1BSGA

Beta-lactamase from streptomyces albus g
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
SDAERRLAGLERASGARLGVYAYDTGSGRTVAYRADELFPMCSVFKTLSSAAVLRDLDRNGEFLSRRILYTQDDVEQADGAPETGKPQNLANGMTVEELCEVSITASDNCAANLMLRELGGPAAVTRFVRSLGDRVTRLDRWEPELNSAEPGRVTDTTSPRAITRTYGRLVLGDALNPRDRRLLTSWLLANTTSGDRFRAGLPDDWTLGDKTGAGRYGTNNDAGVTWPPGRAPIVLTVLTAKTEQDAARDDGLVADAARVLAETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA LACTAMASE
publication title The crystal structure of the beta-lactamase of Streptomyces albus G at 0.3 nm resolution.
pubmed rcsb
molecule tags Hydrolase
total genus 93
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bsgA00
2ZLYA 3ZGAB 3WRZA 2DRWA 2WAEA 3N8RA 3NBLA 1KE0A 3UDFA 1XX2A 5U47A 1TVFA 4OLGA 2H5SA 3IXBA 1ES2A 1O7EA 1PZOA 3LY4A 5CHMA 4PM8A 2ZQAA 3EQUA 4GB7A 4RVAA 4E3KA 4OH0A 2WK0A 5EVIB 3SH7A 3GTCA 3VMAA 3GVBA 3IH8A 4KZ9A 4GNUA 3G31A 4S2LA 2Y2GA 3ZVWA 1PWDA 5EECA 2HDQA 2R9WA 4OOMA 2RCXA 2WZXA 1CI9A 1M40A 2ZQ9A 2WGIA 4C3QA 4ZBEA 3BFGA 1K25A 3G2ZA 5G18A 4JXGA 3W4PA 3BYDA 4EBLA 1IYSA 4MEZA 3FKWA 4LENA 4CPKA 3UPNA 5IHVA 4FSFA 4N9LA 4FCFA 2Q9NA 3MFDA 1ONGA 3BFFA 1E25A 1DJBA 1XP4A 4FH2A 4O7DA 3PBTA 5F83A 4JLFA 1Q2QA 4B4ZA 4YINA 1GA0A 1MWTA 1SKFA 3HREA 4Y0OA 3IXHA 3LCEA 2XK1A 2VGKA 1Y54A 4ZDXA 4QHCA 1GA9A 2ZM2A 4X53A 5L2FA 1FR6A 2XFSA 2JC7A 3IH9A 1Q2PA 4OLDA 5CEBA 3MKFA 1IELA 3G32A 3E2LA 1JTGA 4PMAA 1KDWA 5FQIA 3IT9A 5EVIC 5AQBA 2PU2A 4OVDA 3LY3A 4E3LA 1CEGA 2WZZA 5EVIA 1YLPA 1KE3A 2HDRA 3ITBA 1G6AA 4KG6A 4LV1A 4LV0A 3UPPA 4DKIA 2XD1A 4IEDA 1YLYA 4P85A 3N8LA 1K57A 1MPLA 2Z2LB 3E2KA 5GHXA 4BL3A 1ZG6A 1ERMA 3UY6A 3IF6C 1E3UA 1MWSA 1TDLA 5DTKA 5DTTA 5DVAA 1ES4A 2Y2MA 3ZG5A 4Y0TA 3OPLA 3O3VA 3PBNA 3ZNYA 4DE3A 3RXXA 3ISGA 1ES5A 2Y59A 1O07A 3NIAA 3P98A 5EVID 4JF5A 1NY0A 3V39A 3FKVA 4OOYA 4D2OA 1H5XA 3CMZA 1QMEA 2OLUA 1BSGA 5FI6A 1YLJA 2ZQ7A 4JXSA 4PM5A 3W4OA 2Q9MA 4OQIA 4E3IA 1NZUA 5CGSA 5HARA 3IXDA 4PPRA 5AQ7A 4QD4A 4DXBA 1W5DA 3IWQA 3Q81A 3DWZA 4GZBA 2R9XA 3IWOA 2Y2OA 3PAGA 3Q07A 1JWZA 1L0DA 3M2JA 4R23A 1W8QA 1FCMA 1IKGA 3VP1A 5EOOA 4OPRA 1ZKJA 1N4OA 5M18A 1PW1A 3VP2A 1YMSA 1L0FA 4DDSA 1LL9A 5CTMA 2XQZA 5KZHA 2OLVA 2ZC3B 5TFQA 4GD6A 2H10A 1DJAA 4JF6A 5EE8A 3OPHA 4KZ5A 3S4XA 2V20A 3AGEA 1L0GA 5DTSA 1FR1A 3VP0A 5A92A 4S2NC 3MBZA 3MZDA 4WEJA 3PBSA 4Y7PA 5CEDA 1NRFA 2HP5A 3HUOA 5CGWA 1CI8A 2WADA 4KQOA 2QMIA 4OP8A 3G4PA 4N9KA 2EXAA 4UAAA 3UDXA 4ID4A 2DNSA 4P0MA 4KZ3A 2ZM0A 4RYEA 5CRFA 3GMWA 4S2JA 5FATA 3QNBA 3ITAA 1OMEA 4UA7A 4P6BA 1BLSA 3Q1FA 1MBLA 1SDNA 4KZBA 2XFTA 3C7VA 3CZDA 4U0XA 5GLAA 2G2WA 2HDSA 5FDHA 1VQQA 2GDNA 2FFYA 3PBQA 4FH4A 2JCHA 3UDIA 2H0YA 1EWZA 3OCNA 4X69A 4U3TA 4E6XA 5FI7A 1TEMA 3M2KA 4S2PA 2E8IA 2BG1A 4S2IA 2QPNA 2A3UA 3V50A 3NDGA 1E4DA 3HUNA 2Y2KA 1JTDA 1K38A 3GR2A 3MXRA 4M3KA 4WM9A 2Y4AA 3NDEA 4K0WA 3W8KA 1K4EA 1XGIA 1KGEA 2ZD8A 5E2EA 1K56A 5GL9A 4XXRA 5CERA 3UE1A 3EQVA 5A90A 3Q7ZA 1BULA 3G30A 1DJCA 3NY4A 5HL1A 1HZOA 2Y2IA 2EX2A 3LO7A 3Q7VB 5AQ9A 3O86A 2ZQCA 1WE4A 1GHIA 4BL2A 4Z9QA 3UE3A 5CECA 4GN2A 1FSWA 4LV3A 4R4RA 2QZ6A 3N4IA 3C4PA 3A3IA 2ZC5B 1YM1A 1L0EA 2Y2QA 2VGJA 1NXYA 1ALQA 2RL3A 4R0QA 3V3RA 4PM9A 4R3BA 1BLHA 4MNRA 4ZJ1A 1K56D 5KSHA 4OPYA 5FASA 5EVLA 2X01A 2ZMAA 3FYZA 4R4SA 3DWKA 3VOYA 4DDYA 1AXBA 1H8YA 5FA7A 1U60A 5HX9A 5E2HA 4IVKA 2HP6A 3WWXA 4IBRA 3TG9A 1SDEA 1K57C 1WYCA 4UA9A 4EBNA 3UPOA 2WAFA 2G2UA 4LCMA 3WS1A 1JWVA 3BFCA 5GHZA 4DE2A 3V3SA 4KG2A 4OONA 3MZFA 3C5AA 3SS3A 4BD1A 4NK3A 2C5WB 3MXSA 4DRTA 4NETA 5GLDA 1ESUA 5CHJA 4QJGA 1PWCA 1XA7A 4HESA 1G68A 2WKHA 3Q7VA 1LI0A 4LCLA 4EV4A 1Z6FA 1CK3A 2J7VA 2JBFA 4OP5A 2J9OA 2WGVA 3ZHHA 4PM6A 1IKIA 2ZQDA 3I7JA 2X02A 3BLMA 2Y91A 3N8SA 1FCOA 3S1YA 1LL5A 3IXGA 5M19A 3W4QA 4S2OA 4JBFA 4OQ0A 2H0TA 4WZ4A 3UN7A 1YMXA 3FV7A 4JPMA 1K6SA 2HDUA 4ZJ2A 2OSUA 3HLGA 5FQJA 3BM6A 1BLCA 5CTNA 4WZ5C 3ZG8B 4Y0UA 1YLZA 1PYYA 5EOEA 2WUQA 4GDBA 3RJUA 2Y2HA 3M6HA 4WZ5A 3WS2A 5GLCA 3ZG9B 4A5RA 4BLMA 5FQKA 4B88A 1DY6A 2Y55A 5CHUA 3NI9A 4KZ4A 2FFFB 1BZAA 1GHPA 3CG5A 2P74A 4X56A 1GHMA 3HLWA 4C6YA 2HP9A 1KVLA 3IHAA 4ZJ3A 2X71A 2Y2LA 4GDNA 1BUEA 4QB8A 1YLWA 3UE0A 1XGJA 2UWXA 4CJNA 4MBHA 5F82A 2WGWB 5M1AA 1K54C 3A3DA 1K55A 2WKEA 5E2FA 1KDSA 1KGFA 3VOZA 2P9VB 3PBRA 1YLTA 3VFHA 1LLBA 1K54A 3SS4A 5I94A 3WS0A 4QU3A 2I72A 1KGGA 3BLSA 3CJMA 2J9PA 4R3JA 1JVJA 4UA6A 1NJ4A 3OZHA 5TR7A 5AQAA 1LHYA 1GCEA 2EFUA 1QMFA 4GKUA 2XLNA 4HBUA 2EXBA 3JYIA 4OPZA 2Z2MB 1K6RA 1ZC2A 1RP5A 1BTLA 3HL9A 3BECA 4N92A 5EPHA 1HVBA 5DF7A 2XF3A 2XD5A 1EROA 1W8YA 1NZOA 2CC1A 3D4FA 1CEFA 4MBFA 2ZJ9A 3DTMA 4DXCA 5FAPA 1ONHA 3BFDA 1RGZA 3IF5A 4EWFA 4BQMA 2Y2PA 3WRTA 3UO9A 3PTEA 3VP4A 1XXMA 4P87A 1BLPA 3UNWA 3ZFZA 3MKEA 4KQRA 3O87A 2Y2NA 3ZNTA 5HAPA 1VM1A 3ZCZA 3IHBA 2WGWA 5F1FA 4DE1A 5EUAA 4OOLA 3G34A 5E43A 3LEZA 2P9VA 4X55A 1ZG4A 1HTZA 2IWCA 2ZC7A 5DF9A 3VSLA 3WS4A 3SH9A 1XKZA 5E2GA 1KVMA 1NYYA 3BFEA 4N1HA 1MY8A 4WMCD 5JYPA 1IYQA 5FQQA 3ZG7B 4BD0A 1PI4A 1YQSA 4HEFA 5CXWA 5FAOA 2ZQ8A 5TGFA 1RCJA 4JXVA 4QY6A 3IF6B 5KSCA 4JKTA 2XEPA 2XDMA 1JWPA 4KZ6A 4R1GA 5BOHA 4S2MA 3HLCA 3G35A 4C75A 1I2WA 4HBTA 4LV2A 5HAIA 1MXOA 1FCNA 3GSGA 4RX3A 1S6RA 5A93A 2Y2JA 1I5QA 4PM7A 1PI5A 3AGDA 4Q8IA 1XPBA 3HLEA 4X68A 3Q82A 2V2FF 4MBKA 5HFOA 5HAQA 4WELA 1XA1A 1PZPA 3O88A 5FI2A 3BEBA 1BT5A 4KENB 1MWUA 5FAQA 4OKPA 3ZG0A 2DCFA 3VSKA 3HBRA 2XGNA 4WBGA 2XH9A 4ZAMA 4BENA 1NYMA 3PBOA 4X6TA 3HLFA 3SOIA 3TSGA 3C4OA 3NCKA 5HW3A 4U0TA 4MLLA 1W7FA 4UHUA 2IWDA 4DF6A 4E3MA 2HPBA 1S0WA 3OPPA 3N6IA 3FZCA 4GD8A 4H8RA 3A3JA 3GV9A 3IWIA 4KG5A 2EFXA 4E3NA 1EI5A 4KZ8A 2WYXA 2ZM8A 4GOGA 1SHVA 3N7WA 3QNCA 3OC2A 2PU4A 5D3OA 1C3BA 4JXWA 4BJPA 3PAEA 3QHYA 1IYOA 4OPQA 4B4XA 4L0LA 4OQGA 4WEKA 5GHYA 3BRMA 1L2SA 3IF6A 3C7UA 4EQIA 3OPRA 5CGXA 4JF4A 1MWRA 4S2KA 4KZAA 3G2YA 1YT4A 2A49A 3P09A 1WYBA 4N1XA 2BLSA 4EBPA 4IVIA 3A3EA 1KE4A 5F1GA 3MZEA 1M6KA 4E6WA 4DE0A 4XUZA 5DF8A 4QY5A 3HUMA 1PW8A 3SS5A 1E3UD 2WKIA 1ERQA 1IYPA 1PWGA 2EX9A 3GQZA 1FQGA 3HVFA 1SCWA 4IBXA 4KZ7A 2JE5A 3GRJA 1H8ZA 1K55C 3RXWA 1K4FA 4OQHA 3OCLA 5FQMA 3HLBA 1HD8A 2C6WB 4RX2A 1FSYA 3NC8A 4K91A 4EUZA 3ZDJA 4RA7A 3B3XA 1FOFA 2V1ZA 3IQAA 3S22A 2IWBA 5KMWA 3WS5A 4E3JA 4WYYA 5FQ9A 2OV5A 4E3OA 3VP3A 4FD8A 4YFMA 4F94A 1TDGA 5J8XA 2EX8A 2ZC6B 5JYOA 2J8YA 3FWLA 2PBYA 2ZC4B 3ZVTA 3A3FA 1ESIA 5FSRA 4XUXA 1J9MA 2B5RA 5GLBA 1I2SA 4KQQA 3M6BA 5A91A 1LI9A 4ZTKA 3HLDA 4S2NA 3V5MA 1PIOA 1IEMA 1RGYA 3SH8A 1MKIA 2EX6A 1N9BA 2XR0A 3DW0A 1W79A 3AGFA 4K0XA 4WMCA 3VFFA 1ES3A 3TOIA
chains in the Genus database with same CATH superfamily
