2J3TD

The crystal structure of the bet3-trs33-bet5-trs23 complex.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
210
Chain Sequence
AIFSVYVVNKAGGLIYQLDSYEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 3
publication title The Architecture of the Multisubunit Trapp I Complex Suggests a Model for Vesicle Tethering.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 210
sequence length 214
ec nomenclature
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04099 Sybindin Sybindin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2j3tD01
2J3WA 3CUEA 1H3QA 2ZMVA 3CUEC 2J3TC 3PR6A 2J3TD
chains in the Genus database with same CATH superfamily
1ONHA 4FTXA 3T4SA 4P6ZM 1MZUA 4YINA 5DKKA 3ITBA 4X68A 2RCXA 3NHQA 1T18A 2Q9MA 4R23A 3S7OA 5CX7A 3MZDA 1VETB 2H28A 1XKZA 4Y7PA 4IVKA 2DNSA 2OOLA 4BENA 1OMEA 5CEDA 3H82A 1T1AA 2WGVA 1MWUA 1CI8A 3VP0A 2PT7A 4X6TA 3CJMA 2Y2IA 2WADA 4Y2FA 5HD3A 4M4XA 3G30A 1N4OA 3LIEA 3W4QA 4Y0OA 2XEPA 1G5UA 3LIBA 1I2SA 2XH9A 4XT2B 3FZCA 3IF6B 2HDSA 3UB8A 4L9GA 5TBMA 2WAEA 1XA7A 3Q81A 2UWXA 4F3LA 3V5MA 3MXQA 1HZOA 1DJAA 1NYMA 3FPVA 4HI4A 4JF6A 3G31A 3MFDA 1N9LA 2KDKA 4LENA 4MNRA 3CMZA 5GLDA 3WRZA 2JBFA 2V20A 1V9ZA 3F1NB 3KX0X 3FV7A 2OAP1 5EVID 2ZC7A 1G28A 3O88A 3PBRA 4HJ3A 3NULA 2KOIA 2MJ6A 1S4SA 4LV1A 4GDBA 1WE4A 3IXDA 4OKPA 1K56A 1NJ4A 1CEFA 3P01A 3T1QB 5EPHA 3NC8A 3B33A 4JPMA 2XGNA 4WYYA 1XX2A 3ZNTA 1ERQA 2Y2JA 4GN2A 3E2LA 2L4RA 4PM6A 1MY8A 3SW1A 2P74A 4LPZA 2ACGA 4YFMA 1PNEA 3PXPA 3LIFA 3Q7ZA 4BL3A 1JWVA 1F2KA 2VKSA 4FOFA 3S7QA 4YWZA 1H5XA 1VEUB 5BOHA 1GSWA 2B95A 1T19A 2ZQ8A 1YLZA 5EE8A 3ZQ5A 1OTEA 3MZFA 2QMIA 2L0WA 4FH4A 2QYBA 2X02A 4EXOA 2K31A 5HD5A 5IHVA 2J7VA 4PM8A 4HEFA 1K0KA 3N8SA 4I3AA 1E3UD 3HLWA 3PAGA 3N8RA 4IBXA 1W63M 3PHYA 1CF0A 5G4ZA 4IHQA 1H3QA 3EWKA 1SKOB 2JKFA 3BFGA 4ZJ3A 1OJGA 4RQ9A 4ZAMA 4PAUA 2Z2MB 4H8RA 4GHIA 4Q8IA 3RJUA 1PI5A 4IUHA 5HFOA 1KVLA 3AGFA 2J8YA 1XGIA 4S2OA 3CAXA 4KZ6A 3PAEA 2L1MA 4FSFA 3UN7A 1OTDA 2PYRA 4GOGA 2B5RA 3B3XA 1NRFA 4RYEA 3DBAA 4DDYA 1BUEA 1YMSA 2JKRI 4WMCD 1TEMA 2DCFA 1H8ZA 2K2NA 3KYEA 4JGOA 2XD5A 3MKEA 2JKTM 1K55A 3UNWA 5L07A 5M1AA 2Y55A 3NJAA 1PW8A 4EUVA 4WM9A 5DF8A 4WF0A 5L09A 3DTMA 2G2WA 1ERMA 3M6HA 2XF3A 1Z09A 5CGXA 5G4YA 2B02A 4KZ5A 4JGPA 2VGLM 4GKUA 1FILA 4HESA 4G3VA 4ZJ2A 5EUAA 2ZQ7A 3KYZA 2HF6A 1ZKJA 4UHUA 4FH2A 2Y79A 1XFQA 4HBTA 1LSWA 5CHMA 3UB5P 3Q82A 3IWQA 3N7WA 2WZZA 2LB5A 5GHZA 3P7NA 4DXCA 4OLGA 4F94A 1O07A 1RP5A 1I2WA 3V3RA 5HX9A 5KSCA 4HP9A 2M1CA 2WUQA 5EVLA 3D4FA 4MCWA 2QJ7A 1M6KA 4EV4A 4PM5A 1K54A 3ZYTA 1S0WA 4KG6A 1K6RA 1KGGA 3VSLA 3OZHA 3T4TA 4JXSA 4U3TA 1YLJA 1YLWA 3EQVA 4ZBEA 4OPRA 3HUMA 5LBRA 4LRYC 3D9YA 1IELA 4YNRA 2WGIA 3NOUC 4HH2A 2B18A 2EX9A 3ZGAB 2JHEA 2WGWA 3QP4A 5F69A 1ALQA 2Y59A 4GZBA 4UA9A 1MWRA 5AQ7A 2PU4A 3A3IA 4QD4A 3OPRA 4N9KA 2DMWA 4UQIS 5EVIC 4EW7A 3HLBA 3F1OA 3PBSA 1K4FA 3BM6A 1GSXA 4E3KA 4YOFA 1EROA 4O8GA 4GDNA 1PWCA 5CGWA 5EOOA 2A3UA 5DTSA 1LL8A 5FEFA 4PMAA 4N1HA 1OTAA 1FCNA 3HUNA 1MWSA 3GTCA 3T1XA 2VJWA 1U60A 2IWBA 4LV3A 1S1YA 2ZL1A 3E4QA 3KYQA 3DWZA 1HVBA 2HDQA 1BLHA 3UB7A 4G3WA 5CGSA 3SS5A 3CPTA 1FOFA 3BECA 1PIOA 1XJ3A 3QNCA 3D72A 3RFBA 1VB6A 3A0VA 1N9OA 1XXMA 5A8BA 3BLMA 1EI5A 4R1GA 1WYBA 1J9MA 2CC1A 5J7EA 4I39A 4OQGA 4DN0A 2R78A 4Q0JA 1L0EA 2IWDA 2W1TB 4CJNA 2RL3A 3IX8A 4H6JA 3K3CA 3O86A 3EOIA 5HL1A 1NLZA 1SCWA 4B4XA 2XFSA 3BFFA 4GD6A 1IKGA 4JGRA 2H5SA 2LB9A 5M18A 1CJFA 4BBTA 3ZVWA 4I3JA 5HARA 2EX6A 4KG5A 5AVFA 4S2NC 2VV6A 1OPXA 2ZQDA 3ICYA 1MBLA 4GJ4A 4LV2A 3LYXA 4GLQA 4EWFA 1PZPA 4EEUA 2GZAA 2EFUA 1HTZA 3ITAA 3HVFA 3K2NA 4C3QA 4EBPA 4OP5A 4DXBA 2P9VB 2XK1A 3LGOA 5TJJA 5L2FA 1YQSA 4L9EA 1KVMA 3SOIA 1DP9A 2EA9A 2PRFA 2XA7S 1OTBA 1NZUA 2P7JA 3IHAA 3LY3A 3VFFA 1PW1A 4IVIA 5GHXA 3OLOA 4GB7A 2PBYA 3IX4A 2JN7A 4D60A 1SKFA 5FAOA 3H7WA 3SH8A 4QPRA 1TVFA 3MR0A 4GS9B 3E98A 4LGWA 2EXBA 4O01A 4BBVA 4CLCC 3O87A 2W1RA 3Q7VB 4EESA 4NEED 2Q9NA 3QP5A 1LT0A 3MBZA 3Q1FA 4NXFA 4CPKA 5HAPA 3IS2B 3GECA 2J9PA 4ZJ1A 3TOIA 5CEBA 1ZHHB 3IT9A 2K7SA 4U0TA 1VHMA 3IQAA 3KSIA 2A49A 1LHYA 3ZDJA 2PAVP 3FPWA 5DVAA 3HBRA 3E2KA 2WKPA 1ZTUA 4P87A 4WELA 3JYIA 3L9KA 2V8FA 3JVVA 4EBNA 2V0WA 4CQHA 1FR6A 4QU3A 4FUWA 4RVAA 4MMNA 1NYYA 2Y2KA 4EETB 1NLYA 2V9AA 4KZBA 5E2GA 1ES3A 5IU1A 4BD0A 2XQZA 3HLEA 4DJ3A 3E4OA 1HD8A 4DE1A 1DP8A 4X56A 4MN5A 4DKIA 3NOPC 3OPPA 3VV4A 5FL3A 4WLAA 3K3DA 3H82B 2P04A 2Y2GA 2J9OA 4HBUA 4Y5FA 2VV7A 5EM0A 3BFCA 4S2MA 1JNUA 4E3NA 