4N9KA

Crystal structure of beta-lactamse penp_e166s in complex with cephaloridine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n9kA00
4ZDXA 1RGZA 4EBNA 1DJAA 1NXYA 4OLGA 5KZHA 5FA7A 4DE0A 1LLBA 3LY3A 3VOZA 3WS4A 1K6SA 3HREA 1FR6A 3OPHA 3BM6A 4YINA 1VQQA 2ZQ8A 5A91A 1MXOA 1IKGA 5F1FA 1SKFA 2DRWA 3AGDA 5A90A 2EX2A 3CZDA 3G4PA 1SHVA 3IF6B 4LV1A 3GRJA 4JXWA 3V3SA 3IHBA 3SH8A 2WKIA 3A3JA 3ZHHA 3LEZA 2WAFA 1L0FA 4OPRA 4PM8A 3GVBA 5FQ9A 5EVLA 3VSLA 4QHCA 3C5AA 3IF5A 2QMIA 1TDLA 3NC8A 4WZ5C 3WS2A 5HW3A 1QMEA 3UN7A 3VP4A 4GZBA 2H0TA 1QMFA 3IWIA 4IBXA 3QNBA 1DY6A 1U60A 1KE0A 3ZFZA 2ZC7A 5KMWA 3QNCA 4KZ8A 5CHMA 4S2IA 4F94A 4QD4A 3SOIA 2WZZA 3G2ZA 1PIOA 3DW0A 4DE2A 5KSCA 1KGGA 1NZOA 3S1YA 1WE4A 3PBSA 3P09A 4WYYA 4IBRA 4WEKA 4OOLA 5FQJA 5M18A 3OC2A 4CJNA 3OPLA 3PBNA 2Y2KA 1H8ZA 4OP8A 1ONGA 1YT4A 3HLGA 4DXBA 1K55C 3GQZA 4WZ5A 1SCWA 1N9BA 1YMXA 4DDSA 1CI8A 4U3TA 3Q07A 3I7JA 5M1AA 3S22A 5CECA 4BJPA 2WAEA 5FI2A 4GOGA 2RL3A 1YMSA 3PAEA 3B3XA 4JF4A 3V5MA 2EX8A 3C7UA 4KENB 4XXRA 5HAIA 4C75A 3BLSA 4RYEA 4DKIA 2Q9MA 2EX6A 2HDRA 3IWOA 5AQ7A 4ZBEA 2B5RA 4E3NA 3EQUA 1TVFA 2HP6A 3V3RA 5CEDA 2Y91A 4P0MA 1O07A 4X56A 5FAQA 3VOYA 1NYMA 1MBLA 4FCFA 3MZEA 2J7VA 4XUXA 1AXBA 4K91A 3MXSA 2C6WB 2RCXA 4HEFA 2PU2A 1RGYA 1KE3A 2Y59A 1LL5A 4WMCA 1IKIA 1PZPA 2DNSA 2QZ6A 3BLMA 3NDEA 4GD6A 4C3QA 4OQIA 3GR2A 3M6BA 4S2OA 1NRFA 3N8RA 3PBRA 4Y0UA 5HX9A 1LHYA 5E2GA 3TSGA 1JWPA 2IWBA 1ZC2A 2J8YA 4GDBA 3UE1A 2P9VB 4OLDA 3NDGA 1LL9A 1K38A 2A3UA 1K55A 4R3JA 2HP5A 1Z6FA 1E25A 4OQ0A 5DF9A 1EWZA 3ZVWA 1MKIA 1W8YA 5FQIA 2Y55A 4JPMA 3Q7VB 3IWQA 3OPPA 5AQ9A 3WWXA 1PZOA 1K54A 3IXGA 4WELA 2HDQA 5EUAA 4P6BA 3UDFA 3Q82A 5HAQA 1HD8A 2EXAA 3Q81A 4WMCD 3VP0A 4ZJ1A 1KDWA 4GD8A 2OV5A 4KQRA 2P9VA 3IXHA 3WS5A 4BQMA 1RP5A 4MBHA 3ZVTA 5U47A 4LCLA 3TOIA 4MEZA 5EPHA 5M19A 4KG5A 4WEJA 3PBTA 3IH9A 1KGEA 1FR1A 1M6KA 4EQIA 2HDUA 3HLWA 4BL3A 5HAPA 3M2JA 1NY0A 1YLZA 1H5XA 2BLSA 3IHAA 3MKFA 4NETA 4PM6A 5CXWA 1C3BA 1GHPA 2EX9A 1PI5A 4FSFA 4KG6A 4OP5A 3HLCA 1MWUA 2VGKA 3GTCA 4MBFA 2ZC4B 3UPPA 1YLTA 4UA9A 4X55A 2PBYA 1K57A 4JXSA 1SDNA 4IEDA 3IXBA 3HLEA 3Q1FA 5JYPA 3WRZA 1I2SA 5E43A 1E3UA 1G68A 3WS0A 1FSWA 2ZLYA 5FI6A 3G2YA 5DF8A 1YLYA 4U0XA 1CEGA 2A49A 2ZMAA 1Y54A 4PM9A 5JYOA 2H0YA 1MWTA 4B4XA 3A3EA 1KE4A 5DTKA 3V50A 2Z2LB 4PM5A 3CJMA 3ZNTA 4X6TA 5G18A 5EVIA 3UDIA 4QB8A 3G30A 4N1HA 4M3KA 4O7DA 5GHZA 5GL9A 2HDSA 3RXWA 1FOFA 1E4DA 3VFHA 2ZC3B 2WZXA 2Z2MB 2Y2PA 4JXGA 4OOYA 3WRTA 3N6IA 2WGWA 2QPNA 1W5DA 4KZAA 4QU3A 1GHMA 4UHUA 2ZM2A 2WGVA 4E6XA 4P87A 1MWRA 3ZG7B 5A93A 1JVJA 3ITAA 2ZJ9A 1JWZA 3LCEA 4MBKA 4B88A 1G6AA 3E2KA 1ES3A 2JC7A 3W4OA 4GKUA 1CEFA 4Q8IA 3SS3A 3N8LA 5BOHA 4ZTKA 4X53A 4ID4A 5CTNA 3IXDA 5TFQA 1PWGA 2Y2IA 3DWKA 4QJGA 1PYYA 4Y0TA 2XFSA 1BT5A 3RXXA 4LCMA 1M40A 4E3JA 1DJCA 4A5RA 1IYQA 2ZM8A 5F83A 3ZG5A 3W4PA 3D4FA 4PMAA 5CGSA 4N1XA 1XGIA 1ERMA 1KDSA 2XF3A 5D3OA 5L2FA 1FQGA 3QHYA 4S2NA 3UPNA 4S2JA 2BG1A 1KGFA 2H10A 4KZ9A 1LI9A 2ZQCA 4HESA 1ES4A 2R9WA 3LO7A 5DTTA 1S6RA 2JCHA 3BECA 3PBOA 3NIAA 4X69A 2J9OA 2V2FF 5EE8A 5IHVA 3ZG9B 2ZC6B 1IELA 1ERQA 3GMWA 1J9MA 1OMEA 1XPBA 3W8KA 3UNWA 2Y2JA 5EECA 2XD5A 3N7WA 3FV7A 1Q2QA 5GLCA 3SH9A 4R0QA 2X01A 5A92A 4ZAMA 3UO9A 3CG5A 5AQBA 1FSYA 1YLWA 5FDHA 2ZQAA 1YQSA 2XLNA 4QY5A 3PAGA 5J8XA 3N4IA 1S0WA 4HBUA 3AGFA 1LI0A 1ES2A 2OLUA 5CEBA 2PU4A 2I72A 2OSUA 1HZOA 1HTZA 2ZQDA 4S2MA 1GA0A 1FCOA 3O3VA 4BLMA 3BFDA 2XK1A 4E6WA 3OCNA 4EBLA 2V1ZA 1XP4A 1PW1A 2Y2OA 3C4OA 1ZG6A 1BLSA 3MFDA 4KZBA 4U0TA 4YFMA 4OOMA 3A3DA 5FQQA 4BD0A 3UPOA 4RA7A 3G34A 3A3FA 4OPQA 4UAAA 3SS4A 5KSHA 4NK3A 2XDMA 4RX3A 4DRTA 3BFEA 4JXVA 5FASA 3HUNA 5DF7A 4Z9QA 1EI5A 4JF5A 4OQGA 4R4SA 3NBLA 3MKEA 3BRMA 2OLVA 2VGJA 4UA6A 3BYDA 4DE3A 5E2FA 2ZM0A 3O87A 1XGJA 2Y2GA 1GHIA 4S2LA 4S2NC 3EQVA 5EVIB 5FSRA 2XR0A 2Q9NA 3ZG8B 1IYPA 4LV0A 4P85A 2Y2NA 1NZUA 5TGFA 3BEBA 2EXBA 4FH2A 2WADA 4D2OA 4KZ4A 1YM1A 1K57C 3E2LA 4IVIA 4KQQA 4XUZA 4KZ6A 5EOOA 1W8QA 3PTEA 1Q2PA 1XA1A 5FI7A 3UE3A 3N8SA 4ZJ3A 4K0WA 3A3IA 3SH7A 1K4EA 1RCJA 1N4OA 4KZ5A 4DF6A 3M2KA 5GLDA 4KZ7A 1K6RA 4LENA 4HBTA 4L0LA 1IYSA 3UDXA 2ZQ9A 4R3BA 5E2HA 4K0XA 2J9PA 4N92A 5FQKA 2X02A 5CERA 3OPRA 3VFFA 4OH0A 2ZD8A 3DWZA 3HUMA 5FQMA 3IT9A 4R23A 5AQAA 3JYIA 1YLPA 1W7FA 5CGXA 1GCEA 2IWDA 3FKVA 3WS1A 2V20A 4C6YA 4EV4A 2E8IA 4E3LA 4CPKA 2EFUA 2HP9A 4RVAA 1TEMA 3VMAA 5FATA 2GDNA 3M6HA 4R4RA 2FFYA 4JLFA 3AGEA 1ES5A 1ESIA 3C4PA 1ZG4A 5CTMA 2XFTA 3PBQA 1WYCA 1BUEA 3HLFA 4Y7PA 3Q7ZA 4LV2A 4N9LA 4PPRA 2XD1A 1PWCA 4JF6A 1MY8A 4MLLA 5CHJA 1K25A 2C5WB 4Y0OA 3HLBA 3ZDJA 3NCKA 1JTDA 1MPLA 1XXMA 2ZQ7A 1KVMA 5GLBA 2H5SA 3UY6A 1PW8A 4EBPA 1KVLA 4X68A 1H8YA 4N9KA 3V39A 3IF6A 4JBFA 1CK3A 1I5QA 3S4XA 3BFFA 4WBGA 1BLHA 4DXCA 2G2UA 4KZ3A 1ALQA 2HPBA 2WUQA 5F82A 1BZAA 4S2KA 3P98A 2WGWB 1BTLA 4KG2A 4OQHA 4OONA 4GN2A 4S2PA 3ZNYA 1L0GA 2JBFA 3IH8A 3BFGA 3HBRA 4GB7A 4WZ4A 5FAPA 1K56D 1WYBA 3MZDA 3LY4A 3MZFA 4KQOA 3HL9A 4LV3A 1DJBA 2DCFA 3ZG0A 4DDYA 1MWSA 2JE5A 3FYZA 5F1GA 5CHUA 3O86A 3OZHA 3HUOA 4BENA 4GNUA 3FKWA 2Y2HA 2G2WA 1IEMA 3NI9A 4B4ZA 5HFOA 4BL2A 1CI9A 1JTGA 5I94A 3OCLA 1XKZA 3BFCA 3C7VA 3HVFA 1NJ4A 1EROA 2Y2QA 3G31A 2WGIA 4GDNA 1TDGA 3ZCZA 3G32A 5GLAA 1L2SA 3SS5A 1ESUA 4BD1A 1XA7A 3MBZA 4E3OA 5GHYA 1K56A 3FZCA 3ISGA 2WKEA 3HLDA 2XH9A 1XX2A 4E3IA 5DTSA 2Y4AA 4R1GA 1E3UD 4OPYA 5E2EA 5FAOA 4ZJ2A 2X71A 1BULA 4H8RA 3W4QA 2WK0A 3G35A 1BSGA 1IYOA 3ZGAB 3VP2A 4WM9A 3Q7VA 4OVDA 5TR7A 4E3KA 4PM7A 5EVIC 1K4FA 1ZKJA 5EVID 3RJUA 2IWCA 2P74A 4UA7A 2ZC5B 1BLCA 4QY6A 4FD8A 4DE1A 4MNRA 4OKPA 1ONHA 1O7EA 2XEPA 3GV9A 1L0DA 3NY4A 1I2WA 5HARA 1JWVA 1GA9A 1W79A 3IF6C 4EUZA 1FCMA 2XGNA 2FFFB 5GHXA 4JKTA 3IQAA 2Y2LA 2XQZA 1PWDA 4EWFA 5CRFA 4OPZA 1VM1A 1L0EA 1SDEA 4FH4A 5HL1A 2Y2MA 1NYYA 4IVKA 2EFXA 3FWLA 5CGWA 3VSKA 1K54C 3GSGA 2R9XA 2CC1A 5DVAA 3TG9A 1YLJA 3UE0A 1BLPA 4RX2A 2UWXA 1HVBA 2WKHA 5EOEA 3MXRA 3DTMA 1FCNA 2WYXA 3VP3A 3ITBA 4E3MA 3VP1A 1PI4A 3O88A 3CMZA
chains in the Genus database with same CATH superfamily