4LGWA 1TVFA 2ZQAA 3EQUA 4E3KA 1F9IA 3SH7A 5EVIB 3IH8A 4S2LA 3G31A 1DP6A 1PWDA 5HDDA 5EECA 4DMZA 2RCXA 4ZBEA 1D1JA 3BFGA 2YKHA 3IX4A 3LIEA 4CPKA 5IHVA 2O99A 2Q9NA 1XP4A 4FH2A 5CX7A 5F83A 1Q2QA 4B4ZA 4CLCC 3F1PA 4Y0OA 2WKRA 4HJ6A 4QHCA 1GA9A 2PT7A 4X53A 2JC7A 3IH9A 1JTGA 1KDWA 5FQIA 2PU2A 4OVDA 3HJKA 3ITBA 3P7NA 2R78A 5HZHA 3DTIA 1MPLA 4EERA 2Z2LB 4BL3A 1ZG6A 3UY6A 3IF6C 1TDLA 5DVAA 5HD5A 4Y0TA 3OPLA 2VV8A 1MC0A 3NIAA 5EVID 3B42A 3CMZA 1BSGA 2OWHA 2Q9MA 1NLZA 4PPRA 1A0KA 1UGUA 2R9XA 3IWOA 3PAGA 3Q07A 1Y4OA 4H6JA 2PR5A 1PW1A 2M7VA 1L0FA 1LL9A 3BQ8A 2W1TB 5DTSA 1FR1A 3F1NA 1GSVA 4LLOB 2J3WA 4R70A 5CGWA 1CI8A 3MSHA 2EXAA 2DNSA 5CRFA 3CWFA 4S2JA 3QNBA 1BLSA 1MBLA 1NWZA 1D06A 4IUHA 5GLAA 2H28A 3UDIA 4X69A 4U3TA 3M2KA 2PD7A 3V50A 3T4TA 3HUNA 2Y2KA 1K38A 3GR2A 4M3KA 3NDEA 2ZOIA 1K4EA 1XGIA 1KGEA 1K56A 3UE1A 5TBMB 4CLCE 3NY4A 1IOUA 4GN2A 1FSWA 2QZ6A 2VGJA 1ALQA 4GHIB 3V3RA 4R3BA 3LI9A 2X01A 5E2HA 4IVKA 2QWSA 1K57C 4UA9A 3GDIA 4HH3A 3UMDA 3K3CA 4BMWA 5HPIA 2J80A 1ESUA 5CHJA 3NOTC 3QP5A 5F69A 4QJGA 3MQQA 1G68A 1LI0A 4NG2A 4DJ2A 1Z6FA 1CK3A 1S1YA 2WGVA 3IBJA 1S66L 1P97A 4HOIA 3N8SA 5DFYA 4WLAA 3S1YA 2VZWA 2ZL1B 2HF6A 4JBFA 3UN7A 1YMXA 1K6SA 4ZJ2A 3BM6A 3PHYA 2W1RA 4I3JA 2Y2HA 4WF0A 3M6HA 3WS2A 3ZG9B 2M1CA 1ZHHB 1DY6A 1BZAA 1OPXA 3CG5A 4X56A 3CPTB 4ZJ3A 3UE0A 2UWXA 2O9CA 4JGRA 5M1AA 1KDSA 1LLBA 3SS4A 4QU3A 2I72A 1JVJA 1NJ4A 3OZHA 5AQAA 3UB8A 4HBUA 1XFQA 4OPZA 1RP5A 4B93A 1BTLA 3BECA 3TRCA 4EEPA 2XD5A 2CC1A 3D4FA 3W2ZA 2A24B 2ZJ9A 2BASA 4Y2FA 4MN7A 5FAPA 1ONHA 3BFDA 3IF5A 4BQMA 3WRTA 5HWTA 4ARZB 3PTEA 1BLPA 3O87A 3T4QA 1VM1A 2WGWA 3LYXA 1HTZA 1XKZA 5E2GA 1KVMA 3T4OA 3F1OA 3BFEA 4LPZA 5K5BA 3ZG7B 3BY8A 5TGFA 1VEUA 1BYWA 1I2WA 2JKTM 1MXOA 3L7HA 1FCNA 3GSGA 1PI5A 3HLEA 3BEBA 3EOIA 2DCFA 1NYMA 3JVUA 3TSGA 3HLFA 5HW3A 3NCKA 4U0TA 4UHUA 4E3MA 3N6IA 2LB5A 4GD8A 3IWIA 3N7WA 3D72A 5D3OA 1C3BA 1GSXA 4BJPA 1IYOA 4OPQA 4B4XA 4OQGA 5GHYA 1L2SA 3IF6A 4EQIA 3OPRA 5CGXA 4JF4A 2PYPA 3BJNA 4KZAA 3K3DA 2ZOHA 3ICYA 4N1XA 2BLSA 3MZEA 4KQDA 2ACGA 4DE0A 4QY5A 1PW8A 3HVFA 1EW0A 3T4SA 4IBXA 1FQGA 1SCWA 1H8ZA 1K4FA 4OQHA 1FSYA 5EM0A 4K91A 4EUZA 1T1BA 4RA7A 3B3XA 3IQAA 3LIBA 2WKQA 3IS2A 1ZTUA 3LIDA 3VP3A 4YFMA 1TDGA 5JYOA 2ZC4B 3GECA 4XUXA 5GLBA 4O01A 3HLDA 2W3FA 1VETB 3V5MA 4MMNA 4I5SA 4EU0A 1IEMA 4FUWA 1MKIA 4D60A 3DW0A 1W79A 3TOIA 4IUKA 2DRWA 2WAEA 3N8RA 4CLCB 1KE0A 1XX2A 5L07A 4UQIM 2H5SA 1OTAA 3LY4A 5CHMA 4RVAA 3KYQA 1OT6A 3VMAA 4KZ9A 4GNUA 3ZVWA 2Z6DA 2HDQA 2WZXA 1CI9A 2I9VA 2ZQ9A 4MCWA 1K25A 4UQIS 5G18A 3W4PA 1IYSA 4WL9A 3FKWA 3H82B 3PR6A 4FSFA 4YOFA 1E25A 1DP9A 4Y13A 4YINA 1GA0A 4Z1WA 1XJ2A 2XK1A 2KDKA 2VGKA 2VEAA 5L2FA 1FR6A 1Q2PA 3MKFA 4XT2B 2VX8A 3U4LP 5AQBA 1FILA 4Y15A 4E3LA 5EVIA 1YLPA 4FTXA 4LV1A 4DKIA 2XD1A 4HHDA 1K57A 2ZMVA 2DMWA 3IBRA 2EWVA 4DE3A 3O3VA 3ZNYA 4I39A 3RXXA 1O07A 4D2OA 3FKVA 4G3KA 3P01A 5FI6A 2ZQ7A 4PM5A 4P6ZM 2ZBBA 4E3IA 2O0YA 5CGSA 5AQ7A 4QD4A 5J7EA 2LB9A 1W5DA 3Q81A 4GS9B 2ZMFA 4R3AA 1L3LA 2Y2OA 5HD3A 1JWZA 1L0DA 3SZTA 1FCMA 1IKGA 4OPRA 1N4OA 4KUKA 4DDSA 1P9WA 2QHKA 2HV1A 4EXOA 4JF6A 4KZ5A 2PBDP 3HJIA 2JKRI 4WEJA 1VB6A 1HLUP 4Y7PA 2WADA 4KQOA 4DJ3A 1S67L 4N9KA 4P0MA 2ZM0A 1OMEA 4HJ4A 3NULA 1YPRA 2XFTA 2PHYA 2FFYA 2JCHA 3NDGA 2W1TA 3MXRA 2Y4AA 3W8KA 5KIZA 3CAXA 3KYZA 2ZD8A 5GL9A 5E2EA 3CITA 5A90A 3Q7ZA 1DJCA 5HL1A 2EX2A 4BWIA 3Q7VB 3SW1A 4I3IA 3LR5A 1WE4A 4BL2A 4LV3A 4R4RA 3N4IA 2ZC5B 1YM1A 1L0EA 5C5KA 2RL3A 3MQ0A 1V9ZA 4Y17A 2ZMAA 3O5YA 4R4SA 1AXBA 1TD5A 1H8YA 2D01A 2HP6A 2WAFA 4LCMA 1ACFA 5AVFA 1AWIA 3SS3A 4BD1A 4DRTA 4NETA 5GLDA 4ME4A 5TBMA 1PWCA 1XA7A 1PFLA 4EV4A 1CJFA 3ZQ5A 4PM6A 1IKIA 3I7JA 4YWZA 4GHIA 3W4QA 2H0TA 3FV7A 4JPMA 5FQJA 4R6LA 1N9NA 1BLCA 3RJUA 1PYYA 3LICA 5FL3A 4WZ5A 4NXGA 4DN0A 2FFFB 1F2KA 3HLWA 4C6YA 3V67A 2HP9A 1KVLA 1K0KA 3DTEA 2JKGA 1K54C 2WKEA 1YLTA 2NUTC 5I94A 1DRMA 3MQOA 4R3JA 1GCEA 2EFUA 4GKUA 2XLNA 2P08A 3H7WB 3JYIA 2Z2MB 1K6RA 1ZC2A 2ZL1A 2VA0A 2GX5A 5EPHA 5DF7A 3T12B 1CEFA 4MBFA 3DTMA 3F1PB 3VP4A 3CPTA 4GLQA 3MKEA 4KQRA 3ZNTA 5HAPA 3IHBA 4DE1A 2QYBA 4OOLA 5E43A 2IWCA 5IS1A 3NECA 5JYPA 1IYQA 1LSXA 5FQQA 1PI4A 4MN6A 4HEFA 5FAOA 3FPWA 2ZQ8A 2KX6A 2WKPA 3VV4A 1JWPA 3G35A 1J3WA 3C8CA 4C75A 3LR0A 2A24A 3LUQA 4HBTA 5HAIA 4LRYC 3AGDA 3Q82A 5HAQA 5AJGA 3E0YA 1XA1A 3B33A 5FI2A 1CF0A 5HPFA 3VSKA 3HBRA 2GZAA 4WBGA 1H0MA 4ZAMA 4BENA 3T1XA 3KO6A 3T1SA 2P7JA 4MLLA 1W7FA 2IWDA 2PAVP 2Y8HA 1S0WA 3OPPA 3FZCA 1V9YA 4O8GA 3QP2A 4KZ8A 4GOGA 5EV0A 2PU4A 3QHYA 2HJ9C 3BRMA 1MWRA 4S2KA 1YT4A 2A49A 1WYBA 1CQAA 5HSQA 5L09A 3A3EA 1T1CA 2QKPA 4Q0JA 1KE4A 5F1GA 5HDSA 1TS8A 4LRZE 3HUMA 3KSGA 1IYPA 1PWGA 5G4YA 2JE5A 3GRJA 4ESPA 3OCLA 2D02A 5KMWA 3WS5A 4E3JA 2VLGA 4FD8A 4F94A 3PYPA 2QJ5A 5J8XA 2EX8A 1VHMA 3ZVTA 4NXBA 2HZ5A 3KSHA 2HGVA 3M6BA 3TW8A 1MZUA 2XSSA 1KOUA 2YKFA 3S7OA 1RGYA 3NOPC 4X25A 4K0XA 4WMCA 5DFXA 3ZGAB 3WRZA 5DJUA 1NRJA 3NBLA 5DJTA 5U47A 4OLGA 3IXBA 1ES2A 4HY8A 4ETZA 2V0WA 4PM8A 5EM1A 4LFUA 4GB7A 3EGXC 2K7SA 4OH0A 3GTCA 3GVBA 4EEUA 5I5LA 1M40A 2WGIA 4C3QA 3RH8B 4JXGA 4EBLA 3BY9A 2NUPC 4MEZA 4LENA 4Q0HA 3UPNA 1VETA 1WA9A 3A0VA 4FCFA 3BFFA 4JLFA 1MWTA 3HREA 4L9FA 4HNBA 3IXHA 3LCEA 3LR3A 4ZDXA 1Z09A 4CLCA 2XFSA 5FEFA 1XJ4A 3FG8A 5HDCA 1IELA 3E2LA 3OBFA 4PMAA 2XROA 4NXFA 2OAQ1 3E4OA 1CEGA 2WZZA 1S4SA 2HDRA 4LV0A 1G6OA 4IHQA 3UPPA 2GNXA 3N8LA 1LSWA 4AFIA 1S1ZA 1E3UA 3LIAA 3UB5P 5DTKA 5DTTA 3H9WA 3H82A 3ZG5A 3PBNA 3UB9A 3E4PA 1NLYA 5J4EA 1OTDA 1TS6A 4FOFA 4HJ3A 3P98A 3V39A 1NY0A 4OOYA 1H5XA 1QMEA 3HCYA 1YLJA 4OQIA 2G7UA 1H8MA 4JGQA 4XT2A 3IWQA 3DWZA 4GZBA 4HP9A 3UE6A 4M4XA 4R23A 5HWWA 2HJEA 3LGOA 5M18A 3C2WA 2KOIA 3OLOA 3VP2A 3ULFA 2XQZA 5KZHA 2ZC3B 3CI6A 4GD6A 5EE8A 1L0GA 4S2NC 3MBZA 1LL8A 3B47A 3PBSA 2HP5A 3IX8A 3TJZC 2QMIA 3MXQA 4OP8A 3G4PA 3UDXA 4UAAA 4JGPA 4KZ3A 4RYEA 5FATA 1T19A 3ITAA 3LFVA 4P6BA 1SDNA 3CZDA 4U0XA 4GS9A 2OWJA 1VQQA 4EQ1A 2GDNA 4UEYA 5HL6A 3PBQA 4FH4A 2XRNA 5FI7A 1TEMA 4S2PA 2E8IA 2QPNA 1E4DA 3D3OA 1JTDA 3R7WB 2EA9A 3PXPA 3T4KA 4XXRA 1LSVA 1BULA 3G30A 1HZOA 1OTBA 5AQ9A 3O86A 2ZQCA 3UE3A 5CECA 3QP4A 3C4PA 1N9LA 1T1AA 3BWLA 1Y28A 4LRXC 4PM9A 1BLHA 5KSHA 4IJGA 4OPYA 5FASA 4O0PA 5HX9A 1U60A 4IBRA 3TG9A 1SDEA 1WYCA 4EBNA 4HP4A 1OJ5A 4JGOA 2Q0OA 5GHZA 3JPUA 4KG2A 1X0OA 3MZFA 3C5AA 3DBAA 4ZRRA 3Q7VA 2JKFA 3IS2B 3EEHA 2JBFA 4OP5A 2J9OA 1LT0A 3ZHHA 3CUEC 2ZQDA 5AVEA 2X02A 3BLMA 2Y91A 1FCOA 3IXGA 4OQ0A 2HDUA 1N9OA 2OSUA 3HLGA 4Q0IA 3ZG8B 4Y0UA 1YLZA 5EOEA 4GDBA 5J3WA 3K2NA 4A5RA 5GLCA 4BLMA 5F68A 4B88A 5CHUA 3NI9A 3NOUC 1GHMA 3KSIA 3IHAA 3NHQA 3MMHA 1YLWA 4MBHA 5F82A 3KSFA 3A3DA 3BW6A 1KGFA 3VOZA 2P9VB 3PBRA 3VFHA 2J3TD 3WS0A 1PRQA 3CJMA 3BLSA 3UB6A 5TR7A 4QPRA 1QMFA 2EXBA 2UV0E 1HVBA 5LBRA 3MF0A 2XF3A 1W8YA 5FEGA 3S7QA 1XJ3A 1D7EA 1YAXA 3UO9A 4F3LB 3KX0X 4P87A 3ZFZA 4BBVA 2L0WA 5F1FA 4PKYG 3G34A 2K2NA 2VJWA 1ZG4A 3VSLA 3SH9A 4N1HA 3VOLA 1W63Q 4BD0A 3H7WA 1ODVA 2W3DA 3G6OA 1RCJA 5KSCA 2B02A 4R1GA 3HLCA 5DKLA 4LV2A 1S6RA 5A93A 4PM7A 4Q8IA 2XA7M 1XPBA 4MBKA 5HFOA 5F6AA 1PZPA 1YSPA 1DP8A 1BT5A 1MWUA 5FAQA 4OKPA 3PBOA 4X6TA 4EW7A 2O9BA 4DF6A 4Y5FA 4KG5A 3QP8A 3A3JA 3GV9A 2XA7S 2WYXA 2ZM8A 4X1MA 3QNCA 4HI4A 4EETB 2L4RA 4II7A 5FDSA 4BBTA 2JKTI 3C7UA 2J3TC 2W3HA 3G2YA 4IVIA 4GW9A 3TE8A 1SKOB 4E6WA 2M7UA 1PNEA 1UWPX 