4N9KA

Crystal structure of beta-lactamse penp_e166s in complex with cephaloridine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n9kA00
4Z9QA 4N9KA 4S2IA 4UA7A 4PM5A 5GHYA 4LV2A 1E3UD 1PIOA 5FAOA 3VFHA 2XR0A 4OOLA 2ZJ9A 1L0DA 1NZOA 2Y2QA 4M3KA 4UHUA 3ZVTA 2XD5A 4S2MA 2Y2OA 2EXBA 2Y2KA 5JYPA 4S2KA 3SOIA 4E3KA 2ZQAA 3BYDA 4P0MA 3UE0A 1ESUA 3WS0A 5EPHA 3OZHA 1XXMA 2X02A 1LI9A 3PTEA 3UDXA 1K4FA 1K6SA 3MFDA 4QJGA 3ZFZA 4LV3A 3P98A 4E3MA 3OPRA 4R0QA 1M40A 5E2HA 4LENA 3S1YA 4X69A 4R3JA 5A90A 3HUNA 4ZDXA 2DNSA 4K0WA 4LCMA 3AGEA 4PM8A 3S4XA 5IHVA 5E43A 2EX8A 3HVFA 2Y2HA 1ERMA 4EBNA 3G30A 4Y0OA 4KG6A 2Y2GA 3B3XA 4CPKA 1FCOA 1KDWA 2Y2LA 3UN7A 1BSGA 1E25A 1KE0A 3BFDA 3N4IA 2HPBA 1SHVA 1K57C 2H10A 3LEZA 4FH2A 2Z2MB 3ZG8B 5FQJA 2WZXA 4B4ZA 4DDYA 3M6HA 3FKVA 1IYOA 1KDSA 1GA0A 5FQ9A 1JTDA 3A3EA 3QHYA 1GHIA 2Y59A 4ZJ2A 4BQMA 2V2FF 3IF6C 3OCLA 4NK3A 1PI5A 3SH7A 4WBGA 2WADA 1BT5A 2QZ6A 3MXSA 3M2KA 1FR6A 3N8SA 3VP4A 2Q9NA 5DF9A 5A93A 4BD1A 1CI9A 5U47A 1MKIA 4FCFA 4LV0A 5E2EA 2XLNA 3WRTA 3WS2A 1CEGA 1GCEA 1RGYA 3Q82A 3ZCZA 1FQGA 2ZQ8A 4S2NA 3UE1A 5A92A 1IYPA 1YLTA 1ONHA 2ZQCA 4GN2A 3ITBA 2WKIA 4KQOA 2P9VA 2ZLYA 3Q7ZA 4U0TA 2XK1A 2C6WB 4OONA 4OQ0A 2C5WB 1MWRA 3QNBA 4ZAMA 1KE4A 5FSRA 3HLCA 4FSFA 3CG5A 4WELA 5DTSA 1XGJA 2G2WA 1RP5A 5GHZA 1KVLA 5EOOA 1IEMA 4DE3A 1EROA 1PWGA 4KENB 5FAQA 4ID4A 1JWZA 1YLJA 5GLDA 1NY0A 1YMSA 1ERQA 1I2WA 4DKIA 1L0GA 2G2UA 4OOYA 4OKPA 4JBFA 4N92A 3VOZA 4E3OA 5GLAA 1JWVA 3TG9A 1L0EA 1DY6A 2ZM0A 1JVJA 4R3BA 4DXBA 3BFFA 4X68A 3IQAA 1XKZA 3DW0A 1J9MA 1NYMA 2VGKA 2E8IA 1I5QA 5FI2A 3GR2A 5KSHA 4MEZA 3A3IA 4KZ4A 2XEPA 5FA7A 3VP1A 2J9OA 3UPOA 1K54C 4C6YA 3IWOA 5KSCA 3ZGAB 3N6IA 1O7EA 2WGVA 2Y2MA 1PW1A 3GVBA 5FDHA 1MXOA 3MKFA 1JWPA 3MZFA 4MBKA 2WKHA 3HL9A 3HUOA 3IF6B 1KVMA 3N8LA 5HX9A 5A91A 5KMWA 3OPHA 3C7VA 4DE0A 1HTZA 1ZG6A 4PM7A 3V3RA 2EX2A 3BFEA 4EBLA 4HESA 3HLGA 3IH9A 3O3VA 4IEDA 3RXXA 2PU2A 4DE1A 1FR1A 4E3LA 4IBRA 3BEBA 2H0TA 1Z6FA 4XXRA 5GLCA 3IT9A 1WYCA 1W7FA 4WEKA 2DCFA 3Q7VA 4JF6A 1EI5A 4MNRA 1K4EA 1OMEA 4LCLA 4PM9A 3A3DA 1K54A 1XP4A 2RL3A 3GSGA 4QHCA 3ZNYA 1NXYA 5TFQA 2ZM8A 3FYZA 3NDEA 3TSGA 3ZG5A 5DF7A 3V39A 1DJBA 5CEBA 1K56A 1SDNA 3BECA 4JPMA 5CHMA 3NDGA 3ZG0A 2XD1A 2JE5A 4JXSA 3VMAA 2JCHA 1E3UA 4K91A 4RA7A 3D4FA 3P09A 1H5XA 4E3JA 2WK0A 2OLVA 1LHYA 2OLUA 5KZHA 2J9PA 5DTKA 1FCNA 4EV4A 1K55C 4R23A 5FI6A 3Q7VB 5CHJA 4ZJ1A 2ZQ7A 5F83A 1KGFA 4H8RA 4GD6A 2Z2LB 1C3BA 3MBZA 4OLGA 2Y2NA 5D3OA 2HDSA 4OH0A 5HAPA 3SS4A 2WAEA 5I94A 3HLWA 4XUZA 1TDLA 3G32A 1IYQA 2XGNA 5DF8A 3O88A 4ZTKA 2EXAA 3UDFA 2XFTA 4O7DA 1ZKJA 2HP9A 4HEFA 5EOEA 4UAAA 4S2JA 3LCEA 3WS4A 4DDSA 1G6AA 4GNUA 3DWZA 4RVAA 3SS5A 1YMXA 1W5DA 1TEMA 1JTGA 4Q8IA 3VP0A 2WYXA 2WZZA 1O07A 5DVAA 3OC2A 2UWXA 3PAGA 4ZBEA 3HLEA 3HLFA 2B5RA 4OPRA 1QMFA 1QMEA 3W4OA 4BL2A 1K57A 3N8RA 3ZVWA 3Q81A 3NBLA 3BRMA 1K38A 1SCWA 1ONGA 3PBSA 3PBTA 1IKIA 4WM9A 4KZ9A 1FSYA 5EUAA 2VGJA 4DF6A 3OCNA 3VSLA 4BENA 3IF5A 5HL1A 5CGXA 4DRTA 1K6RA 2JBFA 4JLFA 4OLDA 3V3SA 3ITAA 3UPNA 2QMIA 4OPQA 4JXGA 5CHUA 5HAQA 2V20A 1PYYA 3IF6A 3E2LA 2Y2IA 2ZC6B 3PBQA 5CEDA 4MLLA 3ZG7B 3UNWA 1BLCA 3WWXA 5FQIA 4BD0A 1NJ4A 5GL9A 1AXBA 1NZUA 3FZCA 4PMAA 1M6KA 4A5RA 1BZAA 3MXRA 2H5SA 1XPBA 4KQQA 3PBRA 4FD8A 1HD8A 4U0XA 1Y54A 2HDUA 3IXHA 4R4SA 3A3FA 4B4XA 3G35A 2WKEA 3UY6A 3ZDJA 1XGIA 3G34A 3NI9A 3UE3A 4S2OA 2HDRA 1H8YA 2HDQA 3E2KA 1W79A 3IWQA 4KZ3A 5GLBA 3VP3A 4EUZA 1EWZA 2H0YA 2ZM2A 4RX3A 3QNCA 3SH8A 1K25A 1NYYA 4OQHA 2WUQA 3HLBA 1N9BA 4U3TA 4X53A 4GKUA 2OV5A 2ZC3B 4IVKA 1BLPA 1LL9A 1YLPA 3NC8A 4GDNA 4P87A 1MBLA 2IWDA 4WMCD 2J8YA 4OVDA 3HBRA 5FQMA 3Q07A 3TOIA 1L0FA 3M2JA 4E3NA 1RCJA 5JYOA 3GMWA 3IH8A 4Y0TA 3BFCA 2R9XA 4N1XA 4KZ8A 3W8KA 5M18A 3WS1A 5EVIC 4OOMA 1FCMA 2ZC7A 3PBOA 1U60A 3BFGA 2PU4A 2WAFA 4GZBA 4K0XA 1PWDA 4B88A 4KG5A 2X71A 1LI0A 5GHXA 4EWFA 2A49A 2GDNA 3G31A 1FSWA 3HLDA 3RJUA 1E4DA 5FQQA 1BLSA 1ES3A 1ES5A 3VSKA 1MPLA 4JXWA 3UO9A 3AGDA 4QB8A 4P85A 1PI4A 3DTMA 1ES2A 2XF3A 4QD4A 5E2FA 5EVID 1S0WA 3V50A 3OPPA 1BULA 1Q2PA 3GRJA 1W8QA 4JF5A 2CC1A 2BG1A 2XQZA 3GV9A 3IHBA 3Q1FA 1ES4A 2WGWA 4EQIA 5AQAA 1S6RA 1WYBA 2XDMA 2ZC4B 4RYEA 4D2OA 4RX2A 2Y2JA 3C5AA 3JYIA 1L2SA 1HZOA 3G2ZA 3ISGA 5EVIA 3SH9A 5J8XA 1W8YA 2PBYA 4KZ6A 5HARA 1PWCA 2BLSA 2QPNA 3RXWA 4Y7PA 3EQVA 1KGEA 1LL5A 2DRWA 2V1ZA 1KGGA 3GQZA 4X6TA 3AGFA 3ZHHA 1BUEA 5L2FA 3NIAA 5AQBA 2P74A 3HREA 3I7JA 1LLBA 1KE3A 5TR7A 4KZAA 1IELA 3NCKA 4JKTA 4N9LA 2Y2PA 4PPRA 5CTMA 5EECA 4YINA 1FOFA 4X55A 1WE4A 4GB7A 1ALQA 4KQRA 4XUXA 3IXDA 2Q9MA 4GD8A 2WGWB 5CXWA 3OPLA 4P6BA 3VFFA 4BLMA 5EE8A 1Q2QA 1I2SA 4S2NC 4KG2A 5CGWA 5HFOA 3VP2A 2WGIA 3G4PA 4HBTA 1YM1A 3NY4A 3O87A 1GHPA 3FV7A 3HUMA 1SDEA 3FKWA 5EVIB 3UDIA 4DXCA 1XA7A 4OPZA 3O86A 4HBUA 4IVIA 4GDBA 1K55A 2ZD8A 1YQSA 1YLYA 3MKEA 5FASA 3DWKA 4QU3A 3EQUA 1ZG4A 1ESIA 5G18A 3WS5A 1DJCA 4PM6A 1N4OA 1MWTA 5CRFA 4R4RA 4CJNA 2A3UA 5FATA 3UPPA 2EX6A 4BJPA 4E6XA 1H8ZA 3W4QA 1GHMA 3C7UA 3ZNTA 3C4PA 3M6BA 2XH9A 2Y55A 5EVLA 5BOHA 4WYYA 5AQ7A 5CECA 1MY8A 2ZC5B 4OQIA 1PZPA 5AQ9A 3WRZA 2XFSA 4Y0UA 4C3QA 2X01A 2IWCA 3CMZA 4QY6A 4X56A 1VQQA 3GTCA 1PZOA 4KZ7A 4NETA 2J7VA 3FWLA 5TGFA 3W4PA 4L0LA 4QY5A 1G68A 4F94A 5CTNA 3IHAA 5CGSA 5M19A 1YLWA 2Y91A 1DJAA 1CEFA 5E2GA 2I72A 5FAPA 4N1HA 3V5MA 4WZ5C 2ZQ9A 5F1GA 4GOGA 1YLZA 1RGZA 4DE2A 1XA1A 5DTTA 4OPYA 3C4OA 3BLMA 3LO7A 1IYSA 3A3JA 3VOYA 1VM1A 3MZEA 4WZ4A 2FFYA 3IWIA 3IXGA 4BL3A 2OSUA 3LY3A 4IBXA 3CJMA 3LY4A 4KZ5A 2ZMAA 2R9WA 4ZJ3A 2HP6A 1IKGA 4UA6A 1XX2A 2P9VB 4YFMA 2HP5A 1BLHA 3SS3A 4E6WA 4R1GA 4S2LA 4EBPA 1GA9A 4JXVA 4OP5A 3PBNA 5M1AA 4JF4A 2FFFB 2EFXA 1MWUA 5F1FA 2JC7A 1CK3A 1ZC2A 1MWSA 2EX9A 2RCXA 4S2PA 4E3IA 4WMCA 3PAEA 4C75A 3S22A 5FI7A 5HAIA 1HVBA 3ZG9B 4WZ5A 3N7WA 1SKFA 4KZBA 2EFUA 3IXBA 3MZDA 3G2YA 1NRFA 5HW3A 4FH4A 4WEJA 5CERA 2IWBA 2Y4AA 3BLSA 4MBFA 3CZDA 2ZQDA 1TDGA 4OP8A 4LV1A 4OQGA 1YT4A 1K56D 5FQKA 4UA9A 4MBHA 1BTLA 5F82A 1TVFA 1PW8A 3BM6A 1CI8A
chains in the Genus database with same CATH superfamily
