4N9KA

Crystal structure of beta-lactamse penp_e166s in complex with cephaloridine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n9kA00
4XXRA 1DJBA 1EWZA 1PI5A 4JF6A 2ZM8A 5EOOA 4OLDA 4BL3A 1WE4A 1L0EA 4C75A 2IWBA 5L2FA 2JC7A 5FDHA 2A3UA 4B88A 4QJGA 1KVMA 5FQQA 1HTZA 4F94A 2WAEA 1EI5A 4Y0OA 5AQ9A 5KSHA 3ISGA 2V2FF 3M2KA 4DKIA 1S0WA 5FAOA 5DVAA 3BFDA 3N6IA 2H5SA 1Z6FA 3QNBA 1TDGA 2XEPA 2Y2JA 3A3EA 3A3JA 3MXSA 4BJPA 1FQGA 1ESIA 4UHUA 5GLAA 3UY6A 3UE0A 3HBRA 3IHBA 4OPRA 4Y7PA 3ZNTA 1YMSA 2OLUA 4GD6A 4OPZA 2ZC7A 3UE1A 2Y2GA 4GKUA 3IWIA 5E2FA 2V20A 2QMIA 5GHZA 4ZJ2A 1W8YA 3G4PA 2Y4AA 1ZKJA 5KMWA 2C6WB 1L2SA 1LL5A 3ZG0A 3RXXA 4A5RA 2WZZA 4U3TA 4LV0A 2IWCA 4OH0A 3PBTA 3OZHA 2X01A 1ES3A 1CEGA 5CTNA 3CG5A 2Y2HA 3TG9A 3VOZA 2WGWA 1O07A 3SH8A 3GQZA 3P98A 3ZGAB 4HBUA 1O7EA 4X6TA 2FFFB 2JBFA 1IYQA 3ZFZA 3SOIA 1MWUA 4ZAMA 4Q8IA 1E4DA 1PW1A 4QD4A 4KG5A 3BLSA 4RYEA 4BQMA 4KZBA 2FFYA 3WRTA 3GV9A 3A3IA 3BLMA 1K56A 1BLSA 4GNUA 3TOIA 1K6SA 3NI9A 4MLLA 1MBLA 1MPLA 3HLEA 4UA6A 1KDWA 2B5RA 4PM9A 2R9XA 1IELA 4EV4A 4H8RA 2ZQCA 1I2WA 2XDMA 2WYXA 5CXWA 3GR2A 1BT5A 1IKGA 1C3BA 3C4PA 4WYYA 4LV1A 5CTMA 4Y0UA 3VOYA 1K4FA 1ZC2A 3MKFA 4PMAA 1CK3A 2EX9A 5GLDA 3NCKA 3VFHA 4DE2A 1VQQA 3IF5A 4E3KA 4OOLA 3ZVWA 2ZC5B 1MWSA 4WZ5A 5FAQA 3UPOA 1GHMA 4MEZA 1M6KA 3HLGA 3RJUA 2XGNA 5GHYA 4KZAA 2ZLYA 3MKEA 2WGVA 3N8LA 1XP4A 4OKPA 5FQJA 4KZ6A 3V3SA 3IH9A 3IWOA 1W7FA 1SKFA 1JTDA 5EPHA 4OQIA 3ZVTA 2J9OA 4E3JA 2A49A 4OOMA 3GTCA 1RGYA 1BSGA 5F83A 4LENA 2Y2PA 3MZEA 1NYYA 4JKTA 2ZMAA 4R4SA 4K0WA 2ZM0A 5G18A 1IKIA 4EWFA 1XA1A 4OOYA 1LI9A 1KVLA 4WELA 3WS1A 1W5DA 4JF4A 4N1HA 3Q07A 3ZG9B 4CJNA 3EQUA 3D4FA 3OC2A 3N4IA 1K57A 1HZOA 4DDYA 5DTSA 4S2IA 4R0QA 5HW3A 1YLJA 2OLVA 4IEDA 4UA7A 5A91A 4R3JA 3OPPA 1YT4A 3BECA 4WZ5C 4QHCA 2XD5A 3W4OA 4MBFA 1H5XA 2EFXA 3OPRA 4NK3A 1BLHA 4S2JA 1U60A 1RGZA 2EXAA 4KG2A 2PU4A 5CGSA 4OPQA 3SS3A 1GA9A 1TVFA 4R23A 1ZG4A 1ESUA 5CHJA 1L0FA 2HDRA 1PIOA 4GZBA 3MXRA 2C5WB 3M6HA 2Y2OA 4RX3A 3PBOA 5F1GA 2H0YA 2HP6A 5CGXA 1QMFA 4KQQA 1PW8A 2QZ6A 3MFDA 3BFCA 3VP3A 3IT9A 2EX2A 3N8RA 3C4OA 1XA7A 1FR1A 3HLBA 3CZDA 1K57C 1I2SA 1N9BA 3FZCA 2EX6A 2ZC6B 3G2YA 3O88A 1MKIA 5GLBA 3UNWA 5TFQA 1YLWA 5IHVA 1ONHA 4S2MA 3S1YA 4MBKA 1H8YA 3OCNA 3BYDA 1ONGA 3UPNA 4LCMA 1I5QA 1L0DA 2P9VB 1Q2QA 3W8KA 3HLDA 4P87A 3IH8A 5FI7A 4PM7A 3HUMA 4KENB 3GSGA 4O7DA 1KE3A 5HARA 1IYOA 4LCLA 2XD1A 4RX2A 3LEZA 4E6XA 3O3VA 1XXMA 5CECA 1K55A 5DF7A 1M40A 3IQAA 3BFFA 3VSKA 1H8ZA 5EVID 1NZOA 5AQ7A 3HUOA 1GHIA 4P85A 3G34A 4FSFA 5EVIA 3UDFA 4E6WA 1BLCA 2XLNA 4PM5A 1G6AA 3UO9A 1NXYA 3WWXA 4BD0A 2HPBA 4ZJ3A 4JXGA 1YQSA 3OPHA 2I72A 3ITAA 5M1AA 3UE3A 4ZTKA 1JVJA 1K6RA 4ZJ1A 5FATA 2EFUA 5AQAA 4DE3A 3WS0A 3ZHHA 2CC1A 4EBNA 2ZC4B 4P0MA 3IXBA 4ID4A 4KZ3A 3MZFA 1YMXA 1JWPA 1SCWA 4PM8A 4WEKA 4DXCA 2OV5A 4X53A 1PYYA 1MWTA 4LV2A 2X71A 1K56D 1MWRA 4LV3A 4OPYA 5GLCA 3VP0A 3VP2A 3NY4A 4GDBA 1W8QA 1IYSA 2G2WA 3EQVA 3Q1FA 1CI8A 3V39A 4DF6A 5FQMA 4E3NA 5JYPA 4MBHA 4X56A 1FCNA 4YFMA 1BLPA 4KZ5A 1DY6A 3G30A 1XKZA 4OP8A 4KZ8A 2WKEA 2WUQA 5EE8A 5TGFA 3Q81A 4N1XA 3BFGA 4JF5A 4WBGA 3CJMA 4C6YA 2WAFA 1FSWA 4OVDA 4WEJA 4GN2A 2JE5A 3UDIA 2X02A 5EVIB 2BLSA 1NY0A 4QY6A 1RCJA 4S2NA 3VP1A 2Y2QA 1JWZA 4RVAA 2J8YA 4QB8A 2DNSA 4ZDXA 3VP4A 2UWXA 5CHMA 4DXBA 1G68A 5EUAA 3IF6A 5CEDA 3AGFA 4GB7A 5CRFA 1K25A 3DWZA 1FCMA 4X55A 5EECA 2WK0A 3MBZA 4S2KA 4S2OA 5I94A 4IVKA 4DE1A 1YM1A 3BEBA 1OMEA 3PBRA 3B3XA 4JPMA 5U47A 2ZQ7A 5BOHA 4BD1A 3QNCA 1CEFA 1RP5A 4ZBEA 3NDGA 4DDSA 3FKVA 3WRZA 4N9KA 1K38A 2P9VA 1LL9A 3E2KA 3WS4A 1ES2A 1E25A 1TDLA 3Q7VA 3LY3A 4Z9QA 1L0GA 5HL1A 3ZNYA 1MXOA 3IHAA 5F1FA 2Y2NA 3PTEA 2RL3A 5HX9A 5CEBA 4S2LA 4KG6A 3ZG7B 2WKIA 2DCFA 1E3UD 2Y91A 4QU3A 5E2EA 4FD8A 1KGEA 5DF9A 3ZG8B 5M19A 3WS5A 3G2ZA 2GDNA 4HEFA 1E3UA 1NRFA 4R3BA 1ES4A 1ERQA 2ZJ9A 3FYZA 3SH9A 2R9WA 4KZ7A 3LO7A 4U0XA 1XGIA 4KZ4A 3VMAA 2XFTA 3HLFA 1QMEA 3IF6B 3IWQA 5FI2A 3VSLA 4RA7A 3N7WA 1KE0A 1NZUA 3MZDA 5FI6A 4K91A 2P74A 4IBXA 3O86A 4PM6A 1KGGA 3C7UA 4M3KA 2J9PA 4EBLA 4KZ9A 5FAPA 4Y0TA 1FR6A 2ZD8A 4B4XA 1W79A 1BUEA 3OPLA 3NC8A 1ERMA 4BLMA 2PBYA 2WGIA 4UA9A 4JLFA 3G35A 2RCXA 3ZG5A 4C3QA 1WYCA 4E3LA 5CHUA 3V50A 3NBLA 1YLPA 1WYBA 3O87A 3Q7VB 1FSYA 2HDQA 3PBNA 2H10A 1JWVA 4FH4A 4GOGA 4HESA 5D3OA 5AQBA 3ZCZA 4KQOA 4WM9A 1J9MA 3SS5A 5HAPA 1PI4A 5FQ9A 4HBTA 4CPKA 3SS4A 2HDSA 5A92A 4R4RA 2Z2MB 3TSGA 2ZQDA 4E3MA 2XK1A 1FOFA 4X68A 4EBPA 5HFOA 2V1ZA 1K4EA 3G32A 4OQHA 2J7VA 5KZHA 1DJAA 1GA0A 3GRJA 5E43A 2WKHA 3OCLA 3ZDJA 2VGKA 3LCEA 4R1GA 3IXGA 5DTTA 3E2LA 4IVIA 4E3IA 3W4PA 5FSRA 2H0TA 3I7JA 4S2PA 2Y2MA 5FASA 3M6BA 4JXVA 5DF8A 1ES5A 4JXWA 1CI9A 1ALQA 3DW0A 3GMWA 4OONA 3A3FA 4WMCD 5A93A 3BRMA 1BULA 1XPBA 3DTMA 3ITBA 4OQ0A 4WMCA 4UAAA 5GHXA 2XH9A 1TEMA 3LY4A 1KDSA 1GCEA 1YLYA 3AGDA 4GD8A 5FA7A 2HDUA 2XQZA 1SDNA 4IBRA 1Q2PA 4OP5A 4U0TA 4P6BA 2EX8A 4GDNA 3AGEA 1K55C 1GHPA 4K0XA 4PPRA 5EOEA 2Z2LB 2XR0A 3N8SA 4OQGA 2HP9A 1EROA 2Y2IA 3VFFA 2Q9MA 4KQRA 5HAQA 1K54A 1LHYA 3Q7ZA 5EVIC 2ZQ8A 4E3OA 2Y2KA 4BENA 3NIAA 2Y2LA 1PWCA 3HREA 2HP5A 1PZPA 3G31A 5F82A 4FCFA 1VM1A 3RXWA 1DJCA 4X69A 3GVBA 2Q9NA 3SH7A 3HUNA 3P09A 4NETA 4OLGA 2XFSA 2ZM2A 2ZQ9A 1SDEA 3V5MA 5CGWA 2JCHA 1XGJA 1PWGA 3FV7A 1ZG6A 5DTKA 5A90A 2Y59A 4FH2A 2PU2A 4N9LA 2IWDA 4N92A 4YINA 4JXSA 5CERA 1KE4A 1PZOA 3WS2A 3FKWA 3HLCA 2EXBA 2Y55A 3M2JA 5J8XA 5FQKA 2WZXA 3NDEA 3PBSA 3PAEA 1AXBA 1K54C 3V3RA 1LLBA 1NYMA 3C7VA 3W4QA 2VGJA 5FQIA 3FWLA 3JYIA 5E2HA 2WGWB 1S6RA 5TR7A 3PBQA 3S22A 3UDXA 4B4ZA 2QPNA 1YLTA 4XUXA 4S2NC 3HLWA 1SHVA 3BM6A 4XUZA 1MY8A 1KGFA 1FCOA 2OSUA 5GL9A 1Y54A 4D2OA 1HD8A 3IF6C 1JTGA 4QY5A 2ZC3B 1XX2A 4DE0A 3HVFA 3DWKA 4JBFA 3Q82A 3IXDA 3BFEA 5E2GA 4EQIA 2ZQAA 5EVLA 5KSCA 2WADA 4MNRA 2G2UA 3QHYA 5HAIA 4EUZA 1BTLA 3UPPA 4BL2A 3CMZA 2BG1A 3IXHA 5M18A 1IEMA 2E8IA 2DRWA 1NJ4A 1IYPA 4L0LA 1BZAA 5JYOA 3A3DA 4WZ4A 1LI0A 3PAGA 3S4XA 1YLZA 2XF3A 3UN7A 3HL9A 3C5AA 1N4OA 4DRTA 1PWDA 1HVBA
chains in the Genus database with same CATH superfamily