1K55C 5FQMA 5TJJA 3HLBA 2C6WB 3NC8A 3OOVA 3ZDJA 2IWBA 1P0ZA 4E3OA 4GCZA 1OTIA 2ZC6B 2J8YA 2PBYA 1ESIA 4GJ4A 3EGDC 1J9MA 4KQQA 4S2NA 2XR0A 2PYRA 3VE4A 3AGFA 4B9OA 2IA2A 2ZLYA 1YSQA 3UDFA 3BQAA 1FIKA 1O7EA 1PZOA 5IU1A 2JHEA 4HH2A 4MN5A 4RQ9A 2FZ0A 2WK0A 2PRFA 2Y2GA 3D9YA 2R9WA 4I38A 1OJGA 4OOMA 2CMNA 3G2ZA 3BYDA 1F98A 4N9LA 4WN5A 3MFDA 1ONGA 1DJBA 4O7DA 3PBTA 2V8CA 1S4RA 3LR4A 1SKFA 1Y54A 4ARZA 3LEQA 2W3EA 2ZM2A 4I3AA 4OLDA 5CEBA 3MS6A 4EUVA 2P04A 3MFXA 3G32A 2OOLA 3IT9A 5EVIC 2VK3A 3C38A 3LY3A 4H6JB 4PAUA 3S7NA 1KE3A 4MDZA 1G6AA 4KG6A 4IEDA 1YLYA 4P85A 3E2KA 5GHXA 1ERMA 2FH5A 1MWSA 2V1BA 1ES4A 3VE3A 2Y2MA 3F1NB 3ISGA 1ES5A 2Y59A 2JKRM 4JF5A 1SZVA 3L9KA 2OLUA 4JXSA 1IFQA 3W4OA 1NZUA 5HARA 3CUEA 3IXDA 4DXBA 4ETXA 4Y3IA 2A2LA 3M2JA 1W8QA 2V9AA 3VP1A 5EOOA 1ZKJA 2VKSA 1YMSA 5CTMA 2VV6A 2OLVA 5TFQA 2H10A 1DJAA 3C30A 3OPHA 3S4XA 1H3QA 2V20A 3AGEA 3VP0A 5A92A 3MZDA 4L9EA 5CEDA 1NRFA 5DKKA 3HUOA 2W3GA 4ID4A 3GMWA 1G5UA 2JN7A 4UA7A 4G3WA 3Q1FA 4KZBA 3C7VA 3RFBA 2G2WA 2HDSA 5FDHA 4L9GA 3MJQA 2H0YA 1EWZA 3OCNA 4E6XA 2BG1A 4S2IA 2A3UA 4WM9A 4K0WA 5CERA 4G3VA 3EQVA 2GJ3A 1GSWA 3T4LA 2Y2IA 3LO7A 5F5YA 3QP6A 2V8FA 1GHIA 4Z9QA 1F5MA 3A3IA 2MJ6A 2Y2QA 1OT9A 1NXYA 4R0QA 4MNRA 4ZJ1A 1K56D 5EVLA 2W27A 3FYZA 3DWKA 3VOYA 4DDYA 5FA7A 3WWXA 3UPOA 2G2UA 3QP1A 3WS1A 1JWVA 3BFCA 4NKPA 4DE2A 3V3SA 3R7WA 4OONA 1MKMA 2KLIA 2OAP1 4NK3A 2C5WB 3MXSA 1TS0A 4HESA 3A0RA 2WKHA 3T50A 4LCLA 2B18A 3DTKA 2E8JA 2J7VA 3CHWP 3E98A 1W63M 3T1RA 3RTYA 1LL5A 5M19A 1XJ6A 4WZ4A 2EWWA 1P9RA 5CTNA 4WZ5C 2WUQA 4NXEA 3MR0A 4X1LA 2QJ7A 5FQKA 2W0NA 2VGLM 3UMEA 2Y55A 4KZ4A 1GHPA 3LI8A 2P74A 5A8BA 2B95A 4KUOA 2X71A 2Y2LA 4GDNA 1BUEA 4QB8A 1TF1A 1XGJA 3ZYTA 4CJNA 2WGWB 1K55A 5E2FA 5HWVA 4PHTA 1K54A 1KGGA 2J9PA 2VGLS 3F1OB 4UA6A 2L1MA 1LHYA 1OTEA 2PDRA 5EVEA 3IX3A 3HL9A 4N92A 1VEUB 1EROA 1NZOA 2Y79A 3FC7A 4DXCA 1RGZA 3R4KA 4NEED 4EWFA 2Y2PA 5MC7A 1XXMA 4CQHA 3UNWA 4HQAA 5L10A 2Y2NA 3ZCZA 2BTFP 5EUAA 2K31A 3LEZA 2P9VA 4X55A 2ZC7A 5DF9A 3WS4A 4QWOA 1NYYA 1MY8A 4YNRA 4WMCD 1YQSA 3S7PA 4K08A 5CXWA 4JXVA 4QY6A 3IF6B 3A0SA 2XEPA 2XDMA 4JKTA 4KZ6A 5BOHA 4S2MA 5L8MA 3FPVA 4RX3A 2Y2JA 1I5QA 4X68A 2V2FF 4WELA 4F3LA 3KYEA 3O88A 5EFWA 4KENB 3ZG0A 2XGNA 2O9AA 2XH9A 3SOIA 1G28A 3T1QB 3C4OA 2HPBA 4E04A 4H8RA 2EFXA 4E3NA 1EI5A 1YKDA 1UWNX 1SHVA 4PKYA 4CLCD 3OC2A 4JXWA 3PAEA 4L0LA 4WEKA 2V0UA 4HIAA 1JNUA 3DAVA 4WUJA 3EEAA 3P09A 4EBPA 3NJAA 2AVXA 1T18A 4BBUA 1M6KA 3E4QA 4XUZA 5DF8A 3UB7A 3SS5A 3T4JA 1E3UD 2WKIA 1ERQA 3GQZA 1XFNA 4S2OA 4KZ7A 2EX9A 4EESA 5G4ZA 3RXWA 4RX2A 1HD8A 1STZA 1TS7A 1FOFA 2V1ZA 2Z6CA 3S22A 4WYYA 3U2AA 5FQ9A 2OV5A 2VV7A 4P6ZS 2INWA 3FWLA 3LIFA 3A3FA 3CLOA 5FSRA 5IT5A 4R38A 2B5RA 1I2SA 5A91A 1LI9A 4ZTKA 3JVVA 1PIOA 3SH8A 2EX6A 1N9BA 2PR6A 2PD8A 3VFFA 1ES3A 1SKOA 3EWKA 2V1AA
chains in the Genus database with same CATH topology
2ZLYA 3ZGAB 3WRZA 2DRWA 2WAEA 3N8RA 3NBLA 1KE0A 3UDFA 1XX2A 5U47A 1TVFA 4OLGA 2H5SA 3IXBA 1ES2A 1O7EA 1PZOA 3LY4A 5CHMA 4PM8A 2ZQAA 3EQUA 4GB7A 4RVAA 4E3KA 4OH0A 2WK0A 5EVIB 3SH7A 3GTCA 3VMAA 3GVBA 3IH8A 4KZ9A 4GNUA 3G31A 4S2LA 2Y2GA 3ZVWA 1PWDA 5EECA 2HDQA 2R9WA 4OOMA 2RCXA 2WZXA 1CI9A 1M40A 2ZQ9A 2WGIA 4C3QA 4ZBEA 3BFGA 1K25A 3G2ZA 5G18A 4JXGA 3W4PA 3BYDA 4EBLA 1IYSA 4MEZA 3FKWA 4LENA 4CPKA 3UPNA 5IHVA 4FSFA 4N9LA 4FCFA 2Q9NA 3MFDA 1ONGA 3BFFA 1E25A 1DJBA 1XP4A 4FH2A 4O7DA 3PBTA 5F83A 4JLFA 1Q2QA 4B4ZA 4YINA 1GA0A 1MWTA 1SKFA 3HREA 4Y0OA 3IXHA 3LCEA 2XK1A 2VGKA 1Y54A 4ZDXA 4QHCA 1GA9A 2ZM2A 4X53A 5L2FA 1FR6A 2XFSA 2JC7A 3IH9A 1Q2PA 4OLDA 5CEBA 3MKFA 1IELA 3G32A 3E2LA 1JTGA 4PMAA 1KDWA 5FQIA 3IT9A 5EVIC 5AQBA 2PU2A 4OVDA 3LY3A 4E3LA 1CEGA 2WZZA 5EVIA 1YLPA 1KE3A 2HDRA 3ITBA 1G6AA 4KG6A 4LV1A 4LV0A 3UPPA 4DKIA 2XD1A 4IEDA 1YLYA 4P85A 3N8LA 1K57A 1MPLA 2Z2LB 3E2KA 5GHXA 4BL3A 1ZG6A 1ERMA 3UY6A 3IF6C 1E3UA 1MWSA 1TDLA 5DTKA 5DTTA 5DVAA 1ES4A 2Y2MA 3ZG5A 4Y0TA 3OPLA 3O3VA 3PBNA 3ZNYA 4DE3A 3RXXA 3ISGA 1ES5A 2Y59A 1O07A 3NIAA 3P98A 5EVID 4JF5A 1NY0A 3V39A 3FKVA 4OOYA 4D2OA 1H5XA 3CMZA 1QMEA 2OLUA 1BSGA 5FI6A 1YLJA 2ZQ7A 4JXSA 4PM5A 3W4OA 2Q9MA 4OQIA 4E3IA 1NZUA 5CGSA 5HARA 3IXDA 4PPRA 5AQ7A 4QD4A 4DXBA 1W5DA 3IWQA 3Q81A 3DWZA 4GZBA 2R9XA 3IWOA 2Y2OA 3PAGA 3Q07A 1JWZA 1L0DA 3M2JA 4R23A 1W8QA 1FCMA 1IKGA 3VP1A 5EOOA 4OPRA 1ZKJA 1N4OA 5M18A 1PW1A 3VP2A 1YMSA 1L0FA 4DDSA 1LL9A 5CTMA 2XQZA 5KZHA 2OLVA 2ZC3B 5TFQA 4GD6A 2H10A 1DJAA 4JF6A 5EE8A 3OPHA 4KZ5A 3S4XA 2V20A 3AGEA 1L0GA 5DTSA 1FR1A 3VP0A 5A92A 4S2NC 3MBZA 3MZDA 4WEJA 3PBSA 4Y7PA 5CEDA 1NRFA 2HP5A 3HUOA 5CGWA 1CI8A 2WADA 4KQOA 2QMIA 4OP8A 3G4PA 4N9KA 2EXAA 4UAAA 3UDXA 4ID4A 2DNSA 4P0MA 4KZ3A 2ZM0A 4RYEA 5CRFA 3GMWA 4S2JA 5FATA 3QNBA 3ITAA 1OMEA 4UA7A 4P6BA 1BLSA 3Q1FA 1MBLA 1SDNA 4KZBA 2XFTA 3C7VA 3CZDA 4U0XA 5GLAA 2G2WA 2HDSA 5FDHA 1VQQA 2GDNA 2FFYA 3PBQA 4FH4A 2JCHA 3UDIA 2H0YA 1EWZA 3OCNA 4X69A 4U3TA 4E6XA 5FI7A 1TEMA 3M2KA 4S2PA 2E8IA 2BG1A 4S2IA 2QPNA 2A3UA 3V50A 3NDGA 1E4DA 3HUNA 2Y2KA 1JTDA 1K38A 3GR2A 3MXRA 4M3KA 4WM9A 2Y4AA 3NDEA 4K0WA 3W8KA 1K4EA 1XGIA 1KGEA 2ZD8A 5E2EA 1K56A 5GL9A 4XXRA 5CERA 3UE1A 3EQVA 5A90A 3Q7ZA 1BULA 3G30A 1DJCA 3NY4A 5HL1A 1HZOA 2Y2IA 2EX2A 3LO7A 3Q7VB 5AQ9A 3O86A 2ZQCA 1WE4A 1GHIA 4BL2A 4Z9QA 3UE3A 5CECA 4GN2A 1FSWA 4LV3A 4R4RA 2QZ6A 3N4IA 3C4PA 3A3IA 2ZC5B 1YM1A 1L0EA 2Y2QA 2VGJA 1NXYA 1ALQA 2RL3A 4R0QA 3V3RA 4PM9A 4R3BA 1BLHA 4MNRA 4ZJ1A 1K56D 5KSHA 4OPYA 5FASA 5EVLA 2X01A 2ZMAA 3FYZA 4R4SA 3DWKA 3VOYA 4DDYA 1AXBA 1H8YA 5FA7A 1U60A 5HX9A 5E2HA 4IVKA 2HP6A 3WWXA 4IBRA 3TG9A 1SDEA 1K57C 1WYCA 4UA9A 4EBNA 3UPOA 2WAFA 2G2UA 4LCMA 3WS1A 1JWVA 3BFCA 5GHZA 4DE2A 3V3SA 4KG2A 4OONA 3MZFA 3C5AA 3SS3A 4BD1A 4NK3A 2C5WB 3MXSA 4DRTA 4NETA 5GLDA 1ESUA 5CHJA 4QJGA 1PWCA 1XA7A 4HESA 1G68A 2WKHA 3Q7VA 1LI0A 4LCLA 4EV4A 1Z6FA 1CK3A 2J7VA 2JBFA 4OP5A 2J9OA 2WGVA 3ZHHA 4PM6A 1IKIA 2ZQDA 3I7JA 2X02A 3BLMA 2Y91A 3N8SA 1FCOA 3S1YA 1LL5A 3IXGA 5M19A 3W4QA 4S2OA 4JBFA 4OQ0A 2H0TA 4WZ4A 3UN7A 1YMXA 3FV7A 4JPMA 1K6SA 2HDUA 4ZJ2A 2OSUA 3HLGA 5FQJA 3BM6A 1BLCA 5CTNA 4WZ5C 3ZG8B 4Y0UA 1YLZA 1PYYA 5EOEA 2WUQA 4GDBA 3RJUA 2Y2HA 3M6HA 4WZ5A 3WS2A 5GLCA 3ZG9B 4A5RA 4BLMA 5FQKA 4B88A 1DY6A 2Y55A 5CHUA 3NI9A 4KZ4A 2FFFB 1BZAA 1GHPA 3CG5A 2P74A 4X56A 1GHMA 3HLWA 4C6YA 2HP9A 1KVLA 3IHAA 4ZJ3A 2X71A 2Y2LA 4GDNA 1BUEA 4QB8A 1YLWA 3UE0A 1XGJA 2UWXA 4CJNA 4MBHA 5F82A 2WGWB 5M1AA 1K54C 3A3DA 1K55A 2WKEA 5E2FA 1KDSA 1KGFA 3VOZA 2P9VB 3PBRA 1YLTA 3VFHA 1LLBA 1K54A 3SS4A 5I94A 3WS0A 4QU3A 2I72A 1KGGA 3BLSA 3CJMA 2J9PA 4R3JA 1JVJA 4UA6A 1NJ4A 3OZHA 5TR7A 5AQAA 1LHYA 1GCEA 2EFUA 1QMFA 4GKUA 2XLNA 4HBUA 2EXBA 3JYIA 4OPZA 2Z2MB 1K6RA 1ZC2A 1RP5A 1BTLA 3HL9A 3BECA 4N92A 5EPHA 1HVBA 5DF7A 2XF3A 2XD5A 1EROA 1W8YA 1NZOA 2CC1A 3D4FA 1CEFA 4MBFA 2ZJ9A 3DTMA 4DXCA 5FAPA 1ONHA 3BFDA 1RGZA 3IF5A 4EWFA 4BQMA 2Y2PA 3WRTA 3UO9A 3PTEA 3VP4A 1XXMA 4P87A 1BLPA 3UNWA 3ZFZA 3MKEA 4KQRA 3O87A 