4S2IA 4PM5A 1E3UD 2XR0A 3MQQA 1NZOA 2Y2QA 3ZVTA 2XD5A 4S2MA 2Y2OA 5DFXA 2Z6DA 3WS0A 3VE4A 3OZHA 2X02A 3PTEA 4ESPA 3ZFZA 3HUNA 4I38A 2PAVP 4Y0OA 4KG6A 1KDWA 1BSGA 3N4IA 2HPBA 1SHVA 1H0MA 3IBJA 2J3WA 3ZG8B 2WZXA 1IYOA 1KDSA 1JTDA 1TF1A 3EEAA 4ZJ2A 1NLYA 2V2FF 3OCLA 5FL3A 2QJ7A 1BT5A 2D02A 2QZ6A 5DF9A 5A93A 1CI9A 4GS9A 1MKIA 4L9GA 1GCEA 3ZCZA 2VV7A 2K2NA 1ONHA 2W3DA 3VE3A 2P9VA 2VV8A 4U0TA 3UB9A 4OQ0A 1OJ5A 3D3OA 1OTAA 2XROA 3PXPA 4FSFA 5DTSA 1XGJA 2G2WA 1RP5A 2E8JA 1IEMA 1EROA 1S66L 1JWZA 1I2WA 1LSVA 4GS9B 4OOYA 4N92A 4E3OA 1DY6A 3MR0A 2ZM0A 1JVJA 3IQAA 1NYMA 2E8IA 1EW0A 3LICA 3GR2A 4FUWA 4X25A 3VP1A 3ZGAB 3N6IA 1O7EA 3GVBA 2WKRA 5FDHA 3MXQA 4GJ4A 4XT2A 4HESA 4EBLA 3HLGA 3LIAA 1OTIA 4R3AA 4LPZA 3IH9A 4IEDA 4L9EA 3RXXA 2PU2A 1FR1A 3EEHA 3IT9A 2DCFA 4JF6A 1OMEA 4LCLA 2D01A 2NUPC 2ZM8A 3NDEA 5CEBA 3LUQA 1WA9A 3BECA 3NDGA 4JXSA 3VMAA 1P9RA 2JCHA 4LRZE 1E3UA 4UEYA 4RA7A 3D4FA 3P09A 2WK0A 3BJNA 3EGDC 1LHYA 5KZHA 1XFNA 2J9PA 3MFXA 1FCNA 2ACGA 1DP8A 4JGQA 5FI6A 2OAQ1 1X0OA 2JKFA 3T50A 2Z2LB 1C3BA 3MBZA 3LR0A 1F5MA 4OLGA 4EEPA 3HLWA 4X1LA 3G32A 2VEAA 2XGNA 2HP9A 3CUEC 3WS4A 5KIZA 4DDSA 4RVAA 1JTGA 4Q8IA 4O8GA 1O07A 3FG8A 3T1RA 2B5RA 5HD3A 3SZTA 1QMEA 1K57A 3N8RA 3NECA 5F69A 4WM9A 3BRMA 1K38A 1SCWA 3PBSA 1IKIA 2VGJA 4BENA 3IF5A 4DRTA 1K6RA 3V3SA 2QMIA 3F1OA 1YKDA 5HAQA 3IF6A 1PYYA 2OOLA 5EM0A 2ZC6B 4MLLA 5HL6A 3GDIA 4FOFA 5EVEA 4ARZA 4BD0A 3C38A 5GL9A 1M6KA 3MMHA 1HD8A 1MC0A 4U0XA 2HDUA 2INWA 3ZDJA 4S2OA 1XJ4A 4YWZA 1PRQA 4KZ3A 3VP3A 3QP8A 5HZHA 3QNCA 1N9BA 2PYRA 4IVKA 1BLPA 3F1OB 4WMCD 2J8YA 4OVDA 3CLOA 1LSXA 3TOIA 3CITA 3M2JA 4E3NA 5JYOA 3HJKA 4Y0TA 3F1NB 4KZ8A 3W8KA 4OOMA 1FCMA 2PU4A 4K0XA 1ZHHB 5L10A 1PNEA 4EWFA 2GDNA 5FQQA 1ES5A 5E2FA 3AGDA 2A2LA 3QP2A 1PI4A 2XF3A 4P85A 3OPPA 1W8QA 2CC1A 3GV9A 3IHBA 3Q1FA 1DP9A 3IX8A 2WGWA 1S6RA 5A8BA 4EERA 5K5BA 1CJFA 3JYIA 1L2SA 3G2ZA 3SH9A 1F98A 4R38A 4F3LA 3EQVA 1LL5A 2P04A 2PYPA 2BASA 5AJGA 5AQBA 1N9OA 2P74A 4HIAA 4KZAA 4Q0JA 4JKTA 4N9LA 5CTMA 1J3WA 1WE4A 4KQRA 1ALQA 5IU1A 4GD8A 1ODVA 2WGWB 2J3TD 4CQHA 1I2SA 4S2NC 1YM1A 3C2WA 2PBDP 2VLGA 3HUMA 4CLCD 4IVIA 4GDBA 4F3LB 3WS5A 2BTFP 1MWTA 1H8ZA 1GHMA 2B95A 3ZNTA 3M6BA 3MSHA 5BOHA 5L09A 2JKGA 1MY8A 1KOUA 2QHKA 3CHWP 1PZPA 2XRNA 4HQAA 1T18A 4X56A 1D1JA 1OJGA 1GSVA 5CTNA 5CGSA 1CEFA 3H7WA 4N1HA 1ZTUA 2ZQ9A 1RGZA 5HWVA 4DE2A 2M7UA 4OPYA 1TS0A 3MZEA 4WZ4A 2FFYA 3IXGA 2OSUA 4EXOA 3UB8A 3A0SA 3LY4A 2R9WA 3ZQ5A 2HP5A 3JVVA 4S2LA 4IJGA 4OP5A 3PBNA 5HPIA 5I5LA 5F1FA 3FC7A 4WMCA 4C75A 3S22A 5FI7A 3N7WA 4KZBA 3IXBA 2V9AA 1P0ZA 2JKTM 4FH4A 2Y4AA 4MBFA 1F2KA 3QP4A 2KX6A 4LV1A 2VV6A 2L0WA 4UA9A 3RFBA 4MBHA 5L8MA 4G3VA 4UQIM 4N9KA 5GHYA 4B9OA 4LV2A 1PIOA 4M3KA 4NXEA 2V0WA 2PDRA 4S2KA 3SOIA 4WLAA 4P0MA 1ESUA 1T1CA 3V67A 1DP6A 1XXMA 3UDXA 1K6SA 2H28A 3P98A 3IS2A 3OPRA 1M40A 5E2HA 2DMWA 4R3JA 5A90A 4ZDXA 2V8FA 4BWIA 4K0WA 3OOVA 4PM8A 3AGEA 5TBMA 3S4XA 3S7OA 4DJ2A 3HVFA 3LIFA 3TE8A 2O9BA 2Y2HA 4EBNA 1SZVA 3BY9A 4CPKA 1FCOA 4HNBA 3UN7A 1TS8A 2JKTI 1OT6A 3BFDA 4UQIS 4DDYA 3M6HA 1GA0A 2IA2A 5FQ9A 1GHIA 2Y59A 1PI5A 3SH7A 3IS2B 3VP4A 3H82A 5F68A 3Q82A 5A92A 1IYPA 3NOTC 4GN2A 4GLQA 2XA7M 2C6WB 4OONA 1MWRA 3QNBA 4ZAMA 1KE4A 1Y4OA 3PYPA 1KVLA 3B33A 4DE3A 2QWSA 1PWGA 5FAQA 4ID4A 5GLDA 3H82B 2EWVA 4JBFA 5GLAA 1JWVA 1L0EA 1STZA 5F5YA 1XKZA 1J9MA 1TS7A 1S4SA 1I5QA 5KSHA 2XEPA 3UPOA 4C6YA 3IWOA 3ULFA 3A0VA 1PW1A 2VZWA 3V3RA 3BFEA 4KUKA 3LI9A 3S7PA 4DE1A 3BEBA 3BWLA 3RTYA 3Q7VA 4MNRA 4P6ZM 4IUKA 1K4EA 1Z09A 2V8CA 3A3DA 2RL3A 3ZNYA 5TFQA 3TSGA 5DF7A 1CQAA 1SDNA 4JPMA 5CHMA 1IOUA 3ZG0A 2XD1A 1T1AA 4HJ6A 5HDDA 3EWKA 1H5XA 2OLVA 4M4XA 2KDKA 4H6JA 2OLUA 2EA9A 4EV4A 2L4RA 1K55C 2P7JA 4R23A 3Q7VB 5CHJA 5F83A 2QKPA 3RH8B 1KGFA 1PFLA 4P6ZS 2HDSA 4OH0A 2GZAA 2WAEA 5HWWA 5I94A 3DBAA 3LIBA 1TDLA 3HJIA 2M1CA 2HJ9C 4H6JB 3SS5A 3IBRA 5DVAA 3KSGA 2W1RA 3OC2A 5HDSA 2UWXA 3W4OA 3K3DA 3Q81A 3PBTA 2W1TB 4EQ1A 3T4KA 1FSYA 4DF6A 3VSLA 4EETB 5HL1A 3ITAA 3MQ0A 2V20A 1N9NA 4YNRA 3BQAA 3E2LA 5CEDA 4NG2A 2OAP1 1DRMA 4LRYC 1NZUA 3FZCA 3MXRA 4DJ3A 1Y54A 2XSSA 4R4SA 3G35A 4G3WA 3UY6A 1XGIA 2HDRA 1H8YA 3E2KA 4RX3A 3SH8A 1K25A 1NYYA 2WUQA 3HLBA 1YLPA 3NC8A 4GDNA 4P87A 2IWDA 5FQMA 3Q07A 1N9LA 1G6OA 3K2NA 1L0FA 2K31A 1RCJA 3GMWA 4DMZA 1P9WA 3WS1A 5EVIC 2ZC7A 2O9CA 3PBOA 2WAFA 4GZBA 5FDSA 1PWDA 4B88A 3ICYA 3T1QB 3HLDA 1FSWA 3RJUA 1E4DA 1ES3A 4GCZA 2Z6CA 1MPLA 3DTMA 1ES2A 3V50A 1OTBA 4EQIA 5AQAA 4RYEA 3TW8A 1W63Q 1D7EA 1T19A 4RX2A 1HZOA 3KX0X 3RXWA 4Y7PA 1KGGA 4LLOB 3JPUA 1LL8A 1IELA 3R7WA 4R6LA 4YINA 5DFYA 3LGOA 2Q9MA 3S7NA 4P6BA 2VA0A 5CGWA 4KG2A 2HGVA 3FV7A 5EFWA 3UDIA 4DXCA 4MN5A 3KSFA 4OPZA 3O86A 3O5YA 4HBUA 2Q0OA 4ETXA 2ZD8A 3EQUA 1ESIA 1K0KA 1DJCA 3T4SA 1N4OA 3R7WB 2EX6A 3W4QA 1V9YA 3NJAA 4ETZA 4R70A 2XH9A 4BBTA 2Y55A 4WYYA 1VEUA 4HH2A 4EW7A 2ZC5B 3WRZA 4LRXC 2XFSA 5AVFA 2X01A 2LB9A 2WKQA 2IWCA 1VQQA 3F1NA 1PZOA 4KZ7A 2J7VA 3FWLA 5TGFA 3W4PA 4L0LA 4QY5A 4PHTA 1G68A 2LB5A 3B42A 2PT7A 2Y91A 5E2GA 2ZMVA 4I5SA 1YLZA 5DTTA 2NUTC 3BLMA 3LO7A 4O0PA 3LIEA 4BL3A 1VEUB 3CJMA 2JKRM 2PR6A 2YKFA 1IKGA 2L1MA 4UA6A 1XX2A 4YFMA 3NOUC 2PR5A 1NWZA 4E6WA 4R1GA 4EBPA 1BYWA 1GA9A 1A0KA 5M1AA 4JF4A 2FFFB 1MWUA 1CK3A 4E3IA 2RCXA 4NXGA 4S2PA 3PAEA 3BY8A 3R4KA 2VKSA 3G2YA 5CERA 4WEJA 1XJ3A 3BLSA 2ZQDA 4OP8A 3UB5P 1TVFA 3S1YA 4KQDA 2G7UA 5FAOA 4OOLA 4RQ9A 4IUHA 5HPFA 2Y2KA 5JYPA 3NOPC 3CI6A 2ZQAA 3BYDA 4Y13A 4Z1WA 1AWIA 4ZRRA 1LI9A 2JKRI 4LGWA 3MFDA 4QJGA 4KUOA 4R0QA 1D06A 1G5UA 5HWTA 3PR6A 5IHVA 5E43A 4AFIA 5L07A 2Y2LA 1E25A 1LT0A 1K57C 1V9ZA 3LEZA 2Z2MB 5FQJA 2HZ5A 3FKVA 1VETA 3QHYA 3IF6C 4NK3A 4PKYA 4GHIB 3MXSA 3N8SA 3M2KA 2Q9NA 4NXFA 5U47A 3VOLA 5E2EA 2XLNA 2MJ6A 3WS2A 1CEGA 1RGYA 4EU0A 1FQGA 2GNXA 1ACFA 3ITBA 3LR4A 2VK3A 4KQOA 4Q0HA 5DJTA 2C5WB 5FSRA 2Y79A 4I3IA 3CG5A 4WELA 5GHZA 2O99A 5EOOA 1VETB 3LI8A 5MC7A 3B47A 2GX5A 3S7QA 1YLJA 1ERQA 3VOZA 3TG9A 4DXBA 1YSPA 1NRJA 3DW0A 5AVEA 3BW6A 2VGKA 3A3IA 4KZ4A 2J9OA 1K54C 2WGVA 1JWPA 4MBKA 1TD5A 3HL9A 5HX9A 5A91A 5KMWA 3LIDA 4HP9A 4IBRA 2H0TA 1Z6FA 4XXRA 1XFQA 3UB6A 4EEUA 1EI5A 4NKPA 3GSGA 1NXYA 3FYZA 1IFQA 3V39A 4WF0A 4EESA 3IX3A 5CX7A 1TS6A 4HOIA 2JE5A 5HDCA 2PHYA 1VB6A 2JN7A 1Y28A 4HY8A 4H8RA 2Y2NA 5D3OA 5J7EA 5HAPA 3UMDA 3QP6A 5DF8A 3O88A 4ZTKA 3UDFA 3C30A 3VV4A 3UMEA 5EOEA 4S2JA 4GNUA 4LFUA 3VP0A 2I9VA 3PAGA 4K08A 4BL2A 3ZVWA 5EUAA 4JLFA 4OLDA 4YOFA 2OWHA 4JXGA 3LR5A 4DN0A 3PBQA 3UNWA 1BLCA 3WWXA 5DKLA 4PMAA 2H5SA 1XPBA 2W3HA 3PBRA 4KQQA 3IXHA 3A3FA 4B4XA 3G34A 3NI9A 3UE3A 1S1YA 2HDQA 3LFVA 1EWZA 2H0YA 2ZM2A 3FPWA 4OQHA 4U3TA 4GKUA 4MDZA 1MBLA 3L9KA 3KO6A 2FZ0A 4PKYG 1F9IA 2W27A 3BFCA 4N1XA 3LR3A 4MN7A 1U60A 3BFGA 5HSQA 1SKOB 4KG5A 5FEFA 2X71A 3QP5A 5J4EA 2A49A 4MCWA 3MJQA 1XJ2A 1BLSA 2VX8A 3VSKA 4JXWA 3UO9A 4QD4A 1S0WA 2V1BA 5EM1A 3E4QA 3GRJA 4JF5A 2HV1A 2XQZA 1ES4A 3T4TA 2XDMA 2PRFA 3C5AA 5EVIA 5J8XA 1W8YA 5HARA 2QPNA 3JVUA 2P08A 3ZHHA 1KGEA 2DRWA 4X6TA 2V1ZA 3DTEA 1FIKA 3AGFA 1BUEA 5L2FA 2J3TC 1LLBA 2W1TA 5TR7A 3NCKA 1FOFA 4GB7A 4XUXA 4CLCC 5CXWA 4BLMA 5EE8A 3VP2A 4HBTA 3NY4A 3O87A 1GHPA 1SDEA 5EVIB 4B93A 1YQSA 1YLYA 3MKEA 5FASA 3T12B 1ZG4A 5G18A 4NEED 3UB7A 3UPPA 4WL9A 3C4PA 3KSHA 5AQ7A 1OTEA 4G3KA 4OQIA 3CUEA 3C8CA 4QY6A 4IHQA 4O01A 4NETA 5EV0A 2PD8A 4F94A 5TJJA 1YLWA 2ZL1A 5FAPA 4WUJA 4WZ5C 5F1GA 4Y2FA 1XA1A 4Y17A 4QWOA 3C4OA 3K3CA 2VGLM 3VOYA 4D60A 2VJWA 3IWIA 4IBXA 1NLZA 4KZ5A 2HF6A 2ZMAA 5G4YA 2HP6A 4ZJ3A 2JHEA 2P9VB 1BLHA 4HHDA 4Y3IA 3SS3A 4JXVA 2EFXA 1ZC2A 1MWSA 2ZL1B 3ZG9B 1HVBA 4GW9A 1T1BA 2EFUA 3F1PA 5FEGA 5HW3A 4BMWA 1GSXA 1TDGA 1K56D 4WN5A 1BTLA 3BM6A 2VGLS 4Z9QA 1CI8A 3G6OA 4UA7A 5DJUA 3VFHA 1LSWA 2ZJ9A 1L0DA 2ZMFA 4UHUA 2EXBA 