4XXRA 1PI5A 1F5MA 1L0EA 4WF0A 2JC7A 2A3UA 4B88A 1J3WA 4F94A 3NECA 1EI5A 4Y0OA 4GLQA 3P01A 4HP4A 4EW7A 3ULFA 3N6IA 2XEPA 3D9YA 4UHUA 5F69A 4BBTA 5EV0A 1NRJA 4GD6A 4OPZA 4B9OA 3B33A 5DJUA 1N9LA 3G4PA 4G3WA 1L2SA 1LL5A 4ARZB 2W27A 3NOTC 3OZHA 5CTNA 2PD7A 3A0SA 3LIEA 5IS1A 3ZGAB 1O7EA 2Z6DA 1JNUA 2JBFA 2XRNA 1PW1A 2OAQ1 4QD4A 4KG5A 3BLSA 3K3DA 4RYEA 4KZBA 3WRTA 3A3IA 4MLLA 3HLEA 4UA6A 2B5RA 3NHQA 4ZRRA 3T4JA 2WYXA 5HWVA 1IKGA 4Y0UA 1K4FA 5GLDA 3IF5A 4PKYA 2ZC5B 1MWSA 4MEZA 3HLGA 4Z1WA 4KZAA 1VB6A 3N8LA 4OKPA 4WUJA 5FQJA 3IWOA 4IUKA 1W7FA 4OQIA 2J9OA 2A49A 4LENA 3HJKA 3MZEA 4HHDA 3CI6A 4JKTA 4R4SA 1OTBA 5DFYA 1DP6A 4WELA 3OBFA 3ZG9B 4R0QA 1YLJA 4IEDA 5DKKA 4R3JA 3OPPA 4NKPA 4S2JA 2PU4A 4OPQA 1GA9A 1ESUA 4LRYC 2HDRA 1Y28A 4L9EA 3K3CA 5CGXA 4KQQA 4YNRA 2EX2A 2DMWA 3CUEA 3BY9A 3LIFA 3LYXA 3CZDA 3H82B 2W1TA 2EX6A 1H3QA 2ZC6B 3FZCA 1OT6A 3OCNA 3UPNA 4LCMA 4X25A 1I5QA 2P9VB 3C8CA 3OLOA 3HUMA 4O7DA 1KE3A 1IYOA 4LGWA 3LEZA 3O3VA 1K55A 1NZOA 1GHIA 3DTEA 4E6WA 3UDFA 2V9AA 1NXYA 4JXGA 1YQSA 3OPHA 2PYRA 1JVJA 4GCZA 1N9NA 5FATA 2P04A 3EGDC 3RFBA 4DE3A 3ZHHA 2CC1A 2XA7M 5DKLA 1JWPA 4X53A 1PYYA 3JPUA 1MWTA 3S7NA 4LV3A 1F9IA 1S66L 1UWPX 1W8QA 4NXBA 2G2WA 5FQMA 1S67L 4X56A 4YFMA 1XKZA 4N1XA 5AVEA 3CJMA 2OWJA 5L10A 3EEHA 4QY6A 4S2NA 3VP1A 2Y2QA 4ZDXA 3VP4A 1T18A 5CRFA 4X55A 4S2KA 3MBZA 1DP9A 1OMEA 4JPMA 3UMDA 1PRQA 4X1MA 1LSWA 3R7WA 1OTAA 4Z9QA 2M1CA 2B18A 3PTEA 5FDSA 3ZG7B 2DCFA 2XA7S 1KGEA 5DF9A 5G4YA 1E3UA 2ZJ9A 2VJWA 3FYZA 4Y5FA 2PR5A 2XFTA 3OOVA 1DP8A 1KE0A 4I38A 3KYEA 4XT2A 2P74A 3T50A 1LL8A 3O86A 1PNEA 2J9PA 3IS2A 4EBLA 1TD5A 4HJ3A 4B4XA 2JKFA 3OPLA 3NC8A 3L7HA 3CPTA 1ODVA 5CHUA 3O87A 1FSYA 4EEUA 4GOGA 1JWVA 2PRFA 3KO6A 4MDZA 1T1CA 4R4RA 2Z2MB 4EETB 2ZQDA 2VEAA 1G5UA 4X68A 4EBPA 3C30A 2V1ZA 4OQHA 3G32A 4BMWA 1GA0A 5E43A 4NXFA 1V9YA 3LR3A 3OCLA 3ZDJA 3LCEA 3MQ0A 3IXGA 4H6JB 4HI4A 3DTIA 2H0TA 1YAXA 4Q0IA 2Y2MA 3M6BA 4JXWA 4OONA 1ALQA 3DW0A 4I3JA 4GS9B 4LFUA 4UAAA 3F1PB 4HP9A 1YLYA 3AGDA 4GD8A 4Y3IA 2MJ6A 4IBRA 3CLOA 4P6BA 2EX8A 3N8SA 1VEUA 2VGLM 2XR0A 4OQGA 5HL6A 2KX6A 3Q7ZA 1LHYA 5EVIC 4BENA 2Y2LA 3UMEA 3GVBA 3P09A 4NETA 5LBRA 1SDEA 4E04A 5CGWA 2JCHA 4IUHA 5HWTA 1TF1A 1N9OA 4DN0A 2ZL1B 3FPVA 2W3DA 1XFNA 2HJEA 4QWOA 2ZOIA 3WS2A 2EXBA 2Y55A 4EU0A 3NDEA 3PAEA 4PKYG 4DJ3A 5E2HA 2WGWB 1S6RA 2V1AA 5HD3A 3S22A 4B4ZA 3T1QB 4XUXA 2ACGA 4XUZA 1K0KA 5GL9A 3PXPA 2VV6A 4DE0A 3VV4A 3A0VA 5E2GA 3BFEA 1GSVA 2G2UA 1BTLA 4BL2A 3CMZA 3JVVA 2VGLS 1P9WA 3A3DA 5J7EA 2XF3A 3C5AA 1OTIA 2QHKA 5L2FA 1DJBA 1EWZA 2ZM8A 3NOUC 4OLDA 5EOOA 3LGOA 4C75A 2IWBA 1FIKA 5FDHA 1KVMA 1HTZA 3E0YA 5KSHA 3LI9A 5FAOA 3BFDA 2HJ9C 3CITA 3VOLA 1VETB 3A3EA 3MXSA 3C2WA 5GLAA 4F3LB 3NOPC 3UE0A 3UY6A 3HBRA 3IHBA 1YMSA 3KYQA 2OLUA 3UE1A 2Y2GA 4GKUA 4X1LA 3IWIA 2QMIA 5GHZA 4ZJ2A 3F1NB 4CLCB 3LI8A 3ZG0A 5HD5A 4G3VA 3RXXA 2OWHA 4A5RA 4LV0A 1X0OA 2QYBA 3PBTA 3PR6A 1CEGA 3CG5A 3F1OA 1LT0A 3GQZA 3P98A 5HDSA 4II7A 3VE3A 1SKOB 4HIAA 3MS6A 1MWUA 4Q8IA 2OOLA 2PR6A 1E4DA 4BQMA 3ICYA 2FFYA 3GV9A 1BLSA 2O9AA 3NI9A 1IELA 1BT5A 4WYYA 4Q0JA 5CTMA 4LV1A 3T4SA 2H28A 1ZC2A 4OOLA 3E4OA 3UPOA 3QP5A 5GHYA 4YOFA 1XP4A 3IH9A 2HV1A 4O8GA 4WLAA 1BSGA 1NYYA 4I3AA 2ZMAA 2ZM0A 4EWFA 3B42A 1LI9A 1T1AA 3MQQA 3WS1A 4CJNA 3R4KA 1K57A 1HZOA 5DTSA 5HW3A 3SZTA 2V0WA 3EWKA 3BECA 3IX8A 4MBFA 2EFXA 1RGZA 2EXAA 1TVFA 2A24B 4R23A 1ZG4A 1L0FA 2O9BA 1PIOA 4GZBA 1XJ6A 2C5WB 3PBOA 2H0YA 3VP3A 3IT9A 3N8RA 3E4QA 2W3GA 3C4OA 1XA7A 3HLBA 1K57C 5GLBA 2EWWA 4G3KA 1MZUA 1ONHA 3S1YA 1H8YA 3BYDA 3FG8A 5J3WA 1L0DA 2HF6A 2KDKA 2W3HA 3HLDA 1S4RA 3UB5P 4HY8A 1MC0A 4LCLA 4RX2A 4E6XA 5CECA 3BQ8A 1M40A 2PAVP 5EVID 4Y13A 3G34A 4FSFA 2VV8A 2XLNA 3UB8A 2HPBA 3T1RA 3E98A 2I72A 3RTYA 4ZTKA 1K6RA 5AQAA 2VX8A 3WS0A 2QJ7A 2FH5A 2JKRM 2ZMVA 2ZC4B 3IXBA 4ID4A 4KZ3A 3MZFA 4WEKA 1WA9A 2OV5A 2X71A 4UEYA 3VP2A 1NLZA 4DF6A 3Q1FA 4MBHA 3CWFA 3VE4A 4GHIB 1DY6A 3MJQA 5IT5A 1AWIA 4OP8A 4KZ8A 4FTXA 1W63M 4WBGA 2WAFA 3BW6A 5HSQA 4WEJA 1MKMA 1NY0A 4PAUA 1JWZA 3KSGA 2DNSA 4DXBA 4NXGA 2Y79A 4HJ6A 3KSIA 3MFXA 2WK0A 3T4OA 1L3LA 4IVKA 4DE1A 3UB6A 3PBRA 2ZQ7A 2EWVA 4BD1A 1CEFA 4ZBEA 3CHWP 1A0KA 4DDSA 3WRZA 1YSQA 4N9KA 5FEGA 3EGXC 1E25A 5G4ZA 4I3IA 1L0GA 4EUVA 2Y2NA 2RL3A 5HX9A 2XROA 3NJAA 2WKIA 2Y91A 5E2EA 3ZG8B 3WS5A 1NRFA 4R3BA 5HPFA 1ES4A 1ERQA 1P9RA 2R9WA 4KZ7A 3LO7A 4U0XA 1FILA 5TBMA 3MQOA 1QMEA 3IF6B 1NZUA 4GS9A 4K91A 4PM6A 2K31A 4Y0TA 5C5KA 3KSHA 1FR6A 2OAP1 5DJTA 1BUEA 2PBYA 1TS6A 3G35A 2RCXA 4C3QA 2NUPC 4WL9A 3V50A 3NBLA 1YLPA 5D3OA 4FH4A 1ZTUA 4WM9A 1PI4A 5FQ9A 4HBTA 5HDCA 3TSGA 3MF0A 4E3MA 1FOFA 2O99A 1DJAA 2JN7A 2VV7A 3GRJA 4JGQA 3E4PA 2VGKA 4L9FA 3CUEC 3T1XA 4IVIA 4E3IA 3H7WA 5FSRA 4D60A 5FASA 4S2PA 5F5YA 1ES5A 1CI9A 4WMCD 5A93A 3A3FA 3BRMA 1XJ4A 2HZ5A 3ITBA 3TJZC 5GHXA 2XH9A 1TEMA 3B47A 2XQZA 3IBJA 1K55C 4K0XA 2Z2LB 2Y2IA 3KSFA 1K54A 2ZQ8A 2GNXA 1PWCA 1P97A 3G31A 5F82A 1VM1A 4X69A 3SH7A 5EFWA 3HUNA 4OLGA 2ZM2A 5EVEA 3FV7A 5DTKA 1ZG6A 2Y59A 4FH2A 1YKDA 2JHEA 4N9LA 2IWDA 4KQDA 4YINA 1T1BA 4JGOA 4EESA 3LIDA 2EA9A 3PBSA 1AXBA 1K54C 1LLBA 5DFXA 3W4QA 3FWLA 3JYIA 1V9ZA 2L4RA 5TR7A 3PBQA 2M7VA 3UDXA 2QPNA 2CMNA 3UE6A 4S2NC 3HLWA 3BM6A 4IJGA 2QJ5A 1MY8A 1FCOA 2OSUA 4QY5A 4JBFA 5KSCA 2WADA 5HAIA 3QHYA 4EUZA 1Y4OA 2GZAA 3IXHA 1IEMA 4L0LA 1BZAA 5JYOA 3PYPA 3KX0X 2L0WA 1N4OA 5A8BA 2KLIA 1PWDA 4DRTA 3F1NA 4CLCA 4JF6A 4BL3A 1WE4A 4QJGA 5AQ9A 3S7OA 2V2FF 1S0WA 3KYZA 2H5SA 1S1YA 3QNBA 1TDGA 2Y2JA 2IA2A 3A3JA 4BJPA 1FQGA 4BBVA 3U2AA 4Y7PA 3ZNTA 2WKRA 5E2FA 2V20A 4R3AA 2VLGA 2W1RA 2J80A 2WZZA 2IWCA 4OH0A 4WN5A 3TG9A 3VOZA 3T4QA 4X6TA 2FFFB 1IYQA 3ZFZA 3SOIA 5IU1A 4ZAMA 2W1TB 1S1ZA 2W0NA 2P08A 2J3TC 3LIAA 3L9KA 4GNUA 1MBLA 1MPLA 1KDWA 4PM9A 2R9XA 4H8RA 2ZQCA 1I2WA 2XDMA 4BWIA 5CXWA 3C4PA 3MKFA 4DE2A 3VFHA 1VQQA 2A24A 3S7QA 3ZVWA 5FAQA 1GHMA 1M6KA 3TW8A 3V3SA 1XFQA 2QWSA 2JKRI 4EXOA 1SKFA 4HOIA 3ZVTA 4E3JA 4OOMA 1RGYA 2Y2PA 4GW9A 4K0WA 5G18A 1IKIA 4N1HA 3OC2A 3G6OA 3N4IA 5CX7A 4UA7A 3DTKA 4QHCA 2XD5A 1H5XA 4NK3A 2JKTI 1BLHA 1U60A 4KG2A 3LR5A 2AVXA 3D72A 5CHJA 2O9CA 3U4LP 4ARZA 4RX3A 4Y15A 4HQAA 1PW8A 2QZ6A 3BFCA 3DAVA 1FR1A 2D02A 4MN6A 3G2YA 1N9BA 3UNWA 1D06A 1ONGA 3MMHA 3ZQ5A 1Q2QA 3W8KA 4P87A 3IH8A 4PM7A 2LB5A 5HARA 4I5SA 2XD1A 1XXMA 4GHIA 1T19A 5DF7A 3IQAA 1OJGA 1H8MA 4IHQA 1TS7A 3HJIA 5AQ7A 4P85A 5AVFA 1G6AA 3UO9A 4BD0A 4MCWA 2EFUA 2PDRA 4B93A 4XT2B 4R70A 4EBNA 3IS2B 2B95A 1SCWA 4DXCA 3LUQA 4LV2A 1K56D 4OPYA 4I39A 2LB9A 3NY4A 4GDBA 3CPTB 4HNBA 1IYSA 4E3NA 1CI8A 2BASA 5JYPA 1BYWA 1F98A 4KZ5A 3G30A 3QP8A 3BFGA 4JF5A 1FSWA 1YSPA 4GN2A 3UDIA 2X02A 5EVIB 4Y2FA 2PHYA 2BLSA 4HH3A 2W3EA 2GJ3A 4RVAA 4QB8A 1G68A 2V8FA 3IF6A 5CEDA 2J3WA 2V0UA 1FCMA 1YM1A 3BEBA 3H82A 5BOHA 4Y17A 3NDGA 2VA0A 1K38A 2P9VA 1VEUB 3WS4A 1ES2A 1TDLA 4LLOB 4JGRA 5HL1A 5HPIA 3ZNYA 2B02A 1MXOA 3IHAA 3PHYA 5CEBA 5I5LA 4KG6A 4QU3A 1E3UD 4FD8A 3G2ZA 2UV0E 4KZ4A 4R6LA 3IWQA 3VSLA 4RA7A 3N7WA 4O01A 3MZDA 1UWNX 3C7UA 4KZ9A 5FAPA 3LICA 2ZOHA 2WGIA 4JLFA 3ZG5A 1TS8A 1WYCA 4E3LA 3Q7VB 4LPZA 4LRZE 4L9GA 4HESA 2H10A 3ZCZA 1HLUP 4KQOA 1J9MA 3SS5A 5HAPA 3BJNA 3SW1A 4CPKA 3SS4A 2HDSA 5HDDA 1K4EA 3FC7A 3QP1A 4R1GA 5DTTA 2J3TD 4JXVA 3W2ZA 3LY4A 1KDSA 5FA7A 2WKPA 1SDNA 1Q2PA 4U0TA 4OP5A 2KOIA 1OPXA 4GDNA 3AGEA 4PHTA 1GHPA 4PPRA 5EOEA 1G6OA 2PD8A 1IOUA 3VFFA 5HAQA 2Q9MA 3TE8A 2Y2KA 3NIAA 4DJ2A 3RXWA 2V8CA 2JKTM 2Q9NA 3JVUA 3S7PA 2XFSA 2FZ0A 1XGJA 1PWGA 5TJJA 3V67A 5CERA 1KE4A 1PZOA 3FKWA 3HLCA 5J8XA 3M2JA 5F68A 3LIBA 1NYMA 1OTDA 3C7VA 2VGJA 5FQIA 3F1OB 3MR0A 3D3OA 1YLTA 3BY8A 1SHVA 4D2OA 1H0MA 4JGPA 1XJ2A 1JTGA 3QP2A 3MSHA 2ZC3B 3HVFA 4MN5A 2ZQAA 5EVLA 4H6JA 1CF0A 3UPPA 3A0RA 2DRWA 1NJ4A 3S4XA 1YLZA 