4HJ3A 3P01A 3PBRA 4PKYA 4ZJ2A 2XA7S 4I39A 4MMNA 1TDGA 4Z1WA 3UNWA 1Z09A 3NCKA 4LV1A 3W4OA 1D7EA 1HVBA 2W1RA 4O0PA 4O8GA 1RGZA 5CXWA 2XGNA 4JXGA 2Y4AA 3T1XA 3PBQA 2ZMVA 5C5KA 2H5SA 3HCYA 3HLDA 1LLBA 1FQGA 4NXBA 4EBPA 4OP8A 3VP1A 5DKLA 1FOFA 1NLYA 1LI9A 4JBFA 2HJEA 1YM1A 4S2NC 4X6TA 1TF1A 1YLWA 4KQRA 3A0VA 4PM9A 5AQ9A 5FASA 3LY4A 3ZVWA 4GD6A 2WZXA 1BSGA 3GVBA 2PR6A 4JXWA 1VM1A 2ZMFA 4YWZA 1TS7A 3MFXA 3VV4A 4BJPA 1ONGA 5GHZA 2XSSA 2ZBBA 3IXBA 1PIOA 2ZC4B 4F3LB 2ZOIA 3OPRA 4QJGA 5HX9A 2EFXA 1S4SA 1S66L 4KG2A 1S6RA 4MN5A 2Z6DA 4S2KA 4U3TA 5KIZA 2HGVA 3BM6A 3NY4A 1TDLA 2X02A 2WKIA 4R3BA 1K56D 2EXBA 3CWFA 1O7EA 2OWHA 2WKPA 3RXWA 1HZOA 4BBVA 4BLMA 4JKTA 1ZHHB 4I5SA 4EBNA 3VP0A 1SKOB 2ZC6B 1H5XA 3HVFA 2ZJ9A 5EM1A 3KSFA 1N9LA 4EERA 3HLWA 3HBRA 5E43A 3LEQA 3H9WA 2HP9A 2WGWB 3MSHA 2IWDA 3GR2A 4MDZA 2W1TB 4IBRA 5EE8A 5E2GA 4Y17A 5HD3A 2Y2MA 3E2LA 5FAOA 1K0KA 4R4RA 3W2ZA 3OPHA 4E3KA 3DBAA 2ZL1A 5JYPA 3P98A 1IKIA 1F2KA 3GMWA 4B88A 2KLIA 1E3UD 3QNCA 5CECA 3V3SA 1ES3A 5IS1A 4CPKA 1MZUA 1PRQA 2Y8HA 3EGXC 3SS4A 3VOLA
chains in the Genus database with same CATH topology
3A0RA 1P9WA 3H82B 3MQ0A 2INWA 2M1CA 4EQ1A 3MXQA 2FH5A 3IS2B 3O5YA 2W27A 3UE3A 2DMWA 3D72A 4WUJA 2GJ3A 1TS8A 1OT9A 4I3AA 5MC7A 3U2AA 2M7UA 3EWKA 5HZHA 3MMHA 3UE6A 3UMDA 1NWZA 3EEHA 2PYRA 2A2LA 2I9VA 2LB5A 3MF0A 4HI4A 4CLCA 5HWWA 4ETZA 4LRZE 3BQ8A 1T1CA 3NOPC 4JGPA 3OOVA 5AVFA 5TBMB 4XT2A 3G6OA 3LIEA 1XJ3A 3IBJA 3T4LA 4KQDA 1W63Q 2VGLM 2XA7M 5AJGA 4GHIA 2IA2A 1KOUA 5HDCA 4EW7A 3T4JA 4IJGA 3EOIA 4DJ2A 1IFQA 1XFNA 4G3KA 4MCWA 5G4YA 3CUEA 4JGQA 3LIDA 3T4TA 5DF9A 3MQOA 2V1AA 3EGDC 3PBSA 1XFQA 4PHTA 3FPWA 5IU1A 4GLQA 4CLCB 4ARZA 2J3TD 4I3IA 5HWVA 1UGUA 4BBTA 3A0SA 2KDKA 4BWIA 1NLZA 4KUOA 3F1PA 4FSFA 1OJGA 3F1NB 4GHIB 1NRJA 3PXPA 2QJ5A 3R4KA 2CMNA 1TS6A 2L4RA 2H28A 2GNXA 2P04A 4GS9A 5HD5A 4ZRRA 5F6AA 4I38A 3TRCA 4B93A 1TS0A 3KO6A 5F5YA 5I5LA 1UWNX 4UQIS 3NOTC 3NOUC 1DP9A 4AFIA 2LB9A 4WLAA 1MKMA 4BBUA 1YSQA 3F1PB 3BW6A 3CUEC 4DJ3A 1YSPA 4HNBA 3KYZA 2Y79A 4DN0A 2FZ0A 4NXFA 2G7UA 1OTDA 3H82A 4LLOB 4NXGA 4L0LA 4EXOA 3LR4A 5HL6A 1EW0A 2VZWA 4GS9B 3LYXA 3IS2A 4L9GA 4P6ZM 5AVEA 2VKSA 4EEPA 3NHQA 4LPZA 3VE4A 2WKRA 2JKTI 2VV6A 4Q0JA 4WELA 1F9IA 2OOLA 5DJUA 3HJKA 3PBOA 3ZYTA 4GW9A 2HV1A 2J3WA 2O9BA 2XRNA 4LRYC 2K7SA 2J80A 3LICA 1BYWA 2GX5A 4WL9A 5HDDA 4EUVA 1LL8A 2D01A 5TBMA 2V0WA 3RTYA 1T1BA 1XJ2A 3CITA 3E98A 4HH3A 2W3EA 4H6JB 1STZA 4HHDA 3KYQA 5DFYA 3BWLA 3KSIA 4LRXC 1OTIA 4L9FA 2V1BA 1YKDA 3RFBA 1DP6A 5K5BA 2O0YA 3JVVA 4G3VA 2O99A 4CQHA 1N9NA 4EU0A 1V9YA 5J4EA 4EESA 2VV7A 5A8BA 1T1AA 4HIAA 4B9OA 2NUPC 2KX6A 4OOLA 1TD5A 2V0UA 1Y28A 3LR3A 1OTBA 4WF0A 2W3GA 4HY8A 3PBTA 3EEAA 5CX7A 1DP8A 3F1NA 5DJTA 1LSVA 3LI9A 3PYPA 3C30A 5F69A 3P7NA 1LSXA 3V67A 3KSHA 3HJIA 4HQAA 3UB9A 5J7EA 3OCLA 3MQQA 5HSQA 1V9ZA 1WA9A 2QHKA 4UEYA 1OT6A 3CLOA 3LIAA 3FG8A 1X0OA 3ULFA 1GSWA 4R70A 2VA0A 3BY9A 3UMEA 1F98A 2VX8A 5HPIA 1P97A 5EFWA 3T4KA 1VB6A 2NUTC 3GECA 2EA9A 3LR5A 2ZOHA 3BJNA 4GJ4A 1S4RA 4YOFA 4CLCD 3R7WB 1S1YA 3C8CA 4HJ6A 4R6LA 4CLCC 1VHMA 1LT0A 3ZQ5A 4WN5A 4G3WA 2OAP1 4HJ3A 3P01A 1GSVA 3PBRA 3MJQA 2K2NA 3TE8A 4IHQA 4PKYA 2PT7A 3K2NA 1DRMA 2XA7S 2VGLS 1W63M 4I39A 2QWSA 4MMNA 3EQVA 3F1OB 4HH2A 3ICYA 2V9AA 5DFXA 3FPVA 4Z1WA 3S7PA 4L9EA 5HWTA 4H6JA 1D7EA 2A24B 2WKQA 1F5MA 1OTEA 2W1RA 3C2WA 4O0PA 4O8GA 4Q0HA 5TJJA 3PHYA 2PR5A 3KX0X 2VV8A 3PBQA 2ZMVA 4O01A 3S7NA 1T18A 5HDSA 5C5KA 3UB6A 2VLGA 3OC2A 3HCYA 3D3OA 1OTAA 4KQOA 3CI6A 4QPRA 1YAXA 2B18A 4NEED 2K31A 4NXBA 3E4PA 2D02A 2P7JA 5DKLA 2PDRA 1NLYA 3H7WB 3LI8A 1T19A 4WEJA 1MC0A 1XJ6A 2HJEA 2VJWA 2L0WA 1P9RA 