4UA6A

Ctx-m-14 class a beta-lactamase apo crystal structure at 0.79 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
b'ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua6A00
4WZ5C 3HLWA 3RXXA 4CPKA 4BQMA 2PU2A 3NBLA 5J8XA 1W79A 3G34A 3BYDA 1K54A 2V2FF 1GA9A 5CHMA 5DTSA 2ZC5B 3GQZA 4U0XA 4E3LA 3WS1A 3WS2A 2XLNA 4BL2A 3PAEA 1BULA 1MWSA 1NJ4A 3ZVWA 3FV7A 2Y2GA 1JWPA 3EQVA 2XH9A 4R4RA 3V39A 1ES3A 4RYEA 3PBSA 3Q81A 4DDSA 1K25A 4QHCA 4S2IA 5E2GA 4YFMA 2X02A 1E3UA 3GTCA 1PIOA 1XPBA 5EVIC 1H8YA 3HUMA 4GD6A 1S6RA 1MPLA 2G2UA 1KGEA 4LCLA 3OCLA 3UE3A 3LY4A 1NZUA 5CGWA 3HLGA 4OKPA 1K6SA 5GLBA 4FSFA 2Y2JA 4GDNA 4P85A 3VP4A 5G18A 4HEFA 4P87A 5F83A 1G68A 3TSGA 3UDXA 2DRWA 1M6KA 3GV9A 3O86A 5AQBA 4OH0A 1FQGA 1IELA 4DE1A 4JF6A 3G4PA 3IF6C 3NDEA 2WKIA 4OQ0A 4PM9A 3UY6A 1S0WA 5DTTA 3M6HA 2WAEA 2H10A 4OQIA 4ZTKA 1XXMA 2ZQAA 4Q8IA 3CG5A 1YQSA 2J7VA 3HLCA 5GHYA 2Y4AA 1E3UD 5E43A 3BFCA 4MLLA 4E6WA 3BFEA 1YMSA 4LV0A 3PBOA 5FQQA 3NDGA 3WWXA 3WRZA 4N1XA 3MZDA 3IT9A 1M40A 2FFFB 5FAPA 5HAPA 5CGSA 1KGFA 1U60A 4WZ5A 4S2LA 3VOZA 5HARA 1RP5A 5EE8A 4BL3A 4WELA 2JC7A 1TDLA 1PYYA 2PBYA 2VGJA 3MKEA 3PBRA 5EOEA 2Y2NA 4S2JA 4Y0OA 4R23A 4S2NC 4Y0UA 3B3XA 3QHYA 4M3KA 4E3JA 2BG1A 1DY6A 1JWZA 5HAIA 5CEDA 5IHVA 3ZDJA 2ZQ8A 1XGJA 2EX8A 4N9KA 4K0XA 4PM6A 1ES2A 4Z9QA 2E8IA 4DXCA 4OPRA 3GSGA 4OOMA 2A49A 2J8YA 2VGKA 2Q9MA 4WEJA 1PW1A 3ZG5A 1K56A 3HLBA 3VOYA 3G2YA 2IWCA 5L2FA 1MBLA 4EBNA 2WAFA 3LY3A 5TR7A 3CJMA 2ZQ7A 2WADA 3ZG8B 4KZBA 4DRTA 3ITBA 3FKVA 3IHBA 2R9WA 5I94A 4K91A 3M2KA 3SH9A 3E2LA 5E2HA 2H0YA 3RJUA 1LI0A 3IWOA 3V50A 3G2ZA 1HZOA 3ZNTA 1NYYA 5A90A 4EBPA 4B4ZA 4D2OA 4DF6A 5HAQA 1MWRA 4PM8A 1WYCA 2WYXA 1PWGA 2C5WB 2H0TA 4ZJ1A 1PZOA 4S2PA 3WS4A 4XUZA 1CI8A 5GLCA 2EXAA 1KVMA 2HP9A 5DTKA 4EV4A 5FASA 1KDWA 2JBFA 4LV1A 2Y2LA 3LCEA 3OZHA 1MXOA 3D4FA 1W8YA 2ZMAA 3VFFA 1K56D 3BFGA 4E3OA 3OPRA 1MWTA 4OPZA 3C5AA 3BFDA 4DE2A 5E2FA 1Y54A 1JTGA 3BEBA 3DW0A 5FAOA 5F1GA 3SS5A 1IYOA 3E2KA 3O87A 4ID4A 4S2KA 1H8ZA 4X56A 4LV3A 5AQ7A 4BLMA 3S1YA 1GHPA 4JXVA 2CC1A 2FFYA 3VP3A 1NRFA 2WGWA 5CXWA 3DWZA 3HLFA 2EFXA 1YLYA 2WGIA 4MEZA 1YLPA 3O88A 4OLDA 3G31A 2ZLYA 5E2EA 3ZG0A 2WGWB 3ITAA 1ES4A 1K4EA 4OP5A 4OPQA 5CGXA 3FZCA 1LL5A 1NZOA 4UA7A 1PI5A 4X69A 3HREA 4BJPA 2Y91A 3N8LA 4JXGA 4LENA 2X01A 3UPNA 3HL9A 1TVFA 5CHUA 3FWLA 4Y7PA 1NYMA 5FA7A 3TOIA 5GHZA 2EX9A 2HDQA 4JKTA 1W7FA 2OLVA 4E3IA 5EUAA 3IXHA 2EXBA 1CI9A 1J9MA 2OSUA 4UA6A 5CTNA 5HL1A 2PU4A 3NC8A 3VP2A 3UPOA 4WBGA 3GRJA 5DF7A 2WKEA 1W8QA 3ZHHA 2P9VA 1TEMA 1PW8A 3N7WA 5CERA 2P74A 1LL9A 2Y2KA 4HESA 1K57C 4JBFA 4KG2A 4ZBEA 1IKGA 5A93A 3V3SA 4DXBA 4JF5A 5M1AA 3N8SA 2ZD8A 3OPHA 5EVLA 1SCWA 2QMIA 3MZEA 5TFQA 1YLZA 3BECA 4HBTA 3HVFA 1KE3A 2IWDA 4C3QA 3G32A 1CEFA 1ZG4A 5AQ9A 4GKUA 4FH4A 3CMZA 2XD1A 2XQZA 1OMEA 4IBXA 2ZC3B 2BLSA 4R1GA 5FAQA 4MBHA 4EBLA 2Y2MA 1CK3A 1PWCA 4QY6A 4BD1A 1KDSA 1L0DA 3MBZA 4HBUA 3G30A 3Q07A 4U3TA 4ZJ3A 2OV5A 1N4OA 5KSCA 3QNCA 2J9PA 4KZ7A 5KZHA 1MY8A 1ES5A 4RVAA 3BLMA 4EQIA 2ZC7A 5GLAA 1FSYA 4N92A 3W4QA 5FQMA 3PAGA 5HW3A 1BSGA 5FQJA 1EROA 3P98A 2ZJ9A 1RGYA 1K6RA 3C7UA 3W4PA 1LLBA 1Z6FA 3HLDA 2JE5A 1SDNA 1GCEA 4IVIA 4XUXA 3TG9A 3AGEA 1K54C 3IWIA 4OOYA 4PMAA 2XGNA 1LI9A 2JCHA 4UA9A 4QU3A 3IXGA 1BLPA 3WS0A 4KENB 4R3BA 3UDFA 3LEZA 3UE1A 2HP6A 3Q7ZA 1PZPA 5CTMA 4KQOA 2ZM0A 3LO7A 5FSRA 1GHMA 1JVJA 3M6BA 1IKIA 3VP0A 5EVIA 3ISGA 4QB8A 2H5SA 1E4DA 3PBTA 1FCOA 3C4OA 4O7DA 4JF4A 4IEDA 2DCFA 3SOIA 5JYOA 3IWQA 2XEPA 4X68A 5EVIB 2HDSA 1W5DA 2A3UA 1BUEA 4NETA 5AQAA 5EPHA 1ZG6A 4IBRA 1K38A 3VP1A 3N6IA 2XFSA 3BM6A 1YMXA 2ZM8A 4NK3A 3BLSA 1I2SA 5DVAA 4JXSA 4KZAA 1K57A 2WUQA 3IF6A 3PTEA 4R4SA 2HDUA 4GDBA 2R9XA 4YINA 4E3MA 3MFDA 3SH8A 3A3IA 4PM5A 3WRTA 2RCXA 5U47A 3IF6B 4OLGA 1N9BA 2ZQCA 5FI6A 2WKHA 4P0MA 3QNBA 4RA7A 4GOGA 2WGVA 2Y2HA 5EVID 2Y59A 3WS5A 1YLWA 4GD8A 3RXWA 2V1ZA 4R0QA 4JLFA 3IXDA 4BENA 1IYPA 4KQRA 4RX3A 5GL9A 3HLEA 3G35A 1O07A 5TGFA 1EWZA 3O3VA 1XGIA 2XF3A 3GVBA 4WMCA 1QMEA 1K55C 1KVLA 3MXRA 5A91A 1WYBA 1ALQA 1E25A 4XXRA 3A3DA 3M2JA 2J9OA 4MBKA 4UHUA 4ZAMA 4KZ9A 1Q2QA 1XP4A 2WZZA 1DJAA 1GA0A 4S2NA 1KE0A 4DDYA 3GMWA 3UNWA 3W4OA 2ZC4B 3FKWA 3FYZA 4OP8A 2EFUA 4GZBA 3W8KA 5EOOA 3A3EA 5KSHA 4KZ8A 4PPRA 1YLJA 4KZ4A 2Y55A 2Z2LB 3UDIA 3EQUA 2Y2IA 2WZXA 2Y2PA 1BT5A 3CZDA 4DKIA 5CECA 2WK0A 1L0FA 1GHIA 1VQQA 1JTDA 1ONHA 4FCFA 5FQKA 2UWXA 2DNSA 3UO9A 3Q82A 3NY4A 1ONGA 2I72A 1HD8A 3NCKA 4EUZA 3NI9A 4L0LA 4WMCD 4RX2A 2QPNA 4P6BA 3PBQA 3Q1FA 2P9VB 4GB7A 1EI5A 1QMFA 1BLCA 1ESIA 1XA1A 3UPPA 3OCNA 1MWUA 4KG6A 4LCMA 5GHXA 5FI7A 1LHYA 3A3JA 4PM7A 4C6YA 4B4XA 1I2WA 2ZC6B 5M19A 3AGDA 3IF5A 3P09A 4S2MA 4X6TA 2IWBA 1PI4A 2V20A 4E3KA 1I5QA 4OQHA 4OQGA 1HVBA 1L2SA 1FSWA 1YLTA 3IXBA 4KZ5A 3BFFA 1WE4A 1O7EA 3ZNYA 3ZFZA 3S4XA 2X71A 1FR6A 3OC2A 5CHJA 1YM1A 4IVKA 1IEMA 1AXBA 1FOFA 3VSLA 4A5RA 4E3NA 1IYSA 3V5MA 4UAAA 5F82A 4LV2A 1FR1A 1MKIA 1NY0A 4N9LA 4DE3A 3A3FA 3DTMA 5HFOA 3DWKA 4KG5A 1DJBA 3MZFA 5JYPA 4K0WA 4X53A 1VM1A 3C7VA 4OPYA 5FATA 5FQ9A 4KZ3A 2C6WB 2GDNA 1PWDA 3PBNA 5CRFA 4U0TA 3C4PA 1YT4A 3SS3A 1K55A 3MKFA 4FH2A 2RL3A 2HDRA 1BTLA 4QJGA 3JYIA 4WYYA 2XD5A 5FI2A 3UN7A 5DF9A 3ZCZA 1ZC2A 1L0GA 1XKZA 4C75A 4OONA 2Y2QA 5DF8A 1RGZA 4S2OA 4E6XA 3IH9A 5EECA 1C3BA 4DE0A 1FCMA 1CEGA 1XX2A 5KMWA 2Y2OA 5D3OA 4JPMA 4ZDXA 4Y0TA 3ZG9B 1ERMA 1TDGA 2ZM2A 3AGFA 1IYQA 4B88A 3IH8A 3VFHA 2Z2MB 1G6AA 5GLDA 5FQIA 4OVDA 1SDEA 2XDMA 3ZG7B 1ERQA 3SS4A 5CEBA 3MXSA 3OPPA 2G2WA 3S22A 1FCNA 1Q2PA 1BZAA 3IQAA 5A92A 5BOHA 1SKFA 2ZQDA 1H5XA 4WEKA 4EWFA 5M18A 3VMAA 4OOLA 4FD8A 1HTZA 2XR0A 4WZ4A 3IHAA 2HP5A 3BRMA 3ZGAB 1ESUA 4MBFA 3V3RA 2ZQ9A 3N8RA 1L0EA 3HUNA 3GR2A 4QY5A 3SH7A 1NXYA 1JWVA 3OPLA 3Q7VA 4JXWA 4QD4A 4CJNA 4H8RA 4BD0A 2EX6A 3HUOA 1DJCA 1SHVA 3I7JA 1KE4A 1ZKJA 4KZ6A 4KQQA 1XA7A 3VSKA 3Q7VB 2XFTA 3UE0A 3HBRA 3N4IA 4MNRA 4F94A 2QZ6A 1K4FA 2EX2A 5HX9A 4WM9A 3NIAA 4GNUA 4N1HA 1BLSA 2OLUA 4X55A 5F1FA 1BLHA 2HPBA 4R3JA 2Q9NA 1RCJA 5FDHA 1KGGA 3ZVTA 4ZJ2A 4GN2A 2XK1A 2B5RA
chains in the Genus database with same CATH superfamily