3UN7A 3F1PA 2ZBBA 3DBAA 3UB7A 1HVBA 4FUWA 3T4LA 5FQQA 2WAEA 1DRMA 3ISGA 3M2KA 4DKIA 1CQAA 5DVAA 4EQ1A 4K08A 1Z6FA 3BQAA 2VKSA 1ESIA 4OPRA 2YKHA 1PFLA 2ZL1A 2ZC7A 1W8YA 4KUOA 2Y4AA 1ZKJA 5KMWA 2C6WB 1SZVA 4U3TA 5K5BA 2X01A 1ES3A 2Y2HA 2WGWA 1O07A 3SH8A 4HBUA 1Z09A 1F2KA 4ETXA 2INWA 3GECA 1IFQA 3BLMA 4YWZA 1K56A 3TOIA 2JKGA 1K6SA 3FPWA 1D7EA 4EEPA 4EV4A 3GR2A 1C3BA 2R78A 3VOYA 3NULA 4PMAA 1CK3A 2EX9A 3NCKA 4E3KA 4WZ5A 3BWLA 2WKQA 4FOFA 3RJUA 2XGNA 2ZLYA 3MKEA 4RQ9A 2WGVA 4KUKA 5L8MA 4KZ6A 1TS0A 2E8JA 1JTDA 5EPHA 3T4TA 3LEQA 3GTCA 5F83A 5KIZA 1EW0A 4ETZA 1VETA 1XA1A 4OOYA 1KVLA 1W5DA 4JF4A 4MN7A 3Q07A 3EQUA 3D4FA 4LRXC 4DDYA 4S2IA 4F3LA 2OLVA 5A91A 1YT4A 4WZ5C 5L09A 3W4OA 1NWZA 3OPRA 2W3FA 2GX5A 5L07A 3MXQA 5CGSA 3SS3A 3MXRA 3P7NA 3M6HA 2Y2OA 3RH8B 5F1GA 4QPRA 3LR0A 2HP6A 1QMFA 3MFDA 1SKOA 1I2SA 3O88A 1MKIA 5TFQA 1YLWA 5IHVA 4S2MA 4MBKA 1NLYA 5FI7A 4KENB 3GSGA 4CLCC 3EEAA 2ZMFA 3GDIA 3BFFA 3VSKA 4EERA 1H8ZA 3HUOA 5EVIA 1BLCA 4PM5A 3WWXA 5TBMB 4ZJ3A 3ITAA 5M1AA 3UE3A 4NEED 5MC7A 5AJGA 4ZJ1A 1OT9A 1KOUA 4P0MA 1YMXA 4PM8A 1MWRA 5GLCA 3VP0A 3EQVA 3V39A 4CQHA 2K2NA 1OTEA 1FCNA 1BLPA 3ZYTA 2WKEA 2WUQA 5EE8A 5TGFA 3Q81A 4C6YA 5FL3A 4OVDA 5EM0A 2JE5A 5HWWA 1RCJA 2Y8HA 1GSWA 2J8YA 3H7WB 2UWXA 5CHMA 5EUAA 3UB9A 1VHMA 1LSVA 4UQIM 3EOIA 3AGFA 4GB7A 5EECA 1K25A 3DWZA 3T4KA 4S2OA 5I94A 3B3XA 5U47A 3QNCA 3H9WA 1RP5A 3IBRA 3FKVA 2BTFP 3T12B 1LL9A 3E2KA 3T1SA 3Q7VA 3LR4A 3LY3A 4CLCE 4HH2A 5F1FA 2Z6CA 4S2LA 5M19A 1D1JA 2GDNA 4HEFA 1YPRA 3SH9A 1ACFA 4P6ZM 1XGIA 1XJ3A 2QKPA 3VMAA 1STZA 3HLFA 1OJ5A 5FI2A 2D01A 2M7UA 5FI6A 4BBUA 4IBXA 1KGGA 4M3KA 1W63Q 3QP6A 2P7JA 2ZD8A 1W79A 4BLMA 1ERMA 4UA9A 3R7WB 1WYBA 2HDQA 3PBNA 5AQBA 3IX4A 4UQIS 3HCYA 5HZHA 5A92A 2XK1A 5HFOA 3C38A 5KZHA 2J7VA 3IX3A 2WKHA 3E2LA 3W4PA 2XSSA 4AFIA 3I7JA 2K7SA 4Q0HA 5DF8A 2PBDP 3GMWA 1BULA 1XPBA 3DTMA 4OQ0A 4WMCA 1S4SA 1GCEA 4HJ4A 2HDUA 2PYPA 2NUTC 4P6ZS 2L1MA 3CAXA 4NXEA 2HP9A 1UGUA 2YKFA 1EROA 4KQRA 4E3OA 2Q0OA 3HREA 2HP5A 1PZPA 4FCFA 4ME4A 1DJCA 4MMNA 2ZQ9A 4DMZA 3V5MA 2VZWA 2A2LA 1CJFA 5FEFA 5A90A 2V1BA 4R38A 2PT7A 2PU2A 4M4XA 4N92A 4JXSA 4NG2A 5FQKA 2WZXA 3V3RA 3TRCA 1LSXA 4O0PA 5J4EA 1P0ZA 5EM1A 4ESPA 3O5YA 1GSXA 2O0YA 1G28A 1KGFA 4GJ4A 1Y54A 2HGVA 3LFVA 1HD8A 3K2NA 3IF6C 1XX2A 3QP4A 3DWKA 3Q82A 3IXDA 4EQIA 4MNRA 2VK3A 5F6AA 2G7UA 2BG1A 5M18A 2E8IA 1ZHHB 1IYPA 4WZ4A 1LI0A 3PAGA 2I9VA 3HL9A 4CLCD
chains in the Genus database with same CATH topology
4XXRA 1DJBA 1EWZA 1PI5A 4JF6A 2ZM8A 5EOOA 4OLDA 4BL3A 1WE4A 1L0EA 4C75A 2IWBA 5L2FA 2JC7A 5FDHA 2A3UA 4B88A 4QJGA 1KVMA 5FQQA 1HTZA 4F94A 2WAEA 1EI5A 4Y0OA 5AQ9A 5KSHA 3ISGA 2V2FF 3M2KA 4DKIA 1S0WA 5FAOA 5DVAA 3BFDA 3N6IA 2H5SA 1Z6FA 3QNBA 1TDGA 2XEPA 2Y2JA 3A3EA 3A3JA 3MXSA 4BJPA 1FQGA 1ESIA 4UHUA 5GLAA 3UY6A 3UE0A 3HBRA 3IHBA 4OPRA 4Y7PA 3ZNTA 1YMSA 2OLUA 4GD6A 4OPZA 2ZC7A 3UE1A 2Y2GA 4GKUA 3IWIA 5E2FA 2V20A 2QMIA 5GHZA 4ZJ2A 1W8YA 3G4PA 2Y4AA 1ZKJA 5KMWA 2C6WB 1L2SA 1LL5A 3ZG0A 3RXXA 4A5RA 2WZZA 4U3TA 4LV0A 2IWCA 4OH0A 3PBTA 3OZHA 2X01A 1ES3A 1CEGA 5CTNA 3CG5A 2Y2HA 3TG9A 3VOZA 2WGWA 1O07A 3SH8A 3GQZA 3P98A 3ZGAB 4HBUA 1O7EA 4X6TA 2FFFB 2JBFA 1IYQA 3ZFZA 3SOIA 1MWUA 4ZAMA 4Q8IA 1E4DA 1PW1A 4QD4A 4KG5A 3BLSA 4RYEA 4BQMA 4KZBA 2FFYA 3WRTA 3GV9A 3A3IA 3BLMA 1K56A 1BLSA 4GNUA 3TOIA 1K6SA 3NI9A 4MLLA 1MBLA 1MPLA 3HLEA 4UA6A 1KDWA 2B5RA 4PM9A 2R9XA 1IELA 4EV4A 4H8RA 2ZQCA 1I2WA 2XDMA 2WYXA 5CXWA 3GR2A 1BT5A 1IKGA 1C3BA 3C4PA 4WYYA 4LV1A 5CTMA 4Y0UA 3VOYA 1K4FA 1ZC2A 3MKFA 4PMAA 1CK3A 2EX9A 5GLDA 3NCKA 3VFHA 4DE2A 1VQQA 3IF5A 4E3KA 4OOLA 3ZVWA 2ZC5B 1MWSA 4WZ5A 5FAQA 3UPOA 1GHMA 4MEZA 1M6KA 3HLGA 3RJUA 2XGNA 5GHYA 4KZAA 2ZLYA 3MKEA 2WGVA 3N8LA 1XP4A 4OKPA 5FQJA 4KZ6A 3V3SA 3IH9A 3IWOA 1W7FA 1SKFA 1JTDA 5EPHA 4OQIA 3ZVTA 2J9OA 4E3JA 2A49A 4OOMA 3GTCA 1RGYA 1BSGA 5F83A 4LENA 2Y2PA 3MZEA 1NYYA 4JKTA 2ZMAA 4R4SA 4K0WA 2ZM0A 5G18A 1IKIA 4EWFA 1XA1A 4OOYA 1LI9A 1KVLA 4WELA 3WS1A 1W5DA 4JF4A 4N1HA 3Q07A 3ZG9B 4CJNA 3EQUA 3D4FA 3OC2A 3N4IA 1K57A 1HZOA 4DDYA 5DTSA 4S2IA 4R0QA 5HW3A 1YLJA 2OLVA 4IEDA 4UA7A 5A91A 4R3JA 3OPPA 1YT4A 3BECA 4WZ5C 4QHCA 2XD5A 3W4OA 4MBFA 1H5XA 2EFXA 3OPRA 4NK3A 1BLHA 4S2JA 1U60A 1RGZA 2EXAA 4KG2A 2PU4A 5CGSA 4OPQA 3SS3A 1GA9A 1TVFA 4R23A 1ZG4A 1ESUA 5CHJA 1L0FA 2HDRA 1PIOA 4GZBA 3MXRA 2C5WB 3M6HA 2Y2OA 4RX3A 3PBOA 5F1GA 2H0YA 2HP6A 5CGXA 1QMFA 4KQQA 1PW8A 2QZ6A 3MFDA 3BFCA 3VP3A 3IT9A 2EX2A 3N8RA 3C4OA 1XA7A 1FR1A 3HLBA 3CZDA 1K57C 1I2SA 1N9BA 3FZCA 2EX6A 2ZC6B 3G2YA 3O88A 1MKIA 5GLBA 3UNWA 5TFQA 1YLWA 5IHVA 1ONHA 4S2MA 3S1YA 4MBKA 1H8YA 3OCNA 3BYDA 1ONGA 3UPNA 4LCMA 1I5QA 1L0DA 2P9VB 1Q2QA 3W8KA 3HLDA 4P87A 3IH8A 5FI7A 4PM7A 3HUMA 4KENB 3GSGA 4O7DA 1KE3A 5HARA 1IYOA 4LCLA 2XD1A 4RX2A 3LEZA 4E6XA 3O3VA 1XXMA 5CECA 1K55A 5DF7A 1M40A 3IQAA 3BFFA 3VSKA 1H8ZA 5EVID 1NZOA 5AQ7A 3HUOA 1GHIA 4P85A 3G34A 4FSFA 5EVIA 3UDFA 4E6WA 1BLCA 2XLNA 4PM5A 1G6AA 3UO9A 1NXYA 3WWXA 4BD0A 2HPBA 4ZJ3A 4JXGA 1YQSA 3OPHA 2I72A 3ITAA 5M1AA 3UE3A 4ZTKA 1JVJA 1K6RA 4ZJ1A 5FATA 2EFUA 5AQAA 4DE3A 3WS0A 3ZHHA 2CC1A 4EBNA 2ZC4B 4P0MA 3IXBA 4ID4A 4KZ3A 3MZFA 1YMXA 1JWPA 1SCWA 4PM8A 4WEKA 4DXCA 2OV5A 4X53A 1PYYA 1MWTA 4LV2A 2X71A 1K56D 1MWRA 4LV3A 4OPYA 5GLCA 3VP0A 3VP2A 3NY4A 4GDBA 1W8QA 1IYSA 2G2WA 3EQVA 3Q1FA 1CI8A 3V39A 4DF6A 5FQMA 4E3NA 5JYPA 4MBHA 4X56A 1FCNA 4YFMA 1BLPA 4KZ5A 1DY6A 3G30A 1XKZA 4OP8A 4KZ8A 2WKEA 2WUQA 5EE8A 5TGFA 3Q81A 4N1XA 3BFGA 4JF5A 4WBGA 3CJMA 4C6YA 2WAFA 1FSWA 4OVDA 4WEJA 4GN2A 2JE5A 3UDIA 2X02A 5EVIB 2BLSA 1NY0A 4QY6A 1RCJA 4S2NA 3VP1A 2Y2QA 1JWZA 4RVAA 2J8YA 4QB8A 2DNSA 4ZDXA 3VP4A 2UWXA 5CHMA 4DXBA 1G68A 5EUAA 3IF6A 5CEDA 3AGFA 4GB7A 5CRFA 1K25A 3DWZA 1FCMA 4X55A 5EECA 2WK0A 3MBZA 4S2KA 4S2OA 5I94A 4IVKA 4DE1A 1YM1A 3BEBA 1OMEA 3PBRA 3B3XA 4JPMA 5U47A 2ZQ7A 5BOHA 4BD1A 3QNCA 1CEFA 1RP5A 4ZBEA 3NDGA 4DDSA 3FKVA 3WRZA 4N9KA 1K38A 2P9VA 1LL9A 3E2KA 3WS4A 1ES2A 1E25A 1TDLA 3Q7VA 3LY3A 4Z9QA 1L0GA 5HL1A 3ZNYA 1MXOA 3IHAA 5F1FA 2Y2NA 3PTEA 2RL3A 5HX9A 5CEBA 4S2LA 4KG6A 3ZG7B 2WKIA 2DCFA 1E3UD 2Y91A 4QU3A 5E2EA 4FD8A 1KGEA 5DF9A 3ZG8B 5M19A 3WS5A 3G2ZA 2GDNA 4HEFA 1E3UA 1NRFA 4R3BA 1ES4A 1ERQA 2ZJ9A 3FYZA 3SH9A 2R9WA 4KZ7A 3LO7A 4U0XA 1XGIA 4KZ4A 3VMAA 2XFTA 3HLFA 1QMEA 3IF6B 3IWQA 5FI2A 3VSLA 4RA7A 3N7WA 1KE0A 1NZUA 3MZDA 5FI6A 4K91A 2P74A 4IBXA 3O86A 4PM6A 1KGGA 3C7UA 4M3KA 2J9PA 4EBLA 4KZ9A 5FAPA 4Y0TA 1FR6A 2ZD8A 4B4XA 1W79A 1BUEA 3OPLA 3NC8A 1ERMA 4BLMA 2PBYA 2WGIA 4UA9A 4JLFA 3G35A 2RCXA 3ZG5A 4C3QA 1WYCA 4E3LA 5CHUA 3V50A 3NBLA 1YLPA 1WYBA 3O87A 3Q7VB 1FSYA 2HDQA 3PBNA 2H10A 1JWVA 4FH4A 4GOGA 4HESA 5D3OA 5AQBA 3ZCZA 4KQOA 4WM9A 1J9MA 3SS5A 5HAPA 1PI4A 5FQ9A 4HBTA 4CPKA 3SS4A 2HDSA 5A92A 4R4RA 2Z2MB 3TSGA 2ZQDA 4E3MA 2XK1A 1FOFA 4X68A 4EBPA 5HFOA 2V1ZA 1K4EA 3G32A 4OQHA 2J7VA 5KZHA 1DJAA 1GA0A 3GRJA 5E43A 2WKHA 