4N9KA

Crystal structure of beta-lactamse penp_e166s in complex with cephaloridine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n9kA00
1M6KA 2Y2QA 4KQRA 3W4PA 5CGXA 3UE3A 2XR0A 4ZDXA 4WEKA 4ZJ3A 1MY8A 4OPZA 1LL9A 1L0GA 1YLWA 1WYBA 4MNRA 2ZC3B 3BM6A 2Z2MB 4P0MA 1DJBA 2BG1A 3S4XA 3EQUA 3VP4A 3IF6B 3MKFA 4OLDA 3EQVA 3G30A 4DKIA 4WELA 3GSGA 5HX9A 1XGIA 3UN7A 2WGIA 4JXGA 1XGJA 2H0YA 3IT9A 5DTKA 4Y0TA 5M18A 3CMZA 2PBYA 1W7FA 5FAOA 2OSUA 5FATA 4X6TA 5L2FA 1K57A 3UPPA 4BQMA 3JYIA 3C7VA 4OKPA 5GHXA 5HAIA 1HTZA 5GL9A 1H8YA 4JXSA 1CI8A 3C7UA 4EBNA 2Y2MA 3OPLA 1IYPA 2WGVA 5A91A 3UO9A 4KZAA 3PBOA 1PWDA 2EXBA 3NC8A 4WZ5C 1KGGA 4E3JA 4S2MA 5JYOA 2Y59A 3IWQA 4KG2A 3AGDA 4PM7A 3FKWA 4R0QA 3WWXA 2XQZA 4KZ7A 5EE8A 2XDMA 4DE1A 5EUAA 2B5RA 2V20A 3LY4A 2XH9A 5HARA 4DXCA 2XFSA 3I7JA 5DF9A 1XA7A 4BL3A 4GB7A 4IBRA 4C3QA 1K55C 5M1AA 3IHBA 3OC2A 1FCOA 1U60A 3Q1FA 2G2UA 4P85A 3ITBA 2JC7A 4E6XA 2JE5A 3MZFA 1YLPA 4UA7A 3IWOA 2Y2NA 3RXWA 1FSYA 2J7VA 3FYZA 3GR2A 4S2IA 5TGFA 3RXXA 4N1HA 4RA7A 4FH2A 3A3IA 3IH8A 4JKTA 1KGFA 1EROA 1W8YA 4KQQA 3PAGA 2P9VA 4QY6A 2WZXA 2R9WA 5KMWA 2C6WB 1WE4A 3G31A 1IYOA 3FWLA 4MEZA 1L0EA 3M6HA 4OQHA 4R3BA 4IEDA 1CEFA 5E43A 2XD1A 2Y55A 4JLFA 2HP9A 5TFQA 3LY3A 3ZGAB 1PI5A 2PU2A 5DF7A 1J9MA 1MWRA 2EX6A 4EBPA 1ZC2A 3NDGA 4M3KA 5A92A 2P9VB 3QNCA 3O88A 2WYXA 2V2FF 4K0WA 3TOIA 5F83A 3ZFZA 3N8LA 3QHYA 1W8QA 3SH8A 3UE0A 1MBLA 2CC1A 3IWIA 1RGZA 3NCKA 3MZEA 3VFFA 4KZ8A 4EV4A 2HP5A 4ZAMA 4FSFA 1PYYA 4QHCA 4S2NA 5M19A 3PBSA 4FH4A 4HESA 1L0FA 3HLFA 5U47A 4C6YA 5E2GA 1S6RA 1JWPA 3G2ZA 2ZQ7A 4WM9A 1GA9A 1E25A 4BENA 4P87A 2DRWA 1YLZA 3G2YA 4GDBA 4IVIA 4E3LA 4WMCD 1HZOA 5FAQA 2Y91A 3GV9A 3HLGA 3NBLA 3ZG0A 3GTCA 1LHYA 5EPHA 1MWSA 2JBFA 3CG5A 4N9KA 1KE0A 1S0WA 2IWDA 3D4FA 5FQQA 3IQAA 3M2JA 1SKFA 2HDSA 3ITAA 4MBHA 4R3JA 1K4EA 5GLDA 3IF6A 4R23A 1NY0A 4K91A 1QMFA 4H8RA 4UHUA 1PWGA 2J9PA 1ERMA 1K57C 4S2PA 3IHAA 2WZZA 2Y2KA 4RVAA 3G35A 2ZC5B 2ZLYA 5FDHA 5GHZA 4WYYA 1FR1A 4BL2A 4PM8A 3Q7VB 2QZ6A 5CGSA 3PBNA 2A3UA 1FCNA 4OQIA 3HLDA 3A3JA 3MXRA 3LCEA 3BLSA 5FSRA 5FQKA 4WBGA 3IXBA 2X02A 4JF4A 3SOIA 5EECA 5FAPA 4DXBA 5HFOA 2Y2OA 5EOEA 2XF3A 5F1FA 3Q7ZA 5DTSA 1RP5A 4HBTA 5JYPA 3DWKA 4Y0OA 1YT4A 2Y2GA 4EWFA 3HUOA 2IWBA 1PW8A 4DRTA 3BFDA 1ZKJA 4Q8IA 4QJGA 2J9OA 4B4XA 4RYEA 4BD0A 4DE0A 1EWZA 1JWVA 4ZTKA 3HLEA 1BTLA 1PZPA 2OLUA 5TR7A 1YLYA 1G68A 3PAEA 1O07A 4HBUA 4KG5A 1EI5A 3FZCA 4XUZA 2XD5A 4JF6A 3ZG8B 2QPNA 4N92A 1ONGA 4P6BA 1Q2PA 2ZC4B 3M2KA 4QB8A 3N7WA 1GHMA 4Z9QA 3DTMA 2G2WA 1IYSA 2HPBA 3N6IA 1BULA 5EVLA 2E8IA 4E3KA 2VGKA 2Q9NA 1IYQA 2WUQA 4QU3A 4A5RA 1AXBA 5CHJA 5EVIA 4OPYA 4EUZA 2ZJ9A 3VP0A 1PIOA 2XFTA 1ES5A 1XA1A 3WS1A 1K56D 5FQJA 4WMCA 3NI9A 5DF8A 1XKZA 4PM6A 1ALQA 5D3OA 5CTMA 3OPPA 3BFEA 4KZ5A 2P74A 3DWZA 1QMEA 4DDSA 2GDNA 3V3RA 2Y2HA 3NIAA 1C3BA 4DDYA 3BLMA 4R4RA 4DF6A 3UPOA 2FFYA 2ZC6B 3LO7A 2XLNA 2ZD8A 4JXWA 3GQZA 4LCMA 3WS5A 1ES4A 2H0TA 4NK3A 3C4PA 5EVIB 3P98A 4LV3A 1M40A 1BLCA 3MKEA 4S2NC 4BJPA 1BLHA 3IF5A 2XK1A 3VFHA 2WGWA 2XEPA 5DTTA 2RL3A 5GLCA 5CEBA 4C75A 1K54A 3TG9A 2Y2JA 2VGJA 1KE4A 1BT5A 3HREA 3WS0A 2A49A 3HBRA 3UNWA 5EOOA 1PZOA 5CHMA 5FA7A 4OP5A 5KZHA 4OONA 3ZCZA 3UY6A 5GLBA 1NJ4A 1MPLA 1Y54A 3M6BA 4GN2A 1XXMA 1E4DA 2BLSA 3SS5A 1G6AA 5F1GA 3VP1A 4GD8A 4S2KA 1YLJA 4LCLA 2WGWB 2QMIA 4DE3A 3PBTA 4FCFA 5FASA 3A3FA 4OH0A 2HP6A 1SCWA 3P09A 4OPQA 3IF6C 3WRZA 4KZ6A 3MZDA 3SS4A 1L2SA 4U3TA 5EVID 4DE2A 3BEBA 4JXVA 2ZQAA 1W79A 1PW1A 1I5QA 4IBXA 4PMAA 2Y2PA 4KZ3A 5AQ7A 3NY4A 4MBFA 1NZUA 2UWXA 3GRJA 4WZ4A 3C5AA 2Z2LB 4GZBA 4U0TA 1H5XA 4OQ0A 1K25A 3Q7VA 4OP8A 3BYDA 4RX3A 5A93A 1MWTA 1LLBA 4BLMA 4EQIA 3Q82A 1YMSA 3BFGA 3UPNA 1GCEA 3CJMA 3HLWA 3ZVTA 2JCHA 3N4IA 4ZJ1A 3G34A 1I2SA 5HW3A 3UDXA 3PBQA 1FQGA 5E2FA 3IXHA 1JVJA 4E3MA 5CECA 4KENB 4MLLA 4JPMA 4K0XA 4LENA 3ISGA 4UA9A 3WRTA 4D2OA 3N8SA 2FFFB 1FOFA 3HL9A 4RX2A 1IKIA 1SDEA 1VM1A 1IKGA 4LV0A 2OLVA 4YINA 5GLAA 4CPKA 3BRMA 1K56A 4GD6A 3ZVWA 4GKUA 2Y4AA 1ERQA 3ZDJA 4BD1A 3VOYA 2EXAA 4Y7PA 4S2LA 3RJUA 1TEMA 1ES3A 5J8XA 2XGNA 3G32A 4KZBA 1DY6A 4S2JA 4OQGA 5G18A 4OVDA 3SS3A 5HAPA 1W5DA 3E2LA 4WEJA 1RCJA 3V39A 1K38A 4JF5A 4XXRA 3VP3A 1Q2QA 3W4QA 3MBZA 4F94A 3Q81A 4GDNA 3W8KA 1FCMA 3HLBA 3O3VA 5HL1A 1YQSA 1KDSA 2HDUA 2WK0A 3SH9A 2WAEA 2IWCA 4GOGA 3CZDA 1NRFA 2ZQCA 4L0LA 5EVIC 1JWZA 3VMAA 4EBLA 5HAQA 1E3UD 3MXSA 3HVFA 5CERA 1N4OA 2R9XA 1NXYA 2J8YA 4X53A 5AQBA 4B4ZA 3IXDA 4KZ4A 5BOHA 5KSCA 1ONHA 5AQ9A 1LI0A 5FQ9A 3IH9A 1MXOA 3V5MA 1CEGA 4OOMA 2OV5A 4X55A 3GMWA 1YLTA 3OCLA 2RCXA 3OPHA 1O7EA 4QD4A 4KQOA 2ZM2A 5CTNA 1MWUA 5CRFA 2WKEA 3Q07A 4PM5A 3AGEA 1Z6FA 3BFFA 4YFMA 1SHVA 4UA6A 2WKIA 1BUEA 1TDLA 3E2KA 3HUMA 4PPRA 3SH7A 3S1YA 3UDFA 3MFDA 3ZG9B 1K6RA 1NZOA 3FV7A 2Y2LA 1DJAA 1K54C 1KVMA 3NDEA 2PU4A 3A3DA 3N8RA 3ZG7B 1OMEA 2EX2A 2I72A 4ZBEA 3S22A 1ESUA 3V3SA 1N9BA 5F82A 2Q9MA 1I2WA 2EX8A 1KVLA 4OOLA 1FSWA 4CJNA 3ZNTA 3IXGA 3WS4A 1VQQA 2HDQA 3O87A 5FI6A 3FKVA 1XX2A 4X69A 2WAFA 5FI2A 1XP4A 2ZC7A 1BLSA 2ZQ8A 4S2OA 5E2EA 3ZNYA 3A3EA 4N1XA 4X68A 3ZHHA 4WZ5A 1NYYA 2EFXA 4OPRA 3BFCA 2WKHA 4U0XA 5CXWA 2ZQDA 5IHVA 5AQAA 1TVFA 4KG6A 5E2HA 3G4PA 1JTDA 4E3NA 4R4SA 1PWCA 3HLCA 3OZHA 1IELA 3LEZA 1JTGA 4Y0UA 3VSLA 5CEDA 1FR6A 1RGYA 4HEFA 4X56A 1K55A 1K4FA 1BZAA 1KE3A 2H5SA 4LV2A 2X01A 1SDNA 5FI7A 2EFUA 2X71A 1CK3A 1HD8A 4ID4A 5FQMA 3HUNA 3PTEA 4O7DA 4R1GA 2DCFA 2ZMAA 1ES2A 2HDRA 4JBFA 5FQIA 3TSGA 4OOYA 3QNBA 1BSGA 1L0DA 4GNUA 4PM9A 3AGFA 5CGWA 3UDIA 3C4OA 1TDGA 1E3UA 2C5WB 3V50A 1K6SA 1GHPA 1MKIA 1NYMA 2ZM8A 1GHIA 5GHYA 4ZJ2A 5A90A 3VSKA 1LI9A 3OCNA 1HVBA 1GA0A 1KDWA 1XPBA 4FD8A 5DVAA 1CI9A 4N9LA 4NETA 4E3IA 1WYCA 1ESIA 3UE1A 3ZG5A 1H8ZA 2ZM0A 1LL5A 2WADA 3BECA 1DJCA 4OLGA 4XUXA 3VP2A 1BLPA 3W4OA 1PI4A 3WS2A 4MBKA 3GVBA 4KZ9A 3OPRA 4B88A 2DNSA 3DW0A 3PBRA 4E6WA 4UAAA 5I94A 2H10A 2Y2IA 1IEMA 5CHUA 2V1ZA 3O86A 5KSHA 4IVKA 1YM1A 4LV1A 2ZQ9A 1KGEA 3B3XA 1YMXA 4QY5A 4E3OA 3VOZA 2EX9A 1ZG6A 1ZG4A
chains in the Genus database with same CATH superfamily