4ETXA 4PKYG 1GSXA 2OWJA 1IOUA 2QYBA 3SW1A 4YNRA 4IUKA 1ODVA 4KUKA 1TF1A 4JGRA 2W3DA 3A0VA 3LIBA 1S67L 1UWPX 5J3WA 3B47A 1H3QA 2O9CA 2PR6A 3B42A 3CAXA 2O9AA 2ZMFA 4YWZA 1TS7A 3T4OA 3BQAA 3MFXA 2M7VA 2JKTM 3VV4A 4BJPA 4GCZA 2XSSA 3FC7A 4MN6A 1G28A 2ZBBA 3R7WA 3UB8A 4P6ZS 4NXEA 4II7A 2Z6CA 1P0ZA 4HJ4A 2JN7A 4F3LB 4E04A 2ZOIA 2EWVA 3MR0A 4UQIM 2MJ6A 5F68A 3T4SA 2KOIA 2W3FA 2PHYA 4Y5FA 1OPXA 1S1ZA 2JHEA 1XJ4A 3E0YA 1S4SA 1S66L 2HF6A 3LIFA 4HOIA 2EWWA 4MN5A 1OJ5A 2Z6DA 3T4QA 2XROA 5L8MA 3BY8A 4IUHA 5KIZA 2B02A 2HGVA 4NKPA 3F1OA 5KSHA 2HJ9C 3NJAA 3C38A 1ZTUA 1G6OA 5FL3A 2A24A 3CWFA 2W1TA 2OWHA 2WKPA 4BBVA 1H8MA 2VEAA 4JGOA 2J3TC 4XT2B 3JVUA 1ZHHB 2JKRI 4I5SA 3GDIA 4RQ9A 3PBNA 4FOFA 3KSGA 4WEKA 4ME4A 4PAUA 2BASA 3PR6A 3EQUA 5HPFA 3S7QA 3KSFA 4CLCE 1N9LA 4EERA 1JNUA 3OBFA 2GZAA 3H9WA 3H7WA 3OLOA 2QKPA 4MDZA 3LFVA 3VE3A 2W1TB 4ARZB 2QJ7A 4R3AA 3B33A 4K08A 2W0NA 5HD3A 4OOMA 3K3CA 4MN7A 4EEUA 2YKFA 3S7OA 2W3HA 3W2ZA 4DMZA 2P08A 5IT5A 2R78A 3TW8A 1D06A 3DBAA 4M4XA 3IBRA 2PD7A 5LBRA 3RH8B 5DKKA 3E4QA 4EETB 4I3JA 1N9OA 4BMWA 4Q0IA 2JKRM 4HP9A 3TJZC 1LSWA 2KLIA 3LUQA 3K3DA 3OCNA 3LR0A 4R38A 2L1MA 4Y2FA 4HP4A 4F3LA 2PYPA 4Y3IA 2PD8A 3E4OA 5IS1A 2YKHA 3UB7A 1MZUA 5G4ZA 2Y8HA 3EGXC 3VOLA 2OAQ1 3T50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0R A;  3H82 B;  2INW A;  2M1C A;  4EQ1 A;  3MXQ A;  3IS2 B;  2W27 A;  3D72 A;  4WUJ A;  2GJ3 A;  1TS8 A;  1OT9 A;  4I3A A;  3EWK A;  5HZH A;  3UE6 A;  3UMD A;  1NWZ A;  3EEH A;  2PYR A;  2I9V A;  4HI4 A;  5HWW A;  4LRZ E;  1T1C A;  3NOP C;  4JGP A;  5AVF A;  5TBM B;  4XT2 A;  3G6O A;  3LIE A;  1XJ3 A;  4KQD A;  4GHI A;  1KOU A;  5HDC A;  4EW7 A;  4DJ2 A;  1XFN A;  5G4Y A;  4JGQ A;  3LID A;  3MQO A;  2V1A A;  1XFQ A;  5IU1 A;  4I3I A;  5HWV A;  1UGU A;  4BBT A;  3A0S A;  2KDK A;  4KUO A;  3F1P A;  1OJG A;  3F1N B;  4GHI B;  2QJ5 A;  2CMN A;  1TS6 A;  2L4R A;  2H28 A;  4GS9 A;  5HD5 A;  5F6A A;  4I38 A;  1TS0 A;  5F5Y A;  5I5L A;  1UWN X;  3NOT C;  3NOU C;  1DP9 A;  4WLA A;  4BBU A;  3F1P B;  4DJ3 A;  4HNB A;  4NXF A;  1OTD A;  4LLO B;  3H82 A;  4NXG A;  4EXO A;  1EW0 A;  4GS9 B;  3LYX A;  3IS2 A;  4L9G A;  5AVE A;  4EEP A;  3NHQ A;  4LPZ A;  3VE4 A;  2WKR A;  2VV6 A;  1F9I A;  2OOL A;  5DJU A;  3HJK A;  4GW9 A;  2HV1 A;  4LRY C;  2K7S A;  2J80 A;  3LIC A;  1BYW A;  4WL9 A;  5HDD A;  1LL8 A;  2D01 A;  5TBM A;  2V0W A;  3RTY A;  1T1B A;  1XJ2 A;  4HH3 A;  4H6J B;  4HHD A;  3BWL A;  4LRX C;  1OTI A;  4L9F A;  2V1B A;  1DP6 A;  1N9N A;  1V9Y A;  5J4E A;  4EES A;  2VV7 A;  5A8B A;  1T1A A;  4HIA A;  4B9O A;  2KX6 A;  2V0U A;  1Y28 A;  1OTB A;  4HY8 A;  1DP8 A;  3F1N A;  5DJT A;  1LSV A;  3LI9 A;  3PYP A;  5F69 A;  3P7N A;  1LSX A;  3HJI A;  4HQA A;  3UB9 A;  5J7E A;  3MQQ A;  5HSQ A;  1V9Z A;  1WA9 A;  2QHK A;  1OT6 A;  3CLO A;  3LIA A;  3ULF A;  3FG8 A;  1X0O A;  1GSW A;  4R70 A;  3BY9 A;  3UME A;  1F98 A;  1P97 A;  5EFW A;  1VB6 A;  3GEC A;  2EA9 A;  2ZOH A;  1S4R A;  1S1Y A;  3C8C A;  4HJ6 A;  4R6L A;  1LT0 A;  3ZQ5 A;  4WN5 A;  4HJ3 A;  1GSV A;  3MJQ A;  4PKY A;  1DRM A;  4I39 A;  2QWS A;  3F1O B;  4HH2 A;  3ICY A;  2V9A A;  4L9E A;  5HWT A;  4H6J A;  1D7E A;  2A24 B;  2WKQ A;  1OTE A;  3C2W A;  3PHY A;  2PR5 A;  3KX0 X;  2VV8 A;  1T18 A;  5HDS A;  3UB6 A;  2VLG A;  1OTA A;  4NXB A;  3E4P A;  2D02 A;  2P7J A;  5DKL A;  2PDR A;  3H7W B;  3LI8 A;  1T19 A;  1XJ6 A;  2L0W A;  4PKY G;  1GSX A;  2OWJ A;  3SW1 A;  1ODV A;  4KUK A;  4JGR A;  3A0V A;  3LIB A;  1S67 L;  1UWP X;  5J3W A;  2PR6 A;  3CAX A;  4YWZ A;  1TS7 A;  3MFX A;  4GCZ A;  3FC7 A;  