4E3KA 2ZOHA 3UE0A 5EPHA 1XJ6A 3MQOA 1K4FA 4L9FA 4LV3A 3F1PB 4E3MA 1UWPX 4LENA 4XT2B 2ZBBA 4MMNA 4X69A 2DNSA 4LCMA 2EX8A 3E4PA 1ERMA 3G30A 2Y2GA 3B3XA 1KE0A 2Y8HA 3PHYA 2H10A 4FH2A 1MKMA 4B4ZA 4E04A 3A3EA 4BQMA 4WBGA 2WADA 4JGRA 1FR6A 1S67L 4BD1A 3CAXA 3OBFA 4FCFA 4LV0A 3WRTA 3NULA 5C5KA 2W0NA 4Y5FA 2O9AA 2ZQ8A 2W3FA 3LEQA 4S2NA 3UE1A 1YLTA 2ZQCA 3P7NA 2WKIA 4JGPA 2ZLYA 3Q7ZA 2XK1A 3HLCA 3OLOA 3D9YA 1H8MA 1OPXA 5J3WA 3CWFA 4KENB 1YAXA 1NY0A 1YMSA 1G28A 3T4LA 4HI4A 4DKIA 1L0GA 2G2UA 4OKPA 3E4OA 4R3BA 3BFFA 4X68A 3T1SA 3EOIA 5FI2A 3A0RA 3E98A 4MEZA 5FA7A 4EUVA 5KSCA 4HJ4A 2Y2MA 1MXOA 4ME4A 3MKFA 3MZFA 2J80A 2WKHA 3HUOA 3IF6B 1KVMA 3N8LA 3OPHA 4MN6A 3C7VA 4DE0A 1HLUP 1HTZA 1ZG6A 2KLIA 4PM7A 3U2AA 2EX2A 4ARZB 2EWWA 3MF0A 3O3VA 2ZOIA 4E3LA 1UGUA 5GLCA 1WYCA 1W7FA 4WEKA 4PM9A 1K54A 1XP4A 4QHCA 3ZG5A 1DJBA 2R78A 1K56A 5G4ZA 3KYQA 1VHMA 4GHIA 4II7A 4K91A 4E3JA 2AVXA 5LBRA 5DTKA 3T4OA 4ZJ1A 2ZQ7A 4JGOA 3E0YA 4BBUA 2B02A 4GD6A 1MZUA 3DTIA 3SS4A 5DKKA 4XUZA 1IYQA 2A24A 2EXAA 2XFTA 4O7DA 1ZKJA 4HEFA 3UE6A 3CPTA 4UAAA 3LCEA 1G6AA 3DWZA 3LYXA 3T4QA 1YMXA 1W5DA 1TEMA 2WYXA 2WZZA 3DAVA 4ZBEA 3HLEA 3HLFA 5IS1A 4OPRA 1QMFA 4I3JA 3NBLA 1ONGA 2CMNA 3FPVA 5F6AA 4KZ9A 3OCNA 5CGXA 5IT5A 2JBFA 3UPNA 4OPQA 5CHUA 1S1ZA 2O0YA 2A24B 3NHQA 2Y2IA 4HJ3A 3ZG7B 5FQIA 3CPTB 1NJ4A 4NXBA 1AXBA 4A5RA 1BZAA 4FD8A 2WKPA 2WKEA 3MS6A 4Q0IA 1W79A 3IWQA 5GLBA 4EUZA 3GECA 4X53A 3KYZA 2OV5A 2ZC3B 3U4LP 1LL9A 3BQ8A 4BBVA 2YKHA 3HBRA 3IH8A 4Y15A 2R9XA 5M18A 2PD7A 4FTXA 1YSQA 2GJ3A 1LI0A 3EGXC 3G31A 1OT9A 3H7WB 4QB8A 5GHXA 5EVID 3T4JA 1BULA 1Q2PA 2BG1A 3TJZC 3IX4A 1WYBA 2ZC4B 4PAUA 4D2OA 2Y2JA 2V0UA 2UV0E 2KOIA 3ISGA 2PBYA 4KZ6A 2K7SA 1PWCA 4I3AA 2BLSA 3GQZA 1GSWA 3NIAA 3HREA 3I7JA 1KE3A 4PPRA 2Y2PA 5EECA 4X55A 3L7HA 3TRCA 3IXDA 1P97A 3QP1A 3OPLA 3VFFA 2V1AA 1Q2QA 3H9WA 5HFOA 1YPRA 2WGIA 3G4PA 4I39A 3FKWA 2B18A 1XA7A 1K55A 2W3GA 3DWKA 4QU3A 3ZYTA 1H3QA 2W3EA 3KSIA 4PM6A 4CLCE 5CRFA 4R4RA 4CJNA 2A3UA 5FATA 4X1MA 3KYEA 4BJPA 4E6XA 1S4RA 3C7UA 2OWJA 4CLCA 5EVLA 5TBMB 5CECA 5AQ9A 4Y0UA 4C3QA 3CMZA 3GTCA 4QPRA 1SKOA 1CF0A 3IHAA 3D72A 5M19A 1DJAA 1JNUA 4HH3A 2I72A 3V5MA 3W2ZA 4GOGA 2HJEA 1IYSA 3A3JA 1VM1A 4CLCB 3P01A 1UWNX 3LY3A 4HP4A 3SW1A 3HCYA 2FH5A 1L3LA 1W63M 2QYBA 1FILA 3T1XA 5HD5A 2JC7A 2XA7S 2EX9A 2QJ5A 5HAIA 4WZ5A 1SKFA 2M7VA 3MZDA 1NRFA 3DTKA 2IWBA 3CZDA 1OTDA 4OQGA 1YT4A 5FQKA 5F82A 1PW8A
chains in the Genus database with same CATH topology
4Z9QA 4N9KA 4S2IA 4UA7A 4PM5A 5GHYA 4LV2A 1E3UD 1PIOA 5FAOA 3VFHA 2XR0A 4OOLA 2ZJ9A 1L0DA 1NZOA 2Y2QA 4M3KA 4UHUA 3ZVTA 2XD5A 4S2MA 2Y2OA 2EXBA 2Y2KA 5JYPA 4S2KA 3SOIA 4E3KA 2ZQAA 3BYDA 4P0MA 3UE0A 1ESUA 3WS0A 5EPHA 3OZHA 1XXMA 2X02A 1LI9A 3PTEA 3UDXA 1K4FA 1K6SA 3MFDA 4QJGA 3ZFZA 4LV3A 3P98A 4E3MA 3OPRA 4R0QA 1M40A 5E2HA 4LENA 3S1YA 4X69A 4R3JA 5A90A 3HUNA 4ZDXA 2DNSA 4K0WA 4LCMA 3AGEA 4PM8A 3S4XA 5IHVA 5E43A 2EX8A 3HVFA 2Y2HA 1ERMA 4EBNA 3G30A 4Y0OA 4KG6A 2Y2GA 3B3XA 4CPKA 1FCOA 1KDWA 2Y2LA 3UN7A 1BSGA 1E25A 1KE0A 3BFDA 3N4IA 2HPBA 1SHVA 1K57C 2H10A 3LEZA 4FH2A 2Z2MB 3ZG8B 5FQJA 2WZXA 4B4ZA 4DDYA 3M6HA 3FKVA 1IYOA 1KDSA 1GA0A 5FQ9A 1JTDA 3A3EA 3QHYA 1GHIA 2Y59A 4ZJ2A 4BQMA 2V2FF 3IF6C 3OCLA 4NK3A 1PI5A 3SH7A 4WBGA 2WADA 1BT5A 2QZ6A 3MXSA 3M2KA 1FR6A 3N8SA 3VP4A 2Q9NA 5DF9A 5A93A 4BD1A 1CI9A 5U47A 1MKIA 4FCFA 4LV0A 5E2EA 2XLNA 3WRTA 3WS2A 1CEGA 1GCEA 1RGYA 3Q82A 3ZCZA 1FQGA 2ZQ8A 4S2NA 3UE1A 5A92A 1IYPA 1YLTA 1ONHA 2ZQCA 4GN2A 3ITBA 2WKIA 4KQOA 2P9VA 2ZLYA 3Q7ZA 4U0TA 2XK1A 2C6WB 4OONA 4OQ0A 2C5WB 1MWRA 3QNBA 4ZAMA 1KE4A 5FSRA 3HLCA 4FSFA 3CG5A 4WELA 5DTSA 1XGJA 2G2WA 1RP5A 5GHZA 1KVLA 5EOOA 1IEMA 4DE3A 1EROA 1PWGA 4KENB 5FAQA 4ID4A 1JWZA 1YLJA 5GLDA 1NY0A 1YMSA 1ERQA 1I2WA 4DKIA 1L0GA 2G2UA 4OOYA 4OKPA 4JBFA 4N92A 3VOZA 4E3OA 5GLAA 1JWVA 3TG9A 1L0EA 1DY6A 2ZM0A 1JVJA 4R3BA 4DXBA 3BFFA 4X68A 3IQAA 1XKZA 3DW0A 1J9MA 1NYMA 2VGKA 2E8IA 1I5QA 5FI2A 3GR2A 5KSHA 4MEZA 3A3IA 4KZ4A 2XEPA 5FA7A 3VP1A 2J9OA 3UPOA 1K54C 4C6YA 3IWOA 5KSCA 3ZGAB 3N6IA 1O7EA 2WGVA 2Y2MA 1PW1A 3GVBA 5FDHA 1MXOA 3MKFA 1JWPA 3MZFA 4MBKA 2WKHA 3HL9A 3HUOA 3IF6B 1KVMA 3N8LA 5HX9A 5A91A 5KMWA 3OPHA 3C7VA 4DE0A 1HTZA 1ZG6A 4PM7A 3V3RA 2EX2A 3BFEA 4EBLA 4HESA 3HLGA 3IH9A 3O3VA 4IEDA 3RXXA 2PU2A 4DE1A 1FR1A 4E3LA 4IBRA 3BEBA 2H0TA 1Z6FA 4XXRA 5GLCA 3IT9A 1WYCA 1W7FA 4WEKA 2DCFA 3Q7VA 4JF6A 1EI5A 4MNRA 1K4EA 1OMEA 4LCLA 4PM9A 3A3DA 1K54A 1XP4A 2RL3A 3GSGA 4QHCA 3ZNYA 1NXYA 5TFQA 2ZM8A 3FYZA 3NDEA 3TSGA 3ZG5A 5DF7A 3V39A 1DJBA 5CEBA 1K56A 1SDNA 3BECA 4JPMA 5CHMA 3NDGA 3ZG0A 2XD1A 2JE5A 4JXSA 3VMAA 2JCHA 1E3UA 4K91A 4RA7A 3D4FA 3P09A 1H5XA 4E3JA 2WK0A 2OLVA 1LHYA 2OLUA 5KZHA 2J9PA 5DTKA 1FCNA 4EV4A 1K55C 4R23A 5FI6A 3Q7VB 5CHJA 4ZJ1A 2ZQ7A 5F83A 1KGFA 4H8RA 4GD6A 2Z2LB 1C3BA 3MBZA 4OLGA 2Y2NA 5D3OA 2HDSA 4OH0A 5HAPA 3SS4A 2WAEA 5I94A 3HLWA 4XUZA 1TDLA 3G32A 1IYQA 2XGNA 5DF8A 3O88A 4ZTKA 2EXAA 3UDFA 2XFTA 4O7DA 1ZKJA 2HP9A 4HEFA 5EOEA 4UAAA 4S2JA 3LCEA 3WS4A 4DDSA 1G6AA 4GNUA 3DWZA 4RVAA 3SS5A 1YMXA 1W5DA 1TEMA 1JTGA 4Q8IA 3VP0A 2WYXA 2WZZA 1O07A 5DVAA 3OC2A 2UWXA 3PAGA 4ZBEA 3HLEA 3HLFA 2B5RA 4OPRA 1QMFA 1QMEA 3W4OA 4BL2A 1K57A 3N8RA 3ZVWA 3Q81A 3NBLA 3BRMA 1K38A 1SCWA 1ONGA 3PBSA 3PBTA 1IKIA 4WM9A 4KZ9A 1FSYA 5EUAA 2VGJA 4DF6A 3OCNA 3VSLA 4BENA 3IF5A 5HL1A 5CGXA 4DRTA 1K6RA 2JBFA 4JLFA 4OLDA 3V3SA 3ITAA 3UPNA 2QMIA 4OPQA 4JXGA 5CHUA 5HAQA 2V20A 1PYYA 3IF6A 3E2LA 2Y2IA 2ZC6B 3PBQA 5CEDA 4MLLA 3ZG7B 3UNWA 1BLCA 3WWXA 5FQIA 4BD0A 1NJ4A 5GL9A 1AXBA 1NZUA 3FZCA 4PMAA 1M6KA 4A5RA 1BZAA 3MXRA 2H5SA 1XPBA 4KQQA 3PBRA 4FD8A 1HD8A 4U0XA 1Y54A 2HDUA 3IXHA 4R4SA 3A3FA 4B4XA 3G35A 2WKEA 3UY6A 3ZDJA 1XGIA 3G34A 3NI9A 3UE3A 4S2OA 2HDRA 1H8YA 2HDQA 3E2KA 1W79A 3IWQA 4KZ3A 5GLBA 3VP3A 4EUZA 1EWZA 2H0YA 2ZM2A 4RX3A 3QNCA 3SH8A 1K25A 1NYYA 4OQHA 2WUQA 3HLBA 1N9BA 4U3TA 4X53A 4GKUA 2OV5A 2ZC3B 4IVKA 1BLPA 1LL9A 1YLPA 3NC8A 4GDNA 4P87A 1MBLA 2IWDA 4WMCD 2J8YA 4OVDA 3HBRA 5FQMA 3Q07A 3TOIA 1L0FA 3M2JA 4E3NA 1RCJA 5JYOA 3GMWA 3IH8A 4Y0TA 3BFCA 2R9XA 4N1XA 4KZ8A 3W8KA 5M18A 3WS1A 5EVIC 4OOMA 1FCMA 2ZC7A 3PBOA 1U60A 3BFGA 2PU4A 2WAFA 4GZBA 4K0XA 1PWDA 4B88A 4KG5A 2X71A 1LI0A 5GHXA 4EWFA 2A49A 2GDNA 3G31A 1FSWA 3HLDA 3RJUA 1E4DA 5FQQA 1BLSA 1ES3A 1ES5A 3VSKA 1MPLA 4JXWA 3UO9A 3AGDA 4QB8A 4P85A 1PI4A 3DTMA 1ES2A 2XF3A 4QD4A 5E2FA 5EVID 1S0WA 3V50A 3OPPA 1BULA 1Q2PA 3GRJA 1W8QA 4JF5A 2CC1A 2BG1A 2XQZA 3GV9A 3IHBA 3Q1FA 1ES4A 2WGWA 4EQIA 5AQAA 1S6RA 1WYBA 2XDMA 2ZC4B 4RYEA 4D2OA 4RX2A 2Y2JA 3C5AA 3JYIA 1L2SA 1HZOA 3G2ZA 3ISGA 5EVIA 3SH9A 5J8XA 1W8YA 2PBYA 4KZ6A 5HARA 1PWCA 2BLSA 2QPNA 3RXWA 4Y7PA 3EQVA 1KGEA 1LL5A 2DRWA 2V1ZA 1KGGA 3GQZA 4X6TA 3AGFA 3ZHHA 1BUEA 5L2FA 3NIAA 5AQBA 2P74A 3HREA 3I7JA 1LLBA 1KE3A 5TR7A 4KZAA 1IELA 3NCKA 4JKTA 4N9LA 2Y2PA 4PPRA 5CTMA 5EECA 4YINA 1FOFA 4X55A 1WE4A 