1BSGA

Beta-lactamase from streptomyces albus g
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
SDAERRLAGLERASGARLGVYAYDTGSGRTVAYRADELFPMCSVFKTLSSAAVLRDLDRNGEFLSRRILYTQDDVEQADGAPETGKPQNLANGMTVEELCEVSITASDNCAANLMLRELGGPAAVTRFVRSLGDRVTRLDRWEPELNSAEPGRVTDTTSPRAITRTYGRLVLGDALNPRDRRLLTSWLLANTTSGDRFRAGLPDDWTLGDKTGAGRYGTNNDAGVTWPPGRAPIVLTVLTAKTEQDAARDDGLVADAARVLAETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA LACTAMASE
publication title The crystal structure of the beta-lactamase of Streptomyces albus G at 0.3 nm resolution.
pubmed rcsb
total genus 93
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bsgA00
1NJ4A 2FFYA 4Q8IA 3VP4A 1E4DA 4P87A 5EVIA 3SS3A 1BZAA 1JWVA 3WRZA 3HUNA 2Y2JA 1K55C 2ZC5B 5E2FA 2RCXA 5CGWA 1IEMA 3ZG7B 4OOLA 2B5RA 3G2YA 5FQKA 3FKVA 1ESIA 4N1HA 4DRTA 5FI2A 1YLZA 2Y2OA 5F1GA 4JLFA 3W4PA 3N8LA 3G35A 4Y0TA 5HW3A 4KZ5A 4YFMA 3HLDA 1M6KA 1Z6FA 3UDXA 5EECA 3IWIA 5KSCA 2OSUA 4LV3A 4X69A 2QPNA 2UWXA 3ZG0A 1S0WA 4JBFA 2X71A 1ONHA 2ZLYA 3UPNA 2WZXA 4LV2A 4NK3A 1GHMA 1YT4A 1XX2A 3IQAA 4P85A 3HLWA 3Q7VA 1ZKJA 3TG9A 5M18A 3WS1A 4OQIA 2R9WA 4S2LA 5CXWA 3SS4A 2HDSA 3WS5A 3ZVWA 1CI9A 2J7VA 2R9XA 1XPBA 3VP0A 4BJPA 3N7WA 4BD1A 1AXBA 1S6RA 1I5QA 3UDIA 1EI5A 3ZVTA 2XR0A 1E3UD 3ZNYA 1CEGA 2JC7A 1CI8A 1MWTA 3AGEA 4S2NA 4E3MA 5DF8A 5AQ9A 4OQGA 2EFXA 3M2JA 5FQMA 2ZMAA 3OPHA 1ZC2A 5GLBA 1GA0A 4JKTA 4WEJA 1LLBA 3AGFA 1IYSA 1YLWA 1KE3A 3IF6C 3QNBA 2DCFA 1IYPA 5EVLA 5FQ9A 3UE0A 3VP2A 5HAQA 4BL2A 5CTMA 4OOYA 2DNSA 3A3EA 1RGYA 3WRTA 4EBLA 5CHJA 2XLNA 1CEFA 3C7UA 4IEDA 4QY6A 5HARA 3SH7A 2ZM2A 1XXMA 3BECA 5GHYA 2G2WA 4HEFA 1NZOA 3OPLA 4U3TA 1BTLA 4DDSA 4EBNA 1LHYA 5F83A 2EXAA 5CEDA 1EWZA 4PM7A 4KZ9A 2J8YA 4ZJ1A 5A90A 2Y2PA 1GHIA 3M6HA 1PW8A 4N9KA 3BLMA 4LENA 4MBFA 3W4OA 4KZAA 2WKEA 2ZQ8A 4GNUA 2WKHA 3WS2A 3BYDA 2ZC6B 5FASA 1K54C 2OV5A 3E2LA 3HLCA 3MZEA 1N4OA 3IF6A 5E2GA 4B88A 5A91A 4WEKA 4S2PA 1JWPA 2JBFA 2V20A 3PTEA 4QY5A 3SH9A 4ZJ2A 3TSGA 5CGSA 1RP5A 3I7JA 4GDNA 1LI0A 1NZUA 3FWLA 1GHPA 3O86A 4LCLA 2WGWB 5L2FA 4UHUA 2X02A 4ZDXA 3MXSA 5EOEA 5EUAA 4QD4A 4HBUA 3GRJA 1KE4A 1YLTA 3BFGA 2ZM8A 4HESA 1PYYA 2Y91A 4MBKA 2HP6A 4UA7A 1Y54A 1BLHA 3RXXA 1VQQA 3E2KA 3Q07A 1HVBA 4FD8A 5FQJA 5A93A 4E3NA 1MKIA 3VOZA 2HDUA 1MWRA 3HL9A 2Y4AA 1FR6A 3MKFA 2FFFB 4PM8A 4FCFA 1ONGA 1WYCA 4LCMA 4LV0A 1U60A 1GA9A 1WYBA 4KZ7A 2RL3A 4RVAA 4OVDA 1YLJA 4KQOA 3UPPA 1PWGA 4S2KA 4C75A 1K54A 1K4EA 1PW1A 4EQIA 4WMCA 5TR7A 2WAEA 3IH9A 4MLLA 4QJGA 5HAPA 3HLFA 3G30A 1PIOA 1KDWA 4KZ8A 3CMZA 2JE5A 3OPPA 4P6BA 1K25A 1KVMA 1QMFA 4OQHA 4X6TA 3VMAA 2WZZA 1O7EA 3MBZA 5TGFA 5U47A 1K56D 2WGVA 3IHAA 5AQ7A 1KE0A 2XH9A 1NYYA 2IWCA 2P74A 4H8RA 3WS4A 1KDSA 4M3KA 1JTDA 4WELA 5FDHA 1XGJA 3FYZA 2P9VA 3IWQA 2ZQ9A 3S1YA 2XFTA 2A3UA 3O3VA 4YINA 1LL9A 3DWKA 4JF4A 1BLPA 2QZ6A 2XD5A 4R3BA 4KENB 3GR2A 4MEZA 5A92A 4E6XA 2H10A 3VP3A 1BUEA 2J9PA 4K91A 1YLYA 1BLSA 1NXYA 3S22A 2E8IA 2XK1A 3FKWA 1L0FA 3NCKA 4CPKA 1J9MA 1ES4A 1OMEA 2Y59A 4KG5A 4R4SA 4GD6A 1C3BA 2XQZA 2HPBA 3IT9A 5EVID 2ZQDA 3SH8A 3OC2A 3ZCZA 3M6BA 4JXGA 1BSGA 4OQ0A 1O07A 5GLCA 1KGEA 1DJCA 3V3SA 4GKUA 5GLAA 3UO9A 2ZD8A 4OPRA 3N6IA 4XUZA 5HL1A 5FAOA 1TDGA 3ZDJA 4O7DA 3BRMA 1FQGA 3A3JA 1TDLA 3G2ZA 1IYQA 4S2MA 4JF6A 4WYYA 4BL3A 2A49A 4OP8A 5F1FA 5CGXA 3PAEA 2Y55A 3IWOA 3W4QA 5HAIA 4ZTKA 3DWZA 2ZJ9A 2XDMA 1SCWA 4FSFA 3IHBA 2XF3A 3PBTA 1Q2QA 2OLUA 3QNCA 1G68A 3NIAA 2ZQAA 2WADA 2WK0A 1YM1A 5M1AA 3PBNA 3UY6A 4R0QA 3O88A 4ZBEA 2ZC3B 4RX3A 3PBSA 3VFHA 4BD0A 1LI9A 4PM5A 2EX8A 3HLBA 4OP5A 5CERA 1JTGA 3UE3A 4JPMA 2H5SA 1IKIA 1FSWA 3LEZA 4IVIA 4DE2A 4IBRA 4X56A 2I72A 1PZOA 2WYXA 3LY4A 1PZPA 4R3JA 5KMWA 4DF6A 1ES3A 2ZQ7A 1ERQA 4BLMA 4P0MA 5FQIA 5CEBA 1RGZA 1KGFA 3G4PA 3UNWA 2HDQA 4E3LA 1DJBA 2Y2LA 3HBRA 2PBYA 3HREA 3IH8A 3NBLA 1M40A 1XP4A 3EQVA 4QU3A 2BLSA 3VFFA 2C6WB 1SHVA 2Q9NA 3BFCA 3CJMA 5GHXA 1W8QA 4L0LA 4KG2A 5E2HA 3WWXA 3NC8A 2V1ZA 4WZ5C 2XGNA 3OPRA 1K6SA 2WKIA 3MXRA 3GSGA 3PBRA 1IYOA 4GZBA 3ZGAB 3Q7ZA 2WUQA 4GDBA 3BM6A 3P09A 5JYPA 3RJUA 2C5WB 4KQQA 1JVJA 3MKEA 1BULA 3PBOA 4OKPA 4RX2A 3MZFA 3C5AA 5CTNA 2VGKA 4DE0A 3LY3A 1NRFA 3FV7A 3AGDA 1L0GA 3TOIA 3JYIA 4K0WA 4B4XA 5AQAA 4LV1A 1ALQA 3PAGA 3ZHHA 3MFDA 1Q2PA 1XGIA 5HX9A 4E3IA 1FCMA 1PWCA 2EXBA 3C4OA 3HUMA 2IWDA 2HDRA 3Q82A 4CJNA 2H0TA 4X53A 5KSHA 2Y2GA 3A3IA 2EX9A 5D3OA 3CG5A 4JXVA 1L0DA 4EBPA 4Z9QA 1FCNA 1KGGA 1NYMA 3GVBA 2HP9A 5FQQA 1K6RA 3B3XA 1VM1A 3G31A 3GTCA 1QMEA 3ZG9B 3IXBA 4JXSA 3LO7A 4XUXA 3HLGA 2Y2HA 3PBQA 4WZ5A 1DY6A 3IXDA 5HFOA 3BFDA 1IELA 5CHMA 4EWFA 1E3UA 5CECA 3ZG8B 3EQUA 2PU4A 2ZC4B 1FCOA 2JCHA 3GQZA 3IXHA 2Z2LB 5EOOA 4ZAMA 1L2SA 4JXWA 4D2OA 3C4PA 1SDEA 3GV9A 4DE1A 4KZ6A 1XA1A 4GN2A 4K0XA 3UE1A 5FA7A 1DJAA 1HTZA 2Z2MB 2ZQCA 3HLEA 2HP5A 2Q9MA 1IKGA 3D4FA 4N9LA 1SKFA 3VSKA 3Q81A 3CZDA 4KZ3A 2X01A 4OLGA 5GHZA 1W8YA 5DTTA 3C7VA 1I2SA 3O87A 3DTMA 4WMCD 3VSLA 3HVFA 3V50A 5EVIB 4HBTA 2Y2KA 4PM9A 3WS0A 3GMWA 3QHYA 4A5RA 5FAQA 3G34A 4KQRA 4EUZA 1L0EA 3BFFA 3NDGA 2EX2A 5EPHA 1WE4A 4N1XA 2WGIA 4OPYA 1E25A 1PI4A 5FI6A 4UA9A 4DKIA 1MBLA 3V5MA 1CK3A 5F82A 1RCJA 1ES5A 1K57C 1HZOA 4DXBA 2BG1A 4OPQA 1JWZA 1YQSA 3UN7A 2XD1A 1TVFA 4DE3A 3VOYA 3MZDA 4C3QA 2Y2NA 2P9VB 4U0TA 5E43A 2XEPA 1K55A 1NY0A 3N8RA 3OCNA 4GD8A 3HUOA 1FOFA 1H5XA 4Y0OA 4X68A 4B4ZA 3Q7VB 5DTSA 4GB7A 4JF5A 1GCEA 1G6AA 1MPLA 1MXOA 4DXCA 4UA6A 3FZCA 3A3DA 2WGWA 3IF5A 3IXGA 5GL9A 4OONA 1BLCA 4WZ4A 4IVKA 3S4XA 1W5DA 4DDYA 1ES2A 2PU2A 5E2EA 2WAFA 2XFSA 1N9BA 4E3JA 3BEBA 2IWBA 1SDNA 4ZJ3A 5IHVA 5AQBA 4GOGA 1FR1A 1YMXA 1H8YA 1ZG4A 2ZC7A 3NI9A 2DRWA 4Y7PA 2CC1A 4OPZA 4F94A 4MNRA 4UAAA 1HD8A 4FH2A 3A3FA 3ITAA 5DVAA 3V39A 5FI7A 3BFEA 4XXRA 1KVLA 3BLSA 3NY4A 4PM6A 1K38A 4C6YA 1TEMA 5G18A 4PPRA 1EROA 3G32A 4WM9A 5DF7A 4E6WA 2Y2QA 5KZHA 1K57A 1PI5A 2OLVA 5J8XA 2EFUA 3UDFA 2V2FF 4BENA 2Y2MA 4RYEA 3RXWA 3SOIA 4OOMA 3LCEA 5M19A 1FSYA 3OZHA 1MY8A 5EVIC 3UPOA 4IBXA 4WBGA 1YLPA 4X55A 3ITBA 5FAPA 4E3KA 3M2KA 3ZFZA 4OLDA 1YMSA 5TFQA 2GDNA 3P98A 3V3RA 4QB8A 3OCLA 5DTKA 5EE8A 3ZNTA 4BQMA 4Y0UA 5FSRA 4PMAA 4R23A 1H8ZA 1W7FA 4R4RA 5I94A 1K56A 4R1GA 2QMIA 2Y2IA 3DW0A 4S2OA 3Q1FA 1MWSA 4U0XA 5CRFA 1I2WA 1XA7A 1XKZA 1K4FA 2J9OA 5DF9A 1ERMA 5CHUA 2VGJA 4RA7A 1PWDA 1ZG6A 4QHCA 4KG6A 4E3OA 4FH4A 3N8SA 3SS5A 4KZBA 1LL5A 3IF6B 3W8KA 2ZM0A 5JYOA 2H0YA 1ESUA 5FATA 4S2JA 3VP1A 3NDEA 4EV4A 4S2IA 1W79A 4KZ4A 2G2UA 1BT5A 1MWUA 2EX6A 5BOHA 4MBHA 4ID4A 5GLDA 4OH0A 4NETA 3ZG5A 4N92A 3ISGA 3N4IA 4S2NC
chains in the Genus database with same CATH superfamily