3W4PA 4UEYA 5CGXA 1F98A 2XR0A 3CLOA 4ZDXA 1LL9A 1YLWA 4MNRA 3GDIA 1JNUA 2BG1A 3S4XA 3IF6B 3GSGA 5HX9A 3CAXA 3LIAA 2WGIA 4JXGA 5M18A 3CMZA 4WUJA 2OSUA 5FATA 4X6TA 3T4TA 5DJUA 2A24B 3A0SA 3C7UA 1ZHHB 3LR4A 4ARZA 1KGGA 4S2MA 3WWXA 3FKWA 2PYRA 2XQZA 4GJ4A 5AVEA 2ZMFA 3U4LP 5HARA 4R38A 4MN5A 5L09A 4BL3A 1OJGA 1FCOA 4WLAA 1Y28A 2PR6A 4E6XA 1YLPA 4X25A 2Y2NA 3RXWA 3GR2A 3RXXA 4QY6A 2C6WB 4HY8A 1IYOA 4OQHA 5HSQA 4EU0A 2O0YA 2WKPA 5IU1A 2Y55A 4EETB 4JLFA 1J3WA 4IUKA 4LGWA 3LY3A 3NDGA 3P01A 3DBAA 3O88A 3ZFZA 5F83A 3QHYA 3SH8A 1W8QA 1MBLA 2JKRM 2PAVP 2QWSA 5DFYA 4ZAMA 4S2NA 3E4OA 4HESA 2VEAA 5E2GA 2ZQ7A 4WM9A 4F3LB 1E25A 1HLUP 4GDBA 4IVIA 4LRXC 5FAQA 2G7UA 5EPHA 2JBFA 3DTKA 5J7EA 3ICYA 4NKPA 5K5BA 4MBHA 4R3JA 3IF6A 4R23A 1NY0A 1TS0A 2ZC5B 4EESA 1FR1A 4PM8A 2QZ6A 1FCNA 1NLZA 3HLDA 3LCEA 2X02A 3SOIA 3F1OB 1YKDA 5FAPA 2YKHA 5HFOA 1ODVA 2Y2OA 2BASA 1SKOB 3L9KA 3KSHA 2VJWA 4Y0OA 1YT4A 3NJAA 1ZKJA 4B4XA 3IBJA 1BTLA 5TR7A 1O07A 2K2NA 1EI5A 3ZG8B 3LIBA 3M2KA 4QB8A 1GHMA 1YSPA 3BY9A 2XRNA 5CX7A 2HGVA 1IYQA 1L3LA 4GHIB 4A5RA 1AXBA 4OPYA 1XA1A 3E4PA 1LSWA 4I38A 4PM6A 3T1SA 1OT9A 2Q0OA 1TD5A 4DDSA 4EQ1A 2L4RA 1T1CA 1C3BA 2ZC6B 4JXWA 5AVFA 4LV3A 1M40A 1NLYA 1BLCA 3P7NA 3E98A 1BLHA 3IF5A 2WGWA 3EGDC 3IX3A 2PD7A 4C75A 1S1ZA 2Y2JA 2VGJA 1KE4A 3DTEA 5EOOA 4Q0HA 3E4QA 3ZCZA 5HD5A 3M6BA 4GN2A 4P6ZS 3T4QA 3PYPA 1YLJA 3CPTB 1ZTUA 4FCFA 5FASA 3A3FA 1SCWA 4KZ6A 2EA9A 3SS4A 4DE2A 1Z09A 1W79A 4IBXA 1I5QA 4PMAA 4B93A 5AQ7A 2HV1A 3GRJA 4WZ4A 3QP8A 4GZBA 2PT7A 4U0TA 1H5XA 2JKGA 4OP8A 2YKFA 4BLMA 4EQIA 3Q82A 1YMSA 3HLWA 1GSVA 2W3GA 1TS7A 2D02A 5HW3A 1FQGA 5E2FA 3IXHA 4E3MA 4FTXA 2P08A 3ISGA 3LIEA 2FFFB 5MC7A 1IKIA 1SDEA 1IKGA 3BRMA 1F9IA 2Y4AA 4BD1A 4Y7PA 2JKTM 2VZWA 4JGQA 4OQGA 5HAPA 1TF1A 3E2LA 4JF5A 4XXRA 2M7VA 4F94A 1DP8A 3HLBA 3O3VA 4CLCA 1KDSA 3ZYTA 2HDUA 5DKKA 2PHYA 3LUQA 3VMAA 5HAQA 3MXSA 3HVFA 3OOVA 2R9XA 3VE3A 1NXYA 2J8YA 2XA7S 5TBMB 4KZ4A 2JHEA 4I3JA 1LI0A 2VV6A 4OOMA 2OV5A 3GMWA 5DJTA 2DMWA 2XSSA 4QD4A 2ZM2A 3K3CA 2L1MA 4PM5A 3PXPA 1SHVA 5FDSA 3HUMA 3UDFA 3S1YA 3MFDA 1NZOA 2Y2LA 2J3WA 3NDEA 3A3DA 3F1NB 3RTYA 3D3OA 3S22A 3H7WB 2M7UA 4CJNA 4O01A 3O87A 3KYQA 1XX2A 2QYBA 4S2OA 5E2EA 4N1XA 3ZHHA 4WZ5A 4EW7A 5IHVA 3S7OA 4E3NA 1PWCA 3VSLA 4JGRA 5CEDA 3V67A 5HWVA 5A8BA 3LIFA 1SDNA 5FI7A 1CK3A 5FQIA 1VEUA 4PM9A 4WF0A 1T1AA 3V50A 1GHPA 2ZM8A 1GHIA 5GHYA 4ZJ2A 5A90A 1GA0A 1KDWA 1G5UA 5DVAA 3UE1A 1LL5A 2WADA 3BECA 2W0NA 3LI8A 1PI4A 3WS2A 2LB5A 4II7A 3PBRA 2ACGA 5I94A 2H10A 1CF0A 4AFIA 1IEMA 2O9BA 1YM1A 4LV1A 2Z6CA 1KGEA 2B95A 4E3OA 4MN6A 1M6KA 3OLOA 2Y2QA 4KQRA 3UE3A 4HH2A 2J3TC 3KSIA 1MY8A 4OPZA 1L0GA 1V9YA 1WYBA 1T19A 3VP4A 3UB5P 1XGIA 5KIZA 5DTKA 1PNEA 1MKMA 2PBYA 5L2FA 1CJFA 2GNXA 2EWVA 3VE4A 4OKPA 1EW0A 5GL9A 1H8YA 2QKPA 3OPLA 1IYPA 5G4YA 2WGVA 1AWIA 5A91A 2PR5A 4K08A 1OJ5A 3PBOA 1A0KA 4R0QA 4PM7A 5EE8A 4DE1A 5EUAA 2V20A 5HDDA 2XH9A 4DXCA 5DF9A 4GB7A 5HDSA 1K55C 3TE8A 4ARZB 4P85A 4UA7A 3FYZA 5TGFA 4GS9A 2GZAA 4N1HA 4RA7A 4FH2A 4IHQA 3A3IA 3IH8A 3LEQA 1EROA 2P9VA 2WZXA 2R9WA 3G31A 1PRQA 4MEZA 1L0EA 4R3BA 4IEDA 1CEFA 5E43A 3C8CA 3DAVA 5TFQA 1PI5A 4WN5A 1J9MA 2J80A 4EBPA 3QNCA 2V2FF 4ESPA 4Q0JA 3NCKA 3MZEA 3VFFA 4KZ8A 3BY8A 2VV8A 2VA0A 2PD8A 4QHCA 5M19A 3PBSA 1S6RA 4MN7A 5F5YA 4E3LA 3KYZA 3T1RA 4NEED 4N9KA 4EEUA 1D1JA 4MMNA 1SKFA 1LSVA 3O5YA 2VX8A 4S2PA 1ERMA 1GSWA 3IHAA 2Y2KA 2ZOIA 3LR3A 3G35A 3IS2A 1V9ZA 5FDHA 3QP2A 3T1QB 5FSRA 3BW6A 2W3DA 1X0OA 5EOEA 3Q7ZA 5DTSA 2V1AA 2UV0E 4GW9A 4P6ZM 3HUOA 3BQAA 3TJZC 1XJ2A 4QJGA 1OTEA 1VETA 4DJ2A 5L10A 2ZBBA 5TJJA 2NUPC 1PZPA 3G6OA 4HBUA 1G68A 1S67L 3FZCA 2PDRA 4HJ4A 4P6BA 1ONGA 2VLGA 1Q2PA 3N7WA 4Z9QA 3DTMA 4B9OA 1D06A 2Q9NA 2Y8HA 1UWNX 4Y13A 3EWKA 3A0VA 3FPVA 3NECA 5D3OA 3OPPA 1F2KA 2P74A 2GDNA 4R70A 2Y2HA 5HDCA 3UPOA 4DF6A 2FFYA 3LO7A 2ZD8A 4DMZA 4NXBA 4S2NC 4BJPA 3VFHA 5GLCA 3MXQA 3HREA 3VV4A 3WS0A 3HBRA 5FA7A 5KZHA 3UY6A 5GLBA 1Y54A 1E4DA 2BLSA 4PHTA 5F1GA 4GD8A 4GLQA 2WGWB 4DE3A 2XA7M 2INWA 3PBTA 2HP6A 4OPQA 3IF6C 3MZDA 1L2SA 4U3TA 3UB9A 1S66L 2Y2PA 3NY4A 3C5AA 3KSFA 4OQ0A 1K25A 4LRZE 3C30A 1GCEA 3CJMA 2JCHA 3EOIA 4ZJ1A 3UDXA 3BQ8A 4LENA 5DKLA 4D2OA 1FOFA 3HL9A 1VM1A 2OLVA 3CITA 4CPKA 4GD6A 3ZVWA 4GKUA 3ZDJA 3CHWP 4S2LA 3RJUA 1ES3A 5G4ZA 1STZA 2XGNA 2JKRI 4OVDA 3V39A 3W4QA 1WA9A 3EGXC 3NOTC 1YQSA 2WAEA 4L0LA 1JWZA 4EBLA 4I39A 2ZOHA 5BOHA 5DFXA 4X55A 1TS8A 3OCLA 4CLCB 1XJ4A 5CTNA 1MWUA 3HJKA 5CRFA 2WKEA 1Z6FA 2WKIA 4PPRA 1TDLA 5HWWA 4BWIA 3MF0A 2V0UA 3D9YA 3N8RA 2EX2A 4I3IA 1ESUA 1N9BA 1I2WA 1T18A 1FSWA 3CUEA 3UE6A 4KUKA 4RQ9A 1OTAA 2W27A 1YSQA 1BLSA 4CLCD 1NYYA 3BFCA 5CXWA 5AQAA 1F5MA 1TVFA 3G4PA 1IELA 3T12B 5L8MA 1FR6A 1RGYA 2K7SA 3H82A 4HEFA 2X01A 2X71A 3PTEA 3MSHA 2HDRA 4JBFA 4I3AA 1BSGA 1L0DA 5CGWA 3UDIA 3C4OA 1YPRA 1TDGA 1NYMA 3VSKA 1LI9A 1HVBA 1XPBA 1CI9A 4E3IA 1H8ZA 2ZM0A 1DJCA 1VEUB 3VP2A 3GVBA 4E6WA 3DW0A 4CLCC 3MMHA 2O99A 5CHUA 2V1ZA 2V8FA 3O86A 4ZRRA 1ZG6A 1MC0A 1NWZA 2ZC3B 3BM6A 4UQIS 1DJBA 3EQUA 3MKFA 4OLDA 3EQVA 3G30A 2PYPA 4WELA 1PFLA 1XGJA 2CMNA 1T1BA 4Y0TA 2VGLS 3DTIA 5FAOA 1K57A 3UPPA 2B02A 2PBDP 2R78A 4M4XA 5HAIA 1HTZA 4JXSA 4CLCE 4EBNA 3UO9A 1PWDA 2EXBA 3NC8A 4WZ5C 3JPUA 4E3JA 5JYOA 2Y59A 4KG2A 3LGOA 3LY4A 3I7JA 4LRYC 3KO6A 2JKTI 2K31A 3IHBA 3OC2A 1U60A 3Q1FA 3ITBA 4KUOA 2JE5A 1OPXA 3IWOA 4HI4A 3H9WA 2E8JA 1KGFA 4G3KA 5HD3A 2VV7A 3ZQ5A 3M6HA 3HCYA 2XD1A 4PKYG 3ZGAB 4GS9B 5DF7A 3QP6A 2KDKA 3C38A 2EX6A 3PHYA 5HPIA 1ZC2A 2P9VB 2WYXA 1UWPX 3N8LA 3UE0A 1RGZA 2HP5A 4FH4A 1L0FA 3HLFA 4C6YA 1JWPA 1GA9A 3LYXA 4BENA 4P87A 2DRWA 1YLZA 3GV9A 3HLGA 3NBLA 1LHYA 1MWSA 1OT6A 2KOIA 3CG5A 1S0WA 2IWDA 1NRJA 2HDSA 3ITAA 1P0ZA 3KSGA 1QMFA 3F1PA 4UHUA 2KLIA 4X1LA 3VOLA 3MQ0A 4WYYA 5CGSA 3PBNA 2AVXA 3A3JA 2WKQA 3BLSA 4JF4A 1S4RA 4DJ3A 4BMWA 2WKRA 2XF3A 3KYEA 3LICA 5F1FA 5JYPA 3UB7A 2KX6A 3IS2B 3DWKA 2Y2GA 3PR6A 2IWBA 1PW8A 4BBUA 3BFDA 4RYEA 4DE0A 1JWVA 3MS6A 3HLEA 2OLUA 4X1MA 1YLYA 1H8MA 4KG5A 4XUZA 4JF6A 3T4SA 2QPNA 4Y17A 1ACFA 3S7PA 2OAQ1 2HPBA 1VETB 1BULA 4QU3A 4LPZA 1DP9A 5EVIA 4EUZA 2ZJ9A 3VP0A 1PIOA 2XFTA 4ME4A 3WS1A 1K56D 5FQJA 1XKZA 3LI9A 1ALQA 5FEGA 5CTMA 5IT5A 3DWZA 3V3RA 4R4RA 2L0WA 2QJ7A 3U2AA 2XLNA 4E04A 4LCMA 3WS5A 3LR0A 4HHDA 4G3WA 4HQAA 1K54A 2FH5A 3TG9A 1BT5A 2W3FA 3LIDA 1GSXA 4HOIA 3EEHA 4L9FA 2FZ0A 4OONA 3MR0A 3B42A 1G6AA 3VP1A 4FUWA 2QMIA 4OH0A 3RH8B 3T4LA 2Z6DA 3WRZA 2ZMVA 2LB9A 1VHMA 3BEBA 4PKYA 4JXVA 4MBFA 1NZUA 3BWLA 3T4KA 3BYDA 1W63M 3ZVTA 2OWJA 3N4IA 1FIKA 1I2SA 3PBQA 5CECA 1OTBA 4K0XA 4UA9A 3WRTA 3N8SA 4H6JA 2W1TA 5GLAA 1K56A 2M1CA 1ERQA 2EXAA 1TEMA 5J8XA 4DN0A 3G32A 1LL8A 4S2JA 2O9AA 5G18A 3SS3A 2PRFA 1W5DA 1RCJA 1K38A 1Q2QA 3MBZA 3Q81A 4GDNA 3W8KA 1FCMA 2JKFA 5HL1A 5HWTA 2WK0A 3CWFA 2IWCA 1NRFA 5CERA 3T4OA 2JN7A 2ZL1A 5AQBA 4B4ZA 4HJ3A 1ONHA 5FQ9A 1MXOA 1CEGA 1DRMA 1YLTA 2RCXA 1O7EA 2O9CA 2MJ6A 3R7WA 1IOUA 2W3HA 3JVVA 3AGEA 4NXEA 4YFMA 3SH7A 4UA6A 3E2KA 1K6RA 3FV7A 3NOPC 4YOFA 1OMEA 4Q0IA 2I72A 4ZBEA 3V3SA 5F82A 4HIAA 4Y15A 3GECA 1KVLA 2P04A 1CQAA 3IXGA 3B47A 1VQQA 3WS4A 2HDQA 3JVUA 5FI6A 1IFQA 3UB6A 2WAFA 5FI2A 4GCZA 3ZNYA 2I9VA 4OPRA 4MCWA 2ZQDA 1N9NA 4PAUA 4KG6A 4UQIM 3NHQA 4R4SA 3OZHA 2HF6A 3LEZA 1JTGA 4Y0UA 1XFNA 1K4FA 1KOUA 1BZAA 1KE3A 2H5SA 3QP1A 2VGLM 2EFUA 1Y4OA 1UGUA 1HD8A 2EWWA 4R1GA 2DCFA 3TSGA 4OOYA 3H82B 3QNBA 4GNUA 5L07A 4XT2B 1TS6A 4FD8A 3FC7A 4NETA 1WYCA 3ZG5A 4OLGA 1BLPA 4MBKA 3OPRA 2DNSA 3D72A 4UAAA 2VK3A 2Y2IA 5KSHA 3B3XA 1YMXA 3VOZA 4X69A 2E8IA 2VKSA 4XUXA 1ZG4A 3ULFA 4WEKA 4ZJ3A 5FL3A 3L7HA 2A24A 2Z2MB 4P0MA 4DKIA 3T4JA 3UN7A 2H0YA 3IT9A 4HP4A 1W7FA 4BQMA 2V0WA 3CUEC 1BYWA 3JYIA 3C7VA 5GHXA 1CI8A 1W63Q 2Y2MA 4G3VA 5EV0A 5HZHA 4KZAA 