5HSQA 1DJAA 2HGVA 1YKDA 4DE0A 3VOZA 3WS4A 4GLQA 1K6SA 3HREA 3BM6A 4YINA 1VQQA 3DTKA 3NULA 1MXOA 3QP4A 1IKGA 3U4LP 1SKFA 2DRWA 5A90A 2EX2A 1SHVA 3KSIA 1PNEA 3ZHHA 4Q0HA 2IA2A 3GVBA 3VSLA 1TDLA 3WS2A 3VP4A 3T4TA 4JGRA 5KMWA 4F94A 4DE2A 3G2ZA 4PHTA 5KSCA 3S1YA 3R4KA 1WE4A 4WYYA 1LT0A 2D01A 3OC2A 4CJNA 2Y2KA 3PYPA 1ONGA 4OP8A 1K55C 3JPUA 4WZ5A 3CUEA 1SCWA 2D02A 3C8CA 5LBRA 2HV1A 3I7JA 3V5MA 1YMSA 4H6JA 2QWSA 3NOUC 4C75A 4K08A 4RYEA 4HI4A 2HDRA 1Z09A 2B5RA 3NOPC 2R78A 1YSPA 1LL8A 3S7NA 2RCXA 4FTXA 1PZPA 3BLMA 4GD6A 4S2OA 4QWOA 3N8RA 3QP1A 2GJ3A 1F98A 1S1YA 3TSGA 1ZC2A 4GDBA 2P9VB 1LL9A 4R3JA 1E25A 1EWZA 3ZVWA 2A24B 1MKIA 5FQIA 4E04A 3OPPA 2JKTI 2W1TB 4F3LB 4ZJ1A 1KDWA 2VZWA 4BL3A 1T19A 1NY0A 4NETA 5FSRA 4FSFA 3LI8A 4XT2A 3GTCA 1S4RA 5E43A 3WS0A 3CPTB 2ZLYA 5FI6A 5DF8A 1VETA 4PM9A 4B4XA 1KE4A 4GHIA 3V50A 3NECA 3CJMA 4CLCB 5EVIA 3UDIA 4N1HA 5GHZA 3BJNA 2HDSA 2ZMFA 3B47A 1V9ZA 1G6OA 3UB7A 2WGWA 2QPNA 1W5DA 2WKRA 4HH3A 4UHUA 4WUJA 3F1PB 5AJGA 1JWZA 4B88A 2ZOIA 3HCYA 3W4OA 4NKPA 5AVFA 4ID4A 3RTYA 5HWVA 5DFXA 1PWGA 3UB9A 2Y2IA 3RXXA 4E3JA 3IS2B 3RH8B 3PXPA 3ZG5A 3W4PA 5CGSA 4BBVA 1KDSA 5D3OA 1FQGA 2XA7M 4NXBA 3UPNA 2BG1A 2VV8A 4KZ9A 4QPRA 4HESA 3LO7A 5EE8A 2ZC6B 1ERQA 2PD8A 1J9MA 1OMEA 4O01A 2VA0A 2Y2JA 2O9CA 1Q2QA 2W3GA 5HDSA 5GLCA 4R0QA 4ZAMA 5AQBA 2J3WA 1YLWA 3FG8A 3PAGA 1S0WA 4HBUA 1FIKA 1A0KA 1LI0A 1ES2A 1S66L 4IHQA 1HTZA 2HJEA 4JGOA 4Y0TA 1FCOA 5TBMA 3G6OA 3SZTA 1T1BA 1OPXA 2Z6CA 1BLSA 2Y8HA 4ETZA 1T18A 5FASA 1EI5A 4R38A 1DP8A 3BYDA 2Z6DA 2W3DA 3O87A 2Y2GA 4S2LA 4S2NC 2XR0A 2M7VA 4LV0A 5TGFA 4FH2A 3MR0A 2ZL1A 3K3DA 4IVIA 1SZVA 3LEQA 2GX5A 2OWJA 4KZ5A 4KZ7A 1YPRA 4LENA 4HBTA 5G4YA 2M1CA 1XFQA 1IYSA 4R3BA 5E2HA 4N92A 1OTIA 5J4EA 3HUMA 2PR5A 5K5BA 5CGXA 2IWDA 2PYPA 1TEMA 2GDNA 4R4RA 2V0WA 4JLFA 5CTMA 1BUEA 3HLFA 3Q7ZA 1K25A 2C5WB 1OTDA 3HLBA 3ZDJA 2ZQ7A 1XXMA 5GLBA 1KVMA 2H5SA 3UY6A 1KVLA 4CLCA 1H8YA 4N9KA 1P9RA 2VJWA 1CQAA 4WBGA 1BZAA 3ZNYA 4WZ4A 1DJBA 2DCFA 2JE5A 4HY8A 3HUOA 2G2WA 3NI9A 5HFOA 3JVUA 1JTGA 5I94A 1XKZA 3BFCA 3L9KA 3HVFA 1NJ4A 5IU1A 3ICYA 2XROA 1F9IA 4GDNA 3ZCZA 3G32A 3IX3A 1L2SA 3SS5A 1XA7A 1CJFA 2BASA 4IUKA 5DTSA 3K2NA 5HZHA 4WN5A 4ZJ2A 4H8RA 1BSGA 3Q7VA 3F1OB 4HOIA 1ZKJA 4BBUA 1O7EA 2JKFA 3NY4A 3A0RA 4HJ4A 1FCMA 2FFFB 4JKTA 2Y2LA 2XQZA 1PWDA 3F1OA 5CRFA 4OPZA 1NYYA 4IVKA 4R3AA 1K54C 3GSGA 2R9XA 2CC1A 3TG9A 3T1SA 1YLJA 2UWXA 4G3WA 4EEPA 3VP3A 1PI4A 5HPIA 4ZDXA 3MFXA 1RGZA 4EBNA 4FUWA 4OLGA 2OAQ1 5FA7A 4FOFA 4CLCE 3OPHA 3V67A 3G4PA 3IF6B 3GRJA 3IHBA 1G28A 4NXEA 3MSHA 2WAFA 1L0FA 4OPRA 3E98A 2P7JA 4QHCA 2J80A 3C5AA 3NC8A 5HW3A 1QMEA 4GZBA 2H0TA 4I3IA 3DTEA 3T4SA 1U60A 1OTBA 4HP4A 4II7A 3OOVA 5CHMA 4GS9B 2KOIA 3SOIA 3DW0A 2J3TC 1KGGA 3PBSA 5DFYA 2I9VA 4WEKA 4OOLA 1S1ZA 5FQJA 3IX8A 4I38A 4U3TA 3Q07A 2LB5A 5CECA 3PAEA 1WA9A 4XXRA 1AWIA 1YSQA 2Q9MA 3V3RA 5CEDA 2Y91A 4P0MA 4X56A 2UV0E 2V0UA 3MZEA 4K91A 3MXSA 4Q0IA 2GNXA 1KE3A 2Y59A 4WMCA 1LSWA 1IKIA 3R7WA 3MQ0A 1NRFA 4Y0UA 2QYBA 1JWPA 2IWBA 3KSHA 2EWVA 3T12B 1W8YA 2Y55A 3WWXA 1K54A 3IXGA 5EUAA 2EXAA 3Q81A 4WMCD 2JN7A 3EGDC 3LR5A 4KQRA 3ZVTA 4LCLA 5DKLA 3S7PA 1PRQA 4WEJA 3PBTA 1KGEA 4IJGA 2HDUA 2VKSA 3HLWA 4EU0A 2W1TA 4PM6A 3IHAA 3LIEA 3MKFA 2EX9A 2Q0OA 2O99A 3HJKA 3T4LA 2O9BA 4X55A 4G3VA 4JXSA 1SDNA 4IEDA 3IXBA 5C5KA 5F6AA 1I2SA 5EM0A 2V8FA 5KIZA 1Y54A 3DBAA 3ZNTA 4QB8A 4MDZA 4M3KA 1NLZA 3RXWA 2ZC3B 2WZXA 4OOYA 3NOTC 2ZM2A 3E4QA 1MWRA 5A93A 4JGPA 1JVJA 3LCEA 4X1MA 3KYQA 3E2KA 3OLOA 2JC7A 1CEFA 3SS3A 4ZTKA 3H82A 3F1NA 3LFVA 4QJGA 1D06A 2XFSA 1TF1A 4LCMA 1DJCA 4A5RA 2ZM8A 4ARZB 3D4FA 4PMAA 1XGIA 4UEYA 1TS0A 4S2NA 1ES4A 5DTTA 1S6RA 2JCHA 3BECA 3PBOA 3NIAA 4JGQA 2J9OA 2QJ5A 1H3QA 3GMWA 3TRCA 3UNWA 3NHQA 3N7WA 2KLIA 3FV7A 2JKTM 2XA7S 5A92A 3UO9A 1FSYA 1YQSA 5J8XA 3N4IA 5L8MA 1UGUA 2OLUA 3EGXC 2W0NA 5CEBA 2PU4A 2OSUA 1HZOA 3DTIA 3O3VA 4EBLA 1ZG6A 3MFDA 4KZBA 4U0TA 3UPOA 1OT9A 3A3DA 4BD0A 4RA7A 3G34A 4UAAA 4NK3A 4RX3A 4DRTA 2VK3A 1W63M 4JXVA 5DF7A 4H6JB 3VE3A 2PAVP 2OLVA 3FPWA 2VGJA 4DE3A 2L4RA 5E2FA 2ZM0A 4HHDA 1HLUP 1XGJA 1GHIA 5DJTA 5EVIB 5HPFA 3ZG8B 1IYPA 4P85A 4WF0A 2Y2NA 1NZUA 4D2OA 4KUOA 2W3EA 4KQQA 5EOOA 4ZJ3A 4PKYA 1Y28A 3A3IA 1K4EA 1RCJA 5GLDA 1K6RA 4GW9A 5FL3A 3UDXA 3MQOA 2W27A 4K0XA 1MC0A 2VX8A 2ZD8A 5FQMA 1UWNX 1YLPA 2V9AA 1GCEA 3WS1A 2V20A 4C6YA 1H0MA 4RVAA 2PBDP 1VEUA 4XT2B 3VMAA 2FFYA 1ESIA 1ODVA 3A0VA 4MLLA 4YWZA 5HWWA 3LICA 2HZ5A 5EM1A 3V39A 1BLHA 3KO6A 2G2UA 4KZ3A 1ALQA 2WUQA 4S2KA 2WGWB 1L0GA 2JBFA 3IH8A 4GB7A 5FAPA 1WYBA 4NXGA 3ZG0A 3FYZA 5F1GA 4GNUA 2DMWA 4CLCC 4CLCD 2B95A 3OCLA 1ZTUA 3LR3A 3ZYTA 3D3OA 2WGIA 3LIFA 2FZ0A 3R7WB 5GLAA 4HJ3A 3LIAA 5FDSA 5GHYA 2K7SA 3ISGA 3UB8A 2WKEA 3KYEA 2OOLA 1XX2A 2PYRA 4OPYA 5FAOA 1BULA 1IYOA 4ESPA 4WM9A 4LFUA 3KX0X 1K4FA 4RQ9A 4MNRA 1ONHA 2XEPA 3D9YA 3GV9A 1L0DA 4L9EA 2JKRI 1JWVA 1W79A 2XGNA 4I39A 5EFWA 4EWFA 1VM1A 4FH4A 3TE8A 1KOUA 3P7NA 3UE0A 1BLPA 4EXOA 5HL6A 1HVBA 2WKHA 5EVEA 4MN5A 4YNRA 2WYXA 4E3MA 4YOFA 1NXYA 4ARZA 3LY3A 4LLOB 1FR6A 4EETB 2XRNA 3MXQA 2PR6A 3AGDA 4LV1A 4CQHA 3LIDA 2VGLM 1OT6A 2AVXA 2W3FA 2ZL1B 1YAXA 5FQ9A 3UB5P 3IF5A 3LUQA 4WZ5C 1QMFA 3IWIA 4IBXA 3QNBA 4DJ3A 1DY6A 3T1XA 4HQAA 4ETXA 4Y17A 4Y2FA 3ZFZA 3QNCA 4S2IA 3U2AA 2WZZA 3F1PA 4BBTA 3P09A 1S67L 1H8MA 1TS8A 5M18A 3PBNA 1H8ZA 1YT4A 3HLGA 4DXBA 4HH2A 3UB6A 4DDSA 1CI8A 3O5YA 4BJPA 2RL3A 2GZAA 4JF4A 3VV4A 2EX8A 5TJJA 5HAIA 5AVEA 4DKIA 2EX6A 3IWOA 5AQ7A 4ZBEA 4LRYC 3EQUA 1ZHHB 4DJ2A 1O07A 5FAQA 4FCFA 4MN6A 2J7VA 3FC7A 1AXBA 2C6WB 4HEFA 2PU2A 1RGYA 3ZQ5A 3L7HA 5L10A 1Y4OA 2DNSA 5TBMB 2QZ6A 3NDEA 4OQIA 3GR2A 3M6BA 2L0WA 3PBRA 3MS6A 1LHYA 5E2GA 3UE1A 2O9AA 3NDGA 1P97A 4OQ0A 5DF9A 3Q7VB 3IWQA 4WELA 1P9WA 2HDQA 5HAQA 3Q82A 1HD8A 4BMWA 1UWPX 3VP0A 4GD8A 2OV5A 2P9VA 2NUTC 1RP5A 2E8JA 5DJUA 3TOIA 4MEZA 4KG5A 1P0ZA 4EQIA 5HAPA 4P6ZM 1YLZA 1C3BA 1GHPA 4KG6A 3HLCA 2VGKA 2JKGA 2PD7A 2ZC4B 1YLTA 4UA9A 4GJ4A 1K57A 3Q1FA 5JYPA 3WRZA 1G68A 1FSWA 3E4OA 3G2YA 4U0XA 1CEGA 5JYOA 4Y13A 2H0YA 1MWTA 5DTKA 3T4KA 4X6TA 5G18A 3G30A 4WL9A 4O7DA 1E4DA 3VFHA 2Z2MB 2QJ7A 3WRTA 3CPTA 3N6IA 2CMNA 3T4OA 1EW0A 4KZAA 4QU3A 1GHMA 4E6XA 3ZG7B 4PAUA 1D7EA 3IBJA 5IS1A 3N8LA 1T1CA 2XSSA 3BY9A 2QKPA 3DWKA 1BT5A 3H7WB 2EWWA 4R70A 2VLGA 3C30A 2WKPA 5IT5A 1ERMA 2BTFP 3QHYA 4MCWA 2V1AA 1LI9A 1K0KA 4L9GA 2R9WA 3K3CA 4X69A 2V2FF 2V8CA 1XPBA 3W8KA 5EECA 3SH9A 2X01A 3VE4A 2O0YA 5FDHA 2ZQAA 1DP6A 4DN0A 3MQQA 2P08A 3AGFA 4HJ6A 2PHYA 1GA0A 3BFDA 1JNUA 4UQIM 1IOUA 2Y2OA 3C4OA 2VV6A 5HDCA 4YFMA 5HDDA 4OOMA 3A3FA 1J3WA 1MZUA 1X0OA 2XDMA 2ZBBA 4Z9QA 4JF5A 3C2WA 4OQGA 3NBLA 4LGWA 3UE6A 3MKEA 3BRMA 4UA6A 3BQ8A 2EA9A 4NG2A 3EQVA 4AFIA 2ACGA 1V9YA 1S4SA 2WADA 3T1QB 4P6ZS 1YM1A 4XUZA 1DP9A 3PHYA 1W8QA 3PTEA 1XA1A 4Z1WA 3N8SA 4K0WA 3SH7A 1XJ6A 3M2KA 2A24A 4L0LA 5FQKA 2J9PA 3MF0A 3OPRA 3VFFA 1T1AA 2A2LA 2PT7A 5AQAA 3JYIA 2KX6A 4EV4A 4CPKA 2HP9A 3AGEA 1W63Q 2XFTA 3PBQA 1WYCA 4LV2A 4N9LA 1PWCA 4JF6A 1MY8A 2W3HA 4Y0OA 3NCKA 1JTDA 1MPLA 2V1BA 3IF6A 4JBFA 4X1LA 3S4XA 1I5QA 2INWA 3IBRA 3P98A 1N9NA 4GN2A 4S2PA 5EV0A 3B42A 1K56D 3MZDA 3LY4A 3IX4A 3MZFA 3HJIA 3HL9A 4LV3A 3A0SA 4DDYA 4Q0JA 2W1RA 5CHUA 3O86A 2Y2HA 1IEMA 4B4ZA 3KSGA 1XJ3A 3C7VA 5I5LA 2HF6A 3PR6A 4KUKA 4MN7A 3QP2A 4Y5FA 1PFLA 2Y2QA 3G31A 1TDGA 3E4PA 1ESUA 4BD1A 3FZCA 5F69A 3HLDA 1NLYA 4E3IA 2Y4AA 4R1GA 1E3UD 2X71A 1BYWA 3W4QA 2WK0A 1OJGA 1D1JA 4PM7A 2P74A 4DMZA 2ZC5B 1L3LA 4QY6A 4FD8A 1LSVA 4OKPA 3LI9A 2Y2MA 5CGWA 3FWLA 5DVAA 3CUEC 3MJQA 1N9OA 2VEAA 5EOEA 1LSXA 3MXRA 1FCNA 2LB9A 3ITBA 3VP1A 3RFBA 3O88A 3CMZA 4GHIB 3EOIA 5KZHA 3T1RA 1LLBA 4HP9A 2OWHA 3CITA 3KSFA 5A91A 2ZQ8A 2L1MA 5F1FA 4WLAA 1MKMA 4M4XA 3CZDA 4JXWA 3V3SA 3SH8A 