1NJ4A 2ACGA 2FFYA 3VE4A 1GSXA 3BW6A 1K55C 3DTEA 2ZMVA 3MSHA 3LUQA 2Y2OA 3W4PA 3N8LA 2EA9A 3MQQA 4HJ6A 3UDXA 3IWIA 5KSCA 4LV3A 3ZG0A 1S0WA 1PFLA 4ETXA 2ZLYA 4LV2A 1W63M 4OQIA 4WN5A 2HDSA 4K08A 3A0SA 1XPBA 1D06A 1AXBA 4HH3A 3UDIA 4X1MA 1E3UD 3ZNYA 1CI8A 3AGEA 2OWHA 5AQ9A 5FQMA 3PHYA 4GLQA 1GA0A 1SZVA 2W3GA 3QNBA 2DCFA 3EWKA 3VP2A 1ZHHB 1Y4OA 2BASA 3WRTA 1CEFA 3ULFA 3OBFA 3C7UA 3SH7A 2A24A 2G2WA 4U3TA 5F83A 4AFIA 2AVXA 3EEHA 4ZJ1A 1GHIA 3M6HA 4N9KA 3W4OA 2O9AA 3CPTB 2H28A 5FASA 1H0MA 3HLCA 2V20A 4B93A 4GDNA 1LI0A 1NZUA 2A2LA 3MMHA 5EOEA 5HWVA 4QD4A 4HBUA 1KE4A 1YLTA 1VETB 2ZOIA 3BFGA 3KYZA 2Y91A 4UA7A 2HP6A 1LSVA 1VQQA 3Q07A 1MKIA 3NHQA 2VV6A 2Q0OA 3HL9A 3EEAA 2Y4AA 1ONGA 4LV0A 1WYBA 4KZ7A 1YLJA 3H7WB 1K4EA 5TR7A 2WAEA 3LEQA 5HAPA 3G30A 1KDWA 3CMZA 1NRJA 4HNBA 2V1BA 4WF0A 3MBZA 2XH9A 1NYYA 4H8RA 3WS4A 4L9FA 1XGJA 2P9VA 1LL9A 5J3WA 3K3CA 4KENB 3UE6A 2V1AA 4H6JB 4HIAA 2OAP1 1NXYA 1OJ5A 3FKWA 5CX7A 1OMEA 3CLOA 4GD6A 2XQZA 4B9OA 2W3FA 3ZCZA 2GZAA 5GLCA 3UO9A 2J3TD 4XUZA 1TDGA 3ZDJA 4WYYA 5DFYA 3CPTA 3IWOA 2QYBA 1FILA 5HAIA 2HJEA 2J3WA 2NUTC 2ZQAA 3FG8A 4JGOA 4HJ3A 3CUEC 5M1AA 3UY6A 4R0QA 4ZBEA 1F98A 3HLBA 2VKSA 3UE3A 2J80A 1FSWA 4IBRA 4X56A 1HLUP 1RGZA 1YKDA 2K2NA 3G4PA 4CLCC 2XRNA 3EOIA 1DJBA 5HSQA 2W3DA 4CLCE 1XP4A 1P9WA 2BLSA 1TS6A 3BFCA 5GHXA 4O0PA 4L0LA 3G6OA 4UQIS 4I5SA 2XGNA 3H7WA 3OPRA 1K6SA 2OWJA 2O99A 1IYOA 1FIKA 5L09A 2PRFA 4LRXC 2C5WB 3MKEA 1BULA 3CUEA 4RX2A 5CTNA 2VGKA 3FV7A 4YWZA 3JYIA 1ALQA 3ZHHA 2ZBBA 1Q2PA 1XGIA 1VHMA 2H0TA 1S67L 4CLCA 2Y2GA 2Z6CA 3BY8A 1UGUA 1VEUB 3E4QA 2HP9A 2JKRI 3B3XA 4JXSA 1P97A 3LO7A 2KX6A 4P6ZM 2XA7M 3C2WA 4YOFA 3EQUA 3GQZA 4ZAMA 1L2SA 4D2OA 3UB9A 2M7UA 4KZ6A 5EV0A 4GN2A 2B18A 3HLEA 2Q9MA 3NECA 3VSKA 4UEYA 4OLGA 3C7VA 3DTMA 3VSLA 5HD5A 5EVIB 4PM9A 3WS0A 4A5RA 5FAQA 1UWPX 3JVUA 5EPHA 4LFUA 1E25A 1PI4A 5FI6A 4UA9A 5F82A 1RCJA 3C38A 4OPQA 1YQSA 3T50A 2XD1A 1TVFA 1OTBA 3VOYA 4FOFA 3S7OA 3F1NB 4U0TA 3S7PA 3OCNA 3N8RA 1H5XA 3Q7VB 4GB7A 1G6AA 3MS6A 4IUKA 5GL9A 3O5YA 3S4XA 1ODVA 3CITA 1N9BA 2IWBA 1SDNA 5HWWA 4ZJ3A 5IHVA 1SKOB 4Y7PA 3QP8A 4FH2A 3LI8A 3LR5A 2O9BA 1K38A 2FH5A 3F1PA 1EROA 4WM9A 2V2FF 2Y2MA 3RXWA 5MC7A 5M19A 1MY8A 1VEUA 5EVIC 1YLPA 4X55A 3M2KA 5TFQA 3P98A 3V3RA 5DTKA 4BQMA 4Y0UA 4R1GA 3LYXA 3Q1FA 1MWSA 5DF9A 5CRFA 1XA7A 5CHUA 4WL9A 4II7A 4E3OA 3IF6B 3W8KA 4R70A 2H0YA 4O8GA 5J7EA 1W79A 3LI9A 3B47A 5GLDA 4NETA 3D72A 4S2NC 4Q8IA 5EVIA 2HZ5A 1DRMA 3HUNA 2ZC5B 3LR0A 1ESIA 3TW8A 4DRTA 5AVEA 5F1GA 5HW3A 4KZ5A 2OSUA 4MN5A 2JKTM 2X71A 1ONHA 2WZXA 4NK3A 1YT4A 4P85A 3HLWA 3Q7VA 1ZKJA 5M18A 3WS1A 2R9WA 1S4RA 3SS4A 3WS5A 3ZVWA 1G5UA 2Y79A 2R9XA 3VP0A 4BD1A 1S1YA 2GX5A 3HJKA 3ZVTA 1MWTA 4S2NA 3IX8A 5DF8A 2EFXA 4JKTA 5FDSA 5HWTA 3AGFA 1YLWA 3MF0A 3IF6C 5HAQA 4BL2A 5CTMA 3IBRA 2DNSA 3FPWA 3A3EA 1RGYA 1ZTUA 4EBLA 4I38A 5HARA 1EW0A 3BECA 1OTDA 4HEFA 1BTLA 4EBNA 1LHYA 3VE3A 3P01A 5CEDA 3F1OB 3IBJA 4I3AA 4KZ9A 3LIFA 4HP4A 1T18A 4KZAA 2ZQ8A 1BYWA 3MZEA 5F5YA 1N4OA 1TF1A 3LIBA 3IF6A 5E2GA 2V8FA 4B88A 5A91A 3JPUA 4S2PA 2J3TC 3SH9A 1YPRA 3TSGA 5CGSA 1RP5A 5F68A 5HPFA 3O86A 2WGWB 2X02A 2O9CA 1OJGA 3GRJA 2JHEA 1F9IA 5FQJA 4E3NA 1MWRA 4EXOA 1FR6A 4PM8A 3KX0X 4KUOA 1U60A 1GA9A 2W3EA 1IFQA 2D02A 2VV7A 4KQOA 4S2KA 4EQIA 4WMCA 3IH9A 4MLLA 2W1TB 4KZ8A 4P6BA 1K25A 1KVMA 1QMFA 5L8MA 3UB8A 4BBVA 2HV1A 2VGLM 2P74A 1JTDA 4WELA 5FDHA 1MZUA 2ZL1B 2W27A 4YINA 1BLPA 2QZ6A 2XSSA 3EGDC 4K91A 2PR5A 3S22A 4ESPA 1L0FA 3NCKA 1T1BA 3IT9A 5EVID 4JXGA 1BSGA 1KGEA 2OOLA 5GLAA 3F1OA 2ZD8A 4GHIB 5FAOA 1TDLA 4S2MA 1IYQA 5F1FA 4ZTKA 3E4OA 3T12B 5F6AA 2HGVA 3PBTA 1Q2QA 3QNCA 4LGWA 3PBNA 1CJFA 4PM5A 3VFHA 1LI9A 4JPMA 4IVIA 3LEZA 3LY4A 4DMZA 3L7HA 1PZPA 4R3JA 5KMWA 2IA2A 1ERQA 4BLMA 3CAXA 2Y2LA 3HREA 1XFNA 3VFFA 2C6WB 5TBMB 2W1RA 2V0WA 4KG2A 3WWXA 2V1ZA 4WZ5C 2JKGA 4HQAA 3GSGA 2INWA 4GDBA 3BM6A 2PHYA 3RJUA 4KQQA 3PBOA 1K0KA 1F5MA 3LY3A 4MN6A 3TOIA 3VOLA 4K0WA 4B4XA 5HX9A 1FCMA 1XJ3A 2EXBA 3HUMA 2IWDA 2ZL1A 4R38A 5HL6A 3K3DA 2M1CA 5D3OA 4JXVA 1L0DA 4Z9QA 1K6RA 1XJ2A 3GTCA 3R4KA 4XUXA 4WZ5A 3TRCA 4EWFA 5CECA 4HHDA 2ZC4B 2JCHA 5EOOA 4JXWA 2VEAA 4GHIA 3UE1A 1HTZA 4X1LA 4N9LA 2PYPA 1SKFA 1KOUA 1W8YA 3O87A 4WMCD 2PD7A 4EERA 2QKPA 2WKRA 3CI6A 3UB5P 3V50A 5FEFA 4HBTA 3QHYA 4EUZA 4HY8A 3NOUC 4DKIA 3V5MA 2JN7A 1CK3A 1K57C 1HZOA 2BG1A 3IX3A 1NLZA 2L1MA 3MZDA 3QP5A 4B4ZA 4Y0OA 5TBMA 1MPLA 4DXCA 3UMEA 3IXGA 2K7SA 5TJJA 5E2EA 2WAFA 3MJQA 4E3JA 2VLGA 1VETA 2ZC7A 1ZG4A 1T1AA 4OPZA 4MNRA 1HD8A 3ITAA 5DVAA 3V39A 5FI7A 4LRYC 4XXRA 3A0VA 1KVLA 5DF7A 2Y2QA 1K57A 1PI5A 2EFUA 3UDFA 4BENA 3SOIA 4OOMA 3LCEA 3NOTC 2VK3A 4E3KA 5FAPA 2GDNA 1V9ZA 5EE8A 4R23A 3CWFA 4IHQA 1K56A 1VB6A 2QMIA 5FL3A 4S2OA 5I94A 4U0XA 1I2WA 1XKZA 2VGJA 2GNXA 4ME4A 4X25A 3SS5A 3TJZC 1LL5A 1PNEA 2QWSA 4H6JA 4BBTA 3B42A 3BQAA 5FATA 3T4JA 4S2JA 3U2AA 1OT9A 4KZ4A 5DJTA 2G2UA 1N9OA 3QP4A 5BOHA 4MBHA 4OH0A 3OOVA 3ISGA 4P87A 3SS3A 1BZAA 2Y2JA 2B5RA 5FQKA 4HJ4A 1YLZA 4Y0TA 4JLFA 4HOIA 3HLDA 2OAQ1 3PR6A 2I9VA 4KQDA 3LIAA 2PDRA 2VA0A 4Y15A 4JBFA 4EUVA 3UPNA 4P6ZS 1GHMA 1XX2A 3IQAA 2XA7S 4MCWA 3BY9A 5HDDA 1CI9A 2J7VA 4G3WA 3UMDA 4BJPA 3QP2A 3N7WA 3E98A 1S6RA 3QP6A 1EI5A 2XR0A 2QHKA 4XT2B 4D60A 3OPHA 5GLBA 4WEJA 1TD5A 3E0YA 3RFBA 1LLBA 3NULA 5EVLA 3UE0A 3T4TA 2B02A 1IYPA 5FQ9A 4FTXA 3HJIA 3T1SA 4IEDA 4QY6A 4NEED 2ZM2A 3H82B 5GHYA 2HF6A 3MXQA 2PR6A 3BQ8A 1X0OA 2EXAA 3L9KA 1EWZA 4YNRA 4PM7A 4MN7A 4IJGA 2HJ9C 2FZ0A 3KSFA 5A90A 2QJ7A 2Y2PA 1PW8A 4GNUA 1MKMA 2WKHA 3BYDA 2P08A 3RTYA 2V9AA 4WEKA 3PTEA 1T1CA 4QY5A 3T4KA 3I7JA 1TS0A 2GJ3A 3FWLA 3S7NA 4I3JA 5L2FA 2BTFP 4NKPA 3OLOA 2ZM8A 4HESA 5I5LA 1Y54A 3RXXA 3E2KA 1HVBA 3D9YA 4FD8A 5L10A 1LSXA 2FFFB 1WYCA 4OVDA 4QPRA 3UPPA 4EQ1A 1PWGA 4QJGA 3W2ZA 5EVEA 3HLFA 2JE5A 4OQHA 5DFXA 2WZZA 5U47A 1K56D 3IHAA 3NJAA 1KE0A 2IWCA 1P9RA 4XT2A 1YSPA 4EESA 4M3KA 3FYZA 4CQHA 3H9WA 3IWQA 3F1NA 2A3UA 3O3VA 3DWKA 4R3BA 3GR2A 5A92A 3DTKA 1BUEA 1YLYA 3FPVA 1BLSA 3K2NA 2E8IA 2XK1A 3H82A 1XJ6A 1J9MA 1ES4A 2Y59A 1T19A 2NUPC 3LIEA 1C3BA 2HPBA 3GDIA 2ZQDA 3OC2A 3M6BA 1SKOA 1O07A 4E04A 1DJCA 4GKUA 3N6IA 5HL1A 3G2ZA 4JF6A 4BL3A 4I39A 4LPZA 4OP8A 4BBUA 3PAEA 3W4QA 2ZJ9A 2JKRM 4FSFA 1SCWA 2XF3A 4F3LB 2OLUA 2WK0A 1YM1A 1CQAA 4BD0A 5CERA 1ACFA 1JTGA 2KLIA 2PBDP 2WYXA 4DF6A 3A0RA 2ZQ7A 4P0MA 5FQIA 1KGFA 3UNWA 3HBRA 3IH8A 1M40A 3MQOA 1SHVA 2Q9NA 1W8QA 2A24B 3NC8A 1L3LA 2WKIA 3MXRA 4GZBA 3ZGAB 2WUQA 3UB6A 5JYPA 3C5AA 4DE0A 5DKLA 1YSQA 3PAGA 3IS2B 4E3IA 1PWCA 2CMNA 3C4OA 3Q82A 2HDRA 5KSHA 2EX9A 3CG5A 4Y2FA 3LR3A 1FCNA 1NYMA 3P7NA 2MJ6A 3C30A 5FQQA 4EU0A 1VM1A 3DTIA 1QMEA 3IXBA 3HLGA 2Y2HA 3PBQA 5HD3A 1DY6A 1IELA 5K5BA 1GSVA 3C4PA 1H8MA 3B33A 3GV9A 4DE1A 5FA7A 3QP1A 4ETZA 3Q81A 3CZDA 3SZTA 4JGRA 4F3LA 3HVFA 2YKHA 1OPXA 4PKYA 2VGLS 5HDSA 2Y2KA 4KQRA 1L0EA 2EX2A 1MBLA 1ES5A 3BJNA 4DXBA 5IU1A 1A0KA 3UN7A 1G6OA 4C3QA 2P9VB 4Y13A 1K55A 1FOFA 3DBAA 5G4YA 5DTSA 4JF5A 4UA6A 3FZCA 2WGWA 3IF5A 1ES2A 2G7UA 3KSIA 2L4RA 3BEBA 5AQBA 3UB7A 1YMXA 3NI9A 1YAXA 4GCZA 2CC1A 4UAAA 3A3FA 3BFEA 4KUKA 4PM6A 5G18A 3VV4A 3IS2A 4E6WA 3CHWP 5KZHA 2OLVA 5J8XA 1TS7A 3DAVA 2W1TA 3UPOA 4WBGA 3V67A 2B95A 3U4LP 1N9LA 4M4XA 3ZNTA 2D01A 1OT6A 4PMAA 1H8ZA 3MR0A 4R4RA 5LBRA 2P7JA 2Y2IA 3DW0A 3KYQA 1XFQA 1ERMA 1PWDA 4Y17A 4KG6A 1LSWA 4FH4A 3N8SA 2ZM0A 