3VV4A 2W1RA 5CHMA 3GQZA 4U0XA 1P97A 4BL2A 1BULA 5HZHA 3ZVWA 3E4QA 2GX5A 3V39A 4G3VA 1ES3A 4RYEA 1K25A 4S2IA 3T1QB 1LT0A 2VX8A 1H8YA 3SW1A 4GD6A 1S6RA 4HY8A 3R7WB 3OCLA 5CGWA 5GLBA 1K6SA 2V1BA 2PT7A 1YPRA 3DAVA 3E4PA 2DRWA 4LFUA 3S7OA 3O86A 5AQBA 2M7VA 5K5BA 4DE1A 3T4SA 3IF6C 4OQ0A 2PDRA 4PM9A 4CLCE 5DTTA 2HJEA 4ZTKA 1OTIA 1XXMA 2ZMVA 2J7VA 5GHYA 2PYPA 3LR0A 4LV0A 3A0VA 2MJ6A 4N1XA 5HAPA 4G3WA 1U60A 1SKOA 4S2LA 2JHEA 3C38A 1RP5A 4BL3A 3PBRA 1PYYA 2PBYA 5EOEA 2W27A 3O5YA 4S2NC 2K31A 1JWZA 5IHVA 2ZL1A 1XGJA 2EX8A 5TBMB 4EUVA 4LGWA 2Y79A 2VGKA 2IWCA 3IS2A 4I38A 2Q0OA 3ITBA 3EEHA 3FKVA 3IHBA 5I94A 3M2KA 3SH9A 4BBTA 4HJ4A 3G2ZA 1NYYA 1UGUA 4B4ZA 1MWRA 5HWTA 2C5WB 2H0TA 4XT2A 1PZOA 3WS4A 1D06A 2HP9A 5FASA 1XJ3A 1W8YA 2ZMAA 5J3WA 3BFDA 1Y54A 1JTGA 3SS5A 4S2KA 4X56A 1GHPA 4QPRA 4JXVA 2CC1A 2FFYA 1NRFA 3HLFA 3ZG0A 5E2EA 2WGWB 4DJ3A 1OTDA 5HL6A 2O9AA 3FZCA 1LL5A 4BJPA 4X69A 1PI5A 3HREA 5MC7A 3FWLA 1NYMA 1UWNX 4JKTA 2OLVA 3MFXA 1J9MA 5CTNA 3NC8A 3GRJA 1W8QA 3ZHHA 2P74A 5A93A 3QP6A 5EVLA 1SCWA 4HBTA 2HV1A 4O0PA 4C3QA 2YKFA 3JVVA 3HCYA 4R3AA 2ZC3B 4MBHA 4FUWA 1VB6A 4LLOB 3MBZA 3G30A 4ZJ3A 1T18A 3DBAA 3QNCA 4H6JA 5DJUA 3W4QA 5FQMA 3PAGA 1BSGA 5FQJA 4BWIA 4YNRA 3LR5A 4HH2A 1K6RA 3C7UA 1SKOB 1Z6FA 2JE5A 4HHDA 5L07A 1V9YA 1K54C 2EA9A 2XGNA 1OPXA 4EEUA 3WS0A 4KENB 2ZL1B 2D02A 3D9YA 2K7SA 4KQOA 5FSRA 1GSXA 2H28A 3ISGA 1F5MA 3IS2B 3R4KA 1BUEA 3FPWA 5EPHA 1ZG6A 4IBRA 1K38A 4NXEA 3QP5A 3N6IA 5TJJA 2XFSA 3BM6A 3BLSA 5DVAA 4JXSA 5I5LA 2WUQA 4R4SA 5DFXA 4F3LA 1YSPA 4E3MA 4PM5A 3WRTA 2RCXA 3IF6B 3NOUC 3QNBA 4RA7A 4GOGA 1YLWA 2M1CA 4L9GA 4JLFA 2W3FA 2VGLM 4II7A 2JKRI 1EWZA 3O3VA 3GVBA 1WYBA 4Y2FA 4GS9B 4XXRA 4MDZA 2J9OA 4ZAMA 4K08A 4KZ9A 2QKPA 1XP4A 2WZZA 1KE0A 4DDYA 1OTBA 3W8KA 5AJGA 3MF0A 2M7UA 4PPRA 1YLJA 4KZ4A 2Y55A 2Z2LB 3T4JA 3MQOA 3UDIA 3JVUA 3RFBA 2WK0A 3UB7A 3NCKA 1STZA 3PBQA 3PR6A 1EI5A 3UB5P 1MWUA 4LCMA 5GHXA 2L0WA 5FI7A 1V9ZA 3LI9A 2ZC6B 1NWZA 4Y3IA 5HWWA 4LRXC 1L2SA 4KZ5A 4NEED 2PYRA 2X71A 1FR6A 1FOFA 2ZOIA 3EGDC 2W0NA 1XJ4A 1NY0A 3F1NB 3DTMA 1YAXA 4DE3A 5HFOA 1DJBA 4K0WA 2JN7A 3P7NA 4PHTA 1AWIA 1J3WA 2GDNA 5CRFA 4GJ4A 2RL3A 1BTLA 3LICA 4WYYA 3UN7A 5DF9A 1L0GA 1NLZA 4E6XA 3IH9A 1PFLA 1F9IA 1CEGA 2WKQA 3ZG9B 1TDGA 3T1SA 2Z2MB 3A0RA 5FQIA 2XDMA 2GZAA 1N9LA 4JGQA 1S1YA 3MXSA 2G2WA 1OTAA 3NHQA 3VMAA 4FD8A 4WZ4A 2OOLA 1H8MA 1DP9A 1ESUA 3CPTA 4EXOA 4F3LB 3F1OA 3HUOA 1DJCA 2KOIA 2OAQ1 3Q7VB 2XFTA 4MNRA 1K4FA 4E04A 3TRCA 3LIDA 3NIAA 1BLSA 3KYZA 2OLUA 3S7QA 1FILA 4ETXA 1ACFA 5FDHA 3ZVTA 4ZJ2A 4WZ5C 4WN5A 4BQMA 3NBLA 2VEAA 3G34A 3BYDA 2V2FF 5DTSA 1KOUA 3RH8B 3CI6A 3WS2A 2XLNA 2W3GA 1TS8A 3D3OA 3Q81A 4DDSA 2OAP1 4YFMA 3C2WA 5EVIC 3LIFA 3BWLA 2JKTI 1UWPX 2QJ5A 5G18A 1GSWA 4P87A 1G68A 3UDXA 3C8CA 1M6KA 3G4PA 4FOFA 3D72A 3NDEA 2D01A 3UY6A 1S0WA 1CJFA 3VE4A 4Q8IA 1YQSA 4QWOA 1IOUA 3BFCA 4E6WA 2HJ9C 3B42A 2UV0E 4LPZA 4IJGA 5DJTA 5FAPA 1S4SA 4WZ5A 1TDLA 2VGJA 5L09A 2Y2NA 4S2JA 2QJ7A 4Y0OA 3HJIA 5TBMA 4E3JA 1Y28A 4UQIS 3B33A 4DXCA 4OPRA 3GSGA 4OOMA 2A49A 2Q9MA 4WEJA 1PW1A 3MSHA 3HLBA 1XJ6A 5L2FA 4X25A 2WAFA 3LY3A 5TR7A 3CJMA 2WADA 2PBDP 3S7PA 4K91A 3RJUA 2H0YA 3CPTB 3BJNA 4D2OA 4DF6A 5DKKA 1WYCA 1OJ5A 4XUZA 5GLCA 1KVMA 2O99A 4EV4A 4I3IA 2Y2LA 2W3EA 3LCEA 1MXOA 4E3OA 3BEBA 3T4QA 1IYOA 3O87A 4ID4A 5AQ7A 3F1PA 1P0ZA 3PHYA 4IHQA 2WGWA 5CXWA 2PR5A 4MN6A 2IA2A 3G31A 1HLUP 1OJGA 1K4EA 5CGXA 4UA7A 3UPOA 2V8CA 3HL9A 3PYPA 4BBUA 5FA7A 3TOIA 1W7FA 5EUAA 1CI9A 2OSUA 4UA6A 3LEQA 3KSGA 3VP2A 1VEUA 4CLCC 1TEMA 3N7WA 4KG2A 4HESA 1K57C 4ZBEA 4DXBA 3OPHA 5L8MA 3BECA 3T4KA 2EWWA 3PXPA 4GKUA 3CMZA 2XQZA 1OMEA 4IBXA 1D1JA 4Q0JA 4BD1A 1KDSA 1L0DA 2WKPA 1ZHHB 2W1TA 3LYXA 2J9PA 4KUOA 4RVAA 4EQIA 4HIAA 4N92A 1EROA 3W4PA 3VE3A 3HLDA 4XUXA 3TG9A 4PKYA 3E4OA 3T1XA 4R3BA 2HP6A 3Q7ZA 3LI8A 2HGVA 3LO7A 3NOTC 1JVJA 1IKIA 3H7WB 5A8BA 4L9FA 1FCOA 3C4OA 4JF4A 5JYOA 3IWQA 5EVIB 4CLCA 3OLOA 1I2SA 1K57A 3IBRA 3UE6A 3IF6A 3PTEA 4YINA 5HD5A 4Y17A 5U47A 2Y2HA 2V1ZA 3NJAA 3KSIA 4BENA 4RX3A 4MN5A 5GL9A 2W3DA 4GS9A 3SZTA 4WMCA 4WLAA 1K55C 3F1PB 4CLCD 4IUKA 3M2JA 1Q2QA 4CQHA 1DJAA 4S2NA 2JKRM 3UNWA 3FKWA 4OP8A 2EFUA 4I3AA 1VHMA 3EQUA 4FTXA 2Y2IA 1BT5A 3CZDA 1L0FA 1GHIA 5G4YA 1JTDA 1K0KA 5FQKA 2DNSA 3UO9A 1ONGA 4NXBA 2YKHA 5EFWA 3NI9A 2ZOHA 4WMCD 2QPNA 1YKDA 1VEUB 3U2AA 4GB7A 1QMFA 5DKLA 1ESIA 5FDSA 1LHYA 4C6YA 2HZ5A 5M19A 3IF5A 4S2MA 4X6TA 4E3KA 1PI4A 2V20A 3T4TA 1FSWA 3ZYTA 1LSWA 1WE4A 3B47A 2B95A 1O7EA 3ZNYA 3F1NA 3S4XA 5CHJA 1YM1A 3VSLA 1AXBA 4I5SA 1LSVA 4UAAA 4Y5FA 3A3FA 2I9VA 2W1TB 2GNXA 5HDCA 3MZFA 1PRQA 2Y8HA 5FATA 1PWDA 3SS3A 3C4PA 1YT4A 1K55A 3UB8A 1BYWA 2HDRA 1FIKA 5KIZA 4QJGA 2XD5A 5FI2A 3DTIA 1XKZA 4C75A 2Y2QA 4S2OA 1C3BA 4DE0A 1FCMA 5KMWA 4Y0TA 3QP8A 3IH8A 4ME4A 5GLDA 4O8GA 1OTEA 2KDKA 5L10A 2PD7A 5BOHA 1SKFA 4OOLA 2XR0A 4CLCB 3E98A 4MBFA 3HUNA 3GR2A 3KX0X 2VK3A 3QP4A 2QHKA 3Q7VA 4JXWA 4H8RA 3FG8A 2V1AA 3K3CA 1EW0A 1KE4A 1ZKJA 4KZ6A 4KQQA 3VSKA 3UE0A 3HBRA 4YOFA 3T50A 3FC7A 4GNUA 4X55A 4EW7A 2HPBA 1KGGA 1T1CA 4CPKA 2VA0A 1TS6A 1K54A 1GA9A 2ZC5B 3BY9A 3WS1A 2J80A 3H9WA 2G7UA 1MWSA 1NJ4A 2Y2GA 1JWPA 3NOPC 3IBJA 2QYBA 2L1MA 2O0YA 2X02A 5IS1A 1PIOA 4HI4A 1XPBA 1MPLA 2G2UA 1KGEA 3BY8A 1TS0A 3LY4A 4GDNA 4HEFA 3BQ8A 4P6ZS 4GCZA 4OH0A 1FQGA 2JKTM 2WKIA 3MQQA 3UMEA 2XROA 3M6HA 4OQIA 2H10A 3CG5A 2Y4AA 5E43A 4HP4A 4MLLA 3ZQ5A 5EM0A 4KUKA 1GSVA 3PBOA 5FQQA 3K3DA 3WWXA 3EOIA 1M40A 3CUEC 4MMNA 1KGFA 4ARZB 2INWA 3VOZA 4GHIB 4WELA 1S4RA 3MKEA 4JGRA 5C5KA 4R23A 4Y0UA 3B3XA 1DY6A 5CEDA 4N9KA 4PM6A 1ES2A 1X0OA 3KSFA 2J8YA 4EERA 3ZG5A 3G2YA 1MBLA 4EBNA 3ZG8B 4DRTA 1N9OA 5E2HA 3IWOA 1G5UA 3ZNTA 4EBPA 4PKYG 4YWZA 2WYXA 3LUQA 2NUPC 4S2PA 1TF1A 2EXAA 3IX8A 4JGOA 2ACGA 4LV1A 4HH3A 3NULA 3VFFA 1PNEA 3BFGA 3DTEA 3OPRA 1MWTA 4OPZA 2O9CA 4DE2A 5E2FA 3E2KA 3EGXC 5IT5A 3LR4A 1H8ZA 3T1RA 3VP3A 3CUEA 3MJQA 2EFXA 1YLYA 2OWHA 4MEZA 1YLPA 3O88A 4PAUA 2XA7S 1ES4A 4OP5A 1NZOA 4LENA 4JXGA 5CHUA 5EM1A 5GHZA 2HDQA 4E3IA 2EXBA 4WF0A 2JKFA 1OT6A 4LRYC 2PU4A 3UMDA 5DF7A 2WKEA 5CERA 4JBFA 1IKGA 3V3SA 4Y13A 4JF5A 5M1AA 2ZD8A 4NKPA 3G32A 1ZG4A 4ETZA 5AQ9A 1XFNA 2BLSA 5FAQA 2Y2MA 1PWCA 4R38A 4QY6A 4KQDA 4U3TA 5KSCA 1N4OA 5KZHA 1MY8A 5FEGA 5GLAA 1FSYA 2Z6DA 3P98A 1T1AA 2P04A 2VV6A 2VZWA 1LLBA 1GCEA 4IVIA 4HJ6A 1ODVA 4PMAA 1CQAA 1LI9A 4UQIM 1BLPA 3UDFA 3LEZA 3IX4A 4D60A 3H7WA 4DMZA 4HNBA 4R70A 2ZM0A 1GHMA 3MXQA 3M6BA 5EVIA 5CX7A 1E4DA 3PBTA 2PRFA 1DP6A 4O7DA 5J7EA 4Q0IA 4IEDA 3SOIA 2XEPA 3OOVA 3T4LA 1H0MA 2HDSA 3E0YA 2A3UA 1N9NA 4HOIA 3UB9A 1W63M 5HD3A 1G6OA 4GW9A 4KZAA 1L3LA 2A24B 2V9AA 1S66L 4GDBA 2R9XA 3MFDA 2QWSA 3A3IA 1SZVA 1N9BA 3OBFA 2ZQCA 4P0MA 5EVID 4O01A 3IXDA 4KQRA 2V0WA 2O9BA 2LB5A 3G35A 1O07A 5TGFA 2XF3A 3MXRA 4BMWA 1ALQA 1E25A 3A3DA 4MBKA 4UHUA 3GMWA 3TE8A 3W4OA 2ZC4B 4EETB 4GZBA 3VOLA 5HPIA 2J3TC 5EVEA 5HPFA 2WZXA 2Y2PA 4Q0HA 4DKIA 1P9WA 4UEYA 5AVEA 5CECA 3KSHA 4DJ2A 1ONHA 2UWXA 3NY4A 4EUZA 1VETB 3S7NA 4RX2A 4P6BA 3Q1FA 1BLCA 1XA1A 4LRZE 3DTKA 3OCNA 3LGOA 1WA9A 3C30A 1I2WA 3P09A 2IWBA 4OQGA 1YLTA 3BFFA 3ZFZA 1IFQA 1IEMA 4IVKA 4A5RA 2ZMFA 4E3NA 5FEFA 5F82A 4LV2A 1FR1A 1MKIA 4N9LA 3CWFA 5JYPA 3DWKA 4KG5A 3W2ZA 4RQ9A 4X53A 4KZ3A 3KO6A 3PBNA 3MKFA 4FH2A 3ZCZA 4OONA 2FH5A 5F69A 4JPMA 1LSXA 1MKMA 1OT9A 1ERMA 3AGFA 4B88A 4NG2A 3KYQA 3VFHA 1G6AA 3CAXA 4OVDA 5F6AA 3ZG7B 4ZRRA 1ERQA 3SS4A 5CEBA 3UB6A 1FCNA 1XFQA 1BZAA 4EWFA 1HTZA 2FZ0A 3IHAA 2HP5A 3LR3A 1JNUA 1MC0A 5AVFA 3V3RA 4QY5A 1NXYA 1JWVA 4JGPA 4QD4A 4BD0A 2EX6A 2CMNA 2Z6CA 2J3WA 1SHVA 3I7JA 5HSQA 2J3TD 3N4IA 2B18A 2P7JA 2QZ6A 2EX2A 5HX9A 3P01A 2EWVA 3ICYA 1BLHA 4R3JA 2Q9NA 1RCJA 4GN2A 2XK1A 2B5RA 1DP8A 3HLWA 