4UA6A

Ctx-m-14 class a beta-lactamase apo crystal structure at 0.79 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua6A00
4IBRA 3A3FA 1KDWA 3A3JA 4PM7A 4KZ7A 3ZG7B 4N9KA 1SHVA 4XUZA 4E3OA 1FSWA 4EBNA 5A93A 4OPZA 4N92A 2J7VA 3GTCA 2EX8A 4UA6A 2VGKA 3Q7VB 5DTTA 2ZQ8A 1GHIA 3LEZA 5E43A 1MKIA 2ZJ9A 3NC8A 4KZ3A 3A3IA 3DW0A 1H8YA 1AXBA 3G32A 3IWIA 2XFSA 4P0MA 1W8QA 4OKPA 3FYZA 3N4IA 3Q81A 3ZHHA 3BFDA 1JTDA 4BL2A 1K25A 1K4EA 3DTMA 4PM5A 1CEGA 3CZDA 5FDHA 5HARA 1KGEA 1TVFA 1ZC2A 5HW3A 4XUXA 4E3JA 2HP9A 2A49A 1YMXA 3HBRA 3BRMA 3P98A 4LV3A 5FAPA 4KG2A 4DE1A 4K0XA 4QU3A 1DY6A 3NY4A 2WAEA 1U60A 4R4SA 3UDXA 1FCOA 2G2WA 1EROA 1XP4A 1KE4A 1K56A 2XLNA 2WK0A 4OQ0A 5EUAA 1PI5A 1SCWA 1I2SA 2JBFA 2X71A 3NDGA 1BLCA 2ZM2A 4RX2A 2WGWB 3UN7A 3M2KA 5CTMA 2IWBA 2I72A 4IBXA 2X02A 4OQHA 4DE0A 4EUZA 2Y2MA 1JVJA 3O87A 3ISGA 3OPPA 1SDNA 4LCLA 5KZHA 4ZDXA 5FI2A 4DDYA 4M3KA 2ZLYA 5FQIA 5FQMA 2OSUA 3Q7ZA 4ZJ3A 3G4PA 2XK1A 1PW8A 2HP5A 3BEBA 4H8RA 1YMSA 3FV7A 3SH8A 1W5DA 1PI4A 1XPBA 4OPYA 1K6SA 4WMCA 1N4OA 1NY0A 2CC1A 2WAFA 5JYPA 5F83A 5EVIA 3M6BA 1FSYA 2BG1A 1K4FA 4O7DA 4QD4A 3MZEA 1K54A 5A91A 4JBFA 4P87A 5CEBA 1W8YA 4HESA 4KZAA 1K54C 2EX2A 4OP8A 2WADA 5GLAA 1BLSA 1NYMA 1EWZA 2Y2KA 4U0XA 1ZG4A 2ZQAA 5TR7A 3SH7A 3UPPA 1BULA 1IYOA 1ESUA 2R9WA 2ZC6B 4X6TA 3MXSA 1VQQA 4P6BA 4X56A 2ZD8A 3MZDA 1L2SA 3FKVA 2JC7A 1NZOA 1J9MA 4QY5A 1O07A 5HAQA 5AQ7A 2Q9MA 4RA7A 3WRZA 1IKIA 3HVFA 2ZMAA 3MKEA 4X68A 4JXVA 4KZ9A 2RCXA 3IXBA 4U0TA 2Z2MB 1M6KA 5G18A 4WZ5A 5M18A 3O88A 1IELA 2Y59A 3Q7VA 2Y2LA 4OLGA 5M19A 4WZ5C 1Z6FA 1PZOA 3OZHA 3V3SA 3S4XA 1H5XA 3G30A 2ZC5B 2HDSA 4JKTA 4WM9A 3VOYA 4KZ4A 3TG9A 3HUOA 3IHBA 4R23A 5CGWA 4C75A 5L2FA 1NXYA 1ESIA 1IYQA 1YM1A 2XEPA 4GZBA 2Y2JA 1L0GA 2EXBA 3UPNA 1PIOA 1LI0A 4BLMA 3WS2A 2XD5A 3TSGA 1E25A 1PYYA 3IWOA 3Q1FA 4QB8A 4FH4A 3EQVA 1KE3A 2HDQA 5CERA 3AGFA 5FASA 2ZC4B 1GHPA 1VM1A 5TGFA 3C7VA 1Y54A 1E3UA 2DRWA 3IH9A 5CGXA 5KSHA 4LV0A 3G35A 4QY6A 2Y2GA 2JCHA 3IT9A 1KGFA 3TOIA 1ALQA 5CHJA 4GD8A 2EFXA 2Y2QA 3N8SA 3UDIA 2E8IA 2WGWA 1PW1A 3SS5A 4R3BA 2H0TA 3VFHA 2J9OA 1K55A 4GN2A 3RXXA 3Q07A 4K0WA 4ID4A 1FCNA 1K55C 1FCMA 2WYXA 2OLVA 2R9XA 1HVBA 1YLWA 5BOHA 4QHCA 3PAEA 3ZDJA 4UAAA 4ZTKA 4FCFA 5AQBA 2HP6A 3UE3A 3VFFA 3HLGA 4OOYA 3BFFA 4MBKA 3VSLA 5EVLA 3BYDA 4S2OA 2WKIA 1QMEA 3UNWA 1CI9A 3HLEA 2WZZA 3FZCA 1CI8A 2Y4AA 4S2PA 5EVID 3S22A 2RL3A 1NZUA 2WGIA 1W7FA 4LV2A 1RCJA 2XQZA 2Q9NA 1KDSA 3W4OA 1GA9A 2HDRA 4S2NA 5FQKA 3ZNTA 3G2ZA 4S2LA 3IWQA 3JYIA 4FSFA 3QNCA 4S2NC 1KE0A 3ZG9B 5E2EA 4Y7PA 4Q8IA 2G2UA 3OCLA 2Z2LB 2J8YA 4C3QA 1L0DA 3WWXA 1Q2PA 1S0WA 5HL1A 1GA0A 1K38A 3C4PA 1BUEA 3GQZA 3LO7A 2ZQ7A 4UHUA 3NCKA 4Z9QA 3N7WA 3ZNYA 2WKEA 1FQGA 1LI9A 3ZVWA 5CXWA 4LENA 3VP2A 4S2JA 1MY8A 4RYEA 3RXWA 3DWKA 3BFGA 1YLYA 1YT4A 1LHYA 1I5QA 1G68A 2VGJA 2ZC7A 4R1GA 2GDNA 4S2IA 4B4XA 2XH9A 4GNUA 1PZPA 3WRTA 1K6RA 4JF6A 2C6WB 3MFDA 5GLBA 3N8LA 4R4RA 4OLDA 4WELA 4C6YA 1MWRA 5HX9A 1TDGA 3QNBA 3GR2A 3SS3A 4WYYA 1PWDA 5CGSA 1XGJA 3FWLA 5JYOA 4ZBEA 5CEDA 3PTEA 4KZBA 1JTGA 1ERMA 1W79A 3W4PA 3C4OA 5DVAA 4X55A 3UDFA 1MBLA 1OMEA 5HAIA 3VOZA 4E3LA 3G2YA 3M6HA 4S2KA 2H0YA 3BLSA 1KGGA 4MNRA 2ZM8A 4B4ZA 4LV1A 1IYPA 4GDNA 4QJGA 3CMZA 2UWXA 1E3UD 1ONHA 3V50A 1RGYA 1YQSA 3VP3A 1BLHA 2B5RA 1C3BA 2FFFB 1LL5A 3D4FA 4GOGA 3IQAA 3NDEA 2Y2HA 4JXSA 5FAOA 2EXAA 3GV9A 2XGNA 3IF6C 3SS4A 4N1XA 3HLWA 4EV4A 2DCFA 3E2LA 5HFOA 4BD1A 3A3EA 4MLLA 1MXOA 4E3MA 4GDBA 4NK3A 4OQIA 4IVKA 4OONA 4E3NA 1MWSA 3CG5A 4ZAMA 3N6IA 1N9BA 5F82A 5FATA 2IWDA 1GHMA 3ZVTA 4D2OA 4E6XA 4DE3A 3HLDA 1ZKJA 4E3KA 4PM8A 