5JYOA 1ESUA 1NWZA 4Y3IA 3VP1A 3NDEA 4S2IA 5HZHA 1BT5A 2EX6A 4ID4A 4FUWA 4GS9B 4DN0A 5HPIA 3EGXC 3VP4A 1E4DA 1W63Q 1JWVA 3R7WB 3WRZA 5E2FA 4O01A 2RCXA 5CGWA 1IEMA 3ZG7B 4OOLA 3G2YA 5KIZA 1JNUA 3FKVA 4N1HA 5FI2A 3G35A 5G4ZA 4YFMA 3PXPA 1M6KA 1Z6FA 2KDKA 5EECA 5EM1A 2VJWA 4X69A 2QPNA 2UWXA 2Z6DA 4CLCB 3TG9A 4S2LA 5CXWA 1GSWA 4WUJA 1I5QA 1CEGA 2JC7A 4E3MA 4OQGA 3M2JA 2ZMAA 1ZC2A 4Q0JA 4IUHA 1IYSA 1KE3A 5IS1A 4OOYA 4GJ4A 3T4OA 5CHJA 2XLNA 1XXMA 1NZOA 3KO6A 3OPLA 4DDSA 1S66L 3D3OA 3ZYTA 2J8YA 1OTIA 4UQIM 4DJ3A 3BLMA 4LENA 4MBFA 2WKEA 3S7QA 4WLAA 1UWNX 1LT0A 3WS2A 2P04A 2ZC6B 1K54C 2OV5A 3E2LA 2PD8A 4Q0HA 4HP9A 3ZQ5A 1JWPA 2JBFA 1AWIA 4ZJ2A 2JKTI 1D1JA 4LCLA 1GHPA 4GS9A 4UHUA 5L07A 3T4SA 4ZDXA 3MXSA 5EUAA 3R7WA 4MBKA 1PYYA 1BLHA 4QWOA 2PT7A 5A93A 3VOZA 2HDUA 3MKFA 5C5KA 4FCFA 4LCMA 3F1PB 4GW9A 2RL3A 1G28A 4RVAA 4BWIA 2W0NA 4C75A 1K54A 1PW1A 1PIOA 3OPPA 4X6TA 5DKKA 3VMAA 1O7EA 5TGFA 2WGVA 5AQ7A 4NXGA 4EEUA 1KDSA 2M7VA 2ZQ9A 3S1YA 2XFTA 4JF4A 2XD5A 4MEZA 3FC7A 1XJ4A 4E6XA 2H10A 3VP3A 2J9PA 3T4LA 4MDZA 4Q0IA 3BWLA 4EW7A 4NXFA 4CPKA 4KG5A 4R4SA 3SH8A 4OQ0A 3V3SA 3T4QA 1J3WA 4OPRA 4DJ2A 4O7DA 5J4EA 3MQ0A 3BRMA 1FQGA 3A3JA 3TE8A 1WA9A 2A49A 5CGXA 2Y55A 3DWZA 1DP6A 1CF0A 2XDMA 3IHBA 3PYPA 4R6LA 1G68A 3NIAA 2WADA 4G3VA 4HH2A 2QJ5A 2ZOHA 3O88A 2ZC3B 4RX3A 3PBSA 2EX8A 4OP5A 3KSGA 2H5SA 1IKIA 4DE2A 5AVFA 2I72A 1PZOA 2ZMFA 4JGQA 1D7EA 1ES3A 5DJUA 5CEBA 4NXEA 2HDQA 3JVVA 4RQ9A 1Y28A 4E3LA 2PBYA 2UV0E 1MC0A 3NBLA 3EQVA 4QU3A 3CJMA 2Y8HA 1STZA 5E2HA 3PBRA 1IOUA 3Q7ZA 3LICA 3P09A 1JVJA 4OKPA 3MZFA 1OTAA 3T1QB 1NRFA 3AGDA 1L0GA 4PHTA 1F2KA 5AQAA 4LV1A 3MFDA 1NLYA 5EFWA 3RH8B 2V8CA 4CJNA 5HDCA 4X53A 3A3IA 2L0WA 4EBPA 1KGGA 2VX8A 3LR4A 3GVBA 2WKQA 2LB5A 3LGOA 3G31A 4PAUA 3E4PA 3ZG9B 4ARZB 1V9YA 3C8CA 4NXBA 3IXDA 4JGPA 5HFOA 5IT5A 3BFDA 5CHMA 1E3UA 2JKFA 3ZG8B 2PU4A 1FCOA 3IXHA 2Z2LB 1SDEA 1XA1A 4K0XA 1DJAA 2Z2MB 2ZQCA 2YKFA 2HP5A 1IKGA 3D4FA 3KYEA 4EEPA 4KZ3A 2X01A 1N9NA 5GHZA 2LB9A 4CLCD 5DTTA 1DP8A 1I2SA 1LL8A 4EETB 3IX4A 2XROA 5EM0A 3GMWA 3G34A 3BFFA 3NDGA 5A8BA 1WE4A 4N1XA 2WGIA 4R3AA 4OPYA 1DP9A 4LRZE 1JWZA 1TS8A 4BMWA 3MFXA 4DE3A 1H3QA 2Y2NA 4HI4A 5E43A 2VZWA 2XEPA 4GD8A 1NY0A 3HUOA 4X68A 2EWWA 1GCEA 1MXOA 4NG2A 1S1ZA 3A3DA 3ICYA 4OONA 2K31A 1BLCA 5F69A 2E8JA 2R78A 4WZ4A 4IVKA 1W5DA 4DDYA 2PU2A 3HCYA 2XFSA 4G3KA 4GOGA 1FR1A 1H8YA 2DRWA 3LFVA 4PKYG 5AJGA 2DMWA 4F94A 3KSHA 3BLSA 3NY4A 4C6YA 4I3IA 3T1RA 1TEMA 1OTEA 4PPRA 3G32A 4Z1WA 3LIDA 4RYEA 3SW1A 2EWVA 1FSYA 3OZHA 5FEGA 1PRQA 4IBXA 2WKPA 4Y5FA 3ITBA 3ZFZA 4OLDA 1YMSA 3NOPC 4QB8A 2PAVP 3OCLA 2W3HA 4L9GA 4ARZA 2V0UA 5FSRA 2O0YA 4L9EA 3GECA 1W7FA 1S4SA 2KOIA 1P0ZA 2VV8A 1K4FA 2J9OA 4RA7A 1ZG6A 4QHCA 2PYRA 1Z09A 4KZBA 4ZRRA 4MMNA 4EV4A 4LLOB 3T1XA 1MWUA 3ZG5A 4N92A 3N4IA
chains in the Genus database with same CATH topology
1NJ4A 2FFYA 4Q8IA 3VP4A 1E4DA 4P87A 5EVIA 3SS3A 1BZAA 1JWVA 3WRZA 3HUNA 2Y2JA 1K55C 2ZC5B 5E2FA 2RCXA 5CGWA 1IEMA 3ZG7B 4OOLA 2B5RA 3G2YA 5FQKA 3FKVA 1ESIA 4N1HA 4DRTA 5FI2A 1YLZA 2Y2OA 5F1GA 4JLFA 3W4PA 3N8LA 3G35A 4Y0TA 5HW3A 4KZ5A 4YFMA 3HLDA 1M6KA 1Z6FA 3UDXA 5EECA 3IWIA 5KSCA 2OSUA 4LV3A 4X69A 2QPNA 2UWXA 3ZG0A 1S0WA 4JBFA 2X71A 1ONHA 2ZLYA 3UPNA 2WZXA 4LV2A 4NK3A 1GHMA 1YT4A 1XX2A 3IQAA 4P85A 3HLWA 3Q7VA 1ZKJA 3TG9A 5M18A 3WS1A 4OQIA 2R9WA 4S2LA 5CXWA 3SS4A 2HDSA 3WS5A 3ZVWA 1CI9A 2J7VA 2R9XA 1XPBA 3VP0A 4BJPA 3N7WA 4BD1A 1AXBA 1S6RA 1I5QA 3UDIA 1EI5A 3ZVTA 2XR0A 1E3UD 3ZNYA 1CEGA 2JC7A 1CI8A 1MWTA 3AGEA 4S2NA 4E3MA 5DF8A 5AQ9A 4OQGA 2EFXA 3M2JA 5FQMA 2ZMAA 3OPHA 1ZC2A 5GLBA 1GA0A 4JKTA 4WEJA 1LLBA 3AGFA 1IYSA 1YLWA 1KE3A 3IF6C 3QNBA 2DCFA 1IYPA 5EVLA 5FQ9A 3UE0A 3VP2A 5HAQA 4BL2A 5CTMA 4OOYA 2DNSA 3A3EA 1RGYA 3WRTA 4EBLA 5CHJA 2XLNA 1CEFA 3C7UA 4IEDA 4QY6A 5HARA 3SH7A 2ZM2A 1XXMA 3BECA 5GHYA 2G2WA 4HEFA 1NZOA 3OPLA 4U3TA 1BTLA 4DDSA 4EBNA 1LHYA 5F83A 2EXAA 5CEDA 1EWZA 4PM7A 4KZ9A 2J8YA 4ZJ1A 5A90A 2Y2PA 1GHIA 3M6HA 1PW8A 4N9KA 3BLMA 4LENA 4MBFA 3W4OA 4KZAA 2WKEA 2ZQ8A 4GNUA 2WKHA 3WS2A 3BYDA 2ZC6B 5FASA 1K54C 2OV5A 3E2LA 3HLCA 3MZEA 1N4OA 3IF6A 5E2GA 4B88A 5A91A 4WEKA 4S2PA 1JWPA 2JBFA 2V20A 3PTEA 4QY5A 3SH9A 4ZJ2A 3TSGA 5CGSA 1RP5A 3I7JA 4GDNA 1LI0A 1NZUA 3FWLA 1GHPA 3O86A 4LCLA 2WGWB 5L2FA 4UHUA 2X02A 4ZDXA 3MXSA 5EOEA 5EUAA 4QD4A 4HBUA 3GRJA 1KE4A 1YLTA 3BFGA 2ZM8A 4HESA 1PYYA 2Y91A 4MBKA 2HP6A 4UA7A 1Y54A 1BLHA 3RXXA 1VQQA 3E2KA 3Q07A 1HVBA 4FD8A 5FQJA 5A93A 4E3NA 1MKIA 3VOZA 2HDUA 1MWRA 3HL9A 2Y4AA 1FR6A 3MKFA 2FFFB 4PM8A 4FCFA 1ONGA 1WYCA 4LCMA 4LV0A 1U60A 1GA9A 1WYBA 4KZ7A 2RL3A 4RVAA 4OVDA 1YLJA 4KQOA 3UPPA 1PWGA 4S2KA 4C75A 1K54A 1K4EA 1PW1A 4EQIA 4WMCA 5TR7A 2WAEA 3IH9A 4MLLA 4QJGA 5HAPA 3HLFA 3G30A 1PIOA 1KDWA 4KZ8A 3CMZA 2JE5A 3OPPA 4P6BA 1K25A 1KVMA 1QMFA 4OQHA 4X6TA 3VMAA 2WZZA 1O7EA 3MBZA 5TGFA 5U47A 1K56D 2WGVA 3IHAA 5AQ7A 1KE0A 2XH9A 1NYYA 2IWCA 2P74A 4H8RA 3WS4A 1KDSA 4M3KA 1JTDA 4WELA 5FDHA 1XGJA 3FYZA 2P9VA 3IWQA 2ZQ9A 3S1YA 2XFTA 2A3UA 3O3VA 4YINA 1LL9A 3DWKA 4JF4A 1BLPA 2QZ6A 2XD5A 4R3BA 4KENB 3GR2A 4MEZA 5A92A 4E6XA 2H10A 3VP3A 1BUEA 2J9PA 4K91A 1YLYA 1BLSA 1NXYA 3S22A 2E8IA 2XK1A 3FKWA 1L0FA 3NCKA 4CPKA 1J9MA 1ES4A 1OMEA 2Y59A 4KG5A 4R4SA 4GD6A 1C3BA 2XQZA 2HPBA 3IT9A 5EVID 2ZQDA 3SH8A 3OC2A 3ZCZA 3M6BA 4JXGA 1BSGA 4OQ0A 1O07A 5GLCA 1KGEA 1DJCA 3V3SA 4GKUA 5GLAA 3UO9A 2ZD8A 4OPRA 3N6IA 4XUZA 5HL1A 5FAOA 1TDGA 3ZDJA 4O7DA 3BRMA 1FQGA 3A3JA 1TDLA 3G2ZA 1IYQA 4S2MA 4JF6A 4WYYA 4BL3A 2A49A 4OP8A 5F1FA 5CGXA 3PAEA 2Y55A 3IWOA 3W4QA 5HAIA 4ZTKA 3DWZA 2ZJ9A 2XDMA 1SCWA 4FSFA 3IHBA 2XF3A 3PBTA 1Q2QA 2OLUA 3QNCA 1G68A 3NIAA 2ZQAA 2WADA 2WK0A 1YM1A 5M1AA 3PBNA 3UY6A 4R0QA 3O88A 4ZBEA 2ZC3B 4RX3A 3PBSA 3VFHA 4BD0A 1LI9A 4PM5A 2EX8A 3HLBA 4OP5A 5CERA 1JTGA 3UE3A 4JPMA 2H5SA 1IKIA 1FSWA 3LEZA 4IVIA 4DE2A 4IBRA 4X56A 2I72A 1PZOA 2WYXA 3LY4A 1PZPA 4R3JA 5KMWA 4DF6A 1ES3A 2ZQ7A 1ERQA 4BLMA 4P0MA 5FQIA 5CEBA 1RGZA 1KGFA 3G4PA 3UNWA 2HDQA 4E3LA 1DJBA 2Y2LA 3HBRA 2PBYA 3HREA 3IH8A 3NBLA 1M40A 1XP4A 3EQVA 4QU3A 2BLSA 3VFFA 2C6WB 1SHVA 2Q9NA 3BFCA 3CJMA 5GHXA 1W8QA 4L0LA 4KG2A 5E2HA 3WWXA 3NC8A 2V1ZA 4WZ5C 2XGNA 3OPRA 1K6SA 2WKIA 3MXRA 3GSGA 3PBRA 1IYOA 4GZBA 3ZGAB 3Q7ZA 2WUQA 4GDBA 3BM6A 3P09A 5JYPA 3RJUA 2C5WB 4KQQA 1JVJA 3MKEA 1BULA 3PBOA 4OKPA 4RX2A 3MZFA 3C5AA 5CTNA 2VGKA 4DE0A 3LY3A 1NRFA 3FV7A 3AGDA 1L0GA 3TOIA 3JYIA 4K0WA 4B4XA 5AQAA 4LV1A 1ALQA 3PAGA 3ZHHA 3MFDA 1Q2PA 1XGIA 5HX9A 4E3IA 1FCMA 1PWCA 2EXBA 3C4OA 3HUMA 2IWDA 2HDRA 3Q82A 4CJNA 2H0TA 4X53A 5KSHA 2Y2GA 3A3IA 2EX9A 5D3OA 3CG5A 4JXVA 1L0DA 4EBPA 4Z9QA 1FCNA 1KGGA 1NYMA 3GVBA 2HP9A 5FQQA 1K6RA 3B3XA 1VM1A 3G31A 3GTCA 1QMEA 3ZG9B 3IXBA 4JXSA 3LO7A 4XUXA 3HLGA 2Y2HA 3PBQA 4WZ5A 1DY6A 3IXDA 5HFOA 3BFDA 1IELA 5CHMA 4EWFA 1E3UA 5CECA 3ZG8B 3EQUA 2PU4A 2ZC4B 1FCOA 2JCHA 3GQZA 3IXHA 2Z2LB 5EOOA 4ZAMA 1L2SA 4JXWA 4D2OA 3C4PA 1SDEA 3GV9A 4DE1A 4KZ6A 1XA1A 4GN2A 