5DF7A 2VEAA 4QY5A 3W4PA 3GQZA 3PBOA 3QP8A 4KZ4A 3DAVA 4R3BA 4N1XA 5JYPA 1PI4A 3E0YA 2VV8A 1FIKA 4BJPA 4X53A 5DTTA 3W2ZA 3ZG9B 5TBMB 2EX8A 5F6AA 2J3WA 1IKIA 4F3LB 5EVEA 3ZVTA 2JKRM 1W79A 3OCLA 3S7PA 2QKPA 3LR4A 4UEYA 3T12B 3UE0A 3GV9A 3G34A 4E3OA 4M3KA 3LR0A 5GLBA 5A92A 2Y2LA 1Y28A 5KIZA 1IYQA 3LIDA 3BQ8A 2C5WB 2ZMAA 1P0ZA 3CWFA 2FFYA 4R70A 4OOMA 2C6WB 1H8YA 2QPNA 5AQ9A 4A5RA 2EWWA 3P98A 4II7A 3OPHA 4MBHA 2FZ0A 2Y4AA 4NK3A 5FASA 2JC7A 5GL9A 3QHYA 1LI0A 4E3IA 2VX8A 3IF6C 3Q07A 1F9IA 1MC0A 3NDEA 2HP9A 5F82A 4S2JA 5FQMA 3KO6A 2FFFB 2PR6A 1Y54A 2BLSA 4K91A 1XGJA 3G2YA 5FQIA 2ZC4B 5EVIA 1TF1A 1MKMA 2QWSA 5J8XA 3D3OA 1ZG6A 5GLCA 2FH5A 1D1JA 1VQQA 3CI6A 3MF0A 2OWHA 2XSSA 4KZ3A 2ZM8A 4DF6A 4UA7A 1V9YA 1LLBA 4JXWA 5U47A 5F1FA 3T50A 4QY6A 5HDCA 2PYPA 4R6LA 2HDUA 2M7UA 4R3AA 5CXWA 3R7WA 1PWDA 4EU0A 4GCZA 3HLGA 3IXGA 3UDIA 3W4OA 2PR5A 4OOYA 1QMFA 4S2KA 2Y2PA 2HV1A 1QMEA 3L7HA 3RTYA 2Y2HA 1PRQA 4HQAA 2ZBBA 5I5LA 5HWWA 3ZG8B 4ZDXA 1GA9A 5I94A 4GHIB 2PDRA 5A93A 3LCEA 2GDNA 2JKGA 3VE4A 4HY8A 2PBDP 2O9AA 3HLCA 4LFUA 4ARZA 4HJ6A 2YKFA 1ES2A 2XRNA 3SZTA 4EEPA 2I72A 1JTGA 4E6WA 3PBQA 4Q0HA 3BYDA 1EW0A 2HGVA 1W7FA 3RXXA 3VOZA 1DJBA 1DY6A 2ZC6B 3V50A 5AQBA 3WS5A 3HL9A 3PBTA 4Y3IA 3LUQA 1GCEA 4ZRRA 1L0FA 1GHIA 2CMNA 3E4PA 4B9OA 2IA2A 4DE0A 4S2NA 5KMWA 3ZG0A 5MC7A 1E25A 5FI2A 3UDFA 4JXVA 3C5AA 1TS0A 3AGEA 3N8LA 3DTIA 2WK0A 3S4XA 4AFIA 1P9WA 2G2UA 3ZFZA 1CQAA 3HREA 3ZG7B 4P0MA 3HCYA 3T4LA 4OOLA 4EUZA 5EECA 1BULA 1XPBA 4JKTA 1O7EA 1XJ6A 3GR2A 1F5MA 4I3IA 2Y8HA 4WMCA 4NG2A 2X01A 2H0YA 4E6XA 2GNXA 4UQIM 1FQGA 4Q0IA 1VM1A 4E3LA 1Q2PA 5FDSA 1L3LA 2O9CA 2J3TD 3I7JA 1X0OA 3BWLA 2QZ6A 4QB8A 2A24A 2W3EA 2XR0A 5JYOA 4EQ1A 4MDZA 1G6OA 4CLCA 2ZQ9A 4K08A 2H10A 4KQRA 5GHYA 4X1LA 4KUOA 4KZAA 3O3VA 5G18A 3V3SA 3F1PA 4ZTKA 4B93A 2Y2NA 1LSXA 3CZDA 5FDHA 3A3EA 5HPFA 2Y2OA 3QP1A 4Z1WA 1W8YA 5FQQA 2OV5A 3VOYA 1TS6A 1AWIA 3PBNA 3GRJA 3UPOA 3WWXA 1ES4A 4Y0UA 2WKIA 3FWLA 5IT5A 3CUEC 3IBJA 1YT4A 4Y13A 2KX6A 1MWTA 4RX3A 1YSPA 1Y4OA 3BRMA 5DFXA 1LI9A 4O7DA 1N9NA 2WGWB 4L0LA 2O9BA 2W3GA 3NIAA 3GVBA 4N92A 4ETXA 2XROA 3LR5A 4MLLA 3G32A 2V0UA 1KGEA 3MQOA 5FAQA 3M2KA 5J4EA 5TFQA 5CHUA 2ZQAA 5A91A 1ONGA 3HUOA 2I9VA 3F1OB 3HLFA 5TR7A 3MQ0A 3UE3A 2WKRA 2KLIA 5FQ9A 2V1AA 4D2OA 1NXYA 5FSRA 3UPNA 4LCLA 5DTKA 2BASA 3CLOA 1S1ZA 2ZQCA 4FD8A 2ZJ9A 3VSKA 4KQOA 4S2LA 2ZMFA 2VGKA 4BLMA 4LLOB 3NECA 2ZL1B 3UE1A 1XJ4A 4CLCE 3C7VA 5AVEA 2EXAA 1BLCA 5E2EA 3RH8B 1IFQA 1YPRA 4HHDA 3P09A 2E8IA 1K57C 4OVDA 4B88A 3T1SA 1YLYA 2PD7A 4KUKA 4BMWA 1WYCA 3CPTB 1L0DA 1IOUA 3VP1A 4E3JA 3UB9A 4ETZA 3N6IA 4X69A 5CRFA 1GA0A 3PYPA 1KDSA 4JF4A 2XA7M 1CI9A 4IUKA 5HW3A 3LO7A 5EFWA 1RGZA 4WZ4A 3IF5A 1Q2QA 5HL6A 3BY9A 4S2IA 4EQIA 4ESPA 4H6JB 4PPRA 4WZ5C 1DRMA 3U4LP 1XJ2A 5HAQA 1FCMA 3MXSA 4KQDA 1VETA 3C8CA 5FQKA 3S1YA 1H0MA 3BJNA 3B47A 4S2PA 3U2AA 2D01A 5HPIA 4HP4A 4QWOA 1YSQA 3LY4A 4OONA 2OLUA 3A3DA 4HJ4A 1PFLA 2NUPC 3VP2A 1YLTA 3UDXA 1JWZA 1LL9A 5E2FA 4MN6A 2HDRA 2HJ9C 4XUXA 5F68A 1LL5A 4I38A 4Y17A 4XT2A 4B4ZA 2Z6DA 1XFNA 1K56D 3KSFA 3LFVA 3IF6A 4OP8A 2R9XA 1KGFA 2ZOHA 2AVXA 4DE2A 1ESIA 2GJ3A 2WKEA 3HLDA 4R0QA 1BLSA 2WZXA 5C5KA 2R9WA 1MXOA 3C4PA 1UGUA 2VK3A 3WRTA 3F1NA 1IYOA 2ZOIA 2G7UA 4P6ZS 1FSWA 3BFDA 3H7WB 3H9WA 5EOEA 1UWNX 4KG2A 3DTEA 4NETA 4N9LA 3V39A 1KOUA 3IBRA 3TJZC 2ZMVA 4Z9QA 5AJGA 4DRTA 5CHJA 2WYXA 3GMWA 4LV0A 1YMXA 1S67L 4XUZA 4C6YA 4IJGA 4GNUA 5DFYA 3SH9A 5FQJA 4E3MA 4WEKA 5J3WA 3C4OA 4QJGA 4HH3A 2J80A 5L10A 1S6RA 4MN7A 1YAXA 3VOLA 5CTMA 4NXGA 5CERA 4R3JA 2VZWA 3G35A 3ZNYA 2J3TC 5FI7A 3A0RA 3KSHA 3ZG5A 1J3WA 2Y2MA 4HNBA 3R4KA 3ULFA 4OQHA 3UO9A 1VEUA 1DP6A 3DTKA 3NI9A 3CG5A 1JTDA 2XLNA 3UY6A 2EFXA 4OPQA 3BW6A 1E4DA 4P85A 1STZA 4XXRA 4R4SA 3TW8A 2XD1A 4MBFA 2PD8A 3O5YA 5HWVA 3FG8A 1MKIA 1ESUA 4OH0A 3MQQA 1OT9A 3MSHA 1SHVA 1TS8A 4OQ0A 3ISGA 3A3JA 5F5YA 2WKQA 5F83A 2JE5A 1SKOA 2O99A 4FCFA 1ODVA 4IEDA 3M6BA 1D06A 3C38A 5FEGA 4PM9A 2H0TA 3QNBA 3M2JA 3B42A 3LEZA 5HDSA 4BD1A 1EWZA 2OLVA 3EEAA 4ME4A 3FKVA 3SH7A 4X25A 4Y15A 1CEGA 3S22A 1G68A 1XP4A 4OLDA 4C75A 5DF9A 2OAQ1 1W63Q 3VMAA 1DJCA 2V2FF 1BTLA 2Y91A 4K0WA 1XA1A 3BFEA 3FYZA 5TGFA 1W8QA 1LSVA 3IWIA 1ZC2A 2EWVA 4EERA 3IH9A 3A3FA 2DRWA 4P6BA 3T4JA 1ES5A 3SS4A 1RCJA 4KZ9A 3NOTC 1P9RA 4MEZA 3CITA 3SS3A 4WEJA 3OBFA 3WS1A 4DDSA 3VP3A 1W5DA 1JVJA 4UA6A 1I5QA 3C2WA 4LRXC 3VFHA 5FI6A 1ACFA 1G6AA 3VP4A 3CUEA 4KZ7A 4ID4A 1KDWA 2W3FA 1YLPA 4HOIA 2BTFP 3BLSA 3NY4A 3UMEA 5L8MA 