1BSGA

Beta-lactamase from streptomyces albus g
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
b'SDAERRLAGLERASGARLGVYAYDTGSGRTVAYRADELFPMCSVFKTLSSAAVLRDLDRNGEFLSRRILYTQDDVEQADGAPETGKPQNLANGMTVEELCEVSITASDNCAANLMLRELGGPAAVTRFVRSLGDRVTRLDRWEPELNSAEPGRVTDTTSPRAITRTYGRLVLGDALNPRDRRLLTSWLLANTTSGDRFRAGLPDDWTLGDKTGAGRYGTNNDAGVTWPPGRAPIVLTVLTAKTEQDAARDDGLVADAARVLAETLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA LACTAMASE
publication title The crystal structure of the beta-lactamase of Streptomyces albus G at 0.3 nm resolution.
pubmed rcsb
molecule tags Hydrolase
total genus 93
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bsgA00
2IWCA 3ZDJA 3HUOA 4FH2A 3UE0A 3VP1A 4L0LA 4U0TA 5FAQA 2XK1A 3WS1A 3Q1FA 3ZG7B 5EOOA 2ZQ9A 4GN2A 4XUZA 5A90A 5E43A 1ONGA 1YLPA 2XGNA 2Q9MA 2WAEA 2OV5A 1NZUA 3SH7A 2B5RA 2V2FF 3O3VA 5GHYA 4PMAA 5CTNA 1G68A 5CGWA 1IYOA 2Y2JA 3IQAA 2Y2KA 1BZAA 3C7UA 1TEMA 3HBRA 2EX9A 4HESA 4EWFA 2HPBA 4PPRA 4Q8IA 1PI5A 4CPKA 1O7EA 1S0WA 2EX2A 1ZG4A 2JBFA 3UE1A 4WMCD 4R3JA 4DE0A 4KZ8A 5AQAA 1ES5A 1PWDA 4EV4A 2C5WB 2G2UA 3B3XA 2H0YA 3IXGA 3HLFA 3WS5A 3LEZA 3VFFA 3MZEA 3P09A 5AQ9A 3ZVTA 3A3IA 3ISGA 3HLDA 1W7FA 5DVAA 1L0GA 3C5AA 2ZQAA 3BLMA 3IWIA 5CHMA 4QB8A 5FATA 5L2FA 2WKHA 2JCHA 4OLGA 4E3IA 4QJGA 5FQ9A 1QMFA 3MZFA 3NC8A 3W4QA 1VQQA 3EQUA 3G2YA 1LI9A 3IT9A 4JF5A 2WKIA 3LO7A 5G18A 2WGIA 1K57C 5HFOA 3WWXA 2BLSA 3A3DA 4HBTA 4JXGA 1NJ4A 4R1GA 5HW3A 1RGYA 1E4DA 1J9MA 2RCXA 4EBLA 1U60A 4C6YA 3IWQA 2QMIA 3SS3A 4E3KA 2HP6A 4ZJ1A 1MXOA 2ZLYA 4ZDXA 4QD4A 4N92A 3VP4A 1GHPA 4WZ5C 2ZD8A 4RVAA 4R23A 3VOYA 3IH8A 3WRZA 1K56D 4E3MA 1GHIA 4LV1A 5IHVA 1NY0A 1DJBA 3MXRA 1PW1A 4P87A 3HREA 1FR1A 5GLBA 3ZFZA 4DE3A 2Q9NA 1E3UA 4B4XA 2XD1A 1K6RA 1K55C 2DRWA 2EX6A 1MWUA 3DWZA 1I5QA 1PZPA 1PW8A 2ZM8A 1L0EA 3HUMA 4WEKA 5DF9A 4B4ZA 2H10A 3ITBA 3Q7VB 2XFTA 5FA7A 1YLTA 4XXRA 3GSGA 4PM8A 1FSWA 3Q81A 1HD8A 3IH9A 3LCEA 1YQSA 3BEBA 2EXAA 3GV9A 2OLVA 4OP8A 3RJUA 4GDNA 4WELA 1IYSA 3PAEA 1MWTA 2GDNA 4K91A 1ES2A 3V3RA 1IYPA 3N8LA 1YLYA 3AGFA 1I2SA 4K0WA 5DF8A 3UO9A 3BFCA 4ID4A 3M2KA 3OCNA 2A49A 2IWBA 2Y2IA 1K57A 5E2GA 4X69A 3RXWA 1FOFA 2QPNA 3SS5A 3SOIA 4RYEA 2C6WB 1PWGA 3N7WA 4UHUA 4OONA 1CI9A 1ONHA 3N6IA 4X6TA 4Y0OA 5TFQA 3HLWA 1VM1A 5FI2A 4S2PA 3VP2A 2X02A 3Q7VA 3MKEA 5FAOA 4P85A 4LV2A 1WE4A 4WZ5A 4ZBEA 5M1AA 5EUAA 1SCWA 3S22A 4KQOA 2XH9A 2EFXA 2QZ6A 3G35A 5HAIA 3NDGA 1H8ZA 4QY5A 3W8KA 4LV0A 4R4RA 1K55A 2ZQCA 3CJMA 3ZG9B 3ZVWA 4A5RA 1Q2PA 5F1GA 3VOZA 2XF3A 3V50A 5D3OA 1ESUA 5FASA 1FQGA 5CGSA 3NI9A 1FR6A 2HDRA 4EBNA 2HP5A 2DCFA 1ALQA 4IBXA 1KDSA 2J9PA 3BRMA 3TSGA 3HVFA 3WS4A 2XDMA 4S2MA 2Y4AA 1N4OA 3A3FA 4P0MA 1K54C 3HLEA 1SHVA 2WAFA 1BTLA 3M6HA 1L0DA 4JXVA 4OOLA 4ZTKA 4DRTA 4Y0UA 5FQIA 1W79A 3RXXA 1MBLA 5CHJA 4JKTA 1NZOA 3IXDA 1MPLA 4UA9A 1XX2A 4N1XA 4OP5A 4QHCA 3PAGA 5GLDA 3PTEA 3UDFA 4P6BA 2P74A 4XUXA 3BLSA 3PBTA 3Q7ZA 4RX3A 4OQIA 1ERQA 1XXMA 1BULA 2WKEA 3TG9A 5I94A 2RL3A 4KZ6A 4F94A 3OZHA 4S2NC 5E2FA 3G30A 1I2WA 1G6AA 3GRJA 1K4FA 1DJAA 4FH4A 2H5SA 1LHYA 3S1YA 5JYPA 3N8SA 4GZBA 4KZ4A 3W4PA 3OPLA 3WS0A 5BOHA 4KENB 1IELA 5E2HA 4ZJ3A 1JWVA 5FQKA 2Y55A 3CZDA 5CEBA 3BFDA 1H5XA 3HL9A 2ZM0A 1XKZA 5TR7A 1W5DA 4EBPA 2ZC6B 2WGVA 3I7JA 4KQRA 4KZ3A 1XP4A 2WYXA 2HP9A 1O07A 4M3KA 1JWZA 5FSRA 5KZHA 2Y59A 4NK3A 5FAPA 1EI5A 1FCNA 5JYOA 4JF6A 1HVBA 3QHYA 5F82A 3CG5A 3ZNTA 2E8IA 3UN7A 4S2OA 2FFYA 1YMXA 1HTZA 3ZGAB 2ZC4B 1BSGA 3CMZA 5CXWA 4S2LA 3ZG0A 1GA9A 3MZDA 4OLDA 3FKWA 5EVID 4E3OA 2XQZA 4EQIA 3DWKA 2Y2OA 3OPHA 4JBFA 5GLAA 2HDQA 3FV7A 1LLBA 5FI6A 3GQZA 2JE5A 3GMWA 2EFUA 4GB7A 5EE8A 4YINA 2V20A 3ZG8B 4QY6A 3G31A 1MWSA 3A3EA 4OOMA 3LY4A 4BENA 1XGIA 3M2JA 5E2EA 5J8XA 3BFGA 3IWOA 4C3QA 1YLWA 3C7VA 2OLUA 4WMCA 2IWDA 2Y2LA 2ZC5B 3C4OA 1TVFA 4JXSA 1NRFA 4IVIA 1JVJA 2JC7A 4BLMA 4GD6A 2WZXA 5CERA 3FKVA 1K6SA 3HLBA 3JYIA 2PU2A 2I72A 4RA7A 1YT4A 1BUEA 1MKIA 4FD8A 4WYYA 3BM6A 4OVDA 3NIAA 4KZ7A 4Z9QA 4E6XA 2EXBA 2G2WA 3VMAA 5M18A 3HUNA 2J8YA 5FQMA 3G32A 1W8QA 4K0XA 4KZ5A 4JLFA 1K4EA 4IEDA 1XPBA 4E3JA 4BJPA 2Y91A 1TDGA 5U47A 3IXHA 5F83A 1E25A 2J9OA 4LCMA 4OKPA 4PM5A 4WZ4A 5HAPA 5CGXA 4IBRA 4Y0TA 3HLGA 2BG1A 3O88A 4HBUA 2UWXA 5M19A 2WK0A 2Y2HA 4OPYA 3A3JA 5GLCA 5DTSA 4PM9A 3UPOA 1TDLA 4GKUA 1KVMA 5DTKA 1BLPA 2XD5A 4BD0A 3Q82A 3SS4A 4BL3A 2ZQDA 1PIOA 3OPRA 1K56A 1OMEA 1JTGA 4BQMA 3E2LA 1BLSA 4DDSA 1DY6A 3G34A 3ZCZA 3UE3A 4LCLA 1RGZA 1YLJA 1NXYA 3EQVA 3UPPA 1YMSA 4R3BA 3QNBA 5GL9A 3NCKA 1IYQA 5HX9A 1KGFA 5TGFA 2X01A 2WGWB 1ES4A 1LI0A 4WBGA 3AGDA 5CHUA 4N1HA 5EECA 1KGEA 4UA6A 2Z2LB 1NYYA 5AQBA 2ZMAA 4UAAA 4N9KA 3IHAA 4OQGA 1L0FA 4PM7A 4GD8A 3GR2A 1CEGA 1RCJA 4U0XA 2ZJ9A 2WUQA 1YM1A 4DF6A 1MWRA 4H8RA 1EWZA 1IEMA 3N8RA 1ZKJA 1K38A 1E3UD 4KG6A 4LV3A 3W4OA 3PBRA 1N9BA 3MXSA 3OC2A 4X53A 1ZC2A 1SKFA 4B88A 4IVKA 3WRTA 5CECA 1IKGA 1WYCA 2CC1A 1QMEA 4LENA 4FSFA 1BT5A 3G2ZA 1ERMA 1LL5A 1KVLA 2Y2QA 1KE3A 4MBHA 3Q07A 4PM6A 1CI8A 4R0QA 3FZCA 3VSKA 4DE2A 2VGKA 1ZG6A 2ZM2A 3PBOA 3FWLA 1YLZA 5DF7A 2WGWA 3BFFA 1NYMA 4N9LA 3ZNYA 2ZC7A 3N4IA 4OPRA 5CRFA 4X56A 1ESIA 2WZZA 3MKFA 1HZOA 4HEFA 3WS2A 3PBNA 1GHMA 1KE4A 1S6RA 2P9VB 3S4XA 1SDEA 4GOGA 4MNRA 3UDXA 1IKIA 5KSCA 3LY3A 4MBKA 3FYZA 4S2KA 1K54A 1EROA 5GHXA 5FDHA 5CEDA 3OCLA 2DNSA 4E3NA 3UPNA 4DE1A 4KG5A 5DTTA 3MFDA 3MBZA 5CTMA 3BFEA 1K25A 4E3LA 4FCFA 2H0TA 3NY4A 1PWCA 1L2SA 1WYBA 4U3TA 3ZG5A 4NETA 1FCMA 2Y2GA 2Y2NA 3PBQA 4GDBA 3VP3A 1JTDA 4OPZA 1DJCA 1CK3A 1XA7A 4BL2A 1KGGA 3D4FA 4S2NA 2ZQ8A 5EPHA 2V1ZA 3M6BA 3G4PA 3AGEA 5KMWA 2P9VA 1GCEA 1BLHA 2EX8A 2ZQ7A 1AXBA 4Y7PA 5EVIC 5FI7A 2OSUA 3IF5A 3NBLA 1M6KA 1FCOA 4OQHA 3IF6C 3IHBA 4YFMA 5KSHA 3HLCA 1KDWA 3ZHHA 2HDSA 1FSYA 4S2JA 1KE0A 1PYYA 5HL1A 3ITAA 4KZ9A 1PI4A 4KZAA 3BECA 4MLLA 3UNWA 2R9WA 1PZOA 4WM9A 4JXWA 4CJNA 3UY6A 3IXBA 4ZAMA 3TOIA 5FQJA 4KQQA 5A91A 4DXBA 4D2OA 2Y2PA 2XEPA 1BLCA 3BYDA 5A93A 3E2KA 5EVIB 1MY8A 5AQ7A 3SH9A 4C75A 1XA1A 3OPPA 4S2IA 3IF6B 1Y54A 4OH0A 5GHZA 4DDYA 1SDNA 3C4PA 4MEZA 5FQQA 3DTMA 5HARA 2HDUA 3O87A 4OQ0A 4R4SA 4O7DA 2FFFB 2XLNA 1RP5A 5A92A 1W8YA 4GNUA 5HAQA 1LL9A 5F1FA 2PU4A 3PBSA 1XGJA 4BD1A 1CEFA 1H8YA 4ZJ2A 1C3BA 2PBYA 2WADA 3O86A 4KZBA 2Y2MA 2Z2MB 3SH8A 3NDEA 2R9XA 3P98A 4JPMA 3QNCA 4JF4A 2X71A 3GVBA 2J7VA 2XR0A 2ZC3B 3VFHA 5EVLA 4DXCA 1ES3A 5EVIA 1Z6FA 2A3UA 2XFSA 4RX2A 4X55A 4DKIA 4OOYA 3IF6A 1JWPA 3V3SA 3V39A 4UA7A 3VP0A 3GTCA 3UDIA 4X68A 4QU3A 4OPQA 1M40A 4KG2A 4WEJA 2VGJA 1GA0A 4EUZA 5EOEA 4MBFA 1Q2QA 3V5MA 3VSLA 3DW0A 4E6WA
chains in the Genus database with same CATH superfamily