1FOFA 4EWFA 3OPHA 3OCNA 1IEMA 3W8KA 4Y0UA 4KENB 1O7EA 1L0EA 5CRFA 2ZM0A 5D3OA 2WZXA 4FH2A 4PM9A 5DF8A 1XX2A 4RVAA 5F1GA 3GRJA 1Q2QA 4DKIA 5FI6A 1PWGA 1ES5A 2HPBA 4UA9A 2V20A 3IF6B 3ZG0A 4JPMA 2OLUA 4R3JA 1ES4A 4DDSA 1ZG6A 2ZQCA 2QPNA 3ZGAB 1K56D 3GSGA 4KQOA 3O86A 1DJCA 5A90A 4KZ8A 1ES2A 4KZ5A 5GLCA 3VP0A 5KSCA 1CEFA 4DE2A 1SKFA 3HREA 4DRTA 5CTNA 5EOEA 1ES3A 1XKZA 2XF3A 4WBGA 4YINA 3LY3A 2J9PA 3HLCA 4OQGA 5FI7A 3VP1A 5GHXA 4N1HA 3CJMA 5GHZA 4EBPA 2Y2OA 3W4QA 1S6RA 1WYCA 3IXGA 4EBLA 4X69A 1MWUA 1RP5A 3ITBA 5M1AA 1LLBA 2V1ZA 3PBRA 4WMCD 3WS4A 1DJBA 3N8RA 4U3TA 3V5MA 4A5RA 1L0FA 3PAGA 1IYSA 4ZJ2A 3HLBA 2Y2NA 1M40A 5EPHA 1PWCA 1HTZA 4JLFA 5CHMA 3LY4A 4KG6A 1TDLA 4YFMA 4WEKA 4OH0A 2XDMA 2ZQDA 4MBFA 3IH8A 1BLPA 3O3VA 3UPOA 1YLTA 2EFUA 4OP5A 1IKGA 4B88A 3BFCA 2XFTA 1BTLA 5DF9A 2Y55A 1G6AA 4FD8A 1YLPA 1HZOA 3ITAA 5CECA 3UY6A 1FR6A 4KG5A 3ZG5A 1XGIA 1WE4A 5FQ9A 3SH9A 1K57A 3OPRA 2IWCA 3C7UA 5EE8A 1K57C 4IEDA 4PM6A 4HBTA 4JF5A 4Y0OA 3V39A 1QMFA 3BECA 3I7JA 5FQQA 4OPQA 4CPKA 3HLFA 2WKHA 3PBNA 4JXGA 3RJUA 4LCMA 1NYYA 4KQRA 4OOLA 3ZFZA 4HEFA 3G34A 2PBYA 1NJ4A 4IVIA 2HDUA 4WEJA 1EI5A 5EECA 3BLMA 4DF6A 1XA7A 2Y91A 3A3DA 4XXRA 1KVLA 4OOMA 3WS5A 3PBSA 3UE1A 3UE0A 2P74A 2PU2A 2Y2IA 3GMWA 4BENA 4MEZA 3QHYA 4CJNA 5FQJA 4EQIA 2Y2PA 3S1YA 3VSKA 1BZAA 3LCEA 4GD6A 2H5SA 5TFQA 3PBQA 3DWZA 4UA7A 4OPRA 5EVIC 2ZQ9A 4BD0A 3G31A 5GLDA 2V2FF 4NETA 4PPRA 4ZJ1A 3IXDA 2DNSA 4E3IA 2H10A 4KQQA 5GL9A 4DXBA 3ZG8B 4RX3A 4BQMA 1SDEA 2XR0A 3MKFA 3PBOA 4JF4A 4JXWA 1DJAA 3AGEA 5DTKA 3OPLA 3EQUA 4KZ6A 5FSRA 1JWVA 2P9VA 1CK3A 3IF6A 4GKUA 2JE5A 4HBUA 5IHVA 2FFYA 5HAPA 5J8XA 3VMAA 1RGZA 2PU4A 2QZ6A 3HL9A 4N9LA 3SOIA 4GB7A 1JWPA 1YLJA 3PBTA 2A3UA 4L0LA 2QMIA 3IXHA 3Q82A 4WZ4A 2BLSA 1MPLA 4E6WA 2XD1A 1XXMA 3FKWA 2ZC3B 4BJPA 3HUMA 3HUNA 1BT5A 5E2FA 5DF7A 1I2WA 1JWZA 5FAQA 5GHYA 3BM6A 1BSGA 3OC2A 3VP4A 4Y0TA 3WS1A 1GCEA 2OV5A 5E2GA 5I94A 5EVIB 3WS0A 5AQAA 1HD8A 2EX9A 1YLZA 5E2HA 3MZFA 3NBLA 3V3RA 3IF5A 1ERQA 3UO9A 3MBZA 3C5AA 5F1FA 3NIAA 5CHUA 4MBHA 5FA7A 1LL9A 3P09A 4K91A 4R0QA 3ZCZA 4X53A 3NI9A 5KMWA 2X01A 4F94A 3MXRA 5EOOA 5U47A 3GVBA 2WUQA 5A92A 3E2KA 4BL3A 4DXCA 2P9VB 2WGVA 4S2MA 1ONGA 4P85A 5DTSA 1TEMA 3AGDA 5AQ9A 3BFEA 1MWTA 3M2JA 1H8ZA 1WYBA 1XA1A 2C5WB 3IHAA 4OVDA 1NRFA 4PMAA 1KVMA 1FR1A 2EX6A 1E4DA 3B3XA
chains in the Genus database with same CATH superfamily
3A3JA 5DFXA 4XUZA 1P0ZA 5IS1A 5A93A 2PAVP 4N92A 5F68A 3GTCA 2ZQ8A 2ZJ9A 4O01A 4P0MA 1FIKA 4BL2A 1D7EA 1EW0A 1K4EA 4PM5A 5HARA 2M1CA 4ETZA 2HP9A 1YMXA 3BJNA 3P98A 4KG2A 5C5KA 2ZOIA 4R4SA 1FCOA 2G2WA 3S7QA 1CJFA 4OQ0A 4KUOA 3NDGA 2XA7M 4H6JA 4Q0JA 1JVJA 5KZHA 4Y15A 3SH8A 1XJ3A 2WAFA 2DMWA 5F83A 4EXOA 5EVIA 3MZEA 1S4RA 2M7UA 5CEBA 4GHIB 3BWLA 4U0XA 1ZG4A 2ZQAA 3SH7A 2R9WA 2ZC6B 4YWZA 5A8BA 3FKVA 1J9MA 4QY5A 5AQ7A 3MXQA 1IKIA 2J3TC 4U0TA 3Q7VA 5M19A 2Y2LA 1OT9A 1WA9A 1Z6FA 4Q0IA 3OZHA 1H5XA 2VV8A 3HUOA 1IYQA 1YM1A 2VEAA 2XEPA 2Y2JA 3CUEA 3K2NA 3LEQA 1PIOA 1LI0A 2PYRA 1XFNA 3Q1FA 1LSWA 5CERA 3AGFA 2ZC4B 3IBRA 2JHEA 5TGFA 3C7VA 1Y54A 4LV0A 3G35A 1T19A 3UMDA 5HWTA 5CHJA 1OJ5A 4ZRRA 2EA9A 5DJTA 1VB6A 3F1PB 4R3BA 3VFHA 1A0KA 2R9XA 4QHCA 1X0OA 4I3JA 4OOYA 2E8JA 3VSLA 5EVLA 3BYDA 3F1OA 3UNWA 2WZZA 1CI8A 3S22A 2RL3A 1OTIA 3T4LA 3CI6A 2XQZA 5HDDA 4P6ZS 2HDRA 4S2NA 3ZNTA 4M4XA 3G2ZA 1AWIA 4Y7PA 1UGUA 3OCLA 2Z2LB 2QJ7A 4WLAA 4C3QA 2KX6A 4FOFA 4KQDA 1K38A 3GQZA 3LO7A 1BUEA 3MQ0A 4NEED 2CMNA 3ZNYA 4LENA 3VP2A 4S2JA 3RXWA 4EW7A 3DWKA 4WN5A 4IUHA 1I5QA 2YKHA 4S2IA 3EEAA 1N9OA 4Y5FA 1PZPA 1K6RA 3VOLA 5GLBA 4OLDA 1GSXA 3PTEA 1ERMA 