2Y2NA 3ZNTA 5HAPA 1VM1A 3ZCZA 3IHBA 2WGWA 5F1FA 4DE1A 5EUAA 4OOLA 3G34A 5E43A 3LEZA 2P9VA 4X55A 1ZG4A 1HTZA 2IWCA 2ZC7A 5DF9A 3VSLA 3WS4A 3SH9A 1XKZA 5E2GA 1KVMA 1NYYA 3BFEA 4N1HA 1MY8A 4WMCD 5JYPA 1IYQA 5FQQA 3ZG7B 4BD0A 1PI4A 1YQSA 4HEFA 5CXWA 5FAOA 2ZQ8A 5TGFA 1RCJA 4JXVA 4QY6A 3IF6B 5KSCA 4JKTA 2XEPA 2XDMA 1JWPA 4KZ6A 4R1GA 5BOHA 4S2MA 3HLCA 3G35A 4C75A 1I2WA 4HBTA 4LV2A 5HAIA 1MXOA 1FCNA 3GSGA 4RX3A 1S6RA 5A93A 2Y2JA 1I5QA 4PM7A 1PI5A 3AGDA 4Q8IA 1XPBA 3HLEA 4X68A 3Q82A 2V2FF 4MBKA 5HFOA 5HAQA 4WELA 1XA1A 1PZPA 3O88A 5FI2A 3BEBA 1BT5A 4KENB 1MWUA 5FAQA 4OKPA 3ZG0A 2DCFA 3VSKA 3HBRA 2XGNA 4WBGA 2XH9A 4ZAMA 4BENA 1NYMA 3PBOA 4X6TA 3HLFA 3SOIA 3TSGA 3C4OA 3NCKA 5HW3A 4U0TA 4MLLA 1W7FA 4UHUA 2IWDA 4DF6A 4E3MA 2HPBA 1S0WA 3OPPA 3N6IA 3FZCA 4GD8A 4H8RA 3A3JA 3GV9A 3IWIA 4KG5A 2EFXA 4E3NA 1EI5A 4KZ8A 2WYXA 2ZM8A 4GOGA 1SHVA 3N7WA 3QNCA 3OC2A 2PU4A 5D3OA 1C3BA 4JXWA 4BJPA 3PAEA 3QHYA 1IYOA 4OPQA 4B4XA 4L0LA 4OQGA 4WEKA 5GHYA 3BRMA 1L2SA 3IF6A 3C7UA 4EQIA 3OPRA 5CGXA 4JF4A 1MWRA 4S2KA 4KZAA 3G2YA 1YT4A 2A49A 3P09A 1WYBA 4N1XA 2BLSA 4EBPA 4IVIA 3A3EA 1KE4A 5F1GA 3MZEA 1M6KA 4E6WA 4DE0A 4XUZA 5DF8A 4QY5A 3HUMA 1PW8A 3SS5A 1E3UD 2WKIA 1ERQA 1IYPA 1PWGA 2EX9A 3GQZA 1FQGA 3HVFA 1SCWA 4IBXA 4KZ7A 2JE5A 3GRJA 1H8ZA 1K55C 3RXWA 1K4FA 4OQHA 3OCLA 5FQMA 3HLBA 1HD8A 2C6WB 4RX2A 1FSYA 3NC8A 4K91A 4EUZA 3ZDJA 4RA7A 3B3XA 1FOFA 2V1ZA 3IQAA 3S22A 2IWBA 5KMWA 3WS5A 4E3JA 4WYYA 5FQ9A 2OV5A 4E3OA 3VP3A 4FD8A 4YFMA 4F94A 1TDGA 5J8XA 2EX8A 2ZC6B 5JYOA 2J8YA 3FWLA 2PBYA 2ZC4B 3ZVTA 3A3FA 1ESIA 5FSRA 4XUXA 1J9MA 2B5RA 5GLBA 1I2SA 4KQQA 3M6BA 5A91A 1LI9A 4ZTKA 3HLDA 4S2NA 3V5MA 1PIOA 1IEMA 1RGYA 3SH8A 1MKIA 2EX6A 1N9BA 2XR0A 3DW0A 1W79A 3AGFA 4K0XA 4WMCA 3VFFA 1ES3A 3TOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZLY A;  3ZGA B;  3WRZ A;  2DRW A;  2WAE A;  3N8R A;  3NBL A;  1KE0 A;  3UDF A;  1XX2 A;  5U47 A;  1TVF A;  4OLG A;  2H5S A;  3IXB A;  1ES2 A;  1O7E A;  1PZO A;  3LY4 A;  5CHM A;  4PM8 A;  2ZQA A;  3EQU A;  4GB7 A;  4RVA A;  4E3K A;  4OH0 A;  2WK0 A;  5EVI B;  3SH7 A;  3GTC A;  3VMA A;  3GVB A;  3IH8 A;  4KZ9 A;  4GNU A;  3G31 A;  4S2L A;  2Y2G A;  3ZVW A;  1PWD A;  5EEC A;  2HDQ A;  2R9W A;  4OOM A;  2RCX A;  2WZX A;  1CI9 A;  1M40 A;  2ZQ9 A;  2WGI A;  4C3Q A;  4ZBE A;  3BFG A;  1K25 A;  3G2Z A;  5G18 A;  4JXG A;  3W4P A;  3BYD A;  4EBL A;  1IYS A;  4MEZ A;  3FKW A;  4LEN A;  4CPK A;  3UPN A;  5IHV A;  4FSF A;  4N9L A;  4FCF A;  2Q9N A;  3MFD A;  1ONG A;  3BFF A;  1E25 A;  1DJB A;  1XP4 A;  4FH2 A;  4O7D A;  3PBT A;  5F83 A;  4JLF A;  1Q2Q A;  4B4Z A;  4YIN A;  1GA0 A;  1MWT A;  1SKF A;  3HRE A;  4Y0O A;  3IXH A;  3LCE A;  2XK1 A;  2VGK A;  1Y54 A;  4ZDX A;  4QHC A;  1GA9 A;  2ZM2 A;  4X53 A;  5L2F A;  1FR6 A;  2XFS A;  2JC7 A;  3IH9 A;  1Q2P A;  4OLD A;  5CEB A;  3MKF A;  1IEL A;  3G32 A;  3E2L A;  1JTG A;  4PMA A;  1KDW A;  5FQI A;  3IT9 A;  5EVI C;  5AQB A;  2PU2 A;  4OVD A;  3LY3 A;  4E3L A;  1CEG A;  2WZZ A;  5EVI A;  1YLP A;  1KE3 A;  2HDR A;  3ITB A;  1G6A A;  4KG6 A;  4LV1 A;  4LV0 A;  3UPP A;  4DKI A;  2XD1 A;  4IED A;  1YLY A;  4P85 A;  3N8L A;  1K57 A;  1MPL A;  2Z2L B;  3E2K A;  5GHX A;  4BL3 A;  1ZG6 A;  1ERM A;  3UY6 A;  3IF6 C;  1E3U A;  1MWS A;  1TDL A;  5DTK A;  5DTT A;  5DVA A;  1ES4 A;  2Y2M A;  3ZG5 A;  4Y0T A;  3OPL A;  3O3V A;  3PBN A;  3ZNY A;  4DE3 A;  3RXX A;  3ISG A;  1ES5 A;  2Y59 A;  1O07 A;  3NIA A;  3P98 A;  5EVI D;  4JF5 A;  1NY0 A;  3V39 A;  3FKV A;  4OOY A;  4D2O A;  1H5X A;  3CMZ A;  1QME A;  2OLU A;  1BSG A;  5FI6 A;  1YLJ A;  2ZQ7 A;  4JXS A;  4PM5 A;  3W4O A;  2Q9M A;  4OQI A;  4E3I A;  1NZU A;  5CGS A;  5HAR A;  3IXD A;  4PPR A;  5AQ7 A;  4QD4 A;  4DXB A;  1W5D A;  3IWQ A;  3Q81 A;  3DWZ A;  4GZB A;  2R9X A;  3IWO A;  2Y2O A;  3PAG A;  3Q07 A;  1JWZ A;  1L0D A;  3M2J A;  4R23 A;  1W8Q A;  1FCM A;  1IKG A;  3VP1 A;  5EOO A;  4OPR A;  1ZKJ A;  1N4O A;  5M18 A;  1PW1 A;  3VP2 A;  1YMS A;  1L0F A;  4DDS A;  1LL9 A;  5CTM A;  2XQZ A;  5KZH A;  2OLV A;  2ZC3 B;  5TFQ A;  4GD6 A;  2H10 A;  1DJA A;  4JF6 A;  5EE8 A;  3OPH A;  4KZ5 A;  3S4X A;  2V20 A;  3AGE A;  1L0G A;  5DTS A;  1FR1 A;  3VP0 A;  5A92 A;  4S2N C;  3MBZ A;  3MZD A;  4WEJ A;  3PBS A;  4Y7P A;  5CED A;  1NRF A;  2HP5 A;  3HUO A;  5CGW A;  1CI8 A;  2WAD A;  4KQO A;  2QMI A;  4OP8 A;  3G4P A;  4N9K A;  2EXA A;  4UAA A;  3UDX A;  4ID4 A;  2DNS A;  4P0M A;  4KZ3 A;  2ZM0 A;  4RYE A;  5CRF A;  3GMW A;  4S2J A;  5FAT A;  3QNB A;  3ITA A;  1OME A;  4UA7 A;  4P6B A;  1BLS A;  3Q1F A;  1MBL A;  1SDN A;  4KZB A;  2XFT A;  3C7V A;  3CZD A;  4U0X A;  5GLA A;  2G2W A;  2HDS A;  5FDH A;  1VQQ A;  2GDN A;  2FFY A;  3PBQ A;  4FH4 A;  2JCH A;  3UDI A;  2H0Y A;  1EWZ A;  3OCN A;  4X69 A;  4U3T A;  4E6X A;  5FI7 A;  1TEM A;  3M2K A;  4S2P A;  2E8I A;  2BG1 A;  4S2I A;  2QPN A;  2A3U A;  3V50 A;  3NDG A;  1E4D A;  3HUN A;  2Y2K A;  1JTD A;  1K38 A;  3GR2 A;  3MXR A;  4M3K A;  4WM9 A;  2Y4A A;  3NDE A;  4K0W A;  3W8K A;  1K4E A;  1XGI A;  1KGE A;  2ZD8 A;  5E2E A;  1K56 A;  5GL9 A;  4XXR A;  5CER A;  3UE1 A;  3EQV A;  5A90 A;  3Q7Z A;  1BUL A;  3G30 A;  1DJC A;  3NY4 A;  5HL1 A;  1HZO A;  2Y2I A;  2EX2 A;  3LO7 A;  3Q7V B;  5AQ9 A;  3O86 A;  2ZQC A;  1WE4 A;  1GHI A;  4BL2 A;  4Z9Q A;  3UE3 A;  5CEC A;  4GN2 A;  1FSW A;  4LV3 A;  4R4R A;  2QZ6 A;  3N4I A;  3C4P A;  3A3I A;  2ZC5 B;  1YM1 A;  1L0E A;  2Y2Q A;  2VGJ A;  1NXY A;  1ALQ A;  2RL3 A;  4R0Q A;  3V3R A;  4PM9 A;  4R3B A;  1BLH A;  4MNR A;  4ZJ1 A;  1K56 D;  5KSH A;  4OPY A;  5FAS A;  5EVL A;  2X01 A;  2ZMA A;  3FYZ A;  4R4S A;  3DWK A;  3VOY A;  4DDY A;  1AXB A;  1H8Y A;  5FA7 A;  1U60 A;  5HX9 A;  5E2H A;  4IVK A;  2HP6 A;  3WWX A;  4IBR A;  3TG9 A;  1SDE A;  1K57 C;  1WYC A;  4UA9 A;  4EBN A;  3UPO A;  2WAF A;  2G2U A;  4LCM A;  3WS1 A;  1JWV A;  3BFC A;  5GHZ A;  4DE2 A;  3V3S A;  4KG2 A;  4OON A;  3MZF A;  3C5A A;  3SS3 A;  4BD1 A;  4NK3 A;  2C5W B;  3MXS A;  4DRT A;  4NET A;  5GLD A;  1ESU A;  5CHJ A;  4QJG A;  1PWC A;  1XA7 A;  4HES A;  1G68 A;  2WKH A;  3Q7V A;  1LI0 A;  4LCL A;  4EV4 A;  1Z6F A;  1CK3 A;  2J7V A;  2JBF A;  4OP5 A;  2J9O A;  2WGV A;  3ZHH A;  4PM6 A;  1IKI A;  2ZQD A;  3I7J A;  2X02 A;  3BLM A;  2Y91 A;  3N8S A;  1FCO A;  3S1Y A;  1LL5 A;  3IXG A;  5M19 A;  3W4Q A;  4S2O A;  4JBF A;  4OQ0 A;  2H0T A;  4WZ4 A;  3UN7 A;  1YMX A;  3FV7 A;  4JPM A;  1K6S A;  2HDU A;  4ZJ2 A;  2OSU A;  3HLG A;  5FQJ A;  3BM6 A;  1BLC A;  5CTN A;  4WZ5 C;  3ZG8 B;  4Y0U A;  1YLZ A;  1PYY A;  5EOE A;  2WUQ A;  4GDB A;  3RJU A;  2Y2H A;  3M6H A;  4WZ5 A;  3WS2 A;  5GLC A;  3ZG9 B;  4A5R A;  4BLM A;  5FQK A;  4B88 A;  1DY6 A;  2Y55 A;  5CHU A;  3NI9 A;  4KZ4 A;  2FFF B;  1BZA A;  1GHP A;  3CG5 A;  2P74 A;  4X56 A;  1GHM A;  3HLW A;  4C6Y A;  2HP9 A;  1KVL A;  