2WKIA 3A3JA 3LEZA 4I3AA 1GSXA 1GSVA 4PM8A 5EVLA 2PRFA 2QMIA 1G5UA 1SKOB 3UN7A 5G4ZA 1KE0A 3JVVA 4EEUA 4PKYG 2ZC7A 4KZ8A 4EESA 4QD4A 1PIOA 1NZOA 4IBRA 1OTEA 4HIAA 3QP6A 3OPLA 4ZRRA 3TW8A 3GQZA 4GCZA 1N9BA 1YMXA 1OJ5A 5M1AA 3S22A 1GSWA 5J3WA 2WAEA 5FI2A 4GOGA 3B3XA 1CF0A 3C7UA 3H7WA 4KENB 4L9FA 2YKHA 3BLSA 4E3NA 4G3KA 4D60A 1TVFA 2HP6A 4KQDA 3VOLA 2H28A 1NYMA 1MBLA 3VOYA 4XUXA 3EEAA 1LL5A 5FEFA 1N9LA 4C3QA 4F3LA 5HX9A 5F68A 5CX7A 2J8YA 3EEHA 4OLDA 3S7OA 1K38A 2A3UA 1K55A 2HP5A 1Z6FA 3CWFA 3T50A 1STZA 2J3TD 4JPMA 4BWIA 5AQ9A 1PZOA 4P6BA 3UDFA 2B02A 2P04A 3IXHA 3WS5A 4BQMA 4MBHA 5U47A 4R6LA 4O8GA 5EPHA 5M19A 1XJ2A 1XFNA 3IH9A 1FR1A 1M6KA 3M2JA 5HL1A 1H5XA 2BLSA 5CXWA 1PI5A 2KDKA 4OP5A 3QP8A 1MWUA 4MBFA 3UPPA 2PBYA 3B33A 3HLEA 3LR4A 1E3UA 3W2ZA 1YLYA 2A49A 2ZMAA 3A3EA 4PM5A 2Z2LB 3CAXA 3GECA 3DAVA 3SW1A 3E0YA 5GL9A 3CLOA 4I5SA 1XJ4A 1FOFA 4JXGA 2Y2PA 4EUVA 3LR0A 1DRMA 3T4QA 1VEUB 2WGVA 3BW6A 4P87A 4ME4A 3D72A 3ITAA 4MBKA 2ZJ9A 3IS2A 1G6AA 1ES3A 4GKUA 4Q8IA 5BOHA 4X53A 5CTNA 3IXDA 5TFQA 3QP5A 1PYYA 4Y15A 4O0PA 2PDRA 1M40A 2Y79A 5HD3A 1IYQA 5F83A 5MC7A 4N1XA 2XF3A 5L2FA 4NEED 2M7UA 4S2JA 3BQAA 1KGFA 2H10A 2VGLS 2ZQCA 3FPVA 5IHVA 3ZG9B 1IELA 1F2KA 2XD5A 2ZMVA 3KYZA 3UMDA 3CG5A 4NXFA 1ACFA 2XLNA 4QY5A 1VB6A 2K2NA 2K31A 2I72A 3CHWP 3LIBA 5FEGA 2WKQA 2ZQDA 4S2MA 3CI6A 4E6WA 5F5YA 4BLMA 2XK1A 3OCNA 2V1ZA 1XP4A 4I3JA 1PW1A 5FQQA 4EERA 4OPQA 3SS4A 5KSHA 3BFEA 3HUNA 1F5MA 4R4SA 3ULFA 2Q9NA 2G7UA 3BEBA 2EXBA 4KZ4A 1K57C 2JKRM 3E2LA 5L09A 4B93A 5J7EA 4KZ6A 3BWLA 3NJAA 1Q2PA 3BY8A 5FI7A 3UE3A 3GDIA 1N4OA 4DF6A 4X25A 4EQ1A 2ZQ9A 3F1NB 2X02A 5CERA 4OH0A 3DWZA 3IT9A 4R23A 1NRJA 4EW7A 3MMHA 1W7FA 3FKVA 2E8IA 4E3LA 2EFUA 5DKKA 1SKOA 3TJZC 5FATA 3M6HA 1ES5A 3C4PA 1ZG4A 4Y7PA 3T4JA 4PPRA 1OTAA 2XD1A 5L07A 5CHJA 3H9WA 1PW8A 4EBPA 4X68A 2OAP1 2ZOHA 4MMNA 4LPZA 1CK3A 3BFFA 3LGOA 4DXCA 5F82A 1FILA 2HPBA 2NUPC 1IFQA 4B9OA 4OONA 1BTLA 4KG2A 4OQHA 3BFGA 3HBRA 4KQOA 1MWSA 2MJ6A 1VHMA 4IUHA 3OZHA 4LRXC 4BENA 3FKWA 4GS9A 4BL2A 1CI9A 3H82B 1NWZA 4LRZE 2QHKA 1EROA 3MBZA 4E3OA 1K56A 4Y3IA 2XH9A 4HNBA 5E2EA 3G35A 4UQIS 3P01A 3VP2A 3ZGAB 2VV7A 2JHEA 4OVDA 2B18A 5TR7A 4E3KA 1VETB 5EVIC 3RJUA 5EVID 2IWCA 4UA7A 2HJ9C 1BLCA 4DE1A 1TS6A 1I2WA 5HARA 1TS7A 3IF6C 1GA9A 4EUZA 5HD5A 5GHXA 3EWKA 3IQAA 3S7QA 3UMEA 1L0EA 1SDEA 3C38A 5HWTA 3OBFA 2EFXA 3VSKA 3LYXA 2FH5A 4RX2A 1TD5A 5A8BA 3DTMA 2YKFA
chains in the Genus database with same CATH topology
4ZDXA 1RGZA 4EBNA 1DJAA 1NXYA 4OLGA 5KZHA 5FA7A 4DE0A 1LLBA 3LY3A 3VOZA 3WS4A 1K6SA 3HREA 1FR6A 3OPHA 3BM6A 4YINA 1VQQA 2ZQ8A 5A91A 1MXOA 1IKGA 5F1FA 1SKFA 2DRWA 3AGDA 5A90A 2EX2A 3CZDA 3G4PA 1SHVA 3IF6B 4LV1A 3GRJA 4JXWA 3V3SA 3IHBA 3SH8A 2WKIA 3A3JA 3ZHHA 3LEZA 2WAFA 1L0FA 4OPRA 4PM8A 3GVBA 5FQ9A 5EVLA 3VSLA 4QHCA 3C5AA 3IF5A 2QMIA 1TDLA 3NC8A 4WZ5C 3WS2A 5HW3A 1QMEA 3UN7A 3VP4A 4GZBA 2H0TA 1QMFA 3IWIA 4IBXA 3QNBA 1DY6A 1U60A 1KE0A 3ZFZA 2ZC7A 5KMWA 3QNCA 4KZ8A 5CHMA 4S2IA 4F94A 4QD4A 3SOIA 2WZZA 3G2ZA 1PIOA 3DW0A 4DE2A 5KSCA 1KGGA 1NZOA 3S1YA 1WE4A 3PBSA 3P09A 4WYYA 4IBRA 4WEKA 4OOLA 5FQJA 5M18A 3OC2A 4CJNA 3OPLA 3PBNA 2Y2KA 1H8ZA 4OP8A 1ONGA 1YT4A 3HLGA 4DXBA 1K55C 3GQZA 4WZ5A 1SCWA 1N9BA 1YMXA 4DDSA 1CI8A 4U3TA 3Q07A 3I7JA 5M1AA 3S22A 5CECA 4BJPA 2WAEA 5FI2A 4GOGA 2RL3A 1YMSA 3PAEA 3B3XA 4JF4A 3V5MA 2EX8A 3C7UA 4KENB 4XXRA 5HAIA 4C75A 3BLSA 4RYEA 4DKIA 2Q9MA 2EX6A 2HDRA 3IWOA 5AQ7A 4ZBEA 2B5RA 4E3NA 3EQUA 1TVFA 2HP6A 3V3RA 5CEDA 2Y91A 4P0MA 1O07A 4X56A 5FAQA 3VOYA 1NYMA 1MBLA 4FCFA 3MZEA 2J7VA 4XUXA 1AXBA 4K91A 3MXSA 2C6WB 2RCXA 4HEFA 2PU2A 1RGYA 1KE3A 2Y59A 1LL5A 4WMCA 1IKIA 1PZPA 2DNSA 2QZ6A 3BLMA 3NDEA 4GD6A 4C3QA 4OQIA 3GR2A 3M6BA 4S2OA 1NRFA 3N8RA 3PBRA 4Y0UA 5HX9A 1LHYA 5E2GA 3TSGA 1JWPA 2IWBA 1ZC2A 2J8YA 4GDBA 3UE1A 2P9VB 4OLDA 3NDGA 1LL9A 1K38A 2A3UA 1K55A 4R3JA 2HP5A 1Z6FA 1E25A 4OQ0A 5DF9A 1EWZA 3ZVWA 1MKIA 1W8YA 5FQIA 2Y55A 4JPMA 3Q7VB 3IWQA 3OPPA 5AQ9A 3WWXA 1PZOA 1K54A 3IXGA 4WELA 2HDQA 5EUAA 4P6BA 3UDFA 3Q82A 5HAQA 1HD8A 2EXAA 3Q81A 4WMCD 3VP0A 4ZJ1A 1KDWA 4GD8A 2OV5A 4KQRA 2P9VA 3IXHA 3WS5A 4BQMA 1RP5A 4MBHA 3ZVTA 5U47A 4LCLA 3TOIA 4MEZA 5EPHA 5M19A 4KG5A 4WEJA 3PBTA 3IH9A 1KGEA 1FR1A 1M6KA 4EQIA 2HDUA 3HLWA 4BL3A 5HAPA 3M2JA 1NY0A 1YLZA 1H5XA 2BLSA 3IHAA 3MKFA 4NETA 4PM6A 5CXWA 1C3BA 1GHPA 2EX9A 1PI5A 4FSFA 4KG6A 4OP5A 3HLCA 1MWUA 2VGKA 3GTCA 4MBFA 2ZC4B 3UPPA 1YLTA 4UA9A 4X55A 2PBYA 1K57A 4JXSA 1SDNA 4IEDA 3IXBA 3HLEA 3Q1FA 5JYPA 3WRZA 1I2SA 5E43A 1E3UA 1G68A 3WS0A 1FSWA 2ZLYA 5FI6A 3G2YA 5DF8A 1YLYA 4U0XA 1CEGA 2A49A 2ZMAA 1Y54A 4PM9A 5JYOA 2H0YA 1MWTA 4B4XA 3A3EA 1KE4A 5DTKA 3V50A 2Z2LB 4PM5A 3CJMA 3ZNTA 4X6TA 5G18A 5EVIA 3UDIA 4QB8A 3G30A 4N1HA 4M3KA 4O7DA 5GHZA 5GL9A 2HDSA 3RXWA 1FOFA 1E4DA 3VFHA 2ZC3B 2WZXA 2Z2MB 2Y2PA 4JXGA 4OOYA 3WRTA 3N6IA 2WGWA 2QPNA 1W5DA 4KZAA 4QU3A 1GHMA 4UHUA 2ZM2A 2WGVA 4E6XA 4P87A 1MWRA 3ZG7B 5A93A 1JVJA 3ITAA 2ZJ9A 1JWZA 3LCEA 4MBKA 4B88A 1G6AA 3E2KA 1ES3A 2JC7A 3W4OA 4GKUA 1CEFA 4Q8IA 3SS3A 3N8LA 5BOHA 4ZTKA 4X53A 4ID4A 5CTNA 3IXDA 5TFQA 1PWGA 2Y2IA 3DWKA 4QJGA 1PYYA 4Y0TA 2XFSA 1BT5A 3RXXA 4LCMA 1M40A 4E3JA 1DJCA 4A5RA 1IYQA 2ZM8A 5F83A 3ZG5A 3W4PA 3D4FA 4PMAA 5CGSA 4N1XA 1XGIA 1ERMA 1KDSA 2XF3A 5D3OA 5L2FA 1FQGA 3QHYA 4S2NA 3UPNA 4S2JA 2BG1A 1KGFA 2H10A 4KZ9A 1LI9A 2ZQCA 4HESA 1ES4A 2R9WA 3LO7A 5DTTA 1S6RA 2JCHA 3BECA 3PBOA 3NIAA 4X69A 2J9OA 2V2FF 5EE8A 5IHVA 3ZG9B 2ZC6B 1IELA 1ERQA 3GMWA 1J9MA 1OMEA 1XPBA 3W8KA 3UNWA 2Y2JA 5EECA 2XD5A 3N7WA 3FV7A 1Q2QA 5GLCA 3SH9A 4R0QA 2X01A 5A92A 4ZAMA 3UO9A 3CG5A 5AQBA 1FSYA 1YLWA 5FDHA 2ZQAA 1YQSA 2XLNA 4QY5A 3PAGA 5J8XA 3N4IA 1S0WA 4HBUA 3AGFA 1LI0A 1ES2A 2OLUA 5CEBA 2PU4A 2I72A 2OSUA 1HZOA 1HTZA 2ZQDA 4S2MA 1GA0A 1FCOA 3O3VA 4BLMA 3BFDA 2XK1A 4E6WA 3OCNA 4EBLA 2V1ZA 1XP4A 1PW1A 2Y2OA 3C4OA 1ZG6A 1BLSA 3MFDA 4KZBA 4U0TA 4YFMA 4OOMA 3A3DA 5FQQA 4BD0A 3UPOA 4RA7A 3G34A 3A3FA 4OPQA 4UAAA 3SS4A 5KSHA 4NK3A 2XDMA 4RX3A 4DRTA 3BFEA 4JXVA 5FASA 3HUNA 5DF7A 4Z9QA 1EI5A 4JF5A 4OQGA 4R4SA 3NBLA 3MKEA 3BRMA 2OLVA 2VGJA 4UA6A 3BYDA 4DE3A 5E2FA 2ZM0A 3O87A 1XGJA 2Y2GA 1GHIA 4S2LA 4S2NC 3EQVA 5EVIB 5FSRA 2XR0A 2Q9NA 3ZG8B 1IYPA 4LV0A 4P85A 2Y2NA 1NZUA 5TGFA 3BEBA 2EXBA 4FH2A 2WADA 4D2OA 4KZ4A 1YM1A 1K57C 3E2LA 4IVIA 4KQQA 4XUZA 4KZ6A 5EOOA 1W8QA 3PTEA 1Q2PA 1XA1A 5FI7A 3UE3A 3N8SA 4ZJ3A 4K0WA 3A3IA 3SH7A 1K4EA 1RCJA 1N4OA 4KZ5A 4DF6A 3M2KA 5GLDA 4KZ7A 1K6RA 4LENA 4HBTA 4L0LA 1IYSA 3UDXA 2ZQ9A 4R3BA 5E2HA 4K0XA 2J9PA 4N92A 5FQKA 2X02A 5CERA 3OPRA 3VFFA 4OH0A 2ZD8A 3DWZA 3HUMA 5FQMA 3IT9A 4R23A 5AQAA 3JYIA 1YLPA 1W7FA 5CGXA 1GCEA 2IWDA 3FKVA 3WS1A 2V20A 4C6YA 4EV4A 2E8IA 4E3LA 4CPKA 2EFUA 2HP9A 4RVAA 1TEMA 3VMAA 5FATA 2GDNA 3M6HA 4R4RA 2FFYA 4JLFA 3AGEA 1ES5A 1ESIA 3C4PA 1ZG4A 5CTMA 2XFTA 3PBQA 1WYCA 1BUEA 3HLFA 4Y7PA 3Q7ZA 4LV2A 4N9LA 4PPRA 