4K0XA 3UE1A 5FA7A 1DJAA 1HTZA 2Z2MB 2ZQCA 3HLEA 2HP5A 2Q9MA 1IKGA 3D4FA 4N9LA 1SKFA 3VSKA 3Q81A 3CZDA 4KZ3A 2X01A 4OLGA 5GHZA 1W8YA 5DTTA 3C7VA 1I2SA 3O87A 3DTMA 4WMCD 3VSLA 3HVFA 3V50A 5EVIB 4HBTA 2Y2KA 4PM9A 3WS0A 3GMWA 3QHYA 4A5RA 5FAQA 3G34A 4KQRA 4EUZA 1L0EA 3BFFA 3NDGA 2EX2A 5EPHA 1WE4A 4N1XA 2WGIA 4OPYA 1E25A 1PI4A 5FI6A 4UA9A 4DKIA 1MBLA 3V5MA 1CK3A 5F82A 1RCJA 1ES5A 1K57C 1HZOA 4DXBA 2BG1A 4OPQA 1JWZA 1YQSA 3UN7A 2XD1A 1TVFA 4DE3A 3VOYA 3MZDA 4C3QA 2Y2NA 2P9VB 4U0TA 5E43A 2XEPA 1K55A 1NY0A 3N8RA 3OCNA 4GD8A 3HUOA 1FOFA 1H5XA 4Y0OA 4X68A 4B4ZA 3Q7VB 5DTSA 4GB7A 4JF5A 1GCEA 1G6AA 1MPLA 1MXOA 4DXCA 4UA6A 3FZCA 3A3DA 2WGWA 3IF5A 3IXGA 5GL9A 4OONA 1BLCA 4WZ4A 4IVKA 3S4XA 1W5DA 4DDYA 1ES2A 2PU2A 5E2EA 2WAFA 2XFSA 1N9BA 4E3JA 3BEBA 2IWBA 1SDNA 4ZJ3A 5IHVA 5AQBA 4GOGA 1FR1A 1YMXA 1H8YA 1ZG4A 2ZC7A 3NI9A 2DRWA 4Y7PA 2CC1A 4OPZA 4F94A 4MNRA 4UAAA 1HD8A 4FH2A 3A3FA 3ITAA 5DVAA 3V39A 5FI7A 3BFEA 4XXRA 1KVLA 3BLSA 3NY4A 4PM6A 1K38A 4C6YA 1TEMA 5G18A 4PPRA 1EROA 3G32A 4WM9A 5DF7A 4E6WA 2Y2QA 5KZHA 1K57A 1PI5A 2OLVA 5J8XA 2EFUA 3UDFA 2V2FF 4BENA 2Y2MA 4RYEA 3RXWA 3SOIA 4OOMA 3LCEA 5M19A 1FSYA 3OZHA 1MY8A 5EVIC 3UPOA 4IBXA 4WBGA 1YLPA 4X55A 3ITBA 5FAPA 4E3KA 3M2KA 3ZFZA 4OLDA 1YMSA 5TFQA 2GDNA 3P98A 3V3RA 4QB8A 3OCLA 5DTKA 5EE8A 3ZNTA 4BQMA 4Y0UA 5FSRA 4PMAA 4R23A 1H8ZA 1W7FA 4R4RA 5I94A 1K56A 4R1GA 2QMIA 2Y2IA 3DW0A 4S2OA 3Q1FA 1MWSA 4U0XA 5CRFA 1I2WA 1XA7A 1XKZA 1K4FA 2J9OA 5DF9A 1ERMA 5CHUA 2VGJA 4RA7A 1PWDA 1ZG6A 4QHCA 4KG6A 4E3OA 4FH4A 3N8SA 3SS5A 4KZBA 1LL5A 3IF6B 3W8KA 2ZM0A 5JYOA 2H0YA 1ESUA 5FATA 4S2JA 3VP1A 3NDEA 4EV4A 4S2IA 1W79A 4KZ4A 2G2UA 1BT5A 1MWUA 2EX6A 5BOHA 4MBHA 4ID4A 5GLDA 4OH0A 4NETA 3ZG5A 4N92A 3ISGA 3N4IA 4S2NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ4 A;  2FFY A;  4Q8I A;  3VP4 A;  1E4D A;  4P87 A;  5EVI A;  3SS3 A;  1BZA A;  1JWV A;  3WRZ A;  3HUN A;  2Y2J A;  1K55 C;  2ZC5 B;  5E2F A;  2RCX A;  5CGW A;  1IEM A;  3ZG7 B;  4OOL A;  2B5R A;  3G2Y A;  5FQK A;  3FKV A;  1ESI A;  4N1H A;  4DRT A;  5FI2 A;  1YLZ A;  2Y2O A;  5F1G A;  4JLF A;  3W4P A;  3N8L A;  3G35 A;  4Y0T A;  5HW3 A;  4KZ5 A;  4YFM A;  3HLD A;  1M6K A;  1Z6F A;  3UDX A;  5EEC A;  3IWI A;  5KSC A;  2OSU A;  4LV3 A;  4X69 A;  2QPN A;  2UWX A;  3ZG0 A;  1S0W A;  4JBF A;  2X71 A;  1ONH A;  2ZLY A;  3UPN A;  2WZX A;  4LV2 A;  4NK3 A;  1GHM A;  1YT4 A;  1XX2 A;  3IQA A;  4P85 A;  3HLW A;  3Q7V A;  1ZKJ A;  3TG9 A;  5M18 A;  3WS1 A;  4OQI A;  2R9W A;  4S2L A;  5CXW A;  3SS4 A;  2HDS A;  3WS5 A;  3ZVW A;  1CI9 A;  2J7V A;  2R9X A;  1XPB A;  3VP0 A;  4BJP A;  3N7W A;  4BD1 A;  1AXB A;  1S6R A;  1I5Q A;  3UDI A;  1EI5 A;  3ZVT A;  2XR0 A;  1E3U D;  3ZNY A;  1CEG A;  2JC7 A;  1CI8 A;  1MWT A;  3AGE A;  4S2N A;  4E3M A;  5DF8 A;  5AQ9 A;  4OQG A;  2EFX A;  3M2J A;  5FQM A;  2ZMA A;  3OPH A;  1ZC2 A;  5GLB A;  1GA0 A;  4JKT A;  4WEJ A;  1LLB A;  3AGF A;  1IYS A;  1YLW A;  1KE3 A;  3IF6 C;  3QNB A;  2DCF A;  1IYP A;  5EVL A;  5FQ9 A;  3UE0 A;  3VP2 A;  5HAQ A;  4BL2 A;  5CTM A;  4OOY A;  2DNS A;  3A3E A;  1RGY A;  3WRT A;  4EBL A;  5CHJ A;  2XLN A;  1CEF A;  3C7U A;  4IED A;  4QY6 A;  5HAR A;  3SH7 A;  2ZM2 A;  1XXM A;  3BEC A;  5GHY A;  2G2W A;  4HEF A;  1NZO A;  3OPL A;  4U3T A;  1BTL A;  4DDS A;  4EBN A;  1LHY A;  5F83 A;  2EXA A;  5CED A;  1EWZ A;  4PM7 A;  4KZ9 A;  2J8Y A;  4ZJ1 A;  5A90 A;  2Y2P A;  1GHI A;  3M6H A;  1PW8 A;  4N9K A;  3BLM A;  4LEN A;  4MBF A;  3W4O A;  4KZA A;  2WKE A;  2ZQ8 A;  4GNU A;  2WKH A;  3WS2 A;  3BYD A;  2ZC6 B;  5FAS A;  1K54 C;  2OV5 A;  3E2L A;  3HLC A;  3MZE A;  1N4O A;  3IF6 A;  5E2G A;  4B88 A;  5A91 A;  4WEK A;  4S2P A;  1JWP A;  2JBF A;  2V20 A;  3PTE A;  4QY5 A;  3SH9 A;  4ZJ2 A;  3TSG A;  5CGS A;  1RP5 A;  3I7J A;  4GDN A;  1LI0 A;  1NZU A;  3FWL A;  1GHP A;  3O86 A;  4LCL A;  2WGW B;  5L2F A;  4UHU A;  2X02 A;  4ZDX A;  3MXS A;  5EOE A;  5EUA A;  4QD4 A;  4HBU A;  3GRJ A;  1KE4 A;  1YLT A;  3BFG A;  2ZM8 A;  4HES A;  1PYY A;  2Y91 A;  4MBK A;  2HP6 A;  4UA7 A;  1Y54 A;  1BLH A;  3RXX A;  1VQQ A;  3E2K A;  3Q07 A;  1HVB A;  4FD8 A;  5FQJ A;  5A93 A;  4E3N A;  1MKI A;  3VOZ A;  2HDU A;  1MWR A;  3HL9 A;  2Y4A A;  1FR6 A;  3MKF A;  2FFF B;  4PM8 A;  4FCF A;  1ONG A;  1WYC A;  4LCM A;  4LV0 A;  1U60 A;  1GA9 A;  1WYB A;  4KZ7 A;  2RL3 A;  4RVA A;  4OVD A;  1YLJ A;  4KQO A;  3UPP A;  1PWG A;  4S2K A;  4C75 A;  1K54 A;  1K4E A;  1PW1 A;  4EQI A;  4WMC A;  5TR7 A;  2WAE A;  3IH9 A;  4MLL A;  4QJG A;  5HAP A;  3HLF A;  3G30 A;  1PIO A;  1KDW A;  4KZ8 A;  3CMZ A;  2JE5 A;  3OPP A;  4P6B A;  1K25 A;  1KVM A;  1QMF A;  4OQH A;  4X6T A;  3VMA A;  2WZZ A;  1O7E A;  3MBZ A;  5TGF A;  5U47 A;  1K56 D;  2WGV A;  3IHA A;  5AQ7 A;  1KE0 A;  2XH9 A;  1NYY A;  2IWC A;  2P74 A;  4H8R A;  3WS4 A;  1KDS A;  4M3K A;  1JTD A;  4WEL A;  5FDH A;  1XGJ A;  3FYZ A;  2P9V A;  3IWQ A;  2ZQ9 A;  3S1Y A;  2XFT A;  2A3U A;  3O3V A;  4YIN A;  1LL9 A;  3DWK A;  4JF4 A;  1BLP A;  2QZ6 A;  2XD5 A;  4R3B A;  4KEN B;  3GR2 A;  4MEZ A;  5A92 A;  4E6X A;  2H10 A;  3VP3 A;  1BUE A;  2J9P A;  4K91 A;  1YLY A;  1BLS A;  1NXY A;  3S22 A;  2E8I A;  2XK1 A;  3FKW A;  1L0F A;  3NCK A;  4CPK A;  1J9M A;  1ES4 A;  1OME A;  2Y59 A;  4KG5 A;  4R4S A;  4GD6 A;  1C3B A;  2XQZ A;  2HPB A;  3IT9 A;  5EVI D;  2ZQD A;  3SH8 A;  3OC2 A;  3ZCZ A;  3M6B A;  4JXG A;  1BSG A;  4OQ0 A;  1O07 A;  5GLC A;  1KGE A;  1DJC A;  3V3S A;  4GKU A;  5GLA A;  3UO9 A;  2ZD8 A;  4OPR A;  3N6I A;  4XUZ A;  5HL1 A;  5FAO A;  1TDG A;  3ZDJ A;  4O7D A;  3BRM A;  1FQG A;  3A3J A;  1TDL A;  3G2Z A;  1IYQ A;  4S2M A;  4JF6 A;  4WYY A;  4BL3 A;  2A49 A;  4OP8 A;  5F1F A;  5CGX A;  3PAE A;  2Y55 A;  3IWO A;  3W4Q A;  5HAI A;  4ZTK A;  3DWZ A;  2ZJ9 A;  2XDM A;  1SCW A;  4FSF A;  3IHB A;  2XF3 A;  3PBT A;  1Q2Q A;  2OLU A;  3QNC A;  1G68 A;  3NIA A;  2ZQA A;  2WAD A;  2WK0 A;  1YM1 A;  5M1A A;  3PBN A;  3UY6 A;  4R0Q A;  3O88 A;  4ZBE A;  2ZC3 B;  4RX3 A;  3PBS A;  3VFH A;  4BD0 A;  1LI9 A;  4PM5 A;  2EX8 A;  3HLB A;  4OP5 A;  5CER A;  1JTG A;  3UE3 A;  4JPM A;  2H5S A;  1IKI A;  1FSW A;  3LEZ A;  4IVI A;  4DE2 A;  4IBR A;  4X56 A;  2I72 A;  1PZO A;  2WYX A;  3LY4 A;  1PZP A;  4R3J A;  5KMW A;  4DF6 A;  1ES3 A;  2ZQ7 A;  1ERQ A;  4BLM A;  4P0M A;  5FQI A;  5CEB A;  1RGZ A;  1KGF A;  3G4P A;  3UNW A;  2HDQ A;  4E3L A;  1DJB A;  2Y2L A;  3HBR A;  2PBY A;  3HRE A;  3IH8 A;  3NBL A;  1M40 A;  1XP4 A;  3EQV A;  4QU3 A;  2BLS A;  3VFF A;  2C6W B;  1SHV A;  2Q9N A;  3BFC A;  3CJM A;  5GHX A;  1W8Q A;  4L0L A;  4KG2 A;  5E2H A;  3WWX A;  3NC8 A;  2V1Z A;  4WZ5 C;  2XGN A;  3OPR A;  1K6S A;  2WKI A;  3MXR A;  3GSG A;  3PBR A;  1IYO A;  4GZB A;  3ZGA B;  3Q7Z A;  2WUQ A;  4GDB A;  3BM6 A;  3P09 A;  5JYP A;  3RJU A;  2C5W B;  4KQQ A;  1JVJ A;  3MKE