3IWQA 3AGDA 4NXFA 4KZ7A 2QHKA 2XDMA 2B5RA 2XFSA 2IA2A 1XA7A 4IBRA 4C3QA 3UMEA 5M1AA 2G2UA 3E0YA 2JC7A 3MZFA 4I5SA 4QWOA 1FSYA 2J7VA 4HNBA 4S2IA 5EM0A 5C5KA 1G28A 4CQHA 4JKTA 1FILA 1W8YA 4KQQA 3PAGA 5KMWA 1H0MA 1WE4A 5HL6A 3FWLA 4XT2A 4IUHA 2HP9A 3MJQA 3TRCA 2PU2A 1MWRA 5AJGA 4ETXA 4M3KA 4F3LA 5A92A 4K0WA 2OAP1 3TOIA 1K0KA 3FG8A 2CC1A 3IWIA 3LFVA 4EV4A 4FSFA 1PYYA 5U47A 3G2ZA 3EEAA 1SZVA 4NG2A 4EXOA 3G2YA 4WMCD 1HZOA 2HJ9C 4HP9A 2Y91A 5J3WA 3ZG0A 3GTCA 4NXGA 1KE0A 5F69A 3D4FA 5FQQA 2OWHA 3IQAA 3M2JA 5EVEA 3BJNA 5GLDA 1K4EA 3F1OA 4LLOB 4K91A 3SW1A 4H8RA 4BBVA 3LR5A 1PWGA 2J9PA 1K57C 1SKOA 2WZZA 4RVAA 3R4KA 2ZLYA 5GHZA 4BL2A 3Q7VB 2A3UA 2P7JA 4OQIA 4QPRA 3MXRA 1OTIA 5EM1A 5FQKA 4WBGA 3IXBA 4WL9A 1XFQA 5EECA 4DXBA 3F1PB 2Y79A 1RP5A 4HBTA 2V8CA 2D01A 4EWFA 4DRTA 4Q8IA 2J9OA 2V9AA 4BD0A 1EWZA 3NOUC 4ZTKA 4GHIA 3PAEA 2XD5A 1H3QA 4N92A 4FOFA 2ZC4B 2G2WA 1IYSA 3N6IA 2B18A 5EVLA 3SZTA 4E3KA 2VGKA 2WUQA 4BBTA 5CHJA 3S7NA 4EERA 1ES5A 2XROA 1N9OA 4WMCA 3NI9A 5DF8A 3OBFA 5F68A 3BFEA 4KZ5A 1QMEA 3NULA 3NIAA 4DDYA 3MFXA 3BLMA 3GQZA 1ES4A 2H0TA 4NK3A 2BTFP 3C4PA 5EVIB 3P98A 3MKEA 2XK1A 3CPTA 2XEPA 5DTTA 2RL3A 5CEBA 3IX8A 2A49A 1DP6A 3UNWA 1PZOA 5CHMA 4OP5A 3HJIA 2GJ3A 1NJ4A 1MPLA 1XXMA 3SS5A 5LBRA 4JGOA 3K3DA 2J3TD 4S2KA 2W1RA 4LCLA 4R6LA 3B33A 3P09A 4ETZA 5EVID 1YAXA 2ZQAA 1PW1A 4KZ3A 2UWXA 2Z2LB 1XJ3A 4L9GA 3Q7VA 3RFBA 4RX3A 5A93A 1MWTA 1LT0A 3T50A 1LLBA 3BFGA 5EFWA 3UPNA 2A2LA 3QP4A 2V1BA 3G34A 3KX0X 3MQOA 4YNRA 1JVJA 4KENB 4MLLA 1G6OA 4YWZA 4JPMA 4RX2A 1P97A 2HJEA 2OOLA 4LV0A 4YINA 4L9EA 3VOYA 2HZ5A 5F6AA 4D60A 1P9WA 4KZBA 1DY6A 1MZUA 5TBMA 4WEJA 4H6JB 2W1TB 3VP3A 1LSXA 3W2ZA 5FEFA 2NUTC 3SH9A 4GOGA 5EVIC 3CZDA 2ZQCA 1E3UD 1N4OA 4X53A 5J4EA 3IXDA 5KSCA 5AQ9A 4KQDA 3IH9A 3V5MA 3IX4A 4EUVA 3OPHA 3F1NA 4JGPA 4KQOA 3H7WA 3C2WA 5I5LA 3UB8A 4HJ6A 3Q07A 2ZL1B 3BFFA 1BUEA 3ZG9B 1DJAA 1K54C 5IS1A 1KVMA 2GX5A 2PU4A 3MQQA 4O8GA 3ZG7B 4EEPA 2Q9MA 2EX8A 3R7WB 4OOLA 3ZNTA 4IJGA 3FKVA 1XP4A 1S4SA 2ZC7A 2ZQ8A 3A3EA 2QJ5A 4X68A 1XJ6A 3CI6A 2EFXA 4O0PA 2WKHA 4U0XA 5E2HA 4MDZA 1JTDA 3HLCA 3QP5A 4Y2FA 4X56A 1K55A 5HPFA 4R3AA 3T1XA 4LV2A 3IBRA 3FPWA 4Y5FA 4ID4A 1OTDA 5FQMA 3HUNA 3TW8A 4O7DA 2ZMAA 3UMDA 1ES2A 2W3EA 1P9RA 4LFUA 1N9LA 3AGFA 1E3UA 2C5WB 1K6SA 1MKIA 3OCNA 4Z1WA 4N9LA 4Y3IA 1ESIA 3A0RA 4HH3A 2H28A 1D7EA 3W4OA 3K2NA 4KZ9A 4B88A 4IVKA 3S7QA 2ZQ9A 4QY5A 1VB6A 1S1YA 2EX9A
chains in the Genus database with same CATH topology
1M6KA 2Y2QA 4KQRA 3W4PA 5CGXA 3UE3A 2XR0A 4ZDXA 4WEKA 4ZJ3A 1MY8A 4OPZA 1LL9A 1L0GA 1YLWA 1WYBA 4MNRA 2ZC3B 3BM6A 2Z2MB 4P0MA 1DJBA 2BG1A 3S4XA 3EQUA 3VP4A 3IF6B 3MKFA 4OLDA 3EQVA 3G30A 4DKIA 4WELA 3GSGA 5HX9A 1XGIA 3UN7A 2WGIA 4JXGA 1XGJA 2H0YA 3IT9A 5DTKA 4Y0TA 5M18A 3CMZA 2PBYA 1W7FA 5FAOA 2OSUA 5FATA 4X6TA 5L2FA 1K57A 3UPPA 4BQMA 3JYIA 3C7VA 4OKPA 5GHXA 5HAIA 1HTZA 5GL9A 1H8YA 4JXSA 1CI8A 3C7UA 4EBNA 2Y2MA 3OPLA 1IYPA 2WGVA 5A91A 3UO9A 4KZAA 3PBOA 1PWDA 2EXBA 3NC8A 4WZ5C 1KGGA 4E3JA 4S2MA 5JYOA 2Y59A 3IWQA 4KG2A 3AGDA 4PM7A 3FKWA 4R0QA 3WWXA 2XQZA 4KZ7A 5EE8A 2XDMA 4DE1A 5EUAA 2B5RA 2V20A 3LY4A 2XH9A 5HARA 4DXCA 2XFSA 3I7JA 5DF9A 1XA7A 4BL3A 4GB7A 4IBRA 4C3QA 1K55C 5M1AA 3IHBA 3OC2A 1FCOA 1U60A 3Q1FA 2G2UA 4P85A 3ITBA 2JC7A 4E6XA 2JE5A 3MZFA 1YLPA 4UA7A 3IWOA 2Y2NA 3RXWA 1FSYA 2J7VA 3FYZA 3GR2A 4S2IA 5TGFA 3RXXA 4N1HA 4RA7A 4FH2A 3A3IA 3IH8A 4JKTA 1KGFA 1EROA 1W8YA 4KQQA 3PAGA 2P9VA 4QY6A 2WZXA 2R9WA 5KMWA 2C6WB 1WE4A 3G31A 1IYOA 3FWLA 4MEZA 1L0EA 3M6HA 4OQHA 4R3BA 4IEDA 1CEFA 5E43A 2XD1A 2Y55A 4JLFA 2HP9A 5TFQA 3LY3A 3ZGAB 1PI5A 2PU2A 5DF7A 1J9MA 1MWRA 2EX6A 4EBPA 1ZC2A 3NDGA 4M3KA 5A92A 2P9VB 3QNCA 3O88A 2WYXA 2V2FF 4K0WA 3TOIA 5F83A 3ZFZA 3N8LA 3QHYA 1W8QA 3SH8A 3UE0A 1MBLA 2CC1A 3IWIA 1RGZA 3NCKA 3MZEA 3VFFA 4KZ8A 4EV4A 2HP5A 4ZAMA 4FSFA 1PYYA 4QHCA 4S2NA 5M19A 3PBSA 4FH4A 4HESA 1L0FA 3HLFA 5U47A 4C6YA 5E2GA 1S6RA 1JWPA 3G2ZA 2ZQ7A 4WM9A 1GA9A 1E25A 4BENA 4P87A 2DRWA 1YLZA 3G2YA 4GDBA 4IVIA 4E3LA 4WMCD 1HZOA 5FAQA 2Y91A 3GV9A 3HLGA 3NBLA 3ZG0A 3GTCA 1LHYA 5EPHA 1MWSA 2JBFA 3CG5A 4N9KA 1KE0A 1S0WA 2IWDA 3D4FA 5FQQA 3IQAA 3M2JA 1SKFA 2HDSA 3ITAA 4MBHA 4R3JA 1K4EA 5GLDA 3IF6A 4R23A 1NY0A 4K91A 1QMFA 4H8RA 4UHUA 1PWGA 2J9PA 1ERMA 1K57C 4S2PA 3IHAA 2WZZA 2Y2KA 4RVAA 3G35A 2ZC5B 2ZLYA 5FDHA 5GHZA 4WYYA 1FR1A 4BL2A 4PM8A 3Q7VB 2QZ6A 5CGSA 3PBNA 2A3UA 1FCNA 4OQIA 3HLDA 3A3JA 3MXRA 3LCEA 3BLSA 5FSRA 5FQKA 4WBGA 3IXBA 2X02A 4JF4A 3SOIA 5EECA 5FAPA 4DXBA 5HFOA 2Y2OA 5EOEA 2XF3A 5F1FA 3Q7ZA 5DTSA 1RP5A 4HBTA 5JYPA 3DWKA 4Y0OA 1YT4A 2Y2GA 4EWFA 3HUOA 2IWBA 1PW8A 4DRTA 3BFDA 1ZKJA 4Q8IA 4QJGA 2J9OA 4B4XA 4RYEA 4BD0A 4DE0A 1EWZA 1JWVA 4ZTKA 3HLEA 1BTLA 1PZPA 2OLUA 5TR7A 1YLYA 1G68A 3PAEA 1O07A 4HBUA 4KG5A 1EI5A 3FZCA 4XUZA 2XD5A 4JF6A 3ZG8B 2QPNA 4N92A 1ONGA 4P6BA 1Q2PA 2ZC4B 3M2KA 4QB8A 3N7WA 1GHMA 4Z9QA 3DTMA 2G2WA 1IYSA 2HPBA 3N6IA 1BULA 5EVLA 2E8IA 4E3KA 2VGKA 2Q9NA 1IYQA 2WUQA 4QU3A 4A5RA 1AXBA 5CHJA 5EVIA 4OPYA 4EUZA 2ZJ9A 3VP0A 1PIOA 2XFTA 1ES5A 1XA1A 3WS1A 1K56D 5FQJA 4WMCA 3NI9A 5DF8A 1XKZA 4PM6A 1ALQA 5D3OA 5CTMA 3OPPA 3BFEA 4KZ5A 2P74A 3DWZA 1QMEA 4DDSA 2GDNA 3V3RA 2Y2HA 3NIAA 1C3BA 4DDYA 3BLMA 4R4RA 4DF6A 3UPOA 2FFYA 2ZC6B 3LO7A 2XLNA 2ZD8A 4JXWA 3GQZA 4LCMA 3WS5A 1ES4A 2H0TA 4NK3A 3C4PA 5EVIB 3P98A 4LV3A 1M40A 1BLCA 3MKEA 4S2NC 4BJPA 1BLHA 3IF5A 2XK1A 3VFHA 2WGWA 2XEPA 5DTTA 2RL3A 5GLCA 5CEBA 4C75A 1K54A 3TG9A 2Y2JA 2VGJA 1KE4A 1BT5A 3HREA 3WS0A 2A49A 3HBRA 3UNWA 5EOOA 1PZOA 5CHMA 5FA7A 4OP5A 5KZHA 4OONA 3ZCZA 3UY6A 5GLBA 1NJ4A 1MPLA 1Y54A 3M6BA 4GN2A 1XXMA 1E4DA 2BLSA 3SS5A 1G6AA 5F1GA 3VP1A 4GD8A 4S2KA 1YLJA 4LCLA 2WGWB 2QMIA 4DE3A 3PBTA 4FCFA 5FASA 3A3FA 4OH0A 2HP6A 1SCWA 3P09A 4OPQA 3IF6C 3WRZA 4KZ6A 3MZDA 3SS4A 1L2SA 4U3TA 5EVID 4DE2A 3BEBA 4JXVA 2ZQAA 1W79A 1PW1A 1I5QA 4IBXA 4PMAA 2Y2PA 4KZ3A 5AQ7A 3NY4A 4MBFA 1NZUA 2UWXA 3GRJA 4WZ4A 3C5AA 2Z2LB 4GZBA 4U0TA 1H5XA 4OQ0A 1K25A 3Q7VA 4OP8A 3BYDA 4RX3A 5A93A 1MWTA 1LLBA 4BLMA 4EQIA 3Q82A 1YMSA 3BFGA 3UPNA 1GCEA 3CJMA 3HLWA 3ZVTA 2JCHA 3N4IA 4ZJ1A 3G34A 1I2SA 5HW3A 3UDXA 3PBQA 1FQGA 5E2FA 3IXHA 1JVJA 4E3MA 5CECA 4KENB 4MLLA 4JPMA 4K0XA 4LENA 3ISGA 4UA9A 3WRTA 4D2OA 3N8SA 2FFFB 1FOFA 3HL9A 4RX2A 1IKIA 1SDEA 1VM1A 1IKGA 4LV0A 2OLVA 4YINA 5GLAA 4CPKA 3BRMA 1K56A 4GD6A 3ZVWA 4GKUA 2Y4AA 1ERQA 3ZDJA 4BD1A 3VOYA 2EXAA 4Y7PA 4S2LA 3RJUA 1TEMA 1ES3A 5J8XA 2XGNA 3G32A 4KZBA 1DY6A 4S2JA 4OQGA 5G18A 4OVDA 3SS3A 5HAPA 1W5DA 3E2LA 4WEJA 1RCJA 3V39A 1K38A 4JF5A 4XXRA 3VP3A 1Q2QA 3W4QA 3MBZA 4F94A 3Q81A 4GDNA 3W8KA 1FCMA 3HLBA 3O3VA 5HL1A 1YQSA 1KDSA 2HDUA 2WK0A 3SH9A 2WAEA 2IWCA 4GOGA 3CZDA 1NRFA 2ZQCA 4L0LA 5EVIC 1JWZA 3VMAA 4EBLA 5HAQA 1E3UD 3MXSA 3HVFA 5CERA 1N4OA 2R9XA 1NXYA 2J8YA 4X53A 5AQBA 4B4ZA 3IXDA 4KZ4A 5BOHA 5KSCA 1ONHA 5AQ9A 1LI0A 5FQ9A 3IH9A 1MXOA 3V5MA 1CEGA 4OOMA 