4MN6 A;  1G28 A;  2ZBB A;  3UB8 A;  4NXE A;  2Z6C A;  1P0Z A;  4HJ4 A;  2JN7 A;  4F3L B;  4E04 A;  2ZOI A;  3MR0 A;  5F68 A;  2PHY A;  1S1Z A;  2JHE A;  1XJ4 A;  1S4S A;  1S66 L;  3LIF A;  4HOI A;  4MN5 A;  1OJ5 A;  2Z6D A;  3BY8 A;  5KIZ A;  2B02 A;  3F1O A;  3NJA A;  2A24 A;  3CWF A;  2OWH A;  2WKP A;  4BBV A;  2VEA A;  4JGO A;  4XT2 B;  4I5S A;  3GDI A;  4RQ9 A;  2BAS A;  1N9L A;  4EER A;  1JNU A;  3H9W A;  3H7W A;  3OLO A;  2QKP A;  3VE3 A;  2QJ7 A;  4R3A A;  3B33 A;  4K08 A;  2W0N A;  5HD3 A;  3K3C A;  4EEU A;  2YKF A;  2R78 A;  1D06 A;  4M4X A;  3IBR A;  2PD7 A;  3RH8 B;  5DKK A;  3E4Q A;  4EET B;  4I3J A;  1N9O A;  4HP9 A;  1LSW A;  3LUQ A;  3K3D A;  4R38 A;  2L1M A;  4HP4 A;  4F3L A;  2PYP A;  2PD8 A;  3E4O A;  5IS1 A;  2YKH A;  3UB7 A;  1MZU A;  5G4Z A;  3VOL A;  4WF0 A;  3T50 A; 
#chains in the Genus database with same CATH topology
 3ZNT A;  1P9W A;  4PMA A;  3IWI A;  1KGF A;  3IS2 B;  2W27 A;  2GJ3 A;  1TS8 A;  5MC7 A;  3U2A A;  3FV7 A;  2M7U A;  5HZH A;  2Y2Q A;  4OQI A;  1GHP A;  3MF0 A;  4HI4 A;  1K55 A;  5HWW A;  4LRZ E;  1K25 A;  4JGP A;  5AVF A;  3CHW P;  5TBM B;  1XJ3 A;  4K0X A;  3UO9 A;  2DCF A;  3PTE A;  1W63 Q;  4ZDX A;  3AGD A;  5AJG A;  2WGV A;  2IA2 A;  4EW7 A;  1D1J A;  5HDC A;  5CHU A;  1KVL A;  1XGJ A;  4RA7 A;  1A0K A;  2WAF A;  2Y55 A;  3LID A;  3T4T A;  5DF9 A;  3MQO A;  4GNU A;  1BTL A;  1KDS A;  3FPW A;  1H8Y A;  1CEG A;  4DE2 A;  4ARZ A;  4BBT A;  3IXH A;  5AQB A;  4RX2 A;  4OOY A;  4JF6 A;  4E3M A;  3PXP A;  4DXB A;  2P04 A;  2H28 A;  1RP5 A;  3MFD A;  4UA6 A;  4ZRR A;  3N4I A;  3C4O A;  4ZBE A;  4Y7P A;  1W79 A;  4WLA A;  4BBU A;  3CUE C;  1MPL A;  4E3J A;  4A5R A;  2Y79 A;  4NXF A;  4NXG A;  1IYS A;  1K6S A;  3LYX A;  4L9G A;  5DTS A;  1CJF A;  5EV0 A;  4P6B A;  5CTN A;  2Y2P A;  4JXV A;  5A92 A;  4LPZ A;  3VE4 A;  4Q0J A;  2OOL A;  3W4Q A;  4KZ3 A;  4WZ5 C;  3HJK A;  1G68 A;  4GW9 A;  1YLP A;  3BFE A;  2J80 A;  5M18 A;  1BYW A;  3UPO A;  3SZT A;  5HFO A;  1G5U A;  1T1B A;  2HDS A;  2W3E A;  3IWQ A;  4H6J B;  4HHD A;  3IHB A;  1AXB A;  2V1B A;  3RFB A;  1MY8 A;  2O99 A;  4EU0 A;  1V9Y A;  3E2K A;  3QP6 A;  3HLB A;  2J9P A;  3N7W A;  1SHV A;  3PAE A;  3MXR A;  3VFF A;  4EV4 A;  1SCW A;  1OTB A;  4K0W A;  3EEA A;  5CX7 A;  2A3U A;  3VP3 A;  2PBD P;  4DE3 A;  3C30 A;  1LSX A;  1PZP A;  3OZH A;  3MQQ A;  1XA1 A;  1V9Z A;  1OT6 A;  4OLG A;  1X0O A;  1GSW A;  2XDM A;  2OV5 A;  4EBL A;  4BL2 A;  3G35 A;  3TSG A;  3UPN A;  3W8K A;  4E3O A;  4FD8 A;  1ERQ A;  5FI7 A;  4WMC A;  2FFY A;  3LR5 A;  1DY6 A;  2WKH A;  4GJ4 A;  2ZM0 A;  4BD0 A;  4FTX A;  3VSL A;  3DW0 A;  3BEB A;  5TFQ A;  2JCH A;  1SZV A;  3VOY A;  2IWC A;  4Y0U A;  3OPP A;  1PW8 A;  2ZD8 A;  4N92 A;  1NY0 A;  1W8Y A;  2WAD A;  3DWK A;  2VGL S;  4QU3 A;  4JXS A;  3F1O B;  4Y0O A;  3ICY A;  3ZDJ A;  2Y2G A;  3L9K A;  2A24 B;  3ZGA B;  1Y54 A;  2JKG A;  3C2W A;  2PAV P;  4Q0H A;  1W8Q A;  5TJJ A;  3P09 A;  4LCM A;  5D3O A;  3KX0 X;  4LGW A;  4N9K A;  1T18 A;  3V5M A;  1K57 C;  1FCO A;  3OC2 A;  2VGJ A;  3D3O A;  3I7J A;  4KQO A;  4C75 A;  1W7F A;  4MLL A;  3CI6 A;  2B18 A;  4NEE D;  1K4E A;  2K31 A;  2HDU A;  1L2S A;  2PDR A;  1O07 A;  2JE5 A;  3H7W B;  3LI8 A;  2ZLY A;  4GB7 A;  1MC0 A;  1K6R A;  1CI8 A;  2L0W A;  1P9R A;  3A3E A;  3G2Z A;  2V8F A;  1IOU A;  2BLS A;  4YNR A;  4IUK A;  5I94 A;  3VFH A;  1UWP X;  4HEF A;  3WWX A;  4ESP A;  5EM0 A;  1CEF A;  2E8I A;  3MKE A;  4E3I A;  2VGK A;  3T4O A;  4KG5 A;  2M7V A;  2JKT M;  2WYX A;  1CF0 A;  5FSR A;  3R7W A;  5F1F A;  3UB8 A;  