3OCLA 3ZDJA 2VGKA 3LCEA 4R1GA 3IXGA 5DTTA 3E2LA 4IVIA 4E3IA 3W4PA 5FSRA 2H0TA 3I7JA 4S2PA 2Y2MA 5FASA 3M6BA 4JXVA 5DF8A 1ES5A 4JXWA 1CI9A 1ALQA 3DW0A 3GMWA 4OONA 3A3FA 4WMCD 5A93A 3BRMA 1BULA 1XPBA 3DTMA 3ITBA 4OQ0A 4WMCA 4UAAA 5GHXA 2XH9A 1TEMA 3LY4A 1KDSA 1GCEA 1YLYA 3AGDA 4GD8A 5FA7A 2HDUA 2XQZA 1SDNA 4IBRA 1Q2PA 4OP5A 4U0TA 4P6BA 2EX8A 4GDNA 3AGEA 1K55C 1GHPA 4K0XA 4PPRA 5EOEA 2Z2LB 2XR0A 3N8SA 4OQGA 2HP9A 1EROA 2Y2IA 3VFFA 2Q9MA 4KQRA 5HAQA 1K54A 1LHYA 3Q7ZA 5EVIC 2ZQ8A 4E3OA 2Y2KA 4BENA 3NIAA 2Y2LA 1PWCA 3HREA 2HP5A 1PZPA 3G31A 5F82A 4FCFA 1VM1A 3RXWA 1DJCA 4X69A 3GVBA 2Q9NA 3SH7A 3HUNA 3P09A 4NETA 4OLGA 2XFSA 2ZM2A 2ZQ9A 1SDEA 3V5MA 5CGWA 2JCHA 1XGJA 1PWGA 3FV7A 1ZG6A 5DTKA 5A90A 2Y59A 4FH2A 2PU2A 4N9LA 2IWDA 4N92A 4YINA 4JXSA 5CERA 1KE4A 1PZOA 3WS2A 3FKWA 3HLCA 2EXBA 2Y55A 3M2JA 5J8XA 5FQKA 2WZXA 3NDEA 3PBSA 3PAEA 1AXBA 1K54C 3V3RA 1LLBA 1NYMA 3C7VA 3W4QA 2VGJA 5FQIA 3FWLA 3JYIA 5E2HA 2WGWB 1S6RA 5TR7A 3PBQA 3S22A 3UDXA 4B4ZA 2QPNA 1YLTA 4XUXA 4S2NC 3HLWA 1SHVA 3BM6A 4XUZA 1MY8A 1KGFA 1FCOA 2OSUA 5GL9A 1Y54A 4D2OA 1HD8A 3IF6C 1JTGA 4QY5A 2ZC3B 1XX2A 4DE0A 3HVFA 3DWKA 4JBFA 3Q82A 3IXDA 3BFEA 5E2GA 4EQIA 2ZQAA 5EVLA 5KSCA 2WADA 4MNRA 2G2UA 3QHYA 5HAIA 4EUZA 1BTLA 3UPPA 4BL2A 3CMZA 2BG1A 3IXHA 5M18A 1IEMA 2E8IA 2DRWA 1NJ4A 1IYPA 4L0LA 1BZAA 5JYOA 3A3DA 4WZ4A 1LI0A 3PAGA 3S4XA 1YLZA 2XF3A 3UN7A 3HL9A 3C5AA 1N4OA 4DRTA 1PWDA 1HVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XXR A;  1DJB A;  1EWZ A;  1PI5 A;  4JF6 A;  2ZM8 A;  5EOO A;  4OLD A;  4BL3 A;  1WE4 A;  1L0E A;  4C75 A;  2IWB A;  5L2F A;  2JC7 A;  5FDH A;  2A3U A;  4B88 A;  4QJG A;  1KVM A;  5FQQ A;  1HTZ A;  4F94 A;  2WAE A;  1EI5 A;  4Y0O A;  5AQ9 A;  5KSH A;  3ISG A;  2V2F F;  3M2K A;  4DKI A;  1S0W A;  5FAO A;  5DVA A;  3BFD A;  3N6I A;  2H5S A;  1Z6F A;  3QNB A;  1TDG A;  2XEP A;  2Y2J A;  3A3E A;  3A3J A;  3MXS A;  4BJP A;  1FQG A;  1ESI A;  4UHU A;  5GLA A;  3UY6 A;  3UE0 A;  3HBR A;  3IHB A;  4OPR A;  4Y7P A;  3ZNT A;  1YMS A;  2OLU A;  4GD6 A;  4OPZ A;  2ZC7 A;  3UE1 A;  2Y2G A;  4GKU A;  3IWI A;  5E2F A;  2V20 A;  2QMI A;  5GHZ A;  4ZJ2 A;  1W8Y A;  3G4P A;  2Y4A A;  1ZKJ A;  5KMW A;  2C6W B;  1L2S A;  1LL5 A;  3ZG0 A;  3RXX A;  4A5R A;  2WZZ A;  4U3T A;  4LV0 A;  2IWC A;  4OH0 A;  3PBT A;  3OZH A;  2X01 A;  1ES3 A;  1CEG A;  5CTN A;  3CG5 A;  2Y2H A;  3TG9 A;  3VOZ A;  2WGW A;  1O07 A;  3SH8 A;  3GQZ A;  3P98 A;  3ZGA B;  4HBU A;  1O7E A;  4X6T A;  2FFF B;  2JBF A;  1IYQ A;  3ZFZ A;  3SOI A;  1MWU A;  4ZAM A;  4Q8I A;  1E4D A;  1PW1 A;  4QD4 A;  4KG5 A;  3BLS A;  4RYE A;  4BQM A;  4KZB A;  2FFY A;  3WRT A;  3GV9 A;  3A3I A;  3BLM A;  1K56 A;  1BLS A;  4GNU A;  3TOI A;  1K6S A;  3NI9 A;  4MLL A;  1MBL A;  1MPL A;  3HLE A;  4UA6 A;  1KDW A;  2B5R A;  4PM9 A;  2R9X A;  1IEL A;  4EV4 A;  4H8R A;  2ZQC A;  1I2W A;  2XDM A;  2WYX A;  5CXW A;  3GR2 A;  1BT5 A;  1IKG A;  1C3B A;  3C4P A;  4WYY A;  4LV1 A;  5CTM A;  4Y0U A;  3VOY A;  1K4F A;  1ZC2 A;  3MKF A;  4PMA A;  1CK3 A;  2EX9 A;  5GLD A;  3NCK A;  3VFH A;  4DE2 A;  1VQQ A;  3IF5 A;  4E3K A;  4OOL A;  3ZVW A;  2ZC5 B;  1MWS A;  4WZ5 A;  5FAQ A;  3UPO A;  1GHM A;  4MEZ A;  1M6K A;  3HLG A;  3RJU A;  2XGN A;  5GHY A;  4KZA A;  2ZLY A;  3MKE A;  2WGV A;  3N8L A;  1XP4 A;  4OKP A;  5FQJ A;  4KZ6 A;  3V3S A;  3IH9 A;  3IWO A;  1W7F A;  1SKF A;  1JTD A;  5EPH A;  4OQI A;  3ZVT A;  2J9O A;  4E3J A;  2A49 A;  4OOM A;  3GTC A;  1RGY A;  1BSG A;  5F83 A;  4LEN A;  2Y2P A;  3MZE A;  1NYY A;  4JKT A;  2ZMA A;  4R4S A;  4K0W A;  2ZM0 A;  5G18 A;  1IKI A;  4EWF A;  1XA1 A;  4OOY A;  1LI9 A;  1KVL A;  4WEL A;  3WS1 A;  1W5D A;  4JF4 A;  4N1H A;  3Q07 A;  3ZG9 B;  4CJN A;  3EQU A;  3D4F A;  3OC2 A;  3N4I A;  1K57 A;  1HZO A;  4DDY A;  5DTS A;  4S2I A;  4R0Q A;  5HW3 A;  1YLJ A;  2OLV A;  4IED A;  4UA7 A;  5A91 A;  4R3J A;  3OPP A;  1YT4 A;  3BEC A;  4WZ5 C;  4QHC A;  2XD5 A;  3W4O A;  4MBF A;  1H5X A;  2EFX A;  3OPR A;  4NK3 A;  1BLH A;  4S2J A;  1U60 A;  1RGZ A;  2EXA A;  4KG2 A;  2PU4 A;  5CGS A;  4OPQ A;  3SS3 A;  1GA9 A;  1TVF A;  4R23 A;  1ZG4 A;  1ESU A;  5CHJ A;  1L0F A;  2HDR A;  1PIO A;  4GZB A;  3MXR A;  2C5W B;  3M6H A;  2Y2O A;  4RX3 A;  3PBO A;  5F1G A;  2H0Y A;  2HP6 A;  5CGX A;  1QMF A;  4KQQ A;  1PW8 A;  2QZ6 A;  3MFD A;  3BFC A;  3VP3 A;  3IT9 A;  2EX2 A;  3N8R A;  3C4O A;  1XA7 A;  1FR1 A;  3HLB A;  3CZD A;  1K57 C;  1I2S A;  1N9B A;  3FZC A;  2EX6 A;  2ZC6 B;  3G2Y A;  3O88 A;  1MKI A;  5GLB A;  3UNW A;  5TFQ A;  1YLW A;  5IHV A;  1ONH A;  4S2M A;  3S1Y A;  4MBK A;  1H8Y A;  3OCN A;  3BYD A;  1ONG A;  3UPN A;  4LCM A;  1I5Q A;  1L0D A;  2P9V B;  1Q2Q A;  3W8K A;  3HLD A;  4P87 A;  3IH8 A;  5FI7 A;  4PM7 A;  3HUM A;  4KEN B;  3GSG A;  4O7D A;  1KE3 A;  5HAR A;  1IYO A;  4LCL A;  2XD1 A;  4RX2 A;  3LEZ A;  4E6X A;  3O3V A;  1XXM A;  5CEC A;  1K55 A;  5DF7 A;  1M40 A;  3IQA A;  3BFF A;  3VSK A;  1H8Z A;  5EVI D;  1NZO A;  5AQ7 A;  3HUO A;  1GHI A;  4P85 A;  3G34 A;  4FSF A;  5EVI A;  3UDF A;  4E6W A;  1BLC A;  2XLN A;  4PM5 A;  1G6A A;  3UO9 A;  1NXY A;  3WWX A;  4BD0 A;  2HPB A;  4ZJ3 A;  4JXG A;  1YQS A;  3OPH A;  2I72 A;  3ITA A;  5M1A A;  3UE3 A;  4ZTK A;  1JVJ A;  1K6R A;  4ZJ1 A;  5FAT A;  2EFU A;  5AQA A;  4DE3 A;  3WS0 A;  3ZHH A;  2CC1 A;  4EBN A;  2ZC4 B;  4P0M A;  3IXB A;  4ID4 A;  4KZ3 A;  3MZF A;  1YMX A;  1JWP A;  1SCW A;  4PM8 A;  4WEK A;  4DXC A;  2OV5 A;  4X53 A;  1PYY A;  1MWT A;  4LV2 A;  2X71 A;  1K56 D;  1MWR A;  4LV3 A;  4OPY A;  5GLC A;  3VP0 A;  3VP2 A;  3NY4 A;  4GDB A;  1W8Q A;  1IYS A;  2G2W A;  3EQV A;  3Q1F A;  1CI8 A;  3V39 A;  4DF6 A;  5FQM A;  4E3N A;  5JYP A;  4MBH A;  4X56 A;  1FCN A;  4YFM A;  1BLP A;  4KZ5 A;  1DY6 A;  3G30 A;  1XKZ A;  4OP8 A;  4KZ8 A;  2WKE A;  2WUQ A;  5EE8 A;  5TGF A;  3Q81 A;  4N1X A;  3BFG A;  4JF5 A;  4WBG A;  3CJM A;  4C6Y A;  2WAF A;  1FSW A;  4OVD A;  4WEJ A;  4GN2 A;  2JE5 A;  3UDI A;  2X02 A;  5EVI B;  2BLS A;  1NY0 A;  4QY6 A;  1RCJ A;  4S2N A;  3VP1 A;  2Y2Q A;  1JWZ A;  4RVA A;  2J8Y A;  4QB8 A;  2DNS A;  4ZDX A;  3VP4 A;  2UWX A;  5CHM A;  4DXB A;  1G68 A;  5EUA A;  3IF6 A;  5CED A;  3AGF A;  4GB7 A;  5CRF A;  1K25 A;  3DWZ A;  1FCM A;  4X55 A;  5EEC A;  2WK0 A;  3MBZ A;  4S2K A;  4S2O A;  5I94 A;  4IVK A;  4DE1 A;  1YM1 A;  3BEB A;  1OME A;  3PBR A;  3B3X A;  4JPM A;  5U47 A;  2ZQ7 A;  5BOH A;  4BD1 A;  3QNC A;  1CEF A;  1RP5 A;  4ZBE A;  3NDG A;  4DDS A;  3FKV A;  3WRZ A;  4N9K A;  1K38 A;  2P9V A;  1LL9 A;  3E2K A;  3WS4 A;  1ES2 A;  1E25 A;  1TDL A;  3Q7V A;  3LY3 A;  4Z9Q A;  1L0G A;  5HL1 A;  3ZNY A;  1MXO A;  3IHA A;  5F1F A;  2Y2N A;  3PTE A;  2RL3 A;  5HX9 A;  5CEB A;  4S2L A;  4KG6 A;  3ZG7 B;  2WKI A;  2DCF A;  1E3U