4I3IA 4GJ4A 4NXEA 1OT9A 2XSSA 2ZQ9A 5E43A 1YLPA 2Q9MA 2WAEA 2OV5A 1OPXA 4K08A 3O3VA 5GHYA 4PMAA 1ODVA 2BASA 1IYOA 3IQAA 1P0ZA 4Q8IA 4CPKA 2EX2A 1ZG4A 4DE0A 4KZ8A 2W27A 1PWDA 2G2UA 1SKOA 3ISGA 3D9YA 4QB8A 2HV1A 5FQ9A 3LIFA 3EQUA 3G2YA 2J3TD 4HOIA 2HGVA 3A0SA 2RCXA 4C6YA 3CLOA 2HP6A 1CQAA 4QD4A 2VEAA 4XT2A 3VOYA 4R23A 1GHIA 1TS8A 5J7EA 3MXRA 4DMZA 1FR1A 3ZFZA 2K7SA 1K6RA 2DRWA 1MWUA 1PW8A 2ZM8A 4B4ZA 3LIBA 4Y2FA 2J3WA 2GJ3A 4PM8A 1FSWA 3VE3A 1BYWA 3R7WA 1YQSA 2EXAA 1AWIA 4WELA 2V1BA 4QPRA 4GLQA 3CITA 3AGFA 3UO9A 3BFCA 3M2KA 1K57A 5E2GA 1FOFA 2QPNA 3KSGA 1PWGA 4X1MA 2PAVP 4X6TA 4Y0OA 3EGXC 5FI2A 3VP2A 2X02A 5FAOA 4P85A 2JKTM 2PBDP 4KQOA 2OWHA 3G35A 3NDGA 3CJMA 3V50A 2HDRA 2HP5A 3BRMA 4BWIA 3IBJA 3WS4A 4S2MA 3A3FA 4P0MA 3HLEA 2WAFA 3M6HA 1L0DA 4JXVA 4ZTKA 4DRTA 1W79A 4PKYG 1MBLA 2WKQA 3VV4A 4N1XA 4OP5A 2WKPA 3QP5A 1DP9A 3PBTA 4RX3A 4OQIA 1ERQA 4GW9A 1BULA 2V0UA 3TG9A 3T4QA 3QP2A 4EEUA 1I2WA 3MSHA 3S1YA 4KZ4A 2VLGA 3W4PA 3WS0A 5FQKA 3F1NB 2WGVA 4WN5A 1YPRA 1O07A 4X1LA 3CI6A 3MQQA 5DKKA 3HJIA 4R6LA 2ZC4B 1BSGA 2A24B 4OLDA 2QKPA 3O5YA 5HSQA 1LLBA 5FI6A 3IX8A 3GMWA 4YINA 2V20A 3ZG8B 1WA9A 4QY6A 3A3EA 3LY4A 4BENA 1XGIA 5J8XA 3BFGA 1S66L 3MS6A 4HP4A 2ZC5B 1CF0A 4R3AA 1NRFA 2JN7A 4BLMA 2WZXA 3TRCA 3F1OA 3P7NA 2PU2A 1YT4A 3UE6A 4WYYA 2EXBA 2G2WA 5M18A 2J8YA 2UV0E 4EERA 4JLFA 1K4EA 4IEDA 3FG8A 1G5UA 4E3JA 3NOUC 2JKRM 2Y91A 2QHKA 5F83A 2J9OA 2W0NA 5HAPA 4IBRA 4Y0TA 2E8JA 1NWZA 2BG1A 2CMNA 3UB5P 3O88A 5HD3A 2WK0A 1GSXA 4OPYA 3UPOA 1K0KA 4GKUA 3UB7A 3Q82A 3OPRA 3VE4A 4KUKA 2Z6CA 1H0MA 4O0PA 3E2LA 3LUQA 5AJGA 3ZCZA 2GZAA 4Y3IA 3UPPA 3LI8A 1PRQA 5GL9A 3QNBA 2X01A 1LI0A 3AGDA 4N1HA 5AVFA 1KGEA 2PHYA 4HH2A 4Y15A 4OQGA 4PM7A 3GR2A 1CEGA 3JVVA 4I39A 3N8RA 1ZKJA 1K38A 1E3UD 3OC2A 3C2WA 4B88A 4IVKA 1IKGA 3FPWA 3ZYTA 3OLOA 4R0QA 1KE3A 1CI8A 2VV7A 3CUEC 3PBOA 3FWLA 3ZNYA 3D72A 4N9LA 2KOIA 2WZZA 3MKFA 2XA7S 1G6OA 3KYEA 4PKYA 5CEDA 4L9EA 5DTTA 3MFDA 3BFEA 1K25A 3LIEA 2OOLA 4U3TA 2Y2GA 3PBQA 4Q0HA 3PXPA 1CK3A 4BL2A 2ZQ8A 5EPHA 2V1ZA 3M6BA 3AGEA 1GCEA 2EX8A 3LR4A 5FI7A 3IS2A 1M6KA 3IF6C 3HLCA 1OJ5A 3T4SA 4KZ9A 3BECA 1PZOA 3T4OA 5F69A 1EW0A 4CJNA 2G7UA 3EEHA 4ZAMA 5A91A 2XEPA 1BLCA 3BYDA 5EVIB 5FEGA 3OPPA 1SZVA 1OTEA 4OH0A 1SDNA 5KIZA 3C4PA 2HDUA 4OQ0A 4R4SA 1LL9A 5F1FA 2PU4A 1H8YA 5IU1A 1UWNX 3MR0A 4LRYC 2BTFP 1UWPX 2X71A 1ES3A 2A3UA 2XFSA 4X55A 3NOPC 5HDCA 4OOYA 1JWPA 3GDIA 1M40A 4KG2A 5HZHA 4ETZA 1JNUA 2VGJA 4EUZA 2NUPC 5TBMB 1Q2QA 3VOLA 3DW0A 4E6WA 3BW6A 4FH2A 4NG2A 3VP1A 2XK1A 1SKOB 3ZG7B 5EOOA 4GN2A 4XUZA 5A90A 4P6ZS 5CTNA 1G68A 5CGWA 3HBRA 2HPBA 5L09A 4PPRA 1S0WA 3UE1A 2W3EA 1XJ2A 3IXGA 3LEZA 1DP6A 3HLDA 1W7FA 3C5AA 2ZQAA 3FC7A 3BLMA 2W1TA 5CHMA 4XT2B 4E04A 2I9VA 4E3IA 3TW8A 3NC8A 3IT9A 3LFVA 3LO7A 2WGIA 2PD7A 4CLCA 1F2KA 4HBTA 5HW3A 3BQAA 1KOUA 3SS3A 3R7WB 4ZJ1A 2ZLYA 4ZDXA 2J3TC 4GS9A 2PRFA 3IH8A 3K3DA 5IHVA 3K2NA 5GLBA 2QJ7A 1E3UA 4NXGA 1K55C 1PZPA 4MN6A 2P7JA 3QP1A 2W1RA 3MMHA 3IH9A 2ZBBA 3GV9A 4OP8A 3RJUA 4GDNA 3PAEA 3V3RA 1NRJA 2A49A 2Y2IA 3RXWA 4R38A 3SS5A 4RYEA 3N7WA 4OONA 4NXFA 5TFQA 1VM1A 4S2PA 1WE4A 4WZ5A 5EUAA 3S22A 3UB6A 1H8ZA 1STZA 3W8KA 3ZVWA 2Z6DA 5F1GA 5D3OA 4EBNA 2DCFA 1ALQA 3TSGA 2XDMA 1S67L 3B33A 2PYRA 4OOLA 3RXXA 4JKTA 3IXDA 4UA9A 3E4PA 3PTEA 4P6BA 4XUXA 2GNXA 3T1SA 1DP8A 5I94A 5A8BA 2V1AA 4F94A 2V8CA 2KX6A 3UMDA 3QP6A 3GRJA 1N9OA 4FH4A 1LHYA 4Y5FA 3N8SA 3LR5A 4L9GA 5J3WA 4GZBA 4KENB 5E2HA 1JWVA 2QYBA 3CZDA 4IUKA 4MMNA 4EBPA 3HL9A 5TR7A 1XKZA 4MCWA 2YKHA 2WYXA 4F3LA 1JWZA 2Y59A 4NK3A 5FAPA 1EI5A 1FCNA 4JGQA 3QHYA 1LT0A 3CG5A 4S2OA 3LICA 3ZG0A 1GA9A 3F1OB 4WF0A 4EQIA 2HDQA 2JHEA 5L8MA 4KUOA 5EE8A 4G3WA 4GHIA 2B18A 2O0YA 3G31A 2L1MA 4OOMA 3M2JA 2PYPA 1YLWA 3KYQA 1D06A 3E0YA 1MKMA 2ZL1A 4GD6A 3HLBA 4BBVA 3TJZC 1BUEA 4OVDA 3NIAA 4Z9QA 5G4YA 5FQMA 4KZ5A 2Y8HA 1XPBA 3KSHA 2EWVA 4OKPA 1LSWA 3NHQA 5EV0A 3LI9A 3HLGA 3ULFA 4EQ1A 2UWXA 5M19A 5FDSA 2Y2HA 4MDZA 4PM9A 2KDKA 5DTKA 2W3GA 2XD5A 3SS4A 1TS7A 2ZQDA 1FILA 3CPTA 4BQMA 5K5BA 4Q0IA 3UE3A 5G4ZA 1YLJA 5TGFA 4WL9A 3NCKA 1FIKA 5AQBA 4N9KA 3IHAA 4IHQA 1L0FA 3P01A 4GD8A 4CLCC 2M7VA 1YM1A 4DF6A 1T1CA 1EWZA 4LV3A 3MXSA 1CJFA 5CECA 4EESA 4LENA 1KVLA 3VSKA 4MBHA 4DE2A 5DF7A 4LGWA 2M1CA 3BFFA 2ZC7A 4OPRA 5CRFA 4X56A 4HEFA 3PBNA 4YWZA 3A0RA 1SDEA 3IS2B 1S4RA 3PYPA 4GOGA 1L3LA 1IKIA 3LY3A 4MBKA 3FYZA 1EROA 3EWKA 3LR3A 3E4QA 2HJEA 2ZOHA 3RFBA 2O9BA 4E3NA 3MBZA 5CTMA 2H0TA 5AVEA 1L2SA 1WYBA 3QP4A 4NETA 3S7PA 5F68A 2Y2NA 4OPZA 1YAXA 1F5MA 5HPFA 5KMWA 3K3CA 2P9VA 2ZQ7A 5EVIC 1FCOA 4YFMA 3HCYA 5KSHA 1KDWA 2HDSA 1FSYA 4S2JA 1KE0A 2DMWA 3MQOA 2GX5A 3TOIA 2B95A 2Y2PA 3KSIA 3LIDA 4HJ6A 5FEFA 4S2IA 1Y54A 3KX0X 3KYZA 3KO6A 4ZJ2A 3DTEA 2WADA 3P98A 4JF4A 1GSVA 2J7VA 4CQHA 4MN5A 4DJ3A 1HLUP 2QWSA 4RX2A 3UB8A 3V3SA 2HJ9C 4UA7A 3VP0A 3GTCA 3L7HA 4QU3A 3E4OA 2K2NA 5HWTA 1Z09A 3H82A 4FUWA 2XA7M 3UE0A 4L0LA 4U0TA 3WS1A 3Q1FA 1ZTUA 2XGNA 3LR0A 1T18A 4QWOA 2B5RA 3U2AA 2W1TB 3V67A 4LPZA 2Y2KA 2VX8A 3C7UA 1TEMA 2EX9A 2PDRA 4EWFA 1PI5A 2R78A 2JBFA 4WMCD 1XFNA 4CLCB 5AQAA 1ES5A 3TE8A 4EV4A 2C5WB 4I5SA 3WS5A 3MZEA 3P09A 4HIAA 5EM1A 5AQ9A 2VKSA 3H7WA 3A3IA 5DVAA 1P9WA 4GS9B 3IWIA 5FATA 2WKHA 1V9ZA 5F5YA 4QJGA 1QMFA 3MZFA 1LI9A 2WKIA 5G18A 1K57C 3MQ0A 2LB5A 5HFOA 3WWXA 3A3DA 4JXGA 1NJ4A 3LEQA 2VV8A 2W3DA 1RGYA 1J9MA 4FOFA 4WLAA 2QMIA 4E3KA 1MXOA 3MFXA 3ICYA 4N92A 2LB9A 3CWFA 2OAP1 1GHPA 4RVAA 1DJBA 1PW1A 1N9LA 2XD1A 4ARZA 3DWZA 1I5QA 1OT6A 4Y17A 2Y79A 1T1AA 4WEKA 2H10A 2XFTA 3GSGA 3LYXA 1VB6A 3Q81A 1HD8A 4BBUA 2OLVA 2GDNA 5DFYA 1ES2A 4P6ZM 1YLYA 5DF8A 3OCNA 2IWBA 1G28A 4X69A 4HNBA 3SOIA 2C6WB 1OJGA 1CI9A 1ONHA 3N6IA 3HLWA 3Q7VA 4LV2A 3B42A 1ZHHB 2VZWA 1SCWA 1YSPA 2XH9A 2EFXA 5LBRA 3BY9A 1XFQA 3DBAA 4LV0A 4EUVA 4A5RA 1Q2PA 3VOZA 5FASA 1FQGA 3R4KA 5CGSA 4ME4A 4IBXA 1KDSA 2O9CA 2Y4AA 4UEYA 5I5LA 1SHVA 1BTLA 1VHMA 4Y0UA 4EW7A 5CHJA 1NZOA 4F3LB 3PAGA 3UDFA 3T4LA 2P74A 3BLSA 1XXMA 1ACFA 2RL3A 2VGLM 4KZ6A 3OZHA 4HH3A 1G6AA 4AFIA 1K4FA 1TS0A 2H5SA 2PR5A 3OPLA 3PR6A 1VEUA 2Y55A 3A0VA 3BFDA 1H5XA 1W5DA 3I7JA 3PHYA 3NJAA 4GHIB 4PHTA 5FSRA 5KZHA 4R70A 2JKFA 2E8IA 1YMXA 1HTZA 3CMZA 2ZL1B 4S2LA 5CXWA 3MZDA 2EA9A 1XJ4A 4E3OA 2VGLS 4MN7A 3DWKA 2Y2OA 2JE5A 5IT5A 1MWSA 5E2EA 3IWOA 4C3QA 3C7VA 3MJQA 4WMCA 4O8GA 4DN0A 2JC7A 1GSWA 1VETA 1K6SA 1UGUA 2I72A 4RA7A 1MKIA 3BM6A 4E6XA 3VMAA 1W8QA 4K0XA 4EEPA 4ETXA 2VK3A 3CPTB 4BJPA 3RH8B 5DFXA 4LCMA 4PM5A 2HF6A 3T1XA 5CGXA 4EU0A 3JVUA 1LL8A 4HBUA 4NXBA 3A3JA 5GLCA 1TDLA 1BLPA 5HD5A 1X0OA 1MC0A 1PIOA 2W3HA 1JTGA 1BLSA 3OBFA 1DY6A 2L4RA 1YMSA 4R3BA 2B02A 1IYQA 3D3OA 3JPUA 5CHUA 3B47A 4UA6A 2Z2LB 2ZMAA 4JGRA 5F6AA 1H3QA 4U0XA 2ZJ9A 1MWRA 1IEMA 1TS6A 3PBRA 1N9BA 4X53A 2K31A 3LIAA 3WRTA 1WYCA 2CC1A 4FSFA 3G2ZA 3CAXA 1ERMA 1LL5A 2Y2QA 3NECA 1J3WA 3FZCA 2Q0OA 4EETB 1ZG6A 5TBMA 2ZM2A 1YLZA 3G6OA 2WGWA 1NYMA 3N4IA 2PT7A 2IA2A 3RTYA 3H9WA 3BQ8A 1IOUA 3WS2A 2PR6A 3MXQA 1GHMA 2P9VB 4BMWA 3CHWP 4MNRA 4Z1WA 4S2KA 1K54A 5FDHA 4DE1A 1XJ6A 2AVXA 5CX7A 4FCFA 3W2ZA 4IUHA 3ZG5A 1FCMA 4GDBA 1JTDA 1PFLA 1KGGA 3D4FA 4S2NA 3NOTC 5MC7A 3G4PA 4H6JA 1BLHA 4Y7PA 2J80A 3U4LP 3F1PA 3IHBA 1PYYA 1NLZA 3ITAA 4MLLA 3CUEA 4KZAA 3UNWA 2R9WA 4WM9A 4JXWA 3IXBA 4KQQA 4D2OA 4JGPA 3IX4A 5AQ7A 3SH9A 4C75A 5GHZA 4DDYA 4MEZA 5FQQA 