2OV5A 4X55A 3GMWA 1YLTA 3OCLA 2RCXA 3OPHA 1O7EA 4QD4A 4KQOA 2ZM2A 5CTNA 1MWUA 5CRFA 2WKEA 3Q07A 4PM5A 3AGEA 1Z6FA 3BFFA 4YFMA 1SHVA 4UA6A 2WKIA 1BUEA 1TDLA 3E2KA 3HUMA 4PPRA 3SH7A 3S1YA 3UDFA 3MFDA 3ZG9B 1K6RA 1NZOA 3FV7A 2Y2LA 1DJAA 1K54C 1KVMA 3NDEA 2PU4A 3A3DA 3N8RA 3ZG7B 1OMEA 2EX2A 2I72A 4ZBEA 3S22A 1ESUA 3V3SA 1N9BA 5F82A 2Q9MA 1I2WA 2EX8A 1KVLA 4OOLA 1FSWA 4CJNA 3ZNTA 3IXGA 3WS4A 1VQQA 2HDQA 3O87A 5FI6A 3FKVA 1XX2A 4X69A 2WAFA 5FI2A 1XP4A 2ZC7A 1BLSA 2ZQ8A 4S2OA 5E2EA 3ZNYA 3A3EA 4N1XA 4X68A 3ZHHA 4WZ5A 1NYYA 2EFXA 4OPRA 3BFCA 2WKHA 4U0XA 5CXWA 2ZQDA 5IHVA 5AQAA 1TVFA 4KG6A 5E2HA 3G4PA 1JTDA 4E3NA 4R4SA 1PWCA 3HLCA 3OZHA 1IELA 3LEZA 1JTGA 4Y0UA 3VSLA 5CEDA 1FR6A 1RGYA 4HEFA 4X56A 1K55A 1K4FA 1BZAA 1KE3A 2H5SA 4LV2A 2X01A 1SDNA 5FI7A 2EFUA 2X71A 1CK3A 1HD8A 4ID4A 5FQMA 3HUNA 3PTEA 4O7DA 4R1GA 2DCFA 2ZMAA 1ES2A 2HDRA 4JBFA 5FQIA 3TSGA 4OOYA 3QNBA 1BSGA 1L0DA 4GNUA 4PM9A 3AGFA 5CGWA 3UDIA 3C4OA 1TDGA 1E3UA 2C5WB 3V50A 1K6SA 1GHPA 1MKIA 1NYMA 2ZM8A 1GHIA 5GHYA 4ZJ2A 5A90A 3VSKA 1LI9A 3OCNA 1HVBA 1GA0A 1KDWA 1XPBA 4FD8A 5DVAA 1CI9A 4N9LA 4NETA 4E3IA 1WYCA 1ESIA 3UE1A 3ZG5A 1H8ZA 2ZM0A 1LL5A 2WADA 3BECA 1DJCA 4OLGA 4XUXA 3VP2A 1BLPA 3W4OA 1PI4A 3WS2A 4MBKA 3GVBA 4KZ9A 3OPRA 4B88A 2DNSA 3DW0A 3PBRA 4E6WA 4UAAA 5I94A 2H10A 2Y2IA 1IEMA 5CHUA 2V1ZA 3O86A 5KSHA 4IVKA 1YM1A 4LV1A 2ZQ9A 1KGEA 3B3XA 1YMXA 4QY5A 4E3OA 3VOZA 2EX9A 1ZG6A 1ZG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M6K A;  2Y2Q A;  4KQR A;  3W4P A;  5CGX A;  3UE3 A;  2XR0 A;  4ZDX A;  4WEK A;  4ZJ3 A;  1MY8 A;  4OPZ A;  1LL9 A;  1L0G A;  1YLW A;  1WYB A;  4MNR A;  2ZC3 B;  3BM6 A;  2Z2M B;  4P0M A;  1DJB A;  2BG1 A;  3S4X A;  3EQU A;  3VP4 A;  3IF6 B;  3MKF A;  4OLD A;  3EQV A;  3G30 A;  4DKI A;  4WEL A;  3GSG A;  5HX9 A;  1XGI A;  3UN7 A;  2WGI A;  4JXG A;  1XGJ A;  2H0Y A;  3IT9 A;  5DTK A;  4Y0T A;  5M18 A;  3CMZ A;  2PBY A;  1W7F A;  5FAO A;  2OSU A;  5FAT A;  4X6T A;  5L2F A;  1K57 A;  3UPP A;  4BQM A;  3JYI A;  3C7V A;  4OKP A;  5GHX A;  5HAI A;  1HTZ A;  5GL9 A;  1H8Y A;  4JXS A;  1CI8 A;  3C7U A;  4EBN A;  2Y2M A;  3OPL A;  1IYP A;  2WGV A;  5A91 A;  3UO9 A;  4KZA A;  3PBO A;  1PWD A;  2EXB A;  3NC8 A;  4WZ5 C;  1KGG A;  4E3J A;  4S2M A;  5JYO A;  2Y59 A;  3IWQ A;  4KG2 A;  3AGD A;  4PM7 A;  3FKW A;  4R0Q A;  3WWX A;  2XQZ A;  4KZ7 A;  5EE8 A;  2XDM A;  4DE1 A;  5EUA A;  2B5R A;  2V20 A;  3LY4 A;  2XH9 A;  5HAR A;  4DXC A;  2XFS A;  3I7J A;  5DF9 A;  1XA7 A;  4BL3 A;  4GB7 A;  4IBR A;  4C3Q A;  1K55 C;  5M1A A;  3IHB A;  3OC2 A;  1FCO A;  1U60 A;  3Q1F A;  2G2U A;  4P85 A;  3ITB A;  2JC7 A;  4E6X A;  2JE5 A;  3MZF A;  1YLP A;  4UA7 A;  3IWO A;  2Y2N A;  3RXW A;  1FSY A;  2J7V A;  3FYZ A;  3GR2 A;  4S2I A;  5TGF A;  3RXX A;  4N1H A;  4RA7 A;  4FH2 A;  3A3I A;  3IH8 A;  4JKT A;  1KGF A;  1ERO A;  1W8Y A;  4KQQ A;  3PAG A;  2P9V A;  4QY6 A;  2WZX A;  2R9W A;  5KMW A;  2C6W B;  1WE4 A;  3G31 A;  1IYO A;  3FWL A;  4MEZ A;  1L0E A;  3M6H A;  4OQH A;  4R3B A;  4IED A;  1CEF A;  5E43 A;  2XD1 A;  2Y55 A;  4JLF A;  2HP9 A;  5TFQ A;  3LY3 A;  3ZGA B;  1PI5 A;  2PU2 A;  5DF7 A;  1J9M A;  1MWR A;  2EX6 A;  4EBP A;  1ZC2 A;  3NDG A;  4M3K A;  5A92 A;  2P9V B;  3QNC A;  3O88 A;  2WYX A;  2V2F F;  4K0W A;  3TOI A;  5F83 A;  3ZFZ A;  3N8L A;  3QHY A;  1W8Q A;  3SH8 A;  3UE0 A;  1MBL A;  2CC1 A;  3IWI A;  1RGZ A;  3NCK A;  3MZE A;  3VFF A;  4KZ8 A;  4EV4 A;  2HP5 A;  4ZAM A;  4FSF A;  1PYY A;  4QHC A;  4S2N A;  5M19 A;  3PBS A;  4FH4 A;  4HES A;  1L0F A;  3HLF A;  5U47 A;  4C6Y A;  5E2G A;  1S6R A;  1JWP A;  3G2Z A;  2ZQ7 A;  4WM9 A;  1GA9 A;  1E25 A;  4BEN A;  4P87 A;  2DRW A;  1YLZ A;  3G2Y A;  4GDB A;  4IVI A;  4E3L A;  4WMC D;  1HZO A;  5FAQ A;  2Y91 A;  3GV9 A;  3HLG A;  3NBL A;  3ZG0 A;  3GTC A;  1LHY A;  5EPH A;  1MWS A;  2JBF A;  3CG5 A;  4N9K A;  1KE0 A;  1S0W A;  2IWD A;  3D4F A;  5FQQ A;  3IQA A;  3M2J A;  1SKF A;  2HDS A;  3ITA A;  4MBH A;  4R3J A;  1K4E A;  5GLD A;  3IF6 A;  4R23 A;  1NY0 A;  4K91 A;  1QMF A;  4H8R A;  4UHU A;  1PWG A;  2J9P A;  1ERM A;  1K57 C;  4S2P A;  3IHA A;  2WZZ A;  2Y2K A;  4RVA A;  3G35 A;  2ZC5 B;  2ZLY A;  5FDH A;  5GHZ A;  4WYY A;  1FR1 A;  4BL2 A;  4PM8 A;  3Q7V B;  2QZ6 A;  5CGS A;  3PBN A;  2A3U A;  1FCN A;  4OQI A;  3HLD A;  3A3J A;  3MXR A;  3LCE A;  3BLS A;  5FSR A;  5FQK A;  4WBG A;  3IXB A;  2X02 A;  4JF4 A;  3SOI A;  5EEC A;  5FAP A;  4DXB A;  5HFO A;  2Y2O A;  5EOE A;  2XF3 A;  5F1F A;  3Q7Z A;  5DTS A;  1RP5 A;  4HBT A;  5JYP A;  3DWK A;  4Y0O A;  1YT4 A;  2Y2G A;  4EWF A;  3HUO A;  2IWB A;  1PW8 A;  4DRT A;  3BFD A;  1ZKJ A;  4Q8I A;  4QJG A;  2J9O A;  4B4X A;  4RYE A;  4BD0 A;  4DE0 A;  1EWZ A;  1JWV A;  4ZTK A;  3HLE A;  1BTL A;  1PZP A;  2OLU A;  5TR7 A;  1YLY A;  1G68 A;  3PAE A;  1O07 A;  4HBU A;  4KG5 A;  1EI5 A;  3FZC A;  4XUZ A;  2XD5 A;  4JF6 A;  3ZG8 B;  2QPN A;  4N92 A;  1ONG A;  4P6B A;  1Q2P A;  2ZC4 B;  3M2K A;  4QB8 A;  3N7W A;  1GHM A;  4Z9Q A;  3DTM A;  2G2W A;  1IYS A;  2HPB A;  3N6I A;  1BUL A;  5EVL A;  2E8I A;  4E3K A;  2VGK A;  2Q9N A;  1IYQ A;  2WUQ A;  4QU3 A;  4A5R A;  1AXB A;  5CHJ A;  5EVI A;  4OPY A;  4EUZ A;  2ZJ9 A;  3VP0 A;  1PIO A;  2XFT A;  1ES5 A;  1XA1 A;  3WS1 A;  1K56 D;  5FQJ A;  4WMC A;  3NI9 A;  5DF8 A;  1XKZ A;  4PM6 A;  1ALQ A;  5D3O A;  5CTM A;  3OPP A;  3BFE A;  4KZ5 A;  2P74 A;  3DWZ A;  1QME A;  4DDS A;  2GDN A;  3V3R A;  2Y2H A;  3NIA A;  1C3B A;  4DDY A;  3BLM A;  4R4R A;  4DF6 A;  3UPO A;  2FFY A;  2ZC6 B;  3LO7 A;  2XLN A;  2ZD8 A;  4JXW A;  3GQZ A;  4LCM A;  3WS5 A;  1ES4 A;  2H0T A;  4NK3 A;  3C4P A;  5EVI B;  3P98 A;  4LV3 A;  1M40 A;  1BLC A;  3MKE A;  4S2N C;  4BJP A;  1BLH A;  3IF5 A;  2XK1 A;  3VFH A;  2WGW A;  2XEP A;  5DTT A;  2RL3 A;  5GLC A;  5CEB A;  4C75 A;  1K54 A;  3TG9 A;  2Y2J A;  2VGJ A;  1KE4 A;  1BT5 A;  3HRE A;  3WS0 A;  2A49 A;  3HBR A;  3UNW A;  5EOO A;  1PZO A;  5CHM A;  5FA7 A;  4OP5 A;  5KZH A;  4OON A;  3ZCZ A;  3UY6 A;  5GLB A;  1NJ4 A;  1MPL A;  1Y54 A;  3M6B A;  4GN2 A;  1XXM A;  1E4D A;  2BLS A;  3SS5 A;  1G6A A;  5F1G A;  3VP1 A;  4GD8 A;  4S2K A;  1YLJ A;  4LCL A;  2WGW B;  2QMI A;  4DE3 A;  3PBT A;  4FCF A;  5FAS A;  3A3F A;  4OH0 A;  2HP6 A;  1SCW A;  3P09 A;  4OPQ A;  3IF6 C;  3WRZ A;  4KZ6 A;  3MZD A;  3SS4 A;  1L2S A;  4U3T A;  5EVI D;  4DE2 A;  3BEB A;  4JXV A;  2ZQA A;  1W79 A;  1PW1 A;  1I5Q A;  4IBX A;  4PMA A;  2Y2P A;  4KZ3 A;  5AQ7 A;  3NY4 A;  4MBF A;  1NZU A;  2UWX A;  3GRJ A;  4WZ4 A;  3C5A A;  2Z2L B;  4GZB A;  4U0T A;  1H5X A;  4OQ0 A;  1K25 A;  3Q7V A;  4OP8 A;  3BYD A;  4RX3 A;  5A93 A;  1MWT A;  1LLB A;  4BLM A;  4EQI A;  3Q82 A;  1YMS A;  3BFG A;  3UPN A;  1GCE A;  3CJM A;  3HLW A;  3ZVT A;  2JCH A;  3N4I