2XD1A 1PWCA 4JF6A 1MY8A 4MLLA 5CHJA 1K25A 2C5WB 4Y0OA 3HLBA 3ZDJA 3NCKA 1JTDA 1MPLA 1XXMA 2ZQ7A 1KVMA 5GLBA 2H5SA 3UY6A 1PW8A 4EBPA 1KVLA 4X68A 1H8YA 4N9KA 3V39A 3IF6A 4JBFA 1CK3A 1I5QA 3S4XA 3BFFA 4WBGA 1BLHA 4DXCA 2G2UA 4KZ3A 1ALQA 2HPBA 2WUQA 5F82A 1BZAA 4S2KA 3P98A 2WGWB 1BTLA 4KG2A 4OQHA 4OONA 4GN2A 4S2PA 3ZNYA 1L0GA 2JBFA 3IH8A 3BFGA 3HBRA 4GB7A 4WZ4A 5FAPA 1K56D 1WYBA 3MZDA 3LY4A 3MZFA 4KQOA 3HL9A 4LV3A 1DJBA 2DCFA 3ZG0A 4DDYA 1MWSA 2JE5A 3FYZA 5F1GA 5CHUA 3O86A 3OZHA 3HUOA 4BENA 4GNUA 3FKWA 2Y2HA 2G2WA 1IEMA 3NI9A 4B4ZA 5HFOA 4BL2A 1CI9A 1JTGA 5I94A 3OCLA 1XKZA 3BFCA 3C7VA 3HVFA 1NJ4A 1EROA 2Y2QA 3G31A 2WGIA 4GDNA 1TDGA 3ZCZA 3G32A 5GLAA 1L2SA 3SS5A 1ESUA 4BD1A 1XA7A 3MBZA 4E3OA 5GHYA 1K56A 3FZCA 3ISGA 2WKEA 3HLDA 2XH9A 1XX2A 4E3IA 5DTSA 2Y4AA 4R1GA 1E3UD 4OPYA 5E2EA 5FAOA 4ZJ2A 2X71A 1BULA 4H8RA 3W4QA 2WK0A 3G35A 1BSGA 1IYOA 3ZGAB 3VP2A 4WM9A 3Q7VA 4OVDA 5TR7A 4E3KA 4PM7A 5EVIC 1K4FA 1ZKJA 5EVID 3RJUA 2IWCA 2P74A 4UA7A 2ZC5B 1BLCA 4QY6A 4FD8A 4DE1A 4MNRA 4OKPA 1ONHA 1O7EA 2XEPA 3GV9A 1L0DA 3NY4A 1I2WA 5HARA 1JWVA 1GA9A 1W79A 3IF6C 4EUZA 1FCMA 2XGNA 2FFFB 5GHXA 4JKTA 3IQAA 2Y2LA 2XQZA 1PWDA 4EWFA 5CRFA 4OPZA 1VM1A 1L0EA 1SDEA 4FH4A 5HL1A 2Y2MA 1NYYA 4IVKA 2EFXA 3FWLA 5CGWA 3VSKA 1K54C 3GSGA 2R9XA 2CC1A 5DVAA 3TG9A 1YLJA 3UE0A 1BLPA 4RX2A 2UWXA 1HVBA 2WKHA 5EOEA 3MXRA 3DTMA 1FCNA 2WYXA 3VP3A 3ITBA 4E3MA 3VP1A 1PI4A 3O88A 3CMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDX A;  1RGZ A;  4EBN A;  1DJA A;  1NXY A;  4OLG A;  5KZH A;  5FA7 A;  4DE0 A;  1LLB A;  3LY3 A;  3VOZ A;  3WS4 A;  1K6S A;  3HRE A;  1FR6 A;  3OPH A;  3BM6 A;  4YIN A;  1VQQ A;  2ZQ8 A;  5A91 A;  1MXO A;  1IKG A;  5F1F A;  1SKF A;  2DRW A;  3AGD A;  5A90 A;  2EX2 A;  3CZD A;  3G4P A;  1SHV A;  3IF6 B;  4LV1 A;  3GRJ A;  4JXW A;  3V3S A;  3IHB A;  3SH8 A;  2WKI A;  3A3J A;  3ZHH A;  3LEZ A;  2WAF A;  1L0F A;  4OPR A;  4PM8 A;  3GVB A;  5FQ9 A;  5EVL A;  3VSL A;  4QHC A;  3C5A A;  3IF5 A;  2QMI A;  1TDL A;  3NC8 A;  4WZ5 C;  3WS2 A;  5HW3 A;  1QME A;  3UN7 A;  3VP4 A;  4GZB A;  2H0T A;  1QMF A;  3IWI A;  4IBX A;  3QNB A;  1DY6 A;  1U60 A;  1KE0 A;  3ZFZ A;  2ZC7 A;  5KMW A;  3QNC A;  4KZ8 A;  5CHM A;  4S2I A;  4F94 A;  4QD4 A;  3SOI A;  2WZZ A;  3G2Z A;  1PIO A;  3DW0 A;  4DE2 A;  5KSC A;  1KGG A;  1NZO A;  3S1Y A;  1WE4 A;  3PBS A;  3P09 A;  4WYY A;  4IBR A;  4WEK A;  4OOL A;  5FQJ A;  5M18 A;  3OC2 A;  4CJN A;  3OPL A;  3PBN A;  2Y2K A;  1H8Z A;  4OP8 A;  1ONG A;  1YT4 A;  3HLG A;  4DXB A;  1K55 C;  3GQZ A;  4WZ5 A;  1SCW A;  1N9B A;  1YMX A;  4DDS A;  1CI8 A;  4U3T A;  3Q07 A;  3I7J A;  5M1A A;  3S22 A;  5CEC A;  4BJP A;  2WAE A;  5FI2 A;  4GOG A;  2RL3 A;  1YMS A;  3PAE A;  3B3X A;  4JF4 A;  3V5M A;  2EX8 A;  3C7U A;  4KEN B;  4XXR A;  5HAI A;  4C75 A;  3BLS A;  4RYE A;  4DKI A;  2Q9M A;  2EX6 A;  2HDR A;  3IWO A;  5AQ7 A;  4ZBE A;  2B5R A;  4E3N A;  3EQU A;  1TVF A;  2HP6 A;  3V3R A;  5CED A;  2Y91 A;  4P0M A;  1O07 A;  4X56 A;  5FAQ A;  3VOY A;  1NYM A;  1MBL A;  4FCF A;  3MZE A;  2J7V A;  4XUX A;  1AXB A;  4K91 A;  3MXS A;  2C6W B;  2RCX A;  4HEF A;  2PU2 A;  1RGY A;  1KE3 A;  2Y59 A;  1LL5 A;  4WMC A;  1IKI A;  1PZP A;  2DNS A;  2QZ6 A;  3BLM A;  3NDE A;  4GD6 A;  4C3Q A;  4OQI A;  3GR2 A;  3M6B A;  4S2O A;  1NRF A;  3N8R A;  3PBR A;  4Y0U A;  5HX9 A;  1LHY A;  5E2G A;  3TSG A;  1JWP A;  2IWB A;  1ZC2 A;  2J8Y A;  4GDB A;  3UE1 A;  2P9V B;  4OLD A;  3NDG A;  1LL9 A;  1K38 A;  2A3U A;  1K55 A;  4R3J A;  2HP5 A;  1Z6F A;  1E25 A;  4OQ0 A;  5DF9 A;  1EWZ A;  3ZVW A;  1MKI A;  1W8Y A;  5FQI A;  2Y55 A;  4JPM A;  3Q7V B;  3IWQ A;  3OPP A;  5AQ9 A;  3WWX A;  1PZO A;  1K54 A;  3IXG A;  4WEL A;  2HDQ A;  5EUA A;  4P6B A;  3UDF A;  3Q82 A;  5HAQ A;  1HD8 A;  2EXA A;  3Q81 A;  4WMC D;  3VP0 A;  4ZJ1 A;  1KDW A;  4GD8 A;  2OV5 A;  4KQR A;  2P9V A;  3IXH A;  3WS5 A;  4BQM A;  1RP5 A;  4MBH A;  3ZVT A;  5U47 A;  4LCL A;  3TOI A;  4MEZ A;  5EPH A;  5M19 A;  4KG5 A;  4WEJ A;  3PBT A;  3IH9 A;  1KGE A;  1FR1 A;  1M6K A;  4EQI A;  2HDU A;  3HLW A;  4BL3 A;  5HAP A;  3M2J A;  1NY0 A;  1YLZ A;  1H5X A;  2BLS A;  3IHA A;  3MKF A;  4NET A;  4PM6 A;  5CXW A;  1C3B A;  1GHP A;  2EX9 A;  1PI5 A;  4FSF A;  4KG6 A;  4OP5 A;  3HLC A;  1MWU A;  2VGK A;  3GTC A;  4MBF A;  2ZC4 B;  3UPP A;  1YLT A;  4UA9 A;  4X55 A;  2PBY A;  1K57 A;  4JXS A;  1SDN A;  4IED A;  3IXB A;  3HLE A;  3Q1F A;  5JYP A;  3WRZ A;  1I2S A;  5E43 A;  1E3U A;  1G68 A;  3WS0 A;  1FSW A;  2ZLY A;  5FI6 A;  3G2Y A;  5DF8 A;  1YLY A;  4U0X A;  1CEG A;  2A49 A;  2ZMA A;  1Y54 A;  4PM9 A;  5JYO A;  2H0Y A;  1MWT A;  4B4X A;  3A3E A;  1KE4 A;  5DTK A;  3V50 A;  2Z2L B;  4PM5 A;  3CJM A;  3ZNT A;  4X6T A;  5G18 A;  5EVI A;  3UDI A;  4QB8 A;  3G30 A;  4N1H A;  4M3K A;  4O7D A;  5GHZ A;  5GL9 A;  2HDS A;  3RXW A;  1FOF A;  1E4D A;  3VFH A;  2ZC3 B;  2WZX A;  2Z2M B;  2Y2P A;  4JXG A;  4OOY A;  3WRT A;  3N6I A;  2WGW A;  2QPN A;  1W5D A;  4KZA A;  4QU3 A;  1GHM A;  4UHU A;  2ZM2 A;  2WGV A;  4E6X A;  4P87 A;  1MWR A;  3ZG7 B;  5A93 A;  1JVJ A;  3ITA A;  2ZJ9 A;  1JWZ A;  3LCE A;  4MBK A;  4B88 A;  1G6A A;  3E2K A;  1ES3 A;  2JC7 A;  3W4O A;  4GKU A;  1CEF A;  4Q8I A;  3SS3 A;  3N8L A;  5BOH A;  4ZTK A;  4X53 A;  4ID4 A;  5CTN A;  3IXD A;  5TFQ A;  1PWG A;  2Y2I A;  3DWK A;  4QJG A;  1PYY A;  4Y0T A;  2XFS A;  1BT5 A;  3RXX A;  4LCM A;  1M40 A;  4E3J A;  1DJC A;  4A5R A;  1IYQ A;  2ZM8 A;  5F83 A;  3ZG5 A;  3W4P A;  3D4F A;  4PMA A;  5CGS A;  4N1X A;  1XGI A;  1ERM A;  1KDS A;  2XF3 A;  5D3O A;  5L2F A;  1FQG A;  3QHY A;  4S2N A;  3UPN A;  4S2J A;  2BG1 A;  1KGF A;  2H10 A;  4KZ9 A;  1LI9 A;  2ZQC A;  4HES A;  1ES4 A;  2R9W A;  3LO7 A;  5DTT A;  1S6R A;  2JCH A;  3BEC A;  3PBO A;  3NIA A;  4X69 A;  2J9O A;  2V2F F;  5EE8 A;  5IHV A;  3ZG9 B;  2ZC6 B;  1IEL A;  1ERQ A;  3GMW A;  1J9M A;  1OME A;  1XPB A;  3W8K A;  3UNW A;  2Y2J A;  5EEC A;  2XD5 A;  3N7W A;  3FV7 A;  1Q2Q A;  5GLC A;  3SH9 A;  4R0Q A;  2X01 A;  5A92 A;  4ZAM A;  3UO9 A;  3CG5 A;  5AQB A;  1FSY A;  1YLW A;  5FDH A;  2ZQA A;  1YQS A;  2XLN A;  4QY5 A;  3PAG A;  5J8X A;  3N4I A;  1S0W A;  4HBU A;  3AGF A;  1LI0 A;  1ES2 A;  2OLU A;  5CEB A;  2PU4 A;  2I72 A;  2OSU A;  1HZO A;  1HTZ A;  2ZQD A;  4S2M A;  1GA0 A;  1FCO A;  3O3V A;  4BLM A;  3BFD A;  2XK1 A;  4E6W A;  3OCN A;  4EBL A;  2V1Z A;  1XP4 A;  1PW1 A;  2Y2O A;  3C4O A;  1ZG6 A;  1BLS A;  3MFD A;  4KZB A;  4U0T A;  4YFM A;  4OOM A;  3A3D A;  5FQQ A;  4BD0 A;  3UPO A;  4RA7 A;  3G34 A;  3A3F A;  4OPQ A;  4UAA A;  3SS4 A;  5KSH A;  4NK3 A;  2XDM A;  4RX3 A;  4DRT A;  3BFE A;  4JXV A;  5FAS A;  3HUN A;  5DF7 A;  4Z9Q A;  1EI5 A;  4JF5 A;  4OQG A;  4R4S A;  3NBL A;  3MKE A;  3BRM A;  2OLV