3RXXA 4X1LA 2PU2A 5J8XA 1W79A 3T12B 4E3LA 1TD5A 1D7EA 3PAEA 2VV7A 3FV7A 2A2LA 3EQVA 1MZUA 2XH9A 4R4RA 3PBSA 4QHCA 5E2GA 2V8FA 1W63Q 1Z09A 5HWVA 3GTCA 1E3UA 3HUMA 3LIEA 2V0UA 3L9KA 4LCLA 3UE3A 1NZUA 3HLGA 4OKPA 3TJZC 4FSFA 2Y2JA 4I39A 4P85A 3VP4A 3LIBA 5F83A 3TSGA 1S1ZA 3G6OA 3GV9A 2PAVP 1IELA 2L4RA 4JF6A 3K2NA 2WAEA 2ZQAA 3HLCA 2VKSA 1E3UD 3BFEA 1YMSA 1F98A 1LL8A 4MCWA 2NUTC 3NDGA 4ARZA 3WRZA 4NXGA 3MZDA 3IT9A 4GHIA 2FFFB 4Y15A 1NLYA 5CGSA 3A0SA 4BBVA 5HARA 3GECA 5EE8A 2OWJA 2B02A 2JC7A 5HDDA 3QHYA 4M3KA 2BG1A 5HAIA 3ZDJA 3QP1A 2ZQ8A 4K0XA 3U4LP 4Z9QA 2E8IA 3MQ0A 3MR0A 1K56A 2K2NA 3VOYA 3LFVA 5F5YA 2ZQ7A 2PHYA 4KZBA 1DRMA 2R9WA 3E2LA 1LI0A 3V50A 5G4ZA 2WKRA 1HZOA 5IU1A 5A90A 5HAQA 4R6LA 4PM8A 1PWGA 2P08A 4ZJ1A 4HP9A 1CI8A 5FL3A 5DTKA 1KDWA 2JBFA 4XT2B 4X1MA 3OZHA 3D4FA 3L7HA 1K56D 3C5AA 2BTFP 3DW0A 5FAOA 2XSSA 5F1GA 2VGLS 4BLMA 4LV3A 3S1YA 3DWZA 2WGIA 4OLDA 1YSQA 2ZLYA 3MS6A 1H3QA 1XJ2A 4OPQA 2Y91A 3N8LA 2X01A 3UPNA 1TVFA 4ESPA 4Y7PA 2EX9A 3IXHA 3EEAA 2XRNA 2GJ3A 3KYEA 5HL1A 4WBGA 2P9VA 1PW8A 4P6ZM 1LL9A 2Y2KA 3N8SA 2VLGA 3ULFA 3QP2A 2QMIA 3HJKA 3MZEA 5TFQA 1G28A 1YLZA 3HVFA 1KE3A 4M4XA 2IWDA 3JPUA 3RTYA 1CEFA 4FH4A 2XD1A 4R1GA 4NXFA 2LB9A 4EBLA 1CK3A 4HBUA 3TW8A 3Q07A 2OV5A 4KZ7A 1ES5A 3BLMA 2ZC7A 5HW3A 3H82A 5HDSA 2ZJ9A 1RGYA 4H6JB 4DN0A 3MMHA 1SDNA 4WUJA 3AGEA 4I3JA 3IWIA 4OOYA 2JCHA 4UA9A 4QU3A 3IXGA 1P9RA 3UE1A 2ZBBA 1PZPA 5CTMA 5J4EA 3VP0A 4QB8A 2H5SA 4Z1WA 2DCFA 4X68A 1W5DA 4NETA 5AQAA 3VP1A 2A24A 1YMXA 2ZM8A 4NK3A 1TS7A 2DMWA 3FPVA 3V67A 2HDUA 3EWKA 3SH8A 4GLQA 4OLGA 5FI6A 2WKHA 2WGVA 2Y59A 3WS5A 4GD8A 3RXWA 4R0QA 1IYPA 2PR6A 3HLEA 1XGIA 3GDIA 1QMEA 1KVLA 5A91A 4HJ3A 2XA7M 1GA0A 2W3HA 2VJWA 2JKGA 3FYZA 4HQAA 5LBRA 4G3KA 5EOOA 3A3EA 5KSHA 4KZ8A 5F68A 3BW6A 4B9OA 3CLOA 1VQQA 1VETA 4FCFA 3LIAA 3Q82A 1F2KA 2I72A 1HD8A 4L0LA 4IUHA 3R7WA 4L9EA 2P9VB 4AFIA 3UPPA 4KG6A 1Y4OA 3A3JA 4PM7A 4B4XA 3AGDA 4MN7A 1I5QA 4OQHA 1HVBA 3IXBA 3BQAA 3OC2A 4EQ1A 1IYSA 3V5MA 3CITA 1T1BA 1VM1A 3H82B 3C7VA 1ZTUA 4OPYA 5FQ9A 4EU0A 2AVXA 2C6WB 4U0TA 3IX3A 1S67L 3JYIA 1CF0A 5DFYA 4EESA 1ZC2A 2KX6A 5DF8A 1RGZA 5EECA 1XX2A 2E8JA 2Y2OA 5D3OA 4ZDXA 2PD8A 4EEPA 2ZM2A 1IYQA 5EV0A 1SDEA 3OPPA 1T19A 3S22A 1Q2PA 3IQAA 5A92A 1A0KA 2ZQDA 1H5XA 4WEKA 4B93A 5M18A 3NECA 3CHWP 3T4OA 3BRMA 3ZGAB 2ZQ9A 3N8RA 2BASA 1L0EA 3SH7A 3OPLA 4CJNA 2HF6A 2VV8A 2KLIA 1XA7A 3F1OB 2R78A 1NRJA 4F94A 4WM9A 4N1HA 5F1FA 4WL9A 3ITAA
chains in the Genus database with same CATH topology
4WZ5C 3HLWA 3RXXA 4CPKA 4BQMA 2PU2A 3NBLA 5J8XA 1W79A 3G34A 3BYDA 1K54A 2V2FF 1GA9A 5CHMA 5DTSA 2ZC5B 3GQZA 4U0XA 4E3LA 3WS1A 3WS2A 2XLNA 4BL2A 3PAEA 1BULA 1MWSA 1NJ4A 3ZVWA 3FV7A 2Y2GA 1JWPA 3EQVA 2XH9A 4R4RA 3V39A 1ES3A 4RYEA 3PBSA 3Q81A 4DDSA 1K25A 4QHCA 4S2IA 5E2GA 4YFMA 2X02A 1E3UA 3GTCA 1PIOA 1XPBA 5EVIC 1H8YA 3HUMA 4GD6A 1S6RA 1MPLA 2G2UA 1KGEA 4LCLA 3OCLA 3UE3A 3LY4A 1NZUA 5CGWA 3HLGA 4OKPA 1K6SA 5GLBA 4FSFA 2Y2JA 4GDNA 4P85A 3VP4A 5G18A 4HEFA 4P87A 5F83A 1G68A 3TSGA 3UDXA 2DRWA 1M6KA 3GV9A 3O86A 5AQBA 4OH0A 1FQGA 1IELA 4DE1A 4JF6A 3G4PA 3IF6C 3NDEA 2WKIA 4OQ0A 4PM9A 3UY6A 1S0WA 5DTTA 3M6HA 2WAEA 2H10A 4OQIA 4ZTKA 1XXMA 2ZQAA 4Q8IA 3CG5A 1YQSA 2J7VA 3HLCA 5GHYA 2Y4AA 1E3UD 5E43A 3BFCA 4MLLA 4E6WA 3BFEA 1YMSA 4LV0A 3PBOA 5FQQA 3NDGA 3WWXA 3WRZA 4N1XA 3MZDA 3IT9A 1M40A 2FFFB 5FAPA 5HAPA 5CGSA 1KGFA 1U60A 4WZ5A 4S2LA 3VOZA 5HARA 1RP5A 5EE8A 4BL3A 4WELA 2JC7A 1TDLA 1PYYA 2PBYA 2VGJA 3MKEA 3PBRA 5EOEA 2Y2NA 4S2JA 4Y0OA 4R23A 4S2NC 4Y0UA 3B3XA 3QHYA 4M3KA 4E3JA 2BG1A 1DY6A 1JWZA 5HAIA 5CEDA 5IHVA 3ZDJA 2ZQ8A 1XGJA 2EX8A 4N9KA 4K0XA 4PM6A 1ES2A 4Z9QA 2E8IA 4DXCA 4OPRA 3GSGA 4OOMA 2A49A 2J8YA 2VGKA 2Q9MA 4WEJA 1PW1A 3ZG5A 1K56A 3HLBA 3VOYA 3G2YA 2IWCA 5L2FA 1MBLA 4EBNA 2WAFA 3LY3A 5TR7A 3CJMA 2ZQ7A 2WADA 3ZG8B 4KZBA 4DRTA 3ITBA 3FKVA 3IHBA 2R9WA 5I94A 4K91A 3M2KA 3SH9A 3E2LA 5E2HA 2H0YA 3RJUA 1LI0A 3IWOA 3V50A 3G2ZA 1HZOA 3ZNTA 1NYYA 5A90A 4EBPA 4B4ZA 4D2OA 4DF6A 5HAQA 1MWRA 4PM8A 1WYCA 2WYXA 1PWGA 2C5WB 2H0TA 4ZJ1A 1PZOA 4S2PA 3WS4A 4XUZA 1CI8A 5GLCA 2EXAA 1KVMA 2HP9A 5DTKA 4EV4A 5FASA 1KDWA 2JBFA 4LV1A 2Y2LA 3LCEA 3OZHA 1MXOA 3D4FA 1W8YA 2ZMAA 3VFFA 1K56D 3BFGA 4E3OA 3OPRA 1MWTA 4OPZA 3C5AA 3BFDA 4DE2A 5E2FA 1Y54A 1JTGA 3BEBA 3DW0A 5FAOA 5F1GA 3SS5A 1IYOA 3E2KA 3O87A 4ID4A 4S2KA 1H8ZA 4X56A 4LV3A 5AQ7A 4BLMA 3S1YA 1GHPA 4JXVA 2CC1A 2FFYA 3VP3A 1NRFA 2WGWA 5CXWA 3DWZA 3HLFA 2EFXA 1YLYA 2WGIA 4MEZA 1YLPA 3O88A 4OLDA 3G31A 2ZLYA 5E2EA 3ZG0A 2WGWB 3ITAA 1ES4A 1K4EA 4OP5A 4OPQA 5CGXA 3FZCA 1LL5A 1NZOA 4UA7A 1PI5A 4X69A 3HREA 4BJPA 2Y91A 3N8LA 4JXGA 4LENA 2X01A 3UPNA 3HL9A 1TVFA 5CHUA 3FWLA 4Y7PA 1NYMA 5FA7A 3TOIA 5GHZA 2EX9A 2HDQA 4JKTA 1W7FA 2OLVA 4E3IA 5EUAA 3IXHA 2EXBA 1CI9A 1J9MA 2OSUA 4UA6A 5CTNA 5HL1A 2PU4A 3NC8A 3VP2A 3UPOA 4WBGA 3GRJA 5DF7A 2WKEA 1W8QA 3ZHHA 2P9VA 1TEMA 1PW8A 3N7WA 5CERA 2P74A 1LL9A 2Y2KA 4HESA 1K57C 4JBFA 4KG2A 4ZBEA 1IKGA 5A93A 3V3SA 4DXBA 4JF5A 5M1AA 3N8SA 2ZD8A 3OPHA 5EVLA 1SCWA 2QMIA 3MZEA 5TFQA 1YLZA 3BECA 4HBTA 3HVFA 1KE3A 2IWDA 4C3QA 3G32A 1CEFA 1ZG4A 5AQ9A 4GKUA 4FH4A 3CMZA 2XD1A 2XQZA 1OMEA 4IBXA 2ZC3B 2BLSA 4R1GA 5FAQA 4MBHA 4EBLA 2Y2MA 1CK3A 1PWCA 4QY6A 4BD1A 1KDSA 1L0DA 3MBZA 4HBUA 3G30A 3Q07A 4U3TA 4ZJ3A 2OV5A 1N4OA 5KSCA 3QNCA 2J9PA 4KZ7A 5KZHA 1MY8A 1ES5A 4RVAA 3BLMA 4EQIA 2ZC7A 5GLAA 1FSYA 4N92A 3W4QA 5FQMA 3PAGA 5HW3A 1BSGA 5FQJA 1EROA 3P98A 2ZJ9A 1RGYA 1K6RA 3C7UA 3W4PA 1LLBA 1Z6FA 3HLDA 2JE5A 1SDNA 1GCEA 4IVIA 4XUXA 3TG9A 3AGEA 1K54C 3IWIA 4OOYA 4PMAA 2XGNA 1LI9A 2JCHA 4UA9A 4QU3A 3IXGA 1BLPA 3WS0A 4KENB 4R3BA 3UDFA 3LEZA 3UE1A 2HP6A 3Q7ZA 1PZPA 5CTMA 4KQOA 2ZM0A 3LO7A 5FSRA 1GHMA 1JVJA 3M6BA 1IKIA 3VP0A 5EVIA 3ISGA 4QB8A 2H5SA 1E4DA 3PBTA 1FCOA 3C4OA 4O7DA 4JF4A 4IEDA 2DCFA 3SOIA 5JYOA 3IWQA 2XEPA 4X68A 5EVIB 2HDSA 1W5DA 2A3UA 1BUEA 4NETA 5AQAA 5EPHA 1ZG6A 4IBRA 1K38A 3VP1A 3N6IA 2XFSA 3BM6A 1YMXA 2ZM8A 4NK3A 3BLSA 1I2SA 5DVAA 4JXSA 4KZAA 1K57A 2WUQA 3IF6A 3PTEA 4R4SA 2HDUA 4GDBA 2R9XA 4YINA 4E3MA 3MFDA 3SH8A 3A3IA 4PM5A 3WRTA 2RCXA 5U47A 3IF6B 4OLGA 1N9BA 2ZQCA 5FI6A 2WKHA 4P0MA 3QNBA 4RA7A 4GOGA 2WGVA 2Y2HA 5EVID 2Y59A 3WS5A 1YLWA 4GD8A 3RXWA 2V1ZA 4R0QA 4JLFA 3IXDA 4BENA 1IYPA 4KQRA 4RX3A 5GL9A 3HLEA 3G35A 1O07A 5TGFA 1EWZA 3O3VA 1XGIA 2XF3A 3GVBA 4WMCA 1QMEA 1K55C 1KVLA 3MXRA 5A91A 1WYBA 1ALQA 1E25A 4XXRA 3A3DA 3M2JA 2J9OA 4MBKA 4UHUA 4ZAMA 4KZ9A 1Q2QA 1XP4A 2WZZA 1DJAA 1GA0A 4S2NA 1KE0A 4DDYA 3GMWA 3UNWA 3W4OA 2ZC4B 3FKWA 3FYZA 4OP8A 2EFUA 4GZBA 3W8KA 5EOOA 3A3EA 5KSHA 4KZ8A 4PPRA 1YLJA 4KZ4A 2Y55A 2Z2LB 3UDIA 3EQUA 2Y2IA 2WZXA 2Y2PA 1BT5A 3CZDA 4DKIA 5CECA 2WK0A 1L0FA 1GHIA 1VQQA 1JTDA 1ONHA 4FCFA 5FQKA 2UWXA 2DNSA 3UO9A 3Q82A 3NY4A 1ONGA 2I72A 1HD8A 3NCKA 4EUZA 3NI9A 4L0LA 4WMCD 4RX2A 2QPNA 4P6BA 3PBQA 3Q1FA 2P9VB 4GB7A 1EI5A 1QMFA 1BLCA 1ESIA 1XA1A 