3W4PA 2W1RA 3UDFA 3G2YA 4S2KA 4X1MA 2H0YA 3BLSA 4MNRA 4B4ZA 1IYPA 4R38A 3VP3A 2FFFB 4GOGA 3D4FA 2EXAA 3IF6C 3SS4A 3HLWA 4GCZA 5DKKA 2DCFA 2HJ9C 4XT2A 1FILA 1MWSA 5FEGA 4ZAMA 2BASA 2Y79A 4GLQA 4I5SA 4Y17A 5FATA 3LI8A 4F3LA 3DTIA 3H9WA 4NG2A 4DE3A 4BBUA 1FOFA 3G6OA 3EGDC 1IEMA 4KENB 3MMHA 2UV0E 4RVAA 1Y4OA 1PWGA 3IF6B 2OLUA 1ES4A 3E4PA 1ZG6A 3ZGAB 5KIZA 4KQOA 1ES2A 4KZ5A 3VP0A 4CLCC 1SKFA 2JN7A 1DRMA 2O9AA 4WBGA 3HLCA 4N1HA 3CJMA 2Y2OA 1MWUA 3WS4A 4WMCD 1TS7A 1DJBA 3N8RA 4U3TA 1IYSA 4ZJ2A 1HTZA 5HPFA 2JKTM 4KG6A 1TS0A 4WEKA 2W0NA 1ZHHB 3BFCA 2XFTA 5DF9A 2Y55A 4FD8A 2QJ5A 2INWA 3R7WB 2OAP1 5EE8A 3B33A 2Q0OA 4HBTA 4JF5A 3V39A 4L9FA 1QMFA 3BECA 1T1BA 3CITA 4CPKA 3HLFA 3RJUA 2W3EA 4LCMA 4L9GA 2K7SA 3H82B 4HJ6A 2ZBBA 2PBYA 2HV1A 5EECA 3A0SA 4ARZA 4OOMA 4QPRA 2PU2A 3CPTA 3QHYA 3NULA 3DWZA 3NECA 3G31A 5GLDA 4PPRA 4ZJ1A 4DXBA 5GL9A 3PR6A 3NHQA 2HZ5A 3EQUA 1JWVA 1CK3A 2JE5A 5HAPA 5J8XA 4QWOA 4E04A 3T1RA 1YLJA 3NOTC 5EM0A 3Q82A 4WZ4A 2B02A 2D02A 2XD1A 1XXMA 2ZC3B 4GW9A 5E2FA 5DF7A 1I2WA 5IU1A 3OC2A 2NUPC 4EESA 1CF0A 5J4EA 3V3RA 1F98A 1ERQA 3LR3A 2W1TB 5CHUA 3LI9A 4MBHA 5HL6A 3ZCZA 2MJ6A 5EFWA 2X01A 3MXRA 5EOOA 3GVBA 1SKOA 1ACFA 3KX0X 4G3VA 1VEUA 3DAVA 4EERA 1MWTA 1S4SA 4LGWA 4OVDA 4Y3IA 4YNRA 5J3WA 1NLYA 2EX6A 1KDWA 4PM7A 4E3OA 3MF0A 1FSWA 1F9IA 4OPZA 2VGKA 1S67L 1UWNX 4KZ3A 3A3IA 3C30A 3DW0A 3L9KA 4HP4A 1ZTUA 4WL9A 5G4ZA 4X25A 3IWIA 4EUVA 4OKPA 1TF1A 3FYZA 1G28A 1K25A 2VKSA 3DTMA 3B42A 5EM1A 5HW3A 5FAPA 2WAEA 3H7WA 5CX7A 1EROA 4Q0HA 1XP4A 3D9YA 2X71A 3T12B 3M2KA 2IWBA 3KSIA 3O87A 2J80A 1OTAA 5FQIA 2OSUA 3G4PA 4H8RA 3S7OA 3B47A 4WMCA 1NY0A 5JYPA 3MSHA 3M6BA 2V8CA 3KSGA 5A91A 4JBFA 1W8YA 1K54C 2EX2A 2VGLS 4OP8A 1N9LA 5TR7A 4X6TA 3MXSA 3JVVA 3MZDA 3C8CA 1O07A 2PHYA 3LR5A 4DJ3A 1VETA 3DBAA 1IOUA 4JXVA 4KZ9A 5G18A 3F1PA 5L10A 3T4KA 4WM9A 4JKTA 2HDSA 3KO6A 5CGWA 2KOIA 4NXEA 5L2FA 5HWWA 4BLMA 3WS2A 4MN7A 1F2KA 1E25A 3EQVA 1KE3A 5FASA 1KOUA 1E3UA 2DRWA 3IH9A 3LUQA 3ZYTA 4QY6A 3T4QA 1KGFA 3TOIA 1ALQA 2XA7S 4HP9A 5I5LA 3UDIA 2WGWA 1PW1A 2H0TA 3QP5A 4GN2A 3NOPC 4R3AA 2WYXA 2OLVA 4UEYA 5BOHA 3UE3A 4PHTA 5L09A 4S2OA 5TJJA 1T1CA 2WKIA 5EVEA 2P08A 2VA0A 3CWFA 4GS9B 4Y2FA 1SZVA 2Y4AA 1PNEA 4II7A 3A0VA 4MN6A 2Q9NA 4MMNA 1G5UA 3IWQA 4FSFA 4Q8IA 3OLOA 5HL1A 4UHUA 4Z9QA 1LI9A 5CXWA 5FL3A 3BFGA 1YLYA 3KSHA 1LHYA 2VGJA 2ZC7A 2GDNA 2XH9A 4GNUA 5CGSA 1XGJA 5CEDA 1T1AA 4Y13A 5DVAA 4X55A 3RTYA 1MBLA 4HQAA 5HAIA 4E3LA 4UQIM 3M6HA 1S1ZA 1ODVA 2ZM8A 2QYBA 5L07A 4QJGA 1ONHA 1S66L 2PDRA 3IQAA 4JXSA 5FAOA 3QP6A 3IBJA 4N1XA 5TBMA 3A3EA 4FTXA 1MXOA 4NK3A 4OQIA 4IVKA 3CG5A 3N6IA 1N9BA 3T4SA 5F82A 2JKGA 1ZKJA 4WUJA 4EWFA 3OCNA 5CRFA 3IX8A 2WZXA 4PM9A 5DF8A 5F1GA 3GRJA 2D01A 3NJAA 1ES5A 4UA9A 5EV0A 2V20A 3ZG0A 4DDSA 4CLCA 1XJ6A 1DJCA 4HHDA 4DE2A 5EOEA 3VP1A 2OWHA 5JYOA 2J9PA 4OQGA 5GHZA 4EBPA 3ITBA 5M1AA 3PBRA 3PAGA 1L3LA 5EPHA 1PWCA 4LRZE 1TDLA 1YPRA 2ZQDA 3O3VA 2EFUA 4YOFA 3F1NA 4HH2A 3LIBA 3C2WA 3ITAA 1XGIA 4G3KA 3SZTA 4PM6A 3RH8B 4Y0OA 3I7JA 2PT7A 1NYYA 4KQRA 4LFUA 2HDUA 4WEJA 2ZL1B 1EI5A 4DF6A 2Y91A 1NWZA 3WS5A 3KYZA 3PBSA 3UE1A 3GMWA 4BENA 2W3HA 3LCEA 3RFBA 2H5SA 3T1SA 2B18A 5EVIC 2W1TA 3MS6A 2V2FF 2DNSA 2H10A 2A24B 1SDEA 3PBOA 4JF4A 2K31A 3P7NA 1OJGA 5DTKA 4KZ6A 5FSRA 3LYXA 2PU4A 4R6LA 2QZ6A 4N9LA 1JWPA 4LRYC 1OTBA 4L0LA 2O9CA 3IS2A 3CHWP 1LSXA 3FKWA 4BJPA 3HUNA 1BT5A 2IA2A 3VE4A 3E4QA 1BSGA 3VP4A 1GSVA 1NLZA 4Y0TA 3WS1A 5E2GA 5EVIB 3UO9A 3C5AA 2J3WA 3NIAA 4ME4A 5FA7A 1LL9A 3P09A 4R0QA 3GECA 5KMWA 2Y8HA 4F94A 3E2KA 4BL3A 2P9VB 3MQQA 3D72A 4S2MA 4P85A 3TJZC 