4P6Z S;  4HJ4 A;  2G2W A;  3LGO A;  4E04 A;  3V3R A;  3MR0 A;  4UQI M;  3T1S A;  2MJ6 A;  3Q7V A;  2W3F A;  3SS5 A;  1I5Q A;  1I2W A;  2JHE A;  3HRE A;  2Q0O A;  3CPT A;  3LIF A;  2HF6 A;  3G32 A;  3BRM A;  4HBU A;  1RGY A;  1ZKJ A;  1Q2Q A;  1OJ5 A;  5L8M A;  4IUH A;  3ZG7 B;  3ZNY A;  1JVJ A;  5EVI B;  2OSU A;  4E6W A;  1ZTU A;  3BLS A;  2EX9 A;  5A93 A;  2W1T A;  5AQA A;  3ZVT A;  2VEA A;  4JGO A;  4GD8 A;  1BUL A;  2J3T C;  2C5W B;  2JKR I;  3UE1 A;  4KQQ A;  1AWI A;  5EUA A;  4PAU A;  5EOE A;  3VMA A;  1WYC A;  3IF6 B;  1E3U A;  1JNU A;  1GA0 A;  4KZ6 A;  3WRT A;  2GZA A;  1H0M A;  5IHV A;  4PM6 A;  3W4P A;  2Y2H A;  1SKF A;  2QKP A;  3VE3 A;  4WMC D;  2XEP A;  3U4L P;  2ZQ7 A;  3B33 A;  3FZC A;  4R3J A;  2E8J A;  4OQG A;  3WRZ A;  4XXR A;  1YLZ A;  1XPB A;  4C6Y A;  3K3C A;  3S4X A;  2YKF A;  4LV2 A;  2W3H A;  5GLC A;  4EQI A;  4DMZ A;  5IT5 A;  4OP5 A;  4OPQ A;  1LL5 A;  3TW8 A;  1D06 A;  4X1M A;  5LBR A;  2XQZ A;  4EET B;  3L7H A;  1N9O A;  2JKR M;  3BLM A;  2XR0 A;  1NYM A;  3OPL A;  4Y2F A;  4S2P A;  1ES4 A;  4Y3I A;  2PD8 A;  2YKH A;  3FWL A;  3UB7 A;  4WF0 A;  2OAQ 1;  1JWP A;  3A0R A;  5EPH A;  5HAI A;  2INW A;  2M1C A;  3MXQ A;  2FH5 A;  4OKP A;  3Q1F A;  4DKI A;  5FQI A;  1OT9 A;  2DNS A;  5E2F A;  3UMD A;  4U0T A;  1DJC A;  4CJN A;  2PYR A;  2A2L A;  4X53 A;  2I9V A;  5FDH A;  4KZB A;  1YLT A;  2IWB A;  3Q07 A;  5CHM A;  3UN7 A;  1DJB A;  2QZ6 A;  3OOV A;  4XT2 A;  5L07 A;  1XKZ A;  4KQD A;  3N8L A;  4UAA A;  4RYE A;  3T4J A;  4DJ2 A;  3O88 A;  2HPB A;  5G18 A;  1BLS A;  2ZQ8 A;  4O7D A;  5G4Y A;  1IEM A;  4KZA A;  4D2O A;  4NK3 A;  2V1A A;  3VOZ A;  3PBS A;  3VP2 A;  4CLC B;  3Q7Z A;  2Y2J A;  5HWV A;  1K54 C;  3T1R A;  3A0S A;  5HAR A;  4BWI A;  5FQ9 A;  5CEB A;  2J7V A;  3HLC A;  2ZM8 A;  4PM8 A;  2UV0 E;  5EVI C;  2QPN A;  1S0W A;  2XD1 A;  1TS6 A;  2L4R A;  1JTD A;  4UA7 A;  5HD5 A;  4I38 A;  1GHI A;  4LFU A;  1KE3 A;  5F5Y A;  1ERO A;  2J9O A;  4BEN A;  3MKF A;  4QD4 A;  3NOT C;  2HDQ A;  1YPR A;  3IF6 C;  1MXO A;  3BW6 A;  1E25 A;  3KYZ A;  2PRF A;  2PU4 A;  3H82 A;  4LLO B;  4L0L A;  1TVF A;  3HLF A;  1VQQ A;  4HBT A;  4X56 A;  1ZC2 A;  4FUW A;  3WS2 A;  1VET B;  4IBX A;  3NHQ A;  1C3B A;  2VV6 A;  4WEL A;  4X1L A;  3NBL A;  4WM9 A;  2J3W A;  2O9B A;  1NZU A;  2ACG A;  3LIC A;  5HDD A;  4EUV A;  1LL8 A;  2D01 A;  1VEU A;  1WE4 A;  2I72 A;  1DJA A;  2V0W A;  1XJ2 A;  5F1G A;  5FQM A;  1YQS A;  1STZ A;  5CGS A;  3KYQ A;  1FIL A;  3BWL A;  2C6W B;  1DP6 A;  5K5B A;  2O0Y A;  4CQH A;  3MBZ A;  5J4E A;  1BT5 A;  2VV7 A;  4PM7 A;  5A8B A;  4HIA A;  4B9O A;  3ZG8 B;  2XH9 A;  2HDR A;  4OOL A;  1TD5 A;  2V0U A;  4JF5 A;  4S2M A;  5GHY A;  3F1N A;  3ITB A;  3PYP A;  5F69 A;  3HJI A;  2P74 A;  4GZB A;  5J7E A;  2EX8 A;  4X69 A;  3LO7 A;  2WAE A;  3FG8 A;  1Z6F A;  4P0M A;  2ZQC A;  4UHU A;  3T4K A;  5L09 A;  1Y4O A;  5E2H A;  4DDY A;  2ZOH A;  3BJN A;  3M2J A;  1GHM A;  2Q9M A;  2PU2 A;  5FQJ A;  3MZD A;  4HJ6 A;  4CLC C;  1VHM A;  4H8R A;  2OAP 1;  5FDS A;  4LV3 A;  1GSV A;  4XUX A;  3MJQ A;  2K2N A;  3B3X A;  4S2N A;  3TE8 A;  5HAQ A;  2H0T A;  3K2N A;  1DRM A;  1W63 M;  2QWS A;  2BG1 A;  2X71 A;  4HH2 A;  2V9A A;  3UDX A;  5DFX A;  1YLJ A;  2WKQ A;  4BQM A;  3QP1 A;  3PHY A;  2VV8 A;  4O01 A;  2EFU A;  5HDS A;  3LCE A;  3D4F A;  2VLG A;  3UB6 A;  1OTA A;  2V1Z A;  4P87 A;  5F83 A;  1PI5 A;  1IYO A;  3E4P A;  4N1X A;  4P85 A;  1ALQ A;  1OME A;  2WK0 A;  4YFM A;  3HUN A;  2VJW A;  5TR7 A;  4ETX A;  2V2F F;  3CMZ A;  4PKY G;  1GSX A;  4E3N A;  2QYB