3DTMA 4O7DA 3H82B 2D02A 5A92A 1IFQA 4FTXA 1CEFA 4YOFA 1H8MA 4KQDA 3MF0A 2PBYA 3O86A 4Y13A 2Y2MA 2Z2MB 3SH8A 1T19A 2R9XA 3NULA 1S1ZA 4JPMA 3GVBA 2ZC3B 5EVLA 4DXCA 4ESPA 4HI4A 4DKIA 2JKGA 3IF6A 1TF1A 3UDIA 4X68A 4OPQA 3KSFA 1GA0A 4HJ3A 3QP8A 4MBFA 3V5MA 3VSLA 2IWCA 3ZDJA 3HUOA 3T1QB 1MZUA 4X25A 5FAQA 1ONGA 3H7WB 1NZUA 3SH7A 2V2FF 2L0WA 4IJGA 2Y2JA 1BZAA 5HWVA 4HESA 1O7EA 1OTIA 4R3JA 2M7UA 4O01A 2P08A 3B3XA 2H0YA 3HLFA 3VFFA 4NKPA 5C5KA 3ZVTA 3BY8A 2VJWA 1L0GA 5L2FA 2JCHA 4CLCE 4OLGA 1VQQA 2FZ0A 4JF5A 4ARZB 2BLSA 4R1GA 4EBLA 1E4DA 1U60A 3IWQA 2WKRA 4B93A 1D1JA 3VP4A 4HJ4A 4WZ5C 2ZD8A 1OTBA 3WRZA 1K56D 3ZQ5A 4LV1A 4E3MA 1NY0A 4P87A 3T50A 3HREA 4RQ9A 4DE3A 2Q9NA 4B4XA 5FL3A 3SW1A 2EX6A 3EGDC 3HJKA 1L0EA 3HUMA 4HP9A 5DF9A 3ITBA 3Q7VB 5FA7A 1YLTA 4XXRA 3LCEA 3BEBA 1P97A 3EOIA 4G3VA 2V8FA 2O99A 1IYSA 4K91A 1MWTA 1IYPA 3N8LA 1I2SA 2NUTC 4K0WA 4ID4A 4UHUA 5EFWA 4M4XA 3MKEA 1D7EA 4ZBEA 5M1AA 2HZ5A 2QZ6A 5HAIA 1YKDA 4QY5A 4R4RA 1K55A 2ZQCA 3ZG9B 2EWWA 2XF3A 1ESUA 1S4SA 3NI9A 1FR6A 3T1RA 5IS1A 4I3JA 2J9PA 1F98A 3HVFA 4CLCD 2KLIA 3UMEA 1N4OA 1K54C 1VEUB 3L9KA 5FQIA 4LFUA 3EEAA 1MPLA 1XX2A 4QHCA 5GLDA 3Q7ZA 1P9RA 2WKEA 3BWLA 2A2LA 4S2NC 5E2FA 3G30A 3S7NA 1DJAA 4L9FA 5JYPA 5BOHA 1IELA 4ZJ3A 4LRXC 1W63Q 5CEBA 2XROA 2ZM0A 2ZC6B 4KQRA 4KZ3A 3S7OA 1W63M 1XP4A 2HP9A 4M3KA 4EXOA 4II7A 2ZOIA 2W3FA 5JYOA 4JF6A 1HVBA 5F82A 3ZNTA 2PD8A 1DRMA 3UN7A 2FFYA 3ZGAB 2P04A 1VETB 3FKWA 5EVID 4BBTA 2XQZA 3E98A 3T12B 3F1NA 3OPHA 4JBFA 5GLAA 4B9OA 3FV7A 2JKTI 5HDSA 3DTKA 5TJJA 3DTIA 3GQZA 2EFUA 4GB7A 3DAVA 3GECA 2V0WA 2OLUA 2IWDA 2Y2LA 3C4OA 1TVFA 4JXSA 2A24A 4IVIA 1JVJA 1A0KA 4NEED 4I38A 5CERA 3FKVA 3JYIA 5DJUA 4FD8A 4KZ7A 3HUNA 3G32A 3IBRA 5L07A 1N9NA 2OWJA 2OAQ1 4I3AA 1TDGA 5U47A 1F9IA 3IXHA 1E25A 4YNRA 4WZ4A 3UB9A 1XJ3A 3C8CA 2ZMVA 5DTSA 1LSVA 1KVMA 4G3KA 5EVEA 4BD0A 2D01A 1Y4OA 4BL3A 4HQAA 4PAUA 3C30A 1K56A 1OMEA 4DDSA 3G34A 4LCLA 1OTDA 1RGZA 3T4JA 1NXYA 2ACGA 3EQVA 2FH5A 5HX9A 1KGFA 2WGWB 1ES4A 4WBGA 2MJ6A 5EECA 1NYYA 4UAAA 1RCJA 2ZMFA 2WUQA 3T4TA 4H8RA 1S1YA 4KG6A 3W4OA 1ZC2A 1SKFA 1QMEA 3SZTA 1BT5A 4PM6A 3OOVA 3Q07A 2VGKA 1TD5A 2VV6A 3LGOA 1ESIA 1YSQA 1HZOA 4UQIM 1KE4A 1S6RA 4H6JB 4JGOA 3S4XA 5HL6A 3F1PB 2QJ5A 3UDXA 5KSCA 4LLOB 1PNEA 5GHXA 5J4EA 3OCLA 2H28A 2DNSA 2JKRI 3UPNA 4KG5A 3S7QA 4HHDA 4E3LA 3NY4A 1PWCA 3BJNA 5L10A 3VP3A 1Y28A 1DJCA 1XA7A 2INWA 3C38A 4LRZE 1AXBA 4DJ2A 2OSUA 3IF5A 3NBLA 1NLYA 4OQHA 3ZHHA 5DKLA 5HL1A 2VA0A 1PI4A 4UQIS 3UY6A 5FQJA 4DXBA 5HDDA 3IX3A 3E2KA 4D60A 5A93A 5HWWA 1MY8A 1T1BA 5DJTA 1XA1A 1OTAA 3IF6B 4GCZA 1LSXA 5HARA 3O87A 3T4KA 2FFFB 2XLNA 1RP5A 1W8YA 4GNUA 1V9YA 5HAQA 2V9AA 3PBSA 1XGJA 2O9AA 4BD1A 4WUJA 1C3BA 4ZRRA 4KZBA 2YKFA 5EM0A 3NDEA 2XRNA 5HPIA 3QNCA 4HY8A 2XR0A 3VFHA 3FPVA 5EVIA 1Z6FA 3V39A 4Q0JA 4WEJA 5EOEA 3W4QA
chains in the Genus database with same CATH topology
2IWCA 3ZDJA 3HUOA 4FH2A 3UE0A 3VP1A 4L0LA 4U0TA 5FAQA 2XK1A 3WS1A 3Q1FA 3ZG7B 5EOOA 2ZQ9A 4GN2A 4XUZA 5A90A 5E43A 1ONGA 1YLPA 2XGNA 2Q9MA 2WAEA 2OV5A 1NZUA 3SH7A 2B5RA 2V2FF 3O3VA 5GHYA 4PMAA 5CTNA 1G68A 5CGWA 1IYOA 2Y2JA 3IQAA 2Y2KA 1BZAA 3C7UA 1TEMA 3HBRA 2EX9A 4HESA 4EWFA 2HPBA 4PPRA 4Q8IA 1PI5A 4CPKA 1O7EA 1S0WA 2EX2A 1ZG4A 2JBFA 3UE1A 4WMCD 4R3JA 4DE0A 4KZ8A 5AQAA 1ES5A 1PWDA 4EV4A 2C5WB 2G2UA 3B3XA 2H0YA 3IXGA 3HLFA 3WS5A 3LEZA 3VFFA 3MZEA 3P09A 5AQ9A 3ZVTA 3A3IA 3ISGA 3HLDA 1W7FA 5DVAA 1L0GA 3C5AA 2ZQAA 3BLMA 3IWIA 5CHMA 4QB8A 5FATA 5L2FA 2WKHA 2JCHA 4OLGA 4E3IA 4QJGA 5FQ9A 1QMFA 3MZFA 3NC8A 3W4QA 1VQQA 3EQUA 3G2YA 1LI9A 3IT9A 4JF5A 2WKIA 3LO7A 5G18A 2WGIA 1K57C 5HFOA 3WWXA 2BLSA 3A3DA 4HBTA 4JXGA 1NJ4A 4R1GA 5HW3A 1RGYA 1E4DA 1J9MA 2RCXA 4EBLA 1U60A 4C6YA 3IWQA 2QMIA 3SS3A 4E3KA 2HP6A 4ZJ1A 1MXOA 2ZLYA 4ZDXA 4QD4A 4N92A 3VP4A 1GHPA 4WZ5C 2ZD8A 4RVAA 4R23A 3VOYA 3IH8A 3WRZA 1K56D 4E3MA 1GHIA 4LV1A 5IHVA 1NY0A 1DJBA 3MXRA 1PW1A 4P87A 3HREA 1FR1A 5GLBA 3ZFZA 4DE3A 2Q9NA 1E3UA 4B4XA 2XD1A 1K6RA 1K55C 2DRWA 2EX6A 1MWUA 3DWZA 1I5QA 1PZPA 1PW8A 2ZM8A 1L0EA 3HUMA 4WEKA 5DF9A 4B4ZA 2H10A 3ITBA 3Q7VB 2XFTA 5FA7A 1YLTA 4XXRA 3GSGA 4PM8A 1FSWA 3Q81A 1HD8A 3IH9A 3LCEA 1YQSA 3BEBA 2EXAA 3GV9A 2OLVA 4OP8A 3RJUA 4GDNA 4WELA 1IYSA 3PAEA 1MWTA 2GDNA 4K91A 1ES2A 3V3RA 1IYPA 3N8LA 1YLYA 3AGFA 1I2SA 4K0WA 5DF8A 3UO9A 3BFCA 4ID4A 3M2KA 3OCNA 2A49A 2IWBA 2Y2IA 1K57A 5E2GA 4X69A 3RXWA 1FOFA 2QPNA 3SS5A 3SOIA 4RYEA 2C6WB 1PWGA 3N7WA 4UHUA 4OONA 1CI9A 1ONHA 3N6IA 4X6TA 4Y0OA 5TFQA 3HLWA 1VM1A 5FI2A 4S2PA 3VP2A 2X02A 3Q7VA 3MKEA 5FAOA 4P85A 4LV2A 1WE4A 4WZ5A 4ZBEA 5M1AA 5EUAA 1SCWA 3S22A 4KQOA 2XH9A 2EFXA 2QZ6A 3G35A 5HAIA 3NDGA 1H8ZA 4QY5A 3W8KA 4LV0A 4R4RA 1K55A 2ZQCA 3CJMA 3ZG9B 3ZVWA 4A5RA 1Q2PA 5F1GA 3VOZA 2XF3A 3V50A 5D3OA 1ESUA 5FASA 1FQGA 5CGSA 3NI9A 1FR6A 2HDRA 4EBNA 2HP5A 2DCFA 1ALQA 4IBXA 1KDSA 2J9PA 3BRMA 3TSGA 3HVFA 3WS4A 2XDMA 4S2MA 2Y4AA 1N4OA 3A3FA 4P0MA 1K54C 3HLEA 1SHVA 2WAFA 1BTLA 3M6HA 1L0DA 4JXVA 4OOLA 4ZTKA 4DRTA 4Y0UA 5FQIA 1W79A 3RXXA 1MBLA 5CHJA 4JKTA 1NZOA 3IXDA 1MPLA 4UA9A 1XX2A 4N1XA 4OP5A 4QHCA 3PAGA 5GLDA 3PTEA 3UDFA 4P6BA 2P74A 4XUXA 3BLSA 3PBTA 3Q7ZA 4RX3A 4OQIA 1ERQA 1XXMA 1BULA 2WKEA 3TG9A 5I94A 2RL3A 4KZ6A 4F94A 3OZHA 4S2NC 5E2FA 3G30A 1I2WA 1G6AA 3GRJA 1K4FA 1DJAA 4FH4A 2H5SA 1LHYA 3S1YA 5JYPA 3N8SA 4GZBA 4KZ4A 3W4PA 3OPLA 3WS0A 5BOHA 4KENB 1IELA 5E2HA 4ZJ3A 1JWVA 5FQKA 2Y55A 3CZDA 5CEBA 3BFDA 1H5XA 3HL9A 2ZM0A 1XKZA 5TR7A 1W5DA 4EBPA 2ZC6B 2WGVA 3I7JA 4KQRA 4KZ3A 1XP4A 2WYXA 2HP9A 1O07A 4M3KA 1JWZA 5FSRA 5KZHA 2Y59A 4NK3A 5FAPA 1EI5A 1FCNA 5JYOA 4JF6A 1HVBA 3QHYA 5F82A 3CG5A 3ZNTA 2E8IA 3UN7A 4S2OA 2FFYA 1YMXA 1HTZA 3ZGAB 2ZC4B 1BSGA 3CMZA 5CXWA 4S2LA 3ZG0A 1GA9A 3MZDA 4OLDA 3FKWA 5EVID 4E3OA 2XQZA 4EQIA 3DWKA 2Y2OA 3OPHA 4JBFA 5GLAA 2HDQA 3FV7A 1LLBA 5FI6A 3GQZA 2JE5A 3GMWA 2EFUA 4GB7A 5EE8A 4YINA 2V20A 3ZG8B 4QY6A 3G31A 1MWSA 3A3EA 4OOMA 3LY4A 4BENA 1XGIA 3M2JA 5E2EA 5J8XA 3BFGA 3IWOA 4C3QA 1YLWA 3C7VA 2OLUA 4WMCA 2IWDA 2Y2LA 2ZC5B 3C4OA 1TVFA 4JXSA 1NRFA 4IVIA 1JVJA 2JC7A 4BLMA 4GD6A 2WZXA 5CERA 3FKVA 1K6SA 3HLBA 3JYIA 2PU2A 2I72A 4RA7A 1YT4A 1BUEA 1MKIA 4FD8A 4WYYA 3BM6A 4OVDA 3NIAA 4KZ7A 4Z9QA 4E6XA 2EXBA 2G2WA 3VMAA 5M18A 3HUNA 2J8YA 5FQMA 3G32A 1W8QA 4K0XA 4KZ5A 4JLFA 1K4EA 4IEDA 1XPBA 4E3JA 4BJPA 2Y91A 1TDGA 5U47A 3IXHA 5F83A 1E25A 2J9OA 4LCMA 4OKPA 4PM5A 4WZ4A 5HAPA 5CGXA 4IBRA 4Y0TA 3HLGA 2BG1A 3O88A 4HBUA 2UWXA 5M19A 2WK0A 2Y2HA 4OPYA 3A3JA 5GLCA 5DTSA 4PM9A 3UPOA 1TDLA 4GKUA 1KVMA 5DTKA 1BLPA 2XD5A 4BD0A 3Q82A 3SS4A 4BL3A 2ZQDA 1PIOA 3OPRA 1K56A 1OMEA 1JTGA 4BQMA 3E2LA 1BLSA 4DDSA 1DY6A 3G34A 3ZCZA 3UE3A 4LCLA 1RGZA 1YLJA 1NXYA 3EQVA 3UPPA 1YMSA 4R3BA 3QNBA 5GL9A 3NCKA 1IYQA 5HX9A 1KGFA 5TGFA 2X01A 2WGWB 1ES4A 1LI0A 4WBGA 3AGDA 5CHUA 4N1HA 5EECA 1KGEA 4UA6A 2Z2LB 1NYYA 5AQBA 2ZMAA 4UAAA 4N9KA 3IHAA 4OQGA 1L0FA 4PM7A 4GD8A 3GR2A 1CEGA 1RCJA 4U0XA 2ZJ9A 2WUQA 1YM1A 4DF6A 1MWRA 4H8RA 