D;  2Y91 A;  4QU3 A;  5E2E A;  4FD8 A;  1KGE A;  5DF9 A;  3ZG8 B;  5M19 A;  3WS5 A;  3G2Z A;  2GDN A;  4HEF A;  1E3U A;  1NRF A;  4R3B A;  1ES4 A;  1ERQ A;  2ZJ9 A;  3FYZ A;  3SH9 A;  2R9W A;  4KZ7 A;  3LO7 A;  4U0X A;  1XGI A;  4KZ4 A;  3VMA A;  2XFT A;  3HLF A;  1QME A;  3IF6 B;  3IWQ A;  5FI2 A;  3VSL A;  4RA7 A;  3N7W A;  1KE0 A;  1NZU A;  3MZD A;  5FI6 A;  4K91 A;  2P74 A;  4IBX A;  3O86 A;  4PM6 A;  1KGG A;  3C7U A;  4M3K A;  2J9P A;  4EBL A;  4KZ9 A;  5FAP A;  4Y0T A;  1FR6 A;  2ZD8 A;  4B4X A;  1W79 A;  1BUE A;  3OPL A;  3NC8 A;  1ERM A;  4BLM A;  2PBY A;  2WGI A;  4UA9 A;  4JLF A;  3G35 A;  2RCX A;  3ZG5 A;  4C3Q A;  1WYC A;  4E3L A;  5CHU A;  3V50 A;  3NBL A;  1YLP A;  1WYB A;  3O87 A;  3Q7V B;  1FSY A;  2HDQ A;  3PBN A;  2H10 A;  1JWV A;  4FH4 A;  4GOG A;  4HES A;  5D3O A;  5AQB A;  3ZCZ A;  4KQO A;  4WM9 A;  1J9M A;  3SS5 A;  5HAP A;  1PI4 A;  5FQ9 A;  4HBT A;  4CPK A;  3SS4 A;  2HDS A;  5A92 A;  4R4R A;  2Z2M B;  3TSG A;  2ZQD A;  4E3M A;  2XK1 A;  1FOF A;  4X68 A;  4EBP A;  5HFO A;  2V1Z A;  1K4E A;  3G32 A;  4OQH A;  2J7V A;  5KZH A;  1DJA A;  1GA0 A;  3GRJ A;  5E43 A;  2WKH A;  3OCL A;  3ZDJ A;  2VGK A;  3LCE A;  4R1G A;  3IXG A;  5DTT A;  3E2L A;  4IVI A;  4E3I A;  3W4P A;  5FSR A;  2H0T A;  3I7J A;  4S2P A;  2Y2M A;  5FAS A;  3M6B A;  4JXV A;  5DF8 A;  1ES5 A;  4JXW A;  1CI9 A;  1ALQ A;  3DW0 A;  3GMW A;  4OON A;  3A3F A;  4WMC D;  5A93 A;  3BRM A;  1BUL A;  1XPB A;  3DTM A;  3ITB A;  4OQ0 A;  4WMC A;  4UAA A;  5GHX A;  2XH9 A;  1TEM A;  3LY4 A;  1KDS A;  1GCE A;  1YLY A;  3AGD A;  4GD8 A;  5FA7 A;  2HDU A;  2XQZ A;  1SDN A;  4IBR A;  1Q2P A;  4OP5 A;  4U0T A;  4P6B A;  2EX8 A;  4GDN A;  3AGE A;  1K55 C;  1GHP A;  4K0X A;  4PPR A;  5EOE A;  2Z2L B;  2XR0 A;  3N8S A;  4OQG A;  2HP9 A;  1ERO A;  2Y2I A;  3VFF A;  2Q9M A;  4KQR A;  5HAQ A;  1K54 A;  1LHY A;  3Q7Z A;  5EVI C;  2ZQ8 A;  4E3O A;  2Y2K A;  4BEN A;  3NIA A;  2Y2L A;  1PWC A;  3HRE A;  2HP5 A;  1PZP A;  3G31 A;  5F82 A;  4FCF A;  1VM1 A;  3RXW A;  1DJC A;  4X69 A;  3GVB A;  2Q9N A;  3SH7 A;  3HUN A;  3P09 A;  4NET A;  4OLG A;  2XFS A;  2ZM2 A;  2ZQ9 A;  1SDE A;  3V5M A;  5CGW A;  2JCH A;  1XGJ A;  1PWG A;  3FV7 A;  1ZG6 A;  5DTK A;  5A90 A;  2Y59 A;  4FH2 A;  2PU2 A;  4N9L A;  2IWD A;  4N92 A;  4YIN A;  4JXS A;  5CER A;  1KE4 A;  1PZO A;  3WS2 A;  3FKW A;  3HLC A;  2EXB A;  2Y55 A;  3M2J A;  5J8X A;  5FQK A;  2WZX A;  3NDE A;  3PBS A;  3PAE A;  1AXB A;  1K54 C;  3V3R A;  1LLB A;  1NYM A;  3C7V A;  3W4Q A;  2VGJ A;  5FQI A;  3FWL A;  3JYI A;  5E2H A;  2WGW B;  1S6R A;  5TR7 A;  3PBQ A;  3S22 A;  3UDX A;  4B4Z A;  2QPN A;  1YLT A;  4XUX A;  4S2N C;  3HLW A;  1SHV A;  3BM6 A;  4XUZ A;  1MY8 A;  1KGF A;  1FCO A;  2OSU A;  5GL9 A;  1Y54 A;  4D2O A;  1HD8 A;  3IF6 C;  1JTG A;  4QY5 A;  2ZC3 B;  1XX2 A;  4DE0 A;  3HVF A;  3DWK A;  4JBF A;  3Q82 A;  3IXD A;  3BFE A;  5E2G A;  4EQI A;  2ZQA A;  5EVL A;  5KSC A;  2WAD A;  4MNR A;  2G2U A;  3QHY A;  5HAI A;  4EUZ A;  1BTL A;  3UPP A;  4BL2 A;  3CMZ A;  2BG1 A;  3IXH A;  5M18 A;  1IEM A;  2E8I A;  2DRW A;  1NJ4 A;  1IYP A;  4L0L A;  1BZA A;  5JYO A;  3A3D A;  4WZ4 A;  1LI0 A;  3PAG A;  3S4X A;  1YLZ A;  2XF3 A;  3UN7 A;  3HL9 A;  3C5A A;  1N4O A;  4DRT A;  1PWD A;  1HVB A; 
#chains in the Genus database with same CATH topology
 4XXR A;  1PI5 A;  1F5M A;  1L0E A;  4WF0 A;  2JC7 A;  2A3U A;  4B88 A;  1J3W A;  4F94 A;  3NEC A;  1EI5 A;  4Y0O A;  4GLQ A;  3P01 A;  4HP4 A;  4EW7 A;  3ULF A;  3N6I A;  2XEP A;  3D9Y A;  4UHU A;  5F69 A;  4BBT A;  5EV0 A;  1NRJ A;  4GD6 A;  4OPZ A;  4B9O A;  3B33 A;  5DJU A;  1N9L A;  3G4P A;  4G3W A;  1L2S A;  1LL5 A;  4ARZ B;  2W27 A;  3NOT C;  3OZH A;  5CTN A;  2PD7 A;  3A0S A;  3LIE A;  5IS1 A;  3ZGA B;  1O7E A;  2Z6D A;  1JNU A;  2JBF A;  2XRN A;  1PW1 A;  2OAQ 1;  4QD4 A;  4KG5 A;  3BLS A;  3K3D A;  4RYE A;  4KZB A;  3WRT A;  3A3I A;  4MLL A;  3HLE A;  4UA6 A;  2B5R A;  3NHQ A;  4ZRR A;  3T4J A;  2WYX A;  5HWV A;  1IKG A;  4Y0U A;  1K4F A;  5GLD A;  3IF5 A;  4PKY A;  2ZC5 B;  1MWS A;  4MEZ A;  3HLG A;  4Z1W A;  4KZA A;  1VB6 A;  3N8L A;  4OKP A;  4WUJ A;  5FQJ A;  3IWO A;  4IUK A;  1W7F A;  4OQI A;  2J9O A;  2A49 A;  4LEN A;  3HJK A;  3MZE A;  4HHD A;  3CI6 A;  4JKT A;  4R4S A;  1OTB A;  5DFY A;  1DP6 A;  4WEL A;  3OBF A;  3ZG9 B;  4R0Q A;  1YLJ A;  4IED A;  5DKK A;  4R3J A;  3OPP A;  4NKP A;  4S2J A;  2PU4 A;  4OPQ A;  1GA9 A;  1ESU A;  4LRY C;  2HDR A;  1Y28 A;  4L9E A;  3K3C A;  5CGX A;  4KQQ A;  4YNR A;  2EX2 A;  2DMW A;  3CUE A;  3BY9 A;  3LIF A;  3LYX A;  3CZD A;  3H82 B;  2W1T A;  2EX6 A;  1H3Q A;  2ZC6 B;  3FZC A;  1OT6 A;  3OCN A;  3UPN A;  4LCM A;  4X25 A;  1I5Q A;  2P9V B;  3C8C A;  3OLO A;  3HUM A;  4O7D A;  1KE3 A;  1IYO A;  4LGW A;  3LEZ A;  3O3V A;  1K55 A;  1NZO A;  1GHI A;  3DTE A;  4E6W A;  3UDF A;  2V9A A;  1NXY A;  4JXG A;  1YQS A;  3OPH A;  2PYR A;  1JVJ A;  4GCZ A;  1N9N A;  5FAT A;  2P04 A;  3EGD C;  3RFB A;  4DE3 A;  3ZHH A;  2CC1 A;  2XA7 M;  5DKL A;  1JWP A;  4X53 A;  1PYY A;  3JPU A;  1MWT A;  3S7N A;  4LV3 A;  1F9I A;  1S66 L;  1UWP X;  1W8Q A;  4NXB A;  2G2W A;  5FQM A;  1S67 L;  4X56 A;  4YFM A;  1XKZ A;  4N1X A;  5AVE A;  3CJM A;  2OWJ A;  5L10 A;  3EEH A;  4QY6 A;  4S2N A;  3VP1 A;  2Y2Q A;  4ZDX A;  3VP4 A;  1T18 A;  5CRF A;  4X55 A;  4S2K A;  3MBZ A;  1DP9 A;  1OME A;  4JPM A;  3UMD A;  1PRQ A;  4X1M A;  1LSW A;  3R7W A;  1OTA A;  4Z9Q A;  2M1C A;  2B18 A;  3PTE A;  5FDS A;  3ZG7 B;  2DCF A;  2XA7 S;  1KGE A;  5DF9 A;  5G4Y A;  1E3U A;  2ZJ9 A;  2VJW A;  3FYZ A;  4Y5F A;  2PR5 A;  2XFT A;  3OOV A;  1DP8 A;  1KE0 A;  4I38 A;  3KYE A;  4XT2 A;  2P74 A;  3T50 A;  1LL8 A;  3O86 A;  1PNE A;  2J9P A;  3IS2 A;  4EBL A;  1TD5 A;  4HJ3 A;  4B4X A;  2JKF A;  3OPL A;  3NC8 A;  3L7H A;  3CPT A;  1ODV A;  5CHU A;  3O87 A;  1FSY A;  4EEU A;  4GOG A;  1JWV A;  2PRF A;  3KO6 A;  4MDZ A;  1T1C A;  4R4R A;  2Z2M B;  4EET B;  2ZQD A;  2VEA A;  1G5U A;  4X68 A;  4EBP A;  3C30 A;  2V1Z A;  4OQH A;  3G32 A;  4BMW A;  1GA0 A;  5E43 A;  4NXF A;  1V9Y A;  3LR3 A;  3OCL A;  3ZDJ A;  3LCE A;  3MQ0 A;  3IXG A;  4H6J B;  4HI4 A;  3DTI A;  2H0T A;  1YAX A;  4Q0I A;  2Y2M A;  3M6B A;  4JXW A;  4OON A;  1ALQ A;  3DW0 A;  4I3J A;  4GS9 B;  4LFU A;  4UAA A;  3F1P B;  4HP9 A;  1YLY A;  3AGD A;  4GD8 A;  4Y3I A;  2MJ6 A;  4IBR A;  3CLO A;  4P6B A;  2EX8 A;  3N8S A;  1VEU A;  2VGL M;  2XR0 A;  4OQG A;  5HL6 A;  2KX6 A;  3Q7Z A;  1LHY A;  5EVI C;  4BEN A;  2Y2L A;  3UME A;  3GVB A;  3P09 A;  4NET A;  5LBR A;  1SDE A;  4E04 A;  5CGW A;  2JCH A;  4IUH A;  5HWT A;  1TF1 A;  1N9O A;  4DN0 A;  2ZL1 B;  3FPV A;  2W3D A;  1XFN A;  2HJE A;  4QWO A;  2ZOI A;  3WS2 A;  2EXB A;  2Y55 