3IHA A;  4ZJ3 A;  2X71 A;  2Y2L A;  4GDN A;  1BUE A;  4QB8 A;  1YLW A;  3UE0 A;  1XGJ A;  2UWX A;  4CJN A;  4MBH A;  5F82 A;  2WGW B;  5M1A A;  1K54 C;  3A3D A;  1K55 A;  2WKE A;  5E2F A;  1KDS A;  1KGF A;  3VOZ A;  2P9V B;  3PBR A;  1YLT A;  3VFH A;  1LLB A;  1K54 A;  3SS4 A;  5I94 A;  3WS0 A;  4QU3 A;  2I72 A;  1KGG A;  3BLS A;  3CJM A;  2J9P A;  4R3J A;  1JVJ A;  4UA6 A;  1NJ4 A;  3OZH A;  5TR7 A;  5AQA A;  1LHY A;  1GCE A;  2EFU A;  1QMF A;  4GKU A;  2XLN A;  4HBU A;  2EXB A;  3JYI A;  4OPZ A;  2Z2M B;  1K6R A;  1ZC2 A;  1RP5 A;  1BTL A;  3HL9 A;  3BEC A;  4N92 A;  5EPH A;  1HVB A;  5DF7 A;  2XF3 A;  2XD5 A;  1ERO A;  1W8Y A;  1NZO A;  2CC1 A;  3D4F A;  1CEF A;  4MBF A;  2ZJ9 A;  3DTM A;  4DXC A;  5FAP A;  1ONH A;  3BFD A;  1RGZ A;  3IF5 A;  4EWF A;  4BQM A;  2Y2P A;  3WRT A;  3UO9 A;  3PTE A;  3VP4 A;  1XXM A;  4P87 A;  1BLP A;  3UNW A;  3ZFZ A;  3MKE A;  4KQR A;  3O87 A;  2Y2N A;  3ZNT A;  5HAP A;  1VM1 A;  3ZCZ A;  3IHB A;  2WGW A;  5F1F A;  4DE1 A;  5EUA A;  4OOL A;  3G34 A;  5E43 A;  3LEZ A;  2P9V A;  4X55 A;  1ZG4 A;  1HTZ A;  2IWC A;  2ZC7 A;  5DF9 A;  3VSL A;  3WS4 A;  3SH9 A;  1XKZ A;  5E2G A;  1KVM A;  1NYY A;  3BFE A;  4N1H A;  1MY8 A;  4WMC D;  5JYP A;  1IYQ A;  5FQQ A;  3ZG7 B;  4BD0 A;  1PI4 A;  1YQS A;  4HEF A;  5CXW A;  5FAO A;  2ZQ8 A;  5TGF A;  1RCJ A;  4JXV A;  4QY6 A;  3IF6 B;  5KSC A;  4JKT A;  2XEP A;  2XDM A;  1JWP A;  4KZ6 A;  4R1G A;  5BOH A;  4S2M A;  3HLC A;  3G35 A;  4C75 A;  1I2W A;  4HBT A;  4LV2 A;  5HAI A;  1MXO A;  1FCN A;  3GSG A;  4RX3 A;  1S6R A;  5A93 A;  2Y2J A;  1I5Q A;  4PM7 A;  1PI5 A;  3AGD A;  4Q8I A;  1XPB A;  3HLE A;  4X68 A;  3Q82 A;  2V2F F;  4MBK A;  5HFO A;  5HAQ A;  4WEL A;  1XA1 A;  1PZP A;  3O88 A;  5FI2 A;  3BEB A;  1BT5 A;  4KEN B;  1MWU A;  5FAQ A;  4OKP A;  3ZG0 A;  2DCF A;  3VSK A;  3HBR A;  2XGN A;  4WBG A;  2XH9 A;  4ZAM A;  4BEN A;  1NYM A;  3PBO A;  4X6T A;  3HLF A;  3SOI A;  3TSG A;  3C4O A;  3NCK A;  5HW3 A;  4U0T A;  4MLL A;  1W7F A;  4UHU A;  2IWD A;  4DF6 A;  4E3M A;  2HPB A;  1S0W A;  3OPP A;  3N6I A;  3FZC A;  4GD8 A;  4H8R A;  3A3J A;  3GV9 A;  3IWI A;  4KG5 A;  2EFX A;  4E3N A;  1EI5 A;  4KZ8 A;  2WYX A;  2ZM8 A;  4GOG A;  1SHV A;  3N7W A;  3QNC A;  3OC2 A;  2PU4 A;  5D3O A;  1C3B A;  4JXW A;  4BJP A;  3PAE A;  3QHY A;  1IYO A;  4OPQ A;  4B4X A;  4L0L A;  4OQG A;  4WEK A;  5GHY A;  3BRM A;  1L2S A;  3IF6 A;  3C7U A;  4EQI A;  3OPR A;  5CGX A;  4JF4 A;  1MWR A;  4S2K A;  4KZA A;  3G2Y A;  1YT4 A;  2A49 A;  3P09 A;  1WYB A;  4N1X A;  2BLS A;  4EBP A;  4IVI A;  3A3E A;  1KE4 A;  5F1G A;  3MZE A;  1M6K A;  4E6W A;  4DE0 A;  4XUZ A;  5DF8 A;  4QY5 A;  3HUM A;  1PW8 A;  3SS5 A;  1E3U D;  2WKI A;  1ERQ A;  1IYP A;  1PWG A;  2EX9 A;  3GQZ A;  1FQG A;  3HVF A;  1SCW A;  4IBX A;  4KZ7 A;  2JE5 A;  3GRJ A;  1H8Z A;  1K55 C;  3RXW A;  1K4F A;  4OQH A;  3OCL A;  5FQM A;  3HLB A;  1HD8 A;  2C6W B;  4RX2 A;  1FSY A;  3NC8 A;  4K91 A;  4EUZ A;  3ZDJ A;  4RA7 A;  3B3X A;  1FOF A;  2V1Z A;  3IQA A;  3S22 A;  2IWB A;  5KMW A;  3WS5 A;  4E3J A;  4WYY A;  5FQ9 A;  2OV5 A;  4E3O A;  3VP3 A;  4FD8 A;  4YFM A;  4F94 A;  1TDG A;  5J8X A;  2EX8 A;  2ZC6 B;  5JYO A;  2J8Y A;  3FWL A;  2PBY A;  2ZC4 B;  3ZVT A;  3A3F A;  1ESI A;  5FSR A;  4XUX A;  1J9M A;  2B5R A;  5GLB A;  1I2S A;  4KQQ A;  3M6B A;  5A91 A;  1LI9 A;  4ZTK A;  3HLD A;  4S2N A;  3V5M A;  1PIO A;  1IEM A;  1RGY A;  3SH8 A;  1MKI A;  2EX6 A;  1N9B A;  2XR0 A;  3DW0 A;  1W79 A;  3AGF A;  4K0X A;  4WMC A;  3VFF A;  1ES3 A;  3TOI A; 
#chains in the Genus database with same CATH topology
 4LGW A;  1TVF A;  2ZQA A;  3EQU A;  4E3K A;  1F9I A;  3SH7 A;  5EVI B;  3IH8 A;  4S2L A;  3G31 A;  1DP6 A;  1PWD A;  5HDD A;  5EEC A;  4DMZ A;  2RCX A;  4ZBE A;  1D1J A;  3BFG A;  2YKH A;  3IX4 A;  3LIE A;  4CPK A;  5IHV A;  2O99 A;  2Q9N A;  1XP4 A;  4FH2 A;  5CX7 A;  5F83 A;  1Q2Q A;  4B4Z A;  4CLC C;  3F1P A;  4Y0O A;  2WKR A;  4HJ6 A;  4QHC A;  1GA9 A;  2PT7 A;  4X53 A;  2JC7 A;  3IH9 A;  1JTG A;  1KDW A;  5FQI A;  2PU2 A;  4OVD A;  3HJK A;  3ITB A;  3P7N A;  2R78 A;  5HZH A;  3DTI A;  1MPL A;  4EER A;  2Z2L B;  4BL3 A;  1ZG6 A;  3UY6 A;  3IF6 C;  1TDL A;  5DVA A;  5HD5 A;  4Y0T A;  3OPL A;  2VV8 A;  1MC0 A;  3NIA A;  5EVI D;  3B42 A;  3CMZ A;  1BSG A;  2OWH A;  2Q9M A;  1NLZ A;  4PPR A;  1A0K A;  1UGU A;  2R9X A;  3IWO A;  3PAG A;  3Q07 A;  1Y4O A;  4H6J A;  2PR5 A;  1PW1 A;  2M7V A;  1L0F A;  1LL9 A;  3BQ8 A;  2W1T B;  5DTS A;  1FR1 A;  3F1N A;  1GSV A;  4LLO B;  2J3W A;  4R70 A;  5CGW A;  1CI8 A;  3MSH A;  2EXA A;  2DNS A;  5CRF A;  3CWF A;  4S2J A;  3QNB A;  1BLS A;  1MBL A;  1NWZ A;  1D06 A;  4IUH A;  5GLA A;  2H28 A;  3UDI A;  4X69 A;  4U3T A;  3M2K A;  2PD7 A;  3V50 A;  3T4T A;  3HUN A;  2Y2K A;  1K38 A;  3GR2 A;  4M3K A;  3NDE A;  2ZOI A;  1K4E A;  1XGI A;  1KGE A;  1K56 A;  3UE1 A;  5TBM B;  4CLC E;  3NY4 A;  1IOU A;  4GN2 A;  1FSW A;  2QZ6 A;  2VGJ A;  1ALQ A;  4GHI B;  3V3R A;  4R3B A;  3LI9 A;  2X01 A;  5E2H A;  4IVK A;  2QWS A;  1K57 C;  4UA9 A;  3GDI A;  4HH3 A;  3UMD A;  3K3C A;  4BMW A;  5HPI A;  2J80 A;  1ESU A;  5CHJ A;  3NOT C;  3QP5 A;  5F69 A;  4QJG A;  3MQQ A;  1G68 A;  1LI0 A;  4NG2 A;  4DJ2 A;  1Z6F A;  1CK3 A;  1S1Y A;  2WGV A;  3IBJ A;  1S66 L;  1P97 A;  4HOI A;  3N8S A;  5DFY A;  4WLA A;  3S1Y A;  2VZW A;  2ZL1 B;  2HF6 A;  4JBF A;  3UN7 A;  1YMX A;  1K6S A;  4ZJ2 A;  3BM6 A;  3PHY A;  2W1R A;  4I3J A;  2Y2H A;  4WF0 A;  3M6H A;  3WS2 A;  3ZG9 B;  2M1C A;  1ZHH B;  1DY6 A;  1BZA A;  1OPX A;  3CG5 A;  4X56 A;  3CPT B;  4ZJ3 A;  3UE0 A;  2UWX A;  2O9C A;  4JGR A;  5M1A A;  1KDS A;  1LLB A;  3SS4 A;  4QU3 A;  2I72 A;  1JVJ A;  1NJ4 A;  3OZH A;  5AQA A;  3UB8 A;  4HBU A;  1XFQ A;  4OPZ A;  1RP5 A;  4B93 A;  1BTL A;  3BEC A;  3TRC A;  4EEP A;  2XD5 A;  2CC1 A;  3D4F A;  3W2Z A;  2A24 B;  2ZJ9 A;  2BAS A;  4Y2F A;  4MN7 A;  5FAP A;  1ONH A;  3BFD A;  3IF5 A;  4BQM A;  3WRT A;  5HWT A;  4ARZ B;  3PTE A;  1BLP A;  3O87 A;  3T4Q A;  1VM1 A;  2WGW A;  3LYX A;  1HTZ A;  1XKZ A;  5E2G A;  1KVM A;  3T4O A;  3F1O A;  3BFE A;  4LPZ A;  5K5B A;  3ZG7 B;  3BY8 A;  5TGF A;  1VEU A;  1BYW A;  1I2W A;  2JKT M;  1MXO A;  3L7H A;  1FCN A;  3GSG A;  1PI5 A;  3HLE A;  3BEB A;  3EOI A;  2DCF A;  1NYM A;  3JVU A;  3TSG A;  3HLF A;  5HW3 A;  3NCK A;  4U0T A;  4UHU A;  4E3M A;  3N6I A;  2LB5 A;  4GD8 A;  3IWI A;  3N7W A;  3D72 A;  5D3O A;  1C3B A;  1GSX A;  4BJP A;  1IYO A;  4OPQ A;  4B4X A;  4OQG A;  5GHY A;  1L2S A;  3IF6 A;  4EQI A;  3OPR A;  5CGX A;  4JF4 A;  2PYP A;  3BJN A;  4KZA A;  3K3D A;  2ZOH A;  3ICY A;  4N1X A;  2BLS A;  3MZE A;  4KQD A;  2ACG A;  4DE0 A;  4QY5 A;  1PW8 A;  3HVF A;  1EW0 A;  3T4S A;  4IBX A;  1FQG A;  1SCW A;  1H8Z A;  1K4F A;  4OQH A;  1FSY A;  5EM0 A;  4K91 