4GB7A 1ALQA 4KQRA 4XUXA 3IXDA 2Q9MA 4GD8A 2WGWB 5CXWA 3OPLA 4P6BA 3VFFA 4BLMA 5EE8A 1Q2QA 1I2SA 4S2NC 4KG2A 5CGWA 5HFOA 3VP2A 2WGIA 3G4PA 4HBTA 1YM1A 3NY4A 3O87A 1GHPA 3FV7A 3HUMA 1SDEA 3FKWA 5EVIB 3UDIA 4DXCA 1XA7A 4OPZA 3O86A 4HBUA 4IVIA 4GDBA 1K55A 2ZD8A 1YQSA 1YLYA 3MKEA 5FASA 3DWKA 4QU3A 3EQUA 1ZG4A 1ESIA 5G18A 3WS5A 1DJCA 4PM6A 1N4OA 1MWTA 5CRFA 4R4RA 4CJNA 2A3UA 5FATA 3UPPA 2EX6A 4BJPA 4E6XA 1H8ZA 3W4QA 1GHMA 3C7UA 3ZNTA 3C4PA 3M6BA 2XH9A 2Y55A 5EVLA 5BOHA 4WYYA 5AQ7A 5CECA 1MY8A 2ZC5B 4OQIA 1PZPA 5AQ9A 3WRZA 2XFSA 4Y0UA 4C3QA 2X01A 2IWCA 3CMZA 4QY6A 4X56A 1VQQA 3GTCA 1PZOA 4KZ7A 4NETA 2J7VA 3FWLA 5TGFA 3W4PA 4L0LA 4QY5A 1G68A 4F94A 5CTNA 3IHAA 5CGSA 5M19A 1YLWA 2Y91A 1DJAA 1CEFA 5E2GA 2I72A 5FAPA 4N1HA 3V5MA 4WZ5C 2ZQ9A 5F1GA 4GOGA 1YLZA 1RGZA 4DE2A 1XA1A 5DTTA 4OPYA 3C4OA 3BLMA 3LO7A 1IYSA 3A3JA 3VOYA 1VM1A 3MZEA 4WZ4A 2FFYA 3IWIA 3IXGA 4BL3A 2OSUA 3LY3A 4IBXA 3CJMA 3LY4A 4KZ5A 2ZMAA 2R9WA 4ZJ3A 2HP6A 1IKGA 4UA6A 1XX2A 2P9VB 4YFMA 2HP5A 1BLHA 3SS3A 4E6WA 4R1GA 4S2LA 4EBPA 1GA9A 4JXVA 4OP5A 3PBNA 5M1AA 4JF4A 2FFFB 2EFXA 1MWUA 5F1FA 2JC7A 1CK3A 1ZC2A 1MWSA 2EX9A 2RCXA 4S2PA 4E3IA 4WMCA 3PAEA 4C75A 3S22A 5FI7A 5HAIA 1HVBA 3ZG9B 4WZ5A 3N7WA 1SKFA 4KZBA 2EFUA 3IXBA 3MZDA 3G2YA 1NRFA 5HW3A 4FH4A 4WEJA 5CERA 2IWBA 2Y4AA 3BLSA 4MBFA 3CZDA 2ZQDA 1TDGA 4OP8A 4LV1A 4OQGA 1YT4A 1K56D 5FQKA 4UA9A 4MBHA 1BTLA 5F82A 1TVFA 1PW8A 3BM6A 1CI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9Q A;  4N9K A;  4S2I A;  4UA7 A;  4PM5 A;  5GHY A;  4LV2 A;  1E3U D;  1PIO A;  5FAO A;  3VFH A;  2XR0 A;  4OOL A;  2ZJ9 A;  1L0D A;  1NZO A;  2Y2Q A;  4M3K A;  4UHU A;  3ZVT A;  2XD5 A;  4S2M A;  2Y2O A;  2EXB A;  2Y2K A;  5JYP A;  4S2K A;  3SOI A;  4E3K A;  2ZQA A;  3BYD A;  4P0M A;  3UE0 A;  1ESU A;  3WS0 A;  5EPH A;  3OZH A;  1XXM A;  2X02 A;  1LI9 A;  3PTE A;  3UDX A;  1K4F A;  1K6S A;  3MFD A;  4QJG A;  3ZFZ A;  4LV3 A;  3P98 A;  4E3M A;  3OPR A;  4R0Q A;  1M40 A;  5E2H A;  4LEN A;  3S1Y A;  4X69 A;  4R3J A;  5A90 A;  3HUN A;  4ZDX A;  2DNS A;  4K0W A;  4LCM A;  3AGE A;  4PM8 A;  3S4X A;  5IHV A;  5E43 A;  2EX8 A;  3HVF A;  2Y2H A;  1ERM A;  4EBN A;  3G30 A;  4Y0O A;  4KG6 A;  2Y2G A;  3B3X A;  4CPK A;  1FCO A;  1KDW A;  2Y2L A;  3UN7 A;  1BSG A;  1E25 A;  1KE0 A;  3BFD A;  3N4I A;  2HPB A;  1SHV A;  1K57 C;  2H10 A;  3LEZ A;  4FH2 A;  2Z2M B;  3ZG8 B;  5FQJ A;  2WZX A;  4B4Z A;  4DDY A;  3M6H A;  3FKV A;  1IYO A;  1KDS A;  1GA0 A;  5FQ9 A;  1JTD A;  3A3E A;  3QHY A;  1GHI A;  2Y59 A;  4ZJ2 A;  4BQM A;  2V2F F;  3IF6 C;  3OCL A;  4NK3 A;  1PI5 A;  3SH7 A;  4WBG A;  2WAD A;  1BT5 A;  2QZ6 A;  3MXS A;  3M2K A;  1FR6 A;  3N8S A;  3VP4 A;  2Q9N A;  5DF9 A;  5A93 A;  4BD1 A;  1CI9 A;  5U47 A;  1MKI A;  4FCF A;  4LV0 A;  5E2E A;  2XLN A;  3WRT A;  3WS2 A;  1CEG A;  1GCE A;  1RGY A;  3Q82 A;  3ZCZ A;  1FQG A;  2ZQ8 A;  4S2N A;  3UE1 A;  5A92 A;  1IYP A;  1YLT A;  1ONH A;  2ZQC A;  4GN2 A;  3ITB A;  2WKI A;  4KQO A;  2P9V A;  2ZLY A;  3Q7Z A;  4U0T A;  2XK1 A;  2C6W B;  4OON A;  4OQ0 A;  2C5W B;  1MWR A;  3QNB A;  4ZAM A;  1KE4 A;  5FSR A;  3HLC A;  4FSF A;  3CG5 A;  4WEL A;  5DTS A;  1XGJ A;  2G2W A;  1RP5 A;  5GHZ A;  1KVL A;  5EOO A;  1IEM A;  4DE3 A;  1ERO A;  1PWG A;  4KEN B;  5FAQ A;  4ID4 A;  1JWZ A;  1YLJ A;  5GLD A;  1NY0 A;  1YMS A;  1ERQ A;  1I2W A;  4DKI A;  1L0G A;  2G2U A;  4OOY A;  4OKP A;  4JBF A;  4N92 A;  3VOZ A;  4E3O A;  5GLA A;  1JWV A;  3TG9 A;  1L0E A;  1DY6 A;  2ZM0 A;  1JVJ A;  4R3B A;  4DXB A;  3BFF A;  4X68 A;  3IQA A;  1XKZ A;  3DW0 A;  1J9M A;  1NYM A;  2VGK A;  2E8I A;  1I5Q A;  5FI2 A;  3GR2 A;  5KSH A;  4MEZ A;  3A3I A;  4KZ4 A;  2XEP A;  5FA7 A;  3VP1 A;  2J9O A;  3UPO A;  1K54 C;  4C6Y A;  3IWO A;  5KSC A;  3ZGA B;  3N6I A;  1O7E A;  2WGV A;  2Y2M A;  1PW1 A;  3GVB A;  5FDH A;  1MXO A;  3MKF A;  1JWP A;  3MZF A;  4MBK A;  2WKH A;  3HL9 A;  3HUO A;  3IF6 B;  1KVM A;  3N8L A;  5HX9 A;  5A91 A;  5KMW A;  3OPH A;  3C7V A;  4DE0 A;  1HTZ A;  1ZG6 A;  4PM7 A;  3V3R A;  2EX2 A;  3BFE A;  4EBL A;  4HES A;  3HLG A;  3IH9 A;  3O3V A;  4IED A;  3RXX A;  2PU2 A;  4DE1 A;  1FR1 A;  4E3L A;  4IBR A;  3BEB A;  2H0T A;  1Z6F A;  4XXR A;  5GLC A;  3IT9 A;  1WYC A;  1W7F A;  4WEK A;  2DCF A;  3Q7V A;  4JF6 A;  1EI5 A;  4MNR A;  1K4E A;  1OME A;  4LCL A;  4PM9 A;  3A3D A;  1K54 A;  1XP4 A;  2RL3 A;  3GSG A;  4QHC A;  3ZNY A;  1NXY A;  5TFQ A;  2ZM8 A;  3FYZ A;  3NDE A;  3TSG A;  3ZG5 A;  5DF7 A;  3V39 A;  1DJB A;  5CEB A;  1K56 A;  1SDN A;  3BEC A;  4JPM A;  5CHM A;  3NDG A;  3ZG0 A;  2XD1 A;  2JE5 A;  4JXS A;  3VMA A;  2JCH A;  1E3U A;  4K91 A;  4RA7 A;  3D4F A;  3P09 A;  1H5X A;  4E3J A;  2WK0 A;  2OLV A;  1LHY A;  2OLU A;  5KZH A;  2J9P A;  5DTK A;  1FCN A;  4EV4 A;  1K55 C;  4R23 A;  5FI6 A;  3Q7V B;  5CHJ A;  4ZJ1 A;  2ZQ7 A;  5F83 A;  1KGF A;  4H8R A;  4GD6 A;  2Z2L B;  1C3B A;  3MBZ A;  4OLG A;  2Y2N A;  5D3O A;  2HDS A;  4OH0 A;  5HAP A;  3SS4 A;  2WAE A;  5I94 A;  3HLW A;  4XUZ A;  1TDL A;  3G32 A;  1IYQ A;  2XGN A;  5DF8 A;  3O88 A;  4ZTK A;  2EXA A;  3UDF A;  2XFT A;  4O7D A;  1ZKJ A;  2HP9 A;  4HEF A;  5EOE A;  4UAA A;  4S2J A;  3LCE A;  3WS4 A;  4DDS A;  1G6A A;  4GNU A;  3DWZ A;  4RVA A;  3SS5 A;  1YMX A;  1W5D A;  1TEM A;  1JTG A;  4Q8I A;  3VP0 A;  2WYX A;  2WZZ A;  1O07 A;  5DVA A;  3OC2 A;  2UWX A;  3PAG A;  4ZBE A;  3HLE A;  3HLF A;  2B5R A;  4OPR A;  1QMF A;  1QME A;  3W4O A;  4BL2 A;  1K57 A;  3N8R A;  3ZVW A;  3Q81 A;  3NBL A;  3BRM A;  1K38 A;  1SCW A;  1ONG A;  3PBS A;  3PBT A;  1IKI A;  4WM9 A;  4KZ9 A;  1FSY A;  5EUA A;  2VGJ A;  4DF6 A;  3OCN A;  3VSL A;  4BEN A;  3IF5 A;  5HL1 A;  5CGX A;  4DRT A;  1K6R A;  2JBF A;  4JLF A;  4OLD A;  3V3S A;  3ITA A;  3UPN A;  2QMI A;  4OPQ A;  4JXG A;  5CHU A;  5HAQ A;  2V20 A;  1PYY A;  3IF6 A;  3E2L A;  2Y2I A;  2ZC6 B;  3PBQ A;  5CED A;  4MLL A;  3ZG7 B;  3UNW A;  1BLC A;  3WWX A;  5FQI A;  4BD0 A;  1NJ4 A;  5GL9 A;  1AXB A;  1NZU A;  3FZC A;  4PMA A;  1M6K A;  4A5R A;  1BZA A;  3MXR A;  2H5S A;  1XPB A;  4KQQ A;  3PBR A;  4FD8 A;  1HD8 A;  4U0X A;  1Y54 A;  2HDU A;  3IXH A;  4R4S A;  3A3F A;  4B4X A;  3G35 A;  2WKE A;  3UY6 A;  3ZDJ A;  1XGI A;  3G34 A;  3NI9 A;  3UE3 A;  4S2O A;  2HDR A;  1H8Y A;  2HDQ A;  3E2K A;  1W79 A;  3IWQ A;  4KZ3 A;  5GLB A;  3VP3 A;  4EUZ A;  1EWZ A;  2H0Y A;  2ZM2 A;  4RX3 A;  3QNC A;  3SH8 A;  1K25 A;  1NYY A;  4OQH A;  2WUQ A;  3HLB A;  1N9B A;  4U3T A;  4X53 A;  4GKU A;  2OV5 A;  2ZC3 B;  4IVK A;  1BLP A;  1LL9 A;  1YLP A;  3NC8 A;  4GDN A;  4P87 A;  1MBL A;  2IWD A;  4WMC D;  2J8Y A;  4OVD A;  3HBR A;  5FQM A;  3Q07 A;  3TOI A;  1L0F A;  3M2J A;  4E3N A;  1RCJ A;  5JYO A;  3GMW A;  3IH8 A;  4Y0T A;  3BFC A;  2R9X A;  4N1X A;  4KZ8 