3UPPA 3OCNA 1MWUA 4KG6A 4LCMA 5GHXA 5FI7A 1LHYA 3A3JA 4PM7A 4C6YA 4B4XA 1I2WA 2ZC6B 5M19A 3AGDA 3IF5A 3P09A 4S2MA 4X6TA 2IWBA 1PI4A 2V20A 4E3KA 1I5QA 4OQHA 4OQGA 1HVBA 1L2SA 1FSWA 1YLTA 3IXBA 4KZ5A 3BFFA 1WE4A 1O7EA 3ZNYA 3ZFZA 3S4XA 2X71A 1FR6A 3OC2A 5CHJA 1YM1A 4IVKA 1IEMA 1AXBA 1FOFA 3VSLA 4A5RA 4E3NA 1IYSA 3V5MA 4UAAA 5F82A 4LV2A 1FR1A 1MKIA 1NY0A 4N9LA 4DE3A 3A3FA 3DTMA 5HFOA 3DWKA 4KG5A 1DJBA 3MZFA 5JYPA 4K0WA 4X53A 1VM1A 3C7VA 4OPYA 5FATA 5FQ9A 4KZ3A 2C6WB 2GDNA 1PWDA 3PBNA 5CRFA 4U0TA 3C4PA 1YT4A 3SS3A 1K55A 3MKFA 4FH2A 2RL3A 2HDRA 1BTLA 4QJGA 3JYIA 4WYYA 2XD5A 5FI2A 3UN7A 5DF9A 3ZCZA 1ZC2A 1L0GA 1XKZA 4C75A 4OONA 2Y2QA 5DF8A 1RGZA 4S2OA 4E6XA 3IH9A 5EECA 1C3BA 4DE0A 1FCMA 1CEGA 1XX2A 5KMWA 2Y2OA 5D3OA 4JPMA 4ZDXA 4Y0TA 3ZG9B 1ERMA 1TDGA 2ZM2A 3AGFA 1IYQA 4B88A 3IH8A 3VFHA 2Z2MB 1G6AA 5GLDA 5FQIA 4OVDA 1SDEA 2XDMA 3ZG7B 1ERQA 3SS4A 5CEBA 3MXSA 3OPPA 2G2WA 3S22A 1FCNA 1Q2PA 1BZAA 3IQAA 5A92A 5BOHA 1SKFA 2ZQDA 1H5XA 4WEKA 4EWFA 5M18A 3VMAA 4OOLA 4FD8A 1HTZA 2XR0A 4WZ4A 3IHAA 2HP5A 3BRMA 3ZGAB 1ESUA 4MBFA 3V3RA 2ZQ9A 3N8RA 1L0EA 3HUNA 3GR2A 4QY5A 3SH7A 1NXYA 1JWVA 3OPLA 3Q7VA 4JXWA 4QD4A 4CJNA 4H8RA 4BD0A 2EX6A 3HUOA 1DJCA 1SHVA 3I7JA 1KE4A 1ZKJA 4KZ6A 4KQQA 1XA7A 3VSKA 3Q7VB 2XFTA 3UE0A 3HBRA 3N4IA 4MNRA 4F94A 2QZ6A 1K4FA 2EX2A 5HX9A 4WM9A 3NIAA 4GNUA 4N1HA 1BLSA 2OLUA 4X55A 5F1FA 1BLHA 2HPBA 4R3JA 2Q9NA 1RCJA 5FDHA 1KGGA 3ZVTA 4ZJ2A 4GN2A 2XK1A 2B5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ5 C;  3HLW A;  3RXX A;  4CPK A;  4BQM A;  2PU2 A;  3NBL A;  5J8X A;  1W79 A;  3G34 A;  3BYD A;  1K54 A;  2V2F F;  1GA9 A;  5CHM A;  5DTS A;  2ZC5 B;  3GQZ A;  4U0X A;  4E3L A;  3WS1 A;  3WS2 A;  2XLN A;  4BL2 A;  3PAE A;  1BUL A;  1MWS A;  1NJ4 A;  3ZVW A;  3FV7 A;  2Y2G A;  1JWP A;  3EQV A;  2XH9 A;  4R4R A;  3V39 A;  1ES3 A;  4RYE A;  3PBS A;  3Q81 A;  4DDS A;  1K25 A;  4QHC A;  4S2I A;  5E2G A;  4YFM A;  2X02 A;  1E3U A;  3GTC A;  1PIO A;  1XPB A;  5EVI C;  1H8Y A;  3HUM A;  4GD6 A;  1S6R A;  1MPL A;  2G2U A;  1KGE A;  4LCL A;  3OCL A;  3UE3 A;  3LY4 A;  1NZU A;  5CGW A;  3HLG A;  4OKP A;  1K6S A;  5GLB A;  4FSF A;  2Y2J A;  4GDN A;  4P85 A;  3VP4 A;  5G18 A;  4HEF A;  4P87 A;  5F83 A;  1G68 A;  3TSG A;  3UDX A;  2DRW A;  1M6K A;  3GV9 A;  3O86 A;  5AQB A;  4OH0 A;  1FQG A;  1IEL A;  4DE1 A;  4JF6 A;  3G4P A;  3IF6 C;  3NDE A;  2WKI A;  4OQ0 A;  4PM9 A;  3UY6 A;  1S0W A;  5DTT A;  3M6H A;  2WAE A;  2H10 A;  4OQI A;  4ZTK A;  1XXM A;  2ZQA A;  4Q8I A;  3CG5 A;  1YQS A;  2J7V A;  3HLC A;  5GHY A;  2Y4A A;  1E3U D;  5E43 A;  3BFC A;  4MLL A;  4E6W A;  3BFE A;  1YMS A;  4LV0 A;  3PBO A;  5FQQ A;  3NDG A;  3WWX A;  3WRZ A;  4N1X A;  3MZD A;  3IT9 A;  1M40 A;  2FFF B;  5FAP A;  5HAP A;  5CGS A;  1KGF A;  1U60 A;  4WZ5 A;  4S2L A;  3VOZ A;  5HAR A;  1RP5 A;  5EE8 A;  4BL3 A;  4WEL A;  2JC7 A;  1TDL A;  1PYY A;  2PBY A;  2VGJ A;  3MKE A;  3PBR A;  5EOE A;  2Y2N A;  4S2J A;  4Y0O A;  4R23 A;  4S2N C;  4Y0U A;  3B3X A;  3QHY A;  4M3K A;  4E3J A;  2BG1 A;  1DY6 A;  1JWZ A;  5HAI A;  5CED A;  5IHV A;  3ZDJ A;  2ZQ8 A;  1XGJ A;  2EX8 A;  4N9K A;  4K0X A;  4PM6 A;  1ES2 A;  4Z9Q A;  2E8I A;  4DXC A;  4OPR A;  3GSG A;  4OOM A;  2A49 A;  2J8Y A;  2VGK A;  2Q9M A;  4WEJ A;  1PW1 A;  3ZG5 A;  1K56 A;  3HLB A;  3VOY A;  3G2Y A;  2IWC A;  5L2F A;  1MBL A;  4EBN A;  2WAF A;  3LY3 A;  5TR7 A;  3CJM A;  2ZQ7 A;  2WAD A;  3ZG8 B;  4KZB A;  4DRT A;  3ITB A;  3FKV A;  3IHB A;  2R9W A;  5I94 A;  4K91 A;  3M2K A;  3SH9 A;  3E2L A;  5E2H A;  2H0Y A;  3RJU A;  1LI0 A;  3IWO A;  3V50 A;  3G2Z A;  1HZO A;  3ZNT A;  1NYY A;  5A90 A;  4EBP A;  4B4Z A;  4D2O A;  4DF6 A;  5HAQ A;  1MWR A;  4PM8 A;  1WYC A;  2WYX A;  1PWG A;  2C5W B;  2H0T A;  4ZJ1 A;  1PZO A;  4S2P A;  3WS4 A;  4XUZ A;  1CI8 A;  5GLC A;  2EXA A;  1KVM A;  2HP9 A;  5DTK A;  4EV4 A;  5FAS A;  1KDW A;  2JBF A;  4LV1 A;  2Y2L A;  3LCE A;  3OZH A;  1MXO A;  3D4F A;  1W8Y A;  2ZMA A;  3VFF A;  1K56 D;  3BFG A;  4E3O A;  3OPR A;  1MWT A;  4OPZ A;  3C5A A;  3BFD A;  4DE2 A;  5E2F A;  1Y54 A;  1JTG A;  3BEB A;  3DW0 A;  5FAO A;  5F1G A;  3SS5 A;  1IYO A;  3E2K A;  3O87 A;  4ID4 A;  4S2K A;  1H8Z A;  4X56 A;  4LV3 A;  5AQ7 A;  4BLM A;  3S1Y A;  1GHP A;  4JXV A;  2CC1 A;  2FFY A;  3VP3 A;  1NRF A;  2WGW A;  5CXW A;  3DWZ A;  3HLF A;  2EFX A;  1YLY A;  2WGI A;  4MEZ A;  1YLP A;  3O88 A;  4OLD A;  3G31 A;  2ZLY A;  5E2E A;  3ZG0 A;  2WGW B;  3ITA A;  1ES4 A;  1K4E A;  4OP5 A;  4OPQ A;  5CGX A;  3FZC A;  1LL5 A;  1NZO A;  4UA7 A;  1PI5 A;  4X69 A;  3HRE A;  4BJP A;  2Y91 A;  3N8L A;  4JXG A;  4LEN A;  2X01 A;  3UPN A;  3HL9 A;  1TVF A;  5CHU A;  3FWL A;  4Y7P A;  1NYM A;  5FA7 A;  3TOI A;  5GHZ A;  2EX9 A;  2HDQ A;  4JKT A;  1W7F A;  2OLV A;  4E3I A;  5EUA A;  3IXH A;  2EXB A;  1CI9 A;  1J9M A;  2OSU A;  4UA6 A;  5CTN A;  5HL1 A;  2PU4 A;  3NC8 A;  3VP2 A;  3UPO A;  4WBG A;  3GRJ A;  5DF7 A;  2WKE A;  1W8Q A;  3ZHH A;  2P9V A;  1TEM A;  1PW8 A;  3N7W A;  5CER A;  2P74 A;  1LL9 A;  2Y2K A;  4HES A;  1K57 C;  4JBF A;  4KG2 A;  4ZBE A;  1IKG A;  5A93 A;  3V3S A;  4DXB A;  4JF5 A;  5M1A A;  3N8S A;  2ZD8 A;  3OPH A;  5EVL A;  1SCW A;  2QMI A;  3MZE A;  5TFQ A;  1YLZ A;  3BEC A;  4HBT A;  3HVF A;  1KE3 A;  2IWD A;  4C3Q A;  3G32 A;  1CEF A;  1ZG4 A;  5AQ9 A;  4GKU A;  4FH4 A;  3CMZ A;  2XD1 A;  2XQZ A;  1OME A;  4IBX A;  2ZC3 B;  2BLS A;  4R1G A;  5FAQ A;  4MBH A;  4EBL A;  2Y2M A;  1CK3 A;  1PWC A;  4QY6 A;  4BD1 A;  1KDS A;  1L0D A;  3MBZ A;  4HBU A;  3G30 A;  3Q07 A;  4U3T A;  4ZJ3 A;  2OV5 A;  1N4O A;  5KSC A;  3QNC A;  2J9P A;  4KZ7 A;  5KZH A;  1MY8 A;  1ES5 A;  4RVA A;  3BLM A;  4EQI A;  2ZC7 A;  5GLA A;  1FSY A;  4N92 A;  3W4Q A;  5FQM A;  3PAG A;  5HW3 A;  1BSG A;  5FQJ A;  1ERO A;  3P98 A;  2ZJ9 A;  1RGY A;  1K6R A;  3C7U A;  3W4P A;  1LLB A;  1Z6F A;  3HLD A;  2JE5 A;  1SDN A;  1GCE A;  4IVI A;  4XUX A;  3TG9 A;  3AGE A;  1K54 C;  3IWI A;  4OOY A;  4PMA A;  2XGN A;  1LI9 A;  2JCH A;  4UA9 A;  4QU3 A;  3IXG A;  1BLP A;  3WS0 A;  4KEN B;  4R3B A;  3UDF A;  3LEZ A;  3UE1 A;  2HP6 A;  3Q7Z A;  1PZP A;  5CTM A;  4KQO A;  2ZM0 A;  3LO7 A;  5FSR A;  1GHM A;  1JVJ A;  3M6B A;  1IKI A;  3VP0 A;  5EVI A;  3ISG A;  4QB8 A;  2H5S A;  1E4D A;  3PBT A;  1FCO A;  3C4O A;  4O7D A;  4JF4 A;  4IED A;  2DCF A;  3SOI A;  5JYO A;  3IWQ A;  2XEP A;  4X68 A;  5EVI B;  2HDS A;  1W5D A;  2A3U A;  1BUE A;  4NET A;  5AQA A;  5EPH A;  1ZG6 A;  4IBR A;  1K38 A;  3VP1 A;  3N6I A;  2XFS A;  3BM6 A;  1YMX A;  2ZM8 A;  4NK3 A;  3BLS A;  1I2S A;  5DVA A;  4JXS A;  4KZA A;  1K57 A;  2WUQ A;  3IF6 A;  3PTE A;  4R4S A;  2HDU A;  4GDB A;  2R9X A;  4YIN A;  4E3M A;  3MFD A;  3SH8 A;  3A3I A;  4PM5 A;  3WRT A;  2RCX A;  5U47 A;  