A;  3SW1 A;  5DTT A;  5F82 A;  4MEZ A;  1YMS A;  4JGR A;  2W3D A;  3WS0 A;  4GKU A;  5J3W A;  3C7V A;  3B47 A;  4Z9Q A;  1H3Q A;  3B42 A;  3CAX A;  2O9A A;  4OPY A;  1LL9 A;  3FYZ A;  3T12 B;  3BQA A;  2V8C A;  3N8R A;  3GQZ A;  4GCZ A;  1HTZ A;  4FH2 A;  3FC7 A;  3ZFZ A;  4NXE A;  3CJM A;  1E4D A;  4II7 A;  1M6K A;  2EWV A;  3IH8 A;  5F68 A;  4Y5F A;  1S1Z A;  3E0Y A;  3RXX A;  2RCX A;  3ZHH A;  3T4Q A;  4U0X A;  5KSH A;  3NC8 A;  2HJ9 C;  2WKE A;  3NIA A;  1GA9 A;  3C38 A;  2Y91 A;  1G6O A;  2Y2K A;  4HES A;  4IVK A;  1KGG A;  2XF3 A;  1H8M A;  2BTF P;  3JVU A;  4ZJ1 A;  4IED A;  3T1Q B;  5GL9 A;  1CI9 A;  3PBN A;  4FOF A;  5GLA A;  4WEK A;  4FCF A;  4ME4 A;  1BLC A;  2BAS A;  3EQU A;  2XFS A;  1LI0 A;  3PAG A;  2CC1 A;  4D60 A;  2AVX A;  3ZG0 A;  2Y2N A;  4E3L A;  3DTI A;  2HP6 A;  2Y2O A;  2XLN A;  3IX8 A;  3WS1 A;  1PWD A;  4ARZ B;  4R3A A;  1FR6 A;  4K08 A;  1GCE A;  4OOM A;  5FAQ A;  4MBK A;  1KE4 A;  4GDN A;  4MN7 A;  3JPU A;  4EEU A;  5A91 A;  3GSG A;  3IHA A;  4IVI A;  2PD7 A;  3RH8 B;  5DKK A;  1IYQ A;  4I3J A;  4BMW A;  4Q0I A;  5FA7 A;  1QME A;  4QY6 A;  2DRW A;  2FFF B;  3K3D A;  1N9B A;  2ZQD A;  1FCN A;  4HP4 A;  4F3L A;  2PYP A;  3E4O A;  5CGX A;  3Q81 A;  3C7U A;  3T50 A;  5DVA A;  3MQ0 A;  4EQ1 A;  1PW1 A;  3G31 A;  4DXC A;  3O5Y A;  3UE3 A;  1MWT A;  1BLH A;  3MMH A;  5A90 A;  3UE6 A;  3NEC A;  1NWZ A;  2ZQA A;  3DAV A;  4X55 A;  4OVD A;  4CLC A;  4ETZ A;  3NOP C;  2WZZ A;  4LCL A;  1NJ4 A;  3LIE A;  3LEZ A;  3IBJ A;  1WYB A;  2XA7 M;  2XD5 A;  1MWU A;  1EI5 A;  3AGF A;  5EVL A;  3IT9 A;  1SKO A;  5GLB A;  1KOU A;  3SH8 A;  4IJG A;  1IFQ A;  1XFN A;  4MCW A;  3HL9 A;  3CUE A;  4JGQ A;  3WS4 A;  1YLY A;  3NDE A;  3EGD C;  4N9L A;  4NET A;  1XFQ A;  2WGW A;  5IU1 A;  4GLQ A;  5L10 A;  4R23 A;  1RCJ A;  1UGU A;  5CER A;  2ZMA A;  1NLZ A;  2GDN A;  5EVI D;  5JYO A;  3TG9 A;  3ITA A;  4GHI B;  1NRJ A;  4WZ5 A;  5HL1 A;  1XX2 A;  2QJ5 A;  4PPR A;  2CMN A;  1K55 C;  3UDF A;  2GNX A;  4ID4 A;  4OQH A;  3BEC A;  5F6A A;  3TRC A;  4OH0 A;  4B93 A;  1TS0 A;  1L0E A;  1UWN X;  4UQI S;  5CGW A;  3NOU C;  4AFI A;  4GOG A;  2LB9 A;  3DTE A;  5FAP A;  1YMX A;  1MKM A;  5FI2 A;  3FKV A;  3F1P B;  4DJ3 A;  3MZE A;  2JKF A;  4DN0 A;  1OTD A;  2G7U A;  2PBY A;  4EXO A;  4NG2 A;  1EW0 A;  2VZW A;  4GS9 B;  4PM5 A;  3O86 A;  3IS2 A;  2EX6 A;  2ZC5 B;  4EEP A;  5M1A A;  5CED A;  3UE0 A;  2WKR A;  1TEM A;  2OLV A;  1F9I A;  3ZYT A;  1CQA A;  2G2U A;  2K7S A;  4ZAM A;  1JWV A;  3KYE A;  5EEC A;  5TBM A;  3QNB A;  3QP8 A;  2H10 A;  4HH3 A;  5DFY A;  3NDG A;  3MS6 A;  5HAP A;  3CG5 A;  3KSI A;  4LRX C;  1OTI A;  4L9F A;  1YKD A;  2B95 A;  3JVV A;  1N9N A;  1H8Z A;  1KDW A;  4EES A;  1T1A A;  3LY3 A;  1IKG A;  1PNE A;  1PYY A;  2NUP C;  2J8Y A;  2KX6 A;  2P9V B;  4ZJ3 A;  3BFG A;  1KE0 A;  2W3G A;  3DTK A;  3PBT A;  4GN2 A;  1DP8 A;  5DJT A;  3GRJ A;  3KSH A;  2JC7 A;  1BUE A;  4HQA A;  3UB9 A;  3ZG5 A;  3VP4 A;  3OCL A;  3O3V A;  2QHK A;  4UEY A;  3CLO A;  2WUQ A;  3LIA A;  2ZC3 B;  3IH9 A;  4R70 A;  2H0Y A;  1PWG A;  3SS3 A;  2VA0 A;  3BY9 A;  4Q8I A;  4BL3 A;  2VX8 A;  2ZC7 A;  5EFW A;  1VB6 A;  3CZD A;  2NUT C;  4LEN A;  2R9X A;  2EA9 A;  3IXD A;  1K57 A;  1S4R A;  4YOF A;  4CLC D;  3R7W B;  4XUZ A;  5M19 A;  3C8C A;  1LT0 A;  1JWZ A;  1ES5 A;  1CK3 A;  1ESI A;  3Q7V B;  4WN5 A;  4G3W A;  3VSK A;  3WS5 A;  1J9M A;  3CPT B;  2Z2L B;  4IHQ A;  2XFT A;  2PT7 A;  1L3L A;  3HLG A;  3EQV A;  2EXA A;  1XP4 A;  3QP4 A;  3FPV A;  5DF8 A;  3FKW A;  3S7P A;  4L9E A;  4M3K A;  4H6J