1IYPA 1K25A 5KZHA 2VGJA 2BG1A 5FA7A 2XDMA 2O0YA 5HWTA 3TSGA 2QHKA 1KE4A 2PHYA 4PHTA 1BYWA 2Z6CA 5AQAA 4WL9A 4DMZA 4QHCA 4RX2A 5EVIB 4OQIA 5HDDA 1TD5A 2EX2A 5CTNA 1BLPA 3OC2A 5GLAA 4CLCD 1SDEA 3IHBA 4E04A 4PKYA 4DJ2A 5F1GA 3UB6A 3BY8A 3S7NA 3N4IA 2ZC5B 1KE0A 1E3UA 4RA7A 3R7WB 3HJKA 3PR6A 2Y2QA 5E43A 2IWCA 4I5SA 1K57A 3OOVA 4NXEA 2VGLS 1L2SA 4K0XA 4JF5A 4WUJA 1UWPX 2QJ5A 3TE8A 4R4RA 2V1BA 3IX3A 5D3OA 4L9FA 3FKWA 2A2LA 2W3HA 3MXRA 1C3BA 3QP2A 2ZD8A 3WS4A 2HP6A 1KE3A 2P08A 2HJEA 4JGQA 4ARZB 3DWKA 2ZM2A 3MJQA 1RGYA 3RXWA 4OPYA 3MZEA 4WZ5A 4GW9A 3T4KA 1OT6A 3LEQA 4X1MA 2WAFA 3UE6A 2JKTI 4LCMA 3LICA 1MPLA 3JVUA 5FAPA 2PU2A 3G6OA 1PWGA 4WBGA 2OWJA 4BWIA 3MKFA 3HJIA 2HPBA 1GHPA 3EGDC 5E2HA 3OPLA 3GDIA 1YM1A 1ZG4A 1NRJA 3ZCZA 3A0SA 5DKLA 4HIAA 3LIAA 3C30A 1S4RA 3NBLA 1IYSA 1BZAA 2INWA 1IEMA 3JPUA 4X55A 1S66L 3AGDA 1FSYA 4GD8A 1N9BA 4MBKA 5HAIA 3BQAA 3IWOA 1T1BA 4IBRA 3MMHA 1M40A 1PYYA 2W1TA 3EQUA 2YKHA 1D7EA 4EBLA 1PZOA 3ZHHA 1H8MA 2UV0E 1K6SA 2HZ5A 1F98A 3T4OA 3LI9A 1FCOA 2Z2LB 2W0NA 3IXBA 4UAAA 1K55C 1T1CA 3EEHA 2OSUA 4DE3A 2WKHA 3LI8A 2GX5A 5EM1A 4OPZA 1JWPA 4KENB 2A24B 5HZHA 4WN5A 2W27A 1NY0A 3TG9A 5M19A 4CLCB 3NDGA 3CHWP 4PKYG 3F1PB 1BT5A 3WS2A 4JLFA 4KZ8A 3KSGA 3QP6A 4BQMA 4BBUA 1TS7A 4KQQA 2P9VA 1Z6FA 3NCKA 2E8JA 3T1RA 1NWZA 4G3KA 3UPPA 2D02A 4NKPA 3W8KA 3G2ZA 2ZM0A 1TDGA 1K38A 1HLUP 5FATA 5K5BA 1OJ5A 4Y0TA 3BEBA 2VA0A 4GS9A 5HSQA 3FC7A 2Q0OA 1FR1A 5EV0A 3C7UA 1P97A 1AXBA 1BSGA 3Q7VA 3UMDA 4BL2A 5KSHA 1SDNA 1OTIA 1K54C 1YKDA 2ZLYA 3G4PA 3MFXA 4O0PA 3IS2A 5DJUA 3OCNA 3IH8A 4PM7A 5CECA 3V67A 3TRCA 5DJTA 1TDLA 2JCHA 2V8CA 4LRZE 3PTEA 5A90A 4JBFA 2X71A 3LR3A 2VLGA 3T4QA 1L0GA 4JXGA 4U0XA 3IXHA 3MS6A 5IS1A 3EGXC 4NXBA 1A0KA 1GHMA 1K4EA 2XFTA 2NUTC 2M7VA 1GSVA 1NZOA 1WA9A 2V1ZA 1CK3A 2ZC3B 3VE3A 3DW0A 2W3DA 2HP5A 3WS0A 1SZVA 4R38A 3GSGA
chains in the Genus database with same CATH topology
4EEPA 2O99A 1ODVA 4G3WA 3PBQA 4Q0HA 1D06A 1EW0A 2HGVA 3T4SA 1XJ3A 4P6ZM 3D72A 1MZUA 5DKKA 3RFBA 1VB6A 3A0VA 3C38A 3NHQA 1T18A 1N9OA 3S7OA 5CX7A 3PBTA 4Y3IA 5A8BA 3B42A 3LUQA 2H28A 5HDSA 4ZRRA 2OOLA 5J7EA 4I39A 2CMNA 3E4PA 4B9OA 4DN0A 2IA2A 2R78A 3EEAA 4ME4A 4Q0JA 3H82A 5MC7A 1T1AA 2W1TB 5DF9A 1TS0A 2OAQ1 1W63Q 4H6JA 3K3CA 2PT7A 3EOIA 4AFIA 1NLZA 4Y2FA 5HD3A 1P9WA 4M4XA 1LSVA 3LIEA 2EWVA 3HCYA 4JGRA 4OOLA 3T4LA 2LB9A 4EERA 3LIBA 4BBTA 4XT2B 3T4JA 4I3JA 1XJ6A 1F5MA 5AVFA 4I3IA 2VV6A 2Y8HA 3UB8A 3NOTC 4L9GA 5TBMA 1P9RA 4F3LA 1OPXA 3CITA 3ICYA 2GNXA 4UQIM 3MXQA 4Q0IA 4GJ4A 4WEJA 3OBFA 3LYXA 4GLQA 3FPVA 4HI4A 2O9CA 2J3TD 1X0OA 3BWLA 1N9LA 2KDKA 3C2WA 4LRXC 4EEUA 2GZAA 3K2NA 1V9ZA 2A24A 2W3EA 3F1NB 3KX0X 5TJJA 4EQ1A 2OAP1 3CUEA 4MDZA 1G6OA 4CLCA 4L9EA 4K08A 1G28A 2W3FA 3PBRA 4HJ3A 4KUOA 4HOIA 2KOIA 1DP9A 2MJ6A 2EA9A 3UMEA 5L8MA 1S4SA 3F1PA 2XA7S 4B93A 1OTBA 2P7JA 1LSXA 2O0YA 3OLOA 5HWTA 5HPFA 4Z1WA 2QHKA 2PHYA 2JN7A 4PHTA 1BYWA 1TS6A 3PBNA 2Z6CA 3P01A 4WL9A 4DMZA 3H7WA 4QPRA 3B33A 5HDDA 3MR0A 4GS9B 3E98A 1TD5A 5IT5A 3CUEC 3OC2A 3IBJA 4O01A 4BBVA 4CLCC 4CLCD 2W1RA 4EESA 4NEED 2KX6A 4E04A 1LT0A 4PKYA 4DJ2A 1YSPA 3UB6A 2L4RA 3BY8A 4NXFA 3S7NA 3SW1A 5DFXA 3IS2B 3GECA 4LPZA 1N9NA 1ZHHB 4L0LA 3R7WB 2O9BA 3PXPA 2W3GA 4ETXA 3LIFA 2XROA 3HJKA 3LR5A 3PR6A 2K7SA 2VKSA 4FOFA 1VHMA 4I5SA 2V0UA 3S7QA 4YWZA 3MQOA 3KSIA 5J4EA 3OOVA 1GSWA 4NXEA 2VGLS 3FPWA 1T19A 2I9VA 3F1OB 3MQ0A 3UE3A 3ZQ5A 1OTEA 2WKRA 2KLIA 2L0WA 4WUJA 2QYBA 1UWPX 2V1AA 2QJ5A 2WKPA 1ZTUA 3TE8A 4EXOA 2K31A 4WELA 5HD5A 2V1BA 4L9FA 2BASA 3JVVA 3CLOA 2A2LA 4I3AA 1S1ZA 2W3HA 4KQOA 2V0WA 2ZMFA 4CQHA 4LLOB 1XJ4A 2P08A 2HJEA 4CLCE 5AVEA 1W63M 4MMNA 3RH8B 1IFQA 3PHYA 4HHDA 4JGQA 5G4ZA 4IHQA 1H3QA 4ARZB 3EWKA 4EETB 1NLYA 3MJQA 2PD7A 2V9AA 4KUKA 4BMWA 3T4KA 4GW9A 1OT6A 1OJGA 4RQ9A 4PAUA 3UE6A 2JKTI 1IOUA 3LICA 4GHIA 5IU1A 3UB9A 3JVUA 4ETZA 4DJ3A 3E4OA 3G6OA 4IUHA 1DP8A 3PYPA 2OWJA 2XA7M 4BWIA 4MN5A 3HJIA 3CAXA 4IUKA 3EGDC 3NOPC 3VV4A 2L1MA 3GDIA 4FSFA 5EFWA 5FL3A 1NRJA 1OTDA 2PYRA 3A0SA 4WLAA 5DKLA 3K3DA 3H82B 4HIAA 2P04A 3DBAA 5HL6A 3LIAA 4Y5FA 3BY9A 2VV7A 2JKRI 4H6JB 3C30A 1JNUA 1S4RA 1DRMA 2VEAA 2K2NA 1XJ2A 4JGOA 4KQDA 2INWA 3C8CA 2JKTM 3PBOA 1S66L 3NJAA 3BJNA 3B47A 3BQAA 1T1BA 4EUVA 3MMHA 3U2AA 2D01A 5HPIA 4HP4A 2W1TA 1YSQA 3EQUA 2YKHA 4WF0A 1D7EA 3E0YA 2VV8A 4BJPA 4HJ4A 3W2ZA 5TBMB 2NUPC 5F6AA 2J3WA 1H8MA 4F3LB 5G4YA 1F98A 3T4OA 2B02A 4JGPA 2JKRM 2VGLM 3LI9A 4MN6A 2W0NA 3OCLA 2HJ9C 4G3VA 3S7PA 2QKPA 5F68A 3EEHA 1T1CA 