A;  4EUZ A;  1T1B A;  4RA7 A;  3B3X A;  3IQA A;  3LIB A;  2WKQ A;  3IS2 A;  1ZTU A;  3LID A;  3VP3 A;  4YFM A;  1TDG A;  5JYO A;  2ZC4 B;  3GEC A;  4XUX A;  5GLB A;  4O01 A;  3HLD A;  2W3F A;  1VET B;  3V5M A;  4MMN A;  4I5S A;  4EU0 A;  1IEM A;  4FUW A;  1MKI A;  4D60 A;  3DW0 A;  1W79 A;  3TOI A;  4IUK A;  2DRW A;  2WAE A;  3N8R A;  4CLC B;  1KE0 A;  1XX2 A;  5L07 A;  4UQI M;  2H5S A;  1OTA A;  3LY4 A;  5CHM A;  4RVA A;  3KYQ A;  1OT6 A;  3VMA A;  4KZ9 A;  4GNU A;  3ZVW A;  2Z6D A;  2HDQ A;  2WZX A;  1CI9 A;  2I9V A;  2ZQ9 A;  4MCW A;  1K25 A;  4UQI S;  5G18 A;  3W4P A;  1IYS A;  4WL9 A;  3FKW A;  3H82 B;  3PR6 A;  4FSF A;  4YOF A;  1E25 A;  1DP9 A;  4Y13 A;  4YIN A;  1GA0 A;  4Z1W A;  1XJ2 A;  2XK1 A;  2KDK A;  2VGK A;  2VEA A;  5L2F A;  1FR6 A;  1Q2P A;  3MKF A;  4XT2 B;  2VX8 A;  3U4L P;  5AQB A;  1FIL A;  4Y15 A;  4E3L A;  5EVI A;  1YLP A;  4FTX A;  4LV1 A;  4DKI A;  2XD1 A;  4HHD A;  1K57 A;  2ZMV A;  2DMW A;  3IBR A;  2EWV A;  4DE3 A;  3O3V A;  3ZNY A;  4I39 A;  3RXX A;  1O07 A;  4D2O A;  3FKV A;  4G3K A;  3P01 A;  5FI6 A;  2ZQ7 A;  4PM5 A;  4P6Z M;  2ZBB A;  4E3I A;  2O0Y A;  5CGS A;  5AQ7 A;  4QD4 A;  5J7E A;  2LB9 A;  1W5D A;  3Q81 A;  4GS9 B;  2ZMF A;  4R3A A;  1L3L A;  2Y2O A;  5HD3 A;  1JWZ A;  1L0D A;  3SZT A;  1FCM A;  1IKG A;  4OPR A;  1N4O A;  4KUK A;  4DDS A;  1P9W A;  2QHK A;  2HV1 A;  4EXO A;  4JF6 A;  4KZ5 A;  2PBD P;  3HJI A;  2JKR I;  4WEJ A;  1VB6 A;  1HLU P;  4Y7P A;  2WAD A;  4KQO A;  4DJ3 A;  1S67 L;  4N9K A;  4P0M A;  2ZM0 A;  1OME A;  4HJ4 A;  3NUL A;  1YPR A;  2XFT A;  2PHY A;  2FFY A;  2JCH A;  3NDG A;  2W1T A;  3MXR A;  2Y4A A;  3W8K A;  5KIZ A;  3CAX A;  3KYZ A;  2ZD8 A;  5GL9 A;  5E2E A;  3CIT A;  5A90 A;  3Q7Z A;  1DJC A;  5HL1 A;  2EX2 A;  4BWI A;  3Q7V B;  3SW1 A;  4I3I A;  3LR5 A;  1WE4 A;  4BL2 A;  4LV3 A;  4R4R A;  3N4I A;  2ZC5 B;  1YM1 A;  1L0E A;  5C5K A;  2RL3 A;  3MQ0 A;  1V9Z A;  4Y17 A;  2ZMA A;  3O5Y A;  4R4S A;  1AXB A;  1TD5 A;  1H8Y A;  2D01 A;  2HP6 A;  2WAF A;  4LCM A;  1ACF A;  5AVF A;  1AWI A;  3SS3 A;  4BD1 A;  4DRT A;  4NET A;  5GLD A;  4ME4 A;  5TBM A;  1PWC A;  1XA7 A;  1PFL A;  4EV4 A;  1CJF A;  3ZQ5 A;  4PM6 A;  1IKI A;  3I7J A;  4YWZ A;  4GHI A;  3W4Q A;  2H0T A;  3FV7 A;  4JPM A;  5FQJ A;  4R6L A;  1N9N A;  1BLC A;  3RJU A;  1PYY A;  3LIC A;  5FL3 A;  4WZ5 A;  4NXG A;  4DN0 A;  2FFF B;  1F2K A;  3HLW A;  4C6Y A;  3V67 A;  2HP9 A;  1KVL A;  1K0K A;  3DTE A;  2JKG A;  1K54 C;  2WKE A;  1YLT A;  2NUT C;  5I94 A;  1DRM A;  3MQO A;  4R3J A;  1GCE A;  2EFU A;  4GKU A;  2XLN A;  2P08 A;  3H7W B;  3JYI A;  2Z2M B;  1K6R A;  1ZC2 A;  2ZL1 A;  2VA0 A;  2GX5 A;  5EPH A;  5DF7 A;  3T12 B;  1CEF A;  4MBF A;  3DTM A;  3F1P B;  3VP4 A;  3CPT A;  4GLQ A;  3MKE A;  4KQR A;  3ZNT A;  5HAP A;  3IHB A;  4DE1 A;  2QYB A;  4OOL A;  5E43 A;  2IWC A;  5IS1 A;  3NEC A;  5JYP A;  1IYQ A;  1LSX A;  5FQQ A;  1PI4 A;  4MN6 A;  4HEF A;  5FAO A;  3FPW A;  2ZQ8 A;  2KX6 A;  2WKP A;  3VV4 A;  1JWP A;  3G35 A;  1J3W A;  3C8C A;  4C75 A;  3LR0 A;  2A24 A;  3LUQ A;  4HBT A;  5HAI A;  4LRY C;  3AGD A;  3Q82 A;  5HAQ A;  5AJG A;  3E0Y A;  1XA1 A;  3B33 A;  5FI2 A;  1CF0 A;  5HPF A;  3VSK A;  3HBR A;  2GZA A;  4WBG A;  1H0M A;  4ZAM A;  4BEN A;  3T1X A;  3KO6 A;  3T1S A;  2P7J A;  4MLL A;  1W7F A;  2IWD A;  2PAV P;  2Y8H A;  1S0W A;  3OPP A;  3FZC A;  1V9Y A;  4O8G A;  3QP2 A;  4KZ8 A;  4GOG A;  5EV0 A;  2PU4 A;  3QHY A;  2HJ9 C;  3BRM A;  1MWR A;  4S2K A;  1YT4 A;  2A49 A;  1WYB A;  1CQA A;  5HSQ A;  5L09 A;  3A3E A;  1T1C A;  2QKP A;  4Q0J A;  1KE4 A;  5F1G A;  5HDS A;  1TS8 A;  4LRZ E;  3HUM A;  3KSG A;  1IYP A;  1PWG A;  5G4Y A;  2JE5 A;  3GRJ A;  4ESP A;  3OCL A;  2D02 A;  5KMW A;  3WS5 A;  4E3J A;  2VLG A;  4FD8 A;  4F94 A;  3PYP A;  2QJ5 A;  5J8X A;  2EX8 A;  1VHM A;  3ZVT A;  4NXB A;  2HZ5 A;  3KSH A;  2HGV A;  3M6B A;  3TW8 A;  1MZU A;  2XSS A;  1KOU A;  2YKF A;  3S7O A;  1RGY A;  3NOP C;  4X25 A;  4K0X A;  4WMC A;  5DFX A;  3ZGA B;  3WRZ A;  5DJU A;  1NRJ A;  3NBL A;  5DJT A;  5U47 A;  4OLG A;  3IXB A;  1ES2 A;  4HY8 A;  4ETZ A;  2V0W A;  4PM8 A;  5EM1 A;  4LFU A;  4GB7 A;  3EGX C;  2K7S A;  4OH0 A;  3GTC A;  3GVB A;  4EEU A;  5I5L A;  1M40 A;  2WGI A;  4C3Q A;  3RH8 B;  4JXG A;  4EBL A;  3BY9 A;  2NUP C;  4MEZ A;  4LEN A;  4Q0H A;  3UPN A;  1VET A;  1WA9 A;  3A0V A;  4FCF A;  3BFF A;  4JLF A;  1MWT A;  3HRE A;  4L9F A;  4HNB A;  3IXH A;  3LCE A;  3LR3 A;  4ZDX A;  1Z09 A;  4CLC A;  2XFS A;  5FEF A;  1XJ4 A;  3FG8 A;  5HDC A;  1IEL A;  3E2L A;  3OBF A;  4PMA A;  2XRO A;  4NXF A;  2OAQ 1;  3E4O A;  1CEG A;  2WZZ A;  1S4S A;  2HDR A;  4LV0 A;  1G6O A;  4IHQ A;  3UPP A;  2GNX A;  3N8L A;  1LSW A;  4AFI A;  1S1Z A;  1E3U A;  3LIA A;  3UB5 P;  5DTK A;  5DTT A;  3H9W A;  3H82 A;  3ZG5 A;  3PBN A;  3UB9 A;  3E4P A;  1NLY A;  5J4E A;  1OTD A;  1TS6 A;  4FOF A;  4HJ3 A;  3P98 A;  3V39 A;  1NY0 A;  4OOY A;  1H5X A;  1QME A;  3HCY A;  1YLJ A;  4OQI A;  2G7U A;  1H8M A;  4JGQ A;  4XT2 A;  3IWQ A;  3DWZ A;  4GZB A;  4HP9 A;  3UE6 A;  4M4X A;  4R23 A;  5HWW A;  2HJE A;  3LGO A;  5M18 A;  3C2W A;  2KOI A;  3OLO A;  3VP2 A;  3ULF A;  2XQZ A;  5KZH A;  2ZC3 B;  3CI6 A;  4GD6 A;  5EE8 A;  1L0G A;  4S2N C;  3MBZ A;  1LL8 A;  3B47 A;  3PBS A;  2HP5 A;  3IX8 A;  3TJZ C;  2QMI A;  3MXQ A;  4OP8 A;  3G4P A;  3UDX A;  4UAA A;  4JGP A;  4KZ3 A;  4RYE A;  5FAT A;  1T19 A;  3ITA A;  3LFV A;  4P6B A;  1SDN A;  3CZD A;  4U0X A;  4GS9 A;  2OWJ A;  1VQQ A;  4EQ1 A;  2GDN A;  4UEY A;  5HL6 A;  3PBQ A;  4FH4 A;  2XRN A;  5FI7 A;  1TEM A;  4S2P A;  2E8I A;  2QPN A;  1E4D A;  3D3O A;  1JTD A;  3R7W B;  2EA9 A;  3PXP A;  3T4K A;  4XXR A;  1LSV A;  1BUL A;  3G30 A;  1HZO A;  1OTB A;  5AQ9 A;  3O86 A;  2ZQC A;  3UE3 A;  5CEC A;  3QP4 A;  3C4P A;  1N9L A;  1T1A A;  3BWL A;  1Y28 A;  4LRX C;  4PM9 A;  1BLH A;  5KSH A;  4IJG A;  4OPY A;  5FAS A;  4O0P A;  5HX9 A;  1U60 A;  4IBR A;  3TG9 A;  1SDE A;  1WYC A;  4EBN A;  4HP4 A;  1OJ5 A;  4JGO A;  2Q0O A;  5GHZ A;  3JPU A;  4KG2 A;  1X0O A;  3MZF A;  3C5A A;  3DBA A;  4ZRR A;  3Q7V A;  2JKF A;  3IS2 B;  3EEH A;  2JBF A;  4OP5 A;  2J9O A;  1LT0 A;  3ZHH A;  3CUE C;  2ZQD A;  5AVE A;  2X02 A;  3BLM A;  2Y91 A;  1FCO A;  3IXG A;  4OQ0 A;  2HDU A;  1N9O A;  2OSU A;  3HLG A;  4Q0I A;  3ZG8 B;  4Y0U A;  1YLZ A;  5EOE A;  4GDB A;  5J3W A;  3K2N A;  4A5R A;  5GLC A;  4BLM A;  5F68 A;  4B88 A;  5CHU A;  3NI9 A;  3NOU C;  1GHM A;  3KSI A;  3IHA A;  3NHQ A;  3MMH A;  1YLW A;  4MBH A;  5F82 A;  3KSF A;  3A3D A;  3BW6 A;  1KGF A;  3VOZ A;  2P9V B;  3PBR A;  3VFH A;  2J3T D;  3WS0 A;  1PRQ A;  3CJM A;  3BLS A;  3UB6 A;  5TR7 A;  4QPR A;  1QMF A;  2EXB A;  2UV0 E;  1HVB A;  5LBR A;  3MF0 A;  2XF3 A;  1W8Y A;  5FEG A;  3S7Q A;  1XJ3 A;  1D7E A;  1YAX A;  