3IF6 B;  4OLG A;  1N9B A;  2ZQC A;  5FI6 A;  2WKH A;  4P0M A;  3QNB A;  4RA7 A;  4GOG A;  2WGV A;  2Y2H A;  5EVI D;  2Y59 A;  3WS5 A;  1YLW A;  4GD8 A;  3RXW A;  2V1Z A;  4R0Q A;  4JLF A;  3IXD A;  4BEN A;  1IYP A;  4KQR A;  4RX3 A;  5GL9 A;  3HLE A;  3G35 A;  1O07 A;  5TGF A;  1EWZ A;  3O3V A;  1XGI A;  2XF3 A;  3GVB A;  4WMC A;  1QME A;  1K55 C;  1KVL A;  3MXR A;  5A91 A;  1WYB A;  1ALQ A;  1E25 A;  4XXR A;  3A3D A;  3M2J A;  2J9O A;  4MBK A;  4UHU A;  4ZAM A;  4KZ9 A;  1Q2Q A;  1XP4 A;  2WZZ A;  1DJA A;  1GA0 A;  4S2N A;  1KE0 A;  4DDY A;  3GMW A;  3UNW A;  3W4O A;  2ZC4 B;  3FKW A;  3FYZ A;  4OP8 A;  2EFU A;  4GZB A;  3W8K A;  5EOO A;  3A3E A;  5KSH A;  4KZ8 A;  4PPR A;  1YLJ A;  4KZ4 A;  2Y55 A;  2Z2L B;  3UDI A;  3EQU A;  2Y2I A;  2WZX A;  2Y2P A;  1BT5 A;  3CZD A;  4DKI A;  5CEC A;  2WK0 A;  1L0F A;  1GHI A;  1VQQ A;  1JTD A;  1ONH A;  4FCF A;  5FQK A;  2UWX A;  2DNS A;  3UO9 A;  3Q82 A;  3NY4 A;  1ONG A;  2I72 A;  1HD8 A;  3NCK A;  4EUZ A;  3NI9 A;  4L0L A;  4WMC D;  4RX2 A;  2QPN A;  4P6B A;  3PBQ A;  3Q1F A;  2P9V B;  4GB7 A;  1EI5 A;  1QMF A;  1BLC A;  1ESI A;  1XA1 A;  3UPP A;  3OCN A;  1MWU A;  4KG6 A;  4LCM A;  5GHX A;  5FI7 A;  1LHY A;  3A3J A;  4PM7 A;  4C6Y A;  4B4X A;  1I2W A;  2ZC6 B;  5M19 A;  3AGD A;  3IF5 A;  3P09 A;  4S2M A;  4X6T A;  2IWB A;  1PI4 A;  2V20 A;  4E3K A;  1I5Q A;  4OQH A;  4OQG A;  1HVB A;  1L2S A;  1FSW A;  1YLT A;  3IXB A;  4KZ5 A;  3BFF A;  1WE4 A;  1O7E A;  3ZNY A;  3ZFZ A;  3S4X A;  2X71 A;  1FR6 A;  3OC2 A;  5CHJ A;  1YM1 A;  4IVK A;  1IEM A;  1AXB A;  1FOF A;  3VSL A;  4A5R A;  4E3N A;  1IYS A;  3V5M A;  4UAA A;  5F82 A;  4LV2 A;  1FR1 A;  1MKI A;  1NY0 A;  4N9L A;  4DE3 A;  3A3F A;  3DTM A;  5HFO A;  3DWK A;  4KG5 A;  1DJB A;  3MZF A;  5JYP A;  4K0W A;  4X53 A;  1VM1 A;  3C7V A;  4OPY A;  5FAT A;  5FQ9 A;  4KZ3 A;  2C6W B;  2GDN A;  1PWD A;  3PBN A;  5CRF A;  4U0T A;  3C4P A;  1YT4 A;  3SS3 A;  1K55 A;  3MKF A;  4FH2 A;  2RL3 A;  2HDR A;  1BTL A;  4QJG A;  3JYI A;  4WYY A;  2XD5 A;  5FI2 A;  3UN7 A;  5DF9 A;  3ZCZ A;  1ZC2 A;  1L0G A;  1XKZ A;  4C75 A;  4OON A;  2Y2Q A;  5DF8 A;  1RGZ A;  4S2O A;  4E6X A;  3IH9 A;  5EEC A;  1C3B A;  4DE0 A;  1FCM A;  1CEG A;  1XX2 A;  5KMW A;  2Y2O A;  5D3O A;  4JPM A;  4ZDX A;  4Y0T A;  3ZG9 B;  1ERM A;  1TDG A;  2ZM2 A;  3AGF A;  1IYQ A;  4B88 A;  3IH8 A;  3VFH A;  2Z2M B;  1G6A A;  5GLD A;  5FQI A;  4OVD A;  1SDE A;  2XDM A;  3ZG7 B;  1ERQ A;  3SS4 A;  5CEB A;  3MXS A;  3OPP A;  2G2W A;  3S22 A;  1FCN A;  1Q2P A;  1BZA A;  3IQA A;  5A92 A;  5BOH A;  1SKF A;  2ZQD A;  1H5X A;  4WEK A;  4EWF A;  5M18 A;  3VMA A;  4OOL A;  4FD8 A;  1HTZ A;  2XR0 A;  4WZ4 A;  3IHA A;  2HP5 A;  3BRM A;  3ZGA B;  1ESU A;  4MBF A;  3V3R A;  2ZQ9 A;  3N8R A;  1L0E A;  3HUN A;  3GR2 A;  4QY5 A;  3SH7 A;  1NXY A;  1JWV A;  3OPL A;  3Q7V A;  4JXW A;  4QD4 A;  4CJN A;  4H8R A;  4BD0 A;  2EX6 A;  3HUO A;  1DJC A;  1SHV A;  3I7J A;  1KE4 A;  1ZKJ A;  4KZ6 A;  4KQQ A;  1XA7 A;  3VSK A;  3Q7V B;  2XFT A;  3UE0 A;  3HBR A;  3N4I A;  4MNR A;  4F94 A;  2QZ6 A;  1K4F A;  2EX2 A;  5HX9 A;  4WM9 A;  3NIA A;  4GNU A;  4N1H A;  1BLS A;  2OLU A;  4X55 A;  5F1F A;  1BLH A;  2HPB A;  4R3J A;  2Q9N A;  1RCJ A;  5FDH A;  1KGG A;  3ZVT A;  4ZJ2 A;  4GN2 A;  2XK1 A;  2B5R A; 
#chains in the Genus database with same CATH topology
 3VV4 A;  2W1R A;  5CHM A;  3GQZ A;  4U0X A;  1P97 A;  4BL2 A;  1BUL A;  5HZH A;  3ZVW A;  3E4Q A;  2GX5 A;  3V39 A;  4G3V A;  1ES3 A;  4RYE A;  1K25 A;  4S2I A;  3T1Q B;  1LT0 A;  2VX8 A;  1H8Y A;  3SW1 A;  4GD6 A;  1S6R A;  4HY8 A;  3R7W B;  3OCL A;  5CGW A;  5GLB A;  1K6S A;  2V1B A;  2PT7 A;  1YPR A;  3DAV A;  3E4P A;  2DRW A;  4LFU A;  3S7O A;  3O86 A;  5AQB A;  2M7V A;  5K5B A;  4DE1 A;  3T4S A;  3IF6 C;  4OQ0 A;  2PDR A;  4PM9 A;  4CLC E;  5DTT A;  2HJE A;  4ZTK A;  1OTI A;  1XXM A;  2ZMV A;  2J7V A;  5GHY A;  2PYP A;  3LR0 A;  4LV0 A;  3A0V A;  2MJ6 A;  4N1X A;  5HAP A;  4G3W A;  1U60 A;  1SKO A;  4S2L A;  2JHE A;  3C38 A;  1RP5 A;  4BL3 A;  3PBR A;  1PYY A;  2PBY A;  5EOE A;  2W27 A;  3O5Y A;  4S2N C;  2K31 A;  1JWZ A;  5IHV A;  2ZL1 A;  1XGJ A;  2EX8 A;  5TBM B;  4EUV A;  4LGW A;  2Y79 A;  2VGK A;  2IWC A;  3IS2 A;  4I38 A;  2Q0O A;  3ITB A;  3EEH A;  3FKV A;  3IHB A;  5I94 A;  3M2K A;  3SH9 A;  4BBT A;  4HJ4 A;  3G2Z A;  1NYY A;  1UGU A;  4B4Z A;  1MWR A;  5HWT A;  2C5W B;  2H0T A;  4XT2 A;  1PZO A;  3WS4 A;  1D06 A;  2HP9 A;  5FAS A;  1XJ3 A;  1W8Y A;  2ZMA A;  5J3W A;  3BFD A;  1Y54 A;  1JTG A;  3SS5 A;  4S2K A;  4X56 A;  1GHP A;  4QPR A;  4JXV A;  2CC1 A;  2FFY A;  1NRF A;  3HLF A;  3ZG0 A;  5E2E A;  2WGW B;  4DJ3 A;  1OTD A;  5HL6 A;  2O9A A;  3FZC A;  1LL5 A;  4BJP A;  4X69 A;  1PI5 A;  3HRE A;  5MC7 A;  3FWL A;  1NYM A;  1UWN X;  4JKT A;  2OLV A;  3MFX A;  1J9M A;  5CTN A;  3NC8 A;  3GRJ A;  1W8Q A;  3ZHH A;  2P74 A;  5A93 A;  3QP6 A;  5EVL A;  1SCW A;  4HBT A;  2HV1 A;  4O0P A;  4C3Q A;  2YKF A;  3JVV A;  3HCY A;  4R3A A;  2ZC3 B;  4MBH A;  4FUW A;  1VB6 A;  4LLO B;  3MBZ A;  3G30 A;  4ZJ3 A;  1T18 A;  3DBA A;  3QNC A;  4H6J A;  5DJU A;  3W4Q A;  5FQM A;  3PAG A;  1BSG A;  5FQJ A;  4BWI A;  4YNR A;  3LR5 A;  4HH2 A;  1K6R A;  3C7U A;  1SKO B;  1Z6F A;  2JE5 A;  4HHD A;  5L07 A;  1V9Y A;  1K54 C;  2EA9 A;  2XGN A;  1OPX A;  4EEU A;  3WS0 A;  4KEN B;  2ZL1 B;  2D02 A;  3D9Y A;  2K7S A;  4KQO A;  5FSR A;  1GSX A;  2H28 A;  3ISG A;  1F5M A;  3IS2 B;  3R4K A;  1BUE A;  3FPW A;  5EPH A;  1ZG6 A;  4IBR A;  1K38 A;  4NXE A;  3QP5 A;  3N6I A;  5TJJ A;  2XFS A;  3BM6 A;  3BLS A;  5DVA A;  4JXS A;  5I5L A;  2WUQ A;  4R4S A;  5DFX A;  4F3L A;  1YSP A;  4E3M A;  4PM5 A;  3WRT A;  2RCX A;  3IF6 B;  3NOU C;  3QNB A;  4RA7 A;  4GOG A;  1YLW A;  2M1C A;  4L9G A;  4JLF A;  2W3F A;  2VGL M;  4II7 A;  2JKR I;  1EWZ A;  3O3V A;  3GVB A;  1WYB A;  4Y2F A;  4GS9 B;  4XXR A;  4MDZ A;  2J9O A;  4ZAM A;  4K08 A;  4KZ9 A;  2QKP A;  1XP4 A;  2WZZ A;  1KE0 A;  4DDY A;  1OTB A;  3W8K A;  5AJG A;  3MF0 A;  2M7U A;  4PPR A;  1YLJ A;  4KZ4 A;  2Y55 A;  2Z2L B;  3T4J A;  3MQO A;  3UDI A;  3JVU A;  3RFB A;  2WK0 A;  3UB7 A;  3NCK A;  1STZ A;  3PBQ A;  3PR6 A;  1EI5 A;  3UB5 P;  1MWU A;  4LCM A;  5GHX A;  2L0W A;  5FI7 A;  1V9Z A;  3LI9 A;  2ZC6 B;  1NWZ A;  4Y3I A;  5HWW A;  4LRX C;  1L2S A;  4KZ5 A;  4NEE D;  2PYR A;  2X71 A;  1FR6 A;  1FOF A;  2ZOI A;  3EGD C;  2W0N A;  1XJ4 A;  1NY0 A;  3F1N B;  3DTM A;  1YAX A;  4DE3 A;  5HFO A;  1DJB A;  4K0W A;  2JN7 A;  3P7N A;  4PHT A;  1AWI A;  1J3W A;  2GDN A;  5CRF A;  4GJ4 A;  2RL3 A;  1BTL A;  3LIC A;  4WYY A;  3UN7 A;  5DF9 A;  1L0G A;  1NLZ A;  4E6X A;  3IH9 A;  1PFL A;  1F9I A;  1CEG A;  2WKQ A;  3ZG9 B;  1TDG A;  3T1S A;  2Z2M B;  