1TEMA 4BBVA 1TS6A 3M2JA 1WYBA 3LR0A 1XA1A 1NRFA 4PMAA 2B95A 3B3XA 4IBRA 2VX8A 3A3FA 4N9KA 4EBNA 1DP8A 2EX8A 2VV6A 3Q7VB 4L9EA 1MKIA 4D60A 3NC8A 2PD8A 4NXGA 3HCYA 1W8QA 4HH3A 4HJ4A 3KYQA 3ZHHA 1JTDA 3UB8A 2VV7A 3EOIA 5FDHA 1KGEA 1TVFA 1ZC2A 2L0WA 4XUXA 4E3JA 1VHMA 3R4KA 3HBRA 3BRMA 4LV3A 4DE1A 2ACGA 4QU3A 3QP1A 3NY4A 4HJ3A 1K0KA 1KE4A 2XLNA 2JBFA 1I2SA 1W63Q 4I39A 2ZM2A 3UN7A 1OPXA 4IBXA 4DE0A 4EUZA 3OPPA 1SDNA 4ZDXA 5FI2A 4M3KA 2ZLYA 5FQMA 2W3FA 2XK1A 3BEBA 1YMSA 5J7EA 1W5DA 1PI4A 1XPBA 1K6SA 4NKPA 1N4OA 1OTDA 2CC1A 3BW6A 3F1OB 1FSYA 2BG1A 4O7DA 4QD4A 4EQ1A 1MKMA 1P97A 1K54A 2LB9A 4P87A 4HESA 4KZAA 2WADA 2GZAA 1NYMA 1EWZA 2Y2KA 1BULA 1ESUA 1VQQA 4P6BA 2OOLA 2R78A 4X56A 3TRCA 2JC7A 1NZOA 3MR0A 3WRZA 3MKEA 2GJ3A 3IXBA 2Z2MB 5M18A 5L8MA 4WZ5C 1PZOA 3S4XA 2ZC5B 3VOYA 3TG9A 3IHBA 4R23A 4C75A 1ESIA 2OAQ1 4GZBA 2EXBA 3UE6A 3LIEA 3BQ8A 5G4YA 1VM1A 4DMZA 5KSHA 3PHYA 2Y2GA 4GD8A 2Y2QA 1D06A 3N8SA 3O5YA 2EWVA 3SS5A 2O9BA 2J9OA 5DJUA 3Q07A 4ID4A 1FCNA 1K55C 3PAEA 4ZTKA 3W2ZA 4FCFA 3HLGA 3BFFA 4F3LB 4MBKA 1XJ2A 3JPUA 4ESPA 1QMEA 3HLEA 5EVID 1NZUA 4GHIA 2WGIA 4EEUA 4LPZA 2P7JA 5FQKA 4AFIA 4EU0A 1KE0A 3ZG9B 3FC7A 2J8YA 1PFLA 1L0DA 1YAXA 3EEHA 1S0WA 3C4PA 2ZQ7A 2EWWA 2WKEA 1H0MA 1H3QA 1FQGA 3ZVWA 4DJ2A 1YT4A 3EGXC 2Z6CA 3T50A 4JF6A 2C6WB 3N8LA 4R4RA 4WELA 1TDGA 2HF6A 3GR2A 3DTEA 3QNBA 1D1JA 4Z1WA 3TW8A 1GSWA 4KZBA 1JTGA 1W79A 3OOVA 3C4OA 3VOZA 2XRNA 2JKFA 1KGGA 3HJIA 4IJGA 4LV1A 1RGYA 1BLHA 1C3BA 5F6AA 3NDEA 3GV9A 5HFOA 3QP8A 2WKPA 4GDBA 4OONA 4ARZB 3CPTB 3U4LP 2IWDA 3LIFA 1GHMA 1DP6A 4E6XA 3HLDA 4E3KA 2W3GA 3OPHA 4LLOB 3W8KA 4CQHA 4Y0UA 4K08A 4FH2A 1Q2QA 2HPBA 4MN5A 4JPMA 4R3JA 3LR4A 2ZQCA 1K56D 5A90A 4KZ8A 5GLCA 2WKQA 1H8MA 1ES3A 1XKZA 2XF3A 4I38A 4YINA 3LY3A 5FI7A 5HPIA 5GHXA 3OBFA 3IXGA 4X69A 1G6OA 4BMWA 3V5MA 4A5RA 1L0FA 4KUKA 3HLBA 2Y2NA 2ZL1A 1SKOB 4OH0A 4MBFA 3IH8A 1BLPA 1YLTA 2YKFA 1VEUB 1IKGA 4B88A 4UQIS 1BTLA 3BQAA 5CECA 3UY6A 1FR6A 5FQ9A 3SH9A 2IWCA 1F5MA 1K57C 3E0YA 2A24A 4OPQA 2WKHA 3PBNA 4EEPA 4OOLA 4MCWA 4HEFA 1NJ4A 1HLUP 2G7UA 5IT5A 1KVLA 2P74A 5K5BA 1UWPX 2VJWA 2Y2PA 3S1YA 4EQIA 3EWKA 3VSKA 4GD6A 5TFQA 3PBQA 3H7WB 3IXDA 5DFYA 3IX3A 4KQQA 4B9OA 4E3IA 3ZG8B 3C38A 1DJAA 3AGEA 3OPLA 2P9VA 3IF6A 4GKUA 4HBUA 3KSFA 4GB7A 4NXBA 5AJGA 2A3UA 3FPVA 3IXHA 2BLSA 4JGPA 3PYPA 1JWZA 5GHYA 4BBTA 1GCEA 5I94A 5AQAA 2EX9A 1V9ZA 3NBLA 1CQAA 3IF5A 3MBZA 2K2NA 5F1FA 4K91A 4X53A 2M7VA 1Y28A 5U47A 3S7NA 3A0RA 2WUQA 4DXCA 1V9YA 4BWIA 5DTSA 3AGDA 5AQ9A 4HI4A 3BFEA 3SW1A 2C5WB 2FH5A 1FR1A 1T18A 3R7WA 1E4DA 4G3WA 4GJ4A 2ZOHA 1VETB 3KYEA 4KZ7A 3ZG7B 1SHVA 2QWSA 3ZQ5A 3UB9A 2J7VA 4UA6A 5GLAA 5DTTA 1GHIA 3LEZA 5E43A 3H82A 1H8YA 1AXBA 3VV4A 3G32A 2LB5A 2XFSA 3N4IA 3Q81A 3BFDA 4ETXA 1CEGA 1STZA 3CZDA 2A49A 2HGVA 4K0XA 1DY6A 3T1QB 1U60A 3UB6A 3UDXA 5AVEA 4FUWA 1K56A 2WK0A 5EUAA 2AVXA 1PI5A 1SCWA 1BLCA 4RX2A 2WGWB 4O0PA 1LT0A 5CTMA 2I72A 4I3AA 2X02A 4OQHA 4O8GA 2Y2MA 3ISGA 4LCLA 1W63M 2GNXA 4DDYA 3MJQA 3E4OA 2QKPA 3CAXA 3Q7ZA 4ZJ3A 3D3OA 1N9NA 4HIAA 1PW8A 2HP5A 3FV7A 4OPYA 3T1XA 1K4FA 1YKDA 3LGOA 4I3IA 3IX4A 1J3WA 3BY8A 3K3CA 1BLSA 2A2LA 1S1YA 3UPPA 1IYOA 3LIAA 1XFQA 4H6JB 2ZD8A 4P6ZM 1L2SA 3QP2A 2VLGA 5HAQA 2Q9MA 4RA7A 3UB7A 5F69A 3HVFA 2ZMAA 4DN0A 2H28A 4X68A 2PD7A 2PBDP 2RCXA 1M6KA 4WZ5A 3O88A 1IELA 2Y59A 4OLGA 1IFQA 2GX5A 1TD5A 3V3SA 3G30A 2BTFP 4KZ4A 2O0YA 3JVUA 1NXYA 1JNUA 3UPNA 1XJ4A 1L0GA 2V1AA 3CUEC 2XD5A 3TSGA 1PYYA 3IWOA 4QB8A 1DP9A 4FH4A 2HDQA 1GHPA 3L7HA 1P9RA 5CGXA 2W27A 3TE8A 2JCHA 3IT9A 3HJKA 2EFXA 2PR6A 2P04A 2E8IA 1YSPA 1K55A 5TBMB 3RXXA 