A;  4EU0 A;  3NDE A;  3PAE A;  4PKY G;  4DJ3 A;  5E2H A;  2WGW B;  1S6R A;  2V1A A;  5HD3 A;  3S22 A;  4B4Z A;  3T1Q B;  4XUX A;  2ACG A;  4XUZ A;  1K0K A;  5GL9 A;  3PXP A;  2VV6 A;  4DE0 A;  3VV4 A;  3A0V A;  5E2G A;  3BFE A;  1GSV A;  2G2U A;  1BTL A;  4BL2 A;  3CMZ A;  3JVV A;  2VGL S;  1P9W A;  3A3D A;  5J7E A;  2XF3 A;  3C5A A;  1OTI A;  2QHK A;  5L2F A;  1DJB A;  1EWZ A;  2ZM8 A;  3NOU C;  4OLD A;  5EOO A;  3LGO A;  4C75 A;  2IWB A;  1FIK A;  5FDH A;  1KVM A;  1HTZ A;  3E0Y A;  5KSH A;  3LI9 A;  5FAO A;  3BFD A;  2HJ9 C;  3CIT A;  3VOL A;  1VET B;  3A3E A;  3MXS A;  3C2W A;  5GLA A;  4F3L B;  3NOP C;  3UE0 A;  3UY6 A;  3HBR A;  3IHB A;  1YMS A;  3KYQ A;  2OLU A;  3UE1 A;  2Y2G A;  4GKU A;  4X1L A;  3IWI A;  2QMI A;  5GHZ A;  4ZJ2 A;  3F1N B;  4CLC B;  3LI8 A;  3ZG0 A;  5HD5 A;  4G3V A;  3RXX A;  2OWH A;  4A5R A;  4LV0 A;  1X0O A;  2QYB A;  3PBT A;  3PR6 A;  1CEG A;  3CG5 A;  3F1O A;  1LT0 A;  3GQZ A;  3P98 A;  5HDS A;  4II7 A;  3VE3 A;  1SKO B;  4HIA A;  3MS6 A;  1MWU A;  4Q8I A;  2OOL A;  2PR6 A;  1E4D A;  4BQM A;  3ICY A;  2FFY A;  3GV9 A;  1BLS A;  2O9A A;  3NI9 A;  1IEL A;  1BT5 A;  4WYY A;  4Q0J A;  5CTM A;  4LV1 A;  3T4S A;  2H28 A;  1ZC2 A;  4OOL A;  3E4O A;  3UPO A;  3QP5 A;  5GHY A;  4YOF A;  1XP4 A;  3IH9 A;  2HV1 A;  4O8G A;  4WLA A;  1BSG A;  1NYY A;  4I3A A;  2ZMA A;  2ZM0 A;  4EWF A;  3B42 A;  1LI9 A;  1T1A A;  3MQQ A;  3WS1 A;  4CJN A;  3R4K A;  1K57 A;  1HZO A;  5DTS A;  5HW3 A;  3SZT A;  2V0W A;  3EWK A;  3BEC A;  3IX8 A;  4MBF A;  2EFX A;  1RGZ A;  2EXA A;  1TVF A;  2A24 B;  4R23 A;  1ZG4 A;  1L0F A;  2O9B A;  1PIO A;  4GZB A;  1XJ6 A;  2C5W B;  3PBO A;  2H0Y A;  3VP3 A;  3IT9 A;  3N8R A;  3E4Q A;  2W3G A;  3C4O A;  1XA7 A;  3HLB A;  1K57 C;  5GLB A;  2EWW A;  4G3K A;  1MZU A;  1ONH A;  3S1Y A;  1H8Y A;  3BYD A;  3FG8 A;  5J3W A;  1L0D A;  2HF6 A;  2KDK A;  2W3H A;  3HLD A;  1S4R A;  3UB5 P;  4HY8 A;  1MC0 A;  4LCL A;  4RX2 A;  4E6X A;  5CEC A;  3BQ8 A;  1M40 A;  2PAV P;  5EVI D;  4Y13 A;  3G34 A;  4FSF A;  2VV8 A;  2XLN A;  3UB8 A;  2HPB A;  3T1R A;  3E98 A;  2I72 A;  3RTY A;  4ZTK A;  1K6R A;  5AQA A;  2VX8 A;  3WS0 A;  2QJ7 A;  2FH5 A;  2JKR M;  2ZMV A;  2ZC4 B;  3IXB A;  4ID4 A;  4KZ3 A;  3MZF A;  4WEK A;  1WA9 A;  2OV5 A;  2X71 A;  4UEY A;  3VP2 A;  1NLZ A;  4DF6 A;  3Q1F A;  4MBH A;  3CWF A;  3VE4 A;  4GHI B;  1DY6 A;  3MJQ A;  5IT5 A;  1AWI A;  4OP8 A;  4KZ8 A;  4FTX A;  1W63 M;  4WBG A;  2WAF A;  3BW6 A;  5HSQ A;  4WEJ A;  1MKM A;  1NY0 A;  4PAU A;  1JWZ A;  3KSG A;  2DNS A;  4DXB A;  4NXG A;  2Y79 A;  4HJ6 A;  3KSI A;  3MFX A;  2WK0 A;  3T4O A;  1L3L A;  4IVK A;  4DE1 A;  3UB6 A;  3PBR A;  2ZQ7 A;  2EWV A;  4BD1 A;  1CEF A;  4ZBE A;  3CHW P;  1A0K A;  4DDS A;  3WRZ A;  1YSQ A;  4N9K A;  5FEG A;  3EGX C;  1E25 A;  5G4Z A;  4I3I A;  1L0G A;  4EUV A;  2Y2N A;  2RL3 A;  5HX9 A;  2XRO A;  3NJA A;  2WKI A;  2Y91 A;  5E2E A;  3ZG8 B;  3WS5 A;  1NRF A;  4R3B A;  5HPF A;  1ES4 A;  1ERQ A;  1P9R A;  2R9W A;  4KZ7 A;  3LO7 A;  4U0X A;  1FIL A;  5TBM A;  3MQO A;  1QME A;  3IF6 B;  1NZU A;  4GS9 A;  4K91 A;  4PM6 A;  2K31 A;  4Y0T A;  5C5K A;  3KSH A;  1FR6 A;  2OAP 1;  5DJT A;  1BUE A;  2PBY A;  1TS6 A;  3G35 A;  2RCX A;  4C3Q A;  2NUP C;  4WL9 A;  3V50 A;  3NBL A;  1YLP A;  5D3O A;  4FH4 A;  1ZTU A;  4WM9 A;  1PI4 A;  5FQ9 A;  4HBT A;  5HDC A;  3TSG A;  3MF0 A;  4E3M A;  1FOF A;  2O99 A;  1DJA A;  2JN7 A;  2VV7 A;  3GRJ A;  4JGQ A;  3E4P A;  2VGK A;  4L9F A;  3CUE C;  3T1X A;  4IVI A;  4E3I A;  3H7W A;  5FSR A;  4D60 A;  5FAS A;  4S2P A;  5F5Y A;  1ES5 A;  1CI9 A;  4WMC D;  5A93 A;  3A3F A;  3BRM A;  1XJ4 A;  2HZ5 A;  3ITB A;  3TJZ C;  5GHX A;  2XH9 A;  1TEM A;  3B47 A;  2XQZ A;  3IBJ A;  1K55 C;  4K0X A;  2Z2L B;  2Y2I A;  3KSF A;  1K54 A;  2ZQ8 A;  2GNX A;  1PWC A;  1P97 A;  3G31 A;  5F82 A;  1VM1 A;  4X69 A;  3SH7 A;  5EFW A;  3HUN A;  4OLG A;  2ZM2 A;  5EVE A;  3FV7 A;  5DTK A;  1ZG6 A;  2Y59 A;  4FH2 A;  1YKD A;  2JHE A;  4N9L A;  2IWD A;  4KQD A;  4YIN A;  1T1B A;  4JGO A;  4EES A;  3LID A;  2EA9 A;  3PBS A;  1AXB A;  1K54 C;  1LLB A;  5DFX A;  3W4Q A;  3FWL A;  3JYI A;  1V9Z A;  2L4R A;  5TR7 A;  3PBQ A;  2M7V A;  3UDX A;  2QPN A;  2CMN A;  3UE6 A;  4S2N C;  3HLW A;  3BM6 A;  4IJG A;  2QJ5 A;  1MY8 A;  1FCO A;  2OSU A;  4QY5 A;  4JBF A;  5KSC A;  2WAD A;  5HAI A;  3QHY A;  4EUZ A;  1Y4O A;  2GZA A;  3IXH A;  1IEM A;  4L0L A;  1BZA A;  5JYO A;  3PYP A;  3KX0 X;  2L0W A;  1N4O A;  5A8B A;  2KLI A;  1PWD A;  4DRT A;  3F1N A;  4CLC A;  4JF6 A;  4BL3 A;  1WE4 A;  4QJG A;  5AQ9 A;  3S7O A;  2V2F F;  1S0W A;  3KYZ A;  2H5S A;  1S1Y A;  3QNB A;  1TDG A;  2Y2J A;  2IA2 A;  3A3J A;  4BJP A;  1FQG A;  4BBV A;  3U2A A;  4Y7P A;  3ZNT A;  2WKR A;  5E2F A;  2V20 A;  4R3A A;  2VLG A;  2W1R A;  2J80 A;  2WZZ A;  2IWC A;  4OH0 A;  4WN5 A;  3TG9 A;  3VOZ A;  3T4Q A;  4X6T A;  2FFF B;  1IYQ A;  3ZFZ A;  3SOI A;  5IU1 A;  4ZAM A;  2W1T B;  1S1Z A;  2W0N A;  2P08 A;  2J3T C;  3LIA A;  3L9K A;  4GNU A;  1MBL A;  1MPL A;  1KDW A;  4PM9 A;  2R9X A;  4H8R A;  2ZQC A;  1I2W A;  2XDM A;  4BWI A;  5CXW A;  3C4P A;  3MKF A;  4DE2 A;  3VFH A;  1VQQ A;  2A24 A;  3S7Q A;  3ZVW A;  5FAQ A;  1GHM A;  1M6K A;  3TW8 A;  3V3S A;  1XFQ A;  2QWS A;  2JKR I;  4EXO A;  1SKF A;  4HOI A;  3ZVT A;  4E3J A;  4OOM A;  1RGY A;  2Y2P A;  4GW9 A;  4K0W A;  5G18 A;  1IKI A;  4N1H A;  3OC2 A;  3G6O A;  3N4I A;  5CX7 A;  4UA7 A;  3DTK A;  4QHC A;  2XD5 A;  1H5X A;  4NK3 A;  2JKT I;  1BLH A;  1U60 A;  4KG2 A;  3LR5 A;  2AVX A;  3D72 A;  5CHJ A;  2O9C A;  3U4L P;  4ARZ A;  4RX3 A;  4Y15 A;  4HQA A;  1PW8 A;  2QZ6 A;  3BFC A;  3DAV A;  1FR1 A;  2D02 A;  4MN6 A;  3G2Y A;  1N9B A;  3UNW A;  1D06 A;  1ONG A;  3MMH A;  3ZQ5 A;  1Q2Q A;  3W8K A;  4P87 A;  3IH8 A;  4PM7 A;  2LB5 A;  5HAR A;  4I5S A;  2XD1 A;  1XXM A;  4GHI A;  1T19 A;  5DF7 A;  3IQA A;  1OJG A;  1H8M A;  4IHQ A;  1TS7 A;  3HJI A;  5AQ7 A;  4P85 A;  5AVF A;  1G6A A;  3UO9 A;  4BD0 A;  4MCW A;  2EFU A;  2PDR A;  4B93 A;  4XT2 B;  4R70 A;  4EBN A;  3IS2 B;  2B95 A;  1SCW A;  4DXC A;  3LUQ A;  4LV2 A;  1K56 D;  4OPY A;  4I39 A;  2LB9 A;  3NY4 A;  4GDB A;  3CPT B;  4HNB A;  1IYS A;  4E3N A;  1CI8 A;  2BAS A;  5JYP A;  1BYW A;  1F98 A;  4KZ5 A;  3G30 A;  3QP8 A;  3BFG A;  4JF5 A;  1FSW A;  1YSP A;  4GN2 A;  3UDI A;  2X02 A;  5EVI B;  4Y2F A;  2PHY A;  2BLS A;  4HH3 A;  2W3E A;  2GJ3 A;  4RVA A;  4QB8 A;  1G68 A;  2V8F A;  3IF6 A;  5CED A;  2J3W A;  2V0U A;  1FCM A;  1YM1 A;  3BEB A;  3H82 A;  5BOH A;  4Y17 A;  3NDG A;  2VA0 A;  1K38 A;  2P9V A;  1VEU B;  3WS4 A;  1ES2 A;  1TDL A;  4LLO B;  4JGR A;  5HL1 A;  5HPI A;  3ZNY A;  2B02 A;  1MXO A;  3IHA A;  3PHY A;  5CEB A;  5I5L A;  4KG6 A;  