A;  4ZJ1 A;  3G34 A;  1I2S A;  5HW3 A;  3UDX A;  3PBQ A;  1FQG A;  5E2F A;  3IXH A;  1JVJ A;  4E3M A;  5CEC A;  4KEN B;  4MLL A;  4JPM A;  4K0X A;  4LEN A;  3ISG A;  4UA9 A;  3WRT A;  4D2O A;  3N8S A;  2FFF B;  1FOF A;  3HL9 A;  4RX2 A;  1IKI A;  1SDE A;  1VM1 A;  1IKG A;  4LV0 A;  2OLV A;  4YIN A;  5GLA A;  4CPK A;  3BRM A;  1K56 A;  4GD6 A;  3ZVW A;  4GKU A;  2Y4A A;  1ERQ A;  3ZDJ A;  4BD1 A;  3VOY A;  2EXA A;  4Y7P A;  4S2L A;  3RJU A;  1TEM A;  1ES3 A;  5J8X A;  2XGN A;  3G32 A;  4KZB A;  1DY6 A;  4S2J A;  4OQG A;  5G18 A;  4OVD A;  3SS3 A;  5HAP A;  1W5D A;  3E2L A;  4WEJ A;  1RCJ A;  3V39 A;  1K38 A;  4JF5 A;  4XXR A;  3VP3 A;  1Q2Q A;  3W4Q A;  3MBZ A;  4F94 A;  3Q81 A;  4GDN A;  3W8K A;  1FCM A;  3HLB A;  3O3V A;  5HL1 A;  1YQS A;  1KDS A;  2HDU A;  2WK0 A;  3SH9 A;  2WAE A;  2IWC A;  4GOG A;  3CZD A;  1NRF A;  2ZQC A;  4L0L A;  5EVI C;  1JWZ A;  3VMA A;  4EBL A;  5HAQ A;  1E3U D;  3MXS A;  3HVF A;  5CER A;  1N4O A;  2R9X A;  1NXY A;  2J8Y A;  4X53 A;  5AQB A;  4B4Z A;  3IXD A;  4KZ4 A;  5BOH A;  5KSC A;  1ONH A;  5AQ9 A;  1LI0 A;  5FQ9 A;  3IH9 A;  1MXO A;  3V5M A;  1CEG A;  4OOM A;  2OV5 A;  4X55 A;  3GMW A;  1YLT A;  3OCL A;  2RCX A;  3OPH A;  1O7E A;  4QD4 A;  4KQO A;  2ZM2 A;  5CTN A;  1MWU A;  5CRF A;  2WKE A;  3Q07 A;  4PM5 A;  3AGE A;  1Z6F A;  3BFF A;  4YFM A;  1SHV A;  4UA6 A;  2WKI A;  1BUE A;  1TDL A;  3E2K A;  3HUM A;  4PPR A;  3SH7 A;  3S1Y A;  3UDF A;  3MFD A;  3ZG9 B;  1K6R A;  1NZO A;  3FV7 A;  2Y2L A;  1DJA A;  1K54 C;  1KVM A;  3NDE A;  2PU4 A;  3A3D A;  3N8R A;  3ZG7 B;  1OME A;  2EX2 A;  2I72 A;  4ZBE A;  3S22 A;  1ESU A;  3V3S A;  1N9B A;  5F82 A;  2Q9M A;  1I2W A;  2EX8 A;  1KVL A;  4OOL A;  1FSW A;  4CJN A;  3ZNT A;  3IXG A;  3WS4 A;  1VQQ A;  2HDQ A;  3O87 A;  5FI6 A;  3FKV A;  1XX2 A;  4X69 A;  2WAF A;  5FI2 A;  1XP4 A;  2ZC7 A;  1BLS A;  2ZQ8 A;  4S2O A;  5E2E A;  3ZNY A;  3A3E A;  4N1X A;  4X68 A;  3ZHH A;  4WZ5 A;  1NYY A;  2EFX A;  4OPR A;  3BFC A;  2WKH A;  4U0X A;  5CXW A;  2ZQD A;  5IHV A;  5AQA A;  1TVF A;  4KG6 A;  5E2H A;  3G4P A;  1JTD A;  4E3N A;  4R4S A;  1PWC A;  3HLC A;  3OZH A;  1IEL A;  3LEZ A;  1JTG A;  4Y0U A;  3VSL A;  5CED A;  1FR6 A;  1RGY A;  4HEF A;  4X56 A;  1K55 A;  1K4F A;  1BZA A;  1KE3 A;  2H5S A;  4LV2 A;  2X01 A;  1SDN A;  5FI7 A;  2EFU A;  2X71 A;  1CK3 A;  1HD8 A;  4ID4 A;  5FQM A;  3HUN A;  3PTE A;  4O7D A;  4R1G A;  2DCF A;  2ZMA A;  1ES2 A;  2HDR A;  4JBF A;  5FQI A;  3TSG A;  4OOY A;  3QNB A;  1BSG A;  1L0D A;  4GNU A;  4PM9 A;  3AGF A;  5CGW A;  3UDI A;  3C4O A;  1TDG A;  1E3U A;  2C5W B;  3V50 A;  1K6S A;  1GHP A;  1MKI A;  1NYM A;  2ZM8 A;  1GHI A;  5GHY A;  4ZJ2 A;  5A90 A;  3VSK A;  1LI9 A;  3OCN A;  1HVB A;  1GA0 A;  1KDW A;  1XPB A;  4FD8 A;  5DVA A;  1CI9 A;  4N9L A;  4NET A;  4E3I A;  1WYC A;  1ESI A;  3UE1 A;  3ZG5 A;  1H8Z A;  2ZM0 A;  1LL5 A;  2WAD A;  3BEC A;  1DJC A;  4OLG A;  4XUX A;  3VP2 A;  1BLP A;  3W4O A;  1PI4 A;  3WS2 A;  4MBK A;  3GVB A;  4KZ9 A;  3OPR A;  4B88 A;  2DNS A;  3DW0 A;  3PBR A;  4E6W A;  4UAA A;  5I94 A;  2H10 A;  2Y2I A;  1IEM A;  5CHU A;  2V1Z A;  3O86 A;  5KSH A;  4IVK A;  1YM1 A;  4LV1 A;  2ZQ9 A;  1KGE A;  3B3X A;  1YMX A;  4QY5 A;  4E3O A;  3VOZ A;  2EX9 A;  1ZG6 A;  1ZG4 A; 
#chains in the Genus database with same CATH topology
 3W4P A;  4UEY A;  5CGX A;  1F98 A;  2XR0 A;  3CLO A;  4ZDX A;  1LL9 A;  1YLW A;  4MNR A;  3GDI A;  1JNU A;  2BG1 A;  3S4X A;  3IF6 B;  3GSG A;  5HX9 A;  3CAX A;  3LIA A;  2WGI A;  4JXG A;  5M18 A;  3CMZ A;  4WUJ A;  2OSU A;  5FAT A;  4X6T A;  3T4T A;  5DJU A;  2A24 B;  3A0S A;  3C7U A;  1ZHH B;  3LR4 A;  4ARZ A;  1KGG A;  4S2M A;  3WWX A;  3FKW A;  2PYR A;  2XQZ A;  4GJ4 A;  5AVE A;  2ZMF A;  3U4L P;  5HAR A;  4R38 A;  4MN5 A;  5L09 A;  4BL3 A;  1OJG A;  1FCO A;  4WLA A;  1Y28 A;  2PR6 A;  4E6X A;  1YLP A;  4X25 A;  2Y2N A;  3RXW A;  3GR2 A;  3RXX A;  4QY6 A;  2C6W B;  4HY8 A;  1IYO A;  4OQH A;  5HSQ A;  4EU0 A;  2O0Y A;  2WKP A;  5IU1 A;  2Y55 A;  4EET B;  4JLF A;  1J3W A;  4IUK A;  4LGW A;  3LY3 A;  3NDG A;  3P01 A;  3DBA A;  3O88 A;  3ZFZ A;  5F83 A;  3QHY A;  3SH8 A;  1W8Q A;  1MBL A;  2JKR M;  2PAV P;  2QWS A;  5DFY A;  4ZAM A;  4S2N A;  3E4O A;  4HES A;  2VEA A;  5E2G A;  2ZQ7 A;  4WM9 A;  4F3L B;  1E25 A;  1HLU P;  4GDB A;  4IVI A;  4LRX C;  5FAQ A;  2G7U A;  5EPH A;  2JBF A;  3DTK A;  5J7E A;  3ICY A;  4NKP A;  5K5B A;  4MBH A;  4R3J A;  3IF6 A;  4R23 A;  1NY0 A;  1TS0 A;  2ZC5 B;  4EES A;  1FR1 A;  4PM8 A;  2QZ6 A;  1FCN A;  1NLZ A;  3HLD A;  3LCE A;  2X02 A;  3SOI A;  3F1O B;  1YKD A;  5FAP A;  2YKH A;  5HFO A;  1ODV A;  2Y2O A;  2BAS A;  1SKO B;  3L9K A;  3KSH A;  2VJW A;  4Y0O A;  1YT4 A;  3NJA A;  1ZKJ A;  4B4X A;  3IBJ A;  1BTL A;  5TR7 A;  1O07 A;  2K2N A;  1EI5 A;  3ZG8 B;  3LIB A;  3M2K A;  4QB8 A;  1GHM A;  1YSP A;  3BY9 A;  2XRN A;  5CX7 A;  2HGV A;  1IYQ A;  1L3L A;  4GHI B;  4A5R A;  1AXB A;  4OPY A;  1XA1 A;  3E4P A;  1LSW A;  4I38 A;  4PM6 A;  3T1S A;  1OT9 A;  2Q0O A;  1TD5 A;  4DDS A;  4EQ1 A;  2L4R A;  1T1C A;  1C3B A;  2ZC6 B;  4JXW A;  5AVF A;  4LV3 A;  1M40 A;  1NLY A;  1BLC A;  3P7N A;  3E98 A;  1BLH A;  3IF5 A;  2WGW A;  3EGD C;  3IX3 A;  2PD7 A;  4C75 A;  1S1Z A;  2Y2J A;  2VGJ A;  1KE4 A;  3DTE A;  5EOO A;  4Q0H A;  3E4Q A;  3ZCZ A;  5HD5 A;  3M6B A;  4GN2 A;  4P6Z S;  3T4Q A;  3PYP A;  1YLJ A;  3CPT B;  1ZTU A;  4FCF A;  5FAS A;  3A3F A;  1SCW A;  4KZ6 A;  2EA9 A;  3SS4 A;  4DE2 A;  1Z09 A;  1W79 A;  4IBX A;  1I5Q A;  4PMA A;  4B93 A;  5AQ7 A;  2HV1 A;  3GRJ A;  4WZ4 A;  3QP8 A;  4GZB A;  2PT7 A;  4U0T A;  1H5X A;  2JKG A;  4OP8 A;  2YKF A;  4BLM A;  4EQI A;  3Q82 A;  1YMS A;  3HLW A;  1GSV A;  2W3G A;  1TS7 A;  2D02 A;  5HW3 A;  1FQG A;  5E2F A;  3IXH A;  4E3M A;  4FTX A;  2P08 A;  3ISG A;  3LIE A;  2FFF B;  5MC7 A;  1IKI A;  1SDE A;  1IKG A;  3BRM A;  1F9I A;  2Y4A A;  4BD1 A;  4Y7P A;  2JKT M;  2VZW A;  4JGQ A;  4OQG A;  5HAP A;  1TF1 A;  3E2L A;  4JF5 A;  4XXR A;  2M7V A;  4F94 A;  1DP8 A;  3HLB A;  3O3V A;  4CLC A;  1KDS A;  3ZYT A;  2HDU A;  5DKK A;  2PHY A;  3LUQ A;  3VMA A;  5HAQ A;  3MXS A;  3HVF A;  3OOV A;  2R9X A;  3VE3 A;  1NXY A;  2J8Y A;  2XA7 S;  5TBM B;  4KZ4 A;  2JHE A;  4I3J A;  1LI0 A;  2VV6 A;  4OOM A;  2OV5 A;  3GMW A;  5DJT A;  2DMW A;  2XSS A;  4QD4 A;  2ZM2 A;  3K3C A;  2L1M A;  4PM5 A;  3PXP A;  1SHV A;  5FDS A;  3HUM A;  3UDF A;  3S1Y A;  3MFD A;  1NZO A;  2Y2L A;  2J3W A;  3NDE A;  3A3D A;  3F1N B;  3RTY A;  3D3O A;  3S22 A;  3H7W B;  2M7U A;  4CJN A;  4O01 A;  3O87 A;  3KYQ A;  1XX2 A;  2QYB A;  4S2O A;  5E2E A;  4N1X A;  3ZHH A;  4WZ5 A;  4EW7 A;  5IHV A;  3S7O A;  4E3N A;  1PWC A;  3VSL A;  4JGR A;  5CED A;  3V67 