A;  1BUL A;  3PBO A;  4OKP A;  4RX2 A;  3MZF A;  3C5A A;  5CTN A;  2VGK A;  4DE0 A;  3LY3 A;  1NRF A;  3FV7 A;  3AGD A;  1L0G A;  3TOI A;  3JYI A;  4K0W A;  4B4X A;  5AQA A;  4LV1 A;  1ALQ A;  3PAG A;  3ZHH A;  3MFD A;  1Q2P A;  1XGI A;  5HX9 A;  4E3I A;  1FCM A;  1PWC A;  2EXB A;  3C4O A;  3HUM A;  2IWD A;  2HDR A;  3Q82 A;  4CJN A;  2H0T A;  4X53 A;  5KSH A;  2Y2G A;  3A3I A;  2EX9 A;  5D3O A;  3CG5 A;  4JXV A;  1L0D A;  4EBP A;  4Z9Q A;  1FCN A;  1KGG A;  1NYM A;  3GVB A;  2HP9 A;  5FQQ A;  1K6R A;  3B3X A;  1VM1 A;  3G31 A;  3GTC A;  1QME A;  3ZG9 B;  3IXB A;  4JXS A;  3LO7 A;  4XUX A;  3HLG A;  2Y2H A;  3PBQ A;  4WZ5 A;  1DY6 A;  3IXD A;  5HFO A;  3BFD A;  1IEL A;  5CHM A;  4EWF A;  1E3U A;  5CEC A;  3ZG8 B;  3EQU A;  2PU4 A;  2ZC4 B;  1FCO A;  2JCH A;  3GQZ A;  3IXH A;  2Z2L B;  5EOO A;  4ZAM A;  1L2S A;  4JXW A;  4D2O A;  3C4P A;  1SDE A;  3GV9 A;  4DE1 A;  4KZ6 A;  1XA1 A;  4GN2 A;  4K0X A;  3UE1 A;  5FA7 A;  1DJA A;  1HTZ A;  2Z2M B;  2ZQC A;  3HLE A;  2HP5 A;  2Q9M A;  1IKG A;  3D4F A;  4N9L A;  1SKF A;  3VSK A;  3Q81 A;  3CZD A;  4KZ3 A;  2X01 A;  4OLG A;  5GHZ A;  1W8Y A;  5DTT A;  3C7V A;  1I2S A;  3O87 A;  3DTM A;  4WMC D;  3VSL A;  3HVF A;  3V50 A;  5EVI B;  4HBT A;  2Y2K A;  4PM9 A;  3WS0 A;  3GMW A;  3QHY A;  4A5R A;  5FAQ A;  3G34 A;  4KQR A;  4EUZ A;  1L0E A;  3BFF A;  3NDG A;  2EX2 A;  5EPH A;  1WE4 A;  4N1X A;  2WGI A;  4OPY A;  1E25 A;  1PI4 A;  5FI6 A;  4UA9 A;  4DKI A;  1MBL A;  3V5M A;  1CK3 A;  5F82 A;  1RCJ A;  1ES5 A;  1K57 C;  1HZO A;  4DXB A;  2BG1 A;  4OPQ A;  1JWZ A;  1YQS A;  3UN7 A;  2XD1 A;  1TVF A;  4DE3 A;  3VOY A;  3MZD A;  4C3Q A;  2Y2N A;  2P9V B;  4U0T A;  5E43 A;  2XEP A;  1K55 A;  1NY0 A;  3N8R A;  3OCN A;  4GD8 A;  3HUO A;  1FOF A;  1H5X A;  4Y0O A;  4X68 A;  4B4Z A;  3Q7V B;  5DTS A;  4GB7 A;  4JF5 A;  1GCE A;  1G6A A;  1MPL A;  1MXO A;  4DXC A;  4UA6 A;  3FZC A;  3A3D A;  2WGW A;  3IF5 A;  3IXG A;  5GL9 A;  4OON A;  1BLC A;  4WZ4 A;  4IVK A;  3S4X A;  1W5D A;  4DDY A;  1ES2 A;  2PU2 A;  5E2E A;  2WAF A;  2XFS A;  1N9B A;  4E3J A;  3BEB A;  2IWB A;  1SDN A;  4ZJ3 A;  5IHV A;  5AQB A;  4GOG A;  1FR1 A;  1YMX A;  1H8Y A;  1ZG4 A;  2ZC7 A;  3NI9 A;  2DRW A;  4Y7P A;  2CC1 A;  4OPZ A;  4F94 A;  4MNR A;  4UAA A;  1HD8 A;  4FH2 A;  3A3F A;  3ITA A;  5DVA A;  3V39 A;  5FI7 A;  3BFE A;  4XXR A;  1KVL A;  3BLS A;  3NY4 A;  4PM6 A;  1K38 A;  4C6Y A;  1TEM A;  5G18 A;  4PPR A;  1ERO A;  3G32 A;  4WM9 A;  5DF7 A;  4E6W A;  2Y2Q A;  5KZH A;  1K57 A;  1PI5 A;  2OLV A;  5J8X A;  2EFU A;  3UDF A;  2V2F F;  4BEN A;  2Y2M A;  4RYE A;  3RXW A;  3SOI A;  4OOM A;  3LCE A;  5M19 A;  1FSY A;  3OZH A;  1MY8 A;  5EVI C;  3UPO A;  4IBX A;  4WBG A;  1YLP A;  4X55 A;  3ITB A;  5FAP A;  4E3K A;  3M2K A;  3ZFZ A;  4OLD A;  1YMS A;  5TFQ A;  2GDN A;  3P98 A;  3V3R A;  4QB8 A;  3OCL A;  5DTK A;  5EE8 A;  3ZNT A;  4BQM A;  4Y0U A;  5FSR A;  4PMA A;  4R23 A;  1H8Z A;  1W7F A;  4R4R A;  5I94 A;  1K56 A;  4R1G A;  2QMI A;  2Y2I A;  3DW0 A;  4S2O A;  3Q1F A;  1MWS A;  4U0X A;  5CRF A;  1I2W A;  1XA7 A;  1XKZ A;  1K4F A;  2J9O A;  5DF9 A;  1ERM A;  5CHU A;  2VGJ A;  4RA7 A;  1PWD A;  1ZG6 A;  4QHC A;  4KG6 A;  4E3O A;  4FH4 A;  3N8S A;  3SS5 A;  4KZB A;  1LL5 A;  3IF6 B;  3W8K A;  2ZM0 A;  5JYO A;  2H0Y A;  1ESU A;  5FAT A;  4S2J A;  3VP1 A;  3NDE A;  4EV4 A;  4S2I A;  1W79 A;  4KZ4 A;  2G2U A;  1BT5 A;  1MWU A;  2EX6 A;  5BOH A;  4MBH A;  4ID4 A;  5GLD A;  4OH0 A;  4NET A;  3ZG5 A;  4N92 A;  3ISG A;  3N4I A;  4S2N C; 
#chains in the Genus database with same CATH topology
 1NJ4 A;  2ACG A;  2FFY A;  3VE4 A;  1GSX A;  3BW6 A;  1K55 C;  3DTE A;  2ZMV A;  3MSH A;  3LUQ A;  2Y2O A;  3W4P A;  3N8L A;  2EA9 A;  3MQQ A;  4HJ6 A;  3UDX A;  3IWI A;  5KSC A;  4LV3 A;  3ZG0 A;  1S0W A;  1PFL A;  4ETX A;  2ZLY A;  4LV2 A;  1W63 M;  4OQI A;  4WN5 A;  2HDS A;  4K08 A;  3A0S A;  1XPB A;  1D06 A;  1AXB A;  4HH3 A;  3UDI A;  4X1M A;  1E3U D;  3ZNY A;  1CI8 A;  3AGE A;  2OWH A;  5AQ9 A;  5FQM A;  3PHY A;  4GLQ A;  1GA0 A;  1SZV A;  2W3G A;  3QNB A;  2DCF A;  3EWK A;  3VP2 A;  1ZHH B;  1Y4O A;  2BAS A;  3WRT A;  1CEF A;  3ULF A;  3OBF A;  3C7U A;  3SH7 A;  2A24 A;  2G2W A;  4U3T A;  5F83 A;  4AFI A;  2AVX A;  3EEH A;  4ZJ1 A;  1GHI A;  3M6H A;  4N9K A;  3W4O A;  2O9A A;  3CPT B;  2H28 A;  5FAS A;  1H0M A;  3HLC A;  2V20 A;  4B93 A;  4GDN A;  1LI0 A;  1NZU A;  2A2L A;  3MMH A;  5EOE A;  5HWV A;  4QD4 A;  4HBU A;  1KE4 A;  1YLT A;  1VET B;  2ZOI A;  3BFG A;  3KYZ A;  2Y91 A;  4UA7 A;  2HP6 A;  1LSV A;  1VQQ A;  3Q07 A;  1MKI A;  3NHQ A;  2VV6 A;  2Q0O A;  3HL9 A;  3EEA A;  2Y4A A;  1ONG A;  4LV0 A;  1WYB A;  4KZ7 A;  1YLJ A;  3H7W B;  1K4E A;  5TR7 A;  2WAE A;  3LEQ A;  5HAP A;  3G30 A;  1KDW A;  3CMZ A;  1NRJ A;  4HNB A;  2V1B A;  4WF0 A;  3MBZ A;  2XH9 A;  1NYY A;  4H8R A;  3WS4 A;  4L9F A;  1XGJ A;  2P9V A;  1LL9 A;  5J3W A;  3K3C A;  4KEN B;  3UE6 A;  2V1A A;  4H6J B;  4HIA A;  2OAP 1;  1NXY A;  1OJ5 A;  3FKW A;  5CX7 A;  1OME A;  3CLO A;  4GD6 A;  2XQZ A;  4B9O A;  2W3F A;  3ZCZ A;  2GZA A;  5GLC A;  3UO9 A;  2J3T D;  4XUZ A;  1TDG A;  3ZDJ A;  4WYY A;  5DFY A;  3CPT A;  3IWO A;  2QYB A;  1FIL A;  5HAI A;  2HJE A;  2J3W A;  2NUT C;  2ZQA A;  3FG8 A;  4JGO A;  4HJ3 A;  3CUE C;  5M1A A;  3UY6 A;  4R0Q A;  4ZBE A;  1F98 A;  3HLB A;  2VKS A;  3UE3 A;  2J80 A;  1FSW A;  4IBR A;  4X56 A;  1HLU P;  1RGZ A;  1YKD A;  2K2N A;  3G4P A;  4CLC C;  2XRN A;  3EOI A;  1DJB A;  5HSQ A;  2W3D A;  4CLC E;  1XP4 A;  1P9W A;  2BLS A;  1TS6 A;  3BFC A;  5GHX A;  4O0P A;  4L0L A;  3G6O A;  4UQI S;  4I5S A;  2XGN A;  3H7W A;  3OPR A;  1K6S A;  2OWJ A;  2O99 A;  1IYO A;  1FIK A;  5L09 A;  2PRF A;  4LRX C;  2C5W B;  3MKE A;  1BUL A;  3CUE A;  4RX2 A;  5CTN A;  2VGK A;  3FV7 A;  4YWZ A;  3JYI A;  1ALQ A;  3ZHH A;  2ZBB A;  1Q2P A;  1XGI A;  1VHM A;  2H0T A;  1S67 L;  4CLC A;  2Y2G A;  2Z6C A;  3BY8 A;  1UGU A;  1VEU B;  3E4Q A;  2HP9 A;  2JKR I;  3B3X A;  4JXS A;  1P97 A;  3LO7 A;  2KX6 A;  4P6Z M;  2XA7 M;  3C2W A;  4YOF A;  3EQU A;  3GQZ A;  4ZAM A;  1L2S A;  4D2O A;  3UB9 A;  2M7U A;  4KZ6 A;  5EV0 A;  4GN2 A;  2B18 A;  3HLE A;  2Q9M A;  3NEC A;  3VSK A;  4UEY A;  4OLG A;  3C7V A;  3DTM A;  3VSL A;  5HD5 A;  5EVI B;  4PM9 A;  3WS0 A;  4A5R A;  5FAQ A;  1UWP X;  3JVU A;  5EPH A;  4LFU A;  1E25 A;  1PI4 A;  5FI6 A;  4UA9 A;  5F82 A;  1RCJ A;  3C38 A;  4OPQ A;  1YQS A;  3T50 A;  2XD1 A;  1TVF A;  1OTB A;  3VOY A;  4FOF A;  3S7O A;  3F1N B;  4U0T A;  3S7P A;  3OCN A;  3N8R A;  1H5X A;  3Q7V B;  4GB7 A;  1G6A A;  3MS6 A;  4IUK A;  5GL9 A;  3O5Y A;  3S4X A;  1ODV A;  3CIT A;  1N9B A;  2IWB A;  1SDN A;  5HWW A;  4ZJ3 A;  5IHV A;  1SKO B;  4Y7P A;  3QP8 A;  4FH2 A;  3LI8 A;  3LR5 A;  2O9B A;  1K38 A;  2FH5 A;  3F1P