A;  3W8K A;  5M18 A;  3WS1 A;  5EVI C;  4OOM A;  1FCM A;  2ZC7 A;  3PBO A;  1U60 A;  3BFG A;  2PU4 A;  2WAF A;  4GZB A;  4K0X A;  1PWD A;  4B88 A;  4KG5 A;  2X71 A;  1LI0 A;  5GHX A;  4EWF A;  2A49 A;  2GDN A;  3G31 A;  1FSW A;  3HLD A;  3RJU A;  1E4D A;  5FQQ A;  1BLS A;  1ES3 A;  1ES5 A;  3VSK A;  1MPL A;  4JXW A;  3UO9 A;  3AGD A;  4QB8 A;  4P85 A;  1PI4 A;  3DTM A;  1ES2 A;  2XF3 A;  4QD4 A;  5E2F A;  5EVI D;  1S0W A;  3V50 A;  3OPP A;  1BUL A;  1Q2P A;  3GRJ A;  1W8Q A;  4JF5 A;  2CC1 A;  2BG1 A;  2XQZ A;  3GV9 A;  3IHB A;  3Q1F A;  1ES4 A;  2WGW A;  4EQI A;  5AQA A;  1S6R A;  1WYB A;  2XDM A;  2ZC4 B;  4RYE A;  4D2O A;  4RX2 A;  2Y2J A;  3C5A A;  3JYI A;  1L2S A;  1HZO A;  3G2Z A;  3ISG A;  5EVI A;  3SH9 A;  5J8X A;  1W8Y A;  2PBY A;  4KZ6 A;  5HAR A;  1PWC A;  2BLS A;  2QPN A;  3RXW A;  4Y7P A;  3EQV A;  1KGE A;  1LL5 A;  2DRW A;  2V1Z A;  1KGG A;  3GQZ A;  4X6T A;  3AGF A;  3ZHH A;  1BUE A;  5L2F A;  3NIA A;  5AQB A;  2P74 A;  3HRE A;  3I7J A;  1LLB A;  1KE3 A;  5TR7 A;  4KZA A;  1IEL A;  3NCK A;  4JKT A;  4N9L A;  2Y2P A;  4PPR A;  5CTM A;  5EEC A;  4YIN A;  1FOF A;  4X55 A;  1WE4 A;  4GB7 A;  1ALQ A;  4KQR A;  4XUX A;  3IXD A;  2Q9M A;  4GD8 A;  2WGW B;  5CXW A;  3OPL A;  4P6B A;  3VFF A;  4BLM A;  5EE8 A;  1Q2Q A;  1I2S A;  4S2N C;  4KG2 A;  5CGW A;  5HFO A;  3VP2 A;  2WGI A;  3G4P A;  4HBT A;  1YM1 A;  3NY4 A;  3O87 A;  1GHP A;  3FV7 A;  3HUM A;  1SDE A;  3FKW A;  5EVI B;  3UDI A;  4DXC A;  1XA7 A;  4OPZ A;  3O86 A;  4HBU A;  4IVI A;  4GDB A;  1K55 A;  2ZD8 A;  1YQS A;  1YLY A;  3MKE A;  5FAS A;  3DWK A;  4QU3 A;  3EQU A;  1ZG4 A;  1ESI A;  5G18 A;  3WS5 A;  1DJC A;  4PM6 A;  1N4O A;  1MWT A;  5CRF A;  4R4R A;  4CJN A;  2A3U A;  5FAT A;  3UPP A;  2EX6 A;  4BJP A;  4E6X A;  1H8Z A;  3W4Q A;  1GHM A;  3C7U A;  3ZNT A;  3C4P A;  3M6B A;  2XH9 A;  2Y55 A;  5EVL A;  5BOH A;  4WYY A;  5AQ7 A;  5CEC A;  1MY8 A;  2ZC5 B;  4OQI A;  1PZP A;  5AQ9 A;  3WRZ A;  2XFS A;  4Y0U A;  4C3Q A;  2X01 A;  2IWC A;  3CMZ A;  4QY6 A;  4X56 A;  1VQQ A;  3GTC A;  1PZO A;  4KZ7 A;  4NET A;  2J7V A;  3FWL A;  5TGF A;  3W4P A;  4L0L A;  4QY5 A;  1G68 A;  4F94 A;  5CTN A;  3IHA A;  5CGS A;  5M19 A;  1YLW A;  2Y91 A;  1DJA A;  1CEF A;  5E2G A;  2I72 A;  5FAP A;  4N1H A;  3V5M A;  4WZ5 C;  2ZQ9 A;  5F1G A;  4GOG A;  1YLZ A;  1RGZ A;  4DE2 A;  1XA1 A;  5DTT A;  4OPY A;  3C4O A;  3BLM A;  3LO7 A;  1IYS A;  3A3J A;  3VOY A;  1VM1 A;  3MZE A;  4WZ4 A;  2FFY A;  3IWI A;  3IXG A;  4BL3 A;  2OSU A;  3LY3 A;  4IBX A;  3CJM A;  3LY4 A;  4KZ5 A;  2ZMA A;  2R9W A;  4ZJ3 A;  2HP6 A;  1IKG A;  4UA6 A;  1XX2 A;  2P9V B;  4YFM A;  2HP5 A;  1BLH A;  3SS3 A;  4E6W A;  4R1G A;  4S2L A;  4EBP A;  1GA9 A;  4JXV A;  4OP5 A;  3PBN A;  5M1A A;  4JF4 A;  2FFF B;  2EFX A;  1MWU A;  5F1F A;  2JC7 A;  1CK3 A;  1ZC2 A;  1MWS A;  2EX9 A;  2RCX A;  4S2P A;  4E3I A;  4WMC A;  3PAE A;  4C75 A;  3S22 A;  5FI7 A;  5HAI A;  1HVB A;  3ZG9 B;  4WZ5 A;  3N7W A;  1SKF A;  4KZB A;  2EFU A;  3IXB A;  3MZD A;  3G2Y A;  1NRF A;  5HW3 A;  4FH4 A;  4WEJ A;  5CER A;  2IWB A;  2Y4A A;  3BLS A;  4MBF A;  3CZD A;  2ZQD A;  1TDG A;  4OP8 A;  4LV1 A;  4OQG A;  1YT4 A;  1K56 D;  5FQK A;  4UA9 A;  4MBH A;  1BTL A;  5F82 A;  1TVF A;  1PW8 A;  3BM6 A;  1CI8 A; 
#chains in the Genus database with same CATH topology
 4S2I A;  4PM5 A;  1E3U D;  2XR0 A;  3MQQ A;  1NZO A;  2Y2Q A;  3ZVT A;  2XD5 A;  4S2M A;  2Y2O A;  5DFX A;  2Z6D A;  3WS0 A;  3VE4 A;  3OZH A;  2X02 A;  3PTE A;  4ESP A;  3ZFZ A;  3HUN A;  4I38 A;  2PAV P;  4Y0O A;  4KG6 A;  1KDW A;  1BSG A;  3N4I A;  2HPB A;  1SHV A;  1H0M A;  3IBJ A;  2J3W A;  3ZG8 B;  2WZX A;  1IYO A;  1KDS A;  1JTD A;  1TF1 A;  3EEA A;  4ZJ2 A;  1NLY A;  2V2F F;  3OCL A;  5FL3 A;  2QJ7 A;  1BT5 A;  2D02 A;  2QZ6 A;  5DF9 A;  5A93 A;  1CI9 A;  4GS9 A;  1MKI A;  4L9G A;  1GCE A;  3ZCZ A;  2VV7 A;  2K2N A;  1ONH A;  2W3D A;  3VE3 A;  2P9V A;  2VV8 A;  4U0T A;  3UB9 A;  4OQ0 A;  1OJ5 A;  3D3O A;  1OTA A;  2XRO A;  3PXP A;  4FSF A;  5DTS A;  1XGJ A;  2G2W A;  1RP5 A;  2E8J A;  1IEM A;  1ERO A;  1S66 L;  1JWZ A;  1I2W A;  1LSV A;  4GS9 B;  4OOY A;  4N92 A;  4E3O A;  1DY6 A;  3MR0 A;  2ZM0 A;  1JVJ A;  3IQA A;  1NYM A;  2E8I A;  1EW0 A;  3LIC A;  3GR2 A;  4FUW A;  4X25 A;  3VP1 A;  3ZGA B;  3N6I A;  1O7E A;  3GVB A;  2WKR A;  5FDH A;  3MXQ A;  4GJ4 A;  4XT2 A;  4HES A;  4EBL A;  3HLG A;  3LIA A;  1OTI A;  4R3A A;  4LPZ A;  3IH9 A;  4IED A;  4L9E A;  3RXX A;  2PU2 A;  1FR1 A;  3EEH A;  3IT9 A;  2DCF A;  4JF6 A;  1OME A;  4LCL A;  2D01 A;  2NUP C;  2ZM8 A;  3NDE A;  5CEB A;  3LUQ A;  1WA9 A;  3BEC A;  3NDG A;  4JXS A;  3VMA A;  1P9R A;  2JCH A;  4LRZ E;  1E3U A;  4UEY A;  4RA7 A;  3D4F A;  3P09 A;  2WK0 A;  3BJN A;  3EGD C;  1LHY A;  5KZH A;  1XFN A;  2J9P A;  3MFX A;  1FCN A;  2ACG A;  1DP8 A;  4JGQ A;  5FI6 A;  2OAQ 1;  1X0O A;  2JKF A;  3T50 A;  2Z2L B;  1C3B A;  3MBZ A;  3LR0 A;  1F5M A;  4OLG A;  4EEP A;  3HLW A;  4X1L A;  3G32 A;  2VEA A;  2XGN A;  2HP9 A;  3CUE C;  3WS4 A;  5KIZ A;  4DDS A;  4RVA A;  1JTG A;  4Q8I A;  4O8G A;  1O07 A;  3FG8 A;  3T1R A;  2B5R A;  5HD3 A;  3SZT A;  1QME A;  1K57 A;  3N8R A;  3NEC A;  5F69 A;  4WM9 A;  3BRM A;  1K38 A;  1SCW A;  3PBS A;  1IKI A;  2VGJ A;  4BEN A;  3IF5 A;  4DRT A;  1K6R A;  3V3S A;  2QMI A;  3F1O A;  1YKD A;  5HAQ A;  3IF6 A;  1PYY A;  2OOL A;  5EM0 A;  2ZC6 B;  4MLL A;  5HL6 A;  3GDI A;  4FOF A;  5EVE A;  4ARZ A;  4BD0 A;  3C38 A;  5GL9 A;  1M6K A;  3MMH A;  1HD8 A;  1MC0 A;  4U0X A;  2HDU A;  2INW A;  3ZDJ A;  4S2O A;  1XJ4 A;  4YWZ A;  1PRQ A;  4KZ3 A;  3VP3 A;  3QP8 A;  5HZH A;  3QNC A;  1N9B A;  2PYR A;  4IVK A;  1BLP A;  3F1O B;  4WMC D;  2J8Y A;  4OVD A;  3CLO A;  1LSX A;  3TOI A;  3CIT A;  3M2J A;  4E3N A;  5JYO A;  3HJK A;  4Y0T A;  3F1N B;  4KZ8 A;  3W8K A;  4OOM A;  1FCM A;  2PU4 A;  4K0X A;  1ZHH B;  5L10 A;  1PNE A;  4EWF A;  2GDN A;  5FQQ A;  1ES5 A;  5E2F A;  3AGD A;  2A2L A;  3QP2 A;  1PI4 A;  2XF3 A;  4P85 A;  3OPP A;  1W8Q A;  2CC1 A;  3GV9 A;  3IHB A;  3Q1F A;  1DP9 A;  3IX8 A;  2WGW A;  1S6R A;  5A8B A;  4EER A;  5K5B A;  1CJF A;  3JYI A;  1L2S A;  3G2Z A;  3SH9 A;  1F98 A;  4R38 A;  4F3L A;  3EQV A;  1LL5 A;  2P04 A;  2PYP A;  2BAS A;  5AJG A;  5AQB A;  1N9O A;  2P74 A;  4HIA A;  4KZA A;  4Q0J A;  4JKT A;  4N9L A;  5CTM A;  1J3W A;  1WE4 A;  4KQR A;  1ALQ A;  5IU1 A;  4GD8 A;  1ODV A;  2WGW B;  2J3T D;  4CQH A;  1I2S A;  4S2N C;  1YM1 A;  3C2W A;  2PBD P;  2VLG A;  3HUM A;  4CLC D;  4IVI A;  4GDB A;  4F3L B;  3WS5 A;  2BTF P;  1MWT A;  1H8Z A;  1GHM A;  2B95 A;  3ZNT A;  3M6B A;  3MSH A;  5BOH A;  5L09 A;  2JKG A;  1MY8 A;  1KOU A;  2QHK A;  3CHW P;  1PZP A;  2XRN A;  4HQA A;  1T18 A;  4X56 