3LR4A 4UEYA 4I38A 4XT2A 3LI8A 2GX5A 2Z6DA 1XFNA 3KSFA 3KYZA 3LR0A 2HF6A 3LFVA 2A24B 2ZOHA 5HZHA 1Y28A 5KIZA 2Y79A 3LIDA 1XFQA 3BQ8A 1P0ZA 4WN5A 2W27A 1LSWA 3CWFA 4R70A 2GJ3A 4CLCB 4OOMA 2EWWA 4PKYG 3F1PB 4II7A 5C5KA 2FZ0A 2LB5A 3KSGA 3P7NA 1UGUA 4BBUA 1TS7A 3F1NA 2ZOIA 2G7UA 4HP9A 2M1CA 2VX8A 4P6ZS 4MCWA 2QJ7A 3H7WB 3H9WA 1UWNX 1NWZA 1F9IA 1MC0A 4G3KA 1KOUA 3IBRA 3TJZC 2D02A 4NKPA 3ZYTA 2ZMVA 5AJGA 3KO6A 2PR6A 3T4TA 5K5BA 1S67L 1OJ5A 4IJGA 5DFYA 1TF1A 1MKMA 2VA0A 4GS9A 5HSQA 3FC7A 2QWSA 4WEKA 5J3WA 3D3OA 2FH5A 1P97A 3CI6A 2OWHA 3MF0A 3EQVA 5KSHA 2XSSA 3UMDA 4HH3A 2J80A 5LBRA 4MN7A 1YAXA 3VOLA 1V9YA 1OTIA 1YKDA 4LRYC 4NXGA 3MFXA 3T50A 4YNRA 3NOUC 2VZWA 4O0PA 5HDCA 3IS2A 5DJUA 3OCNA 2J3TC 2PYPA 4HH2A 4R6LA 2B18A 2M7UA 4R3AA 2JHEA 3A0RA 3R7WA 3KSHA 3TRCA 3V67A 5F69A 4EU0A 4GCZA 4HNBA 5DJTA 3R4KA 3ULFA 4LRZE 2DMWA 4UQIS 3LR3A 2PR5A 2VLGA 3T4QA 4EW7A 3F1OA 1DP6A 3PBSA 1GSXA 2HV1A 4YOFA 3RTYA 4O8GA 3BW6A 1LL8A 4HQAA 5I5LA 1STZA 2ZBBA 5HWWA 5IS1A 3EGXC 4NXBA 1OTAA 3TW8A 2VJWA 4GHIB 2PDRA 2PD8A 3O5YA 5HWVA 2NUTC 1S1YA 2M7VA 3E4QA 1GSVA 3FG8A 3KYQA 1WA9A 3VE3A 3VE4A 4HY8A 1OT9A 3MQQA 2O9AA 2W3DA 1TS8A 4ARZA 4HJ6A 4R38A 2YKFA 3UB7A 2XRNA 5F5YA 2WKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3W A;  3CUE A;  1H3Q A;  2ZMV A;  3CUE C;  2J3T C;  3PR6 A;  2J3T D; 
#chains in the Genus database with same CATH topology
 1ONH A;  4FTX A;  3T4S A;  4P6Z M;  1MZU A;  4YIN A;  5DKK A;  3ITB A;  4X68 A;  2RCX A;  3NHQ A;  1T18 A;  2Q9M A;  4R23 A;  3S7O A;  5CX7 A;  3MZD A;  1VET B;  2H28 A;  1XKZ A;  4Y7P A;  4IVK A;  2DNS A;  2OOL A;  4BEN A;  1OME A;  5CED A;  3H82 A;  1T1A A;  2WGV A;  1MWU A;  1CI8 A;  3VP0 A;  2PT7 A;  4X6T A;  3CJM A;  2Y2I A;  2WAD A;  4Y2F A;  5HD3 A;  4M4X A;  3G30 A;  1N4O A;  3LIE A;  3W4Q A;  4Y0O A;  2XEP A;  1G5U A;  3LIB A;  1I2S A;  2XH9 A;  4XT2 B;  3FZC A;  3IF6 B;  2HDS A;  3UB8 A;  4L9G A;  5TBM A;  2WAE A;  1XA7 A;  3Q81 A;  2UWX A;  4F3L A;  3V5M A;  3MXQ A;  1HZO A;  1DJA A;  1NYM A;  3FPV A;  4HI4 A;  4JF6 A;  3G31 A;  3MFD A;  1N9L A;  2KDK A;  4LEN A;  4MNR A;  3CMZ A;  5GLD A;  3WRZ A;  2JBF A;  2V20 A;  1V9Z A;  3F1N B;  3KX0 X;  3FV7 A;  2OAP 1;  5EVI D;  2ZC7 A;  1G28 A;  3O88 A;  3PBR A;  4HJ3 A;  3NUL A;  2KOI A;  2MJ6 A;  1S4S A;  4LV1 A;  4GDB A;  1WE4 A;  3IXD A;  4OKP A;  1K56 A;  1NJ4 A;  1CEF A;  3P01 A;  3T1Q B;  5EPH A;  3NC8 A;  3B33 A;  4JPM A;  2XGN A;  4WYY A;  1XX2 A;  3ZNT A;  1ERQ A;  2Y2J A;  4GN2 A;  3E2L A;  2L4R A;  4PM6 A;  1MY8 A;  3SW1 A;  2P74 A;  4LPZ A;  2ACG A;  4YFM A;  1PNE A;  3PXP A;  3LIF A;  3Q7Z A;  4BL3 A;  1JWV A;  1F2K A;  2VKS A;  4FOF A;  3S7Q A;  4YWZ A;  1H5X A;  1VEU B;  5BOH A;  1GSW A;  2B95 A;  1T19 A;  2ZQ8 A;  1YLZ A;  5EE8 A;  3ZQ5 A;  1OTE A;  3MZF A;  2QMI A;  2L0W A;  4FH4 A;  2QYB A;  2X02 A;  4EXO A;  2K31 A;  5HD5 A;  5IHV A;  2J7V A;  4PM8 A;  4HEF A;  1K0K A;  3N8S A;  4I3A A;  1E3U D;  3HLW A;  3PAG A;  3N8R A;  4IBX A;  1W63 M;  3PHY A;  1CF0 A;  5G4Z A;  4IHQ A;  1H3Q A;  3EWK A;  1SKO B;  2JKF A;  3BFG A;  4ZJ3 A;  1OJG A;  4RQ9 A;  4ZAM A;  4PAU A;  2Z2M B;  4H8R A;  4GHI A;  4Q8I A;  3RJU A;  1PI5 A;  4IUH A;  5HFO A;  1KVL A;  3AGF A;  2J8Y A;  1XGI A;  4S2O A;  3CAX A;  4KZ6 A;  3PAE A;  2L1M A;  4FSF A;  3UN7 A;  1OTD A;  2PYR A;  4GOG A;  2B5R A;  3B3X A;  1NRF A;  4RYE A;  3DBA A;  4DDY A;  1BUE A;  1YMS A;  2JKR I;  4WMC D;  1TEM A;  2DCF A;  1H8Z A;  2K2N A;  3KYE A;  4JGO A;  2XD5 A;  3MKE A;  2JKT M;  1K55 A;  3UNW A;  5L07 A;  5M1A A;  2Y55 A;  3NJA A;  1PW8 A;  4EUV A;  4WM9 A;  5DF8 A;  4WF0 A;  5L09 A;  3DTM A;  2G2W A;  1ERM A;  3M6H A;  2XF3 A;  1Z09 A;  5CGX A;  5G4Y A;  2B02 A;  4KZ5 A;  4JGP A;  2VGL M;  4GKU A;  1FIL A;  4HES A;  4G3V A;  4ZJ2 A;  5EUA A;  2ZQ7 A;  3KYZ A;  2HF6 A;  1ZKJ A;  4UHU A;  4FH2 A;  2Y79 A;  1XFQ A;  4HBT A;  1LSW A;  5CHM A;  3UB5 P;  3Q82 A;  3IWQ A;  3N7W A;  2WZZ A;  2LB5 A;  5GHZ A;  3P7N A;  4DXC A;  4OLG A;  4F94 A;  1O07 A;  1RP5 A;  1I2W A;  3V3R A;  5HX9 A;  5KSC A;  4HP9 A;  2M1C A;  2WUQ A;  5EVL A;  3D4F A;  4MCW A;  2QJ7 A;  1M6K A;  4EV4 A;  4PM5 A;  1K54 A;  3ZYT A;  1S0W A;  4KG6 A;  1K6R A;  1KGG A;  3VSL A;  3OZH A;  3T4T A;  4JXS A;  4U3T A;  1YLJ A;  1YLW A;  3EQV A;  4ZBE A;  4OPR A;  3HUM A;  5LBR A;  4LRY C;  3D9Y A;  1IEL A;  4YNR A;  2WGI A;  3NOU C;  4HH2 A;  2B18 