A;  1ERO A;  4WM9 A;  2V2F F;  2Y2M A;  3RXW A;  5MC7 A;  5M19 A;  1MY8 A;  1VEU A;  5EVI C;  1YLP A;  4X55 A;  3M2K A;  5TFQ A;  3P98 A;  3V3R A;  5DTK A;  4BQM A;  4Y0U A;  4R1G A;  3LYX A;  3Q1F A;  1MWS A;  5DF9 A;  5CRF A;  1XA7 A;  5CHU A;  4WL9 A;  4II7 A;  4E3O A;  3IF6 B;  3W8K A;  4R70 A;  2H0Y A;  4O8G A;  5J7E A;  1W79 A;  3LI9 A;  3B47 A;  5GLD A;  4NET A;  3D72 A;  4S2N C;  4Q8I A;  5EVI A;  2HZ5 A;  1DRM A;  3HUN A;  2ZC5 B;  3LR0 A;  1ESI A;  3TW8 A;  4DRT A;  5AVE A;  5F1G A;  5HW3 A;  4KZ5 A;  2OSU A;  4MN5 A;  2JKT M;  2X71 A;  1ONH A;  2WZX A;  4NK3 A;  1YT4 A;  4P85 A;  3HLW A;  3Q7V A;  1ZKJ A;  5M18 A;  3WS1 A;  2R9W A;  1S4R A;  3SS4 A;  3WS5 A;  3ZVW A;  1G5U A;  2Y79 A;  2R9X A;  3VP0 A;  4BD1 A;  1S1Y A;  2GX5 A;  3HJK A;  3ZVT A;  1MWT A;  4S2N A;  3IX8 A;  5DF8 A;  2EFX A;  4JKT A;  5FDS A;  5HWT A;  3AGF A;  1YLW A;  3MF0 A;  3IF6 C;  5HAQ A;  4BL2 A;  5CTM A;  3IBR A;  2DNS A;  3FPW A;  3A3E A;  1RGY A;  1ZTU A;  4EBL A;  4I38 A;  5HAR A;  1EW0 A;  3BEC A;  1OTD A;  4HEF A;  1BTL A;  4EBN A;  1LHY A;  3VE3 A;  3P01 A;  5CED A;  3F1O B;  3IBJ A;  4I3A A;  4KZ9 A;  3LIF A;  4HP4 A;  1T18 A;  4KZA A;  2ZQ8 A;  1BYW A;  3MZE A;  5F5Y A;  1N4O A;  1TF1 A;  3LIB A;  3IF6 A;  5E2G A;  2V8F A;  4B88 A;  5A91 A;  3JPU A;  4S2P A;  2J3T C;  3SH9 A;  1YPR A;  3TSG A;  5CGS A;  1RP5 A;  5F68 A;  5HPF A;  3O86 A;  2WGW B;  2X02 A;  2O9C A;  1OJG A;  3GRJ A;  2JHE A;  1F9I A;  5FQJ A;  4E3N A;  1MWR A;  4EXO A;  1FR6 A;  4PM8 A;  3KX0 X;  4KUO A;  1U60 A;  1GA9 A;  2W3E A;  1IFQ A;  2D02 A;  2VV7 A;  4KQO A;  4S2K A;  4EQI A;  4WMC A;  3IH9 A;  4MLL A;  2W1T B;  4KZ8 A;  4P6B A;  1K25 A;  1KVM A;  1QMF A;  5L8M A;  3UB8 A;  4BBV A;  2HV1 A;  2VGL M;  2P74 A;  1JTD A;  4WEL A;  5FDH A;  1MZU A;  2ZL1 B;  2W27 A;  4YIN A;  1BLP A;  2QZ6 A;  2XSS A;  3EGD C;  4K91 A;  2PR5 A;  3S22 A;  4ESP A;  1L0F A;  3NCK A;  1T1B A;  3IT9 A;  5EVI D;  4JXG A;  1BSG A;  1KGE A;  2OOL A;  5GLA A;  3F1O A;  2ZD8 A;  4GHI B;  5FAO A;  1TDL A;  4S2M A;  1IYQ A;  5F1F A;  4ZTK A;  3E4O A;  3T12 B;  5F6A A;  2HGV A;  3PBT A;  1Q2Q A;  3QNC A;  4LGW A;  3PBN A;  1CJF A;  4PM5 A;  3VFH A;  1LI9 A;  4JPM A;  4IVI A;  3LEZ A;  3LY4 A;  4DMZ A;  3L7H A;  1PZP A;  4R3J A;  5KMW A;  2IA2 A;  1ERQ A;  4BLM A;  3CAX A;  2Y2L A;  3HRE A;  1XFN A;  3VFF A;  2C6W B;  5TBM B;  2W1R A;  2V0W A;  4KG2 A;  3WWX A;  2V1Z A;  4WZ5 C;  2JKG A;  4HQA A;  3GSG A;  2INW A;  4GDB A;  3BM6 A;  2PHY A;  3RJU A;  4KQQ A;  3PBO A;  1K0K A;  1F5M A;  3LY3 A;  4MN6 A;  3TOI A;  3VOL A;  4K0W A;  4B4X A;  5HX9 A;  1FCM A;  1XJ3 A;  2EXB A;  3HUM A;  2IWD A;  2ZL1 A;  4R38 A;  5HL6 A;  3K3D A;  2M1C A;  5D3O A;  4JXV A;  1L0D A;  4Z9Q A;  1K6R A;  1XJ2 A;  3GTC A;  3R4K A;  4XUX A;  4WZ5 A;  3TRC A;  4EWF A;  5CEC A;  4HHD A;  2ZC4 B;  2JCH A;  5EOO A;  4JXW A;  2VEA A;  4GHI A;  3UE1 A;  1HTZ A;  4X1L A;  4N9L A;  2PYP A;  1SKF A;  1KOU A;  1W8Y A;  3O87 A;  4WMC D;  2PD7 A;  4EER A;  2QKP A;  2WKR A;  3CI6 A;  3UB5 P;  3V50 A;  5FEF A;  4HBT A;  3QHY A;  4EUZ A;  4HY8 A;  3NOU C;  4DKI A;  3V5M A;  2JN7 A;  1CK3 A;  1K57 C;  1HZO A;  2BG1 A;  3IX3 A;  1NLZ A;  2L1M A;  3MZD A;  3QP5 A;  4B4Z A;  4Y0O A;  5TBM A;  1MPL A;  4DXC A;  3UME A;  3IXG A;  2K7S A;  5TJJ A;  5E2E A;  2WAF A;  3MJQ A;  4E3J A;  2VLG A;  1VET A;  2ZC7 A;  1ZG4 A;  1T1A A;  4OPZ A;  4MNR A;  1HD8 A;  3ITA A;  5DVA A;  3V39 A;  5FI7 A;  4LRY C;  4XXR A;  3A0V A;  1KVL A;  5DF7 A;  2Y2Q A;  1K57 A;  1PI5 A;  2EFU A;  3UDF A;  4BEN A;  3SOI A;  4OOM A;  3LCE A;  3NOT C;  2VK3 A;  4E3K A;  5FAP A;  2GDN A;  1V9Z A;  5EE8 A;  4R23 A;  3CWF A;  4IHQ A;  1K56 A;  1VB6 A;  2QMI A;  5FL3 A;  4S2O A;  5I94 A;  4U0X A;  1I2W A;  1XKZ A;  2VGJ A;  2GNX A;  4ME4 A;  4X25 A;  3SS5 A;  3TJZ C;  1LL5 A;  1PNE A;  2QWS A;  4H6J A;  4BBT A;  3B42 A;  3BQA A;  5FAT A;  3T4J A;  4S2J A;  3U2A A;  1OT9 A;  4KZ4 A;  5DJT A;  2G2U A;  1N9O A;  3QP4 A;  5BOH A;  4MBH A;  4OH0 A;  3OOV A;  3ISG A;  4P87 A;  3SS3 A;  1BZA A;  2Y2J A;  2B5R A;  5FQK A;  4HJ4 A;  1YLZ A;  4Y0T A;  4JLF A;  4HOI A;  3HLD A;  2OAQ 1;  3PR6 A;  2I9V A;  4KQD A;  3LIA A;  2PDR A;  2VA0 A;  4Y15 A;  4JBF A;  4EUV A;  3UPN A;  4P6Z S;  1GHM A;  1XX2 A;  3IQA A;  2XA7 S;  4MCW A;  3BY9 A;  5HDD A;  1CI9 A;  2J7V A;  4G3W A;  3UMD A;  4BJP A;  3QP2 A;  3N7W A;  3E98 A;  1S6R A;  3QP6 A;  1EI5 A;  2XR0 A;  2QHK A;  4XT2 B;  4D60 A;  3OPH A;  5GLB A;  4WEJ A;  1TD5 A;  3E0Y A;  3RFB A;  1LLB A;  3NUL A;  5EVL A;  3UE0 A;  3T4T A;  2B02 A;  1IYP A;  5FQ9 A;  4FTX A;  3HJI A;  3T1S A;  4IED A;  4QY6 A;  4NEE D;  2ZM2 A;  3H82 B;  5GHY A;  2HF6 A;  3MXQ A;  2PR6 A;  3BQ8 A;  1X0O A;  2EXA A;  3L9K A;  1EWZ A;  4YNR A;  4PM7 A;  4MN7 A;  4IJG A;  2HJ9 C;  2FZ0 A;  3KSF A;  5A90 A;  2QJ7 A;  2Y2P A;  1PW8 A;  4GNU A;  1MKM A;  2WKH A;  3BYD A;  2P08 A;  3RTY A;  2V9A A;  4WEK A;  3PTE A;  1T1C A;  4QY5 A;  3T4K A;  3I7J A;  1TS0 A;  2GJ3 A;  3FWL A;  3S7N A;  4I3J A;  5L2F A;  2BTF P;  4NKP A;  3OLO A;  2ZM8 A;  4HES A;  5I5L A;  1Y54 A;  3RXX A;  3E2K A;  1HVB A;  3D9Y A;  4FD8 A;  5L10 A;  1LSX A;  2FFF B;  1WYC A;  4OVD A;  4QPR A;  3UPP A;  4EQ1 A;  1PWG A;  4QJG A;  3W2Z A;  5EVE A;  3HLF A;  2JE5 A;  4OQH A;  5DFX A;  2WZZ A;  5U47 A;  1K56 D;  3IHA A;  3NJA A;  1KE0 A;  2IWC A;  1P9R A;  4XT2 A;  1YSP A;  4EES A;  4M3K A;  3FYZ A;  4CQH A;  3H9W A;  3IWQ A;  3F1N A;  2A3U A;  3O3V A;  3DWK A;  4R3B A;  3GR2 A;  5A92 A;  3DTK A;  1BUE A;  1YLY A;  3FPV A;  1BLS A;  3K2N A;  2E8I A;  2XK1 A;  3H82 A;  1XJ6 A;  1J9M A;  1ES4 A;  2Y59 A;  1T19 A;  2NUP C;  3LIE A;  1C3B A;  2HPB A;  3GDI A;  2ZQD A;  3OC2 A;  3M6B A;  1SKO A;  1O07 A;  4E04 A;  1DJC A;  4GKU A;  3N6I A;  5HL1 A;  3G2Z A;  4JF6 A;  4BL3 A;  4I39 A;  4LPZ A;  4OP8 A;  4BBU A;  3PAE A;  3W4Q A;  2ZJ9 A;  2JKR M;  4FSF A;  1SCW A;  2XF3 A;  4F3L B;  2OLU A;  2WK0 A;  1YM1 A;  1CQA A;  4BD0 A;  5CER A;  1ACF A;  1JTG A;  2KLI A;  2PBD P;  2WYX A;  4DF6 A;  3A0R A;  2ZQ7 A;  4P0M A;  5FQI A;  1KGF A;  3UNW A;  3HBR A;  3IH8 A;  1M40 A;  3MQO A;  1SHV A;  2Q9N A;  1W8Q A;  2A24 B;  3NC8 A;  1L3L A;  2WKI A;  3MXR A;  4GZB A;  3ZGA B;  2WUQ A;  3UB6 A;  5JYP A;  3C5A A;  4DE0 A;  5DKL A;  1YSQ A;  3PAG A;  3IS2 B;  4E3I A;  1PWC A;  2CMN A;  3C4O A;  3Q82 A;  2HDR A;  5KSH A;  2EX9 A;  3CG5 A;  4Y2F A;  3LR3 A;  1FCN A;  1NYM A;  3P7N A;  2MJ6 A;  3C30 A;  5FQQ A;  4EU0 A;  1VM1 A;  3DTI A;  1QME A;  3IXB A;  3HLG A;  2Y2H A;  3PBQ A;  5HD3 A;  1DY6 A;  1IEL A;  5K5B A;  1GSV A;  3C4P A;  1H8M A;  3B33 A;  3GV9 A;  4DE1 A;  5FA7 A;  3QP1 A;  4ETZ A;  3Q81 A;  3CZD A;  3SZT A;  4JGR A;  4F3L A;  3HVF A;  2YKH A;  1OPX A;  4PKY A;  2VGL