A;  5HWV A;  5A8B A;  3LIF A;  1SDN A;  5FI7 A;  1CK3 A;  5FQI A;  1VEU A;  4PM9 A;  4WF0 A;  1T1A A;  3V50 A;  1GHP A;  2ZM8 A;  1GHI A;  5GHY A;  4ZJ2 A;  5A90 A;  1GA0 A;  1KDW A;  1G5U A;  5DVA A;  3UE1 A;  1LL5 A;  2WAD A;  3BEC A;  2W0N A;  3LI8 A;  1PI4 A;  3WS2 A;  2LB5 A;  4II7 A;  3PBR A;  2ACG A;  5I94 A;  2H10 A;  1CF0 A;  4AFI A;  1IEM A;  2O9B A;  1YM1 A;  4LV1 A;  2Z6C A;  1KGE A;  2B95 A;  4E3O A;  4MN6 A;  1M6K A;  3OLO A;  2Y2Q A;  4KQR A;  3UE3 A;  4HH2 A;  2J3T C;  3KSI A;  1MY8 A;  4OPZ A;  1L0G A;  1V9Y A;  1WYB A;  1T19 A;  3VP4 A;  3UB5 P;  1XGI A;  5KIZ A;  5DTK A;  1PNE A;  1MKM A;  2PBY A;  5L2F A;  1CJF A;  2GNX A;  2EWV A;  3VE4 A;  4OKP A;  1EW0 A;  5GL9 A;  1H8Y A;  2QKP A;  3OPL A;  1IYP A;  5G4Y A;  2WGV A;  1AWI A;  5A91 A;  2PR5 A;  4K08 A;  1OJ5 A;  3PBO A;  1A0K A;  4R0Q A;  4PM7 A;  5EE8 A;  4DE1 A;  5EUA A;  2V20 A;  5HDD A;  2XH9 A;  4DXC A;  5DF9 A;  4GB7 A;  5HDS A;  1K55 C;  3TE8 A;  4ARZ B;  4P85 A;  4UA7 A;  3FYZ A;  5TGF A;  4GS9 A;  2GZA A;  4N1H A;  4RA7 A;  4FH2 A;  4IHQ A;  3A3I A;  3IH8 A;  3LEQ A;  1ERO A;  2P9V A;  2WZX A;  2R9W A;  3G31 A;  1PRQ A;  4MEZ A;  1L0E A;  4R3B A;  4IED A;  1CEF A;  5E43 A;  3C8C A;  3DAV A;  5TFQ A;  1PI5 A;  4WN5 A;  1J9M A;  2J80 A;  4EBP A;  3QNC A;  2V2F F;  4ESP A;  4Q0J A;  3NCK A;  3MZE A;  3VFF A;  4KZ8 A;  3BY8 A;  2VV8 A;  2VA0 A;  2PD8 A;  4QHC A;  5M19 A;  3PBS A;  1S6R A;  4MN7 A;  5F5Y A;  4E3L A;  3KYZ A;  3T1R A;  4NEE D;  4N9K A;  4EEU A;  1D1J A;  4MMN A;  1SKF A;  1LSV A;  3O5Y A;  2VX8 A;  4S2P A;  1ERM A;  1GSW A;  3IHA A;  2Y2K A;  2ZOI A;  3LR3 A;  3G35 A;  3IS2 A;  1V9Z A;  5FDH A;  3QP2 A;  3T1Q B;  5FSR A;  3BW6 A;  2W3D A;  1X0O A;  5EOE A;  3Q7Z A;  5DTS A;  2V1A A;  2UV0 E;  4GW9 A;  4P6Z M;  3HUO A;  3BQA A;  3TJZ C;  1XJ2 A;  4QJG A;  1OTE A;  1VET A;  4DJ2 A;  5L10 A;  2ZBB A;  5TJJ A;  2NUP C;  1PZP A;  3G6O A;  4HBU A;  1G68 A;  1S67 L;  3FZC A;  2PDR A;  4HJ4 A;  4P6B A;  1ONG A;  2VLG A;  1Q2P A;  3N7W A;  4Z9Q A;  3DTM A;  4B9O A;  1D06 A;  2Q9N A;  2Y8H A;  1UWN X;  4Y13 A;  3EWK A;  3A0V A;  3FPV A;  3NEC A;  5D3O A;  3OPP A;  1F2K A;  2P74 A;  2GDN A;  4R70 A;  2Y2H A;  5HDC A;  3UPO A;  4DF6 A;  2FFY A;  3LO7 A;  2ZD8 A;  4DMZ A;  4NXB A;  4S2N C;  4BJP A;  3VFH A;  5GLC A;  3MXQ A;  3HRE A;  3VV4 A;  3WS0 A;  3HBR A;  5FA7 A;  5KZH A;  3UY6 A;  5GLB A;  1Y54 A;  1E4D A;  2BLS A;  4PHT A;  5F1G A;  4GD8 A;  4GLQ A;  2WGW B;  4DE3 A;  2XA7 M;  2INW A;  3PBT A;  2HP6 A;  4OPQ A;  3IF6 C;  3MZD A;  1L2S A;  4U3T A;  3UB9 A;  1S66 L;  2Y2P A;  3NY4 A;  3C5A A;  3KSF A;  4OQ0 A;  1K25 A;  4LRZ E;  3C30 A;  1GCE A;  3CJM A;  2JCH A;  3EOI A;  4ZJ1 A;  3UDX A;  3BQ8 A;  4LEN A;  5DKL A;  4D2O A;  1FOF A;  3HL9 A;  1VM1 A;  2OLV A;  3CIT A;  4CPK A;  4GD6 A;  3ZVW A;  4GKU A;  3ZDJ A;  3CHW P;  4S2L A;  3RJU A;  1ES3 A;  5G4Z A;  1STZ A;  2XGN A;  2JKR I;  4OVD A;  3V39 A;  3W4Q A;  1WA9 A;  3EGX C;  3NOT C;  1YQS A;  2WAE A;  4L0L A;  1JWZ A;  4EBL A;  4I39 A;  2ZOH A;  5BOH A;  5DFX A;  4X55 A;  1TS8 A;  3OCL A;  4CLC B;  1XJ4 A;  5CTN A;  1MWU A;  3HJK A;  5CRF A;  2WKE A;  1Z6F A;  2WKI A;  4PPR A;  1TDL A;  5HWW A;  4BWI A;  3MF0 A;  2V0U A;  3D9Y A;  3N8R A;  2EX2 A;  4I3I A;  1ESU A;  1N9B A;  1I2W A;  1T18 A;  1FSW A;  3CUE A;  3UE6 A;  4KUK A;  4RQ9 A;  1OTA A;  2W27 A;  1YSQ A;  1BLS A;  4CLC D;  1NYY A;  3BFC A;  5CXW A;  5AQA A;  1F5M A;  1TVF A;  3G4P A;  1IEL A;  3T12 B;  5L8M A;  1FR6 A;  1RGY A;  2K7S A;  3H82 A;  4HEF A;  2X01 A;  2X71 A;  3PTE A;  3MSH A;  2HDR A;  4JBF A;  4I3A A;  1BSG A;  1L0D A;  5CGW A;  3UDI A;  3C4O A;  1YPR A;  1TDG A;  1NYM A;  3VSK A;  1LI9 A;  1HVB A;  1XPB A;  1CI9 A;  4E3I A;  1H8Z A;  2ZM0 A;  1DJC A;  1VEU B;  3VP2 A;  3GVB A;  4E6W A;  3DW0 A;  4CLC C;  3MMH A;  2O99 A;  5CHU A;  2V1Z A;  2V8F A;  3O86 A;  4ZRR A;  1ZG6 A;  1MC0 A;  1NWZ A;  2ZC3 B;  3BM6 A;  4UQI S;  1DJB A;  3EQU A;  3MKF A;  4OLD A;  3EQV A;  3G30 A;  2PYP A;  4WEL A;  1PFL A;  1XGJ A;  2CMN A;  1T1B A;  4Y0T A;  2VGL S;  3DTI A;  5FAO A;  1K57 A;  3UPP A;  2B02 A;  2PBD P;  2R78 A;  4M4X A;  5HAI A;  1HTZ A;  4JXS A;  4CLC E;  4EBN A;  3UO9 A;  1PWD A;  2EXB A;  3NC8 A;  4WZ5 C;  3JPU A;  4E3J A;  5JYO A;  2Y59 A;  4KG2 A;  3LGO A;  3LY4 A;  3I7J A;  4LRY C;  3KO6 A;  2JKT I;  2K31 A;  3IHB A;  3OC2 A;  1U60 A;  3Q1F A;  3ITB A;  4KUO A;  2JE5 A;  1OPX A;  3IWO A;  4HI4 A;  3H9W A;  2E8J A;  1KGF A;  4G3K A;  5HD3 A;  2VV7 A;  3ZQ5 A;  3M6H A;  3HCY A;  2XD1 A;  4PKY G;  3ZGA B;  4GS9 B;  5DF7 A;  3QP6 A;  2KDK A;  3C38 A;  2EX6 A;  3PHY A;  5HPI A;  1ZC2 A;  2P9V B;  2WYX A;  1UWP X;  3N8L A;  3UE0 A;  1RGZ A;  2HP5 A;  4FH4 A;  1L0F A;  3HLF A;  4C6Y A;  1JWP A;  1GA9 A;  3LYX A;  4BEN A;  4P87 A;  2DRW A;  1YLZ A;  3GV9 A;  3HLG A;  3NBL A;  1LHY A;  1MWS A;  1OT6 A;  2KOI A;  3CG5 A;  1S0W A;  2IWD A;  1NRJ A;  2HDS A;  3ITA A;  1P0Z A;  3KSG A;  1QMF A;  3F1P A;  4UHU A;  2KLI A;  4X1L A;  3VOL A;  3MQ0 A;  4WYY A;  5CGS A;  3PBN A;  2AVX A;  3A3J A;  2WKQ A;  3BLS A;  4JF4 A;  1S4R A;  4DJ3 A;  4BMW A;  2WKR A;  2XF3 A;  3KYE A;  3LIC A;  5F1F A;  5JYP A;  3UB7 A;  2KX6 A;  3IS2 B;  3DWK A;  2Y2G A;  3PR6 A;  2IWB A;  1PW8 A;  4BBU A;  3BFD A;  4RYE A;  4DE0 A;  1JWV A;  3MS6 A;  3HLE A;  2OLU A;  4X1M A;  1YLY A;  1H8M A;  4KG5 A;  4XUZ A;  4JF6 A;  3T4S A;  2QPN A;  4Y17 A;  1ACF A;  3S7P A;  2OAQ 1;  2HPB A;  1VET B;  1BUL A;  4QU3 A;  4LPZ A;  1DP9 A;  5EVI A;  4EUZ A;  2ZJ9 A;  3VP0 A;  1PIO A;  2XFT A;  4ME4 A;  3WS1 A;  1K56 D;  5FQJ A;  1XKZ A;  3LI9 A;  1ALQ A;  5FEG A;  5CTM A;  5IT5 A;  3DWZ A;  3V3R A;  4R4R A;  2L0W A;  2QJ7 A;  3U2A A;  2XLN A;  4E04 A;  4LCM A;  3WS5 A;  3LR0 A;  4HHD A;  4G3W A;  4HQA A;  1K54 A;  2FH5 A;  3TG9 A;  1BT5 A;  2W3F A;  3LID A;  1GSX A;  4HOI A;  3EEH A;  4L9F A;  2FZ0 A;  4OON A;  3MR0 A;  3B42 A;  1G6A A;  3VP1 A;  4FUW A;  2QMI A;  4OH0 A;  3RH8 B;  3T4L A;  2Z6D A;  3WRZ A;  2ZMV A;  2LB9 A;  1VHM A;  3BEB A;  4PKY A;  4JXV A;  4MBF A;  1NZU A;  3BWL A;  3T4K A;  3BYD A;  1W63 M;  3ZVT A;  2OWJ A;  3N4I A;  1FIK A;  1I2S A;  3PBQ A;  5CEC A;  1OTB A;  4K0X A;  4UA9 A;  3WRT A;  3N8S A;  4H6J A;  2W1T A;  5GLA A;  1K56 A;  2M1C A;  1ERQ A;  2EXA A;  1TEM A;  5J8X A;  4DN0 A;  3G32 A;  1LL8 A;  4S2J A;  2O9A A;  5G18 A;  3SS3 A;  2PRF A;  1W5D A;  1RCJ A;  1K38 A;  1Q2Q A;  3MBZ A;  3Q81 A;  4GDN A;  3W8K A;  1FCM A;  2JKF A;  5HL1 A;  5HWT A;  2WK0 A;  3CWF A;  2IWC A;  1NRF A;  5CER A;  3T4O A;  2JN7 A;  2ZL1 A;  5AQB A;  4B4Z A;  4HJ3 A;  1ONH A;  5FQ9 A;  1MXO A;  1CEG A;  1DRM A;  1YLT A;  2RCX A;  1O7E A;  2O9C A;  2MJ6 A;  