1EWZA 1IEMA 3N8RA 1ZKJA 1K38A 1E3UD 4KG6A 4LV3A 3W4OA 3PBRA 1N9BA 3MXSA 3OC2A 4X53A 1ZC2A 1SKFA 4B88A 4IVKA 3WRTA 5CECA 1IKGA 1WYCA 2CC1A 1QMEA 4LENA 4FSFA 1BT5A 3G2ZA 1ERMA 1LL5A 1KVLA 2Y2QA 1KE3A 4MBHA 3Q07A 4PM6A 1CI8A 4R0QA 3FZCA 3VSKA 4DE2A 2VGKA 1ZG6A 2ZM2A 3PBOA 3FWLA 1YLZA 5DF7A 2WGWA 3BFFA 1NYMA 4N9LA 3ZNYA 2ZC7A 3N4IA 4OPRA 5CRFA 4X56A 1ESIA 2WZZA 3MKFA 1HZOA 4HEFA 3WS2A 3PBNA 1GHMA 1KE4A 1S6RA 2P9VB 3S4XA 1SDEA 4GOGA 4MNRA 3UDXA 1IKIA 5KSCA 3LY3A 4MBKA 3FYZA 4S2KA 1K54A 1EROA 5GHXA 5FDHA 5CEDA 3OCLA 2DNSA 4E3NA 3UPNA 4DE1A 4KG5A 5DTTA 3MFDA 3MBZA 5CTMA 3BFEA 1K25A 4E3LA 4FCFA 2H0TA 3NY4A 1PWCA 1L2SA 1WYBA 4U3TA 3ZG5A 4NETA 1FCMA 2Y2GA 2Y2NA 3PBQA 4GDBA 3VP3A 1JTDA 4OPZA 1DJCA 1CK3A 1XA7A 4BL2A 1KGGA 3D4FA 4S2NA 2ZQ8A 5EPHA 2V1ZA 3M6BA 3G4PA 3AGEA 5KMWA 2P9VA 1GCEA 1BLHA 2EX8A 2ZQ7A 1AXBA 4Y7PA 5EVIC 5FI7A 2OSUA 3IF5A 3NBLA 1M6KA 1FCOA 4OQHA 3IF6C 3IHBA 4YFMA 5KSHA 3HLCA 1KDWA 3ZHHA 2HDSA 1FSYA 4S2JA 1KE0A 1PYYA 5HL1A 3ITAA 4KZ9A 1PI4A 4KZAA 3BECA 4MLLA 3UNWA 2R9WA 1PZOA 4WM9A 4JXWA 4CJNA 3UY6A 3IXBA 4ZAMA 3TOIA 5FQJA 4KQQA 5A91A 4DXBA 4D2OA 2Y2PA 2XEPA 1BLCA 3BYDA 5A93A 3E2KA 5EVIB 1MY8A 5AQ7A 3SH9A 4C75A 1XA1A 3OPPA 4S2IA 3IF6B 1Y54A 4OH0A 5GHZA 4DDYA 1SDNA 3C4PA 4MEZA 5FQQA 3DTMA 5HARA 2HDUA 3O87A 4OQ0A 4R4SA 4O7DA 2FFFB 2XLNA 1RP5A 5A92A 1W8YA 4GNUA 5HAQA 1LL9A 5F1FA 2PU4A 3PBSA 1XGJA 4BD1A 1CEFA 1H8YA 4ZJ2A 1C3BA 2PBYA 2WADA 3O86A 4KZBA 2Y2MA 2Z2MB 3SH8A 3NDEA 2R9XA 3P98A 4JPMA 3QNCA 4JF4A 2X71A 3GVBA 2J7VA 2XR0A 2ZC3B 3VFHA 5EVLA 4DXCA 1ES3A 5EVIA 1Z6FA 2A3UA 2XFSA 4RX2A 4X55A 4DKIA 4OOYA 3IF6A 1JWPA 3V3SA 3V39A 4UA7A 3VP0A 3GTCA 3UDIA 4X68A 4QU3A 4OPQA 1M40A 4KG2A 4WEJA 2VGJA 1GA0A 4EUZA 5EOEA 4MBFA 1Q2QA 3V5MA 3VSLA 3DW0A 4E6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWC A;  3ZDJ A;  3HUO A;  4FH2 A;  3UE0 A;  3VP1 A;  4L0L A;  4U0T A;  5FAQ A;  2XK1 A;  3WS1 A;  3Q1F A;  3ZG7 B;  5EOO A;  2ZQ9 A;  4GN2 A;  4XUZ A;  5A90 A;  5E43 A;  1ONG A;  1YLP A;  2XGN A;  2Q9M A;  2WAE A;  2OV5 A;  1NZU A;  3SH7 A;  2B5R A;  2V2F F;  3O3V A;  5GHY A;  4PMA A;  5CTN A;  1G68 A;  5CGW A;  1IYO A;  2Y2J A;  3IQA A;  2Y2K A;  1BZA A;  3C7U A;  1TEM A;  3HBR A;  2EX9 A;  4HES A;  4EWF A;  2HPB A;  4PPR A;  4Q8I A;  1PI5 A;  4CPK A;  1O7E A;  1S0W A;  2EX2 A;  1ZG4 A;  2JBF A;  3UE1 A;  4WMC D;  4R3J A;  4DE0 A;  4KZ8 A;  5AQA A;  1ES5 A;  1PWD A;  4EV4 A;  2C5W B;  2G2U A;  3B3X A;  2H0Y A;  3IXG A;  3HLF A;  3WS5 A;  3LEZ A;  3VFF A;  3MZE A;  3P09 A;  5AQ9 A;  3ZVT A;  3A3I A;  3ISG A;  3HLD A;  1W7F A;  5DVA A;  1L0G A;  3C5A A;  2ZQA A;  3BLM A;  3IWI A;  5CHM A;  4QB8 A;  5FAT A;  5L2F A;  2WKH A;  2JCH A;  4OLG A;  4E3I A;  4QJG A;  5FQ9 A;  1QMF A;  3MZF A;  3NC8 A;  3W4Q A;  1VQQ A;  3EQU A;  3G2Y A;  1LI9 A;  3IT9 A;  4JF5 A;  2WKI A;  3LO7 A;  5G18 A;  2WGI A;  1K57 C;  5HFO A;  3WWX A;  2BLS A;  3A3D A;  4HBT A;  4JXG A;  1NJ4 A;  4R1G A;  5HW3 A;  1RGY A;  1E4D A;  1J9M A;  2RCX A;  4EBL A;  1U60 A;  4C6Y A;  3IWQ A;  2QMI A;  3SS3 A;  4E3K A;  2HP6 A;  4ZJ1 A;  1MXO A;  2ZLY A;  4ZDX A;  4QD4 A;  4N92 A;  3VP4 A;  1GHP A;  4WZ5 C;  2ZD8 A;  4RVA A;  4R23 A;  3VOY A;  3IH8 A;  3WRZ A;  1K56 D;  4E3M A;  1GHI A;  4LV1 A;  5IHV A;  1NY0 A;  1DJB A;  3MXR A;  1PW1 A;  4P87 A;  3HRE A;  1FR1 A;  5GLB A;  3ZFZ A;  4DE3 A;  2Q9N A;  1E3U A;  4B4X A;  2XD1 A;  1K6R A;  1K55 C;  2DRW A;  2EX6 A;  1MWU A;  3DWZ A;  1I5Q A;  1PZP A;  1PW8 A;  2ZM8 A;  1L0E A;  3HUM A;  4WEK A;  5DF9 A;  4B4Z A;  2H10 A;  3ITB A;  3Q7V B;  2XFT A;  5FA7 A;  1YLT A;  4XXR A;  3GSG A;  4PM8 A;  1FSW A;  3Q81 A;  1HD8 A;  3IH9 A;  3LCE A;  1YQS A;  3BEB A;  2EXA A;  3GV9 A;  2OLV A;  4OP8 A;  3RJU A;  4GDN A;  4WEL A;  1IYS A;  3PAE A;  1MWT A;  2GDN A;  4K91 A;  1ES2 A;  3V3R A;  1IYP A;  3N8L A;  1YLY A;  3AGF A;  1I2S A;  4K0W A;  5DF8 A;  3UO9 A;  3BFC A;  4ID4 A;  3M2K A;  3OCN A;  2A49 A;  2IWB A;  2Y2I A;  1K57 A;  5E2G A;  4X69 A;  3RXW A;  1FOF A;  2QPN A;  3SS5 A;  3SOI A;  4RYE A;  2C6W B;  1PWG A;  3N7W A;  4UHU A;  4OON A;  1CI9 A;  1ONH A;  3N6I A;  4X6T A;  4Y0O A;  5TFQ A;  3HLW A;  1VM1 A;  5FI2 A;  4S2P A;  3VP2 A;  2X02 A;  3Q7V A;  3MKE A;  5FAO A;  4P85 A;  4LV2 A;  1WE4 A;  4WZ5 A;  4ZBE A;  5M1A A;  5EUA A;  1SCW A;  3S22 A;  4KQO A;  2XH9 A;  2EFX A;  2QZ6 A;  3G35 A;  5HAI A;  3NDG A;  1H8Z A;  4QY5 A;  3W8K A;  4LV0 A;  4R4R A;  1K55 A;  2ZQC A;  3CJM A;  3ZG9 B;  3ZVW A;  4A5R A;  1Q2P A;  5F1G A;  3VOZ A;  2XF3 A;  3V50 A;  5D3O A;  1ESU A;  5FAS A;  1FQG A;  5CGS A;  3NI9 A;  1FR6 A;  2HDR A;  4EBN A;  2HP5 A;  2DCF A;  1ALQ A;  4IBX A;  1KDS A;  2J9P A;  3BRM A;  3TSG A;  3HVF A;  3WS4 A;  2XDM A;  4S2M A;  2Y4A A;  1N4O A;  3A3F A;  4P0M A;  1K54 C;  3HLE A;  1SHV A;  2WAF A;  1BTL A;  3M6H A;  1L0D A;  4JXV A;  4OOL A;  4ZTK A;  4DRT A;  4Y0U A;  5FQI A;  1W79 A;  3RXX A;  1MBL A;  5CHJ A;  4JKT A;  1NZO A;  3IXD A;  1MPL A;  4UA9 A;  1XX2 A;  4N1X A;  4OP5 A;  4QHC A;  3PAG A;  5GLD A;  3PTE A;  3UDF A;  4P6B A;  2P74 A;  4XUX A;  3BLS A;  3PBT A;  3Q7Z A;  4RX3 A;  4OQI A;  1ERQ A;  1XXM A;  1BUL A;  2WKE A;  3TG9 A;  5I94 A;  2RL3 A;  4KZ6 A;  4F94 A;  3OZH A;  4S2N C;  5E2F A;  3G30 A;  1I2W A;  1G6A A;  3GRJ A;  1K4F A;  1DJA A;  4FH4 A;  2H5S A;  1LHY A;  3S1Y A;  5JYP A;  3N8S A;  4GZB A;  4KZ4 A;  3W4P A;  3OPL A;  3WS0 A;  5BOH A;  4KEN B;  1IEL A;  5E2H A;  4ZJ3 A;  1JWV A;  5FQK A;  2Y55 A;  3CZD A;  5CEB A;  3BFD A;  1H5X A;  3HL9 A;  2ZM0 A;  1XKZ A;  5TR7 A;  1W5D A;  4EBP A;  2ZC6 B;  2WGV A;  3I7J A;  4KQR A;  4KZ3 A;  1XP4 A;  2WYX A;  2HP9 A;  1O07 A;  4M3K A;  1JWZ A;  5FSR A;  5KZH A;  2Y59 A;  4NK3 A;  5FAP A;  1EI5 A;  1FCN A;  5JYO A;  4JF6 A;  1HVB A;  3QHY A;  5F82 A;  3CG5 A;  3ZNT A;  2E8I A;  3UN7 A;  4S2O A;  2FFY A;  1YMX A;  1HTZ A;  3ZGA B;  2ZC4 B;  1BSG A;  3CMZ A;  5CXW A;  4S2L A;  3ZG0 A;  1GA9 A;  3MZD A;  4OLD A;  3FKW A;  5EVI D;  4E3O A;  2XQZ A;  4EQI A;  3DWK A;  2Y2O A;  3OPH A;  4JBF A;  5GLA A;  2HDQ A;  3FV7 A;  1LLB A;  5FI6 A;  3GQZ A;  2JE5 A;  3GMW A;  2EFU A;  4GB7 A;  5EE8 A;  4YIN A;  2V20 A;  3ZG8 B;  4QY6 A;  3G31 A;  1MWS A;  3A3E A;  4OOM A;  3LY4 A;  4BEN A;  1XGI A;  3M2J A;  5E2E A;  5J8X A;  3BFG A;  3IWO A;  4C3Q A;  1YLW A;  3C7V A;  2OLU A;  4WMC A;  2IWD A;  2Y2L A;  2ZC5 B;  3C4O A;  1TVF A;  4JXS A;  1NRF A;  4IVI A;  1JVJ A;  2JC7 A;  4BLM A;  4GD6 A;  2WZX A;  5CER A;  3FKV A;  1K6S A;  3HLB A;  3JYI A;  2PU2 A;  2I72 A;  4RA7 A;  1YT4 A;  1BUE A;  1MKI A;  4FD8 A;  4WYY A;  3BM6 A;  4OVD A;  3NIA A;  4KZ7 A;  4Z9Q A;  4E6X A;  2EXB A;  2G2W A;  3VMA A;  5M18 A;  3HUN A;  2J8Y A;  5FQM A;  3G32 A;  1W8Q A;  4K0X A;  4KZ5 A;  4JLF A;  1K4E A;  4IED A;  1XPB A;  4E3J A;  4BJP A;  2Y91 A;  