A;  5HWT A;  1F5M A;  1N4O A;  1OTE A;  4KZ8 A;  1FCM A;  4S2L A;  1L0G A;  1KGE A;  4OON A;  2PR5 A;  3S7N A;  4KG6 A;  5FI6 A;  3IX4 A;  4WBG A;  4RX3 A;  4QPR A;  1YAX A;  2D02 A;  4S2I A;  2P7J A;  5EOO A;  3A3I A;  1T19 A;  4WEJ A;  1XJ6 A;  2OWJ A;  3BYD A;  1ODV A;  4KUK A;  4LV0 A;  3LIB A;  1S67 L;  3SH9 A;  1ERM A;  2Y59 A;  2ZM2 A;  2O9C A;  4JF4 A;  1KVM A;  1PFL A;  3HUM A;  3IQA A;  3V50 A;  1MBL A;  1BLP A;  3M6H A;  4MN6 A;  1G28 A;  5FAT A;  2Z6C A;  1P0Z A;  2JN7 A;  5KMW A;  1ACF A;  3RJU A;  3T4S A;  2KOI A;  3UY6 A;  2PHY A;  1OPX A;  5AQ7 A;  2WGI A;  3BFF A;  5FQQ A;  3IXG A;  1XXM A;  1XJ4 A;  4HOI A;  3N6I A;  2EWW A;  2EX2 A;  3G4P A;  2XRO A;  3BY8 A;  1HD8 A;  2B02 A;  4NKP A;  3F1O A;  4MBH A;  4K91 A;  3D9Y A;  2V20 A;  1ES2 A;  3NJA A;  5DTK A;  5FL3 A;  2A24 A;  5EVE A;  2A49 A;  1FIK A;  3GTC A;  4XT2 B;  3Q82 A;  1MKI A;  3GDI A;  2XK1 A;  2ZQ9 A;  4RQ9 A;  3KSG A;  3UB5 P;  1NRF A;  3PR6 A;  3M2K A;  5HPF A;  1I2S A;  3N8S A;  2HP5 A;  3S7Q A;  2X01 A;  4DDS A;  4CLC E;  3OBF A;  5U47 A;  4Y15 A;  3V39 A;  4DF6 A;  2R9W A;  3H7W A;  4KZ9 A;  3OLO A;  3DTM A;  3LFV A;  5CHJ A;  2QJ7 A;  2W0N A;  4OLD A;  1ONH A;  1FSY A;  4GDB A;  3S7O A;  3C5A A;  1IEL A;  2P08 A;  2R78 A;  3TOI A;  4Y13 A;  3HUO A;  4M4X A;  3IBR A;  4KZ5 A;  3E4Q A;  5CTM A;  4B4X A;  1ZG6 A;  4HP9 A;  3TJZ C;  1U60 A;  1LSW A;  3LUQ A;  3OCN A;  3LR0 A;  4R38 A;  1L0F A;  2L1M A;  1M40 A;  3ISG A;  1QMF A;  3S1Y A;  4OPR A;  5G4Z A;  2OLU A;  5CRF A;  4X68 A;  1FSW A;  5J8X A;  4F94 A;  4BD1 A;  1LHY A;  3H82 B;  2ZL1 B;  2Y2L A;  1K54 A;  5FQK A;  5TGF A;  2DMW A;  3D72 A;  4QHC A;  4WUJ A;  3DWZ A;  1W5D A;  4I3A A;  3UPP A;  3EWK A;  4FH4 A;  5FEG A;  4R0Q A;  1HLU P;  3EEH A;  3A3D A;  5EVI A;  2LB5 A;  1XGI A;  4WZ4 A;  3GV9 A;  4QWO A;  5GHX A;  1MWR A;  3BQ8 A;  1T1C A;  4Y0T A;  1VEU B;  2HZ5 A;  3G6O A;  4RVA A;  3C4P A;  3T4L A;  3G30 A;  1YT4 A;  3JYI A;  5E2E A;  2VGL M;  3G34 A;  4GHI A;  3EOI A;  4YIN A;  4G3K A;  4WYY A;  4C3Q A;  3IF6 A;  3IWO A;  4JLF A;  3ZCZ A;  5DF7 A;  1ZG4 A;  1PZO A;  4R4S A;  5KSC A;  3SOI A;  1NZO A;  4PHT A;  2J3T D;  4I3I A;  1FR1 A;  2KDK A;  3NI9 A;  2JBF A;  1K4F A;  4KUO A;  3F1P A;  4FSF A;  1OJG A;  3F1N B;  1NXY A;  1SDE A;  4DE0 A;  3R4K A;  1L0D A;  4E6X A;  3UDI A;  4GS9 A;  1IYP A;  1ESU A;  4B4Z A;  1NYY A;  1G6A A;  3KO6 A;  5I5L A;  2Z2M B;  5GLD A;  1DP9 A;  5KZH A;  1YSQ A;  5BOH A;  1PI4 A;  4MNR A;  3MZF A;  1YSP A;  4HNB A;  2FZ0 A;  2VK3 A;  3HLE A;  1K38 A;  3ZG9 B;  3LR4 A;  5HL6 A;  1BZA A;  1EWZ A;  4P6Z M;  5AVE A;  2VKS A;  4MBF A;  4KEN B;  4QY5 A;  2JKT I;  2UWX A;  3A3F A;  1JTG A;  5DJU A;  3PBO A;  4JPM A;  2HV1 A;  4LRY C;  2XRN A;  2QMI A;  4DE1 A;  2B5R A;  2GX5 A;  4WL9 A;  2P9V A;  5HW3 A;  1SDN A;  3BFD A;  3RTY A;  3IX3 A;  3CIT A;  3E98 A;  3M6B A;  3MXS A;  4EWF A;  2Y2I A;  3QP5 A;  4G3V A;  3S22 A;  1PWC A;  4KZ7 A;  3BFC A;  1J3W A;  3SH7 A;  4ZTK A;  5L2F A;  4S2O A;  4EUZ A;  4OQ0 A;  1K56 A;  1Y28 A;  3LR3 A;  4QB8 A;  4HY8 A;  1LSV A;  3LI9 A;  1Q2P A;  4UA9 A;  3P7N A;  3QHY A;  2RL3 A;  3V67 A;  4DRT A;  5HSQ A;  1WA9 A;  1XA7 A;  4OPZ A;  3A3J A;  3ULF A;  3AGE A;  1MWS A;  3NUL A;  4R1G A;  3IF5 A;  4X25 A;  4S2J A;  1F98 A;  4KZ4 A;  3UME A;  5HPI A;  1P97 A;  3G2Y A;  3GEC A;  3O87 A;  5FEF A;  1S1Y A;  2Q9N A;  4R6L A;  3ZQ5 A;  3QP2 A;  4N1H A;  1VET A;  4HJ3 A;  3P01 A;  3PBR A;  4PKY A;  4ZJ2 A;  2XA7 S;  4I39 A;  4MMN A;  1TDG A;  4Z1W A;  3UNW A;  1Z09 A;  