A;  2VGJ A;  4UA6 A;  3BYD A;  4DE3 A;  5E2F A;  2ZM0 A;  3O87 A;  1XGJ A;  2Y2G A;  1GHI A;  4S2L A;  4S2N C;  3EQV A;  5EVI B;  5FSR A;  2XR0 A;  2Q9N A;  3ZG8 B;  1IYP A;  4LV0 A;  4P85 A;  2Y2N A;  1NZU A;  5TGF A;  3BEB A;  2EXB A;  4FH2 A;  2WAD A;  4D2O A;  4KZ4 A;  1YM1 A;  1K57 C;  3E2L A;  4IVI A;  4KQQ A;  4XUZ A;  4KZ6 A;  5EOO A;  1W8Q A;  3PTE A;  1Q2P A;  1XA1 A;  5FI7 A;  3UE3 A;  3N8S A;  4ZJ3 A;  4K0W A;  3A3I A;  3SH7 A;  1K4E A;  1RCJ A;  1N4O A;  4KZ5 A;  4DF6 A;  3M2K A;  5GLD A;  4KZ7 A;  1K6R A;  4LEN A;  4HBT A;  4L0L A;  1IYS A;  3UDX A;  2ZQ9 A;  4R3B A;  5E2H A;  4K0X A;  2J9P A;  4N92 A;  5FQK A;  2X02 A;  5CER A;  3OPR A;  3VFF A;  4OH0 A;  2ZD8 A;  3DWZ A;  3HUM A;  5FQM A;  3IT9 A;  4R23 A;  5AQA A;  3JYI A;  1YLP A;  1W7F A;  5CGX A;  1GCE A;  2IWD A;  3FKV A;  3WS1 A;  2V20 A;  4C6Y A;  4EV4 A;  2E8I A;  4E3L A;  4CPK A;  2EFU A;  2HP9 A;  4RVA A;  1TEM A;  3VMA A;  5FAT A;  2GDN A;  3M6H A;  4R4R A;  2FFY A;  4JLF A;  3AGE A;  1ES5 A;  1ESI A;  3C4P A;  1ZG4 A;  5CTM A;  2XFT A;  3PBQ A;  1WYC A;  1BUE A;  3HLF A;  4Y7P A;  3Q7Z A;  4LV2 A;  4N9L A;  4PPR A;  2XD1 A;  1PWC A;  4JF6 A;  1MY8 A;  4MLL A;  5CHJ A;  1K25 A;  2C5W B;  4Y0O A;  3HLB A;  3ZDJ A;  3NCK A;  1JTD A;  1MPL A;  1XXM A;  2ZQ7 A;  1KVM A;  5GLB A;  2H5S A;  3UY6 A;  1PW8 A;  4EBP A;  1KVL A;  4X68 A;  1H8Y A;  4N9K A;  3V39 A;  3IF6 A;  4JBF A;  1CK3 A;  1I5Q A;  3S4X A;  3BFF A;  4WBG A;  1BLH A;  4DXC A;  2G2U A;  4KZ3 A;  1ALQ A;  2HPB A;  2WUQ A;  5F82 A;  1BZA A;  4S2K A;  3P98 A;  2WGW B;  1BTL A;  4KG2 A;  4OQH A;  4OON A;  4GN2 A;  4S2P A;  3ZNY A;  1L0G A;  2JBF A;  3IH8 A;  3BFG A;  3HBR A;  4GB7 A;  4WZ4 A;  5FAP A;  1K56 D;  1WYB A;  3MZD A;  3LY4 A;  3MZF A;  4KQO A;  3HL9 A;  4LV3 A;  1DJB A;  2DCF A;  3ZG0 A;  4DDY A;  1MWS A;  2JE5 A;  3FYZ A;  5F1G A;  5CHU A;  3O86 A;  3OZH A;  3HUO A;  4BEN A;  4GNU A;  3FKW A;  2Y2H A;  2G2W A;  1IEM A;  3NI9 A;  4B4Z A;  5HFO A;  4BL2 A;  1CI9 A;  1JTG A;  5I94 A;  3OCL A;  1XKZ A;  3BFC A;  3C7V A;  3HVF A;  1NJ4 A;  1ERO A;  2Y2Q A;  3G31 A;  2WGI A;  4GDN A;  1TDG A;  3ZCZ A;  3G32 A;  5GLA A;  1L2S A;  3SS5 A;  1ESU A;  4BD1 A;  1XA7 A;  3MBZ A;  4E3O A;  5GHY A;  1K56 A;  3FZC A;  3ISG A;  2WKE A;  3HLD A;  2XH9 A;  1XX2 A;  4E3I A;  5DTS A;  2Y4A A;  4R1G A;  1E3U D;  4OPY A;  5E2E A;  5FAO A;  4ZJ2 A;  2X71 A;  1BUL A;  4H8R A;  3W4Q A;  2WK0 A;  3G35 A;  1BSG A;  1IYO A;  3ZGA B;  3VP2 A;  4WM9 A;  3Q7V A;  4OVD A;  5TR7 A;  4E3K A;  4PM7 A;  5EVI C;  1K4F A;  1ZKJ A;  5EVI D;  3RJU A;  2IWC A;  2P74 A;  4UA7 A;  2ZC5 B;  1BLC A;  4QY6 A;  4FD8 A;  4DE1 A;  4MNR A;  4OKP A;  1ONH A;  1O7E A;  2XEP A;  3GV9 A;  1L0D A;  3NY4 A;  1I2W A;  5HAR A;  1JWV A;  1GA9 A;  1W79 A;  3IF6 C;  4EUZ A;  1FCM A;  2XGN A;  2FFF B;  5GHX A;  4JKT A;  3IQA A;  2Y2L A;  2XQZ A;  1PWD A;  4EWF A;  5CRF A;  4OPZ A;  1VM1 A;  1L0E A;  1SDE A;  4FH4 A;  5HL1 A;  2Y2M A;  1NYY A;  4IVK A;  2EFX A;  3FWL A;  5CGW A;  3VSK A;  1K54 C;  3GSG A;  2R9X A;  2CC1 A;  5DVA A;  3TG9 A;  1YLJ A;  3UE0 A;  1BLP A;  4RX2 A;  2UWX A;  1HVB A;  2WKH A;  5EOE A;  3MXR A;  3DTM A;  1FCN A;  2WYX A;  3VP3 A;  3ITB A;  4E3M A;  3VP1 A;  1PI4 A;  3O88 A;  3CMZ A; 
#chains in the Genus database with same CATH topology
 5HSQ A;  1DJA A;  2HGV A;  1YKD A;  4DE0 A;  3VOZ A;  3WS4 A;  4GLQ A;  1K6S A;  3HRE A;  3BM6 A;  4YIN A;  1VQQ A;  3DTK A;  3NUL A;  1MXO A;  3QP4 A;  1IKG A;  3U4L P;  1SKF A;  2DRW A;  5A90 A;  2EX2 A;  1SHV A;  3KSI A;  1PNE A;  3ZHH A;  4Q0H A;  2IA2 A;  3GVB A;  3VSL A;  1TDL A;  3WS2 A;  3VP4 A;  3T4T A;  4JGR A;  5KMW A;  4F94 A;  4DE2 A;  3G2Z A;  4PHT A;  5KSC A;  3S1Y A;  3R4K A;  1WE4 A;  4WYY A;  1LT0 A;  2D01 A;  3OC2 A;  4CJN A;  2Y2K A;  3PYP A;  1ONG A;  4OP8 A;  1K55 C;  3JPU A;  4WZ5 A;  3CUE A;  1SCW A;  2D02 A;  3C8C A;  5LBR A;  2HV1 A;  3I7J A;  3V5M A;  1YMS A;  4H6J A;  2QWS A;  3NOU C;  4C75 A;  4K08 A;  4RYE A;  4HI4 A;  2HDR A;  1Z09 A;  2B5R A;  3NOP C;  2R78 A;  1YSP A;  1LL8 A;  3S7N A;  2RCX A;  4FTX A;  1PZP A;  3BLM A;  4GD6 A;  4S2O A;  4QWO A;  3N8R A;  3QP1 A;  2GJ3 A;  1F98 A;  1S1Y A;  3TSG A;  1ZC2 A;  4GDB A;  2P9V B;  1LL9 A;  4R3J A;  1E25 A;  1EWZ A;  3ZVW A;  2A24 B;  1MKI A;  5FQI A;  4E04 A;  3OPP A;  2JKT I;  2W1T B;  4F3L B;  4ZJ1 A;  1KDW A;  2VZW A;  4BL3 A;  1T19 A;  1NY0 A;  4NET A;  5FSR A;  4FSF A;  3LI8 A;  4XT2 A;  3GTC A;  1S4R A;  5E43 A;  3WS0 A;  3CPT B;  2ZLY A;  5FI6 A;  5DF8 A;  1VET A;  4PM9 A;  4B4X A;  1KE4 A;  4GHI A;  3V50 A;  3NEC A;  3CJM A;  4CLC B;  5EVI A;  3UDI A;  4N1H A;  5GHZ A;  3BJN A;  2HDS A;  2ZMF A;  3B47 A;  1V9Z A;  1G6O A;  3UB7 A;  2WGW A;  2QPN A;  1W5D A;  2WKR A;  4HH3 A;  4UHU A;  4WUJ A;  3F1P B;  5AJG A;  1JWZ A;  4B88 A;  2ZOI A;  3HCY A;  3W4O A;  4NKP A;  5AVF A;  4ID4 A;  3RTY A;  5HWV A;  5DFX A;  1PWG A;  3UB9 A;  2Y2I A;  3RXX A;  4E3J A;  3IS2 B;  3RH8 B;  3PXP A;  3ZG5 A;  3W4P A;  5CGS A;  4BBV A;  1KDS A;  5D3O A;  1FQG A;  2XA7 M;  4NXB A;  3UPN A;  2BG1 A;  2VV8 A;  4KZ9 A;  4QPR A;  4HES A;  3LO7 A;  5EE8 A;  2ZC6 B;  1ERQ A;  2PD8 A;  1J9M A;  1OME A;  4O01 A;  2VA0 A;  2Y2J A;  2O9C A;  1Q2Q A;  2W3G A;  5HDS A;  5GLC A;  4R0Q A;  4ZAM A;  5AQB A;  2J3W A;  1YLW A;  3FG8 A;  3PAG A;  1S0W A;  4HBU A;  1FIK A;  1A0K A;  1LI0 A;  1ES2 A;  1S66 L;  4IHQ A;  1HTZ A;  2HJE A;  4JGO A;  4Y0T A;  1FCO A;  5TBM A;  3G6O A;  3SZT A;  1T1B A;  1OPX A;  2Z6C A;  1BLS A;  2Y8H A;  4ETZ A;  1T18 A;  5FAS A;  1EI5 A;  4R38 A;  1DP8 A;  3BYD A;  2Z6D A;  2W3D A;  3O87 A;  2Y2G A;  4S2L A;  4S2N C;  2XR0 A;  2M7V A;  4LV0 A;  5TGF A;  4FH2 A;  3MR0 A;  2ZL1 A;  3K3D A;  4IVI A;  1SZV A;  3LEQ A;  2GX5 A;  2OWJ A;  4KZ5 A;  4KZ7 A;  1YPR A;  4LEN A;  4HBT A;  5G4Y A;  2M1C A;  1XFQ A;  1IYS A;  4R3B A;  5E2H A;  4N92 A;  1OTI A;  5J4E A;  3HUM A;  2PR5 A;  5K5B A;  5CGX A;  2IWD A;  2PYP A;  1TEM A;  2GDN A;  4R4R A;  2V0W A;  4JLF A;  5CTM A;  1BUE A;  3HLF A;  3Q7Z A;  1K25 A;  2C5W B;  1OTD A;  3HLB A;  3ZDJ A;  2ZQ7 A;  1XXM A;  5GLB A;  1KVM A;  2H5S A;  3UY6 A;  1KVL A;  4CLC A;  1H8Y A;  4N9K A;  1P9R A;  2VJW A;  1CQA A;  4WBG A;  1BZA A;  3ZNY A;  4WZ4 A;  1DJB A;  2DCF A;  2JE5 A;  4HY8 A;  3HUO A;  2G2W A;  3NI9 A;  5HFO A;  3JVU A;  1JTG A;  5I94 A;  1XKZ A;  3BFC A;  3L9K A;  3HVF A;  1NJ4 A;  5IU1 A;  3ICY A;  2XRO A;  1F9I A;  4GDN A;  3ZCZ A;  3G32 A;  3IX3 A;  1L2S A;  3SS5 A;  1XA7 A;  1CJF A;  2BAS A;  4IUK A;  5DTS A;  3K2N A;  5HZH A;  4WN5 A;  4ZJ2 A;  4H8R A;  1BSG A;  3Q7V A;  3F1O B;  4HOI A;  1ZKJ A;  4BBU A;  1O7E A;  2JKF A;  3NY4 A;  3A0R A;  4HJ4 A;  1FCM