3UO9 A;  4F3L B;  3KX0 X;  4P87 A;  3ZFZ A;  4BBV A;  2L0W A;  5F1F A;  4PKY G;  3G34 A;  2K2N A;  2VJW A;  1ZG4 A;  3VSL A;  3SH9 A;  4N1H A;  3VOL A;  1W63 Q;  4BD0 A;  3H7W A;  1ODV A;  2W3D A;  3G6O A;  1RCJ A;  5KSC A;  2B02 A;  4R1G A;  3HLC A;  5DKL A;  4LV2 A;  1S6R A;  5A93 A;  4PM7 A;  4Q8I A;  2XA7 M;  1XPB A;  4MBK A;  5HFO A;  5F6A A;  1PZP A;  1YSP A;  1DP8 A;  1BT5 A;  1MWU A;  5FAQ A;  4OKP A;  3PBO A;  4X6T A;  4EW7 A;  2O9B A;  4DF6 A;  4Y5F A;  4KG5 A;  3QP8 A;  3A3J A;  3GV9 A;  2XA7 S;  2WYX A;  2ZM8 A;  4X1M A;  3QNC A;  4HI4 A;  4EET B;  2L4R A;  4II7 A;  5FDS A;  4BBT A;  2JKT I;  3C7U A;  2J3T C;  2W3H A;  3G2Y A;  4IVI A;  4GW9 A;  3TE8 A;  1SKO B;  4E6W A;  2M7U A;  1PNE A;  1UWP X;  1K55 C;  5FQM A;  5TJJ A;  3HLB A;  2C6W B;  3NC8 A;  3OOV A;  3ZDJ A;  2IWB A;  1P0Z A;  4E3O A;  4GCZ A;  1OTI A;  2ZC6 B;  2J8Y A;  2PBY A;  1ESI A;  4GJ4 A;  3EGD C;  1J9M A;  4KQQ A;  4S2N A;  2XR0 A;  2PYR A;  3VE4 A;  3AGF A;  4B9O A;  2IA2 A;  2ZLY A;  1YSQ A;  3UDF A;  3BQA A;  1FIK A;  1O7E A;  1PZO A;  5IU1 A;  2JHE A;  4HH2 A;  4MN5 A;  4RQ9 A;  2FZ0 A;  2WK0 A;  2PRF A;  2Y2G A;  3D9Y A;  2R9W A;  4I38 A;  1OJG A;  4OOM A;  2CMN A;  3G2Z A;  3BYD A;  1F98 A;  4N9L A;  4WN5 A;  3MFD A;  1ONG A;  1DJB A;  4O7D A;  3PBT A;  2V8C A;  1S4R A;  3LR4 A;  1SKF A;  1Y54 A;  4ARZ A;  3LEQ A;  2W3E A;  2ZM2 A;  4I3A A;  4OLD A;  5CEB A;  3MS6 A;  4EUV A;  2P04 A;  3MFX A;  3G32 A;  2OOL A;  3IT9 A;  5EVI C;  2VK3 A;  3C38 A;  3LY3 A;  4H6J B;  4PAU A;  3S7N A;  1KE3 A;  4MDZ A;  1G6A A;  4KG6 A;  4IED A;  1YLY A;  4P85 A;  3E2K A;  5GHX A;  1ERM A;  2FH5 A;  1MWS A;  2V1B A;  1ES4 A;  3VE3 A;  2Y2M A;  3F1N B;  3ISG A;  1ES5 A;  2Y59 A;  2JKR M;  4JF5 A;  1SZV A;  3L9K A;  2OLU A;  4JXS A;  1IFQ A;  3W4O A;  1NZU A;  5HAR A;  3CUE A;  3IXD A;  4DXB A;  4ETX A;  4Y3I A;  2A2L A;  3M2J A;  1W8Q A;  2V9A A;  3VP1 A;  5EOO A;  1ZKJ A;  2VKS A;  1YMS A;  5CTM A;  2VV6 A;  2OLV A;  5TFQ A;  2H10 A;  1DJA A;  3C30 A;  3OPH A;  3S4X A;  1H3Q A;  2V20 A;  3AGE A;  3VP0 A;  5A92 A;  3MZD A;  4L9E A;  5CED A;  1NRF A;  5DKK A;  3HUO A;  2W3G A;  4ID4 A;  3GMW A;  1G5U A;  2JN7 A;  4UA7 A;  4G3W A;  3Q1F A;  4KZB A;  3C7V A;  3RFB A;  2G2W A;  2HDS A;  5FDH A;  4L9G A;  3MJQ A;  2H0Y A;  1EWZ A;  3OCN A;  4E6X A;  2BG1 A;  4S2I A;  2A3U A;  4WM9 A;  4K0W A;  5CER A;  4G3V A;  3EQV A;  2GJ3 A;  1GSW A;  3T4L A;  2Y2I A;  3LO7 A;  5F5Y A;  3QP6 A;  2V8F A;  1GHI A;  4Z9Q A;  1F5M A;  3A3I A;  2MJ6 A;  2Y2Q A;  1OT9 A;  1NXY A;  4R0Q A;  4MNR A;  4ZJ1 A;  1K56 D;  5EVL A;  2W27 A;  3FYZ A;  3DWK A;  3VOY A;  4DDY A;  5FA7 A;  3WWX A;  3UPO A;  2G2U A;  3QP1 A;  3WS1 A;  1JWV A;  3BFC A;  4NKP A;  4DE2 A;  3V3S A;  3R7W A;  4OON A;  1MKM A;  2KLI A;  2OAP 1;  4NK3 A;  2C5W B;  3MXS A;  1TS0 A;  4HES A;  3A0R A;  2WKH A;  3T50 A;  4LCL A;  2B18 A;  3DTK A;  2E8J A;  2J7V A;  3CHW P;  3E98 A;  1W63 M;  3T1R A;  3RTY A;  1LL5 A;  5M19 A;  1XJ6 A;  4WZ4 A;  2EWW A;  1P9R A;  5CTN A;  4WZ5 C;  2WUQ A;  4NXE A;  3MR0 A;  4X1L A;  2QJ7 A;  5FQK A;  2W0N A;  2VGL M;  3UME A;  2Y55 A;  4KZ4 A;  1GHP A;  3LI8 A;  2P74 A;  5A8B A;  2B95 A;  4KUO A;  2X71 A;  2Y2L A;  4GDN A;  1BUE A;  4QB8 A;  1TF1 A;  1XGJ A;  3ZYT A;  4CJN A;  2WGW B;  1K55 A;  5E2F A;  5HWV A;  4PHT A;  1K54 A;  1KGG A;  2J9P A;  2VGL S;  3F1O B;  4UA6 A;  2L1M A;  1LHY A;  1OTE A;  2PDR A;  5EVE A;  3IX3 A;  3HL9 A;  4N92 A;  1VEU B;  1ERO A;  1NZO A;  2Y79 A;  3FC7 A;  4DXC A;  1RGZ A;  3R4K A;  4NEE D;  4EWF A;  2Y2P A;  5MC7 A;  1XXM A;  4CQH A;  3UNW A;  4HQA A;  5L10 A;  2Y2N A;  3ZCZ A;  2BTF P;  5EUA A;  2K31 A;  3LEZ A;  2P9V A;  4X55 A;  2ZC7 A;  5DF9 A;  3WS4 A;  4QWO A;  1NYY A;  1MY8 A;  4YNR A;  4WMC D;  1YQS A;  3S7P A;  4K08 A;  5CXW A;  4JXV A;  4QY6 A;  3IF6 B;  3A0S A;  2XEP A;  2XDM A;  4JKT A;  4KZ6 A;  5BOH A;  4S2M A;  5L8M A;  3FPV A;  4RX3 A;  2Y2J A;  1I5Q A;  4X68 A;  2V2F F;  4WEL A;  4F3L A;  3KYE A;  3O88 A;  5EFW A;  4KEN B;  3ZG0 A;  2XGN A;  2O9A A;  2XH9 A;  3SOI A;  1G28 A;  3T1Q B;  3C4O A;  2HPB A;  4E04 A;  4H8R A;  2EFX A;  4E3N A;  1EI5 A;  1YKD A;  1UWN X;  1SHV A;  4PKY A;  4CLC D;  3OC2 A;  4JXW A;  3PAE A;  4L0L A;  4WEK A;  2V0U A;  4HIA A;  1JNU A;  3DAV A;  4WUJ A;  3EEA A;  3P09 A;  4EBP A;  3NJA A;  2AVX A;  1T18 A;  4BBU A;  1M6K A;  3E4Q A;  4XUZ A;  5DF8 A;  3UB7 A;  3SS5 A;  3T4J A;  1E3U D;  2WKI A;  1ERQ A;  3GQZ A;  1XFN A;  4S2O A;  4KZ7 A;  2EX9 A;  4EES A;  5G4Z A;  3RXW A;  4RX2 A;  1HD8 A;  1STZ A;  1TS7 A;  1FOF A;  2V1Z A;  2Z6C A;  3S22 A;  4WYY A;  3U2A A;  5FQ9 A;  2OV5 A;  2VV7 A;  4P6Z S;  2INW A;  3FWL A;  3LIF A;  3A3F A;  3CLO A;  5FSR A;  5IT5 A;  4R38 A;  2B5R A;  1I2S A;  5A91 A;  1LI9 A;  4ZTK A;  3JVV A;  1PIO A;  3SH8 A;  2EX6 A;  1N9B A;  2PR6 A;  2PD8 A;  3VFF A;  1ES3 A;  1SKO A;  3EWK A;  2V1A A; 
#chains in the Genus database with same CATH homology
 2ZLY A;  3ZGA B;  3WRZ A;  2DRW A;  2WAE A;  3N8R A;  3NBL A;  1KE0 A;  3UDF A;  1XX2 A;  5U47 A;  1TVF A;  4OLG A;  2H5S A;  3IXB A;  1ES2 A;  1O7E A;  1PZO A;  3LY4 A;  5CHM A;  4PM8 A;  2ZQA A;  3EQU A;  4GB7 A;  4RVA A;  4E3K A;  4OH0 A;  2WK0 A;  5EVI B;  3SH7 A;  3GTC A;  3VMA A;  3GVB A;  3IH8 A;  4KZ9 A;  4GNU A;  3G31 A;  4S2L A;  2Y2G A;  3ZVW A;  1PWD A;  5EEC A;  2HDQ A;  2R9W A;  4OOM A;  2RCX A;  2WZX A;  1CI9 A;  1M40 A;  2ZQ9 A;  2WGI A;  4C3Q A;  4ZBE A;  3BFG A;  1K25 A;  3G2Z A;  5G18 A;  4JXG A;  3W4P A;  3BYD A;  4EBL A;  1IYS A;  4MEZ A;  3FKW A;  4LEN A;  4CPK A;  3UPN A;  5IHV A;  4FSF A;  4N9L A;  4FCF A;  2Q9N A;  3MFD A;  1ONG A;  3BFF A;  1E25 A;  1DJB A;  1XP4 A;  4FH2 A;  4O7D A;  3PBT A;  5F83 A;  4JLF A;  1Q2Q A;  4B4Z A;  4YIN A;  1GA0 A;  1MWT A;  1SKF A;  3HRE A;  4Y0O A;  3IXH A;  3LCE A;  2XK1 A;  2VGK A;  1Y54 A;  4ZDX A;  4QHC A;  1GA9 A;  2ZM2 A;  4X53 A;  5L2F A;  1FR6 A;  2XFS A;  2JC7 A;  3IH9 A;  1Q2P A;  4OLD A;  5CEB A;  3MKF A;  1IEL A;  3G32 A;  3E2L A;  1JTG A;  4PMA A;  1KDW A;  5FQI A;  3IT9 A;  5EVI C;  5AQB A;  2PU2 A;  4OVD A;  3LY3 A;  4E3L A;  1CEG A;  2WZZ A;  5EVI A;  1YLP A;  1KE3 A;  2HDR A;  3ITB A;  1G6A A;  4KG6 A;  4LV1 A;  4LV0 A;  3UPP A;  4DKI A;  2XD1 A;  4IED A;  1YLY A;  4P85 A;  3N8L A;  1K57 A;  1MPL A;  2Z2L B;  3E2K A;  5GHX A;  4BL3 A;  1ZG6 A;  1ERM A;  3UY6 A;  3IF6 C;  1E3U A;  1MWS A;  1TDL A;  5DTK A;  5DTT A;  5DVA A;  1ES4 A;  2Y2M A;  3ZG5 A;  4Y0T A;  3OPL A;  3O3V A;  3PBN A;  3ZNY A;  4DE3 A;  3RXX A;  3ISG A;  1ES5 A;  2Y59 A;  1O07 A;  3NIA A;  3P98 A;  5EVI D;  4JF5 A;  1NY0 A;  3V39 A;  3FKV A;  4OOY A;  4D2O A;  1H5X A;  3CMZ A;  1QME A;  2OLU A;  1BSG A;  5FI6 A;  1YLJ A;  2ZQ7 A;  4JXS A;  4PM5 A;  3W4O A;  