3A0R A;  5FQI A;  2XDM A;  2GZA A;  1N9L A;  4JGQ A;  1S1Y A;  3MXS A;  2G2W A;  1OTA A;  3NHQ A;  3VMA A;  4FD8 A;  4WZ4 A;  2OOL A;  1H8M A;  1DP9 A;  1ESU A;  3CPT A;  4EXO A;  4F3L B;  3F1O A;  3HUO A;  1DJC A;  2KOI A;  2OAQ 1;  3Q7V B;  2XFT A;  4MNR A;  1K4F A;  4E04 A;  3TRC A;  3LID A;  3NIA A;  1BLS A;  3KYZ A;  2OLU A;  3S7Q A;  1FIL A;  4ETX A;  1ACF A;  5FDH A;  3ZVT A;  4ZJ2 A;  4WZ5 C;  4WN5 A;  4BQM A;  3NBL A;  2VEA A;  3G34 A;  3BYD A;  2V2F F;  5DTS A;  1KOU A;  3RH8 B;  3CI6 A;  3WS2 A;  2XLN A;  2W3G A;  1TS8 A;  3D3O A;  3Q81 A;  4DDS A;  2OAP 1;  4YFM A;  3C2W A;  5EVI C;  3LIF A;  3BWL A;  2JKT I;  1UWP X;  2QJ5 A;  5G18 A;  1GSW A;  4P87 A;  1G68 A;  3UDX A;  3C8C A;  1M6K A;  3G4P A;  4FOF A;  3D72 A;  3NDE A;  2D01 A;  3UY6 A;  1S0W A;  1CJF A;  3VE4 A;  4Q8I A;  1YQS A;  4QWO A;  1IOU A;  3BFC A;  4E6W A;  2HJ9 C;  3B42 A;  2UV0 E;  4LPZ A;  4IJG A;  5DJT A;  5FAP A;  1S4S A;  4WZ5 A;  1TDL A;  2VGJ A;  5L09 A;  2Y2N A;  4S2J A;  2QJ7 A;  4Y0O A;  3HJI A;  5TBM A;  4E3J A;  1Y28 A;  4UQI S;  3B33 A;  4DXC A;  4OPR A;  3GSG A;  4OOM A;  2A49 A;  2Q9M A;  4WEJ A;  1PW1 A;  3MSH A;  3HLB A;  1XJ6 A;  5L2F A;  4X25 A;  2WAF A;  3LY3 A;  5TR7 A;  3CJM A;  2WAD A;  2PBD P;  3S7P A;  4K91 A;  3RJU A;  2H0Y A;  3CPT B;  3BJN A;  4D2O A;  4DF6 A;  5DKK A;  1WYC A;  1OJ5 A;  4XUZ A;  5GLC A;  1KVM A;  2O99 A;  4EV4 A;  4I3I A;  2Y2L A;  2W3E A;  3LCE A;  1MXO A;  4E3O A;  3BEB A;  3T4Q A;  1IYO A;  3O87 A;  4ID4 A;  5AQ7 A;  3F1P A;  1P0Z A;  3PHY A;  4IHQ A;  2WGW A;  5CXW A;  2PR5 A;  4MN6 A;  2IA2 A;  3G31 A;  1HLU P;  1OJG A;  1K4E A;  5CGX A;  4UA7 A;  3UPO A;  2V8C A;  3HL9 A;  3PYP A;  4BBU A;  5FA7 A;  3TOI A;  1W7F A;  5EUA A;  1CI9 A;  2OSU A;  4UA6 A;  3LEQ A;  3KSG A;  3VP2 A;  1VEU A;  4CLC C;  1TEM A;  3N7W A;  4KG2 A;  4HES A;  1K57 C;  4ZBE A;  4DXB A;  3OPH A;  5L8M A;  3BEC A;  3T4K A;  2EWW A;  3PXP A;  4GKU A;  3CMZ A;  2XQZ A;  1OME A;  4IBX A;  1D1J A;  4Q0J A;  4BD1 A;  1KDS A;  1L0D A;  2WKP A;  1ZHH B;  2W1T A;  3LYX A;  2J9P A;  4KUO A;  4RVA A;  4EQI A;  4HIA A;  4N92 A;  1ERO A;  3W4P A;  3VE3 A;  3HLD A;  4XUX A;  3TG9 A;  4PKY A;  3E4O A;  3T1X A;  4R3B A;  2HP6 A;  3Q7Z A;  3LI8 A;  2HGV A;  3LO7 A;  3NOT C;  1JVJ A;  1IKI A;  3H7W B;  5A8B A;  4L9F A;  1FCO A;  3C4O A;  4JF4 A;  5JYO A;  3IWQ A;  5EVI B;  4CLC A;  3OLO A;  1I2S A;  1K57 A;  3IBR A;  3UE6 A;  3IF6 A;  3PTE A;  4YIN A;  5HD5 A;  4Y17 A;  5U47 A;  2Y2H A;  2V1Z A;  3NJA A;  3KSI A;  4BEN A;  4RX3 A;  4MN5 A;  5GL9 A;  2W3D A;  4GS9 A;  3SZT A;  4WMC A;  4WLA A;  1K55 C;  3F1P B;  4CLC D;  4IUK A;  3M2J A;  1Q2Q A;  4CQH A;  1DJA A;  4S2N A;  2JKR M;  3UNW A;  3FKW A;  4OP8 A;  2EFU A;  4I3A A;  1VHM A;  3EQU A;  4FTX A;  2Y2I A;  1BT5 A;  3CZD A;  1L0F A;  1GHI A;  5G4Y A;  1JTD A;  1K0K A;  5FQK A;  2DNS A;  3UO9 A;  1ONG A;  4NXB A;  2YKH A;  5EFW A;  3NI9 A;  2ZOH A;  4WMC D;  2QPN A;  1YKD A;  1VEU B;  3U2A A;  4GB7 A;  1QMF A;  5DKL A;  1ESI A;  5FDS A;  1LHY A;  4C6Y A;  2HZ5 A;  5M19 A;  3IF5 A;  4S2M A;  4X6T A;  4E3K A;  1PI4 A;  2V20 A;  3T4T A;  1FSW A;  3ZYT A;  1LSW A;  1WE4 A;  3B47 A;  2B95 A;  1O7E A;  3ZNY A;  3F1N A;  3S4X A;  5CHJ A;  1YM1 A;  3VSL A;  1AXB A;  4I5S A;  1LSV A;  4UAA A;  4Y5F A;  3A3F A;  2I9V A;  2W1T B;  2GNX A;  5HDC A;  3MZF A;  1PRQ A;  2Y8H A;  5FAT A;  1PWD A;  3SS3 A;  3C4P A;  1YT4 A;  1K55 A;  3UB8 A;  1BYW A;  2HDR A;  1FIK A;  5KIZ A;  4QJG A;  2XD5 A;  5FI2 A;  3DTI A;  1XKZ A;  4C75 A;  2Y2Q A;  4S2O A;  1C3B A;  4DE0 A;  1FCM A;  5KMW A;  4Y0T A;  3QP8 A;  3IH8 A;  4ME4 A;  5GLD A;  4O8G A;  1OTE A;  2KDK A;  5L10 A;  2PD7 A;  5BOH A;  1SKF A;  4OOL A;  2XR0 A;  4CLC B;  3E98 A;  4MBF A;  3HUN A;  3GR2 A;  3KX0 X;  2VK3 A;  3QP4 A;  2QHK A;  3Q7V A;  4JXW A;  4H8R A;  3FG8 A;  2V1A A;  3K3C A;  1EW0 A;  1KE4 A;  1ZKJ A;  4KZ6 A;  4KQQ A;  3VSK A;  3UE0 A;  3HBR A;  4YOF A;  3T50 A;  3FC7 A;  4GNU A;  4X55 A;  4EW7 A;  2HPB A;  1KGG A;  1T1C A;  4CPK A;  2VA0 A;  1TS6 A;  1K54 A;  1GA9 A;  2ZC5 B;  3BY9 A;  3WS1 A;  2J80 A;  3H9W A;  2G7U A;  1MWS A;  1NJ4 A;  2Y2G A;  1JWP A;  3NOP C;  3IBJ A;  2QYB A;  2L1M A;  2O0Y A;  2X02 A;  5IS1 A;  1PIO A;  4HI4 A;  1XPB A;  1MPL A;  2G2U A;  1KGE A;  3BY8 A;  1TS0 A;  3LY4 A;  4GDN A;  4HEF A;  3BQ8 A;  4P6Z S;  4GCZ A;  4OH0 A;  1FQG A;  2JKT M;  2WKI A;  3MQQ A;  3UME A;  2XRO A;  3M6H A;  4OQI A;  2H10 A;  3CG5 A;  2Y4A A;  5E43 A;  4HP4 A;  4MLL A;  3ZQ5 A;  5EM0 A;  4KUK A;  1GSV A;  3PBO A;  5FQQ A;  3K3D A;  3WWX A;  3EOI A;  1M40 A;  3CUE C;  4MMN A;  1KGF A;  4ARZ B;  2INW A;  3VOZ A;  4GHI B;  4WEL A;  1S4R A;  3MKE A;  4JGR A;  5C5K A;  4R23 A;  4Y0U A;  3B3X A;  1DY6 A;  5CED A;  4N9K A;  4PM6 A;  1ES2 A;  1X0O A;  3KSF A;  2J8Y A;  4EER A;  3ZG5 A;  3G2Y A;  1MBL A;  4EBN A;  3ZG8 B;  4DRT A;  1N9O A;  5E2H A;  3IWO A;  1G5U A;  3ZNT A;  4EBP A;  4PKY G;  4YWZ A;  2WYX A;  3LUQ A;  2NUP C;  4S2P A;  1TF1 A;  2EXA A;  3IX8 A;  4JGO A;  2ACG A;  4LV1 A;  4HH3 A;  3NUL A;  3VFF A;  1PNE A;  3BFG A;  3DTE A;  3OPR A;  1MWT A;  4OPZ A;  2O9C A;  4DE2 A;  5E2F A;  3E2K A;  3EGX C;  5IT5 A;  3LR4 A;  1H8Z A;  3T1R A;  3VP3 A;  3CUE A;  3MJQ A;  2EFX A;  1YLY A;  2OWH A;  4MEZ A;  1YLP A;  3O88 A;  4PAU A;  2XA7 S;  1ES4 A;  4OP5 A;  1NZO A;  4LEN A;  4JXG A;  5CHU A;  5EM1 A;  5GHZ A;  2HDQ A;  4E3I A;  2EXB A;  4WF0 A;  2JKF A;  1OT6 A;  4LRY C;  2PU4 A;  3UMD A;  5DF7 A;  2WKE A;  5CER A;  4JBF A;  1IKG A;  3V3S A;  4Y13 A;  4JF5 A;  5M1A A;  2ZD8 A;  4NKP A;  3G32 A;  1ZG4 A;  4ETZ A;  5AQ9 A;  1XFN A;  2BLS A;  5FAQ A;  2Y2M A;  1PWC A;  4R38 A;  4QY6 A;  4KQD A;  4U3T A;  5KSC A;  1N4O A;  5KZH A;  1MY8 A;  5FEG A;  5GLA A;  1FSY A;  2Z6D A;  3P98 A;  1T1A A;  2P04 A;  2VV6 A;  2VZW A;  1LLB A;  1GCE A;  4IVI A;  4HJ6 A;  1ODV A;  4PMA A;  1CQA A;  1LI9 A;  4UQI M;  1BLP A;  3UDF A;  3LEZ A;  3IX4 A;  4D60 A;  3H7W A;  4DMZ A;  4HNB A;  4R70 A;  2ZM0 A;  1GHM A;  3MXQ A;  3M6B A;  5EVI A;  5CX7 A;  1E4D A;  3PBT A;  2PRF A;  1DP6 A;  4O7D A;  5J7E A;  4Q0I A;  4IED A;  3SOI A;  2XEP A;  3OOV A;  3T4L A;  1H0M A;  2HDS A;  3E0Y A;  2A3U A;  1N9N A;  4HOI A;  3UB9 A;  1W63 M;  5HD3 A;  1G6O A;  4GW9 A;  4KZA A;  1L3L A;  2A24 B;  2V9A A;  1S66 L;  4GDB A;  2R9X A;  3MFD A;  2QWS A;  3A3I A;  1SZV A;  1N9B A;  3OBF A;  2ZQC A;  4P0M A;  5EVI D;  4O01 A;  3IXD A;  4KQR A;  2V0W A;  2O9B A;  2LB5 A;  3G35 A;  1O07 A;  5TGF A;  2XF3 A;  3MXR A;  4BMW A;  1ALQ A;  1E25 A;  3A3D A;  4MBK A;  4UHU A;  3GMW A;  3TE8 A;  3W4O A;  2ZC4 B;  4EET B;  4GZB A;  3VOL A;  5HPI A;  2J3T C;  5EVE A;  5HPF A;  2WZX A;  2Y2P A;  