A;  2EX9 A;  3ZGA B;  2JHE A;  2WGW A;  3QP4 A;  5F69 A;  1ALQ A;  2Y59 A;  4GZB A;  4UA9 A;  1MWR A;  5AQ7 A;  2PU4 A;  3A3I A;  4QD4 A;  3OPR A;  4N9K A;  2DMW A;  4UQI S;  5EVI C;  4EW7 A;  3HLB A;  3F1O A;  3PBS A;  1K4F A;  3BM6 A;  1GSX A;  4E3K A;  4YOF A;  1ERO A;  4O8G A;  4GDN A;  1PWC A;  5CGW A;  5EOO A;  2A3U A;  5DTS A;  1LL8 A;  5FEF A;  4PMA A;  4N1H A;  1OTA A;  1FCN A;  3HUN A;  1MWS A;  3GTC A;  3T1X A;  2VJW A;  1U60 A;  2IWB A;  4LV3 A;  1S1Y A;  2ZL1 A;  3E4Q A;  3KYQ A;  3DWZ A;  1HVB A;  2HDQ A;  1BLH A;  3UB7 A;  4G3W A;  5CGS A;  3SS5 A;  3CPT A;  1FOF A;  3BEC A;  1PIO A;  1XJ3 A;  3QNC A;  3D72 A;  3RFB A;  1VB6 A;  3A0V A;  1N9O A;  1XXM A;  5A8B A;  3BLM A;  1EI5 A;  4R1G A;  1WYB A;  1J9M A;  2CC1 A;  5J7E A;  4I39 A;  4OQG A;  4DN0 A;  2R78 A;  4Q0J A;  1L0E A;  2IWD A;  2W1T B;  4CJN A;  2RL3 A;  3IX8 A;  4H6J A;  3K3C A;  3O86 A;  3EOI A;  5HL1 A;  1NLZ A;  1SCW A;  4B4X A;  2XFS A;  3BFF A;  4GD6 A;  1IKG A;  4JGR A;  2H5S A;  2LB9 A;  5M18 A;  1CJF A;  4BBT A;  3ZVW A;  4I3J A;  5HAR A;  2EX6 A;  4KG5 A;  5AVF A;  4S2N C;  2VV6 A;  1OPX A;  2ZQD A;  3ICY A;  1MBL A;  4GJ4 A;  4LV2 A;  3LYX A;  4GLQ A;  4EWF A;  1PZP A;  4EEU A;  2GZA A;  2EFU A;  1HTZ A;  3ITA A;  3HVF A;  3K2N A;  4C3Q A;  4EBP A;  4OP5 A;  4DXB A;  2P9V B;  2XK1 A;  3LGO A;  5TJJ A;  5L2F A;  1YQS A;  4L9E A;  1KVM A;  3SOI A;  1DP9 A;  2EA9 A;  2PRF A;  2XA7 S;  1OTB A;  1NZU A;  2P7J A;  3IHA A;  3LY3 A;  3VFF A;  1PW1 A;  4IVI A;  5GHX A;  3OLO A;  4GB7 A;  2PBY A;  3IX4 A;  2JN7 A;  4D60 A;  1SKF A;  5FAO A;  3H7W A;  3SH8 A;  4QPR A;  1TVF A;  3MR0 A;  4GS9 B;  3E98 A;  4LGW A;  2EXB A;  4O01 A;  4BBV A;  4CLC C;  3O87 A;  2W1R A;  3Q7V B;  4EES A;  4NEE D;  2Q9N A;  3QP5 A;  1LT0 A;  3MBZ A;  3Q1F A;  4NXF A;  4CPK A;  5HAP A;  3IS2 B;  3GEC A;  2J9P A;  4ZJ1 A;  3TOI A;  5CEB A;  1ZHH B;  3IT9 A;  2K7S A;  4U0T A;  1VHM A;  3IQA A;  3KSI A;  2A49 A;  1LHY A;  3ZDJ A;  2PAV P;  3FPW A;  5DVA A;  3HBR A;  3E2K A;  2WKP A;  1ZTU A;  4P87 A;  4WEL A;  3JYI A;  3L9K A;  2V8F A;  3JVV A;  4EBN A;  2V0W A;  4CQH A;  1FR6 A;  4QU3 A;  4FUW A;  4RVA A;  4MMN A;  1NYY A;  2Y2K A;  4EET B;  1NLY A;  2V9A A;  4KZB A;  5E2G A;  1ES3 A;  5IU1 A;  4BD0 A;  2XQZ A;  3HLE A;  4DJ3 A;  3E4O A;  1HD8 A;  4DE1 A;  1DP8 A;  4X56 A;  4MN5 A;  4DKI A;  3NOP C;  3OPP A;  3VV4 A;  5FL3 A;  4WLA A;  3K3D A;  3H82 B;  2P04 A;  2Y2G A;  2J9O A;  4HBU A;  4Y5F A;  2VV7 A;  5EM0 A;  3BFC A;  4S2M A;  1JNU A;  4E3N A;  5DF7 A;  2VEA A;  4QY5 A;  3W4P A;  3GQZ A;  3PBO A;  3QP8 A;  4KZ4 A;  3DAV A;  4R3B A;  4N1X A;  5JYP A;  1PI4 A;  3E0Y A;  2VV8 A;  1FIK A;  4BJP A;  4X53 A;  5DTT A;  3W2Z A;  3ZG9 B;  5TBM B;  2EX8 A;  5F6A A;  2J3W A;  1IKI A;  4F3L B;  5EVE A;  3ZVT A;  2JKR M;  1W79 A;  3OCL A;  3S7P A;  2QKP A;  3LR4 A;  4UEY A;  3T12 B;  3UE0 A;  3GV9 A;  3G34 A;  4E3O A;  4M3K A;  3LR0 A;  5GLB A;  5A92 A;  2Y2L A;  1Y28 A;  5KIZ A;  1IYQ A;  3LID A;  3BQ8 A;  2C5W B;  2ZMA A;  1P0Z A;  3CWF A;  2FFY A;  4R70 A;  4OOM A;  2C6W B;  1H8Y A;  2QPN A;  5AQ9 A;  4A5R A;  2EWW A;  3P98 A;  4II7 A;  3OPH A;  4MBH A;  2FZ0 A;  2Y4A A;  4NK3 A;  5FAS A;  2JC7 A;  5GL9 A;  3QHY A;  1LI0 A;  4E3I A;  2VX8 A;  3IF6 C;  3Q07 A;  1F9I A;  1MC0 A;  3NDE A;  2HP9 A;  5F82 A;  4S2J A;  5FQM A;  3KO6 A;  2FFF B;  2PR6 A;  1Y54 A;  2BLS A;  4K91 A;  1XGJ A;  3G2Y A;  5FQI A;  2ZC4 B;  5EVI A;  1TF1 A;  1MKM A;  2QWS A;  5J8X A;  3D3O A;  1ZG6 A;  5GLC A;  2FH5 A;  1D1J A;  1VQQ A;  3CI6 A;  3MF0 A;  2OWH A;  2XSS A;  4KZ3 A;  2ZM8 A;  4DF6 A;  4UA7 A;  1V9Y A;  1LLB A;  4JXW A;  5U47 A;  5F1F A;  3T50 A;  4QY6 A;  5HDC A;  2PYP A;  4R6L A;  2HDU A;  2M7U A;  4R3A A;  5CXW A;  3R7W A;  1PWD A;  4EU0 A;  4GCZ A;  3HLG A;  3IXG A;  3UDI A;  3W4O A;  2PR5 A;  4OOY A;  1QMF A;  4S2K A;  2Y2P A;  2HV1 A;  1QME A;  3L7H A;  3RTY A;  2Y2H A;  1PRQ A;  4HQA A;  2ZBB A;  5I5L A;  5HWW A;  3ZG8 B;  4ZDX A;  1GA9 A;  5I94 A;  4GHI B;  2PDR A;  5A93 A;  3LCE A;  2GDN A;  2JKG A;  3VE4 A;  4HY8 A;  2PBD P;  2O9A A;  3HLC A;  4LFU A;  4ARZ A;  4HJ6 A;  2YKF A;  1ES2 A;  2XRN A;  3SZT A;  4EEP A;  2I72 A;  1JTG A;  4E6W A;  3PBQ A;  4Q0H A;  3BYD A;  1EW0 A;  2HGV A;  1W7F A;  3RXX A;  3VOZ A;  1DJB A;  1DY6 A;  2ZC6 B;  3V50 A;  5AQB A;  3WS5 A;  3HL9 A;  3PBT A;  4Y3I A;  