3NCK A;  4LV1 A;  3W4O A;  1D7E A;  1HVB A;  2W1R A;  4O0P A;  4O8G A;  1RGZ A;  5CXW A;  2XGN A;  4JXG A;  2Y4A A;  3T1X A;  3PBQ A;  2ZMV A;  5C5K A;  2H5S A;  3HCY A;  3HLD A;  1LLB A;  1FQG A;  4NXB A;  4EBP A;  4OP8 A;  3VP1 A;  5DKL A;  1FOF A;  1NLY A;  1LI9 A;  4JBF A;  2HJE A;  1YM1 A;  4S2N C;  4X6T A;  1TF1 A;  1YLW A;  4KQR A;  3A0V A;  4PM9 A;  5AQ9 A;  5FAS A;  3LY4 A;  3ZVW A;  4GD6 A;  2WZX A;  1BSG A;  3GVB A;  2PR6 A;  4JXW A;  1VM1 A;  2ZMF A;  4YWZ A;  1TS7 A;  3MFX A;  3VV4 A;  4BJP A;  1ONG A;  5GHZ A;  2XSS A;  2ZBB A;  3IXB A;  1PIO A;  2ZC4 B;  4F3L B;  2ZOI A;  3OPR A;  4QJG A;  5HX9 A;  2EFX A;  1S4S A;  1S66 L;  4KG2 A;  1S6R A;  4MN5 A;  2Z6D A;  4S2K A;  4U3T A;  5KIZ A;  2HGV A;  3BM6 A;  3NY4 A;  1TDL A;  2X02 A;  2WKI A;  4R3B A;  1K56 D;  2EXB A;  3CWF A;  1O7E A;  2OWH A;  2WKP A;  3RXW A;  1HZO A;  4BBV A;  4BLM A;  4JKT A;  1ZHH B;  4I5S A;  4EBN A;  3VP0 A;  1SKO B;  2ZC6 B;  1H5X A;  3HVF A;  2ZJ9 A;  5EM1 A;  3KSF A;  1N9L A;  4EER A;  3HLW A;  3HBR A;  5E43 A;  3LEQ A;  3H9W A;  2HP9 A;  2WGW B;  3MSH A;  2IWD A;  3GR2 A;  4MDZ A;  2W1T B;  4IBR A;  5EE8 A;  5E2G A;  4Y17 A;  5HD3 A;  2Y2M A;  3E2L A;  5FAO A;  1K0K A;  4R4R A;  3W2Z A;  3OPH A;  4E3K A;  3DBA A;  2ZL1 A;  5JYP A;  3P98 A;  1IKI A;  1F2K A;  3GMW A;  4B88 A;  2KLI A;  1E3U D;  3QNC A;  5CEC A;  3V3S A;  1ES3 A;  5IS1 A;  4CPK A;  1MZU A;  1PRQ A;  2Y8H A;  3EGX C;  3SS4 A;  3VOL A; 
#chains in the Genus database with same CATH homology
 3A0R A;  1P9W A;  3H82 B;  3MQ0 A;  2INW A;  2M1C A;  4EQ1 A;  3MXQ A;  2FH5 A;  3IS2 B;  3O5Y A;  2W27 A;  3UE3 A;  2DMW A;  3D72 A;  4WUJ A;  2GJ3 A;  1TS8 A;  1OT9 A;  4I3A A;  5MC7 A;  3U2A A;  2M7U A;  3EWK A;  5HZH A;  3MMH A;  3UE6 A;  3UMD A;  1NWZ A;  3EEH A;  2PYR A;  2A2L A;  2I9V A;  2LB5 A;  3MF0 A;  4HI4 A;  4CLC A;  5HWW A;  4ETZ A;  4LRZ E;  3BQ8 A;  1T1C A;  3NOP C;  4JGP A;  3OOV A;  5AVF A;  5TBM B;  4XT2 A;  3G6O A;  3LIE A;  1XJ3 A;  3IBJ A;  3T4L A;  4KQD A;  1W63 Q;  2VGL M;  2XA7 M;  5AJG A;  4GHI A;  2IA2 A;  1KOU A;  5HDC A;  4EW7 A;  3T4J A;  4IJG A;  3EOI A;  4DJ2 A;  1IFQ A;  1XFN A;  4G3K A;  4MCW A;  5G4Y A;  3CUE A;  4JGQ A;  3LID A;  3T4T A;  5DF9 A;  3MQO A;  2V1A A;  3EGD C;  3PBS A;  1XFQ A;  4PHT A;  3FPW A;  5IU1 A;  4GLQ A;  4CLC B;  4ARZ A;  2J3T D;  4I3I A;  5HWV A;  1UGU A;  4BBT A;  3A0S A;  2KDK A;  4BWI A;  1NLZ A;  4KUO A;  3F1P A;  4FSF A;  1OJG A;  3F1N B;  4GHI B;  1NRJ A;  3PXP A;  2QJ5 A;  3R4K A;  2CMN A;  1TS6 A;  2L4R A;  2H28 A;  2GNX A;  2P04 A;  4GS9 A;  5HD5 A;  4ZRR A;  5F6A A;  4I38 A;  3TRC A;  4B93 A;  1TS0 A;  3KO6 A;  5F5Y A;  5I5L A;  1UWN X;  4UQI S;  3NOT C;  3NOU C;  1DP9 A;  4AFI A;  2LB9 A;  4WLA A;  1MKM A;  4BBU A;  1YSQ A;  3F1P B;  3BW6 A;  3CUE C;  4DJ3 A;  1YSP A;  4HNB A;  3KYZ A;  2Y79 A;  4DN0 A;  2FZ0 A;  4NXF A;  2G7U A;  1OTD A;  3H82 A;  4LLO B;  4NXG A;  4L0L A;  4EXO A;  3LR4 A;  5HL6 A;  1EW0 A;  2VZW A;  4GS9 B;  3LYX A;  3IS2 A;  4L9G A;  4P6Z M;  5AVE A;  2VKS A;  4EEP A;  3NHQ A;  4LPZ A;  3VE4 A;  2WKR A;  2JKT I;  2VV6 A;  4Q0J A;  4WEL A;  1F9I A;  2OOL A;  5DJU A;  3HJK A;  3PBO A;  3ZYT A;  4GW9 A;  2HV1 A;  2J3W A;  2O9B A;  2XRN A;  4LRY C;  2K7S A;  2J80 A;  3LIC A;  1BYW A;  2GX5 A;  4WL9 A;  5HDD A;  4EUV A;  1LL8 A;  2D01 A;  5TBM A;  2V0W A;  3RTY A;  1T1B A;  1XJ2 A;  3CIT A;  3E98 A;  4HH3 A;  2W3E A;  4H6J B;  1STZ A;  4HHD A;  3KYQ A;  5DFY A;  3BWL A;  3KSI A;  4LRX C;  1OTI A;  4L9F A;  2V1B A;  1YKD A;  3RFB A;  1DP6 A;  