4K0WA 1FCMA 3U2AA 1HVBA 1YLWA 3ZDJA 4UAAA 5AQBA 2HP6A 3VFFA 1TS8A 3ICYA 2V1BA 1CI9A 3FZCA 4S2PA 1W7FA 4LV2A 4X1LA 1RCJA 1KDSA 3W4OA 1GA9A 5HDCA 5AVFA 3DTKA 4EETB 2PYPA 4S2LA 1LL8A 4S2NC 3JYIA 3QNCA 1YSQA 3LIDA 2VK3A 5E2EA 4CLCB 2G2UA 3VE3A 3BY9A 2FZ0A 2I9VA 3WWXA 1Q2PA 5HZHA 1GA0A 5MC7A 3NCKA 3N7WA 4PKYG 1MY8A 2J3TD 4RYEA 4PAUA 1G68A 4R1GA 4B4XA 4JGQA 2ZMVA 4LRXC 3WRTA 3MFDA 4C6YA 2WKRA 1MWRA 2JKRM 2KLIA 5HX9A 3SS3A 4WYYA 1PWDA 3FWLA 4ZBEA 1Z09A 3F1NB 1NRJA 5HWVA 1P9WA 4JGRA 1OMEA 2NUTC 4IHQA 4GDNA 5HDSA 3CMZA 2UWXA 4HOIA 1E3UD 2V9AA 3V50A 1YQSA 3UMEA 5FEFA 2B5RA 1LL5A 2V0UA 2Y2HA 2XGNA 2KDKA 4IUKA 4EV4A 3E2LA 4BD1A 4MLLA 4E3MA 4E3NA 4R70A 2OWJA 3T4OA 2W3DA 3ZVTA 4D2OA 4PM8A 4MDZA 4GS9A 1O7EA 1L0EA 2ZM0A 5D3OA 2Z6DA 1XX2A 4DKIA 4CLCE 5FI6A 4NXFA 3V67A 3K3DA 2QPNA 3GSGA 4HNBA 3O86A 2VZWA 1PRQA 3IS2B 3QP4A 3T4JA 4XT2B 5KSCA 1CEFA 3HREA 4DRTA 5CTNA 1BYWA 3FPWA 3W4QA 1S6RA 2PR5A 1WYCA 3MFXA 4EBLA 1RP5A 1LLBA 2V1ZA 2V0WA 1MZUA 5HD5A 1M40A 4JLFA 5CHMA 3LY4A 4YFMA 2XDMA 3UPOA 4OP5A 1G6AA 1YLPA 1HZOA 4WF0A 4KG5A 5LBRA 3ZG5A 1WE4A 3NOUC 1K57A 3OPRA 3C7UA 5FDSA 4IEDA 3P01A 5FQQA 5HSQA 4JXGA 2O99A 2L4RA 4HY8A 1OT6A 1LSVA 3E98A 3ZFZA 3G34A 4IVIA 2L1MA 3FG8A 3BLMA 1XA7A 3A3DA 4XXRA 1MC0A 3UE0A 2Y2IA 4MEZA 3T4TA 4CJNA 5FQJA 3UB5P 1BZAA 4UA7A 4OPRA 4BD0A 2ZQ9A 4JGOA 4RQ9A 4NETA 3S7PA 4B93A 4BQMA 4RX3A 2XSSA 2XR0A 3GDIA 3MKFA 2V8FA 4JXWA 2QHKA 5IHVA 2FFYA 3VMAA 1RGZA 3HL9A 3SOIA 3PBTA 2QMIA 4E6WA 1MPLA 2JKTI 3HUMA 4CLCD 5FAQA 3LFVA 3BM6A 5HD3A 2OV5A 3WS0A 1HD8A 1YLZA 3MQOA 3MZFA 5E2HA 2PRFA 2HJEA 5F5YA 5DKLA 1OTEA 3LICA 3NI9A 5A92A 2VGLM 3ULFA 2WGVA 2XROA 1ONGA 4PKYA 2ZMFA 3PXPA 1H8ZA 3IHAA 1KVMA 2JKRI 3CLOA
chains in the Genus database with same CATH topology
4IBRA 3A3FA 1KDWA 3A3JA 4PM7A 4KZ7A 3ZG7B 4N9KA 1SHVA 4XUZA 4E3OA 1FSWA 4EBNA 5A93A 4OPZA 4N92A 2J7VA 3GTCA 2EX8A 4UA6A 2VGKA 3Q7VB 5DTTA 2ZQ8A 1GHIA 3LEZA 5E43A 1MKIA 2ZJ9A 3NC8A 4KZ3A 3A3IA 3DW0A 1H8YA 1AXBA 3G32A 3IWIA 2XFSA 4P0MA 1W8QA 4OKPA 3FYZA 3N4IA 3Q81A 3ZHHA 3BFDA 1JTDA 4BL2A 1K25A 1K4EA 3DTMA 4PM5A 1CEGA 3CZDA 5FDHA 5HARA 1KGEA 1TVFA 1ZC2A 5HW3A 4XUXA 4E3JA 2HP9A 2A49A 1YMXA 3HBRA 3BRMA 3P98A 4LV3A 5FAPA 4KG2A 4DE1A 4K0XA 4QU3A 1DY6A 3NY4A 2WAEA 1U60A 4R4SA 3UDXA 1FCOA 2G2WA 1EROA 1XP4A 1KE4A 1K56A 2XLNA 2WK0A 4OQ0A 5EUAA 1PI5A 1SCWA 1I2SA 2JBFA 2X71A 3NDGA 1BLCA 2ZM2A 4RX2A 2WGWB 3UN7A 3M2KA 5CTMA 2IWBA 2I72A 4IBXA 2X02A 4OQHA 4DE0A 4EUZA 2Y2MA 1JVJA 3O87A 3ISGA 3OPPA 1SDNA 4LCLA 5KZHA 4ZDXA 5FI2A 4DDYA 4M3KA 2ZLYA 5FQIA 5FQMA 2OSUA 3Q7ZA 4ZJ3A 3G4PA 2XK1A 1PW8A 2HP5A 3BEBA 4H8RA 1YMSA 3FV7A 3SH8A 1W5DA 1PI4A 1XPBA 4OPYA 1K6SA 4WMCA 1N4OA 1NY0A 2CC1A 2WAFA 5JYPA 5F83A 5EVIA 3M6BA 1FSYA 2BG1A 1K4FA 4O7DA 4QD4A 3MZEA 1K54A 5A91A 4JBFA 4P87A 5CEBA 1W8YA 4HESA 4KZAA 1K54C 2EX2A 4OP8A 2WADA 5GLAA 1BLSA 1NYMA 1EWZA 2Y2KA 4U0XA 1ZG4A 2ZQAA 5TR7A 3SH7A 3UPPA 1BULA 1IYOA 1ESUA 2R9WA 2ZC6B 4X6TA 3MXSA 1VQQA 4P6BA 4X56A 2ZD8A 3MZDA 1L2SA 3FKVA 2JC7A 1NZOA 1J9MA 4QY5A 1O07A 5HAQA 5AQ7A 2Q9MA 4RA7A 3WRZA 1IKIA 3HVFA 2ZMAA 3MKEA 4X68A 4JXVA 4KZ9A 2RCXA 3IXBA 4U0TA 2Z2MB 1M6KA 5G18A 4WZ5A 5M18A 3O88A 1IELA 2Y59A 3Q7VA 2Y2LA 4OLGA 5M19A 4WZ5C 1Z6FA 1PZOA 3OZHA 3V3SA 3S4XA 1H5XA 3G30A 2ZC5B 2HDSA 4JKTA 4WM9A 3VOYA 4KZ4A 3TG9A 3HUOA 3IHBA 4R23A 5CGWA 4C75A 5L2FA 1NXYA 1ESIA 1IYQA 1YM1A 2XEPA 4GZBA 2Y2JA 1L0GA 2EXBA 3UPNA 1PIOA 1LI0A 4BLMA 3WS2A 2XD5A 3TSGA 1E25A 1PYYA 3IWOA 3Q1FA 4QB8A 4FH4A 3EQVA 1KE3A 2HDQA 5CERA 3AGFA 5FASA 2ZC4B 1GHPA 1VM1A 5TGFA 3C7VA 1Y54A 1E3UA 2DRWA 3IH9A 5CGXA 