3LUQ A;  1GCE A;  4ZRR A;  1L0F A;  1GHI A;  2CMN A;  3E4P A;  4B9O A;  2IA2 A;  4DE0 A;  4S2N A;  5KMW A;  3ZG0 A;  5MC7 A;  1E25 A;  5FI2 A;  3UDF A;  4JXV A;  3C5A A;  1TS0 A;  3AGE A;  3N8L A;  3DTI A;  2WK0 A;  3S4X A;  4AFI A;  1P9W A;  2G2U A;  3ZFZ A;  1CQA A;  3HRE A;  3ZG7 B;  4P0M A;  3HCY A;  3T4L A;  4OOL A;  4EUZ A;  5EEC A;  1BUL A;  1XPB A;  4JKT A;  1O7E A;  1XJ6 A;  3GR2 A;  1F5M A;  4I3I A;  2Y8H A;  4WMC A;  4NG2 A;  2X01 A;  2H0Y A;  4E6X A;  2GNX A;  4UQI M;  1FQG A;  4Q0I A;  1VM1 A;  4E3L A;  1Q2P A;  5FDS A;  1L3L A;  2O9C A;  2J3T D;  3I7J A;  1X0O A;  3BWL A;  2QZ6 A;  4QB8 A;  2A24 A;  2W3E A;  2XR0 A;  5JYO A;  4EQ1 A;  4MDZ A;  1G6O A;  4CLC A;  2ZQ9 A;  4K08 A;  2H10 A;  4KQR A;  5GHY A;  4X1L A;  4KUO A;  4KZA A;  3O3V A;  5G18 A;  3V3S A;  3F1P A;  4ZTK A;  4B93 A;  2Y2N A;  1LSX A;  3CZD A;  5FDH A;  3A3E A;  5HPF A;  2Y2O A;  3QP1 A;  4Z1W A;  1W8Y A;  5FQQ A;  2OV5 A;  3VOY A;  1TS6 A;  1AWI A;  3PBN A;  3GRJ A;  3UPO A;  3WWX A;  1ES4 A;  4Y0U A;  2WKI A;  3FWL A;  5IT5 A;  3CUE C;  3IBJ A;  1YT4 A;  4Y13 A;  2KX6 A;  1MWT A;  4RX3 A;  1YSP A;  1Y4O A;  3BRM A;  5DFX A;  1LI9 A;  4O7D A;  1N9N A;  2WGW B;  4L0L A;  2O9B A;  2W3G A;  3NIA A;  3GVB A;  4N92 A;  4ETX A;  2XRO A;  3LR5 A;  4MLL A;  3G32 A;  2V0U A;  1KGE A;  3MQO A;  5FAQ A;  3M2K A;  5J4E A;  5TFQ A;  5CHU A;  2ZQA A;  5A91 A;  1ONG A;  3HUO A;  2I9V A;  3F1O B;  3HLF A;  5TR7 A;  3MQ0 A;  3UE3 A;  2WKR A;  2KLI A;  5FQ9 A;  2V1A A;  4D2O A;  1NXY A;  5FSR A;  3UPN A;  4LCL A;  5DTK A;  2BAS A;  3CLO A;  1S1Z A;  2ZQC A;  4FD8 A;  2ZJ9 A;  3VSK A;  4KQO A;  4S2L A;  2ZMF A;  2VGK A;  4BLM A;  4LLO B;  3NEC A;  2ZL1 B;  3UE1 A;  1XJ4 A;  4CLC E;  3C7V A;  5AVE A;  2EXA A;  1BLC A;  5E2E A;  3RH8 B;  1IFQ A;  1YPR A;  4HHD A;  3P09 A;  2E8I A;  1K57 C;  4OVD A;  4B88 A;  3T1S A;  1YLY A;  2PD7 A;  4KUK A;  4BMW A;  1WYC A;  3CPT B;  1L0D A;  1IOU A;  3VP1 A;  4E3J A;  3UB9 A;  4ETZ A;  3N6I A;  4X69 A;  5CRF A;  1GA0 A;  3PYP A;  1KDS A;  4JF4 A;  2XA7 M;  1CI9 A;  4IUK A;  5HW3 A;  3LO7 A;  5EFW A;  1RGZ A;  4WZ4 A;  3IF5 A;  1Q2Q A;  5HL6 A;  3BY9 A;  4S2I A;  4EQI A;  4ESP A;  4H6J B;  4PPR A;  4WZ5 C;  1DRM A;  3U4L P;  1XJ2 A;  5HAQ A;  1FCM A;  3MXS A;  4KQD A;  1VET A;  3C8C A;  5FQK A;  3S1Y A;  1H0M A;  3BJN A;  3B47 A;  4S2P A;  3U2A A;  2D01 A;  5HPI A;  4HP4 A;  4QWO A;  1YSQ A;  3LY4 A;  4OON A;  2OLU A;  3A3D A;  4HJ4 A;  1PFL A;  2NUP C;  3VP2 A;  1YLT A;  3UDX A;  1JWZ A;  1LL9 A;  5E2F A;  4MN6 A;  2HDR A;  2HJ9 C;  4XUX A;  5F68 A;  1LL5 A;  4I38 A;  4Y17 A;  4XT2 A;  4B4Z A;  2Z6D A;  1XFN A;  1K56 D;  3KSF A;  3LFV A;  3IF6 A;  4OP8 A;  2R9X A;  1KGF A;  2ZOH A;  2AVX A;  4DE2 A;  1ESI A;  2GJ3 A;  2WKE A;  3HLD A;  4R0Q A;  1BLS A;  2WZX A;  5C5K A;  2R9W A;  1MXO A;  3C4P A;  1UGU A;  2VK3 A;  3WRT A;  3F1N A;  1IYO A;  2ZOI A;  2G7U A;  4P6Z S;  1FSW A;  3BFD A;  3H7W B;  3H9W A;  5EOE A;  1UWN X;  4KG2 A;  3DTE A;  4NET A;  4N9L A;  3V39 A;  1KOU A;  3IBR A;  3TJZ C;  2ZMV A;  4Z9Q A;  5AJG A;  4DRT A;  5CHJ A;  2WYX A;  3GMW A;  4LV0 A;  1YMX A;  1S67 L;  4XUZ A;  4C6Y A;  4IJG A;  4GNU A;  5DFY A;  3SH9 A;  5FQJ A;  4E3M A;  4WEK A;  5J3W A;  3C4O A;  4QJG A;  4HH3 A;  2J80 A;  5L10 A;  1S6R A;  4MN7 A;  1YAX A;  3VOL A;  5CTM A;  4NXG A;  5CER A;  4R3J A;  2VZW A;  3G35 A;  3ZNY A;  2J3T C;  5FI7 A;  3A0R A;  3KSH A;  3ZG5 A;  1J3W A;  2Y2M A;  4HNB A;  3R4K A;  3ULF A;  4OQH A;  3UO9 A;  1VEU A;  1DP6 A;  3DTK A;  3NI9 A;  3CG5 A;  1JTD A;  2XLN A;  3UY6 A;  2EFX A;  4OPQ A;  3BW6 A;  1E4D A;  4P85 A;  1STZ A;  4XXR A;  4R4S A;  3TW8 A;  2XD1 A;  4MBF A;  2PD8 A;  3O5Y A;  5HWV A;  3FG8 A;  1MKI A;  1ESU A;  4OH0 A;  3MQQ A;  1OT9 A;  3MSH A;  1SHV A;  1TS8 A;  4OQ0 A;  3ISG A;  3A3J A;  5F5Y A;  2WKQ A;  5F83 A;  2JE5 A;  1SKO A;  2O99 A;  4FCF A;  1ODV A;  4IED A;  3M6B A;  1D06 A;  3C38 A;  5FEG A;  4PM9 A;  2H0T A;  3QNB A;  3M2J A;  3B42 A;  3LEZ A;  5HDS A;  4BD1 A;  1EWZ A;  2OLV A;  3EEA A;  4ME4 A;  3FKV A;  3SH7 A;  4X25 A;  4Y15 A;  1CEG A;  3S22 A;  1G68 A;  1XP4 A;  4OLD A;  4C75 A;  5DF9 A;  2OAQ 1;  1W63 Q;  3VMA A;  1DJC A;  2V2F F;  1BTL A;  2Y91 A;  4K0W A;  1XA1 A;  3BFE A;  3FYZ A;  5TGF A;  1W8Q A;  1LSV A;  3IWI A;  1ZC2 A;  2EWV A;  4EER A;  3IH9 A;  3A3F A;  2DRW A;  4P6B A;  3T4J