A;  2FFF B;  4JKT A;  2Y2L A;  2XQZ A;  1PWD A;  3F1O A;  5CRF A;  4OPZ A;  1NYY A;  4IVK A;  4R3A A;  1K54 C;  3GSG A;  2R9X A;  2CC1 A;  3TG9 A;  3T1S A;  1YLJ A;  2UWX A;  4G3W A;  4EEP A;  3VP3 A;  1PI4 A;  5HPI A;  4ZDX A;  3MFX A;  1RGZ A;  4EBN A;  4FUW A;  4OLG A;  2OAQ 1;  5FA7 A;  4FOF A;  4CLC E;  3OPH A;  3V67 A;  3G4P A;  3IF6 B;  3GRJ A;  3IHB A;  1G28 A;  4NXE A;  3MSH A;  2WAF A;  1L0F A;  4OPR A;  3E98 A;  2P7J A;  4QHC A;  2J80 A;  3C5A A;  3NC8 A;  5HW3 A;  1QME A;  4GZB A;  2H0T A;  4I3I A;  3DTE A;  3T4S A;  1U60 A;  1OTB A;  4HP4 A;  4II7 A;  3OOV A;  5CHM A;  4GS9 B;  2KOI A;  3SOI A;  3DW0 A;  2J3T C;  1KGG A;  3PBS A;  5DFY A;  2I9V A;  4WEK A;  4OOL A;  1S1Z A;  5FQJ A;  3IX8 A;  4I38 A;  4U3T A;  3Q07 A;  2LB5 A;  5CEC A;  3PAE A;  1WA9 A;  4XXR A;  1AWI A;  1YSQ A;  2Q9M A;  3V3R A;  5CED A;  2Y91 A;  4P0M A;  4X56 A;  2UV0 E;  2V0U A;  3MZE A;  4K91 A;  3MXS A;  4Q0I A;  2GNX A;  1KE3 A;  2Y59 A;  4WMC A;  1LSW A;  1IKI A;  3R7W A;  3MQ0 A;  1NRF A;  4Y0U A;  2QYB A;  1JWP A;  2IWB A;  3KSH A;  2EWV A;  3T12 B;  1W8Y A;  2Y55 A;  3WWX A;  1K54 A;  3IXG A;  5EUA A;  2EXA A;  3Q81 A;  4WMC D;  2JN7 A;  3EGD C;  3LR5 A;  4KQR A;  3ZVT A;  4LCL A;  5DKL A;  3S7P A;  1PRQ A;  4WEJ A;  3PBT A;  1KGE A;  4IJG A;  2HDU A;  2VKS A;  3HLW A;  4EU0 A;  2W1T A;  4PM6 A;  3IHA A;  3LIE A;  3MKF A;  2EX9 A;  2Q0O A;  2O99 A;  3HJK A;  3T4L A;  2O9B A;  4X55 A;  4G3V A;  4JXS A;  1SDN A;  4IED A;  3IXB A;  5C5K A;  5F6A A;  1I2S A;  5EM0 A;  2V8F A;  5KIZ A;  1Y54 A;  3DBA A;  3ZNT A;  4QB8 A;  4MDZ A;  4M3K A;  1NLZ A;  3RXW A;  2ZC3 B;  2WZX A;  4OOY A;  3NOT C;  2ZM2 A;  3E4Q A;  1MWR A;  5A93 A;  4JGP A;  1JVJ A;  3LCE A;  4X1M A;  3KYQ A;  3E2K A;  3OLO A;  2JC7 A;  1CEF A;  3SS3 A;  4ZTK A;  3H82 A;  3F1N A;  3LFV A;  4QJG A;  1D06 A;  2XFS A;  1TF1 A;  4LCM A;  1DJC A;  4A5R A;  2ZM8 A;  4ARZ B;  3D4F A;  4PMA A;  1XGI A;  4UEY A;  1TS0 A;  4S2N A;  1ES4 A;  5DTT A;  1S6R A;  2JCH A;  3BEC A;  3PBO A;  3NIA A;  4JGQ A;  2J9O A;  2QJ5 A;  1H3Q A;  3GMW A;  3TRC A;  3UNW A;  3NHQ A;  3N7W A;  2KLI A;  3FV7 A;  2JKT M;  2XA7 S;  5A92 A;  3UO9 A;  1FSY A;  1YQS A;  5J8X A;  3N4I A;  5L8M A;  1UGU A;  2OLU A;  3EGX C;  2W0N A;  5CEB A;  2PU4 A;  2OSU A;  1HZO A;  3DTI A;  3O3V A;  4EBL A;  1ZG6 A;  3MFD A;  4KZB A;  4U0T A;  3UPO A;  1OT9 A;  3A3D A;  4BD0 A;  4RA7 A;  3G34 A;  4UAA A;  4NK3 A;  4RX3 A;  4DRT A;  2VK3 A;  1W63 M;  4JXV A;  5DF7 A;  4H6J B;  3VE3 A;  2PAV P;  2OLV A;  3FPW A;  2VGJ A;  4DE3 A;  2L4R A;  5E2F A;  2ZM0 A;  4HHD A;  1HLU P;  1XGJ A;  1GHI A;  5DJT A;  5EVI B;  5HPF A;  3ZG8 B;  1IYP A;  4P85 A;  4WF0 A;  2Y2N A;  1NZU A;  4D2O A;  4KUO A;  2W3E A;  4KQQ A;  5EOO A;  4ZJ3 A;  4PKY A;  1Y28 A;  3A3I A;  1K4E A;  1RCJ A;  5GLD A;  1K6R A;  4GW9 A;  5FL3 A;  3UDX A;  3MQO A;  2W27 A;  4K0X A;  1MC0 A;  2VX8 A;  2ZD8 A;  5FQM A;  1UWN X;  1YLP A;  2V9A A;  1GCE A;  3WS1 A;  2V20 A;  4C6Y A;  1H0M A;  4RVA A;  2PBD P;  1VEU A;  4XT2 B;  3VMA A;  2FFY A;  1ESI A;  1ODV A;  3A0V A;  4MLL A;  4YWZ A;  5HWW A;  3LIC A;  2HZ5 A;  5EM1 A;  3V39 A;  1BLH A;  3KO6 A;  2G2U A;  4KZ3 A;  1ALQ A;  2WUQ A;  4S2K A;  2WGW B;  1L0G A;  2JBF A;  3IH8 A;  4GB7 A;  5FAP A;  1WYB A;  4NXG A;  3ZG0 A;  3FYZ A;  5F1G A;  4GNU A;  2DMW A;  4CLC C;  4CLC D;  2B95 A;  3OCL A;  1ZTU A;  3LR3 A;  3ZYT A;  3D3O A;  2WGI A;  3LIF A;  2FZ0 A;  3R7W B;  5GLA A;  4HJ3 A;  3LIA A;  5FDS A;  5GHY A;  2K7S A;  3ISG A;  3UB8 A;  2WKE A;  3KYE A;  2OOL A;  1XX2 A;  2PYR A;  4OPY A;  5FAO A;  1BUL A;  1IYO A;  4ESP A;  4WM9 A;  4LFU A;  3KX0 X;  1K4F A;  4RQ9 A;  4MNR A;  1ONH A;  2XEP A;  3D9Y A;  3GV9 A;  1L0D A;  4L9E A;  2JKR I;  1JWV A;  1W79 A;  2XGN A;  4I39 A;  5EFW A;  4EWF A;  1VM1 A;  4FH4 A;  3TE8 A;  1KOU A;  3P7N A;  3UE0 A;  1BLP A;  4EXO A;  5HL6 A;  1HVB A;  2WKH A;  5EVE A;  4MN5 A;  4YNR A;  2WYX A;  4E3M A;  4YOF A;  1NXY A;  4ARZ A;  3LY3 A;  4LLO B;  1FR6 A;  4EET B;  2XRN A;  3MXQ A;  2PR6 A;  3AGD A;  4LV1 A;  4CQH A;  3LID A;  2VGL M;  1OT6 A;  2AVX A;  2W3F A;  2ZL1 B;  1YAX A;  5FQ9 A;  3UB5 P;  3IF5 A;  3LUQ A;  4WZ5 C;  1QMF A;  3IWI A;  4IBX A;  3QNB A;  4DJ3 A;  1DY6 A;  3T1X A;  4HQA A;  4ETX A;  4Y17 A;  4Y2F A;  3ZFZ A;  3QNC A;  4S2I A;  3U2A A;  2WZZ A;  3F1P A;  4BBT A;  3P09 A;  1S67 L;  1H8M A;  1TS8 A;  5M18 A;  3PBN A;  1H8Z A;  1YT4 A;  3HLG A;  4DXB A;  4HH2 A;  3UB6 A;  4DDS A;  1CI8 A;  3O5Y A;  4BJP A;  2RL3 A;  2GZA A;  4JF4 A;  3VV4 A;  2EX8 A;  5TJJ A;  5HAI A;  5AVE A;  4DKI A;  2EX6 A;  3IWO A;  5AQ7 A;  4ZBE A;  4LRY C;  3EQU A;  1ZHH B;  4DJ2 A;  1O07 A;  5FAQ A;  4FCF A;  4MN6 A;  2J7V A;  3FC7 A;  1AXB A;  2C6W B;  4HEF A;  2PU2 A;  1RGY A;  3ZQ5 A;  3L7H A;  5L10 A;  1Y4O A;  2DNS A;  5TBM B;  2QZ6 A;  3NDE A;  4OQI A;  3GR2 A;  3M6B A;  2L0W A;  3PBR A;  3MS6 A;  1LHY A;  5E2G A;  3UE1 A;  2O9A A;  3NDG A;  1P97 A;  4OQ0 A;  5DF9 A;  3Q7V B;  3IWQ A;  4WEL A;  1P9W A;  2HDQ A;  5HAQ A;  3Q82 A;  1HD8 A;  4BMW A;  1UWP X;  3VP0 A;  4GD8 A;  2OV5 A;  2P9V A;  2NUT C;  1RP5 A;  2E8J A;  5DJU A;  3TOI A;  4MEZ A;  4KG5 A;  1P0Z A;  4EQI A;  5HAP A;  4P6Z M;  1YLZ A;  1C3B A;  1GHP A;  4KG6 A;  3HLC A;  2VGK A;  2JKG A;  2PD7 A;  2ZC4 B;  1YLT A;  4UA9 A;  4GJ4 A;  1K57 A;  3Q1F A;  5JYP A;  3WRZ A;  1G68 A;  1FSW A;  3E4O A;  3G2Y A;  4U0X A;  1CEG A;  5JYO A;  4Y13 A;  2H0Y A;  1MWT A;  5DTK A;  3T4K A;  4X6T A;  5G18 A;  3G30 A;  4WL9 A;  4O7D A;  1E4D A;  3VFH A;  2Z2M B;  2QJ7 A;  3WRT A;  3CPT A;  3N6I A;  2CMN A;  3T4O A;  1EW0 A;  4KZA A;  4QU3 A;  1GHM A;  4E6X A;  3ZG7 B;  4PAU A;  1D7E A;  3IBJ A;  5IS1 A;  3N8L A;  1T1C A;  2XSS A;  3BY9 A;  2QKP A;  3DWK A;  1BT5 A;  3H7W B;  2EWW A;  4R70 A;  2VLG A;  3C30 A;  2WKP A;  5IT5 A;  1ERM A;  2BTF P;  3QHY A;  4MCW A;  2V1A A;  1LI9 A;  1K0K A;  4L9G A;  2R9W A;  3K3C A;  4X69 A;  2V2F F;  2V8C A;  1XPB A;  3W8K A;  5EEC A;  3SH9 A;  2X01 A;  3VE4 A;  2O0Y A;  5FDH A;  2ZQA A;  1DP6 A;  4DN0 A;  3MQQ A;  2P08 A;  3AGF A;  4HJ6 A;  2PHY A;  1GA0 A;  3BFD A;  1JNU A;  4UQI M;  1IOU A;  2Y2O A;  3C4O A;  2VV6 A;  5HDC A;  4YFM A;  5HDD A;  4OOM A;  3A3F A;  1J3W A;  1MZU A;  1X0O A;  2XDM A;  2ZBB A;  4Z9Q A;  4JF5 A;  3C2W A;  4OQG A;  3NBL A;  4LGW A;  3UE6 A;  3MKE A;  3BRM A;  4UA6 A;  3BQ8 A;  2EA9 A;  4NG2 A;  3EQV A;  4AFI A;  2ACG A;  1V9Y A;  1S4S A;  2WAD A;  3T1Q B;  4P6Z S;  1YM1 A;  4XUZ A;  1DP9 A;  3PHY A;  1W8Q A;  3PTE A;  1XA1 A;  4Z1W A;  3N8S A;  4K0W A;  3SH7 A;  1XJ6 A;  3M2K A;  2A24 A;  4L0L A;  5FQK A;  2J9P A;  3MF0 A;  3OPR A;  3VFF A;  1T1A A;  2A2L A;  2PT7 A;  5AQA A;  3JYI A;  