5KSHA 4LV0A 3G35A 4QY6A 2Y2GA 2JCHA 3IT9A 1KGFA 3TOIA 1ALQA 5CHJA 4GD8A 2EFXA 2Y2QA 3N8SA 3UDIA 2E8IA 2WGWA 1PW1A 3SS5A 4R3BA 2H0TA 3VFHA 2J9OA 1K55A 4GN2A 3RXXA 3Q07A 4K0WA 4ID4A 1FCNA 1K55C 1FCMA 2WYXA 2OLVA 2R9XA 1HVBA 1YLWA 5BOHA 4QHCA 3PAEA 3ZDJA 4UAAA 4ZTKA 4FCFA 5AQBA 2HP6A 3UE3A 3VFFA 3HLGA 4OOYA 3BFFA 4MBKA 3VSLA 5EVLA 3BYDA 4S2OA 2WKIA 1QMEA 3UNWA 1CI9A 3HLEA 2WZZA 3FZCA 1CI8A 2Y4AA 4S2PA 5EVID 3S22A 2RL3A 1NZUA 2WGIA 1W7FA 4LV2A 1RCJA 2XQZA 2Q9NA 1KDSA 3W4OA 1GA9A 2HDRA 4S2NA 5FQKA 3ZNTA 3G2ZA 4S2LA 3IWQA 3JYIA 4FSFA 3QNCA 4S2NC 1KE0A 3ZG9B 5E2EA 4Y7PA 4Q8IA 2G2UA 3OCLA 2Z2LB 2J8YA 4C3QA 1L0DA 3WWXA 1Q2PA 1S0WA 5HL1A 1GA0A 1K38A 3C4PA 1BUEA 3GQZA 3LO7A 2ZQ7A 4UHUA 3NCKA 4Z9QA 3N7WA 3ZNYA 2WKEA 1FQGA 1LI9A 3ZVWA 5CXWA 4LENA 3VP2A 4S2JA 1MY8A 4RYEA 3RXWA 3DWKA 3BFGA 1YLYA 1YT4A 1LHYA 1I5QA 1G68A 2VGJA 2ZC7A 4R1GA 2GDNA 4S2IA 4B4XA 2XH9A 4GNUA 1PZPA 3WRTA 1K6RA 4JF6A 2C6WB 3MFDA 5GLBA 3N8LA 4R4RA 4OLDA 4WELA 4C6YA 1MWRA 5HX9A 1TDGA 3QNBA 3GR2A 3SS3A 4WYYA 1PWDA 5CGSA 1XGJA 3FWLA 5JYOA 4ZBEA 5CEDA 3PTEA 4KZBA 1JTGA 1ERMA 1W79A 3W4PA 3C4OA 5DVAA 4X55A 3UDFA 1MBLA 1OMEA 5HAIA 3VOZA 4E3LA 3G2YA 3M6HA 4S2KA 2H0YA 3BLSA 1KGGA 4MNRA 2ZM8A 4B4ZA 4LV1A 1IYPA 4GDNA 4QJGA 3CMZA 2UWXA 1E3UD 1ONHA 3V50A 1RGYA 1YQSA 3VP3A 1BLHA 2B5RA 1C3BA 2FFFB 1LL5A 3D4FA 4GOGA 3IQAA 3NDEA 2Y2HA 4JXSA 5FAOA 2EXAA 3GV9A 2XGNA 3IF6C 3SS4A 4N1XA 3HLWA 4EV4A 2DCFA 3E2LA 5HFOA 4BD1A 3A3EA 4MLLA 1MXOA 4E3MA 4GDBA 4NK3A 4OQIA 4IVKA 4OONA 4E3NA 1MWSA 3CG5A 4ZAMA 3N6IA 1N9BA 5F82A 5FATA 2IWDA 1GHMA 3ZVTA 4D2OA 4E6XA 4DE3A 3HLDA 1ZKJA 4E3KA 4PM8A 1FOFA 4EWFA 3OPHA 3OCNA 1IEMA 3W8KA 4Y0UA 4KENB 1O7EA 1L0EA 5CRFA 2ZM0A 5D3OA 2WZXA 4FH2A 4PM9A 5DF8A 1XX2A 4RVAA 5F1GA 3GRJA 1Q2QA 4DKIA 5FI6A 1PWGA 1ES5A 2HPBA 4UA9A 2V20A 3IF6B 3ZG0A 4JPMA 2OLUA 4R3JA 1ES4A 4DDSA 1ZG6A 2ZQCA 2QPNA 3ZGAB 1K56D 3GSGA 4KQOA 3O86A 1DJCA 5A90A 4KZ8A 1ES2A 4KZ5A 5GLCA 3VP0A 5KSCA 1CEFA 4DE2A 1SKFA 3HREA 4DRTA 5CTNA 5EOEA 1ES3A 1XKZA 2XF3A 4WBGA 4YINA 3LY3A 2J9PA 3HLCA 4OQGA 5FI7A 3VP1A 5GHXA 4N1HA 3CJMA 5GHZA 4EBPA 2Y2OA 3W4QA 1S6RA 1WYCA 3IXGA 4EBLA 4X69A 1MWUA 1RP5A 3ITBA 5M1AA 1LLBA 2V1ZA 3PBRA 4WMCD 3WS4A 1DJBA 3N8RA 4U3TA 3V5MA 4A5RA 1L0FA 3PAGA 1IYSA 4ZJ2A 3HLBA 2Y2NA 1M40A 5EPHA 1PWCA 1HTZA 4JLFA 5CHMA 3LY4A 4KG6A 1TDLA 4YFMA 4WEKA 4OH0A 2XDMA 2ZQDA 4MBFA 3IH8A 1BLPA 3O3VA 3UPOA 1YLTA 2EFUA 4OP5A 1IKGA 4B88A 3BFCA 2XFTA 1BTLA 5DF9A 2Y55A 1G6AA 4FD8A 1YLPA 1HZOA 3ITAA 5CECA 3UY6A 1FR6A 4KG5A 3ZG5A 1XGIA 1WE4A 5FQ9A 3SH9A 1K57A 3OPRA 2IWCA 3C7UA 5EE8A 1K57C 4IEDA 4PM6A 4HBTA 4JF5A 4Y0OA 3V39A 1QMFA 3BECA 3I7JA 5FQQA 4OPQA 4CPKA 3HLFA 2WKHA 3PBNA 4JXGA 3RJUA 4LCMA 1NYYA 4KQRA 4OOLA 3ZFZA 4HEFA 3G34A 2PBYA 1NJ4A 4IVIA 2HDUA 4WEJA 1EI5A 5EECA 3BLMA 4DF6A 1XA7A 2Y91A 3A3DA 4XXRA 1KVLA 4OOMA 3WS5A 3PBSA 3UE1A 3UE0A 2P74A 2PU2A 2Y2IA 3GMWA 4BENA 4MEZA 3QHYA 4CJNA 5FQJA 4EQIA 2Y2PA 3S1YA 3VSKA 1BZAA 3LCEA 4GD6A 2H5SA 5TFQA 3PBQA 3DWZA 4UA7A 4OPRA 5EVIC 2ZQ9A 4BD0A 3G31A 5GLDA 2V2FF 4NETA 4PPRA 4ZJ1A 3IXDA 2DNSA 4E3IA 2H10A 4KQQA 5GL9A 4DXBA 3ZG8B 4RX3A 4BQMA 1SDEA 2XR0A 3MKFA 3PBOA 4JF4A 4JXWA 1DJAA 3AGEA 5DTKA 3OPLA 3EQUA 4KZ6A 5FSRA 1JWVA 2P9VA 1CK3A 3IF6A 4GKUA 2JE5A 4HBUA 5IHVA 2FFYA 5HAPA 5J8XA 3VMAA 1RGZA 2PU4A 2QZ6A 3HL9A 4N9LA 3SOIA 4GB7A 1JWPA 1YLJA 3PBTA 2A3UA 4L0LA 2QMIA 3IXHA 3Q82A 4WZ4A 2BLSA 1MPLA 4E6WA 2XD1A 1XXMA 3FKWA 2ZC3B 4BJPA 3HUMA 3HUNA 1BT5A 5E2FA 5DF7A 1I2WA 1JWZA 5FAQA 5GHYA 3BM6A 1BSGA 3OC2A 3VP4A 4Y0TA 3WS1A 1GCEA 2OV5A 5E2GA 5I94A 5EVIB 3WS0A 5AQAA 1HD8A 