5K5B A;  2O0Y A;  3JVV A;  4G3V A;  2O99 A;  4CQH A;  1N9N A;  4EU0 A;  1V9Y A;  5J4E A;  4EES A;  2VV7 A;  5A8B A;  1T1A A;  4HIA A;  4B9O A;  2NUP C;  2KX6 A;  4OOL A;  1TD5 A;  2V0U A;  1Y28 A;  3LR3 A;  1OTB A;  4WF0 A;  2W3G A;  4HY8 A;  3PBT A;  3EEA A;  5CX7 A;  1DP8 A;  3F1N A;  5DJT A;  1LSV A;  3LI9 A;  3PYP A;  3C30 A;  5F69 A;  3P7N A;  1LSX A;  3V67 A;  3KSH A;  3HJI A;  4HQA A;  3UB9 A;  5J7E A;  3OCL A;  3MQQ A;  5HSQ A;  1V9Z A;  1WA9 A;  2QHK A;  4UEY A;  1OT6 A;  3CLO A;  3LIA A;  3FG8 A;  1X0O A;  3ULF A;  1GSW A;  4R70 A;  2VA0 A;  3BY9 A;  3UME A;  1F98 A;  2VX8 A;  5HPI A;  1P97 A;  5EFW A;  3T4K A;  1VB6 A;  2NUT C;  3GEC A;  2EA9 A;  3LR5 A;  2ZOH A;  3BJN A;  4GJ4 A;  1S4R A;  4YOF A;  4CLC D;  3R7W B;  1S1Y A;  3C8C A;  4HJ6 A;  4R6L A;  4CLC C;  1VHM A;  1LT0 A;  3ZQ5 A;  4WN5 A;  4G3W A;  2OAP 1;  4HJ3 A;  3P01 A;  1GSV A;  3PBR A;  3MJQ A;  2K2N A;  3TE8 A;  4IHQ A;  4PKY A;  2PT7 A;  3K2N A;  1DRM A;  2XA7 S;  2VGL S;  1W63 M;  4I39 A;  2QWS A;  4MMN A;  3EQV A;  3F1O B;  4HH2 A;  3ICY A;  2V9A A;  5DFX A;  3FPV A;  4Z1W A;  3S7P A;  4L9E A;  5HWT A;  4H6J A;  1D7E A;  2A24 B;  2WKQ A;  1F5M A;  1OTE A;  2W1R A;  3C2W A;  4O0P A;  4O8G A;  4Q0H A;  5TJJ A;  3PHY A;  2PR5 A;  3KX0 X;  2VV8 A;  3PBQ A;  2ZMV A;  4O01 A;  3S7N A;  1T18 A;  5HDS A;  5C5K A;  3UB6 A;  2VLG A;  3OC2 A;  3HCY A;  3D3O A;  1OTA A;  4KQO A;  3CI6 A;  4QPR A;  1YAX A;  2B18 A;  4NEE D;  2K31 A;  4NXB A;  3E4P A;  2D02 A;  2P7J A;  5DKL A;  2PDR A;  1NLY A;  3H7W B;  3LI8 A;  1T19 A;  4WEJ A;  1MC0 A;  1XJ6 A;  2HJE A;  2VJW A;  2L0W A;  1P9R A;  4ETX A;  4PKY G;  1GSX A;  2OWJ A;  1IOU A;  2QYB A;  3SW1 A;  4YNR A;  4IUK A;  1ODV A;  4KUK A;  1TF1 A;  4JGR A;  2W3D A;  3A0V A;  3LIB A;  1S67 L;  1UWP X;  5J3W A;  3B47 A;  1H3Q A;  2O9C A;  2PR6 A;  3B42 A;  3CAX A;  2O9A A;  2ZMF A;  4YWZ A;  1TS7 A;  3T4O A;  3BQA A;  3MFX A;  2M7V A;  2JKT M;  3VV4 A;  4BJP A;  4GCZ A;  2XSS A;  3FC7 A;  4MN6 A;  1G28 A;  2ZBB A;  3R7W A;  3UB8 A;  4P6Z S;  4NXE A;  4II7 A;  2Z6C A;  1P0Z A;  4HJ4 A;  2JN7 A;  4F3L B;  4E04 A;  2ZOI A;  2EWV A;  3MR0 A;  4UQI M;  2MJ6 A;  5F68 A;  3T4S A;  2KOI A;  2W3F A;  2PHY A;  4Y5F A;  1OPX A;  1S1Z A;  2JHE A;  1XJ4 A;  3E0Y A;  1S4S A;  1S66 L;  2HF6 A;  3LIF A;  4HOI A;  2EWW A;  4MN5 A;  1OJ5 A;  2Z6D A;  3T4Q A;  2XRO A;  5L8M A;  3BY8 A;  4IUH A;  5KIZ A;  2B02 A;  2HGV A;  4NKP A;  3F1O A;  5KSH A;  2HJ9 C;  3NJA A;  3C38 A;  1ZTU A;  1G6O A;  5FL3 A;  2A24 A;  3CWF A;  2W1T A;  2OWH A;  2WKP A;  4BBV A;  1H8M A;  2VEA A;  4JGO A;  2J3T C;  4XT2 B;  3JVU A;  1ZHH B;  2JKR I;  4I5S A;  3GDI A;  4RQ9 A;  3PBN A;  4FOF A;  3KSG A;  4WEK A;  4ME4 A;  4PAU A;  2BAS A;  3PR6 A;  3EQU A;  5HPF A;  3S7Q A;  3KSF A;  4CLC E;  1N9L A;  4EER A;  1JNU A;  3OBF A;  2GZA A;  3H9W A;  3H7W A;  3OLO A;  2QKP A;  4MDZ A;  3LFV A;  3VE3 A;  2W1T B;  4ARZ B;  2QJ7 A;  4R3A A;  3B33 A;  4K08 A;  2W0N A;  5HD3 A;  4OOM A;  3K3C A;  4MN7 A;  4EEU A;  2YKF A;  3S7O A;  2W3H A;  3W2Z A;  4DMZ A;  2P08 A;  5IT5 A;  2R78 A;  3TW8 A;  1D06 A;  3DBA A;  4M4X A;  3IBR A;  2PD7 A;  5LBR A;  3RH8 B;  5DKK A;  3E4Q A;  4EET B;  4I3J A;  1N9O A;  4BMW A;  4Q0I A;  2JKR M;  4HP9 A;  3TJZ C;  1LSW A;  2KLI A;  3LUQ A;  3K3D A;  3OCN A;  3LR0 A;  4R38 A;  2L1M A;  4Y2F A;  4HP4 A;  4F3L A;  2PYP A;  4Y3I A;  2PD8 A;  3E4O A;  5IS1 A;  2YKH A;  3UB7 A;  1MZU A;  5G4Z A;  2Y8H A;  3EGX C;  3VOL A;  2OAQ 1;  3T50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...