S;  5HDS A;  2Y2K A;  4KQR A;  1L0E A;  2EX2 A;  1MBL A;  1ES5 A;  3BJN A;  4DXB A;  5IU1 A;  1A0K A;  3UN7 A;  1G6O A;  4C3Q A;  2P9V B;  4Y13 A;  1K55 A;  1FOF A;  3DBA A;  5G4Y A;  5DTS A;  4JF5 A;  4UA6 A;  3FZC A;  2WGW A;  3IF5 A;  1ES2 A;  2G7U A;  3KSI A;  2L4R A;  3BEB A;  5AQB A;  3UB7 A;  1YMX A;  3NI9 A;  1YAX A;  4GCZ A;  2CC1 A;  4UAA A;  3A3F A;  3BFE A;  4KUK A;  4PM6 A;  5G18 A;  3VV4 A;  3IS2 A;  4E6W A;  3CHW P;  5KZH A;  2OLV A;  5J8X A;  1TS7 A;  3DAV A;  2W1T A;  3UPO A;  4WBG A;  3V67 A;  2B95 A;  3U4L P;  1N9L A;  4M4X A;  3ZNT A;  2D01 A;  1OT6 A;  4PMA A;  1H8Z A;  3MR0 A;  4R4R A;  5LBR A;  2P7J A;  2Y2I A;  3DW0 A;  3KYQ A;  1XFQ A;  1ERM A;  1PWD A;  4Y17 A;  4KG6 A;  1LSW A;  4FH4 A;  3N8S A;  2ZM0 A;  5JYO A;  1ESU A;  1NWZ A;  4Y3I A;  3VP1 A;  3NDE A;  4S2I A;  5HZH A;  1BT5 A;  2EX6 A;  4ID4 A;  4FUW A;  4GS9 B;  4DN0 A;  5HPI A;  3EGX C;  3VP4 A;  1E4D A;  1W63 Q;  1JWV A;  3R7W B;  3WRZ A;  5E2F A;  4O01 A;  2RCX A;  5CGW A;  1IEM A;  3ZG7 B;  4OOL A;  3G2Y A;  5KIZ A;  1JNU A;  3FKV A;  4N1H A;  5FI2 A;  3G35 A;  5G4Z A;  4YFM A;  3PXP A;  1M6K A;  1Z6F A;  2KDK A;  5EEC A;  5EM1 A;  2VJW A;  4X69 A;  2QPN A;  2UWX A;  2Z6D A;  4CLC B;  3TG9 A;  4S2L A;  5CXW A;  1GSW A;  4WUJ A;  1I5Q A;  1CEG A;  2JC7 A;  4E3M A;  4OQG A;  3M2J A;  2ZMA A;  1ZC2 A;  4Q0J A;  4IUH A;  1IYS A;  1KE3 A;  5IS1 A;  4OOY A;  4GJ4 A;  3T4O A;  5CHJ A;  2XLN A;  1XXM A;  1NZO A;  3KO6 A;  3OPL A;  4DDS A;  1S66 L;  3D3O A;  3ZYT A;  2J8Y A;  1OTI A;  4UQI M;  4DJ3 A;  3BLM A;  4LEN A;  4MBF A;  2WKE A;  3S7Q A;  4WLA A;  1UWN X;  1LT0 A;  3WS2 A;  2P04 A;  2ZC6 B;  1K54 C;  2OV5 A;  3E2L A;  2PD8 A;  4Q0H A;  4HP9 A;  3ZQ5 A;  1JWP A;  2JBF A;  1AWI A;  4ZJ2 A;  2JKT I;  1D1J A;  4LCL A;  1GHP A;  4GS9 A;  4UHU A;  5L07 A;  3T4S A;  4ZDX A;  3MXS A;  5EUA A;  3R7W A;  4MBK A;  1PYY A;  1BLH A;  4QWO A;  2PT7 A;  5A93 A;  3VOZ A;  2HDU A;  3MKF A;  5C5K A;  4FCF A;  4LCM A;  3F1P B;  4GW9 A;  2RL3 A;  1G28 A;  4RVA A;  4BWI A;  2W0N A;  4C75 A;  1K54 A;  1PW1 A;  1PIO A;  3OPP A;  4X6T A;  5DKK A;  3VMA A;  1O7E A;  5TGF A;  2WGV A;  5AQ7 A;  4NXG A;  4EEU A;  1KDS A;  2M7V A;  2ZQ9 A;  3S1Y A;  2XFT A;  4JF4 A;  2XD5 A;  4MEZ A;  3FC7 A;  1XJ4 A;  4E6X A;  2H10 A;  3VP3 A;  2J9P A;  3T4L A;  4MDZ A;  4Q0I A;  3BWL A;  4EW7 A;  4NXF A;  4CPK A;  4KG5 A;  4R4S A;  3SH8 A;  4OQ0 A;  3V3S A;  3T4Q A;  1J3W A;  4OPR A;  4DJ2 A;  4O7D A;  5J4E A;  3MQ0 A;  3BRM A;  1FQG A;  3A3J A;  3TE8 A;  1WA9 A;  2A49 A;  5CGX A;  2Y55 A;  3DWZ A;  1DP6 A;  1CF0 A;  2XDM A;  3IHB A;  3PYP A;  4R6L A;  1G68 A;  3NIA A;  2WAD A;  4G3V A;  4HH2 A;  2QJ5 A;  2ZOH A;  3O88 A;  2ZC3 B;  4RX3 A;  3PBS A;  2EX8 A;  4OP5 A;  3KSG A;  2H5S A;  1IKI A;  4DE2 A;  5AVF A;  2I72 A;  1PZO A;  2ZMF A;  4JGQ A;  1D7E A;  1ES3 A;  5DJU A;  5CEB A;  4NXE A;  2HDQ A;  3JVV A;  4RQ9 A;  1Y28 A;  4E3L A;  2PBY A;  2UV0 E;  1MC0 A;  3NBL A;  3EQV A;  4QU3 A;  3CJM A;  2Y8H A;  1STZ A;  5E2H A;  3PBR A;  1IOU A;  3Q7Z A;  3LIC A;  3P09 A;  1JVJ A;  4OKP A;  3MZF A;  1OTA A;  3T1Q B;  1NRF A;  3AGD A;  1L0G A;  4PHT A;  1F2K A;  5AQA A;  4LV1 A;  3MFD A;  1NLY A;  5EFW A;  3RH8 B;  2V8C A;  4CJN A;  5HDC A;  4X53 A;  3A3I A;  2L0W A;  4EBP A;  1KGG A;  2VX8 A;  3LR4 A;  3GVB A;  2WKQ A;  2LB5 A;  3LGO A;  3G31 A;  4PAU A;  3E4P A;  3ZG9 B;  4ARZ B;  1V9Y A;  3C8C A;  4NXB A;  3IXD A;  4JGP A;  5HFO A;  5IT5 A;  3BFD A;  5CHM A;  1E3U A;  2JKF A;  3ZG8 B;  2PU4 A;  1FCO A;  3IXH A;  2Z2L B;  1SDE A;  1XA1 A;  4K0X A;  1DJA A;  2Z2M B;  2ZQC A;  2YKF A;  2HP5 A;  1IKG A;  3D4F A;  3KYE A;  4EEP A;  4KZ3 A;  2X01 A;  1N9N A;  5GHZ A;  2LB9 A;  4CLC D;  5DTT A;  1DP8 A;  1I2S A;  1LL8 A;  4EET B;  3IX4 A;  2XRO A;  5EM0 A;  3GMW A;  3G34 A;  3BFF A;  3NDG A;  5A8B A;  1WE4 A;  4N1X A;  2WGI A;  4R3A A;  4OPY A;  1DP9 A;  4LRZ E;  1JWZ A;  1TS8 A;  4BMW A;  3MFX A;  4DE3 A;  1H3Q A;  2Y2N A;  4HI4 A;  5E43 A;  2VZW A;  2XEP A;  4GD8 A;  1NY0 A;  3HUO A;  4X68 A;  2EWW A;  1GCE A;  1MXO A;  4NG2 A;  1S1Z A;  3A3D A;  3ICY A;  4OON A;  2K31 A;  1BLC A;  5F69 A;  2E8J A;  2R78 A;  4WZ4 A;  4IVK A;  1W5D A;  4DDY A;  2PU2 A;  3HCY A;  2XFS A;  4G3K A;  4GOG A;  1FR1 A;  1H8Y A;  2DRW A;  3LFV A;  4PKY G;  5AJG A;  2DMW A;  4F94 A;  3KSH A;  3BLS A;  3NY4 A;  4C6Y A;  4I3I A;  3T1R A;  1TEM A;  1OTE A;  4PPR A;  3G32 A;  4Z1W A;  3LID A;  4RYE A;  3SW1 A;  2EWV A;  1FSY A;  3OZH A;  5FEG A;  1PRQ A;  4IBX A;  2WKP A;  4Y5F A;  3ITB A;  3ZFZ A;  4OLD A;  1YMS A;  3NOP C;  4QB8 A;  2PAV P;  3OCL A;  2W3H A;  4L9G A;  4ARZ A;  2V0U A;  5FSR A;  2O0Y A;  4L9E A;  3GEC A;  1W7F A;  1S4S A;  2KOI A;  1P0Z A;  2VV8 A;  1K4F A;  2J9O A;  4RA7 A;  1ZG6 A;  4QHC A;  2PYR A;  1Z09 A;  4KZB A;  4ZRR A;  4MMN A;  4EV4 A;  4LLO B;  3T1X A;  1MWU A;  3ZG5 A;  4N92 A;  3N4I A; 
#chains in the Genus database with same CATH homology
 1NJ4 A;  2FFY A;  4Q8I A;  3VP4 A;  1E4D A;  4P87 A;  5EVI A;  3SS3 A;  1BZA A;  1JWV A;  3WRZ A;  3HUN A;  2Y2J A;  1K55 C;  2ZC5 B;  5E2F A;  2RCX A;  5CGW A;  1IEM A;  3ZG7 B;  4OOL A;  2B5R A;  3G2Y A;  5FQK A;  3FKV A;  1ESI A;  4N1H A;  4DRT A;  5FI2 A;  1YLZ A;  2Y2O A;  5F1G A;  4JLF A;  3W4P A;  3N8L A;  3G35 A;  4Y0T A;  5HW3 A;  4KZ5 A;  4YFM A;  3HLD A;  1M6K A;  1Z6F A;  3UDX A;  5EEC A;  3IWI A;  5KSC A;  2OSU A;  4LV3 A;  4X69 A;  2QPN A;  2UWX A;  3ZG0 A;  1S0W A;  4JBF A;  2X71 A;  1ONH A;  2ZLY A;  3UPN A;  2WZX A;  4LV2 A;  4NK3 A;  1GHM A;  1YT4 A;  1XX2 A;  3IQA A;  4P85 A;  3HLW A;  3Q7V A;  1ZKJ A;  3TG9 A;  5M18 A;  3WS1 A;  4OQI A;  2R9W A;  4S2L A;  5CXW A;  3SS4 A;  2HDS A;  3WS5 A;  3ZVW A;  1CI9 A;  2J7V A;  2R9X A;  1XPB A;  3VP0 A;  4BJP A;  3N7W A;  4BD1 A;  1AXB A;  1S6R A;  1I5Q A;  3UDI A;  1EI5 A;  3ZVT A;  2XR0 A;  1E3U D;  3ZNY A;  1CEG A;  2JC7 A;  1CI8 A;  1MWT A;  3AGE A;  4S2N A;  4E3M A;  5DF8 A;  5AQ9 A;  4OQG A;  2EFX A;  3M2J A;  5FQM A;  2ZMA A;  3OPH A;  1ZC2 A;  5GLB A;  1GA0 A;  4JKT A;  4WEJ A;  1LLB A;  3AGF A;  1IYS A;  1YLW A;  1KE3 A;  3IF6 C;  3QNB A;  2DCF A;  1IYP A;  5EVL A;  5FQ9 A;  3UE0 A;  3VP2 A;  5HAQ A;  4BL2 A;  5CTM A;  4OOY A;  2DNS A;  3A3E A;  1RGY A;  3WRT A;  4EBL A;  5CHJ A;  2XLN A;  1CEF A;  3C7U A;  4IED A;  4QY6 A;  5HAR A;  3SH7 A;  2ZM2 A;  1XXM A;  3BEC A;  5GHY A;  2G2W A;  4HEF A;  1NZO A;  3OPL A;  4U3T A;  1BTL A;  4DDS A;  4EBN A;  1LHY A;  5F83 A;  2EXA A;  5CED A;  1EWZ A;  4PM7 A;  4KZ9 A;  2J8Y A;  4ZJ1 A;  5A90 A;  2Y2P A;  1GHI A;  3M6H A;  1PW8 A;  4N9K A;  3BLM A;  4LEN A;  4MBF A;  3W4O A;  4KZA A;  2WKE A;  2ZQ8 A;  4GNU A;  2WKH A;  3WS2 A;  3BYD A;  2ZC6 B;  5FAS A;  1K54 C;  2OV5 A;  3E2L A;  3HLC A;  3MZE