4QU3 A;  1E3U D;  4FD8 A;  3G2Z A;  2UV0 E;  4KZ4 A;  4R6L A;  3IWQ A;  3VSL A;  4RA7 A;  3N7W A;  4O01 A;  3MZD A;  1UWN X;  3C7U A;  4KZ9 A;  5FAP A;  3LIC A;  2ZOH A;  2WGI A;  4JLF A;  3ZG5 A;  1TS8 A;  1WYC A;  4E3L A;  3Q7V B;  4LPZ A;  4LRZ E;  4L9G A;  4HES A;  2H10 A;  3ZCZ A;  1HLU P;  4KQO A;  1J9M A;  3SS5 A;  5HAP A;  3BJN A;  3SW1 A;  4CPK A;  3SS4 A;  2HDS A;  5HDD A;  1K4E A;  3FC7 A;  3QP1 A;  4R1G A;  5DTT A;  2J3T D;  4JXV A;  3W2Z A;  3LY4 A;  1KDS A;  5FA7 A;  2WKP A;  1SDN A;  1Q2P A;  4U0T A;  4OP5 A;  2KOI A;  1OPX A;  4GDN A;  3AGE A;  4PHT A;  1GHP A;  4PPR A;  5EOE A;  1G6O A;  2PD8 A;  1IOU A;  3VFF A;  5HAQ A;  2Q9M A;  3TE8 A;  2Y2K A;  3NIA A;  4DJ2 A;  3RXW A;  2V8C A;  2JKT M;  2Q9N A;  3JVU A;  3S7P A;  2XFS A;  2FZ0 A;  1XGJ A;  1PWG A;  5TJJ A;  3V67 A;  5CER A;  1KE4 A;  1PZO A;  3FKW A;  3HLC A;  5J8X A;  3M2J A;  5F68 A;  3LIB A;  1NYM A;  1OTD A;  3C7V A;  2VGJ A;  5FQI A;  3F1O B;  3MR0 A;  3D3O A;  1YLT A;  3BY8 A;  1SHV A;  4D2O A;  1H0M A;  4JGP A;  1XJ2 A;  1JTG A;  3QP2 A;  3MSH A;  2ZC3 B;  3HVF A;  4MN5 A;  2ZQA A;  5EVL A;  4H6J A;  1CF0 A;  3UPP A;  3A0R A;  2DRW A;  1NJ4 A;  3S4X A;  1YLZ A;  3UN7 A;  3F1P A;  2ZBB A;  3DBA A;  3UB7 A;  1HVB A;  4FUW A;  3T4L A;  5FQQ A;  2WAE A;  1DRM A;  3ISG A;  3M2K A;  4DKI A;  1CQA A;  5DVA A;  4EQ1 A;  4K08 A;  1Z6F A;  3BQA A;  2VKS A;  1ESI A;  4OPR A;  2YKH A;  1PFL A;  2ZL1 A;  2ZC7 A;  1W8Y A;  4KUO A;  2Y4A A;  1ZKJ A;  5KMW A;  2C6W B;  1SZV A;  4U3T A;  5K5B A;  2X01 A;  1ES3 A;  2Y2H A;  2WGW A;  1O07 A;  3SH8 A;  4HBU A;  1Z09 A;  1F2K A;  4ETX A;  2INW A;  3GEC A;  1IFQ A;  3BLM A;  4YWZ A;  1K56 A;  3TOI A;  2JKG A;  1K6S A;  3FPW A;  1D7E A;  4EEP A;  4EV4 A;  3GR2 A;  1C3B A;  2R78 A;  3VOY A;  3NUL A;  4PMA A;  1CK3 A;  2EX9 A;  3NCK A;  4E3K A;  4WZ5 A;  3BWL A;  2WKQ A;  4FOF A;  3RJU A;  2XGN A;  2ZLY A;  3MKE A;  4RQ9 A;  2WGV A;  4KUK A;  5L8M A;  4KZ6 A;  1TS0 A;  2E8J A;  1JTD A;  5EPH A;  3T4T A;  3LEQ A;  3GTC A;  5F83 A;  5KIZ A;  1EW0 A;  4ETZ A;  1VET A;  1XA1 A;  4OOY A;  1KVL A;  1W5D A;  4JF4 A;  4MN7 A;  3Q07 A;  3EQU A;  3D4F A;  4LRX C;  4DDY A;  4S2I A;  4F3L A;  2OLV A;  5A91 A;  1YT4 A;  4WZ5 C;  5L09 A;  3W4O A;  1NWZ A;  3OPR A;  2W3F A;  2GX5 A;  5L07 A;  3MXQ A;  5CGS A;  3SS3 A;  3MXR A;  3P7N A;  3M6H A;  2Y2O A;  3RH8 B;  5F1G A;  4QPR A;  3LR0 A;  2HP6 A;  1QMF A;  3MFD A;  1SKO A;  1I2S A;  3O88 A;  1MKI A;  5TFQ A;  1YLW A;  5IHV A;  4S2M A;  4MBK A;  1NLY A;  5FI7 A;  4KEN B;  3GSG A;  4CLC C;  3EEA A;  2ZMF A;  3GDI A;  3BFF A;  3VSK A;  4EER A;  1H8Z A;  3HUO A;  5EVI A;  1BLC A;  4PM5 A;  3WWX A;  5TBM B;  4ZJ3 A;  3ITA A;  5M1A A;  3UE3 A;  4NEE D;  5MC7 A;  5AJG A;  4ZJ1 A;  1OT9 A;  1KOU A;  4P0M A;  1YMX A;  4PM8 A;  1MWR A;  5GLC A;  3VP0 A;  3EQV A;  3V39 A;  4CQH A;  2K2N A;  1OTE A;  1FCN A;  1BLP A;  3ZYT A;  2WKE A;  2WUQ A;  5EE8 A;  5TGF A;  3Q81 A;  4C6Y A;  5FL3 A;  4OVD A;  5EM0 A;  2JE5 A;  5HWW A;  1RCJ A;  2Y8H A;  1GSW A;  2J8Y A;  3H7W B;  2UWX A;  5CHM A;  5EUA A;  3UB9 A;  1VHM A;  1LSV A;  4UQI M;  3EOI A;  3AGF A;  4GB7 A;  5EEC A;  1K25 A;  3DWZ A;  3T4K A;  4S2O A;  5I94 A;  3B3X A;  5U47 A;  3QNC A;  3H9W A;  1RP5 A;  3IBR A;  3FKV A;  2BTF P;  3T12 B;  1LL9 A;  3E2K A;  3T1S A;  3Q7V A;  3LR4 A;  3LY3 A;  4CLC E;  4HH2 A;  5F1F A;  2Z6C A;  4S2L A;  5M19 A;  1D1J A;  2GDN A;  4HEF A;  1YPR A;  3SH9 A;  1ACF A;  4P6Z M;  1XGI A;  1XJ3 A;  2QKP A;  3VMA A;  1STZ A;  3HLF A;  1OJ5 A;  5FI2 A;  2D01 A;  2M7U A;  5FI6 A;  4BBU A;  4IBX A;  1KGG A;  4M3K A;  1W63 Q;  3QP6 A;  2P7J A;  2ZD8 A;  1W79 A;  4BLM A;  1ERM A;  4UA9 A;  3R7W B;  1WYB A;  2HDQ A;  3PBN A;  5AQB A;  3IX4 A;  4UQI S;  3HCY A;  5HZH A;  5A92 A;  2XK1 A;  5HFO A;  3C38 A;  5KZH A;  2J7V A;  3IX3 A;  2WKH A;  3E2L A;  3W4P A;  2XSS A;  4AFI A;  3I7J A;  2K7S A;  4Q0H A;  5DF8 A;  2PBD P;  3GMW A;  1BUL A;  1XPB A;  3DTM A;  4OQ0 A;  4WMC A;  1S4S A;  1GCE A;  4HJ4 A;  2HDU A;  2PYP A;  2NUT C;  4P6Z S;  2L1M A;  3CAX A;  4NXE A;  2HP9 A;  1UGU A;  2YKF A;  1ERO A;  4KQR A;  4E3O A;  2Q0O A;  3HRE A;  2HP5 A;  1PZP A;  4FCF A;  4ME4 A;  1DJC A;  4MMN A;  2ZQ9 A;  4DMZ A;  3V5M A;  2VZW A;  2A2L A;  1CJF A;  5FEF A;  5A90 A;  2V1B A;  4R38 A;  2PT7 A;  2PU2 A;  4M4X A;  4N92 A;  4JXS A;  4NG2 A;  5FQK A;  2WZX A;  3V3R A;  3TRC A;  1LSX A;  4O0P A;  5J4E A;  1P0Z A;  5EM1 A;  4ESP A;  3O5Y A;  1GSX A;  2O0Y A;  1G28 A;  1KGF A;  4GJ4 A;  1Y54 A;  2HGV A;  3LFV A;  1HD8 A;  3K2N A;  3IF6 C;  1XX2 A;  3QP4 A;  3DWK A;  3Q82 A;  3IXD A;  4EQI A;  4MNR A;  2VK3 A;  5F6A A;  2G7U A;  2BG1 A;  5M18 A;  2E8I A;  1ZHH B;  1IYP A;  4WZ4 A;  1LI0 A;  3PAG A;  2I9V A;  3HL9 A;  4CLC D; 
#chains in the Genus database with same CATH homology
 4XXR A;  1DJB A;  1EWZ A;  1PI5 A;  4JF6 A;  2ZM8 A;  5EOO A;  4OLD A;  4BL3 A;  1WE4 A;  1L0E A;  4C75 A;  2IWB A;  5L2F A;  2JC7 A;  5FDH A;  2A3U A;  4B88 A;  4QJG A;  1KVM A;  5FQQ A;  1HTZ A;  4F94 A;  2WAE A;  1EI5 A;  4Y0O A;  5AQ9 A;  5KSH A;  3ISG A;  2V2F F;  3M2K A;  4DKI A;  1S0W A;  5FAO A;  5DVA A;  3BFD A;  3N6I A;  2H5S A;  1Z6F A;  3QNB A;  1TDG A;  2XEP A;  2Y2J A;  3A3E A;  3A3J A;  3MXS A;  4BJP A;  1FQG A;  1ESI A;  4UHU A;  5GLA A;  3UY6 A;  3UE0 A;  3HBR A;  3IHB A;  4OPR A;  4Y7P A;  3ZNT A;  1YMS A;  2OLU A;  4GD6 A;  4OPZ A;  2ZC7 A;  3UE1 A;  2Y2G A;  4GKU A;  3IWI A;  5E2F A;  2V20 A;  2QMI A;  5GHZ A;  4ZJ2 A;  1W8Y A;  3G4P A;  2Y4A A;  1ZKJ A;  5KMW A;  2C6W B;  1L2S A;  1LL5 A;  3ZG0 A;  3RXX A;  4A5R A;  2WZZ A;  4U3T A;  4LV0 A;  2IWC A;  4OH0 A;  3PBT A;  3OZH A;  2X01 A;  1ES3 A;  1CEG A;  5CTN A;  3CG5 A;  2Y2H A;  3TG9 A;  3VOZ A;  2WGW A;  1O07 A;  3SH8 A;  3GQZ A;  3P98 A;  3ZGA B;  4HBU A;  1O7E A;  4X6T A;  2FFF B;  2JBF A;  1IYQ A;  3ZFZ A;  3SOI A;  1MWU A;  4ZAM A;  4Q8I A;  1E4D A;  1PW1 A;  4QD4 A;  4KG5 A;  3BLS A;  4RYE A;  4BQM A;  4KZB A;  2FFY A;  3WRT A;  3GV9 A;  3A3I A;  3BLM A;  1K56 A;  1BLS A;  4GNU A;  3TOI A;  1K6S A;  3NI9 A;  4MLL A;  1MBL A;  1MPL A;  3HLE A;  4UA6 A;  1KDW A;  2B5R A;  4PM9 A;  2R9X A;  1IEL A;  4EV4 A;  4H8R A;  2ZQC A;  1I2W A;  2XDM A;  2WYX A;  5CXW A;  3GR2 A;  1BT5 A;  1IKG A;  1C3B A;  3C4P A;  4WYY A;  4LV1 A;  5CTM A;  4Y0U A;  3VOY A;  1K4F A;  1ZC2 A;  3MKF A;  4PMA A;  1CK3 A;  2EX9 A;  5GLD A;  3NCK A;  3VFH A;  4DE2 A;  1VQQ A;  3IF5 A;  4E3K A;  4OOL A;  3ZVW A;  2ZC5 B;  1MWS A;  4WZ5 A;  5FAQ A;  3UPO A;  1GHM A;  4MEZ A;  1M6K A;  3HLG A;  3RJU A;  2XGN A;  5GHY A;  4KZA A;  2ZLY A;  3MKE A;  2WGV A;  3N8L A;  1XP4 A;  4OKP A;  5FQJ A;  4KZ6 A;  3V3S A;  3IH9 A;  