3R7W A;  1IOU A;  2W3H A;  3JVV A;  3AGE A;  4NXE A;  4YFM A;  3SH7 A;  4UA6 A;  3E2K A;  1K6R A;  3FV7 A;  3NOP C;  4YOF A;  1OME A;  4Q0I A;  2I72 A;  4ZBE A;  3V3S A;  5F82 A;  4HIA A;  4Y15 A;  3GEC A;  1KVL A;  2P04 A;  1CQA A;  3IXG A;  3B47 A;  1VQQ A;  3WS4 A;  2HDQ A;  3JVU A;  5FI6 A;  1IFQ A;  3UB6 A;  2WAF A;  5FI2 A;  4GCZ A;  3ZNY A;  2I9V A;  4OPR A;  4MCW A;  2ZQD A;  1N9N A;  4PAU A;  4KG6 A;  4UQI M;  3NHQ A;  4R4S A;  3OZH A;  2HF6 A;  3LEZ A;  1JTG A;  4Y0U A;  1XFN A;  1K4F A;  1KOU A;  1BZA A;  1KE3 A;  2H5S A;  3QP1 A;  2VGL M;  2EFU A;  1Y4O A;  1UGU A;  1HD8 A;  2EWW A;  4R1G A;  2DCF A;  3TSG A;  4OOY A;  3H82 B;  3QNB A;  4GNU A;  5L07 A;  4XT2 B;  1TS6 A;  4FD8 A;  3FC7 A;  4NET A;  1WYC A;  3ZG5 A;  4OLG A;  1BLP A;  4MBK A;  3OPR A;  2DNS A;  3D72 A;  4UAA A;  2VK3 A;  2Y2I A;  5KSH A;  3B3X A;  1YMX A;  3VOZ A;  4X69 A;  2E8I A;  2VKS A;  4XUX A;  1ZG4 A;  3ULF A;  4WEK A;  4ZJ3 A;  5FL3 A;  3L7H A;  2A24 A;  2Z2M B;  4P0M A;  4DKI A;  3T4J A;  3UN7 A;  2H0Y A;  3IT9 A;  4HP4 A;  1W7F A;  4BQM A;  2V0W A;  3CUE C;  1BYW A;  3JYI A;  3C7V A;  5GHX A;  1CI8 A;  1W63 Q;  2Y2M A;  4G3V A;  5EV0 A;  5HZH A;  4KZA A;  3IWQ A;  3AGD A;  4NXF A;  4KZ7 A;  2QHK A;  2XDM A;  2B5R A;  2XFS A;  2IA2 A;  1XA7 A;  4IBR A;  4C3Q A;  3UME A;  5M1A A;  2G2U A;  3E0Y A;  2JC7 A;  3MZF A;  4I5S A;  4QWO A;  1FSY A;  2J7V A;  4HNB A;  4S2I A;  5EM0 A;  5C5K A;  1G28 A;  4CQH A;  4JKT A;  1FIL A;  1W8Y A;  4KQQ A;  3PAG A;  5KMW A;  1H0M A;  1WE4 A;  5HL6 A;  3FWL A;  4XT2 A;  4IUH A;  2HP9 A;  3MJQ A;  3TRC A;  2PU2 A;  1MWR A;  5AJG A;  4ETX A;  4M3K A;  4F3L A;  5A92 A;  4K0W A;  2OAP 1;  3TOI A;  1K0K A;  3FG8 A;  2CC1 A;  3IWI A;  3LFV A;  4EV4 A;  4FSF A;  1PYY A;  5U47 A;  3G2Z A;  3EEA A;  1SZV A;  4NG2 A;  4EXO A;  3G2Y A;  4WMC D;  1HZO A;  2HJ9 C;  4HP9 A;  2Y91 A;  5J3W A;  3ZG0 A;  3GTC A;  4NXG A;  1KE0 A;  5F69 A;  3D4F A;  5FQQ A;  2OWH A;  3IQA A;  3M2J A;  5EVE A;  3BJN A;  5GLD A;  1K4E A;  3F1O A;  4LLO B;  4K91 A;  3SW1 A;  4H8R A;  4BBV A;  3LR5 A;  1PWG A;  2J9P A;  1K57 C;  1SKO A;  2WZZ A;  4RVA A;  3R4K A;  2ZLY A;  5GHZ A;  4BL2 A;  3Q7V B;  2A3U A;  2P7J A;  4OQI A;  4QPR A;  3MXR A;  1OTI A;  5EM1 A;  5FQK A;  4WBG A;  3IXB A;  4WL9 A;  1XFQ A;  5EEC A;  4DXB A;  3F1P B;  2Y79 A;  1RP5 A;  4HBT A;  2V8C A;  2D01 A;  4EWF A;  4DRT A;  4Q8I A;  2J9O A;  2V9A A;  4BD0 A;  1EWZ A;  3NOU C;  4ZTK A;  4GHI A;  3PAE A;  2XD5 A;  1H3Q A;  4N92 A;  4FOF A;  2ZC4 B;  2G2W A;  1IYS A;  3N6I A;  2B18 A;  5EVL A;  3SZT A;  4E3K A;  2VGK A;  2WUQ A;  4BBT A;  5CHJ A;  3S7N A;  4EER A;  1ES5 A;  2XRO A;  1N9O A;  4WMC A;  3NI9 A;  5DF8 A;  3OBF A;  5F68 A;  3BFE A;  4KZ5 A;  1QME A;  3NUL A;  3NIA A;  4DDY A;  3MFX A;  3BLM A;  3GQZ A;  1ES4 A;  2H0T A;  4NK3 A;  2BTF P;  3C4P A;  5EVI B;  3P98 A;  3MKE A;  2XK1 A;  3CPT A;  2XEP A;  5DTT A;  2RL3 A;  5CEB A;  3IX8 A;  2A49 A;  1DP6 A;  3UNW A;  1PZO A;  5CHM A;  4OP5 A;  3HJI A;  2GJ3 A;  1NJ4 A;  1MPL A;  1XXM A;  3SS5 A;  5LBR A;  4JGO A;  3K3D A;  2J3T D;  4S2K A;  2W1R A;  4LCL A;  4R6L A;  3B33 A;  3P09 A;  4ETZ A;  5EVI D;  1YAX A;  2ZQA A;  1PW1 A;  4KZ3 A;  2UWX A;  2Z2L B;  1XJ3 A;  4L9G A;  3Q7V A;  3RFB A;  4RX3 A;  5A93 A;  1MWT A;  1LT0 A;  3T50 A;  1LLB A;  3BFG A;  5EFW A;  3UPN A;  2A2L A;  3QP4 A;  2V1B A;  3G34 A;  3KX0 X;  3MQO A;  4YNR A;  1JVJ A;  4KEN B;  4MLL A;  1G6O A;  4YWZ A;  4JPM A;  4RX2 A;  1P97 A;  2HJE A;  2OOL A;  4LV0 A;  4YIN A;  4L9E A;  3VOY A;  2HZ5 A;  5F6A A;  4D60 A;  1P9W A;  4KZB A;  1DY6 A;  1MZU A;  5TBM A;  4WEJ A;  4H6J B;  2W1T B;  3VP3 A;  1LSX A;  3W2Z A;  5FEF A;  2NUT C;  3SH9 A;  4GOG A;  5EVI C;  3CZD A;  2ZQC A;  1E3U D;  1N4O A;  4X53 A;  5J4E A;  3IXD A;  5KSC A;  5AQ9 A;  4KQD A;  3IH9 A;  3V5M A;  3IX4 A;  4EUV A;  3OPH A;  3F1N A;  4JGP A;  4KQO A;  3H7W A;  3C2W A;  5I5L A;  3UB8 A;  4HJ6 A;  3Q07 A;  2ZL1 B;  3BFF A;  1BUE A;  3ZG9 B;  1DJA A;  1K54 C;  5IS1 A;  1KVM A;  2GX5 A;  2PU4 A;  3MQQ A;  4O8G A;  3ZG7 B;  4EEP A;  2Q9M A;  2EX8 A;  3R7W B;  4OOL A;  3ZNT A;  4IJG A;  3FKV A;  1XP4 A;  1S4S A;  2ZC7 A;  2ZQ8 A;  3A3E A;  2QJ5 A;  4X68 A;  1XJ6 A;  3CI6 A;  2EFX A;  4O0P A;  2WKH A;  4U0X A;  5E2H A;  4MDZ A;  1JTD A;  3HLC A;  3QP5 A;  4Y2F A;  4X56 A;  1K55 A;  5HPF A;  4R3A A;  3T1X A;  4LV2 A;  3IBR A;  3FPW A;  4Y5F A;  4ID4 A;  1OTD A;  5FQM A;  3HUN A;  3TW8 A;  4O7D A;  2ZMA A;  3UMD A;  1ES2 A;  2W3E A;  1P9R A;  4LFU A;  1N9L A;  3AGF A;  1E3U A;  2C5W B;  1K6S A;  1MKI A;  3OCN A;  4Z1W A;  4N9L A;  4Y3I A;  1ESI A;  3A0R A;  4HH3 A;  2H28 A;  1D7E A;  3W4O A;  3K2N A;  4KZ9 A;  4B88 A;  4IVK A;  3S7Q A;  2ZQ9 A;  4QY5 A;  1VB6 A;  1S1Y A;  2EX9 A; 
#chains in the Genus database with same CATH homology
 1M6K A;  2Y2Q A;  4KQR A;  3W4P A;  5CGX A;  3UE3 A;  2XR0 A;  4ZDX A;  4WEK A;  4ZJ3 A;  1MY8 A;  4OPZ A;  1LL9 A;  1L0G A;  1YLW A;  1WYB A;  4MNR A;  2ZC3 B;  3BM6 A;  2Z2M B;  4P0M A;  1DJB A;  2BG1 A;  3S4X A;  3EQU A;  3VP4 A;  3IF6 B;  3MKF A;  4OLD A;  3EQV A;  3G30 A;  4DKI A;  4WEL A;  3GSG A;  5HX9 A;  1XGI A;  3UN7 A;  2WGI A;  4JXG A;  1XGJ A;  2H0Y A;  3IT9 A;  5DTK A;  4Y0T A;  5M18 A;  3CMZ A;  2PBY A;  1W7F A;  5FAO A;  2OSU A;  5FAT A;  4X6T A;  5L2F A;  1K57 A;  3UPP A;  4BQM A;  3JYI A;  3C7V A;  4OKP A;  5GHX A;  5HAI A;  1HTZ A;  5GL9 A;  1H8Y A;  4JXS A;  1CI8 A;  3C7U A;  4EBN A;  2Y2M A;  3OPL A;  1IYP A;  2WGV A;  5A91 A;  3UO9 A;  4KZA A;  3PBO A;  1PWD A;  2EXB A;  3NC8 A;  4WZ5 C;  1KGG A;  4E3J A;  4S2M A;  5JYO A;  2Y59 A;  3IWQ A;  4KG2 A;  3AGD A;  4PM7 A;  3FKW A;  4R0Q A;  3WWX A;  2XQZ A;  4KZ7 A;  5EE8 A;  2XDM A;  4DE1 A;  5EUA A;  2B5R A;  2V20 A;  3LY4 A;  2XH9 A;  5HAR A;  4DXC A;  2XFS A;  3I7J A;  5DF9 A;  1XA7 A;  4BL3 A;  4GB7 A;  4IBR A;  4C3Q A;  1K55 C;  5M1A A;  3IHB A;  3OC2 A;  1FCO A;  1U60 A;  3Q1F A;  2G2U A;  4P85 A;  3ITB A;  2JC7 A;  4E6X A;  2JE5 A;  3MZF A;  1YLP A;  4UA7 A;  3IWO A;  2Y2N A;  3RXW A;  1FSY A;  2J7V A;  3FYZ A;  3GR2 A;  4S2I A;  5TGF A;  3RXX A;  4N1H A;  4RA7 A;  4FH2 A;  3A3I A;  3IH8 A;  4JKT A;  1KGF A;  1ERO A;  1W8Y A;  4KQQ A;  3PAG A;  2P9V A;  4QY6 A;  2WZX A;  2R9W A;  5KMW A;  2C6W B;  1WE4 A;  3G31 A;  1IYO A;  3FWL A;  4MEZ A;  1L0E A;  3M6H A;  4OQH A;  4R3B A;  4IED A;  1CEF A;  5E43 A;  2XD1 A;  2Y55 A;  4JLF A;  2HP9 A;  5TFQ A;  3LY3 A;  3ZGA B;  1PI5 A;  2PU2 A;  5DF7 A;  1J9M A;  1MWR A;  2EX6 A;  4EBP A;  1ZC2 A;  3NDG A;  4M3K A;  5A92 A;  2P9V B;  3QNC A;  3O88 A;  2WYX A;  2V2F F;  4K0W A;  3TOI A;  5F83 A;  3ZFZ A;  3N8L A;  3QHY A;  1W8Q A;  3SH8 A;  3UE0 A;  