A;  1D1J A;  1OJG A;  1GSV A;  5CTN A;  5CGS A;  1CEF A;  3H7W A;  4N1H A;  1ZTU A;  2ZQ9 A;  1RGZ A;  5HWV A;  4DE2 A;  2M7U A;  4OPY A;  1TS0 A;  3MZE A;  4WZ4 A;  2FFY A;  3IXG A;  2OSU A;  4EXO A;  3UB8 A;  3A0S A;  3LY4 A;  2R9W A;  3ZQ5 A;  2HP5 A;  3JVV A;  4S2L A;  4IJG A;  4OP5 A;  3PBN A;  5HPI A;  5I5L A;  5F1F A;  3FC7 A;  4WMC A;  4C75 A;  3S22 A;  5FI7 A;  3N7W A;  4KZB A;  3IXB A;  2V9A A;  1P0Z A;  2JKT M;  4FH4 A;  2Y4A A;  4MBF A;  1F2K A;  3QP4 A;  2KX6 A;  4LV1 A;  2VV6 A;  2L0W A;  4UA9 A;  3RFB A;  4MBH A;  5L8M A;  4G3V A;  4UQI M;  4N9K A;  5GHY A;  4B9O A;  4LV2 A;  1PIO A;  4M3K A;  4NXE A;  2V0W A;  2PDR A;  4S2K A;  3SOI A;  4WLA A;  4P0M A;  1ESU A;  1T1C A;  3V67 A;  1DP6 A;  1XXM A;  3UDX A;  1K6S A;  2H28 A;  3P98 A;  3IS2 A;  3OPR A;  1M40 A;  5E2H A;  2DMW A;  4R3J A;  5A90 A;  4ZDX A;  2V8F A;  4BWI A;  4K0W A;  3OOV A;  4PM8 A;  3AGE A;  5TBM A;  3S4X A;  3S7O A;  4DJ2 A;  3HVF A;  3LIF A;  3TE8 A;  2O9B A;  2Y2H A;  4EBN A;  1SZV A;  3BY9 A;  4CPK A;  1FCO A;  4HNB A;  3UN7 A;  1TS8 A;  2JKT I;  1OT6 A;  3BFD A;  4UQI S;  4DDY A;  3M6H A;  1GA0 A;  2IA2 A;  5FQ9 A;  1GHI A;  2Y59 A;  1PI5 A;  3SH7 A;  3IS2 B;  3VP4 A;  3H82 A;  5F68 A;  3Q82 A;  5A92 A;  1IYP A;  3NOT C;  4GN2 A;  4GLQ A;  2XA7 M;  2C6W B;  4OON A;  1MWR A;  3QNB A;  4ZAM A;  1KE4 A;  1Y4O A;  3PYP A;  1KVL A;  3B33 A;  4DE3 A;  2QWS A;  1PWG A;  5FAQ A;  4ID4 A;  5GLD A;  3H82 B;  2EWV A;  4JBF A;  5GLA A;  1JWV A;  1L0E A;  1STZ A;  5F5Y A;  1XKZ A;  1J9M A;  1TS7 A;  1S4S A;  1I5Q A;  5KSH A;  2XEP A;  3UPO A;  4C6Y A;  3IWO A;  3ULF A;  3A0V A;  1PW1 A;  2VZW A;  3V3R A;  3BFE A;  4KUK A;  3LI9 A;  3S7P A;  4DE1 A;  3BEB A;  3BWL A;  3RTY A;  3Q7V A;  4MNR A;  4P6Z M;  4IUK A;  1K4E A;  1Z09 A;  2V8C A;  3A3D A;  2RL3 A;  3ZNY A;  5TFQ A;  3TSG A;  5DF7 A;  1CQA A;  1SDN A;  4JPM A;  5CHM A;  1IOU A;  3ZG0 A;  2XD1 A;  1T1A A;  4HJ6 A;  5HDD A;  3EWK A;  1H5X A;  2OLV A;  4M4X A;  2KDK A;  4H6J A;  2OLU A;  2EA9 A;  4EV4 A;  2L4R A;  1K55 C;  2P7J A;  4R23 A;  3Q7V B;  5CHJ A;  5F83 A;  2QKP A;  3RH8 B;  1KGF A;  1PFL A;  4P6Z S;  2HDS A;  4OH0 A;  2GZA A;  2WAE A;  5HWW A;  5I94 A;  3DBA A;  3LIB A;  1TDL A;  3HJI A;  2M1C A;  2HJ9 C;  4H6J B;  3SS5 A;  3IBR A;  5DVA A;  3KSG A;  2W1R A;  3OC2 A;  5HDS A;  2UWX A;  3W4O A;  3K3D A;  3Q81 A;  3PBT A;  2W1T B;  4EQ1 A;  3T4K A;  1FSY A;  4DF6 A;  3VSL A;  4EET B;  5HL1 A;  3ITA A;  3MQ0 A;  2V20 A;  1N9N A;  4YNR A;  3BQA A;  3E2L A;  5CED A;  4NG2 A;  2OAP 1;  1DRM A;  4LRY C;  1NZU A;  3FZC A;  3MXR A;  4DJ3 A;  1Y54 A;  2XSS A;  4R4S A;  3G35 A;  4G3W A;  3UY6 A;  1XGI A;  2HDR A;  1H8Y A;  3E2K A;  4RX3 A;  3SH8 A;  1K25 A;  1NYY A;  2WUQ A;  3HLB A;  1YLP A;  3NC8 A;  4GDN A;  4P87 A;  2IWD A;  5FQM A;  3Q07 A;  1N9L A;  1G6O A;  3K2N A;  1L0F A;  2K31 A;  1RCJ A;  3GMW A;  4DMZ A;  1P9W A;  3WS1 A;  5EVI C;  2ZC7 A;  2O9C A;  3PBO A;  2WAF A;  4GZB A;  5FDS A;  1PWD A;  4B88 A;  3ICY A;  3T1Q B;  3HLD A;  1FSW A;  3RJU A;  1E4D A;  1ES3 A;  4GCZ A;  2Z6C A;  1MPL A;  3DTM A;  1ES2 A;  3V50 A;  1OTB A;  4EQI A;  5AQA A;  4RYE A;  3TW8 A;  1W63 Q;  1D7E A;  1T19 A;  4RX2 A;  1HZO A;  3KX0 X;  3RXW A;  4Y7P A;  1KGG A;  4LLO B;  3JPU A;  1LL8 A;  1IEL A;  3R7W A;  4R6L A;  4YIN A;  5DFY A;  3LGO A;  2Q9M A;  3S7N A;  4P6B A;  2VA0 A;  5CGW A;  4KG2 A;  2HGV A;  3FV7 A;  5EFW A;  3UDI A;  4DXC A;  4MN5 A;  3KSF A;  4OPZ A;  3O86 A;  3O5Y A;  4HBU A;  2Q0O A;  4ETX A;  2ZD8 A;  3EQU A;  1ESI A;  1K0K A;  1DJC A;  3T4S A;  1N4O A;  3R7W B;  2EX6 A;  3W4Q A;  1V9Y A;  3NJA A;  4ETZ A;  4R70 A;  2XH9 A;  4BBT A;  2Y55 A;  4WYY A;  1VEU A;  4HH2 A;  4EW7 A;  2ZC5 B;  3WRZ A;  4LRX C;  2XFS A;  5AVF A;  2X01 A;  2LB9 A;  2WKQ A;  2IWC A;  1VQQ A;  3F1N A;  1PZO A;  4KZ7 A;  2J7V A;  3FWL A;  5TGF A;  3W4P A;  4L0L A;  4QY5 A;  4PHT A;  1G68 A;  2LB5 A;  3B42 A;  2PT7 A;  2Y91 A;  5E2G A;  2ZMV A;  4I5S A;  1YLZ A;  5DTT A;  2NUT C;  3BLM A;  3LO7 A;  4O0P A;  3LIE A;  4BL3 A;  1VEU B;  3CJM A;  2JKR M;  2PR6 A;  2YKF A;  1IKG A;  2L1M A;  4UA6 A;  1XX2 A;  4YFM A;  3NOU C;  2PR5 A;  1NWZ A;  4E6W A;  4R1G A;  4EBP A;  1BYW A;  1GA9 A;  1A0K A;  5M1A A;  4JF4 A;  2FFF B;  1MWU A;  1CK3 A;  4E3I A;  2RCX A;  4NXG A;  4S2P A;  3PAE A;  3BY8 A;  3R4K A;  2VKS A;  3G2Y A;  5CER A;  4WEJ A;  1XJ3 A;  3BLS A;  2ZQD A;  4OP8 A;  3UB5 P;  1TVF A;  3S1Y A;  4KQD A;  2G7U A;  5FAO A;  4OOL A;  4RQ9 A;  4IUH A;  5HPF A;  2Y2K A;  5JYP A;  3NOP C;  3CI6 A;  2ZQA A;  3BYD A;  4Y13 A;  4Z1W A;  1AWI A;  4ZRR A;  1LI9 A;  2JKR I;  4LGW A;  3MFD A;  4QJG A;  4KUO A;  4R0Q A;  1D06 A;  1G5U A;  5HWT A;  3PR6 A;  5IHV A;  5E43 A;  4AFI A;  5L07 A;  2Y2L A;  1E25 A;  1LT0 A;  1K57 C;  1V9Z A;  3LEZ A;  2Z2M B;  5FQJ A;  2HZ5 A;  3FKV A;  1VET A;  3QHY A;  3IF6 C;  4NK3 A;  4PKY A;  4GHI B;  3MXS A;  3N8S A;  3M2K A;  2Q9N A;  4NXF A;  5U47 A;  3VOL A;  5E2E A;  2XLN A;  2MJ6 A;  3WS2 A;  1CEG A;  1RGY A;  4EU0 A;  1FQG A;  2GNX A;  1ACF A;  3ITB A;  3LR4 A;  2VK3 A;  4KQO A;  4Q0H A;  5DJT A;  2C5W B;  5FSR A;  2Y79 A;  4I3I A;  3CG5 A;  4WEL A;  5GHZ A;  2O99 A;  5EOO A;  1VET B;  3LI8 A;  5MC7 A;  3B47 A;  2GX5 A;  3S7Q A;  1YLJ A;  1ERQ A;  3VOZ A;  3TG9 A;  4DXB A;  1YSP A;  1NRJ A;  3DW0 A;  5AVE A;  3BW6 A;  2VGK A;  3A3I A;  4KZ4 A;  2J9O A;  1K54 C;  2WGV A;  1JWP A;  4MBK A;  1TD5 A;  3HL9 A;  5HX9 A;  5A91 A;  5KMW A;  3LID A;  4HP9 A;  4IBR A;  2H0T A;  1Z6F A;  4XXR A;  1XFQ A;  3UB6 A;  4EEU A;  1EI5 A;  4NKP A;  3GSG A;  1NXY A;  3FYZ A;  1IFQ A;  3V39 A;  4WF0 A;  4EES A;  3IX3 A;  5CX7 A;  1TS6 A;  4HOI A;  2JE5 A;  5HDC A;  2PHY A;  1VB6 A;  2JN7 A;  1Y28 A;  4HY8 A;  4H8R A;  2Y2N A;  5D3O A;  5J7E A;  5HAP A;  3UMD A;  3QP6 A;  5DF8 A;  3O88 A;  4ZTK A;  3UDF A;  3C30 A;  3VV4 A;  3UME A;  5EOE A;  4S2J A;  4GNU A;  4LFU A;  3VP0 A;  2I9V A;  3PAG A;  4K08 A;  4BL2 A;  3ZVW A;  5EUA A;  4JLF A;  4OLD A;  4YOF A;  2OWH A;  4JXG A;  3LR5 A;  4DN0 A;  3PBQ A;  3UNW A;  1BLC A;  3WWX A;  5DKL A;  4PMA A;  2H5S A;  1XPB A;  2W3H A;  3PBR A;  4KQQ A;  3IXH A;  3A3F A;  4B4X A;  3G34 A;  3NI9 A;  3UE3 A;  1S1Y A;  2HDQ A;  3LFV A;  1EWZ A;  2H0Y A;  2ZM2 A;  3FPW A;  4OQH A;  4U3T A;  4GKU A;  4MDZ A;  1MBL A;  3L9K A;  3KO6 A;  2FZ0 A;  4PKY G;  1F9I A;  2W27 A;  3BFC A;  4N1X A;  3LR3 A;  4MN7 A;  1U60 A;  3BFG A;  5HSQ A;  1SKO B;  4KG5 A;  5FEF A;  2X71 A;  3QP5 A;  5J4E A;  2A49 A;  4MCW A;  3MJQ A;  1XJ2 A;  1BLS A;  2VX8 A;  3VSK A;  4JXW A;  3UO9 A;  4QD4 A;  1S0W A;  2V1B A;  5EM1 A;  3E4Q A;  3GRJ A;  4JF5 A;  2HV1 A;  2XQZ A;  1ES4 A;  3T4T A;  2XDM A;  2PRF A;  