3IWO A;  1W7F A;  1SKF A;  1JTD A;  5EPH A;  4OQI A;  3ZVT A;  2J9O A;  4E3J A;  2A49 A;  4OOM A;  3GTC A;  1RGY A;  1BSG A;  5F83 A;  4LEN A;  2Y2P A;  3MZE A;  1NYY A;  4JKT A;  2ZMA A;  4R4S A;  4K0W A;  2ZM0 A;  5G18 A;  1IKI A;  4EWF A;  1XA1 A;  4OOY A;  1LI9 A;  1KVL A;  4WEL A;  3WS1 A;  1W5D A;  4JF4 A;  4N1H A;  3Q07 A;  3ZG9 B;  4CJN A;  3EQU A;  3D4F A;  3OC2 A;  3N4I A;  1K57 A;  1HZO A;  4DDY A;  5DTS A;  4S2I A;  4R0Q A;  5HW3 A;  1YLJ A;  2OLV A;  4IED A;  4UA7 A;  5A91 A;  4R3J A;  3OPP A;  1YT4 A;  3BEC A;  4WZ5 C;  4QHC A;  2XD5 A;  3W4O A;  4MBF A;  1H5X A;  2EFX A;  3OPR A;  4NK3 A;  1BLH A;  4S2J A;  1U60 A;  1RGZ A;  2EXA A;  4KG2 A;  2PU4 A;  5CGS A;  4OPQ A;  3SS3 A;  1GA9 A;  1TVF A;  4R23 A;  1ZG4 A;  1ESU A;  5CHJ A;  1L0F A;  2HDR A;  1PIO A;  4GZB A;  3MXR A;  2C5W B;  3M6H A;  2Y2O A;  4RX3 A;  3PBO A;  5F1G A;  2H0Y A;  2HP6 A;  5CGX A;  1QMF A;  4KQQ A;  1PW8 A;  2QZ6 A;  3MFD A;  3BFC A;  3VP3 A;  3IT9 A;  2EX2 A;  3N8R A;  3C4O A;  1XA7 A;  1FR1 A;  3HLB A;  3CZD A;  1K57 C;  1I2S A;  1N9B A;  3FZC A;  2EX6 A;  2ZC6 B;  3G2Y A;  3O88 A;  1MKI A;  5GLB A;  3UNW A;  5TFQ A;  1YLW A;  5IHV A;  1ONH A;  4S2M A;  3S1Y A;  4MBK A;  1H8Y A;  3OCN A;  3BYD A;  1ONG A;  3UPN A;  4LCM A;  1I5Q A;  1L0D A;  2P9V B;  1Q2Q A;  3W8K A;  3HLD A;  4P87 A;  3IH8 A;  5FI7 A;  4PM7 A;  3HUM A;  4KEN B;  3GSG A;  4O7D A;  1KE3 A;  5HAR A;  1IYO A;  4LCL A;  2XD1 A;  4RX2 A;  3LEZ A;  4E6X A;  3O3V A;  1XXM A;  5CEC A;  1K55 A;  5DF7 A;  1M40 A;  3IQA A;  3BFF A;  3VSK A;  1H8Z A;  5EVI D;  1NZO A;  5AQ7 A;  3HUO A;  1GHI A;  4P85 A;  3G34 A;  4FSF A;  5EVI A;  3UDF A;  4E6W A;  1BLC A;  2XLN A;  4PM5 A;  1G6A A;  3UO9 A;  1NXY A;  3WWX A;  4BD0 A;  2HPB A;  4ZJ3 A;  4JXG A;  1YQS A;  3OPH A;  2I72 A;  3ITA A;  5M1A A;  3UE3 A;  4ZTK A;  1JVJ A;  1K6R A;  4ZJ1 A;  5FAT A;  2EFU A;  5AQA A;  4DE3 A;  3WS0 A;  3ZHH A;  2CC1 A;  4EBN A;  2ZC4 B;  4P0M A;  3IXB A;  4ID4 A;  4KZ3 A;  3MZF A;  1YMX A;  1JWP A;  1SCW A;  4PM8 A;  4WEK A;  4DXC A;  2OV5 A;  4X53 A;  1PYY A;  1MWT A;  4LV2 A;  2X71 A;  1K56 D;  1MWR A;  4LV3 A;  4OPY A;  5GLC A;  3VP0 A;  3VP2 A;  3NY4 A;  4GDB A;  1W8Q A;  1IYS A;  2G2W A;  3EQV A;  3Q1F A;  1CI8 A;  3V39 A;  4DF6 A;  5FQM A;  4E3N A;  5JYP A;  4MBH A;  4X56 A;  1FCN A;  4YFM A;  1BLP A;  4KZ5 A;  1DY6 A;  3G30 A;  1XKZ A;  4OP8 A;  4KZ8 A;  2WKE A;  2WUQ A;  5EE8 A;  5TGF A;  3Q81 A;  4N1X A;  3BFG A;  4JF5 A;  4WBG A;  3CJM A;  4C6Y A;  2WAF A;  1FSW A;  4OVD A;  4WEJ A;  4GN2 A;  2JE5 A;  3UDI A;  2X02 A;  5EVI B;  2BLS A;  1NY0 A;  4QY6 A;  1RCJ A;  4S2N A;  3VP1 A;  2Y2Q A;  1JWZ A;  4RVA A;  2J8Y A;  4QB8 A;  2DNS A;  4ZDX A;  3VP4 A;  2UWX A;  5CHM A;  4DXB A;  1G68 A;  5EUA A;  3IF6 A;  5CED A;  3AGF A;  4GB7 A;  5CRF A;  1K25 A;  3DWZ A;  1FCM A;  4X55 A;  5EEC A;  2WK0 A;  3MBZ A;  4S2K A;  4S2O A;  5I94 A;  4IVK A;  4DE1 A;  1YM1 A;  3BEB A;  1OME A;  3PBR A;  3B3X A;  4JPM A;  5U47 A;  2ZQ7 A;  5BOH A;  4BD1 A;  3QNC A;  1CEF A;  1RP5 A;  4ZBE A;  3NDG A;  4DDS A;  3FKV A;  3WRZ A;  4N9K A;  1K38 A;  2P9V A;  1LL9 A;  3E2K A;  3WS4 A;  1ES2 A;  1E25 A;  1TDL A;  3Q7V A;  3LY3 A;  4Z9Q A;  1L0G A;  5HL1 A;  3ZNY A;  1MXO A;  3IHA A;  5F1F A;  2Y2N A;  3PTE A;  2RL3 A;  5HX9 A;  5CEB A;  4S2L A;  4KG6 A;  3ZG7 B;  2WKI A;  2DCF A;  1E3U D;  2Y91 A;  4QU3 A;  5E2E A;  4FD8 A;  1KGE A;  5DF9 A;  3ZG8 B;  5M19 A;  3WS5 A;  3G2Z A;  2GDN A;  4HEF A;  1E3U A;  1NRF A;  4R3B A;  1ES4 A;  1ERQ A;  2ZJ9 A;  3FYZ A;  3SH9 A;  2R9W A;  4KZ7 A;  3LO7 A;  4U0X A;  1XGI A;  4KZ4 A;  3VMA A;  2XFT A;  3HLF A;  1QME A;  3IF6 B;  3IWQ A;  5FI2 A;  3VSL A;  4RA7 A;  3N7W A;  1KE0 A;  1NZU A;  3MZD A;  5FI6 A;  4K91 A;  2P74 A;  4IBX A;  3O86 A;  4PM6 A;  1KGG A;  3C7U A;  4M3K A;  2J9P A;  4EBL A;  4KZ9 A;  5FAP A;  4Y0T A;  1FR6 A;  2ZD8 A;  4B4X A;  1W79 A;  1BUE A;  3OPL A;  3NC8 A;  1ERM A;  4BLM A;  2PBY A;  2WGI A;  4UA9 A;  4JLF A;  3G35 A;  2RCX A;  3ZG5 A;  4C3Q A;  1WYC A;  4E3L A;  5CHU A;  3V50 A;  3NBL A;  1YLP A;  1WYB A;  3O87 A;  3Q7V B;  1FSY A;  2HDQ A;  3PBN A;  2H10 A;  1JWV A;  4FH4 A;  4GOG A;  4HES A;  5D3O A;  5AQB A;  3ZCZ A;  4KQO A;  4WM9 A;  1J9M A;  3SS5 A;  5HAP A;  1PI4 A;  5FQ9 A;  4HBT A;  4CPK A;  3SS4 A;  2HDS A;  5A92 A;  4R4R A;  2Z2M B;  3TSG A;  2ZQD A;  4E3M A;  2XK1 A;  1FOF A;  4X68 A;  4EBP A;  5HFO A;  2V1Z A;  1K4E A;  3G32 A;  4OQH A;  2J7V A;  5KZH A;  1DJA A;  1GA0 A;  3GRJ A;  5E43 A;  2WKH A;  3OCL A;  3ZDJ A;  2VGK A;  3LCE A;  4R1G A;  3IXG A;  5DTT A;  3E2L A;  4IVI A;  4E3I A;  3W4P A;  5FSR A;  2H0T A;  3I7J A;  4S2P A;  2Y2M A;  5FAS A;  3M6B A;  4JXV A;  5DF8 A;  1ES5 A;  4JXW A;  1CI9 A;  1ALQ A;  3DW0 A;  3GMW A;  4OON A;  3A3F A;  4WMC D;  5A93 A;  3BRM A;  1BUL A;  1XPB A;  3DTM A;  3ITB A;  4OQ0 A;  4WMC A;  4UAA A;  5GHX A;  2XH9 A;  1TEM A;  3LY4 A;  1KDS A;  1GCE A;  1YLY A;  3AGD A;  4GD8 A;  5FA7 A;  2HDU A;  2XQZ A;  1SDN A;  4IBR A;  1Q2P A;  4OP5 A;  4U0T A;  4P6B A;  2EX8 A;  4GDN A;  3AGE A;  1K55 C;  1GHP A;  4K0X A;  4PPR A;  5EOE A;  2Z2L B;  2XR0 A;  3N8S A;  4OQG A;  2HP9 A;  1ERO A;  2Y2I A;  3VFF A;  2Q9M A;  4KQR A;  5HAQ A;  1K54 A;  1LHY A;  3Q7Z A;  5EVI C;  2ZQ8 A;  4E3O A;  2Y2K A;  4BEN A;  3NIA A;  2Y2L A;  1PWC A;  3HRE A;  2HP5 A;  1PZP A;  3G31 A;  5F82 A;  4FCF A;  1VM1 A;  3RXW A;  1DJC A;  4X69 A;  3GVB A;  2Q9N A;  3SH7 A;  3HUN A;  3P09 A;  4NET A;  4OLG A;  2XFS A;  2ZM2 A;  2ZQ9 A;  1SDE A;  3V5M A;  5CGW A;  2JCH A;  1XGJ A;  1PWG A;  3FV7 A;  1ZG6 A;  5DTK A;  5A90 A;  2Y59 A;  4FH2 A;  2PU2 A;  4N9L A;  2IWD A;  4N92 A;  4YIN A;  4JXS A;  5CER A;  1KE4 A;  1PZO A;  3WS2 A;  3FKW A;  3HLC A;  2EXB A;  2Y55 A;  3M2J A;  5J8X A;  5FQK A;  2WZX A;  3NDE A;  3PBS A;  3PAE A;  1AXB A;  1K54 C;  3V3R A;  1LLB A;  1NYM A;  3C7V A;  3W4Q A;  2VGJ A;  5FQI A;  3FWL A;  3JYI A;  5E2H A;  2WGW B;  1S6R A;  5TR7 A;  3PBQ A;  3S22 A;  3UDX A;  4B4Z A;  2QPN A;  1YLT A;  4XUX A;  4S2N C;  3HLW A;  1SHV A;  3BM6 A;  4XUZ A;  1MY8 A;  1KGF A;  1FCO A;  2OSU A;  5GL9 A;  1Y54 A;  4D2O A;  1HD8 A;  3IF6 C;  1JTG A;  4QY5 A;  2ZC3 B;  1XX2 A;  4DE0 A;  3HVF A;  3DWK A;  4JBF A;  3Q82 A;  3IXD A;  3BFE A;  5E2G A;  4EQI A;  2ZQA A;  5EVL A;  5KSC A;  2WAD A;  4MNR A;  2G2U A;  3QHY A;  5HAI A;  4EUZ A;  1BTL A;  3UPP A;  4BL2 A;  3CMZ A;  2BG1 A;  3IXH A;  5M18 A;  1IEM A;  2E8I A;  2DRW A;  1NJ4 A;  1IYP A;  4L0L A;  1BZA A;  5JYO A;  3A3D A;  4WZ4 A;  1LI0 A;  3PAG A;  3S4X A;  1YLZ A;  2XF3 A;  3UN7 A;  3HL9 A;  3C5A A;  1N4O A;  4DRT A;  1PWD A;  1HVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...