2Q9M A;  4OQI A;  4E3I A;  1NZU A;  5CGS A;  5HAR A;  3IXD A;  4PPR A;  5AQ7 A;  4QD4 A;  4DXB A;  1W5D A;  3IWQ A;  3Q81 A;  3DWZ A;  4GZB A;  2R9X A;  3IWO A;  2Y2O A;  3PAG A;  3Q07 A;  1JWZ A;  1L0D A;  3M2J A;  4R23 A;  1W8Q A;  1FCM A;  1IKG A;  3VP1 A;  5EOO A;  4OPR A;  1ZKJ A;  1N4O A;  5M18 A;  1PW1 A;  3VP2 A;  1YMS A;  1L0F A;  4DDS A;  1LL9 A;  5CTM A;  2XQZ A;  5KZH A;  2OLV A;  2ZC3 B;  5TFQ A;  4GD6 A;  2H10 A;  1DJA A;  4JF6 A;  5EE8 A;  3OPH A;  4KZ5 A;  3S4X A;  2V20 A;  3AGE A;  1L0G A;  5DTS A;  1FR1 A;  3VP0 A;  5A92 A;  4S2N C;  3MBZ A;  3MZD A;  4WEJ A;  3PBS A;  4Y7P A;  5CED A;  1NRF A;  2HP5 A;  3HUO A;  5CGW A;  1CI8 A;  2WAD A;  4KQO A;  2QMI A;  4OP8 A;  3G4P A;  4N9K A;  2EXA A;  4UAA A;  3UDX A;  4ID4 A;  2DNS A;  4P0M A;  4KZ3 A;  2ZM0 A;  4RYE A;  5CRF A;  3GMW A;  4S2J A;  5FAT A;  3QNB A;  3ITA A;  1OME A;  4UA7 A;  4P6B A;  1BLS A;  3Q1F A;  1MBL A;  1SDN A;  4KZB A;  2XFT A;  3C7V A;  3CZD A;  4U0X A;  5GLA A;  2G2W A;  2HDS A;  5FDH A;  1VQQ A;  2GDN A;  2FFY A;  3PBQ A;  4FH4 A;  2JCH A;  3UDI A;  2H0Y A;  1EWZ A;  3OCN A;  4X69 A;  4U3T A;  4E6X A;  5FI7 A;  1TEM A;  3M2K A;  4S2P A;  2E8I A;  2BG1 A;  4S2I A;  2QPN A;  2A3U A;  3V50 A;  3NDG A;  1E4D A;  3HUN A;  2Y2K A;  1JTD A;  1K38 A;  3GR2 A;  3MXR A;  4M3K A;  4WM9 A;  2Y4A A;  3NDE A;  4K0W A;  3W8K A;  1K4E A;  1XGI A;  1KGE A;  2ZD8 A;  5E2E A;  1K56 A;  5GL9 A;  4XXR A;  5CER A;  3UE1 A;  3EQV A;  5A90 A;  3Q7Z A;  1BUL A;  3G30 A;  1DJC A;  3NY4 A;  5HL1 A;  1HZO A;  2Y2I A;  2EX2 A;  3LO7 A;  3Q7V B;  5AQ9 A;  3O86 A;  2ZQC A;  1WE4 A;  1GHI A;  4BL2 A;  4Z9Q A;  3UE3 A;  5CEC A;  4GN2 A;  1FSW A;  4LV3 A;  4R4R A;  2QZ6 A;  3N4I A;  3C4P A;  3A3I A;  2ZC5 B;  1YM1 A;  1L0E A;  2Y2Q A;  2VGJ A;  1NXY A;  1ALQ A;  2RL3 A;  4R0Q A;  3V3R A;  4PM9 A;  4R3B A;  1BLH A;  4MNR A;  4ZJ1 A;  1K56 D;  5KSH A;  4OPY A;  5FAS A;  5EVL A;  2X01 A;  2ZMA A;  3FYZ A;  4R4S A;  3DWK A;  3VOY A;  4DDY A;  1AXB A;  1H8Y A;  5FA7 A;  1U60 A;  5HX9 A;  5E2H A;  4IVK A;  2HP6 A;  3WWX A;  4IBR A;  3TG9 A;  1SDE A;  1K57 C;  1WYC A;  4UA9 A;  4EBN A;  3UPO A;  2WAF A;  2G2U A;  4LCM A;  3WS1 A;  1JWV A;  3BFC A;  5GHZ A;  4DE2 A;  3V3S A;  4KG2 A;  4OON A;  3MZF A;  3C5A A;  3SS3 A;  4BD1 A;  4NK3 A;  2C5W B;  3MXS A;  4DRT A;  4NET A;  5GLD A;  1ESU A;  5CHJ A;  4QJG A;  1PWC A;  1XA7 A;  4HES A;  1G68 A;  2WKH A;  3Q7V A;  1LI0 A;  4LCL A;  4EV4 A;  1Z6F A;  1CK3 A;  2J7V A;  2JBF A;  4OP5 A;  2J9O A;  2WGV A;  3ZHH A;  4PM6 A;  1IKI A;  2ZQD A;  3I7J A;  2X02 A;  3BLM A;  2Y91 A;  3N8S A;  1FCO A;  3S1Y A;  1LL5 A;  3IXG A;  5M19 A;  3W4Q A;  4S2O A;  4JBF A;  4OQ0 A;  2H0T A;  4WZ4 A;  3UN7 A;  1YMX A;  3FV7 A;  4JPM A;  1K6S A;  2HDU A;  4ZJ2 A;  2OSU A;  3HLG A;  5FQJ A;  3BM6 A;  1BLC A;  5CTN A;  4WZ5 C;  3ZG8 B;  4Y0U A;  1YLZ A;  1PYY A;  5EOE A;  2WUQ A;  4GDB A;  3RJU A;  2Y2H A;  3M6H A;  4WZ5 A;  3WS2 A;  5GLC A;  3ZG9 B;  4A5R A;  4BLM A;  5FQK A;  4B88 A;  1DY6 A;  2Y55 A;  5CHU A;  3NI9 A;  4KZ4 A;  2FFF B;  1BZA A;  1GHP A;  3CG5 A;  2P74 A;  4X56 A;  1GHM A;  3HLW A;  4C6Y A;  2HP9 A;  1KVL A;  3IHA A;  4ZJ3 A;  2X71 A;  2Y2L A;  4GDN A;  1BUE A;  4QB8 A;  1YLW A;  3UE0 A;  1XGJ A;  2UWX A;  4CJN A;  4MBH A;  5F82 A;  2WGW B;  5M1A A;  1K54 C;  3A3D A;  1K55 A;  2WKE A;  5E2F A;  1KDS A;  1KGF A;  3VOZ A;  2P9V B;  3PBR A;  1YLT A;  3VFH A;  1LLB A;  1K54 A;  3SS4 A;  5I94 A;  3WS0 A;  4QU3 A;  2I72 A;  1KGG A;  3BLS A;  3CJM A;  2J9P A;  4R3J A;  1JVJ A;  4UA6 A;  1NJ4 A;  3OZH A;  5TR7 A;  5AQA A;  1LHY A;  1GCE A;  2EFU A;  1QMF A;  4GKU A;  2XLN A;  4HBU A;  2EXB A;  3JYI A;  4OPZ A;  2Z2M B;  1K6R A;  1ZC2 A;  1RP5 A;  1BTL A;  3HL9 A;  3BEC A;  4N92 A;  5EPH A;  1HVB A;  5DF7 A;  2XF3 A;  2XD5 A;  1ERO A;  1W8Y A;  1NZO A;  2CC1 A;  3D4F A;  1CEF A;  4MBF A;  2ZJ9 A;  3DTM A;  4DXC A;  5FAP A;  1ONH A;  3BFD A;  1RGZ A;  3IF5 A;  4EWF A;  4BQM A;  2Y2P A;  3WRT A;  3UO9 A;  3PTE A;  3VP4 A;  1XXM A;  4P87 A;  1BLP A;  3UNW A;  3ZFZ A;  3MKE A;  4KQR A;  3O87 A;  2Y2N A;  3ZNT A;  5HAP A;  1VM1 A;  3ZCZ A;  3IHB A;  2WGW A;  5F1F A;  4DE1 A;  5EUA A;  4OOL A;  3G34 A;  5E43 A;  3LEZ A;  2P9V A;  4X55 A;  1ZG4 A;  1HTZ A;  2IWC A;  2ZC7 A;  5DF9 A;  3VSL A;  3WS4 A;  3SH9 A;  1XKZ A;  5E2G A;  1KVM A;  1NYY A;  3BFE A;  4N1H A;  1MY8 A;  4WMC D;  5JYP A;  1IYQ A;  5FQQ A;  3ZG7 B;  4BD0 A;  1PI4 A;  1YQS A;  4HEF A;  5CXW A;  5FAO A;  2ZQ8 A;  5TGF A;  1RCJ A;  4JXV A;  4QY6 A;  3IF6 B;  5KSC A;  4JKT A;  2XEP A;  2XDM A;  1JWP A;  4KZ6 A;  4R1G A;  5BOH A;  4S2M A;  3HLC A;  3G35 A;  4C75 A;  1I2W A;  4HBT A;  4LV2 A;  5HAI A;  1MXO A;  1FCN A;  3GSG A;  4RX3 A;  1S6R A;  5A93 A;  2Y2J A;  1I5Q A;  4PM7 A;  1PI5 A;  3AGD A;  4Q8I A;  1XPB A;  3HLE A;  4X68 A;  3Q82 A;  2V2F F;  4MBK A;  5HFO A;  5HAQ A;  4WEL A;  1XA1 A;  1PZP A;  3O88 A;  5FI2 A;  3BEB A;  1BT5 A;  4KEN B;  1MWU A;  5FAQ A;  4OKP A;  3ZG0 A;  2DCF A;  3VSK A;  3HBR A;  2XGN A;  4WBG A;  2XH9 A;  4ZAM A;  4BEN A;  1NYM A;  3PBO A;  4X6T A;  3HLF A;  3SOI A;  3TSG A;  3C4O A;  3NCK A;  5HW3 A;  4U0T A;  4MLL A;  1W7F A;  4UHU A;  2IWD A;  4DF6 A;  4E3M A;  2HPB A;  1S0W A;  3OPP A;  3N6I A;  3FZC A;  4GD8 A;  4H8R A;  3A3J A;  3GV9 A;  3IWI A;  4KG5 A;  2EFX A;  4E3N A;  1EI5 A;  4KZ8 A;  2WYX A;  2ZM8 A;  4GOG A;  1SHV A;  3N7W A;  3QNC A;  3OC2 A;  2PU4 A;  5D3O A;  1C3B A;  4JXW A;  4BJP A;  3PAE A;  3QHY A;  1IYO A;  4OPQ A;  4B4X A;  4L0L A;  4OQG A;  4WEK A;  5GHY A;  3BRM A;  1L2S A;  3IF6 A;  3C7U A;  4EQI A;  3OPR A;  5CGX A;  4JF4 A;  1MWR A;  4S2K A;  4KZA A;  3G2Y A;  1YT4 A;  2A49 A;  3P09 A;  1WYB A;  4N1X A;  2BLS A;  4EBP A;  4IVI A;  3A3E A;  1KE4 A;  5F1G A;  3MZE A;  1M6K A;  4E6W A;  4DE0 A;  4XUZ A;  5DF8 A;  4QY5 A;  3HUM A;  1PW8 A;  3SS5 A;  1E3U D;  2WKI A;  1ERQ A;  1IYP A;  1PWG A;  2EX9 A;  3GQZ A;  1FQG A;  3HVF A;  1SCW A;  4IBX A;  4KZ7 A;  2JE5 A;  3GRJ A;  1H8Z A;  1K55 C;  3RXW A;  1K4F A;  4OQH A;  3OCL A;  5FQM A;  3HLB A;  1HD8 A;  2C6W B;  4RX2 A;  1FSY A;  3NC8 A;  4K91 A;  4EUZ A;  3ZDJ A;  4RA7 A;  3B3X A;  1FOF A;  2V1Z A;  3IQA A;  3S22 A;  2IWB A;  5KMW A;  3WS5 A;  4E3J A;  4WYY A;  5FQ9 A;  2OV5 A;  4E3O A;  3VP3 A;  4FD8 A;  4YFM A;  4F94 A;  1TDG A;  5J8X A;  2EX8 A;  2ZC6 B;  5JYO A;  2J8Y A;  3FWL A;  2PBY A;  2ZC4 B;  3ZVT A;  3A3F A;  1ESI A;  5FSR A;  4XUX A;  1J9M A;  2B5R A;  5GLB A;  1I2S A;  4KQQ A;  3M6B A;  5A91 A;  1LI9 A;  4ZTK A;  3HLD A;  4S2N A;  3V5M A;  1PIO A;  1IEM A;  1RGY A;  3SH8 A;  1MKI A;  2EX6 A;  1N9B A;  2XR0 A;  3DW0 A;  1W79 A;  3AGF A;  4K0X A;  4WMC A;  3VFF A;  1ES3 A;  3TOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...