3C5A A;  5EVI A;  5J8X A;  1W8Y A;  5HAR A;  2QPN A;  3JVU A;  2P08 A;  3ZHH A;  1KGE A;  2DRW A;  4X6T A;  2V1Z A;  3DTE A;  1FIK A;  3AGF A;  1BUE A;  5L2F A;  2J3T C;  1LLB A;  2W1T A;  5TR7 A;  3NCK A;  1FOF A;  4GB7 A;  4XUX A;  4CLC C;  5CXW A;  4BLM A;  5EE8 A;  3VP2 A;  4HBT A;  3NY4 A;  3O87 A;  1GHP A;  1SDE A;  5EVI B;  4B93 A;  1YQS A;  1YLY A;  3MKE A;  5FAS A;  3T12 B;  1ZG4 A;  5G18 A;  4NEE D;  3UB7 A;  3UPP A;  4WL9 A;  3C4P A;  3KSH A;  5AQ7 A;  1OTE A;  4G3K A;  4OQI A;  3CUE A;  3C8C A;  4QY6 A;  4IHQ A;  4O01 A;  4NET A;  5EV0 A;  2PD8 A;  4F94 A;  5TJJ A;  1YLW A;  2ZL1 A;  5FAP A;  4WUJ A;  4WZ5 C;  5F1G A;  4Y2F A;  1XA1 A;  4Y17 A;  4QWO A;  3C4O A;  3K3C A;  2VGL M;  3VOY A;  4D60 A;  2VJW A;  3IWI A;  4IBX A;  1NLZ A;  4KZ5 A;  2HF6 A;  2ZMA A;  5G4Y A;  2HP6 A;  4ZJ3 A;  2JHE A;  2P9V B;  1BLH A;  4HHD A;  4Y3I A;  3SS3 A;  4JXV A;  2EFX A;  1ZC2 A;  1MWS A;  2ZL1 B;  3ZG9 B;  1HVB A;  4GW9 A;  1T1B A;  2EFU A;  3F1P A;  5FEG A;  5HW3 A;  4BMW A;  1GSX A;  1TDG A;  1K56 D;  4WN5 A;  1BTL A;  3BM6 A;  2VGL S;  4Z9Q A;  1CI8 A;  3G6O A;  4UA7 A;  5DJU A;  3VFH A;  1LSW A;  2ZJ9 A;  1L0D A;  2ZMF A;  4UHU A;  2EXB A;  4E3K A;  2ZOH A;  3UE0 A;  5EPH A;  1XJ6 A;  3MQO A;  1K4F A;  4L9F A;  4LV3 A;  3F1P B;  4E3M A;  1UWP X;  4LEN A;  4XT2 B;  2ZBB A;  4MMN A;  4X69 A;  2DNS A;  4LCM A;  2EX8 A;  3E4P A;  1ERM A;  3G30 A;  2Y2G A;  3B3X A;  1KE0 A;  2Y8H A;  3PHY A;  2H10 A;  4FH2 A;  1MKM A;  4B4Z A;  4E04 A;  3A3E A;  4BQM A;  4WBG A;  2WAD A;  4JGR A;  1FR6 A;  1S67 L;  4BD1 A;  3CAX A;  3OBF A;  4FCF A;  4LV0 A;  3WRT A;  3NUL A;  5C5K A;  2W0N A;  4Y5F A;  2O9A A;  2ZQ8 A;  2W3F A;  3LEQ A;  4S2N A;  3UE1 A;  1YLT A;  2ZQC A;  3P7N A;  2WKI A;  4JGP A;  2ZLY A;  3Q7Z A;  2XK1 A;  3HLC A;  3OLO A;  3D9Y A;  1H8M A;  1OPX A;  5J3W A;  3CWF A;  4KEN B;  1YAX A;  1NY0 A;  1YMS A;  1G28 A;  3T4L A;  4HI4 A;  4DKI A;  1L0G A;  2G2U A;  4OKP A;  3E4O A;  4R3B A;  3BFF A;  4X68 A;  3T1S A;  3EOI A;  5FI2 A;  3A0R A;  3E98 A;  4MEZ A;  5FA7 A;  4EUV A;  5KSC A;  4HJ4 A;  2Y2M A;  1MXO A;  4ME4 A;  3MKF A;  3MZF A;  2J80 A;  2WKH A;  3HUO A;  3IF6 B;  1KVM A;  3N8L A;  3OPH A;  4MN6 A;  3C7V A;  4DE0 A;  1HLU P;  1HTZ A;  1ZG6 A;  2KLI A;  4PM7 A;  3U2A A;  2EX2 A;  4ARZ B;  2EWW A;  3MF0 A;  3O3V A;  2ZOI A;  4E3L A;  1UGU A;  5GLC A;  1WYC A;  1W7F A;  4WEK A;  4PM9 A;  1K54 A;  1XP4 A;  4QHC A;  3ZG5 A;  1DJB A;  2R78 A;  1K56 A;  5G4Z A;  3KYQ A;  1VHM A;  4GHI A;  4II7 A;  4K91 A;  4E3J A;  2AVX A;  5LBR A;  5DTK A;  3T4O A;  4ZJ1 A;  2ZQ7 A;  4JGO A;  3E0Y A;  4BBU A;  2B02 A;  4GD6 A;  1MZU A;  3DTI A;  3SS4 A;  5DKK A;  4XUZ A;  1IYQ A;  2A24 A;  2EXA A;  2XFT A;  4O7D A;  1ZKJ A;  4HEF A;  3UE6 A;  3CPT A;  4UAA A;  3LCE A;  1G6A A;  3DWZ A;  3LYX A;  3T4Q A;  1YMX A;  1W5D A;  1TEM A;  2WYX A;  2WZZ A;  3DAV A;  4ZBE A;  3HLE A;  3HLF A;  5IS1 A;  4OPR A;  1QMF A;  4I3J A;  3NBL A;  1ONG A;  2CMN A;  3FPV A;  5F6A A;  4KZ9 A;  3OCN A;  5CGX A;  5IT5 A;  2JBF A;  3UPN A;  4OPQ A;  5CHU A;  1S1Z A;  2O0Y A;  2A24 B;  3NHQ A;  2Y2I A;  4HJ3 A;  3ZG7 B;  5FQI A;  3CPT B;  1NJ4 A;  4NXB A;  1AXB A;  4A5R A;  1BZA A;  4FD8 A;  2WKP A;  2WKE A;  3MS6 A;  4Q0I A;  1W79 A;  3IWQ A;  5GLB A;  4EUZ A;  3GEC A;  4X53 A;  3KYZ A;  2OV5 A;  2ZC3 B;  3U4L P;  1LL9 A;  3BQ8 A;  4BBV A;  2YKH A;  3HBR A;  3IH8 A;  4Y15 A;  2R9X A;  5M18 A;  2PD7 A;  4FTX A;  1YSQ A;  2GJ3 A;  1LI0 A;  3EGX C;  3G31 A;  1OT9 A;  3H7W B;  4QB8 A;  5GHX A;  5EVI D;  3T4J A;  1BUL A;  1Q2P A;  2BG1 A;  3TJZ C;  3IX4 A;  1WYB A;  2ZC4 B;  4PAU A;  4D2O A;  2Y2J A;  2V0U A;  2UV0 E;  2KOI A;  3ISG A;  2PBY A;  4KZ6 A;  2K7S A;  1PWC A;  4I3A A;  2BLS A;  3GQZ A;  1GSW A;  3NIA A;  3HRE A;  3I7J A;  1KE3 A;  4PPR A;  2Y2P A;  5EEC A;  4X55 A;  3L7H A;  3TRC A;  3IXD A;  1P97 A;  3QP1 A;  3OPL A;  3VFF A;  2V1A A;  1Q2Q A;  3H9W A;  5HFO A;  1YPR A;  2WGI A;  3G4P A;  4I39 A;  3FKW A;  2B18 A;  1XA7 A;  1K55 A;  2W3G A;  3DWK A;  4QU3 A;  3ZYT A;  1H3Q A;  2W3E A;  3KSI A;  4PM6 A;  4CLC E;  5CRF A;  4R4R A;  4CJN A;  2A3U A;  5FAT A;  4X1M A;  3KYE A;  4BJP A;  4E6X A;  1S4R A;  3C7U A;  2OWJ A;  4CLC A;  5EVL A;  5TBM B;  5CEC A;  5AQ9 A;  4Y0U A;  4C3Q A;  3CMZ A;  3GTC A;  4QPR A;  1SKO A;  1CF0 A;  3IHA A;  3D72 A;  5M19 A;  1DJA A;  1JNU A;  4HH3 A;  2I72 A;  3V5M A;  3W2Z A;  4GOG A;  2HJE A;  1IYS A;  3A3J A;  1VM1 A;  4CLC B;  3P01 A;  1UWN X;  3LY3 A;  4HP4 A;  3SW1 A;  3HCY A;  2FH5 A;  1L3L A;  1W63 M;  2QYB A;  1FIL A;  3T1X A;  5HD5 A;  2JC7 A;  2XA7 S;  2EX9 A;  2QJ5 A;  5HAI A;  4WZ5 A;  1SKF A;  2M7V A;  3MZD A;  1NRF A;  3DTK A;  2IWB A;  3CZD A;  1OTD A;  4OQG A;  1YT4 A;  5FQK A;  5F82 A;  1PW8 A; 
#chains in the Genus database with same CATH homology
 4Z9Q A;  4N9K A;  4S2I A;  4UA7 A;  4PM5 A;  5GHY A;  4LV2 A;  1E3U D;  1PIO A;  5FAO A;  3VFH A;  2XR0 A;  4OOL A;  2ZJ9 A;  1L0D A;  1NZO A;  2Y2Q A;  4M3K A;  4UHU A;  3ZVT A;  2XD5 A;  4S2M A;  2Y2O A;  2EXB A;  2Y2K A;  5JYP A;  4S2K A;  3SOI A;  4E3K A;  2ZQA A;  3BYD A;  4P0M A;  3UE0 A;  1ESU A;  3WS0 A;  5EPH A;  3OZH A;  1XXM A;  2X02 A;  1LI9 A;  3PTE A;  3UDX A;  1K4F A;  1K6S A;  3MFD A;  4QJG A;  3ZFZ A;  4LV3 A;  3P98 A;  4E3M A;  3OPR A;  4R0Q A;  1M40 A;  5E2H A;  4LEN A;  3S1Y A;  4X69 A;  4R3J A;  5A90 A;  3HUN A;  4ZDX A;  2DNS A;  4K0W A;  4LCM A;  3AGE A;  4PM8 A;  3S4X A;  5IHV A;  5E43 A;  2EX8 A;  3HVF A;  2Y2H A;  1ERM A;  4EBN A;  3G30 A;  4Y0O A;  4KG6 A;  2Y2G A;  3B3X A;  4CPK A;  1FCO A;  1KDW A;  2Y2L A;  3UN7 A;  1BSG A;  1E25 A;  1KE0 A;  3BFD A;  3N4I A;  2HPB A;  1SHV A;  1K57 C;  2H10 A;  3LEZ A;  4FH2 A;  2Z2M B;  3ZG8 B;  5FQJ A;  2WZX A;  4B4Z A;  4DDY A;  3M6H A;  3FKV A;  1IYO A;  1KDS A;  1GA0 A;  5FQ9 A;  1JTD A;  3A3E A;  3QHY A;  1GHI A;  2Y59 A;  4ZJ2 A;  4BQM A;  2V2F F;  3IF6 C;  3OCL A;  4NK3 A;  1PI5 A;  3SH7 A;  4WBG A;  2WAD A;  1BT5 A;  2QZ6 A;  3MXS A;  3M2K A;  1FR6 A;  3N8S A;  3VP4 A;  2Q9N A;  5DF9 A;  5A93 A;  4BD1 A;  1CI9 A;  5U47 A;  1MKI A;  4FCF A;  4LV0 A;  5E2E A;  2XLN A;  3WRT A;  3WS2 A;  1CEG A;  1GCE A;  1RGY A;  3Q82 A;  3ZCZ A;  1FQG A;  2ZQ8 A;  4S2N A;  3UE1 A;  5A92 A;  1IYP A;  1YLT A;  1ONH A;  2ZQC A;  4GN2 A;  3ITB A;  2WKI A;  4KQO A;  2P9V A;  2ZLY A;  3Q7Z A;  4U0T A;  2XK1 A;  2C6W B;  4OON A;  4OQ0 A;  2C5W B;  1MWR A;  3QNB A;  4ZAM A;  1KE4 A;  5FSR A;  3HLC A;  4FSF A;  3CG5 A;  4WEL A;  5DTS A;  1XGJ A;  2G2W A;  1RP5 A;  5GHZ A;  1KVL A;  5EOO A;  1IEM A;  4DE3 A;  1ERO A;  1PWG A;  4KEN B;  5FAQ A;  4ID4 A;  1JWZ A;  1YLJ A;  5GLD A;  1NY0 A;  1YMS A;  1ERQ A;  1I2W A;  