A;  1ES5 A;  3SS4 A;  1RCJ A;  4KZ9 A;  3NOT C;  1P9R A;  4MEZ A;  3CIT A;  3SS3 A;  4WEJ A;  3OBF A;  3WS1 A;  4DDS A;  3VP3 A;  1W5D A;  1JVJ A;  4UA6 A;  1I5Q A;  3C2W A;  4LRX C;  3VFH A;  5FI6 A;  1ACF A;  1G6A A;  3VP4 A;  3CUE A;  4KZ7 A;  4ID4 A;  1KDW A;  2W3F A;  1YLP A;  4HOI A;  2BTF P;  3BLS A;  3NY4 A;  3UME A;  5L8M A;  1IYP A;  1K25 A;  5KZH A;  2VGJ A;  2BG1 A;  5FA7 A;  2XDM A;  2O0Y A;  5HWT A;  3TSG A;  2QHK A;  1KE4 A;  2PHY A;  4PHT A;  1BYW A;  2Z6C A;  5AQA A;  4WL9 A;  4DMZ A;  4QHC A;  4RX2 A;  5EVI B;  4OQI A;  5HDD A;  1TD5 A;  2EX2 A;  5CTN A;  1BLP A;  3OC2 A;  5GLA A;  4CLC D;  1SDE A;  3IHB A;  4E04 A;  4PKY A;  4DJ2 A;  5F1G A;  3UB6 A;  3BY8 A;  3S7N A;  3N4I A;  2ZC5 B;  1KE0 A;  1E3U A;  4RA7 A;  3R7W B;  3HJK A;  3PR6 A;  2Y2Q A;  5E43 A;  2IWC A;  4I5S A;  1K57 A;  3OOV A;  4NXE A;  2VGL S;  1L2S A;  4K0X A;  4JF5 A;  4WUJ A;  1UWP X;  2QJ5 A;  3TE8 A;  4R4R A;  2V1B A;  3IX3 A;  5D3O A;  4L9F A;  3FKW A;  2A2L A;  2W3H A;  3MXR A;  1C3B A;  3QP2 A;  2ZD8 A;  3WS4 A;  2HP6 A;  1KE3 A;  2P08 A;  2HJE A;  4JGQ A;  4ARZ B;  3DWK A;  2ZM2 A;  3MJQ A;  1RGY A;  3RXW A;  4OPY A;  3MZE A;  4WZ5 A;  4GW9 A;  3T4K A;  1OT6 A;  3LEQ A;  4X1M A;  2WAF A;  3UE6 A;  2JKT I;  4LCM A;  3LIC A;  1MPL A;  3JVU A;  5FAP A;  2PU2 A;  3G6O A;  1PWG A;  4WBG A;  2OWJ A;  4BWI A;  3MKF A;  3HJI A;  2HPB A;  1GHP A;  3EGD C;  5E2H A;  3OPL A;  3GDI A;  1YM1 A;  1ZG4 A;  1NRJ A;  3ZCZ A;  3A0S A;  5DKL A;  4HIA A;  3LIA A;  3C30 A;  1S4R A;  3NBL A;  1IYS A;  1BZA A;  2INW A;  1IEM A;  3JPU A;  4X55 A;  1S66 L;  3AGD A;  1FSY A;  4GD8 A;  1N9B A;  4MBK A;  5HAI A;  3BQA A;  3IWO A;  1T1B A;  4IBR A;  3MMH A;  1M40 A;  1PYY A;  2W1T A;  3EQU A;  2YKH A;  1D7E A;  4EBL A;  1PZO A;  3ZHH A;  1H8M A;  2UV0 E;  1K6S A;  2HZ5 A;  1F98 A;  3T4O A;  3LI9 A;  1FCO A;  2Z2L B;  2W0N A;  3IXB A;  4UAA A;  1K55 C;  1T1C A;  3EEH A;  2OSU A;  4DE3 A;  2WKH A;  3LI8 A;  2GX5 A;  5EM1 A;  4OPZ A;  1JWP A;  4KEN B;  2A24 B;  5HZH A;  4WN5 A;  2W27 A;  1NY0 A;  3TG9 A;  5M19 A;  4CLC B;  3NDG A;  3CHW P;  4PKY G;  3F1P B;  1BT5 A;  3WS2 A;  4JLF A;  4KZ8 A;  3KSG A;  3QP6 A;  4BQM A;  4BBU A;  1TS7 A;  4KQQ A;  2P9V A;  1Z6F A;  3NCK A;  2E8J A;  3T1R A;  1NWZ A;  4G3K A;  3UPP A;  2D02 A;  4NKP A;  3W8K A;  3G2Z A;  2ZM0 A;  1TDG A;  1K38 A;  1HLU P;  5FAT A;  5K5B A;  1OJ5 A;  4Y0T A;  3BEB A;  2VA0 A;  4GS9 A;  5HSQ A;  3FC7 A;  2Q0O A;  1FR1 A;  5EV0 A;  3C7U A;  1P97 A;  1AXB A;  1BSG A;  3Q7V A;  3UMD A;  4BL2 A;  5KSH A;  1SDN A;  1OTI A;  1K54 C;  1YKD A;  2ZLY A;  3G4P A;  3MFX A;  4O0P A;  3IS2 A;  5DJU A;  3OCN A;  3IH8 A;  4PM7 A;  5CEC A;  3V67 A;  3TRC A;  5DJT A;  1TDL A;  2JCH A;  2V8C A;  4LRZ E;  3PTE A;  5A90 A;  4JBF A;  2X71 A;  3LR3 A;  2VLG A;  3T4Q A;  1L0G A;  4JXG A;  4U0X A;  3IXH A;  3MS6 A;  5IS1 A;  3EGX C;  4NXB A;  1A0K A;  1GHM A;  1K4E A;  2XFT A;  2NUT C;  2M7V A;  1GSV A;  1NZO A;  1WA9 A;  2V1Z A;  1CK3 A;  2ZC3 B;  3VE3 A;  3DW0 A;  2W3D A;  2HP5 A;  3WS0 A;  1SZV A;  4R38 A;  3GSG A; 
#chains in the Genus database with same CATH homology
 4EEP A;  2O99 A;  1ODV A;  4G3W A;  3PBQ A;  4Q0H A;  1D06 A;  1EW0 A;  2HGV A;  3T4S A;  1XJ3 A;  4P6Z M;  3D72 A;  1MZU A;  5DKK A;  3RFB A;  1VB6 A;  3A0V A;  3C38 A;  3NHQ A;  1T18 A;  1N9O A;  3S7O A;  5CX7 A;  3PBT A;  4Y3I A;  5A8B A;  3B42 A;  3LUQ A;  2H28 A;  5HDS A;  4ZRR A;  2OOL A;  5J7E A;  4I39 A;  2CMN A;  3E4P A;  4B9O A;  4DN0 A;  2IA2 A;  2R78 A;  3EEA A;  4ME4 A;  4Q0J A;  3H82 A;  5MC7 A;  1T1A A;  2W1T B;  5DF9 A;  1TS0 A;  2OAQ 1;  1W63 Q;  4H6J A;  3K3C A;  2PT7 A;  3EOI A;  4AFI A;  1NLZ A;  4Y2F A;  5HD3 A;  1P9W A;  4M4X A;  1LSV A;  3LIE A;  2EWV A;  3HCY A;  4JGR A;  4OOL A;  3T4L A;  2LB9 A;  4EER A;  3LIB A;  4BBT A;  4XT2 B;  3T4J A;  4I3J A;  1XJ6 A;  1F5M A;  5AVF A;  4I3I A;  2VV6 A;  2Y8H A;  3UB8 A;  3NOT C;  4L9G A;  5TBM A;  1P9R A;  4F3L A;  1OPX A;  3CIT A;  3ICY A;  2GNX A;  4UQI M;  3MXQ A;  4Q0I A;  4GJ4 A;  4WEJ A;  3OBF A;  3LYX A;  4GLQ A;  3FPV A;  4HI4 A;  2O9C A;  2J3T D;  1X0O A;  3BWL A;  1N9L A;  2KDK A;  3C2W A;  4LRX C;  4EEU A;  2GZA A;  3K2N A;  1V9Z A;  2A24 A;  2W3E A;  3F1N B;  3KX0 X;  5TJJ A;  4EQ1 A;  2OAP 1;  3CUE A;  4MDZ A;  1G6O A;  4CLC A;  4L9E A;  4K08 A;  1G28 A;  2W3F A;  3PBR A;  4HJ3 A;  