2KX6 A;  4EV4 A;  4CPK A;  2HP9 A;  3AGE A;  1W63 Q;  2XFT A;  3PBQ A;  1WYC A;  4LV2 A;  4N9L A;  1PWC A;  4JF6 A;  1MY8 A;  2W3H A;  4Y0O A;  3NCK A;  1JTD A;  1MPL A;  2V1B A;  3IF6 A;  4JBF A;  4X1L A;  3S4X A;  1I5Q A;  2INW A;  3IBR A;  3P98 A;  1N9N A;  4GN2 A;  4S2P A;  5EV0 A;  3B42 A;  1K56 D;  3MZD A;  3LY4 A;  3IX4 A;  3MZF A;  3HJI A;  3HL9 A;  4LV3 A;  3A0S A;  4DDY A;  4Q0J A;  2W1R A;  5CHU A;  3O86 A;  2Y2H A;  1IEM A;  4B4Z A;  3KSG A;  1XJ3 A;  3C7V A;  5I5L A;  2HF6 A;  3PR6 A;  4KUK A;  4MN7 A;  3QP2 A;  4Y5F A;  1PFL A;  2Y2Q A;  3G31 A;  1TDG A;  3E4P A;  1ESU A;  4BD1 A;  3FZC A;  5F69 A;  3HLD A;  1NLY A;  4E3I A;  2Y4A A;  4R1G A;  1E3U D;  2X71 A;  1BYW A;  3W4Q A;  2WK0 A;  1OJG A;  1D1J A;  4PM7 A;  2P74 A;  4DMZ A;  2ZC5 B;  1L3L A;  4QY6 A;  4FD8 A;  1LSV A;  4OKP A;  3LI9 A;  2Y2M A;  5CGW A;  3FWL A;  5DVA A;  3CUE C;  3MJQ A;  1N9O A;  2VEA A;  5EOE A;  1LSX A;  3MXR A;  1FCN A;  2LB9 A;  3ITB A;  3VP1 A;  3RFB A;  3O88 A;  3CMZ A;  4GHI B;  3EOI A;  5KZH A;  3T1R A;  1LLB A;  4HP9 A;  2OWH A;  3CIT A;  3KSF A;  5A91 A;  2ZQ8 A;  2L1M A;  5F1F A;  4WLA A;  1MKM A;  4M4X A;  3CZD A;  4JXW A;  3V3S A;  3SH8 A;  2WKI A;  3A3J A;  3LEZ A;  4I3A A;  1GSX A;  1GSV A;  4PM8 A;  5EVL A;  2PRF A;  2QMI A;  1G5U A;  1SKO B;  3UN7 A;  5G4Z A;  1KE0 A;  3JVV A;  4EEU A;  4PKY G;  2ZC7 A;  4KZ8 A;  4EES A;  4QD4 A;  1PIO A;  1NZO A;  4IBR A;  1OTE A;  4HIA A;  3QP6 A;  3OPL A;  4ZRR A;  3TW8 A;  3GQZ A;  4GCZ A;  1N9B A;  1YMX A;  1OJ5 A;  5M1A A;  3S22 A;  1GSW A;  5J3W A;  2WAE A;  5FI2 A;  4GOG A;  3B3X A;  1CF0 A;  3C7U A;  3H7W A;  4KEN B;  4L9F A;  2YKH A;  3BLS A;  4E3N A;  4G3K A;  4D60 A;  1TVF A;  2HP6 A;  4KQD A;  3VOL A;  2H28 A;  1NYM A;  1MBL A;  3VOY A;  4XUX A;  3EEA A;  1LL5 A;  5FEF A;  1N9L A;  4C3Q A;  4F3L A;  5HX9 A;  5F68 A;  5CX7 A;  2J8Y A;  3EEH A;  4OLD A;  3S7O A;  1K38 A;  2A3U A;  1K55 A;  2HP5 A;  1Z6F A;  3CWF A;  3T50 A;  1STZ A;  2J3T D;  4JPM A;  4BWI A;  5AQ9 A;  1PZO A;  4P6B A;  3UDF A;  2B02 A;  2P04 A;  3IXH A;  3WS5 A;  4BQM A;  4MBH A;  5U47 A;  4R6L A;  4O8G A;  5EPH A;  5M19 A;  1XJ2 A;  1XFN A;  3IH9 A;  1FR1 A;  1M6K A;  3M2J A;  5HL1 A;  1H5X A;  2BLS A;  5CXW A;  1PI5 A;  2KDK A;  4OP5 A;  3QP8 A;  1MWU A;  4MBF A;  3UPP A;  2PBY A;  3B33 A;  3HLE A;  3LR4 A;  1E3U A;  3W2Z A;  1YLY A;  2A49 A;  2ZMA A;  3A3E A;  4PM5 A;  2Z2L B;  3CAX A;  3GEC A;  3DAV A;  3SW1 A;  3E0Y A;  5GL9 A;  3CLO A;  4I5S A;  1XJ4 A;  1FOF A;  4JXG A;  2Y2P A;  4EUV A;  3LR0 A;  1DRM A;  3T4Q A;  1VEU B;  2WGV A;  3BW6 A;  4P87 A;  4ME4 A;  3D72 A;  3ITA A;  4MBK A;  2ZJ9 A;  3IS2 A;  1G6A A;  1ES3 A;  4GKU A;  4Q8I A;  5BOH A;  4X53 A;  5CTN A;  3IXD A;  5TFQ A;  3QP5 A;  1PYY A;  4Y15 A;  4O0P A;  2PDR A;  1M40 A;  2Y79 A;  5HD3 A;  1IYQ A;  5F83 A;  5MC7 A;  4N1X A;  2XF3 A;  5L2F A;  4NEE D;  2M7U A;  4S2J A;  3BQA A;  1KGF A;  2H10 A;  2VGL S;  2ZQC A;  3FPV A;  5IHV A;  3ZG9 B;  1IEL A;  1F2K A;  2XD5 A;  2ZMV A;  3KYZ A;  3UMD A;  3CG5 A;  4NXF A;  1ACF A;  2XLN A;  4QY5 A;  1VB6 A;  2K2N A;  2K31 A;  2I72 A;  3CHW P;  3LIB A;  5FEG A;  2WKQ A;  2ZQD A;  4S2M A;  3CI6 A;  4E6W A;  5F5Y A;  4BLM A;  2XK1 A;  3OCN A;  2V1Z A;  1XP4 A;  4I3J A;  1PW1 A;  5FQQ A;  4EER A;  4OPQ A;  3SS4 A;  5KSH A;  3BFE A;  3HUN A;  1F5M A;  4R4S A;  3ULF A;  2Q9N A;  2G7U A;  3BEB A;  2EXB A;  4KZ4 A;  1K57 C;  2JKR M;  3E2L A;  5L09 A;  4B93 A;  5J7E A;  4KZ6 A;  3BWL A;  3NJA A;  1Q2P A;  3BY8 A;  5FI7 A;  3UE3 A;  3GDI A;  1N4O A;  4DF6 A;  4X25 A;  4EQ1 A;  2ZQ9 A;  3F1N B;  2X02 A;  5CER A;  4OH0 A;  3DWZ A;  3IT9 A;  4R23 A;  1NRJ A;  4EW7 A;  3MMH A;  1W7F A;  3FKV A;  2E8I A;  4E3L A;  2EFU A;  5DKK A;  1SKO A;  3TJZ C;  5FAT A;  3M6H A;  1ES5 A;  3C4P A;  1ZG4 A;  4Y7P A;  3T4J A;  4PPR A;  1OTA A;  2XD1 A;  5L07 A;  5CHJ A;  3H9W A;  1PW8 A;  4EBP A;  4X68 A;  2OAP 1;  2ZOH A;  4MMN A;  4LPZ A;  1CK3 A;  3BFF A;  3LGO A;  4DXC A;  5F82 A;  1FIL A;  2HPB A;  2NUP C;  1IFQ A;  4B9O A;  4OON A;  1BTL A;  4KG2 A;  4OQH A;  3BFG A;  3HBR A;  4KQO A;  1MWS A;  2MJ6 A;  1VHM A;  4IUH A;  3OZH A;  4LRX C;  4BEN A;  3FKW A;  4GS9 A;  4BL2 A;  1CI9 A;  3H82 B;  1NWZ A;  4LRZ E;  2QHK A;  1ERO A;  3MBZ A;  4E3O A;  1K56 A;  4Y3I A;  2XH9 A;  4HNB A;  5E2E A;  3G35 A;  4UQI S;  3P01 A;  3VP2 A;  3ZGA B;  2VV7 A;  2JHE A;  4OVD A;  2B18 A;  5TR7 A;  4E3K A;  1VET B;  5EVI C;  3RJU A;  5EVI D;  2IWC A;  4UA7 A;  2HJ9 C;  1BLC A;  4DE1 A;  1TS6 A;  1I2W A;  5HAR A;  1TS7 A;  3IF6 C;  1GA9 A;  4EUZ A;  5HD5 A;  5GHX A;  3EWK A;  3IQA A;  3S7Q A;  3UME A;  1L0E A;  1SDE A;  3C38 A;  5HWT A;  3OBF A;  2EFX A;  3VSK A;  3LYX A;  2FH5 A;  4RX2 A;  1TD5 A;  5A8B A;  3DTM A;  2YKF A; 
#chains in the Genus database with same CATH homology
 4ZDX A;  1RGZ A;  4EBN A;  1DJA A;  1NXY A;  4OLG A;  5KZH A;  5FA7 A;  4DE0 A;  1LLB A;  3LY3 A;  3VOZ A;  3WS4 A;  1K6S A;  3HRE A;  1FR6 A;  3OPH A;  3BM6 A;  4YIN A;  1VQQ A;  2ZQ8 A;  5A91 A;  1MXO A;  1IKG A;  5F1F A;  1SKF A;  2DRW A;  3AGD A;  5A90 A;  2EX2 A;  3CZD A;  3G4P A;  1SHV A;  3IF6 B;  4LV1 A;  3GRJ A;  4JXW A;  3V3S A;  3IHB A;  3SH8 A;  2WKI A;  3A3J A;  3ZHH A;  3LEZ A;  2WAF A;  1L0F A;  4OPR A;  4PM8 A;  3GVB A;  5FQ9 A;  5EVL A;  3VSL A;  4QHC A;  3C5A A;  3IF5 A;  2QMI A;  1TDL A;  3NC8 A;  4WZ5 C;  3WS2 A;  5HW3 A;  1QME A;  3UN7 A;  3VP4 A;  4GZB A;  2H0T A;  1QMF A;  3IWI A;  4IBX A;  3QNB A;  1DY6 A;  1U60 A;  1KE0 A;  3ZFZ A;  2ZC7 A;  5KMW A;  3QNC A;  4KZ8 A;  5CHM A;  4S2I A;  4F94 A;  4QD4 A;  3SOI A;  2WZZ A;  3G2Z A;  1PIO A;  3DW0 A;  4DE2 A;  5KSC A;  1KGG A;  1NZO A;  3S1Y A;  1WE4 A;  3PBS A;  3P09 A;  4WYY A;  4IBR A;  4WEK A;  4OOL A;  5FQJ A;  5M18 A;  3OC2 A;  4CJN A;  3OPL A;  3PBN A;  2Y2K A;  1H8Z A;  4OP8 A;  1ONG A;  1YT4 A;  3HLG A;  4DXB A;  1K55 C;  3GQZ A;  4WZ5 A;  1SCW A;  1N9B A;  1YMX A;  4DDS A;  1CI8 A;  4U3T A;  3Q07 A;  3I7J A;  5M1A A;  3S22 A;  5CEC A;  4BJP A;  2WAE A;  5FI2 A;  4GOG A;  2RL3 A;  1YMS A;  3PAE A;  3B3X A;  4JF4 A;  3V5M A;  2EX8 A;  3C7U A;  4KEN B;  4XXR A;  5HAI A;  4C75 A;  3BLS A;  4RYE A;  4DKI A;  2Q9M A;  2EX6 A;  2HDR A;  3IWO A;  5AQ7 A;  4ZBE A;  2B5R A;  4E3N A;  3EQU A;  1TVF A;  2HP6 A;  3V3R A;  5CED A;  2Y91 A;  4P0M A;  1O07 A;  4X56 A;  5FAQ A;  3VOY A;  1NYM A;  1MBL A;  4FCF A;  3MZE A;  2J7V A;  4XUX A;  1AXB A;  4K91 A;  3MXS A;  2C6W B;  2RCX A;  4HEF A;  2PU2 A;  1RGY A;  1KE3 A;  2Y59 A;  1LL5 A;  4WMC A;  1IKI A;  1PZP A;  2DNS A;  2QZ6 A;  3BLM A;  3NDE A;  4GD6 A;  4C3Q A;  4OQI A;  3GR2 A;  3M6B A;  4S2O A;  1NRF A;  3N8R A;  3PBR A;  4Y0U A;  5HX9 A;  