1TDG A;  5U47 A;  3IXH A;  5F83 A;  1E25 A;  2J9O A;  4LCM A;  4OKP A;  4PM5 A;  4WZ4 A;  5HAP A;  5CGX A;  4IBR A;  4Y0T A;  3HLG A;  2BG1 A;  3O88 A;  4HBU A;  2UWX A;  5M19 A;  2WK0 A;  2Y2H A;  4OPY A;  3A3J A;  5GLC A;  5DTS A;  4PM9 A;  3UPO A;  1TDL A;  4GKU A;  1KVM A;  5DTK A;  1BLP A;  2XD5 A;  4BD0 A;  3Q82 A;  3SS4 A;  4BL3 A;  2ZQD A;  1PIO A;  3OPR A;  1K56 A;  1OME A;  1JTG A;  4BQM A;  3E2L A;  1BLS A;  4DDS A;  1DY6 A;  3G34 A;  3ZCZ A;  3UE3 A;  4LCL A;  1RGZ A;  1YLJ A;  1NXY A;  3EQV A;  3UPP A;  1YMS A;  4R3B A;  3QNB A;  5GL9 A;  3NCK A;  1IYQ A;  5HX9 A;  1KGF A;  5TGF A;  2X01 A;  2WGW B;  1ES4 A;  1LI0 A;  4WBG A;  3AGD A;  5CHU A;  4N1H A;  5EEC A;  1KGE A;  4UA6 A;  2Z2L B;  1NYY A;  5AQB A;  2ZMA A;  4UAA A;  4N9K A;  3IHA A;  4OQG A;  1L0F A;  4PM7 A;  4GD8 A;  3GR2 A;  1CEG A;  1RCJ A;  4U0X A;  2ZJ9 A;  2WUQ A;  1YM1 A;  4DF6 A;  1MWR A;  4H8R A;  1EWZ A;  1IEM A;  3N8R A;  1ZKJ A;  1K38 A;  1E3U D;  4KG6 A;  4LV3 A;  3W4O A;  3PBR A;  1N9B A;  3MXS A;  3OC2 A;  4X53 A;  1ZC2 A;  1SKF A;  4B88 A;  4IVK A;  3WRT A;  5CEC A;  1IKG A;  1WYC A;  2CC1 A;  1QME A;  4LEN A;  4FSF A;  1BT5 A;  3G2Z A;  1ERM A;  1LL5 A;  1KVL A;  2Y2Q A;  1KE3 A;  4MBH A;  3Q07 A;  4PM6 A;  1CI8 A;  4R0Q A;  3FZC A;  3VSK A;  4DE2 A;  2VGK A;  1ZG6 A;  2ZM2 A;  3PBO A;  3FWL A;  1YLZ A;  5DF7 A;  2WGW A;  3BFF A;  1NYM A;  4N9L A;  3ZNY A;  2ZC7 A;  3N4I A;  4OPR A;  5CRF A;  4X56 A;  1ESI A;  2WZZ A;  3MKF A;  1HZO A;  4HEF A;  3WS2 A;  3PBN A;  1GHM A;  1KE4 A;  1S6R A;  2P9V B;  3S4X A;  1SDE A;  4GOG A;  4MNR A;  3UDX A;  1IKI A;  5KSC A;  3LY3 A;  4MBK A;  3FYZ A;  4S2K A;  1K54 A;  1ERO A;  5GHX A;  5FDH A;  5CED A;  3OCL A;  2DNS A;  4E3N A;  3UPN A;  4DE1 A;  4KG5 A;  5DTT A;  3MFD A;  3MBZ A;  5CTM A;  3BFE A;  1K25 A;  4E3L A;  4FCF A;  2H0T A;  3NY4 A;  1PWC A;  1L2S A;  1WYB A;  4U3T A;  3ZG5 A;  4NET A;  1FCM A;  2Y2G A;  2Y2N A;  3PBQ A;  4GDB A;  3VP3 A;  1JTD A;  4OPZ A;  1DJC A;  1CK3 A;  1XA7 A;  4BL2 A;  1KGG A;  3D4F A;  4S2N A;  2ZQ8 A;  5EPH A;  2V1Z A;  3M6B A;  3G4P A;  3AGE A;  5KMW A;  2P9V A;  1GCE A;  1BLH A;  2EX8 A;  2ZQ7 A;  1AXB A;  4Y7P A;  5EVI C;  5FI7 A;  2OSU A;  3IF5 A;  3NBL A;  1M6K A;  1FCO A;  4OQH A;  3IF6 C;  3IHB A;  4YFM A;  5KSH A;  3HLC A;  1KDW A;  3ZHH A;  2HDS A;  1FSY A;  4S2J A;  1KE0 A;  1PYY A;  5HL1 A;  3ITA A;  4KZ9 A;  1PI4 A;  4KZA A;  3BEC A;  4MLL A;  3UNW A;  2R9W A;  1PZO A;  4WM9 A;  4JXW A;  4CJN A;  3UY6 A;  3IXB A;  4ZAM A;  3TOI A;  5FQJ A;  4KQQ A;  5A91 A;  4DXB A;  4D2O A;  2Y2P A;  2XEP A;  1BLC A;  3BYD A;  5A93 A;  3E2K A;  5EVI B;  1MY8 A;  5AQ7 A;  3SH9 A;  4C75 A;  1XA1 A;  3OPP A;  4S2I A;  3IF6 B;  1Y54 A;  4OH0 A;  5GHZ A;  4DDY A;  1SDN A;  3C4P A;  4MEZ A;  5FQQ A;  3DTM A;  5HAR A;  2HDU A;  3O87 A;  4OQ0 A;  4R4S A;  4O7D A;  2FFF B;  2XLN A;  1RP5 A;  5A92 A;  1W8Y A;  4GNU A;  5HAQ A;  1LL9 A;  5F1F A;  2PU4 A;  3PBS A;  1XGJ A;  4BD1 A;  1CEF A;  1H8Y A;  4ZJ2 A;  1C3B A;  2PBY A;  2WAD A;  3O86 A;  4KZB A;  2Y2M A;  2Z2M B;  3SH8 A;  3NDE A;  2R9X A;  3P98 A;  4JPM A;  3QNC A;  4JF4 A;  2X71 A;  3GVB A;  2J7V A;  2XR0 A;  2ZC3 B;  3VFH A;  5EVL A;  4DXC A;  1ES3 A;  5EVI A;  1Z6F A;  2A3U A;  2XFS A;  4RX2 A;  4X55 A;  4DKI A;  4OOY A;  3IF6 A;  1JWP A;  3V3S A;  3V39 A;  4UA7 A;  3VP0 A;  3GTC A;  3UDI A;  4X68 A;  4QU3 A;  4OPQ A;  1M40 A;  4KG2 A;  4WEJ A;  2VGJ A;  1GA0 A;  4EUZ A;  5EOE A;  4MBF A;  1Q2Q A;  3V5M A;  3VSL A;  3DW0 A;  4E6W A; 
#chains in the Genus database with same CATH topology
 4I3I A;  4GJ4 A;  4NXE A;  1OT9 A;  2XSS A;  2ZQ9 A;  5E43 A;  1YLP A;  2Q9M A;  2WAE A;  2OV5 A;  1OPX A;  4K08 A;  3O3V A;  5GHY A;  4PMA A;  1ODV A;  2BAS A;  1IYO A;  3IQA A;  1P0Z A;  4Q8I A;  4CPK A;  2EX2 A;  1ZG4 A;  4DE0 A;  4KZ8 A;  2W27 A;  1PWD A;  2G2U A;  1SKO A;  3ISG A;  3D9Y A;  4QB8 A;  2HV1 A;  5FQ9 A;  3LIF A;  3EQU A;  3G2Y A;  2J3T D;  4HOI A;  2HGV A;  3A0S A;  2RCX A;  4C6Y A;  3CLO A;  2HP6 A;  1CQA A;  4QD4 A;  2VEA A;  4XT2 A;  3VOY A;  4R23 A;  1GHI A;  1TS8 A;  5J7E A;  3MXR A;  4DMZ A;  1FR1 A;  3ZFZ A;  2K7S A;  1K6R A;  2DRW A;  1MWU A;  1PW8 A;  2ZM8 A;  4B4Z A;  3LIB A;  4Y2F A;  2J3W A;  2GJ3 A;  4PM8 A;  1FSW A;  3VE3 A;  1BYW A;  3R7W A;  1YQS A;  2EXA A;  1AWI A;  4WEL A;  2V1B A;  4QPR A;  4GLQ A;  3CIT A;  3AGF A;  3UO9 A;  3BFC A;  3M2K A;  1K57 A;  5E2G A;  1FOF A;  2QPN A;  3KSG A;  1PWG A;  4X1M A;  2PAV P;  4X6T A;  4Y0O A;  3EGX C;  5FI2 A;  3VP2 A;  2X02 A;  5FAO A;  4P85 A;  2JKT M;  2PBD P;  4KQO A;  2OWH A;  3G35 A;  3NDG A;  3CJM A;  3V50 A;  2HDR A;  2HP5 A;  3BRM A;  4BWI A;  3IBJ A;  3WS4 A;  4S2M A;  3A3F A;  4P0M A;  3HLE A;  2WAF A;  3M6H A;  1L0D A;  4JXV A;  4ZTK A;  4DRT A;  1W79 A;  4PKY G;  1MBL A;  2WKQ A;  3VV4 A;  4N1X A;  4OP5 A;  2WKP A;  3QP5 A;  1DP9 A;  3PBT A;  4RX3 A;  4OQI A;  1ERQ A;  4GW9 A;  1BUL A;  2V0U A;  3TG9 A;  3T4Q A;  3QP2 A;  4EEU A;  1I2W A;  3MSH A;  3S1Y A;  4KZ4 A;  2VLG A;  3W4P A;  3WS0 A;  5FQK A;  3F1N B;  2WGV A;  4WN5 A;  1YPR A;  1O07 A;  4X1L A;  3CI6 A;  3MQQ A;  5DKK A;  3HJI A;  4R6L A;  2ZC4 B;  1BSG A;  2A24 B;  4OLD A;  2QKP A;  3O5Y A;  5HSQ A;  1LLB A;  5FI6 A;  3IX8 A;  3GMW A;  4YIN A;  2V20 A;  3ZG8 B;  1WA9 A;  4QY6 A;  3A3E A;  3LY4 A;  4BEN A;  1XGI A;  5J8X A;  3BFG A;  1S66 L;  3MS6 A;  4HP4 A;  2ZC5 B;  1CF0 A;  4R3A A;  1NRF A;  2JN7 A;  4BLM A;  2WZX A;  3TRC A;  3F1O A;  3P7N A;  2PU2 A;  1YT4 A;  3UE6 A;  4WYY A;  2EXB A;  2G2W A;  5M18 A;  2J8Y A;  2UV0 E;  4EER A;  4JLF A;  1K4E A;  4IED A;  3FG8 A;  1G5U A;  4E3J A;  3NOU C;  2JKR M;  2Y91 A;  2QHK A;  5F83 A;  2J9O A;  2W0N A;  5HAP A;  4IBR A;  4Y0T A;  2E8J A;  1NWZ A;  2BG1 A;  2CMN A;  3UB5 P;  3O88 A;  5HD3 A;  2WK0 A;  1GSX A;  4OPY A;  3UPO A;  1K0K A;  4GKU A;  3UB7 A;  3Q82 A;  3OPR A;  3VE4 A;  4KUK A;  2Z6C A;  1H0M A;  4O0P A;  3E2L A;  3LUQ A;  5AJG A;  3ZCZ A;  2GZA A;  4Y3I A;  3UPP A;  3LI8 A;  1PRQ A;  5GL9 A;  3QNB A;  2X01 A;  1LI0 A;  3AGD A;  4N1H A;  5AVF A;  1KGE A;  2PHY A;  4HH2 A;  4Y15 A;  4OQG A;  4PM7 A;  3GR2 A;  1CEG A;  3JVV A;  4I39 A;  3N8R A;  1ZKJ A;  1K38 A;  1E3U D;  3OC2 A;  3C2W A;  4B88 A;  4IVK A;  1IKG A;  3FPW A;  3ZYT A;  3OLO A;  4R0Q A;  1KE3 A;  1CI8 A;  2VV7 A;  3CUE C;  3PBO A;  3FWL A;  3ZNY A;  3D72 A;  4N9L A;  2KOI A;  2WZZ A;  3MKF A;  2XA7 S;  1G6O A;  3KYE A;  4PKY A;  5CED A;  4L9E A;  5DTT A;  3MFD A;  3BFE A;  1K25 A;  3LIE A;  2OOL A;  4U3T A;  2Y2G A;  3PBQ A;  4Q0H A;  3PXP A;  1CK3 A;  4BL2 A;  2ZQ8 A;  5EPH A;  2V1Z A;  3M6B A;  3AGE A;  1GCE A;  2EX8 A;  3LR4 A;  5FI7 A;  3IS2 A;  1M6K A;  3IF6 C;  3HLC A;  1OJ5 A;  3T4S A;  4KZ9 A;  3BEC A;  1PZO A;  3T4O