4Q0H A;  4DKI A;  1P9W A;  4UEY A;  5AVE A;  5CEC A;  3KSH A;  4DJ2 A;  1ONH A;  2UWX A;  3NY4 A;  4EUZ A;  1VET B;  3S7N A;  4RX2 A;  4P6B A;  3Q1F A;  1BLC A;  1XA1 A;  4LRZ E;  3DTK A;  3OCN A;  3LGO A;  1WA9 A;  3C30 A;  1I2W A;  3P09 A;  2IWB A;  4OQG A;  1YLT A;  3BFF A;  3ZFZ A;  1IFQ A;  1IEM A;  4IVK A;  4A5R A;  2ZMF A;  4E3N A;  5FEF A;  5F82 A;  4LV2 A;  1FR1 A;  1MKI A;  4N9L A;  3CWF A;  5JYP A;  3DWK A;  4KG5 A;  3W2Z A;  4RQ9 A;  4X53 A;  4KZ3 A;  3KO6 A;  3PBN A;  3MKF A;  4FH2 A;  3ZCZ A;  4OON A;  2FH5 A;  5F69 A;  4JPM A;  1LSX A;  1MKM A;  1OT9 A;  1ERM A;  3AGF A;  4B88 A;  4NG2 A;  3KYQ A;  3VFH A;  1G6A A;  3CAX A;  4OVD A;  5F6A A;  3ZG7 B;  4ZRR A;  1ERQ A;  3SS4 A;  5CEB A;  3UB6 A;  1FCN A;  1XFQ A;  1BZA A;  4EWF A;  1HTZ A;  2FZ0 A;  3IHA A;  2HP5 A;  3LR3 A;  1JNU A;  1MC0 A;  5AVF A;  3V3R A;  4QY5 A;  1NXY A;  1JWV A;  4JGP A;  4QD4 A;  4BD0 A;  2EX6 A;  2CMN A;  2Z6C A;  2J3W A;  1SHV A;  3I7J A;  5HSQ A;  2J3T D;  3N4I A;  2B18 A;  2P7J A;  2QZ6 A;  2EX2 A;  5HX9 A;  3P01 A;  2EWV A;  3ICY A;  1BLH A;  4R3J A;  2Q9N A;  1RCJ A;  4GN2 A;  2XK1 A;  2B5R A;  1DP8 A;  3HLW A;  3RXX A;  4X1L A;  2PU2 A;  5J8X A;  1W79 A;  3T12 B;  4E3L A;  1TD5 A;  1D7E A;  3PAE A;  2VV7 A;  3FV7 A;  2A2L A;  3EQV A;  1MZU A;  2XH9 A;  4R4R A;  3PBS A;  4QHC A;  5E2G A;  2V8F A;  1W63 Q;  1Z09 A;  5HWV A;  3GTC A;  1E3U A;  3HUM A;  3LIE A;  2V0U A;  3L9K A;  4LCL A;  3UE3 A;  1NZU A;  3HLG A;  4OKP A;  3TJZ C;  4FSF A;  2Y2J A;  4I39 A;  4P85 A;  3VP4 A;  3LIB A;  5F83 A;  3TSG A;  1S1Z A;  3G6O A;  3GV9 A;  2PAV P;  1IEL A;  2L4R A;  4JF6 A;  3K2N A;  2WAE A;  2ZQA A;  3HLC A;  2VKS A;  1E3U D;  3BFE A;  1YMS A;  1F98 A;  1LL8 A;  4MCW A;  2NUT C;  3NDG A;  4ARZ A;  3WRZ A;  4NXG A;  3MZD A;  3IT9 A;  4GHI A;  2FFF B;  4Y15 A;  1NLY A;  5CGS A;  3A0S A;  4BBV A;  5HAR A;  3GEC A;  5EE8 A;  2OWJ A;  2B02 A;  2JC7 A;  5HDD A;  3QHY A;  4M3K A;  2BG1 A;  5HAI A;  3ZDJ A;  3QP1 A;  2ZQ8 A;  4K0X A;  3U4L P;  4Z9Q A;  2E8I A;  3MQ0 A;  3MR0 A;  1K56 A;  2K2N A;  3VOY A;  3LFV A;  5F5Y A;  2ZQ7 A;  2PHY A;  4KZB A;  1DRM A;  2R9W A;  3E2L A;  1LI0 A;  3V50 A;  5G4Z A;  2WKR A;  1HZO A;  5IU1 A;  5A90 A;  5HAQ A;  4R6L A;  4PM8 A;  1PWG A;  2P08 A;  4ZJ1 A;  4HP9 A;  1CI8 A;  5FL3 A;  5DTK A;  1KDW A;  2JBF A;  4XT2 B;  4X1M A;  3OZH A;  3D4F A;  3L7H A;  1K56 D;  3C5A A;  2BTF P;  3DW0 A;  5FAO A;  2XSS A;  5F1G A;  2VGL S;  4BLM A;  4LV3 A;  3S1Y A;  3DWZ A;  2WGI A;  4OLD A;  1YSQ A;  2ZLY A;  3MS6 A;  1H3Q A;  1XJ2 A;  4OPQ A;  2Y91 A;  3N8L A;  2X01 A;  3UPN A;  1TVF A;  4ESP A;  4Y7P A;  2EX9 A;  3IXH A;  3EEA A;  2XRN A;  2GJ3 A;  3KYE A;  5HL1 A;  4WBG A;  2P9V A;  1PW8 A;  4P6Z M;  1LL9 A;  2Y2K A;  3N8S A;  2VLG A;  3ULF A;  3QP2 A;  2QMI A;  3HJK A;  3MZE A;  5TFQ A;  1G28 A;  1YLZ A;  3HVF A;  1KE3 A;  4M4X A;  2IWD A;  3JPU A;  3RTY A;  1CEF A;  4FH4 A;  2XD1 A;  4R1G A;  4NXF A;  2LB9 A;  4EBL A;  1CK3 A;  4HBU A;  3TW8 A;  3Q07 A;  2OV5 A;  4KZ7 A;  1ES5 A;  3BLM A;  2ZC7 A;  5HW3 A;  3H82 A;  5HDS A;  2ZJ9 A;  1RGY A;  4H6J B;  4DN0 A;  3MMH A;  1SDN A;  4WUJ A;  3AGE A;  4I3J A;  3IWI A;  4OOY A;  2JCH A;  4UA9 A;  4QU3 A;  3IXG A;  1P9R A;  3UE1 A;  2ZBB A;  1PZP A;  5CTM A;  5J4E A;  3VP0 A;  4QB8 A;  2H5S A;  4Z1W A;  2DCF A;  4X68 A;  1W5D A;  4NET A;  5AQA A;  3VP1 A;  2A24 A;  1YMX A;  2ZM8 A;  4NK3 A;  1TS7 A;  2DMW A;  3FPV A;  3V67 A;  2HDU A;  3EWK A;  3SH8 A;  4GLQ A;  4OLG A;  5FI6 A;  2WKH A;  2WGV A;  2Y59 A;  3WS5 A;  4GD8 A;  3RXW A;  4R0Q A;  1IYP A;  2PR6 A;  3HLE A;  1XGI A;  3GDI A;  1QME A;  1KVL A;  5A91 A;  4HJ3 A;  2XA7 M;  1GA0 A;  2W3H A;  2VJW A;  2JKG A;  3FYZ A;  4HQA A;  5LBR A;  4G3K A;  5EOO A;  3A3E A;  5KSH A;  4KZ8 A;  5F68 A;  3BW6 A;  4B9O A;  3CLO A;  1VQQ A;  1VET A;  4FCF A;  3LIA A;  3Q82 A;  1F2K A;  2I72 A;  1HD8 A;  4L0L A;  4IUH A;  3R7W A;  4L9E A;  2P9V B;  4AFI A;  3UPP A;  4KG6 A;  1Y4O A;  3A3J A;  4PM7 A;  4B4X A;  3AGD A;  4MN7 A;  1I5Q A;  4OQH A;  1HVB A;  3IXB A;  3BQA A;  3OC2 A;  4EQ1 A;  1IYS A;  3V5M A;  3CIT A;  1T1B A;  1VM1 A;  3H82 B;  3C7V A;  1ZTU A;  4OPY A;  5FQ9 A;  4EU0 A;  2AVX A;  2C6W B;  4U0T A;  3IX3 A;  1S67 L;  3JYI A;  1CF0 A;  5DFY A;  4EES A;  1ZC2 A;  2KX6 A;  5DF8 A;  1RGZ A;  5EEC A;  1XX2 A;  2E8J A;  2Y2O A;  5D3O A;  4ZDX A;  2PD8 A;  4EEP A;  2ZM2 A;  1IYQ A;  5EV0 A;  1SDE A;  3OPP A;  1T19 A;  3S22 A;  1Q2P A;  3IQA A;  5A92 A;  1A0K A;  2ZQD A;  1H5X A;  4WEK A;  4B93 A;  5M18 A;  3NEC A;  3CHW P;  3T4O A;  3BRM A;  3ZGA B;  2ZQ9 A;  3N8R A;  2BAS A;  1L0E A;  3SH7 A;  3OPL A;  4CJN A;  2HF6 A;  2VV8 A;  2KLI A;  1XA7 A;  3F1O B;  2R78 A;  1NRJ A;  4F94 A;  4WM9 A;  4N1H A;  5F1F A;  4WL9 A;  3ITA A; 
#chains in the Genus database with same CATH homology
 4WZ5 C;  3HLW A;  3RXX A;  4CPK A;  4BQM A;  2PU2 A;  3NBL A;  5J8X A;  1W79 A;  3G34 A;  3BYD A;  1K54 A;  2V2F F;  1GA9 A;  5CHM A;  5DTS A;  2ZC5 B;  3GQZ A;  4U0X A;  4E3L A;  3WS1 A;  3WS2 A;  2XLN A;  4BL2 A;  3PAE A;  1BUL A;  1MWS A;  1NJ4 A;  3ZVW A;  3FV7 A;  2Y2G A;  1JWP A;  3EQV A;  2XH9 A;  4R4R A;  3V39 A;  1ES3 A;  4RYE A;  3PBS A;  3Q81 A;  4DDS A;  1K25 A;  4QHC A;  4S2I A;  5E2G A;  4YFM A;  2X02 A;  1E3U A;  3GTC A;  1PIO A;  1XPB A;  5EVI C;  1H8Y A;  3HUM A;  4GD6 A;  1S6R A;  1MPL A;  2G2U A;  1KGE A;  4LCL A;  3OCL A;  3UE3 A;  3LY4 A;  1NZU A;  5CGW A;  3HLG A;  4OKP A;  1K6S A;  5GLB A;  4FSF A;  2Y2J A;  4GDN A;  4P85 A;  3VP4 A;  5G18 A;  4HEF A;  4P87 A;  5F83 A;  1G68 A;  3TSG A;  3UDX A;  2DRW A;  1M6K A;  3GV9 A;  3O86 A;  5AQB A;  4OH0 A;  1FQG A;  1IEL A;  4DE1 A;  4JF6 A;  3G4P A;  3IF6 C;  3NDE A;  2WKI A;  4OQ0 A;  4PM9 A;  3UY6 A;  1S0W A;  5DTT A;  3M6H A;  2WAE A;  2H10 A;  4OQI A;  4ZTK A;  1XXM A;  2ZQA A;  4Q8I A;  3CG5 A;  1YQS A;  2J7V A;  3HLC A;  5GHY A;  2Y4A A;  1E3U D;  5E43 A;  3BFC A;  4MLL A;  4E6W A;  3BFE A;  1YMS A;  4LV0 A;  3PBO A;  5FQQ A;  3NDG A;  3WWX A;  3WRZ A;  4N1X A;  3MZD A;  3IT9 A;  1M40 A;  2FFF B;  5FAP A;  5HAP A;  5CGS A;  1KGF A;  1U60 A;  4WZ5 A;  4S2L A;  3VOZ A;  5HAR A;  1RP5 A;  5EE8 A;  4BL3 A;  4WEL A;  2JC7 A;  1TDL A;  1PYY A;  2PBY A;  2VGJ A;  3MKE A;  3PBR A;  5EOE A;  2Y2N A;  4S2J A;  4Y0O A;  4R23 A;  4S2N C;  4Y0U A;  3B3X A;  3QHY A;  4M3K A;  4E3J A;  2BG1 A;  1DY6 A;  1JWZ A;  5HAI A;  5CED A;  5IHV A;  3ZDJ A;  2ZQ8 A;  1XGJ A;  2EX8 A;  4N9K A;  4K0X A;  4PM6 A;  1ES2 A;  4Z9Q A;  2E8I A;  4DXC A;  4OPR A;  3GSG A;  4OOM A;  2A49 A;  2J8Y A;  2VGK A;  2Q9M A;  4WEJ A;  1PW1 A;  3ZG5 A;  1K56 A;  3HLB A;  3VOY A;  3G2Y A;  2IWC A;  5L2F A;  1MBL A;  4EBN A;  2WAF