2EX9A 1YLZA 5E2HA 3MZFA 3NBLA 3V3RA 3IF5A 1ERQA 3UO9A 3MBZA 3C5AA 5F1FA 3NIAA 5CHUA 4MBHA 5FA7A 1LL9A 3P09A 4K91A 4R0QA 3ZCZA 4X53A 3NI9A 5KMWA 2X01A 4F94A 3MXRA 5EOOA 5U47A 3GVBA 2WUQA 5A92A 3E2KA 4BL3A 4DXCA 2P9VB 2WGVA 4S2MA 1ONGA 4P85A 5DTSA 1TEMA 3AGDA 5AQ9A 3BFEA 1MWTA 3M2JA 1H8ZA 1WYBA 1XA1A 2C5WB 3IHAA 4OVDA 1NRFA 4PMAA 1KVMA 1FR1A 2EX6A 1E4DA 3B3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBR A;  3A3F A;  1KDW A;  3A3J A;  4PM7 A;  4KZ7 A;  3ZG7 B;  4N9K A;  1SHV A;  4XUZ A;  4E3O A;  1FSW A;  4EBN A;  5A93 A;  4OPZ A;  4N92 A;  2J7V A;  3GTC A;  2EX8 A;  4UA6 A;  2VGK A;  3Q7V B;  5DTT A;  2ZQ8 A;  1GHI A;  3LEZ A;  5E43 A;  1MKI A;  2ZJ9 A;  3NC8 A;  4KZ3 A;  3A3I A;  3DW0 A;  1H8Y A;  1AXB A;  3G32 A;  3IWI A;  2XFS A;  4P0M A;  1W8Q A;  4OKP A;  3FYZ A;  3N4I A;  3Q81 A;  3ZHH A;  3BFD A;  1JTD A;  4BL2 A;  1K25 A;  1K4E A;  3DTM A;  4PM5 A;  1CEG A;  3CZD A;  5FDH A;  5HAR A;  1KGE A;  1TVF A;  1ZC2 A;  5HW3 A;  4XUX A;  4E3J A;  2HP9 A;  2A49 A;  1YMX A;  3HBR A;  3BRM A;  3P98 A;  4LV3 A;  5FAP A;  4KG2 A;  4DE1 A;  4K0X A;  4QU3 A;  1DY6 A;  3NY4 A;  2WAE A;  1U60 A;  4R4S A;  3UDX A;  1FCO A;  2G2W A;  1ERO A;  1XP4 A;  1KE4 A;  1K56 A;  2XLN A;  2WK0 A;  4OQ0 A;  5EUA A;  1PI5 A;  1SCW A;  1I2S A;  2JBF A;  2X71 A;  3NDG A;  1BLC A;  2ZM2 A;  4RX2 A;  2WGW B;  3UN7 A;  3M2K A;  5CTM A;  2IWB A;  2I72 A;  4IBX A;  2X02 A;  4OQH A;  4DE0 A;  4EUZ A;  2Y2M A;  1JVJ A;  3O87 A;  3ISG A;  3OPP A;  1SDN A;  4LCL A;  5KZH A;  4ZDX A;  5FI2 A;  4DDY A;  4M3K A;  2ZLY A;  5FQI A;  5FQM A;  2OSU A;  3Q7Z A;  4ZJ3 A;  3G4P A;  2XK1 A;  1PW8 A;  2HP5 A;  3BEB A;  4H8R A;  1YMS A;  3FV7 A;  3SH8 A;  1W5D A;  1PI4 A;  1XPB A;  4OPY A;  1K6S A;  4WMC A;  1N4O A;  1NY0 A;  2CC1 A;  2WAF A;  5JYP A;  5F83 A;  5EVI A;  3M6B A;  1FSY A;  2BG1 A;  1K4F A;  4O7D A;  4QD4 A;  3MZE A;  1K54 A;  5A91 A;  4JBF A;  4P87 A;  5CEB A;  1W8Y A;  4HES A;  4KZA A;  1K54 C;  2EX2 A;  4OP8 A;  2WAD A;  5GLA A;  1BLS A;  1NYM A;  1EWZ A;  2Y2K A;  4U0X A;  1ZG4 A;  2ZQA A;  5TR7 A;  3SH7 A;  3UPP A;  1BUL A;  1IYO A;  1ESU A;  2R9W A;  2ZC6 B;  4X6T A;  3MXS A;  1VQQ A;  4P6B A;  4X56 A;  2ZD8 A;  3MZD A;  1L2S A;  3FKV A;  2JC7 A;  1NZO A;  1J9M A;  4QY5 A;  1O07 A;  5HAQ A;  5AQ7 A;  2Q9M A;  4RA7 A;  3WRZ A;  1IKI A;  3HVF A;  2ZMA A;  3MKE A;  4X68 A;  4JXV A;  4KZ9 A;  2RCX A;  3IXB A;  4U0T A;  2Z2M B;  1M6K A;  5G18 A;  4WZ5 A;  5M18 A;  3O88 A;  1IEL A;  2Y59 A;  3Q7V A;  2Y2L A;  4OLG A;  5M19 A;  4WZ5 C;  1Z6F A;  1PZO A;  3OZH A;  3V3S A;  3S4X A;  1H5X A;  3G30 A;  2ZC5 B;  2HDS A;  4JKT A;  4WM9 A;  3VOY A;  4KZ4 A;  3TG9 A;  3HUO A;  3IHB A;  4R23 A;  5CGW A;  4C75 A;  5L2F A;  1NXY A;  1ESI A;  1IYQ A;  1YM1 A;  2XEP A;  4GZB A;  2Y2J A;  1L0G A;  2EXB A;  3UPN A;  1PIO A;  1LI0 A;  4BLM A;  3WS2 A;  2XD5 A;  3TSG A;  1E25 A;  1PYY A;  3IWO A;  3Q1F A;  4QB8 A;  4FH4 A;  3EQV A;  1KE3 A;  2HDQ A;  5CER A;  3AGF A;  5FAS A;  2ZC4 B;  1GHP A;  1VM1 A;  5TGF A;  3C7V A;  1Y54 A;  1E3U A;  2DRW A;  3IH9 A;  5CGX A;  5KSH A;  4LV0 A;  3G35 A;  4QY6 A;  2Y2G A;  2JCH A;  3IT9 A;  1KGF A;  3TOI A;  1ALQ A;  5CHJ A;  4GD8 A;  2EFX A;  2Y2Q A;  3N8S A;  3UDI A;  2E8I A;  2WGW A;  1PW1 A;  3SS5 A;  4R3B A;  2H0T A;  3VFH A;  2J9O A;  1K55 A;  4GN2 A;  3RXX A;  3Q07 A;  4K0W A;  4ID4 A;  1FCN A;  1K55 C;  1FCM A;  2WYX A;  2OLV A;  2R9X A;  1HVB A;  1YLW A;  5BOH A;  4QHC A;  3PAE A;  3ZDJ A;  4UAA A;  4ZTK A;  4FCF A;  5AQB