A;  5F69 A;  1EW0 A;  4CJN A;  2G7U A;  3EEH A;  4ZAM A;  5A91 A;  2XEP A;  1BLC A;  3BYD A;  5EVI B;  5FEG A;  3OPP A;  1SZV A;  1OTE A;  4OH0 A;  1SDN A;  5KIZ A;  3C4P A;  2HDU A;  4OQ0 A;  4R4S A;  1LL9 A;  5F1F A;  2PU4 A;  1H8Y A;  5IU1 A;  1UWN X;  3MR0 A;  4LRY C;  2BTF P;  1UWP X;  2X71 A;  1ES3 A;  2A3U A;  2XFS A;  4X55 A;  3NOP C;  5HDC A;  4OOY A;  1JWP A;  3GDI A;  1M40 A;  4KG2 A;  5HZH A;  4ETZ A;  1JNU A;  2VGJ A;  4EUZ A;  2NUP C;  5TBM B;  1Q2Q A;  3VOL A;  3DW0 A;  4E6W A;  3BW6 A;  4FH2 A;  4NG2 A;  3VP1 A;  2XK1 A;  1SKO B;  3ZG7 B;  5EOO A;  4GN2 A;  4XUZ A;  5A90 A;  4P6Z S;  5CTN A;  1G68 A;  5CGW A;  3HBR A;  2HPB A;  5L09 A;  4PPR A;  1S0W A;  3UE1 A;  2W3E A;  1XJ2 A;  3IXG A;  3LEZ A;  1DP6 A;  3HLD A;  1W7F A;  3C5A A;  2ZQA A;  3FC7 A;  3BLM A;  2W1T A;  5CHM A;  4XT2 B;  4E04 A;  2I9V A;  4E3I A;  3TW8 A;  3NC8 A;  3IT9 A;  3LFV A;  3LO7 A;  2WGI A;  2PD7 A;  4CLC A;  1F2K A;  4HBT A;  5HW3 A;  3BQA A;  1KOU A;  3SS3 A;  3R7W B;  4ZJ1 A;  2ZLY A;  4ZDX A;  2J3T C;  4GS9 A;  2PRF A;  3IH8 A;  3K3D A;  5IHV A;  3K2N A;  5GLB A;  2QJ7 A;  1E3U A;  4NXG A;  1K55 C;  1PZP A;  4MN6 A;  2P7J A;  3QP1 A;  2W1R A;  3MMH A;  3IH9 A;  2ZBB A;  3GV9 A;  4OP8 A;  3RJU A;  4GDN A;  3PAE A;  3V3R A;  1NRJ A;  2A49 A;  2Y2I A;  3RXW A;  4R38 A;  3SS5 A;  4RYE A;  3N7W A;  4OON A;  4NXF A;  5TFQ A;  1VM1 A;  4S2P A;  1WE4 A;  4WZ5 A;  5EUA A;  3S22 A;  3UB6 A;  1H8Z A;  1STZ A;  3W8K A;  3ZVW A;  2Z6D A;  5F1G A;  5D3O A;  4EBN A;  2DCF A;  1ALQ A;  3TSG A;  2XDM A;  1S67 L;  3B33 A;  2PYR A;  4OOL A;  3RXX A;  4JKT A;  3IXD A;  4UA9 A;  3E4P A;  3PTE A;  4P6B A;  4XUX A;  2GNX A;  3T1S A;  1DP8 A;  5I94 A;  5A8B A;  2V1A A;  4F94 A;  2V8C A;  2KX6 A;  3UMD A;  3QP6 A;  3GRJ A;  1N9O A;  4FH4 A;  1LHY A;  4Y5F A;  3N8S A;  3LR5 A;  4L9G A;  5J3W A;  4GZB A;  4KEN B;  5E2H A;  1JWV A;  2QYB A;  3CZD A;  4IUK A;  4MMN A;  4EBP A;  3HL9 A;  5TR7 A;  1XKZ A;  4MCW A;  2YKH A;  2WYX A;  4F3L A;  1JWZ A;  2Y59 A;  4NK3 A;  5FAP A;  1EI5 A;  1FCN A;  4JGQ A;  3QHY A;  1LT0 A;  3CG5 A;  4S2O A;  3LIC A;  3ZG0 A;  1GA9 A;  3F1O B;  4WF0 A;  4EQI A;  2HDQ A;  2JHE A;  5L8M A;  4KUO A;  5EE8 A;  4G3W A;  4GHI A;  2B18 A;  2O0Y A;  3G31 A;  2L1M A;  4OOM A;  3M2J A;  2PYP A;  1YLW A;  3KYQ A;  1D06 A;  3E0Y A;  1MKM A;  2ZL1 A;  4GD6 A;  3HLB A;  4BBV A;  3TJZ C;  1BUE A;  4OVD A;  3NIA A;  4Z9Q A;  5G4Y A;  5FQM A;  4KZ5 A;  2Y8H A;  1XPB A;  3KSH A;  2EWV A;  4OKP A;  1LSW A;  3NHQ A;  5EV0 A;  3LI9 A;  3HLG A;  3ULF A;  4EQ1 A;  2UWX A;  5M19 A;  5FDS A;  2Y2H A;  4MDZ A;  4PM9 A;  2KDK A;  5DTK A;  2W3G A;  2XD5 A;  3SS4 A;  1TS7 A;  2ZQD A;  1FIL A;  3CPT A;  4BQM A;  5K5B A;  4Q0I A;  3UE3 A;  5G4Z A;  1YLJ A;  5TGF A;  4WL9 A;  3NCK A;  1FIK A;  5AQB A;  4N9K A;  3IHA A;  4IHQ A;  1L0F A;  3P01 A;  4GD8 A;  4CLC C;  2M7V A;  1YM1 A;  4DF6 A;  1T1C A;  1EWZ A;  4LV3 A;  3MXS A;  1CJF A;  5CEC A;  4EES A;  4LEN A;  1KVL A;  3VSK A;  4MBH A;  4DE2 A;  5DF7 A;  4LGW A;  2M1C A;  3BFF A;  2ZC7 A;  4OPR A;  5CRF A;  4X56 A;  4HEF A;  3PBN A;  4YWZ A;  3A0R A;  1SDE A;  3IS2 B;  1S4R A;  3PYP A;  4GOG A;  1L3L A;  1IKI A;  3LY3 A;  4MBK A;  3FYZ A;  1ERO A;  3EWK A;  3LR3 A;  3E4Q A;  2HJE A;  2ZOH A;  3RFB A;  2O9B A;  4E3N A;  3MBZ A;  5CTM A;  2H0T A;  5AVE A;  1L2S A;  1WYB A;  3QP4 A;  4NET A;  3S7P A;  5F68 A;  2Y2N A;  4OPZ A;  1YAX A;  1F5M A;  5HPF A;  5KMW A;  3K3C A;  2P9V A;  2ZQ7 A;  5EVI C;  1FCO A;  4YFM A;  3HCY A;  5KSH A;  1KDW A;  2HDS A;  1FSY A;  4S2J A;  1KE0 A;  2DMW A;  3MQO A;  2GX5 A;  3TOI A;  2B95 A;  2Y2P A;  3KSI A;  3LID A;  4HJ6 A;  5FEF A;  4S2I A;  1Y54 A;  3KX0 X;  3KYZ A;  3KO6 A;  4ZJ2 A;  3DTE A;  2WAD A;  3P98 A;  4JF4 A;  1GSV A;  2J7V A;  4CQH A;  4MN5 A;  4DJ3 A;  1HLU P;  2QWS A;  4RX2 A;  3UB8 A;  3V3S A;  2HJ9 C;  4UA7 A;  3VP0 A;  3GTC A;  3L7H A;  4QU3 A;  3E4O A;  2K2N A;  5HWT A;  1Z09 A;  3H82 A;  4FUW A;  2XA7 M;  3UE0 A;  4L0L A;  4U0T A;  3WS1 A;  3Q1F A;  1ZTU A;  2XGN A;  3LR0 A;  1T18 A;  4QWO A;  2B5R A;  3U2A A;  2W1T B;  3V67 A;  4LPZ A;  2Y2K A;  2VX8 A;  3C7U A;  1TEM A;  2EX9 A;  2PDR A;  4EWF A;  1PI5 A;  2R78 A;  2JBF A;  4WMC D;  1XFN A;  4CLC B;  5AQA A;  1ES5 A;  3TE8 A;  4EV4 A;  2C5W B;  4I5S A;  3WS5 A;  3MZE A;  3P09 A;  4HIA A;  5EM1 A;  5AQ9 A;  2VKS A;  3H7W A;  3A3I A;  5DVA A;  1P9W A;  4GS9 B;  3IWI A;  5FAT A;  2WKH A;  1V9Z A;  5F5Y A;  4QJG A;  1QMF A;  3MZF A;  1LI9 A;  2WKI A;  5G18 A;  1K57 C;  3MQ0 A;  2LB5 A;  5HFO A;  3WWX A;  3A3D A;  4JXG A;  1NJ4 A;  3LEQ A;  2VV8 A;  2W3D A;  1RGY A;  1J9M A;  4FOF A;  4WLA A;  2QMI A;  4E3K A;  1MXO A;  3MFX A;  3ICY A;  4N92 A;  2LB9 A;  3CWF A;  2OAP 1;  1GHP A;  4RVA A;  1DJB A;  1PW1 A;  1N9L A;  2XD1 A;  4ARZ A;  3DWZ A;  1I5Q A;  1OT6 A;  4Y17 A;  2Y79 A;  1T1A A;  4WEK A;  2H10 A;  2XFT A;  3GSG A;  3LYX A;  1VB6 A;  3Q81 A;  1HD8 A;  4BBU A;  2OLV A;  2GDN A;  5DFY A;  1ES2 A;  4P6Z M;  1YLY A;  5DF8 A;  3OCN A;  2IWB A;  1G28 A;  4X69 A;  4HNB A;  3SOI A;  2C6W B;  1OJG A;  1CI9 A;  1ONH A;  3N6I A;  3HLW A;  3Q7V A;  4LV2 A;  3B42 A;  1ZHH B;  2VZW A;  1SCW A;  1YSP A;  2XH9 A;  2EFX A;  5LBR A;  3BY9 A;  1XFQ A;  3DBA A;  4LV0 A;  4EUV A;  4A5R A;  1Q2P A;  3VOZ A;  5FAS A;  1FQG A;  3R4K A;  5CGS A;  4ME4 A;  4IBX A;  1KDS A;  2O9C A;  2Y4A A;  4UEY A;  5I5L A;  1SHV A;  1BTL A;  1VHM A;  4Y0U A;  4EW7 A;  5CHJ A;  1NZO A;  4F3L B;  3PAG A;  3UDF A;  3T4L A;  2P74 A;  3BLS A;  1XXM A;  1ACF A;  2RL3 A;  2VGL M;  4KZ6 A;  3OZH A;  4HH3 A;  1G6A A;  4AFI A;  1K4F A;  1TS0 A;  2H5S A;  2PR5 A;  3OPL A;  3PR6 A;  1VEU A;  2Y55 A;  3A0V A;  3BFD A;  1H5X A;  1W5D A;  3I7J A;  3PHY A;  3NJA A;  4GHI B;  4PHT A;  5FSR A;  5KZH A;  4R70 A;  2JKF A;  2E8I A;  1YMX A;  1HTZ A;  3CMZ A;  2ZL1 B;  4S2L A;  5CXW A;  3MZD A;  2EA9 A;  1XJ4 A;  4E3O A;  2VGL S;  4MN7 A;  3DWK A;  2Y2O A;  2JE5 A;  5IT5 A;  1MWS A;  5E2E A;  3IWO A;  4C3Q A;  3C7V A;  3MJQ A;  4WMC A;  4O8G A;  4DN0 A;  2JC7 A;  1GSW A;  1VET A;  1K6S A;  1UGU A;  2I72 A;  4RA7 A;  1MKI A;  3BM6 A;  4E6X A;  3VMA A;  1W8Q A;  4K0X A;  4EEP A;  4ETX A;  2VK3 A;  3CPT B;  4BJP A;  3RH8 B;  5DFX A;  4LCM A;  4PM5 A;  2HF6 A;  3T1X A;  5CGX A;  4EU0 A;  3JVU A;  1LL8 A;  4HBU A;  4NXB A;  3A3J A;  5GLC A;  1TDL A;  1BLP A;  5HD5 A;  1X0O A;  1MC0 A;  1PIO A;  2W3H A;  1JTG A;  1BLS A;  3OBF A;  1DY6 A;  2L4R A;  1YMS A;  4R3B A;  2B02 A;  1IYQ A;  3D3O A;  3JPU A;  5CHU A;  3B47 A;  4UA6 A;  2Z2L B;  2ZMA A;  4JGR A;  5F6A A;  1H3Q A;  4U0X A;  2ZJ9 A;  1MWR A;  1IEM A;  1TS6 A;  3PBR A;  1N9B A;  4X53 A;  2K31 A;  3LIA A;  3WRT A;  1WYC A;  2CC1 A;  4FSF A;  3G2Z A;  3CAX A;  1ERM A;  1LL5 A;  