A;  3LY3 A;  5TR7 A;  3CJM A;  2ZQ7 A;  2WAD A;  3ZG8 B;  4KZB A;  4DRT A;  3ITB A;  3FKV A;  3IHB A;  2R9W A;  5I94 A;  4K91 A;  3M2K A;  3SH9 A;  3E2L A;  5E2H A;  2H0Y A;  3RJU A;  1LI0 A;  3IWO A;  3V50 A;  3G2Z A;  1HZO A;  3ZNT A;  1NYY A;  5A90 A;  4EBP A;  4B4Z A;  4D2O A;  4DF6 A;  5HAQ A;  1MWR A;  4PM8 A;  1WYC A;  2WYX A;  1PWG A;  2C5W B;  2H0T A;  4ZJ1 A;  1PZO A;  4S2P A;  3WS4 A;  4XUZ A;  1CI8 A;  5GLC A;  2EXA A;  1KVM A;  2HP9 A;  5DTK A;  4EV4 A;  5FAS A;  1KDW A;  2JBF A;  4LV1 A;  2Y2L A;  3LCE A;  3OZH A;  1MXO A;  3D4F A;  1W8Y A;  2ZMA A;  3VFF A;  1K56 D;  3BFG A;  4E3O A;  3OPR A;  1MWT A;  4OPZ A;  3C5A A;  3BFD A;  4DE2 A;  5E2F A;  1Y54 A;  1JTG A;  3BEB A;  3DW0 A;  5FAO A;  5F1G A;  3SS5 A;  1IYO A;  3E2K A;  3O87 A;  4ID4 A;  4S2K A;  1H8Z A;  4X56 A;  4LV3 A;  5AQ7 A;  4BLM A;  3S1Y A;  1GHP A;  4JXV A;  2CC1 A;  2FFY A;  3VP3 A;  1NRF A;  2WGW A;  5CXW A;  3DWZ A;  3HLF A;  2EFX A;  1YLY A;  2WGI A;  4MEZ A;  1YLP A;  3O88 A;  4OLD A;  3G31 A;  2ZLY A;  5E2E A;  3ZG0 A;  2WGW B;  3ITA A;  1ES4 A;  1K4E A;  4OP5 A;  4OPQ A;  5CGX A;  3FZC A;  1LL5 A;  1NZO A;  4UA7 A;  1PI5 A;  4X69 A;  3HRE A;  4BJP A;  2Y91 A;  3N8L A;  4JXG A;  4LEN A;  2X01 A;  3UPN A;  3HL9 A;  1TVF A;  5CHU A;  3FWL A;  4Y7P A;  1NYM A;  5FA7 A;  3TOI A;  5GHZ A;  2EX9 A;  2HDQ A;  4JKT A;  1W7F A;  2OLV A;  4E3I A;  5EUA A;  3IXH A;  2EXB A;  1CI9 A;  1J9M A;  2OSU A;  4UA6 A;  5CTN A;  5HL1 A;  2PU4 A;  3NC8 A;  3VP2 A;  3UPO A;  4WBG A;  3GRJ A;  5DF7 A;  2WKE A;  1W8Q A;  3ZHH A;  2P9V A;  1TEM A;  1PW8 A;  3N7W A;  5CER A;  2P74 A;  1LL9 A;  2Y2K A;  4HES A;  1K57 C;  4JBF A;  4KG2 A;  4ZBE A;  1IKG A;  5A93 A;  3V3S A;  4DXB A;  4JF5 A;  5M1A A;  3N8S A;  2ZD8 A;  3OPH A;  5EVL A;  1SCW A;  2QMI A;  3MZE A;  5TFQ A;  1YLZ A;  3BEC A;  4HBT A;  3HVF A;  1KE3 A;  2IWD A;  4C3Q A;  3G32 A;  1CEF A;  1ZG4 A;  5AQ9 A;  4GKU A;  4FH4 A;  3CMZ A;  2XD1 A;  2XQZ A;  1OME A;  4IBX A;  2ZC3 B;  2BLS A;  4R1G A;  5FAQ A;  4MBH A;  4EBL A;  2Y2M A;  1CK3 A;  1PWC A;  4QY6 A;  4BD1 A;  1KDS A;  1L0D A;  3MBZ A;  4HBU A;  3G30 A;  3Q07 A;  4U3T A;  4ZJ3 A;  2OV5 A;  1N4O A;  5KSC A;  3QNC A;  2J9P A;  4KZ7 A;  5KZH A;  1MY8 A;  1ES5 A;  4RVA A;  3BLM A;  4EQI A;  2ZC7 A;  5GLA A;  1FSY A;  4N92 A;  3W4Q A;  5FQM A;  3PAG A;  5HW3 A;  1BSG A;  5FQJ A;  1ERO A;  3P98 A;  2ZJ9 A;  1RGY A;  1K6R A;  3C7U A;  3W4P A;  1LLB A;  1Z6F A;  3HLD A;  2JE5 A;  1SDN A;  1GCE A;  4IVI A;  4XUX A;  3TG9 A;  3AGE A;  1K54 C;  3IWI A;  4OOY A;  4PMA A;  2XGN A;  1LI9 A;  2JCH A;  4UA9 A;  4QU3 A;  3IXG A;  1BLP A;  3WS0 A;  4KEN B;  4R3B A;  3UDF A;  3LEZ A;  3UE1 A;  2HP6 A;  3Q7Z A;  1PZP A;  5CTM A;  4KQO A;  2ZM0 A;  3LO7 A;  5FSR A;  1GHM A;  1JVJ A;  3M6B A;  1IKI A;  3VP0 A;  5EVI A;  3ISG A;  4QB8 A;  2H5S A;  1E4D A;  3PBT A;  1FCO A;  3C4O A;  4O7D A;  4JF4 A;  4IED A;  2DCF A;  3SOI A;  5JYO A;  3IWQ A;  2XEP A;  4X68 A;  5EVI B;  2HDS A;  1W5D A;  2A3U A;  1BUE A;  4NET A;  5AQA A;  5EPH A;  1ZG6 A;  4IBR A;  1K38 A;  3VP1 A;  3N6I A;  2XFS A;  3BM6 A;  1YMX A;  2ZM8 A;  4NK3 A;  3BLS A;  1I2S A;  5DVA A;  4JXS A;  4KZA A;  1K57 A;  2WUQ A;  3IF6 A;  3PTE A;  4R4S A;  2HDU A;  4GDB A;  2R9X A;  4YIN A;  4E3M A;  3MFD A;  3SH8 A;  3A3I A;  4PM5 A;  3WRT A;  2RCX A;  5U47 A;  3IF6 B;  4OLG A;  1N9B A;  2ZQC A;  5FI6 A;  2WKH A;  4P0M A;  3QNB A;  4RA7 A;  4GOG A;  2WGV A;  2Y2H A;  5EVI D;  2Y59 A;  3WS5 A;  1YLW A;  4GD8 A;  3RXW A;  2V1Z A;  4R0Q A;  4JLF A;  3IXD A;  4BEN A;  1IYP A;  4KQR A;  4RX3 A;  5GL9 A;  3HLE A;  3G35 A;  1O07 A;  5TGF A;  1EWZ A;  3O3V A;  1XGI A;  2XF3 A;  3GVB A;  4WMC A;  1QME A;  1K55 C;  1KVL A;  3MXR A;  5A91 A;  1WYB A;  1ALQ A;  1E25 A;  4XXR A;  3A3D A;  3M2J A;  2J9O A;  4MBK A;  4UHU A;  4ZAM A;  4KZ9 A;  1Q2Q A;  1XP4 A;  2WZZ A;  1DJA A;  1GA0 A;  4S2N A;  1KE0 A;  4DDY A;  3GMW A;  3UNW A;  3W4O A;  2ZC4 B;  3FKW A;  3FYZ A;  4OP8 A;  2EFU A;  4GZB A;  3W8K A;  5EOO A;  3A3E A;  5KSH A;  4KZ8 A;  4PPR A;  1YLJ A;  4KZ4 A;  2Y55 A;  2Z2L B;  3UDI A;  3EQU A;  2Y2I A;  2WZX A;  2Y2P A;  1BT5 A;  3CZD A;  4DKI A;  5CEC A;  2WK0 A;  1L0F A;  1GHI A;  1VQQ A;  1JTD A;  1ONH A;  4FCF A;  5FQK A;  2UWX A;  2DNS A;  3UO9 A;  3Q82 A;  3NY4 A;  1ONG A;  2I72 A;  1HD8 A;  3NCK A;  4EUZ A;  3NI9 A;  4L0L A;  4WMC D;  4RX2 A;  2QPN A;  4P6B A;  3PBQ A;  3Q1F A;  2P9V B;  4GB7 A;  1EI5 A;  1QMF A;  1BLC A;  1ESI A;  1XA1 A;  3UPP A;  3OCN A;  1MWU A;  4KG6 A;  4LCM A;  5GHX A;  5FI7 A;  1LHY A;  3A3J A;  4PM7 A;  4C6Y A;  4B4X A;  1I2W A;  2ZC6 B;  5M19 A;  3AGD A;  3IF5 A;  3P09 A;  4S2M A;  4X6T A;  2IWB A;  1PI4 A;  2V20 A;  4E3K A;  1I5Q A;  4OQH A;  4OQG A;  1HVB A;  1L2S A;  1FSW A;  1YLT A;  3IXB A;  4KZ5 A;  3BFF A;  1WE4 A;  1O7E A;  3ZNY A;  3ZFZ A;  3S4X A;  2X71 A;  1FR6 A;  3OC2 A;  5CHJ A;  1YM1 A;  4IVK A;  1IEM A;  1AXB A;  1FOF A;  3VSL A;  4A5R A;  4E3N A;  1IYS A;  3V5M A;  4UAA A;  5F82 A;  4LV2 A;  1FR1 A;  1MKI A;  1NY0 A;  4N9L A;  4DE3 A;  3A3F A;  3DTM A;  5HFO A;  3DWK A;  4KG5 A;  1DJB A;  3MZF A;  5JYP A;  4K0W A;  4X53 A;  1VM1 A;  3C7V A;  4OPY A;  5FAT A;  5FQ9 A;  4KZ3 A;  2C6W B;  2GDN A;  1PWD A;  3PBN A;  5CRF A;  4U0T A;  3C4P A;  1YT4 A;  3SS3 A;  1K55 A;  3MKF A;  4FH2 A;  2RL3 A;  2HDR A;  1BTL A;  4QJG A;  3JYI A;  4WYY A;  2XD5 A;  5FI2 A;  3UN7 A;  5DF9 A;  3ZCZ A;  1ZC2 A;  1L0G A;  1XKZ A;  4C75 A;  4OON A;  2Y2Q A;  5DF8 A;  1RGZ A;  4S2O A;  4E6X A;  3IH9 A;  5EEC A;  1C3B A;  4DE0 A;  1FCM A;  1CEG A;  1XX2 A;  5KMW A;  2Y2O A;  5D3O A;  4JPM A;  4ZDX A;  4Y0T A;  3ZG9 B;  1ERM A;  1TDG A;  2ZM2 A;  3AGF A;  1IYQ A;  4B88 A;  3IH8 A;  3VFH A;  2Z2M B;  1G6A A;  5GLD A;  5FQI A;  4OVD A;  1SDE A;  2XDM A;  3ZG7 B;  1ERQ A;  3SS4 A;  5CEB A;  3MXS A;  3OPP A;  2G2W A;  3S22 A;  1FCN A;  1Q2P A;  1BZA A;  3IQA A;  5A92 A;  5BOH A;  1SKF A;  2ZQD A;  1H5X A;  4WEK A;  4EWF A;  5M18 A;  3VMA A;  4OOL A;  4FD8 A;  1HTZ A;  2XR0 A;  4WZ4 A;  3IHA A;  2HP5 A;  3BRM A;  3ZGA B;  1ESU A;  4MBF A;  3V3R A;  2ZQ9 A;  3N8R A;  1L0E A;  3HUN A;  3GR2 A;  4QY5 A;  3SH7 A;  1NXY A;  1JWV A;  3OPL A;  3Q7V A;  4JXW A;  4QD4 A;  4CJN A;  4H8R A;  4BD0 A;  2EX6 A;  3HUO A;  1DJC A;  1SHV A;  3I7J A;  1KE4 A;  1ZKJ A;  4KZ6 A;  4KQQ A;  1XA7 A;  3VSK A;  3Q7V B;  2XFT A;  3UE0 A;  3HBR A;  3N4I A;  4MNR A;  4F94 A;  2QZ6 A;  1K4F A;  2EX2 A;  5HX9 A;  4WM9 A;  3NIA A;  4GNU A;  4N1H A;  1BLS A;  2OLU A;  4X55 A;  5F1F A;  1BLH A;  2HPB A;  4R3J A;  2Q9N A;  1RCJ A;  5FDH A;  1KGG A;  3ZVT A;  4ZJ2 A;  4GN2 A;  2XK1 A;  2B5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...