4DKI A;  1L0G A;  2G2U A;  4OOY A;  4OKP A;  4JBF A;  4N92 A;  3VOZ A;  4E3O A;  5GLA A;  1JWV A;  3TG9 A;  1L0E A;  1DY6 A;  2ZM0 A;  1JVJ A;  4R3B A;  4DXB A;  3BFF A;  4X68 A;  3IQA A;  1XKZ A;  3DW0 A;  1J9M A;  1NYM A;  2VGK A;  2E8I A;  1I5Q A;  5FI2 A;  3GR2 A;  5KSH A;  4MEZ A;  3A3I A;  4KZ4 A;  2XEP A;  5FA7 A;  3VP1 A;  2J9O A;  3UPO A;  1K54 C;  4C6Y A;  3IWO A;  5KSC A;  3ZGA B;  3N6I A;  1O7E A;  2WGV A;  2Y2M A;  1PW1 A;  3GVB A;  5FDH A;  1MXO A;  3MKF A;  1JWP A;  3MZF A;  4MBK A;  2WKH A;  3HL9 A;  3HUO A;  3IF6 B;  1KVM A;  3N8L A;  5HX9 A;  5A91 A;  5KMW A;  3OPH A;  3C7V A;  4DE0 A;  1HTZ A;  1ZG6 A;  4PM7 A;  3V3R A;  2EX2 A;  3BFE A;  4EBL A;  4HES A;  3HLG A;  3IH9 A;  3O3V A;  4IED A;  3RXX A;  2PU2 A;  4DE1 A;  1FR1 A;  4E3L A;  4IBR A;  3BEB A;  2H0T A;  1Z6F A;  4XXR A;  5GLC A;  3IT9 A;  1WYC A;  1W7F A;  4WEK A;  2DCF A;  3Q7V A;  4JF6 A;  1EI5 A;  4MNR A;  1K4E A;  1OME A;  4LCL A;  4PM9 A;  3A3D A;  1K54 A;  1XP4 A;  2RL3 A;  3GSG A;  4QHC A;  3ZNY A;  1NXY A;  5TFQ A;  2ZM8 A;  3FYZ A;  3NDE A;  3TSG A;  3ZG5 A;  5DF7 A;  3V39 A;  1DJB A;  5CEB A;  1K56 A;  1SDN A;  3BEC A;  4JPM A;  5CHM A;  3NDG A;  3ZG0 A;  2XD1 A;  2JE5 A;  4JXS A;  3VMA A;  2JCH A;  1E3U A;  4K91 A;  4RA7 A;  3D4F A;  3P09 A;  1H5X A;  4E3J A;  2WK0 A;  2OLV A;  1LHY A;  2OLU A;  5KZH A;  2J9P A;  5DTK A;  1FCN A;  4EV4 A;  1K55 C;  4R23 A;  5FI6 A;  3Q7V B;  5CHJ A;  4ZJ1 A;  2ZQ7 A;  5F83 A;  1KGF A;  4H8R A;  4GD6 A;  2Z2L B;  1C3B A;  3MBZ A;  4OLG A;  2Y2N A;  5D3O A;  2HDS A;  4OH0 A;  5HAP A;  3SS4 A;  2WAE A;  5I94 A;  3HLW A;  4XUZ A;  1TDL A;  3G32 A;  1IYQ A;  2XGN A;  5DF8 A;  3O88 A;  4ZTK A;  2EXA A;  3UDF A;  2XFT A;  4O7D A;  1ZKJ A;  2HP9 A;  4HEF A;  5EOE A;  4UAA A;  4S2J A;  3LCE A;  3WS4 A;  4DDS A;  1G6A A;  4GNU A;  3DWZ A;  4RVA A;  3SS5 A;  1YMX A;  1W5D A;  1TEM A;  1JTG A;  4Q8I A;  3VP0 A;  2WYX A;  2WZZ A;  1O07 A;  5DVA A;  3OC2 A;  2UWX A;  3PAG A;  4ZBE A;  3HLE A;  3HLF A;  2B5R A;  4OPR A;  1QMF A;  1QME A;  3W4O A;  4BL2 A;  1K57 A;  3N8R A;  3ZVW A;  3Q81 A;  3NBL A;  3BRM A;  1K38 A;  1SCW A;  1ONG A;  3PBS A;  3PBT A;  1IKI A;  4WM9 A;  4KZ9 A;  1FSY A;  5EUA A;  2VGJ A;  4DF6 A;  3OCN A;  3VSL A;  4BEN A;  3IF5 A;  5HL1 A;  5CGX A;  4DRT A;  1K6R A;  2JBF A;  4JLF A;  4OLD A;  3V3S A;  3ITA A;  3UPN A;  2QMI A;  4OPQ A;  4JXG A;  5CHU A;  5HAQ A;  2V20 A;  1PYY A;  3IF6 A;  3E2L A;  2Y2I A;  2ZC6 B;  3PBQ A;  5CED A;  4MLL A;  3ZG7 B;  3UNW A;  1BLC A;  3WWX A;  5FQI A;  4BD0 A;  1NJ4 A;  5GL9 A;  1AXB A;  1NZU A;  3FZC A;  4PMA A;  1M6K A;  4A5R A;  1BZA A;  3MXR A;  2H5S A;  1XPB A;  4KQQ A;  3PBR A;  4FD8 A;  1HD8 A;  4U0X A;  1Y54 A;  2HDU A;  3IXH A;  4R4S A;  3A3F A;  4B4X A;  3G35 A;  2WKE A;  3UY6 A;  3ZDJ A;  1XGI A;  3G34 A;  3NI9 A;  3UE3 A;  4S2O A;  2HDR A;  1H8Y A;  2HDQ A;  3E2K A;  1W79 A;  3IWQ A;  4KZ3 A;  5GLB A;  3VP3 A;  4EUZ A;  1EWZ A;  2H0Y A;  2ZM2 A;  4RX3 A;  3QNC A;  3SH8 A;  1K25 A;  1NYY A;  4OQH A;  2WUQ A;  3HLB A;  1N9B A;  4U3T A;  4X53 A;  4GKU A;  2OV5 A;  2ZC3 B;  4IVK A;  1BLP A;  1LL9 A;  1YLP A;  3NC8 A;  4GDN A;  4P87 A;  1MBL A;  2IWD A;  4WMC D;  2J8Y A;  4OVD A;  3HBR A;  5FQM A;  3Q07 A;  3TOI A;  1L0F A;  3M2J A;  4E3N A;  1RCJ A;  5JYO A;  3GMW A;  3IH8 A;  4Y0T A;  3BFC A;  2R9X A;  4N1X A;  4KZ8 A;  3W8K A;  5M18 A;  3WS1 A;  5EVI C;  4OOM A;  1FCM A;  2ZC7 A;  3PBO A;  1U60 A;  3BFG A;  2PU4 A;  2WAF A;  4GZB A;  4K0X A;  1PWD A;  4B88 A;  4KG5 A;  2X71 A;  1LI0 A;  5GHX A;  4EWF A;  2A49 A;  2GDN A;  3G31 A;  1FSW A;  3HLD A;  3RJU A;  1E4D A;  5FQQ A;  1BLS A;  1ES3 A;  1ES5 A;  3VSK A;  1MPL A;  4JXW A;  3UO9 A;  3AGD A;  4QB8 A;  4P85 A;  1PI4 A;  3DTM A;  1ES2 A;  2XF3 A;  4QD4 A;  5E2F A;  5EVI D;  1S0W A;  3V50 A;  3OPP A;  1BUL A;  1Q2P A;  3GRJ A;  1W8Q A;  4JF5 A;  2CC1 A;  2BG1 A;  2XQZ A;  3GV9 A;  3IHB A;  3Q1F A;  1ES4 A;  2WGW A;  4EQI A;  5AQA A;  1S6R A;  1WYB A;  2XDM A;  2ZC4 B;  4RYE A;  4D2O A;  4RX2 A;  2Y2J A;  3C5A A;  3JYI A;  1L2S A;  1HZO A;  3G2Z A;  3ISG A;  5EVI A;  3SH9 A;  5J8X A;  1W8Y A;  2PBY A;  4KZ6 A;  5HAR A;  1PWC A;  2BLS A;  2QPN A;  3RXW A;  4Y7P A;  3EQV A;  1KGE A;  1LL5 A;  2DRW A;  2V1Z A;  1KGG A;  3GQZ A;  4X6T A;  3AGF A;  3ZHH A;  1BUE A;  5L2F A;  3NIA A;  5AQB A;  2P74 A;  3HRE A;  3I7J A;  1LLB A;  1KE3 A;  5TR7 A;  4KZA A;  1IEL A;  3NCK A;  4JKT A;  4N9L A;  2Y2P A;  4PPR A;  5CTM A;  5EEC A;  4YIN A;  1FOF A;  4X55 A;  1WE4 A;  4GB7 A;  1ALQ A;  4KQR A;  4XUX A;  3IXD A;  2Q9M A;  4GD8 A;  2WGW B;  5CXW A;  3OPL A;  4P6B A;  3VFF A;  4BLM A;  5EE8 A;  1Q2Q A;  1I2S A;  4S2N C;  4KG2 A;  5CGW A;  5HFO A;  3VP2 A;  2WGI A;  3G4P A;  4HBT A;  1YM1 A;  3NY4 A;  3O87 A;  1GHP A;  3FV7 A;  3HUM A;  1SDE A;  3FKW A;  5EVI B;  3UDI A;  4DXC A;  1XA7 A;  4OPZ A;  3O86 A;  4HBU A;  4IVI A;  4GDB A;  1K55 A;  2ZD8 A;  1YQS A;  1YLY A;  3MKE A;  5FAS A;  3DWK A;  4QU3 A;  3EQU A;  1ZG4 A;  1ESI A;  5G18 A;  3WS5 A;  1DJC A;  4PM6 A;  1N4O A;  1MWT A;  5CRF A;  4R4R A;  4CJN A;  2A3U A;  5FAT A;  3UPP A;  2EX6 A;  4BJP A;  4E6X A;  1H8Z A;  3W4Q A;  1GHM A;  3C7U A;  3ZNT A;  3C4P A;  3M6B A;  2XH9 A;  2Y55 A;  5EVL A;  5BOH A;  4WYY A;  5AQ7 A;  5CEC A;  1MY8 A;  2ZC5 B;  4OQI A;  1PZP A;  5AQ9 A;  3WRZ A;  2XFS A;  4Y0U A;  4C3Q A;  2X01 A;  2IWC A;  3CMZ A;  4QY6 A;  4X56 A;  1VQQ A;  3GTC A;  1PZO A;  4KZ7 A;  4NET A;  2J7V A;  3FWL A;  5TGF A;  3W4P A;  4L0L A;  4QY5 A;  1G68 A;  4F94 A;  5CTN A;  3IHA A;  5CGS A;  5M19 A;  1YLW A;  2Y91 A;  1DJA A;  1CEF A;  5E2G A;  2I72 A;  5FAP A;  4N1H A;  3V5M A;  4WZ5 C;  2ZQ9 A;  5F1G A;  4GOG A;  1YLZ A;  1RGZ A;  4DE2 A;  1XA1 A;  5DTT A;  4OPY A;  3C4O A;  3BLM A;  3LO7 A;  1IYS A;  3A3J A;  3VOY A;  1VM1 A;  3MZE A;  4WZ4 A;  2FFY A;  3IWI A;  3IXG A;  4BL3 A;  2OSU A;  3LY3 A;  4IBX A;  3CJM A;  3LY4 A;  4KZ5 A;  2ZMA A;  2R9W A;  4ZJ3 A;  2HP6 A;  1IKG A;  4UA6 A;  1XX2 A;  2P9V B;  4YFM A;  2HP5 A;  1BLH A;  3SS3 A;  4E6W A;  4R1G A;  4S2L A;  4EBP A;  1GA9 A;  4JXV A;  4OP5 A;  3PBN A;  5M1A A;  4JF4 A;  2FFF B;  2EFX A;  1MWU A;  5F1F A;  2JC7 A;  1CK3 A;  1ZC2 A;  1MWS A;  2EX9 A;  2RCX A;  4S2P A;  4E3I A;  4WMC A;  3PAE A;  4C75 A;  3S22 A;  5FI7 A;  5HAI A;  1HVB A;  3ZG9 B;  4WZ5 A;  3N7W A;  1SKF A;  4KZB A;  2EFU A;  3IXB A;  3MZD A;  3G2Y A;  1NRF A;  5HW3 A;  4FH4 A;  4WEJ A;  5CER A;  2IWB A;  2Y4A A;  3BLS A;  4MBF A;  3CZD A;  2ZQD A;  1TDG A;  4OP8 A;  4LV1 A;  4OQG A;  1YT4 A;  1K56 D;  5FQK A;  4UA9 A;  4MBH A;  1BTL A;  5F82 A;  1TVF A;  1PW8 A;  3BM6 A;  1CI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...