2Y2Q A;  3NEC A;  1J3W A;  3FZC A;  2Q0O A;  4EET B;  1ZG6 A;  5TBM A;  2ZM2 A;  1YLZ A;  3G6O A;  2WGW A;  1NYM A;  3N4I A;  2PT7 A;  2IA2 A;  3RTY A;  3H9W A;  3BQ8 A;  1IOU A;  3WS2 A;  2PR6 A;  3MXQ A;  1GHM A;  2P9V B;  4BMW A;  3CHW P;  4MNR A;  4Z1W A;  4S2K A;  1K54 A;  5FDH A;  4DE1 A;  1XJ6 A;  2AVX A;  5CX7 A;  4FCF A;  3W2Z A;  4IUH A;  3ZG5 A;  1FCM A;  4GDB A;  1JTD A;  1PFL A;  1KGG A;  3D4F A;  4S2N A;  3NOT C;  5MC7 A;  3G4P A;  4H6J A;  1BLH A;  4Y7P A;  2J80 A;  3U4L P;  3F1P A;  3IHB A;  1PYY A;  1NLZ A;  3ITA A;  4MLL A;  3CUE A;  4KZA A;  3UNW A;  2R9W A;  4WM9 A;  4JXW A;  3IXB A;  4KQQ A;  4D2O A;  4JGP A;  3IX4 A;  5AQ7 A;  3SH9 A;  4C75 A;  5GHZ A;  4DDY A;  4MEZ A;  5FQQ A;  3DTM A;  4O7D A;  3H82 B;  2D02 A;  5A92 A;  1IFQ A;  4FTX A;  1CEF A;  4YOF A;  1H8M A;  4KQD A;  3MF0 A;  2PBY A;  3O86 A;  4Y13 A;  2Y2M A;  2Z2M B;  3SH8 A;  1T19 A;  2R9X A;  3NUL A;  1S1Z A;  4JPM A;  3GVB A;  2ZC3 B;  5EVL A;  4DXC A;  4ESP A;  4HI4 A;  4DKI A;  2JKG A;  3IF6 A;  1TF1 A;  3UDI A;  4X68 A;  4OPQ A;  3KSF A;  1GA0 A;  4HJ3 A;  3QP8 A;  4MBF A;  3V5M A;  3VSL A;  2IWC A;  3ZDJ A;  3HUO A;  3T1Q B;  1MZU A;  4X25 A;  5FAQ A;  1ONG A;  3H7W B;  1NZU A;  3SH7 A;  2V2F F;  2L0W A;  4IJG A;  2Y2J A;  1BZA A;  5HWV A;  4HES A;  1O7E A;  1OTI A;  4R3J A;  2M7U A;  4O01 A;  2P08 A;  3B3X A;  2H0Y A;  3HLF A;  3VFF A;  4NKP A;  5C5K A;  3ZVT A;  3BY8 A;  2VJW A;  1L0G A;  5L2F A;  2JCH A;  4CLC E;  4OLG A;  1VQQ A;  2FZ0 A;  4JF5 A;  4ARZ B;  2BLS A;  4R1G A;  4EBL A;  1E4D A;  1U60 A;  3IWQ A;  2WKR A;  4B93 A;  1D1J A;  3VP4 A;  4HJ4 A;  4WZ5 C;  2ZD8 A;  1OTB A;  3WRZ A;  1K56 D;  3ZQ5 A;  4LV1 A;  4E3M A;  1NY0 A;  4P87 A;  3T50 A;  3HRE A;  4RQ9 A;  4DE3 A;  2Q9N A;  4B4X A;  5FL3 A;  3SW1 A;  2EX6 A;  3EGD C;  3HJK A;  1L0E A;  3HUM A;  4HP9 A;  5DF9 A;  3ITB A;  3Q7V B;  5FA7 A;  1YLT A;  4XXR A;  3LCE A;  3BEB A;  1P97 A;  3EOI A;  4G3V A;  2V8F A;  2O99 A;  1IYS A;  4K91 A;  1MWT A;  1IYP A;  3N8L A;  1I2S A;  2NUT C;  4K0W A;  4ID4 A;  4UHU A;  5EFW A;  4M4X A;  3MKE A;  1D7E A;  4ZBE A;  5M1A A;  2HZ5 A;  2QZ6 A;  5HAI A;  1YKD A;  4QY5 A;  4R4R A;  1K55 A;  2ZQC A;  3ZG9 B;  2EWW A;  2XF3 A;  1ESU A;  1S4S A;  3NI9 A;  1FR6 A;  3T1R A;  5IS1 A;  4I3J A;  2J9P A;  1F98 A;  3HVF A;  4CLC D;  2KLI A;  3UME A;  1N4O A;  1K54 C;  1VEU B;  3L9K A;  5FQI A;  4LFU A;  3EEA A;  1MPL A;  1XX2 A;  4QHC A;  5GLD A;  3Q7Z A;  1P9R A;  2WKE A;  3BWL A;  2A2L A;  4S2N C;  5E2F A;  3G30 A;  3S7N A;  1DJA A;  4L9F A;  5JYP A;  5BOH A;  1IEL A;  4ZJ3 A;  4LRX C;  1W63 Q;  5CEB A;  2XRO A;  2ZM0 A;  2ZC6 B;  4KQR A;  4KZ3 A;  3S7O A;  1W63 M;  1XP4 A;  2HP9 A;  4M3K A;  4EXO A;  4II7 A;  2ZOI A;  2W3F A;  5JYO A;  4JF6 A;  1HVB A;  5F82 A;  3ZNT A;  2PD8 A;  1DRM A;  3UN7 A;  2FFY A;  3ZGA B;  2P04 A;  1VET B;  3FKW A;  5EVI D;  4BBT A;  2XQZ A;  3E98 A;  3T12 B;  3F1N A;  3OPH A;  4JBF A;  5GLA A;  4B9O A;  3FV7 A;  2JKT I;  5HDS A;  3DTK A;  5TJJ A;  3DTI A;  3GQZ A;  2EFU A;  4GB7 A;  3DAV A;  3GEC A;  2V0W A;  2OLU A;  2IWD A;  2Y2L A;  3C4O A;  1TVF A;  4JXS A;  2A24 A;  4IVI A;  1JVJ A;  1A0K A;  4NEE D;  4I38 A;  5CER A;  3FKV A;  3JYI A;  5DJU A;  4FD8 A;  4KZ7 A;  3HUN A;  3G32 A;  3IBR A;  5L07 A;  1N9N A;  2OWJ A;  2OAQ 1;  4I3A A;  1TDG A;  5U47 A;  1F9I A;  3IXH A;  1E25 A;  4YNR A;  4WZ4 A;  3UB9 A;  1XJ3 A;  3C8C A;  2ZMV A;  5DTS A;  1LSV A;  1KVM A;  4G3K A;  5EVE A;  4BD0 A;  2D01 A;  1Y4O A;  4BL3 A;  4HQA A;  4PAU A;  3C30 A;  1K56 A;  1OME A;  4DDS A;  3G34 A;  4LCL A;  1OTD A;  1RGZ A;  3T4J A;  1NXY A;  2ACG A;  3EQV A;  2FH5 A;  5HX9 A;  1KGF A;  2WGW B;  1ES4 A;  4WBG A;  2MJ6 A;  5EEC A;  1NYY A;  4UAA A;  1RCJ A;  2ZMF A;  2WUQ A;  3T4T A;  4H8R A;  1S1Y A;  4KG6 A;  3W4O A;  1ZC2 A;  1SKF A;  1QME A;  3SZT A;  1BT5 A;  4PM6 A;  3OOV A;  3Q07 A;  2VGK A;  1TD5 A;  2VV6 A;  3LGO A;  1ESI A;  1YSQ A;  1HZO A;  4UQI M;  1KE4 A;  1S6R A;  4H6J B;  4JGO A;  3S4X A;  5HL6 A;  3F1P B;  2QJ5 A;  3UDX A;  5KSC A;  4LLO B;  1PNE A;  5GHX A;  5J4E A;  3OCL A;  2H28 A;  2DNS A;  2JKR I;  3UPN A;  4KG5 A;  3S7Q A;  4HHD A;  4E3L A;  3NY4 A;  1PWC A;  3BJN A;  5L10 A;  3VP3 A;  1Y28 A;  1DJC A;  1XA7 A;  2INW A;  3C38 A;  4LRZ E;  1AXB A;  4DJ2 A;  2OSU A;  3IF5 A;  3NBL A;  1NLY A;  4OQH A;  3ZHH A;  5DKL A;  5HL1 A;  2VA0 A;  1PI4 A;  4UQI S;  3UY6 A;  5FQJ A;  4DXB A;  5HDD A;  3IX3 A;  3E2K A;  4D60 A;  5A93 A;  5HWW A;  1MY8 A;  1T1B A;  5DJT A;  1XA1 A;  1OTA A;  3IF6 B;  4GCZ A;  1LSX A;  5HAR A;  3O87 A;  3T4K A;  2FFF B;  2XLN A;  1RP5 A;  1W8Y A;  4GNU A;  1V9Y A;  5HAQ A;  2V9A A;  3PBS A;  1XGJ A;  2O9A A;  4BD1 A;  4WUJ A;  1C3B A;  4ZRR A;  4KZB A;  2YKF A;  5EM0 A;  3NDE A;  2XRN A;  5HPI A;  3QNC A;  4HY8 A;  2XR0 A;  3VFH A;  3FPV A;  5EVI A;  1Z6F A;  3V39 A;  4Q0J A;  4WEJ A;  5EOE A;  3W4Q A; 
#chains in the Genus database with same CATH homology
 2IWC A;  3ZDJ A;  3HUO A;  4FH2 A;  3UE0 A;  3VP1 A;  4L0L A;  4U0T A;  5FAQ A;  2XK1 A;  3WS1 A;  3Q1F A;  3ZG7 B;  5EOO A;  2ZQ9 A;  4GN2 A;  4XUZ A;  5A90 A;  5E43 A;  1ONG A;  1YLP A;  2XGN A;  2Q9M A;  2WAE A;  2OV5 A;  1NZU A;  3SH7 A;  2B5R A;  2V2F F;  3O3V A;  5GHY A;  4PMA A;  5CTN A;  1G68 A;  5CGW A;  1IYO A;  2Y2J A;  3IQA A;  2Y2K A;  1BZA A;  3C7U A;  1TEM A;  3HBR A;  2EX9 A;  4HES A;  4EWF A;  2HPB A;  4PPR A;  4Q8I A;  1PI5 A;  4CPK A;  1O7E A;  1S0W A;  2EX2 A;  1ZG4 A;  2JBF A;  3UE1 A;  4WMC D;  4R3J A;  4DE0 A;  4KZ8 A;  5AQA A;  1ES5 A;  1PWD A;  4EV4 A;  2C5W B;  2G2U A;  3B3X A;  2H0Y A;  3IXG A;  3HLF A;  3WS5 A;  3LEZ A;  3VFF A;  3MZE A;  3P09 A;  5AQ9 A;  3ZVT A;  3A3I A;  3ISG A;  3HLD A;  1W7F A;  5DVA A;  1L0G A;  3C5A A;  2ZQA A;  3BLM A;  3IWI A;  5CHM A;  4QB8 A;  5FAT A;  5L2F A;  2WKH A;  2JCH A;  4OLG A;  4E3I A;  4QJG A;  5FQ9 A;  1QMF A;  3MZF A;  3NC8 A;  3W4Q A;  1VQQ A;  3EQU A;  3G2Y A;  1LI9 A;  3IT9 A;  4JF5 A;  2WKI A;  3LO7 A;  5G18 A;  2WGI A;  1K57 C;  5HFO A;  3WWX A;  2BLS A;  3A3D A;  4HBT A;  4JXG A;  1NJ4 A;  4R1G A;  5HW3 A;  1RGY A;  1E4D A;  1J9M A;  2RCX A;  4EBL A;  1U60 A;  4C6Y A;  3IWQ A;  2QMI A;  3SS3 A;  4E3K A;  2HP6 A;  4ZJ1 A;  1MXO A;  2ZLY A;  4ZDX A;  4QD4 A;  4N92 A;  3VP4 A;  1GHP A;  4WZ5 C;  2ZD8 A;  4RVA A;  4R23 A;  3VOY A;  3IH8 A;  3WRZ A;  1K56 D;  4E3M A;  1GHI A;  4LV1 A;  5IHV A;  1NY0 A;  1DJB A;  3MXR A;  1PW1 A;  4P87 A;  3HRE A;  1FR1 A;  5GLB A;  3ZFZ A;  4DE3 A;  2Q9N A;  1E3U A;  4B4X A;  2XD1 A;  1K6R A;  1K55 C;  2DRW A;  2EX6 A;  1MWU A;  3DWZ A;  1I5Q A;  1PZP A;  1PW8 A;  2ZM8 A;  1L0E A;  3HUM A;  4WEK A;  5DF9 A;  4B4Z A;  2H10 A;  3ITB A;  3Q7V B;  2XFT A;  5FA7 A;  1YLT A;  4XXR A;  3GSG A;  4PM8 A;  