A;  1N4O A;  3IF6 A;  5E2G A;  4B88 A;  5A91 A;  4WEK A;  4S2P A;  1JWP A;  2JBF A;  2V20 A;  3PTE A;  4QY5 A;  3SH9 A;  4ZJ2 A;  3TSG A;  5CGS A;  1RP5 A;  3I7J A;  4GDN A;  1LI0 A;  1NZU A;  3FWL A;  1GHP A;  3O86 A;  4LCL A;  2WGW B;  5L2F A;  4UHU A;  2X02 A;  4ZDX A;  3MXS A;  5EOE A;  5EUA A;  4QD4 A;  4HBU A;  3GRJ A;  1KE4 A;  1YLT A;  3BFG A;  2ZM8 A;  4HES A;  1PYY A;  2Y91 A;  4MBK A;  2HP6 A;  4UA7 A;  1Y54 A;  1BLH A;  3RXX A;  1VQQ A;  3E2K A;  3Q07 A;  1HVB A;  4FD8 A;  5FQJ A;  5A93 A;  4E3N A;  1MKI A;  3VOZ A;  2HDU A;  1MWR A;  3HL9 A;  2Y4A A;  1FR6 A;  3MKF A;  2FFF B;  4PM8 A;  4FCF A;  1ONG A;  1WYC A;  4LCM A;  4LV0 A;  1U60 A;  1GA9 A;  1WYB A;  4KZ7 A;  2RL3 A;  4RVA A;  4OVD A;  1YLJ A;  4KQO A;  3UPP A;  1PWG A;  4S2K A;  4C75 A;  1K54 A;  1K4E A;  1PW1 A;  4EQI A;  4WMC A;  5TR7 A;  2WAE A;  3IH9 A;  4MLL A;  4QJG A;  5HAP A;  3HLF A;  3G30 A;  1PIO A;  1KDW A;  4KZ8 A;  3CMZ A;  2JE5 A;  3OPP A;  4P6B A;  1K25 A;  1KVM A;  1QMF A;  4OQH A;  4X6T A;  3VMA A;  2WZZ A;  1O7E A;  3MBZ A;  5TGF A;  5U47 A;  1K56 D;  2WGV A;  3IHA A;  5AQ7 A;  1KE0 A;  2XH9 A;  1NYY A;  2IWC A;  2P74 A;  4H8R A;  3WS4 A;  1KDS A;  4M3K A;  1JTD A;  4WEL A;  5FDH A;  1XGJ A;  3FYZ A;  2P9V A;  3IWQ A;  2ZQ9 A;  3S1Y A;  2XFT A;  2A3U A;  3O3V A;  4YIN A;  1LL9 A;  3DWK A;  4JF4 A;  1BLP A;  2QZ6 A;  2XD5 A;  4R3B A;  4KEN B;  3GR2 A;  4MEZ A;  5A92 A;  4E6X A;  2H10 A;  3VP3 A;  1BUE A;  2J9P A;  4K91 A;  1YLY A;  1BLS A;  1NXY A;  3S22 A;  2E8I A;  2XK1 A;  3FKW A;  1L0F A;  3NCK A;  4CPK A;  1J9M A;  1ES4 A;  1OME A;  2Y59 A;  4KG5 A;  4R4S A;  4GD6 A;  1C3B A;  2XQZ A;  2HPB A;  3IT9 A;  5EVI D;  2ZQD A;  3SH8 A;  3OC2 A;  3ZCZ A;  3M6B A;  4JXG A;  1BSG A;  4OQ0 A;  1O07 A;  5GLC A;  1KGE A;  1DJC A;  3V3S A;  4GKU A;  5GLA A;  3UO9 A;  2ZD8 A;  4OPR A;  3N6I A;  4XUZ A;  5HL1 A;  5FAO A;  1TDG A;  3ZDJ A;  4O7D A;  3BRM A;  1FQG A;  3A3J A;  1TDL A;  3G2Z A;  1IYQ A;  4S2M A;  4JF6 A;  4WYY A;  4BL3 A;  2A49 A;  4OP8 A;  5F1F A;  5CGX A;  3PAE A;  2Y55 A;  3IWO A;  3W4Q A;  5HAI A;  4ZTK A;  3DWZ A;  2ZJ9 A;  2XDM A;  1SCW A;  4FSF A;  3IHB A;  2XF3 A;  3PBT A;  1Q2Q A;  2OLU A;  3QNC A;  1G68 A;  3NIA A;  2ZQA A;  2WAD A;  2WK0 A;  1YM1 A;  5M1A A;  3PBN A;  3UY6 A;  4R0Q A;  3O88 A;  4ZBE A;  2ZC3 B;  4RX3 A;  3PBS A;  3VFH A;  4BD0 A;  1LI9 A;  4PM5 A;  2EX8 A;  3HLB A;  4OP5 A;  5CER A;  1JTG A;  3UE3 A;  4JPM A;  2H5S A;  1IKI A;  1FSW A;  3LEZ A;  4IVI A;  4DE2 A;  4IBR A;  4X56 A;  2I72 A;  1PZO A;  2WYX A;  3LY4 A;  1PZP A;  4R3J A;  5KMW A;  4DF6 A;  1ES3 A;  2ZQ7 A;  1ERQ A;  4BLM A;  4P0M A;  5FQI A;  5CEB A;  1RGZ A;  1KGF A;  3G4P A;  3UNW A;  2HDQ A;  4E3L A;  1DJB A;  2Y2L A;  3HBR A;  2PBY A;  3HRE A;  3IH8 A;  3NBL A;  1M40 A;  1XP4 A;  3EQV A;  4QU3 A;  2BLS A;  3VFF A;  2C6W B;  1SHV A;  2Q9N A;  3BFC A;  3CJM A;  5GHX A;  1W8Q A;  4L0L A;  4KG2 A;  5E2H A;  3WWX A;  3NC8 A;  2V1Z A;  4WZ5 C;  2XGN A;  3OPR A;  1K6S A;  2WKI A;  3MXR A;  3GSG A;  3PBR A;  1IYO A;  4GZB A;  3ZGA B;  3Q7Z A;  2WUQ A;  4GDB A;  3BM6 A;  3P09 A;  5JYP A;  3RJU A;  2C5W B;  4KQQ A;  1JVJ A;  3MKE A;  1BUL A;  3PBO A;  4OKP A;  4RX2 A;  3MZF A;  3C5A A;  5CTN A;  2VGK A;  4DE0 A;  3LY3 A;  1NRF A;  3FV7 A;  3AGD A;  1L0G A;  3TOI A;  3JYI A;  4K0W A;  4B4X A;  5AQA A;  4LV1 A;  1ALQ A;  3PAG A;  3ZHH A;  3MFD A;  1Q2P A;  1XGI A;  5HX9 A;  4E3I A;  1FCM A;  1PWC A;  2EXB A;  3C4O A;  3HUM A;  2IWD A;  2HDR A;  3Q82 A;  4CJN A;  2H0T A;  4X53 A;  5KSH A;  2Y2G A;  3A3I A;  2EX9 A;  5D3O A;  3CG5 A;  4JXV A;  1L0D A;  4EBP A;  4Z9Q A;  1FCN A;  1KGG A;  1NYM A;  3GVB A;  2HP9 A;  5FQQ A;  1K6R A;  3B3X A;  1VM1 A;  3G31 A;  3GTC A;  1QME A;  3ZG9 B;  3IXB A;  4JXS A;  3LO7 A;  4XUX A;  3HLG A;  2Y2H A;  3PBQ A;  4WZ5 A;  1DY6 A;  3IXD A;  5HFO A;  3BFD A;  1IEL A;  5CHM A;  4EWF A;  1E3U A;  5CEC A;  3ZG8 B;  3EQU A;  2PU4 A;  2ZC4 B;  1FCO A;  2JCH A;  3GQZ A;  3IXH A;  2Z2L B;  5EOO A;  4ZAM A;  1L2S A;  4JXW A;  4D2O A;  3C4P A;  1SDE A;  3GV9 A;  4DE1 A;  4KZ6 A;  1XA1 A;  4GN2 A;  4K0X A;  3UE1 A;  5FA7 A;  1DJA A;  1HTZ A;  2Z2M B;  2ZQC A;  3HLE A;  2HP5 A;  2Q9M A;  1IKG A;  3D4F A;  4N9L A;  1SKF A;  3VSK A;  3Q81 A;  3CZD A;  4KZ3 A;  2X01 A;  4OLG A;  5GHZ A;  1W8Y A;  5DTT A;  3C7V A;  1I2S A;  3O87 A;  3DTM A;  4WMC D;  3VSL A;  3HVF A;  3V50 A;  5EVI B;  4HBT A;  2Y2K A;  4PM9 A;  3WS0 A;  3GMW A;  3QHY A;  4A5R A;  5FAQ A;  3G34 A;  4KQR A;  4EUZ A;  1L0E A;  3BFF A;  3NDG A;  2EX2 A;  5EPH A;  1WE4 A;  4N1X A;  2WGI A;  4OPY A;  1E25 A;  1PI4 A;  5FI6 A;  4UA9 A;  4DKI A;  1MBL A;  3V5M A;  1CK3 A;  5F82 A;  1RCJ A;  1ES5 A;  1K57 C;  1HZO A;  4DXB A;  2BG1 A;  4OPQ A;  1JWZ A;  1YQS A;  3UN7 A;  2XD1 A;  1TVF A;  4DE3 A;  3VOY A;  3MZD A;  4C3Q A;  2Y2N A;  2P9V B;  4U0T A;  5E43 A;  2XEP A;  1K55 A;  1NY0 A;  3N8R A;  3OCN A;  4GD8 A;  3HUO A;  1FOF A;  1H5X A;  4Y0O A;  4X68 A;  4B4Z A;  3Q7V B;  5DTS A;  4GB7 A;  4JF5 A;  1GCE A;  1G6A A;  1MPL A;  1MXO A;  4DXC A;  4UA6 A;  3FZC A;  3A3D A;  2WGW A;  3IF5 A;  3IXG A;  5GL9 A;  4OON A;  1BLC A;  4WZ4 A;  4IVK A;  3S4X A;  1W5D A;  4DDY A;  1ES2 A;  2PU2 A;  5E2E A;  2WAF A;  2XFS A;  1N9B A;  4E3J A;  3BEB A;  2IWB A;  1SDN A;  4ZJ3 A;  5IHV A;  5AQB A;  4GOG A;  1FR1 A;  1YMX A;  1H8Y A;  1ZG4 A;  2ZC7 A;  3NI9 A;  2DRW A;  4Y7P A;  2CC1 A;  4OPZ A;  4F94 A;  4MNR A;  4UAA A;  1HD8 A;  4FH2 A;  3A3F A;  3ITA A;  5DVA A;  3V39 A;  5FI7 A;  3BFE A;  4XXR A;  1KVL A;  3BLS A;  3NY4 A;  4PM6 A;  1K38 A;  4C6Y A;  1TEM A;  5G18 A;  4PPR A;  1ERO A;  3G32 A;  4WM9 A;  5DF7 A;  4E6W A;  2Y2Q A;  5KZH A;  1K57 A;  1PI5 A;  2OLV A;  5J8X A;  2EFU A;  3UDF A;  2V2F F;  4BEN A;  2Y2M A;  4RYE A;  3RXW A;  3SOI A;  4OOM A;  3LCE A;  5M19 A;  1FSY A;  3OZH A;  1MY8 A;  5EVI C;  3UPO A;  4IBX A;  4WBG A;  1YLP A;  4X55 A;  3ITB A;  5FAP A;  4E3K A;  3M2K A;  3ZFZ A;  4OLD A;  1YMS A;  5TFQ A;  2GDN A;  3P98 A;  3V3R A;  4QB8 A;  3OCL A;  5DTK A;  5EE8 A;  3ZNT A;  4BQM A;  4Y0U A;  5FSR A;  4PMA A;  4R23 A;  1H8Z A;  1W7F A;  4R4R A;  5I94 A;  1K56 A;  4R1G A;  2QMI A;  2Y2I A;  3DW0 A;  4S2O A;  3Q1F A;  1MWS A;  4U0X A;  5CRF A;  1I2W A;  1XA7 A;  1XKZ A;  1K4F A;  2J9O A;  5DF9 A;  1ERM A;  5CHU A;  2VGJ A;  4RA7 A;  1PWD A;  1ZG6 A;  4QHC A;  4KG6 A;  4E3O A;  4FH4 A;  3N8S A;  3SS5 A;  4KZB A;  1LL5 A;  3IF6 B;  3W8K A;  2ZM0 A;  5JYO A;  2H0Y A;  1ESU A;  5FAT A;  4S2J A;  3VP1 A;  3NDE A;  4EV4 A;  4S2I A;  1W79 A;  4KZ4 A;  2G2U A;  1BT5 A;  1MWU A;  2EX6 A;  5BOH A;  4MBH A;  4ID4 A;  5GLD A;  4OH0 A;  4NET A;  3ZG5 A;  4N92 A;  3ISG A;  3N4I A;  4S2N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...