1MBL A;  2CC1 A;  3IWI A;  1RGZ A;  3NCK A;  3MZE A;  3VFF A;  4KZ8 A;  4EV4 A;  2HP5 A;  4ZAM A;  4FSF A;  1PYY A;  4QHC A;  4S2N A;  5M19 A;  3PBS A;  4FH4 A;  4HES A;  1L0F A;  3HLF A;  5U47 A;  4C6Y A;  5E2G A;  1S6R A;  1JWP A;  3G2Z A;  2ZQ7 A;  4WM9 A;  1GA9 A;  1E25 A;  4BEN A;  4P87 A;  2DRW A;  1YLZ A;  3G2Y A;  4GDB A;  4IVI A;  4E3L A;  4WMC D;  1HZO A;  5FAQ A;  2Y91 A;  3GV9 A;  3HLG A;  3NBL A;  3ZG0 A;  3GTC A;  1LHY A;  5EPH A;  1MWS A;  2JBF A;  3CG5 A;  4N9K A;  1KE0 A;  1S0W A;  2IWD A;  3D4F A;  5FQQ A;  3IQA A;  3M2J A;  1SKF A;  2HDS A;  3ITA A;  4MBH A;  4R3J A;  1K4E A;  5GLD A;  3IF6 A;  4R23 A;  1NY0 A;  4K91 A;  1QMF A;  4H8R A;  4UHU A;  1PWG A;  2J9P A;  1ERM A;  1K57 C;  4S2P A;  3IHA A;  2WZZ A;  2Y2K A;  4RVA A;  3G35 A;  2ZC5 B;  2ZLY A;  5FDH A;  5GHZ A;  4WYY A;  1FR1 A;  4BL2 A;  4PM8 A;  3Q7V B;  2QZ6 A;  5CGS A;  3PBN A;  2A3U A;  1FCN A;  4OQI A;  3HLD A;  3A3J A;  3MXR A;  3LCE A;  3BLS A;  5FSR A;  5FQK A;  4WBG A;  3IXB A;  2X02 A;  4JF4 A;  3SOI A;  5EEC A;  5FAP A;  4DXB A;  5HFO A;  2Y2O A;  5EOE A;  2XF3 A;  5F1F A;  3Q7Z A;  5DTS A;  1RP5 A;  4HBT A;  5JYP A;  3DWK A;  4Y0O A;  1YT4 A;  2Y2G A;  4EWF A;  3HUO A;  2IWB A;  1PW8 A;  4DRT A;  3BFD A;  1ZKJ A;  4Q8I A;  4QJG A;  2J9O A;  4B4X A;  4RYE A;  4BD0 A;  4DE0 A;  1EWZ A;  1JWV A;  4ZTK A;  3HLE A;  1BTL A;  1PZP A;  2OLU A;  5TR7 A;  1YLY A;  1G68 A;  3PAE A;  1O07 A;  4HBU A;  4KG5 A;  1EI5 A;  3FZC A;  4XUZ A;  2XD5 A;  4JF6 A;  3ZG8 B;  2QPN A;  4N92 A;  1ONG A;  4P6B A;  1Q2P A;  2ZC4 B;  3M2K A;  4QB8 A;  3N7W A;  1GHM A;  4Z9Q A;  3DTM A;  2G2W A;  1IYS A;  2HPB A;  3N6I A;  1BUL A;  5EVL A;  2E8I A;  4E3K A;  2VGK A;  2Q9N A;  1IYQ A;  2WUQ A;  4QU3 A;  4A5R A;  1AXB A;  5CHJ A;  5EVI A;  4OPY A;  4EUZ A;  2ZJ9 A;  3VP0 A;  1PIO A;  2XFT A;  1ES5 A;  1XA1 A;  3WS1 A;  1K56 D;  5FQJ A;  4WMC A;  3NI9 A;  5DF8 A;  1XKZ A;  4PM6 A;  1ALQ A;  5D3O A;  5CTM A;  3OPP A;  3BFE A;  4KZ5 A;  2P74 A;  3DWZ A;  1QME A;  4DDS A;  2GDN A;  3V3R A;  2Y2H A;  3NIA A;  1C3B A;  4DDY A;  3BLM A;  4R4R A;  4DF6 A;  3UPO A;  2FFY A;  2ZC6 B;  3LO7 A;  2XLN A;  2ZD8 A;  4JXW A;  3GQZ A;  4LCM A;  3WS5 A;  1ES4 A;  2H0T A;  4NK3 A;  3C4P A;  5EVI B;  3P98 A;  4LV3 A;  1M40 A;  1BLC A;  3MKE A;  4S2N C;  4BJP A;  1BLH A;  3IF5 A;  2XK1 A;  3VFH A;  2WGW A;  2XEP A;  5DTT A;  2RL3 A;  5GLC A;  5CEB A;  4C75 A;  1K54 A;  3TG9 A;  2Y2J A;  2VGJ A;  1KE4 A;  1BT5 A;  3HRE A;  3WS0 A;  2A49 A;  3HBR A;  3UNW A;  5EOO A;  1PZO A;  5CHM A;  5FA7 A;  4OP5 A;  5KZH A;  4OON A;  3ZCZ A;  3UY6 A;  5GLB A;  1NJ4 A;  1MPL A;  1Y54 A;  3M6B A;  4GN2 A;  1XXM A;  1E4D A;  2BLS A;  3SS5 A;  1G6A A;  5F1G A;  3VP1 A;  4GD8 A;  4S2K A;  1YLJ A;  4LCL A;  2WGW B;  2QMI A;  4DE3 A;  3PBT A;  4FCF A;  5FAS A;  3A3F A;  4OH0 A;  2HP6 A;  1SCW A;  3P09 A;  4OPQ A;  3IF6 C;  3WRZ A;  4KZ6 A;  3MZD A;  3SS4 A;  1L2S A;  4U3T A;  5EVI D;  4DE2 A;  3BEB A;  4JXV A;  2ZQA A;  1W79 A;  1PW1 A;  1I5Q A;  4IBX A;  4PMA A;  2Y2P A;  4KZ3 A;  5AQ7 A;  3NY4 A;  4MBF A;  1NZU A;  2UWX A;  3GRJ A;  4WZ4 A;  3C5A A;  2Z2L B;  4GZB A;  4U0T A;  1H5X A;  4OQ0 A;  1K25 A;  3Q7V A;  4OP8 A;  3BYD A;  4RX3 A;  5A93 A;  1MWT A;  1LLB A;  4BLM A;  4EQI A;  3Q82 A;  1YMS A;  3BFG A;  3UPN A;  1GCE A;  3CJM A;  3HLW A;  3ZVT A;  2JCH A;  3N4I A;  4ZJ1 A;  3G34 A;  1I2S A;  5HW3 A;  3UDX A;  3PBQ A;  1FQG A;  5E2F A;  3IXH A;  1JVJ A;  4E3M A;  5CEC A;  4KEN B;  4MLL A;  4JPM A;  4K0X A;  4LEN A;  3ISG A;  4UA9 A;  3WRT A;  4D2O A;  3N8S A;  2FFF B;  1FOF A;  3HL9 A;  4RX2 A;  1IKI A;  1SDE A;  1VM1 A;  1IKG A;  4LV0 A;  2OLV A;  4YIN A;  5GLA A;  4CPK A;  3BRM A;  1K56 A;  4GD6 A;  3ZVW A;  4GKU A;  2Y4A A;  1ERQ A;  3ZDJ A;  4BD1 A;  3VOY A;  2EXA A;  4Y7P A;  4S2L A;  3RJU A;  1TEM A;  1ES3 A;  5J8X A;  2XGN A;  3G32 A;  4KZB A;  1DY6 A;  4S2J A;  4OQG A;  5G18 A;  4OVD A;  3SS3 A;  5HAP A;  1W5D A;  3E2L A;  4WEJ A;  1RCJ A;  3V39 A;  1K38 A;  4JF5 A;  4XXR A;  3VP3 A;  1Q2Q A;  3W4Q A;  3MBZ A;  4F94 A;  3Q81 A;  4GDN A;  3W8K A;  1FCM A;  3HLB A;  3O3V A;  5HL1 A;  1YQS A;  1KDS A;  2HDU A;  2WK0 A;  3SH9 A;  2WAE A;  2IWC A;  4GOG A;  3CZD A;  1NRF A;  2ZQC A;  4L0L A;  5EVI C;  1JWZ A;  3VMA A;  4EBL A;  5HAQ A;  1E3U D;  3MXS A;  3HVF A;  5CER A;  1N4O A;  2R9X A;  1NXY A;  2J8Y A;  4X53 A;  5AQB A;  4B4Z A;  3IXD A;  4KZ4 A;  5BOH A;  5KSC A;  1ONH A;  5AQ9 A;  1LI0 A;  5FQ9 A;  3IH9 A;  1MXO A;  3V5M A;  1CEG A;  4OOM A;  2OV5 A;  4X55 A;  3GMW A;  1YLT A;  3OCL A;  2RCX A;  3OPH A;  1O7E A;  4QD4 A;  4KQO A;  2ZM2 A;  5CTN A;  1MWU A;  5CRF A;  2WKE A;  3Q07 A;  4PM5 A;  3AGE A;  1Z6F A;  3BFF A;  4YFM A;  1SHV A;  4UA6 A;  2WKI A;  1BUE A;  1TDL A;  3E2K A;  3HUM A;  4PPR A;  3SH7 A;  3S1Y A;  3UDF A;  3MFD A;  3ZG9 B;  1K6R A;  1NZO A;  3FV7 A;  2Y2L A;  1DJA A;  1K54 C;  1KVM A;  3NDE A;  2PU4 A;  3A3D A;  3N8R A;  3ZG7 B;  1OME A;  2EX2 A;  2I72 A;  4ZBE A;  3S22 A;  1ESU A;  3V3S A;  1N9B A;  5F82 A;  2Q9M A;  1I2W A;  2EX8 A;  1KVL A;  4OOL A;  1FSW A;  4CJN A;  3ZNT A;  3IXG A;  3WS4 A;  1VQQ A;  2HDQ A;  3O87 A;  5FI6 A;  3FKV A;  1XX2 A;  4X69 A;  2WAF A;  5FI2 A;  1XP4 A;  2ZC7 A;  1BLS A;  2ZQ8 A;  4S2O A;  5E2E A;  3ZNY A;  3A3E A;  4N1X A;  4X68 A;  3ZHH A;  4WZ5 A;  1NYY A;  2EFX A;  4OPR A;  3BFC A;  2WKH A;  4U0X A;  5CXW A;  2ZQD A;  5IHV A;  5AQA A;  1TVF A;  4KG6 A;  5E2H A;  3G4P A;  1JTD A;  4E3N A;  4R4S A;  1PWC A;  3HLC A;  3OZH A;  1IEL A;  3LEZ A;  1JTG A;  4Y0U A;  3VSL A;  5CED A;  1FR6 A;  1RGY A;  4HEF A;  4X56 A;  1K55 A;  1K4F A;  1BZA A;  1KE3 A;  2H5S A;  4LV2 A;  2X01 A;  1SDN A;  5FI7 A;  2EFU A;  2X71 A;  1CK3 A;  1HD8 A;  4ID4 A;  5FQM A;  3HUN A;  3PTE A;  4O7D A;  4R1G A;  2DCF A;  2ZMA A;  1ES2 A;  2HDR A;  4JBF A;  5FQI A;  3TSG A;  4OOY A;  3QNB A;  1BSG A;  1L0D A;  4GNU A;  4PM9 A;  3AGF A;  5CGW A;  3UDI A;  3C4O A;  1TDG A;  1E3U A;  2C5W B;  3V50 A;  1K6S A;  1GHP A;  1MKI A;  1NYM A;  2ZM8 A;  1GHI A;  5GHY A;  4ZJ2 A;  5A90 A;  3VSK A;  1LI9 A;  3OCN A;  1HVB A;  1GA0 A;  1KDW A;  1XPB A;  4FD8 A;  5DVA A;  1CI9 A;  4N9L A;  4NET A;  4E3I A;  1WYC A;  1ESI A;  3UE1 A;  3ZG5 A;  1H8Z A;  2ZM0 A;  1LL5 A;  2WAD A;  3BEC A;  1DJC A;  4OLG A;  4XUX A;  3VP2 A;  1BLP A;  3W4O A;  1PI4 A;  3WS2 A;  4MBK A;  3GVB A;  4KZ9 A;  3OPR A;  4B88 A;  2DNS A;  3DW0 A;  3PBR A;  4E6W A;  4UAA A;  5I94 A;  2H10 A;  2Y2I A;  1IEM A;  5CHU A;  2V1Z A;  3O86 A;  5KSH A;  4IVK A;  1YM1 A;  4LV1 A;  2ZQ9 A;  1KGE A;  3B3X A;  1YMX A;  4QY5 A;  4E3O A;  3VOZ A;  2EX9 A;  1ZG6 A;  1ZG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...