1FSW A;  3Q81 A;  1HD8 A;  3IH9 A;  3LCE A;  1YQS A;  3BEB A;  2EXA A;  3GV9 A;  2OLV A;  4OP8 A;  3RJU A;  4GDN A;  4WEL A;  1IYS A;  3PAE A;  1MWT A;  2GDN A;  4K91 A;  1ES2 A;  3V3R A;  1IYP A;  3N8L A;  1YLY A;  3AGF A;  1I2S A;  4K0W A;  5DF8 A;  3UO9 A;  3BFC A;  4ID4 A;  3M2K A;  3OCN A;  2A49 A;  2IWB A;  2Y2I A;  1K57 A;  5E2G A;  4X69 A;  3RXW A;  1FOF A;  2QPN A;  3SS5 A;  3SOI A;  4RYE A;  2C6W B;  1PWG A;  3N7W A;  4UHU A;  4OON A;  1CI9 A;  1ONH A;  3N6I A;  4X6T A;  4Y0O A;  5TFQ A;  3HLW A;  1VM1 A;  5FI2 A;  4S2P A;  3VP2 A;  2X02 A;  3Q7V A;  3MKE A;  5FAO A;  4P85 A;  4LV2 A;  1WE4 A;  4WZ5 A;  4ZBE A;  5M1A A;  5EUA A;  1SCW A;  3S22 A;  4KQO A;  2XH9 A;  2EFX A;  2QZ6 A;  3G35 A;  5HAI A;  3NDG A;  1H8Z A;  4QY5 A;  3W8K A;  4LV0 A;  4R4R A;  1K55 A;  2ZQC A;  3CJM A;  3ZG9 B;  3ZVW A;  4A5R A;  1Q2P A;  5F1G A;  3VOZ A;  2XF3 A;  3V50 A;  5D3O A;  1ESU A;  5FAS A;  1FQG A;  5CGS A;  3NI9 A;  1FR6 A;  2HDR A;  4EBN A;  2HP5 A;  2DCF A;  1ALQ A;  4IBX A;  1KDS A;  2J9P A;  3BRM A;  3TSG A;  3HVF A;  3WS4 A;  2XDM A;  4S2M A;  2Y4A A;  1N4O A;  3A3F A;  4P0M A;  1K54 C;  3HLE A;  1SHV A;  2WAF A;  1BTL A;  3M6H A;  1L0D A;  4JXV A;  4OOL A;  4ZTK A;  4DRT A;  4Y0U A;  5FQI A;  1W79 A;  3RXX A;  1MBL A;  5CHJ A;  4JKT A;  1NZO A;  3IXD A;  1MPL A;  4UA9 A;  1XX2 A;  4N1X A;  4OP5 A;  4QHC A;  3PAG A;  5GLD A;  3PTE A;  3UDF A;  4P6B A;  2P74 A;  4XUX A;  3BLS A;  3PBT A;  3Q7Z A;  4RX3 A;  4OQI A;  1ERQ A;  1XXM A;  1BUL A;  2WKE A;  3TG9 A;  5I94 A;  2RL3 A;  4KZ6 A;  4F94 A;  3OZH A;  4S2N C;  5E2F A;  3G30 A;  1I2W A;  1G6A A;  3GRJ A;  1K4F A;  1DJA A;  4FH4 A;  2H5S A;  1LHY A;  3S1Y A;  5JYP A;  3N8S A;  4GZB A;  4KZ4 A;  3W4P A;  3OPL A;  3WS0 A;  5BOH A;  4KEN B;  1IEL A;  5E2H A;  4ZJ3 A;  1JWV A;  5FQK A;  2Y55 A;  3CZD A;  5CEB A;  3BFD A;  1H5X A;  3HL9 A;  2ZM0 A;  1XKZ A;  5TR7 A;  1W5D A;  4EBP A;  2ZC6 B;  2WGV A;  3I7J A;  4KQR A;  4KZ3 A;  1XP4 A;  2WYX A;  2HP9 A;  1O07 A;  4M3K A;  1JWZ A;  5FSR A;  5KZH A;  2Y59 A;  4NK3 A;  5FAP A;  1EI5 A;  1FCN A;  5JYO A;  4JF6 A;  1HVB A;  3QHY A;  5F82 A;  3CG5 A;  3ZNT A;  2E8I A;  3UN7 A;  4S2O A;  2FFY A;  1YMX A;  1HTZ A;  3ZGA B;  2ZC4 B;  1BSG A;  3CMZ A;  5CXW A;  4S2L A;  3ZG0 A;  1GA9 A;  3MZD A;  4OLD A;  3FKW A;  5EVI D;  4E3O A;  2XQZ A;  4EQI A;  3DWK A;  2Y2O A;  3OPH A;  4JBF A;  5GLA A;  2HDQ A;  3FV7 A;  1LLB A;  5FI6 A;  3GQZ A;  2JE5 A;  3GMW A;  2EFU A;  4GB7 A;  5EE8 A;  4YIN A;  2V20 A;  3ZG8 B;  4QY6 A;  3G31 A;  1MWS A;  3A3E A;  4OOM A;  3LY4 A;  4BEN A;  1XGI A;  3M2J A;  5E2E A;  5J8X A;  3BFG A;  3IWO A;  4C3Q A;  1YLW A;  3C7V A;  2OLU A;  4WMC A;  2IWD A;  2Y2L A;  2ZC5 B;  3C4O A;  1TVF A;  4JXS A;  1NRF A;  4IVI A;  1JVJ A;  2JC7 A;  4BLM A;  4GD6 A;  2WZX A;  5CER A;  3FKV A;  1K6S A;  3HLB A;  3JYI A;  2PU2 A;  2I72 A;  4RA7 A;  1YT4 A;  1BUE A;  1MKI A;  4FD8 A;  4WYY A;  3BM6 A;  4OVD A;  3NIA A;  4KZ7 A;  4Z9Q A;  4E6X A;  2EXB A;  2G2W A;  3VMA A;  5M18 A;  3HUN A;  2J8Y A;  5FQM A;  3G32 A;  1W8Q A;  4K0X A;  4KZ5 A;  4JLF A;  1K4E A;  4IED A;  1XPB A;  4E3J A;  4BJP A;  2Y91 A;  1TDG A;  5U47 A;  3IXH A;  5F83 A;  1E25 A;  2J9O A;  4LCM A;  4OKP A;  4PM5 A;  4WZ4 A;  5HAP A;  5CGX A;  4IBR A;  4Y0T A;  3HLG A;  2BG1 A;  3O88 A;  4HBU A;  2UWX A;  5M19 A;  2WK0 A;  2Y2H A;  4OPY A;  3A3J A;  5GLC A;  5DTS A;  4PM9 A;  3UPO A;  1TDL A;  4GKU A;  1KVM A;  5DTK A;  1BLP A;  2XD5 A;  4BD0 A;  3Q82 A;  3SS4 A;  4BL3 A;  2ZQD A;  1PIO A;  3OPR A;  1K56 A;  1OME A;  1JTG A;  4BQM A;  3E2L A;  1BLS A;  4DDS A;  1DY6 A;  3G34 A;  3ZCZ A;  3UE3 A;  4LCL A;  1RGZ A;  1YLJ A;  1NXY A;  3EQV A;  3UPP A;  1YMS A;  4R3B A;  3QNB A;  5GL9 A;  3NCK A;  1IYQ A;  5HX9 A;  1KGF A;  5TGF A;  2X01 A;  2WGW B;  1ES4 A;  1LI0 A;  4WBG A;  3AGD A;  5CHU A;  4N1H A;  5EEC A;  1KGE A;  4UA6 A;  2Z2L B;  1NYY A;  5AQB A;  2ZMA A;  4UAA A;  4N9K A;  3IHA A;  4OQG A;  1L0F A;  4PM7 A;  4GD8 A;  3GR2 A;  1CEG A;  1RCJ A;  4U0X A;  2ZJ9 A;  2WUQ A;  1YM1 A;  4DF6 A;  1MWR A;  4H8R A;  1EWZ A;  1IEM A;  3N8R A;  1ZKJ A;  1K38 A;  1E3U D;  4KG6 A;  4LV3 A;  3W4O A;  3PBR A;  1N9B A;  3MXS A;  3OC2 A;  4X53 A;  1ZC2 A;  1SKF A;  4B88 A;  4IVK A;  3WRT A;  5CEC A;  1IKG A;  1WYC A;  2CC1 A;  1QME A;  4LEN A;  4FSF A;  1BT5 A;  3G2Z A;  1ERM A;  1LL5 A;  1KVL A;  2Y2Q A;  1KE3 A;  4MBH A;  3Q07 A;  4PM6 A;  1CI8 A;  4R0Q A;  3FZC A;  3VSK A;  4DE2 A;  2VGK A;  1ZG6 A;  2ZM2 A;  3PBO A;  3FWL A;  1YLZ A;  5DF7 A;  2WGW A;  3BFF A;  1NYM A;  4N9L A;  3ZNY A;  2ZC7 A;  3N4I A;  4OPR A;  5CRF A;  4X56 A;  1ESI A;  2WZZ A;  3MKF A;  1HZO A;  4HEF A;  3WS2 A;  3PBN A;  1GHM A;  1KE4 A;  1S6R A;  2P9V B;  3S4X A;  1SDE A;  4GOG A;  4MNR A;  3UDX A;  1IKI A;  5KSC A;  3LY3 A;  4MBK A;  3FYZ A;  4S2K A;  1K54 A;  1ERO A;  5GHX A;  5FDH A;  5CED A;  3OCL A;  2DNS A;  4E3N A;  3UPN A;  4DE1 A;  4KG5 A;  5DTT A;  3MFD A;  3MBZ A;  5CTM A;  3BFE A;  1K25 A;  4E3L A;  4FCF A;  2H0T A;  3NY4 A;  1PWC A;  1L2S A;  1WYB A;  4U3T A;  3ZG5 A;  4NET A;  1FCM A;  2Y2G A;  2Y2N A;  3PBQ A;  4GDB A;  3VP3 A;  1JTD A;  4OPZ A;  1DJC A;  1CK3 A;  1XA7 A;  4BL2 A;  1KGG A;  3D4F A;  4S2N A;  2ZQ8 A;  5EPH A;  2V1Z A;  3M6B A;  3G4P A;  3AGE A;  5KMW A;  2P9V A;  1GCE A;  1BLH A;  2EX8 A;  2ZQ7 A;  1AXB A;  4Y7P A;  5EVI C;  5FI7 A;  2OSU A;  3IF5 A;  3NBL A;  1M6K A;  1FCO A;  4OQH A;  3IF6 C;  3IHB A;  4YFM A;  5KSH A;  3HLC A;  1KDW A;  3ZHH A;  2HDS A;  1FSY A;  4S2J A;  1KE0 A;  1PYY A;  5HL1 A;  3ITA A;  4KZ9 A;  1PI4 A;  4KZA A;  3BEC A;  4MLL A;  3UNW A;  2R9W A;  1PZO A;  4WM9 A;  4JXW A;  4CJN A;  3UY6 A;  3IXB A;  4ZAM A;  3TOI A;  5FQJ A;  4KQQ A;  5A91 A;  4DXB A;  4D2O A;  2Y2P A;  2XEP A;  1BLC A;  3BYD A;  5A93 A;  3E2K A;  5EVI B;  1MY8 A;  5AQ7 A;  3SH9 A;  4C75 A;  1XA1 A;  3OPP A;  4S2I A;  3IF6 B;  1Y54 A;  4OH0 A;  5GHZ A;  4DDY A;  1SDN A;  3C4P A;  4MEZ A;  5FQQ A;  3DTM A;  5HAR A;  2HDU A;  3O87 A;  4OQ0 A;  4R4S A;  4O7D A;  2FFF B;  2XLN A;  1RP5 A;  5A92 A;  1W8Y A;  4GNU A;  5HAQ A;  1LL9 A;  5F1F A;  2PU4 A;  3PBS A;  1XGJ A;  4BD1 A;  1CEF A;  1H8Y A;  4ZJ2 A;  1C3B A;  2PBY A;  2WAD A;  3O86 A;  4KZB A;  2Y2M A;  2Z2M B;  3SH8 A;  3NDE A;  2R9X A;  3P98 A;  4JPM A;  3QNC A;  4JF4 A;  2X71 A;  3GVB A;  2J7V A;  2XR0 A;  2ZC3 B;  3VFH A;  5EVL A;  4DXC A;  1ES3 A;  5EVI A;  1Z6F A;  2A3U A;  2XFS A;  4RX2 A;  4X55 A;  4DKI A;  4OOY A;  3IF6 A;  1JWP A;  3V3S A;  3V39 A;  4UA7 A;  3VP0 A;  3GTC A;  3UDI A;  4X68 A;  4QU3 A;  4OPQ A;  1M40 A;  4KG2 A;  4WEJ A;  2VGJ A;  1GA0 A;  4EUZ A;  5EOE A;  4MBF A;  1Q2Q A;  3V5M A;  3VSL A;  3DW0 A;  4E6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...