1LHY A;  5E2G A;  3TSG A;  1JWP A;  2IWB A;  1ZC2 A;  2J8Y A;  4GDB A;  3UE1 A;  2P9V B;  4OLD A;  3NDG A;  1LL9 A;  1K38 A;  2A3U A;  1K55 A;  4R3J A;  2HP5 A;  1Z6F A;  1E25 A;  4OQ0 A;  5DF9 A;  1EWZ A;  3ZVW A;  1MKI A;  1W8Y A;  5FQI A;  2Y55 A;  4JPM A;  3Q7V B;  3IWQ A;  3OPP A;  5AQ9 A;  3WWX A;  1PZO A;  1K54 A;  3IXG A;  4WEL A;  2HDQ A;  5EUA A;  4P6B A;  3UDF A;  3Q82 A;  5HAQ A;  1HD8 A;  2EXA A;  3Q81 A;  4WMC D;  3VP0 A;  4ZJ1 A;  1KDW A;  4GD8 A;  2OV5 A;  4KQR A;  2P9V A;  3IXH A;  3WS5 A;  4BQM A;  1RP5 A;  4MBH A;  3ZVT A;  5U47 A;  4LCL A;  3TOI A;  4MEZ A;  5EPH A;  5M19 A;  4KG5 A;  4WEJ A;  3PBT A;  3IH9 A;  1KGE A;  1FR1 A;  1M6K A;  4EQI A;  2HDU A;  3HLW A;  4BL3 A;  5HAP A;  3M2J A;  1NY0 A;  1YLZ A;  1H5X A;  2BLS A;  3IHA A;  3MKF A;  4NET A;  4PM6 A;  5CXW A;  1C3B A;  1GHP A;  2EX9 A;  1PI5 A;  4FSF A;  4KG6 A;  4OP5 A;  3HLC A;  1MWU A;  2VGK A;  3GTC A;  4MBF A;  2ZC4 B;  3UPP A;  1YLT A;  4UA9 A;  4X55 A;  2PBY A;  1K57 A;  4JXS A;  1SDN A;  4IED A;  3IXB A;  3HLE A;  3Q1F A;  5JYP A;  3WRZ A;  1I2S A;  5E43 A;  1E3U A;  1G68 A;  3WS0 A;  1FSW A;  2ZLY A;  5FI6 A;  3G2Y A;  5DF8 A;  1YLY A;  4U0X A;  1CEG A;  2A49 A;  2ZMA A;  1Y54 A;  4PM9 A;  5JYO A;  2H0Y A;  1MWT A;  4B4X A;  3A3E A;  1KE4 A;  5DTK A;  3V50 A;  2Z2L B;  4PM5 A;  3CJM A;  3ZNT A;  4X6T A;  5G18 A;  5EVI A;  3UDI A;  4QB8 A;  3G30 A;  4N1H A;  4M3K A;  4O7D A;  5GHZ A;  5GL9 A;  2HDS A;  3RXW A;  1FOF A;  1E4D A;  3VFH A;  2ZC3 B;  2WZX A;  2Z2M B;  2Y2P A;  4JXG A;  4OOY A;  3WRT A;  3N6I A;  2WGW A;  2QPN A;  1W5D A;  4KZA A;  4QU3 A;  1GHM A;  4UHU A;  2ZM2 A;  2WGV A;  4E6X A;  4P87 A;  1MWR A;  3ZG7 B;  5A93 A;  1JVJ A;  3ITA A;  2ZJ9 A;  1JWZ A;  3LCE A;  4MBK A;  4B88 A;  1G6A A;  3E2K A;  1ES3 A;  2JC7 A;  3W4O A;  4GKU A;  1CEF A;  4Q8I A;  3SS3 A;  3N8L A;  5BOH A;  4ZTK A;  4X53 A;  4ID4 A;  5CTN A;  3IXD A;  5TFQ A;  1PWG A;  2Y2I A;  3DWK A;  4QJG A;  1PYY A;  4Y0T A;  2XFS A;  1BT5 A;  3RXX A;  4LCM A;  1M40 A;  4E3J A;  1DJC A;  4A5R A;  1IYQ A;  2ZM8 A;  5F83 A;  3ZG5 A;  3W4P A;  3D4F A;  4PMA A;  5CGS A;  4N1X A;  1XGI A;  1ERM A;  1KDS A;  2XF3 A;  5D3O A;  5L2F A;  1FQG A;  3QHY A;  4S2N A;  3UPN A;  4S2J A;  2BG1 A;  1KGF A;  2H10 A;  4KZ9 A;  1LI9 A;  2ZQC A;  4HES A;  1ES4 A;  2R9W A;  3LO7 A;  5DTT A;  1S6R A;  2JCH A;  3BEC A;  3PBO A;  3NIA A;  4X69 A;  2J9O A;  2V2F F;  5EE8 A;  5IHV A;  3ZG9 B;  2ZC6 B;  1IEL A;  1ERQ A;  3GMW A;  1J9M A;  1OME A;  1XPB A;  3W8K A;  3UNW A;  2Y2J A;  5EEC A;  2XD5 A;  3N7W A;  3FV7 A;  1Q2Q A;  5GLC A;  3SH9 A;  4R0Q A;  2X01 A;  5A92 A;  4ZAM A;  3UO9 A;  3CG5 A;  5AQB A;  1FSY A;  1YLW A;  5FDH A;  2ZQA A;  1YQS A;  2XLN A;  4QY5 A;  3PAG A;  5J8X A;  3N4I A;  1S0W A;  4HBU A;  3AGF A;  1LI0 A;  1ES2 A;  2OLU A;  5CEB A;  2PU4 A;  2I72 A;  2OSU A;  1HZO A;  1HTZ A;  2ZQD A;  4S2M A;  1GA0 A;  1FCO A;  3O3V A;  4BLM A;  3BFD A;  2XK1 A;  4E6W A;  3OCN A;  4EBL A;  2V1Z A;  1XP4 A;  1PW1 A;  2Y2O A;  3C4O A;  1ZG6 A;  1BLS A;  3MFD A;  4KZB A;  4U0T A;  4YFM A;  4OOM A;  3A3D A;  5FQQ A;  4BD0 A;  3UPO A;  4RA7 A;  3G34 A;  3A3F A;  4OPQ A;  4UAA A;  3SS4 A;  5KSH A;  4NK3 A;  2XDM A;  4RX3 A;  4DRT A;  3BFE A;  4JXV A;  5FAS A;  3HUN A;  5DF7 A;  4Z9Q A;  1EI5 A;  4JF5 A;  4OQG A;  4R4S A;  3NBL A;  3MKE A;  3BRM A;  2OLV A;  2VGJ A;  4UA6 A;  3BYD A;  4DE3 A;  5E2F A;  2ZM0 A;  3O87 A;  1XGJ A;  2Y2G A;  1GHI A;  4S2L A;  4S2N C;  3EQV A;  5EVI B;  5FSR A;  2XR0 A;  2Q9N A;  3ZG8 B;  1IYP A;  4LV0 A;  4P85 A;  2Y2N A;  1NZU A;  5TGF A;  3BEB A;  2EXB A;  4FH2 A;  2WAD A;  4D2O A;  4KZ4 A;  1YM1 A;  1K57 C;  3E2L A;  4IVI A;  4KQQ A;  4XUZ A;  4KZ6 A;  5EOO A;  1W8Q A;  3PTE A;  1Q2P A;  1XA1 A;  5FI7 A;  3UE3 A;  3N8S A;  4ZJ3 A;  4K0W A;  3A3I A;  3SH7 A;  1K4E A;  1RCJ A;  1N4O A;  4KZ5 A;  4DF6 A;  3M2K A;  5GLD A;  4KZ7 A;  1K6R A;  4LEN A;  4HBT A;  4L0L A;  1IYS A;  3UDX A;  2ZQ9 A;  4R3B A;  5E2H A;  4K0X A;  2J9P A;  4N92 A;  5FQK A;  2X02 A;  5CER A;  3OPR A;  3VFF A;  4OH0 A;  2ZD8 A;  3DWZ A;  3HUM A;  5FQM A;  3IT9 A;  4R23 A;  5AQA A;  3JYI A;  1YLP A;  1W7F A;  5CGX A;  1GCE A;  2IWD A;  3FKV A;  3WS1 A;  2V20 A;  4C6Y A;  4EV4 A;  2E8I A;  4E3L A;  4CPK A;  2EFU A;  2HP9 A;  4RVA A;  1TEM A;  3VMA A;  5FAT A;  2GDN A;  3M6H A;  4R4R A;  2FFY A;  4JLF A;  3AGE A;  1ES5 A;  1ESI A;  3C4P A;  1ZG4 A;  5CTM A;  2XFT A;  3PBQ A;  1WYC A;  1BUE A;  3HLF A;  4Y7P A;  3Q7Z A;  4LV2 A;  4N9L A;  4PPR A;  2XD1 A;  1PWC A;  4JF6 A;  1MY8 A;  4MLL A;  5CHJ A;  1K25 A;  2C5W B;  4Y0O A;  3HLB A;  3ZDJ A;  3NCK A;  1JTD A;  1MPL A;  1XXM A;  2ZQ7 A;  1KVM A;  5GLB A;  2H5S A;  3UY6 A;  1PW8 A;  4EBP A;  1KVL A;  4X68 A;  1H8Y A;  4N9K A;  3V39 A;  3IF6 A;  4JBF A;  1CK3 A;  1I5Q A;  3S4X A;  3BFF A;  4WBG A;  1BLH A;  4DXC A;  2G2U A;  4KZ3 A;  1ALQ A;  2HPB A;  2WUQ A;  5F82 A;  1BZA A;  4S2K A;  3P98 A;  2WGW B;  1BTL A;  4KG2 A;  4OQH A;  4OON A;  4GN2 A;  4S2P A;  3ZNY A;  1L0G A;  2JBF A;  3IH8 A;  3BFG A;  3HBR A;  4GB7 A;  4WZ4 A;  5FAP A;  1K56 D;  1WYB A;  3MZD A;  3LY4 A;  3MZF A;  4KQO A;  3HL9 A;  4LV3 A;  1DJB A;  2DCF A;  3ZG0 A;  4DDY A;  1MWS A;  2JE5 A;  3FYZ A;  5F1G A;  5CHU A;  3O86 A;  3OZH A;  3HUO A;  4BEN A;  4GNU A;  3FKW A;  2Y2H A;  2G2W A;  1IEM A;  3NI9 A;  4B4Z A;  5HFO A;  4BL2 A;  1CI9 A;  1JTG A;  5I94 A;  3OCL A;  1XKZ A;  3BFC A;  3C7V A;  3HVF A;  1NJ4 A;  1ERO A;  2Y2Q A;  3G31 A;  2WGI A;  4GDN A;  1TDG A;  3ZCZ A;  3G32 A;  5GLA A;  1L2S A;  3SS5 A;  1ESU A;  4BD1 A;  1XA7 A;  3MBZ A;  4E3O A;  5GHY A;  1K56 A;  3FZC A;  3ISG A;  2WKE A;  3HLD A;  2XH9 A;  1XX2 A;  4E3I A;  5DTS A;  2Y4A A;  4R1G A;  1E3U D;  4OPY A;  5E2E A;  5FAO A;  4ZJ2 A;  2X71 A;  1BUL A;  4H8R A;  3W4Q A;  2WK0 A;  3G35 A;  1BSG A;  1IYO A;  3ZGA B;  3VP2 A;  4WM9 A;  3Q7V A;  4OVD A;  5TR7 A;  4E3K A;  4PM7 A;  5EVI C;  1K4F A;  1ZKJ A;  5EVI D;  3RJU A;  2IWC A;  2P74 A;  4UA7 A;  2ZC5 B;  1BLC A;  4QY6 A;  4FD8 A;  4DE1 A;  4MNR A;  4OKP A;  1ONH A;  1O7E A;  2XEP A;  3GV9 A;  1L0D A;  3NY4 A;  1I2W A;  5HAR A;  1JWV A;  1GA9 A;  1W79 A;  3IF6 C;  4EUZ A;  1FCM A;  2XGN A;  2FFF B;  5GHX A;  4JKT A;  3IQA A;  2Y2L A;  2XQZ A;  1PWD A;  4EWF A;  5CRF A;  4OPZ A;  1VM1 A;  1L0E A;  1SDE A;  4FH4 A;  5HL1 A;  2Y2M A;  1NYY A;  4IVK A;  2EFX A;  3FWL A;  5CGW A;  3VSK A;  1K54 C;  3GSG A;  2R9X A;  2CC1 A;  5DVA A;  3TG9 A;  1YLJ A;  3UE0 A;  1BLP A;  4RX2 A;  2UWX A;  1HVB A;  2WKH A;  5EOE A;  3MXR A;  3DTM A;  1FCN A;  2WYX A;  3VP3 A;  3ITB A;  4E3M A;  3VP1 A;  1PI4 A;  3O88 A;  3CMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...