4KUO A;  4HOI A;  2KOI A;  1DP9 A;  2MJ6 A;  2EA9 A;  3UME A;  5L8M A;  1S4S A;  3F1P A;  2XA7 S;  4B93 A;  1OTB A;  2P7J A;  1LSX A;  2O0Y A;  3OLO A;  5HWT A;  5HPF A;  4Z1W A;  2QHK A;  2PHY A;  2JN7 A;  4PHT A;  1BYW A;  1TS6 A;  3PBN A;  2Z6C A;  3P01 A;  4WL9 A;  4DMZ A;  3H7W A;  4QPR A;  3B33 A;  5HDD A;  3MR0 A;  4GS9 B;  3E98 A;  1TD5 A;  5IT5 A;  3CUE C;  3OC2 A;  3IBJ A;  4O01 A;  4BBV A;  4CLC C;  4CLC D;  2W1R A;  4EES A;  4NEE D;  2KX6 A;  4E04 A;  1LT0 A;  4PKY A;  4DJ2 A;  1YSP A;  3UB6 A;  2L4R A;  3BY8 A;  4NXF A;  3S7N A;  3SW1 A;  5DFX A;  3IS2 B;  3GEC A;  4LPZ A;  1N9N A;  1ZHH B;  4L0L A;  3R7W B;  2O9B A;  3PXP A;  2W3G A;  4ETX A;  3LIF A;  2XRO A;  3HJK A;  3LR5 A;  3PR6 A;  2K7S A;  2VKS A;  4FOF A;  1VHM A;  4I5S A;  2V0U A;  3S7Q A;  4YWZ A;  3MQO A;  3KSI A;  5J4E A;  3OOV A;  1GSW A;  4NXE A;  2VGL S;  3FPW A;  1T19 A;  2I9V A;  3F1O B;  3MQ0 A;  3UE3 A;  3ZQ5 A;  1OTE A;  2WKR A;  2KLI A;  2L0W A;  4WUJ A;  2QYB A;  1UWP X;  2V1A A;  2QJ5 A;  2WKP A;  1ZTU A;  3TE8 A;  4EXO A;  2K31 A;  4WEL A;  5HD5 A;  2V1B A;  4L9F A;  2BAS A;  3JVV A;  3CLO A;  2A2L A;  4I3A A;  1S1Z A;  2W3H A;  4KQO A;  2V0W A;  2ZMF A;  4CQH A;  4LLO B;  1XJ4 A;  2P08 A;  2HJE A;  4CLC E;  5AVE A;  1W63 M;  4MMN A;  3RH8 B;  1IFQ A;  3PHY A;  4HHD A;  4JGQ A;  5G4Z A;  4IHQ A;  1H3Q A;  4ARZ B;  3EWK A;  4EET B;  1NLY A;  3MJQ A;  2PD7 A;  2V9A A;  4KUK A;  4BMW A;  3T4K A;  4GW9 A;  1OT6 A;  1OJG A;  4RQ9 A;  4PAU A;  3UE6 A;  2JKT I;  1IOU A;  3LIC A;  4GHI A;  5IU1 A;  3UB9 A;  3JVU A;  4ETZ A;  4DJ3 A;  3E4O A;  3G6O A;  4IUH A;  1DP8 A;  3PYP A;  2OWJ A;  2XA7 M;  4BWI A;  4MN5 A;  3HJI A;  3CAX A;  4IUK A;  3EGD C;  3NOP C;  3VV4 A;  2L1M A;  3GDI A;  4FSF A;  5EFW A;  5FL3 A;  1NRJ A;  1OTD A;  2PYR A;  3A0S A;  4WLA A;  5DKL A;  3K3D A;  3H82 B;  4HIA A;  2P04 A;  3DBA A;  5HL6 A;  3LIA A;  4Y5F A;  3BY9 A;  2VV7 A;  2JKR I;  4H6J B;  3C30 A;  1JNU A;  1S4R A;  1DRM A;  2VEA A;  2K2N A;  1XJ2 A;  4JGO A;  4KQD A;  2INW A;  3C8C A;  2JKT M;  3PBO A;  1S66 L;  3NJA A;  3BJN A;  3B47 A;  3BQA A;  1T1B A;  4EUV A;  3MMH A;  3U2A A;  2D01 A;  5HPI A;  4HP4 A;  2W1T A;  1YSQ A;  3EQU A;  2YKH A;  4WF0 A;  1D7E A;  3E0Y A;  2VV8 A;  4BJP A;  4HJ4 A;  3W2Z A;  5TBM B;  2NUP C;  5F6A A;  2J3W A;  1H8M A;  4F3L B;  5G4Y A;  1F98 A;  3T4O A;  2B02 A;  4JGP A;  2JKR M;  2VGL M;  3LI9 A;  4MN6 A;  2W0N A;  3OCL A;  2HJ9 C;  4G3V A;  3S7P A;  2QKP A;  5F68 A;  3EEH A;  1T1C A;  3LR4 A;  4UEY A;  4I38 A;  4XT2 A;  3LI8 A;  2GX5 A;  2Z6D A;  1XFN A;  3KSF A;  3KYZ A;  3LR0 A;  2HF6 A;  3LFV A;  2A24 B;  2ZOH A;  5HZH A;  1Y28 A;  5KIZ A;  2Y79 A;  3LID A;  1XFQ A;  3BQ8 A;  1P0Z A;  4WN5 A;  2W27 A;  1LSW A;  3CWF A;  4R70 A;  2GJ3 A;  4CLC B;  4OOM A;  2EWW A;  4PKY G;  3F1P B;  4II7 A;  5C5K A;  2FZ0 A;  2LB5 A;  3KSG A;  3P7N A;  1UGU A;  4BBU A;  1TS7 A;  3F1N A;  2ZOI A;  2G7U A;  4HP9 A;  2M1C A;  2VX8 A;  4P6Z S;  4MCW A;  2QJ7 A;  3H7W B;  3H9W A;  1UWN X;  1NWZ A;  1F9I A;  1MC0 A;  4G3K A;  1KOU A;  3IBR A;  3TJZ C;  2D02 A;  4NKP A;  3ZYT A;  2ZMV A;  5AJG A;  3KO6 A;  2PR6 A;  3T4T A;  5K5B A;  1S67 L;  1OJ5 A;  4IJG A;  5DFY A;  1TF1 A;  1MKM A;  2VA0 A;  4GS9 A;  5HSQ A;  3FC7 A;  2QWS A;  4WEK A;  5J3W A;  3D3O A;  2FH5 A;  1P97 A;  3CI6 A;  2OWH A;  3MF0 A;  3EQV A;  5KSH A;  2XSS A;  3UMD A;  4HH3 A;  2J80 A;  5LBR A;  4MN7 A;  1YAX A;  3VOL A;  1V9Y A;  1OTI A;  1YKD A;  4LRY C;  4NXG A;  3MFX A;  3T50 A;  4YNR A;  3NOU C;  2VZW A;  4O0P A;  5HDC A;  3IS2 A;  5DJU A;  3OCN A;  2J3T C;  2PYP A;  4HH2 A;  4R6L A;  2B18 A;  2M7U A;  4R3A A;  2JHE A;  3A0R A;  3R7W A;  3KSH A;  3TRC A;  3V67 A;  5F69 A;  4EU0 A;  4GCZ A;  4HNB A;  5DJT A;  3R4K A;  3ULF A;  4LRZ E;  2DMW A;  4UQI S;  3LR3 A;  2PR5 A;  2VLG A;  3T4Q A;  4EW7 A;  3F1O A;  1DP6 A;  3PBS A;  1GSX A;  2HV1 A;  4YOF A;  3RTY A;  4O8G A;  3BW6 A;  1LL8 A;  4HQA A;  5I5L A;  1STZ A;  2ZBB A;  5HWW A;  5IS1 A;  3EGX C;  4NXB A;  1OTA A;  3TW8 A;  2VJW A;  4GHI B;  2PDR A;  2PD8 A;  3O5Y A;  5HWV A;  2NUT C;  1S1Y A;  2M7V A;  3E4Q A;  1GSV A;  3FG8 A;  3KYQ A;  1WA9 A;  3VE3 A;  3VE4 A;  4HY8 A;  1OT9 A;  3MQQ A;  2O9A A;  2W3D A;  1TS8 A;  4ARZ A;  4HJ6 A;  4R38 A;  2YKF A;  3UB7 A;  2XRN A;  5F5Y A;  2WKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...