A;  2HP6 A;  3UE3 A;  3VFF A;  3HLG A;  4OOY A;  3BFF A;  4MBK A;  3VSL A;  5EVL A;  3BYD A;  4S2O A;  2WKI A;  1QME A;  3UNW A;  1CI9 A;  3HLE A;  2WZZ A;  3FZC A;  1CI8 A;  2Y4A A;  4S2P A;  5EVI D;  3S22 A;  2RL3 A;  1NZU A;  2WGI A;  1W7F A;  4LV2 A;  1RCJ A;  2XQZ A;  2Q9N A;  1KDS A;  3W4O A;  1GA9 A;  2HDR A;  4S2N A;  5FQK A;  3ZNT A;  3G2Z A;  4S2L A;  3IWQ A;  3JYI A;  4FSF A;  3QNC A;  4S2N C;  1KE0 A;  3ZG9 B;  5E2E A;  4Y7P A;  4Q8I A;  2G2U A;  3OCL A;  2Z2L B;  2J8Y A;  4C3Q A;  1L0D A;  3WWX A;  1Q2P A;  1S0W A;  5HL1 A;  1GA0 A;  1K38 A;  3C4P A;  1BUE A;  3GQZ A;  3LO7 A;  2ZQ7 A;  4UHU A;  3NCK A;  4Z9Q A;  3N7W A;  3ZNY A;  2WKE A;  1FQG A;  1LI9 A;  3ZVW A;  5CXW A;  4LEN A;  3VP2 A;  4S2J A;  1MY8 A;  4RYE A;  3RXW A;  3DWK A;  3BFG A;  1YLY A;  1YT4 A;  1LHY A;  1I5Q A;  1G68 A;  2VGJ A;  2ZC7 A;  4R1G A;  2GDN A;  4S2I A;  4B4X A;  2XH9 A;  4GNU A;  1PZP A;  3WRT A;  1K6R A;  4JF6 A;  2C6W B;  3MFD A;  5GLB A;  3N8L A;  4R4R A;  4OLD A;  4WEL A;  4C6Y A;  1MWR A;  5HX9 A;  1TDG A;  3QNB A;  3GR2 A;  3SS3 A;  4WYY A;  1PWD A;  5CGS A;  1XGJ A;  3FWL A;  5JYO A;  4ZBE A;  5CED A;  3PTE A;  4KZB A;  1JTG A;  1ERM A;  1W79 A;  3W4P A;  3C4O A;  5DVA A;  4X55 A;  3UDF A;  1MBL A;  1OME A;  5HAI A;  3VOZ A;  4E3L A;  3G2Y A;  3M6H A;  4S2K A;  2H0Y A;  3BLS A;  1KGG A;  4MNR A;  2ZM8 A;  4B4Z A;  4LV1 A;  1IYP A;  4GDN A;  4QJG A;  3CMZ A;  2UWX A;  1E3U D;  1ONH A;  3V50 A;  1RGY A;  1YQS A;  3VP3 A;  1BLH A;  2B5R A;  1C3B A;  2FFF B;  1LL5 A;  3D4F A;  4GOG A;  3IQA A;  3NDE A;  2Y2H A;  4JXS A;  5FAO A;  2EXA A;  3GV9 A;  2XGN A;  3IF6 C;  3SS4 A;  4N1X A;  3HLW A;  4EV4 A;  2DCF A;  3E2L A;  5HFO A;  4BD1 A;  3A3E A;  4MLL A;  1MXO A;  4E3M A;  4GDB A;  4NK3 A;  4OQI A;  4IVK A;  4OON A;  4E3N A;  1MWS A;  3CG5 A;  4ZAM A;  3N6I A;  1N9B A;  5F82 A;  5FAT A;  2IWD A;  1GHM A;  3ZVT A;  4D2O A;  4E6X A;  4DE3 A;  3HLD A;  1ZKJ A;  4E3K A;  4PM8 A;  1FOF A;  4EWF A;  3OPH A;  3OCN A;  1IEM A;  3W8K A;  4Y0U A;  4KEN B;  1O7E A;  1L0E A;  5CRF A;  2ZM0 A;  5D3O A;  2WZX A;  4FH2 A;  4PM9 A;  5DF8 A;  1XX2 A;  4RVA A;  5F1G A;  3GRJ A;  1Q2Q A;  4DKI A;  5FI6 A;  1PWG A;  1ES5 A;  2HPB A;  4UA9 A;  2V20 A;  3IF6 B;  3ZG0 A;  4JPM A;  2OLU A;  4R3J A;  1ES4 A;  4DDS A;  1ZG6 A;  2ZQC A;  2QPN A;  3ZGA B;  1K56 D;  3GSG A;  4KQO A;  3O86 A;  1DJC A;  5A90 A;  4KZ8 A;  1ES2 A;  4KZ5 A;  5GLC A;  3VP0 A;  5KSC A;  1CEF A;  4DE2 A;  1SKF A;  3HRE A;  4DRT A;  5CTN A;  5EOE A;  1ES3 A;  1XKZ A;  2XF3 A;  4WBG A;  4YIN A;  3LY3 A;  2J9P A;  3HLC A;  4OQG A;  5FI7 A;  3VP1 A;  5GHX A;  4N1H A;  3CJM A;  5GHZ A;  4EBP A;  2Y2O A;  3W4Q A;  1S6R A;  1WYC A;  3IXG A;  4EBL A;  4X69 A;  1MWU A;  1RP5 A;  3ITB A;  5M1A A;  1LLB A;  2V1Z A;  3PBR A;  4WMC D;  3WS4 A;  1DJB A;  3N8R A;  4U3T A;  3V5M A;  4A5R A;  1L0F A;  3PAG A;  1IYS A;  4ZJ2 A;  3HLB A;  2Y2N A;  1M40 A;  5EPH A;  1PWC A;  1HTZ A;  4JLF A;  5CHM A;  3LY4 A;  4KG6 A;  1TDL A;  4YFM A;  4WEK A;  4OH0 A;  2XDM A;  2ZQD A;  4MBF A;  3IH8 A;  1BLP A;  3O3V A;  3UPO A;  1YLT A;  2EFU A;  4OP5 A;  1IKG A;  4B88 A;  3BFC A;  2XFT A;  1BTL A;  5DF9 A;  2Y55 A;  1G6A A;  4FD8 A;  1YLP A;  1HZO A;  3ITA A;  5CEC A;  3UY6 A;  1FR6 A;  4KG5 A;  3ZG5 A;  1XGI A;  1WE4 A;  5FQ9 A;  3SH9 A;  1K57 A;  3OPR A;  2IWC A;  3C7U A;  5EE8 A;  1K57 C;  4IED A;  4PM6 A;  4HBT A;  4JF5 A;  4Y0O A;  3V39 A;  1QMF A;  3BEC A;  3I7J A;  5FQQ A;  4OPQ A;  4CPK A;  3HLF A;  2WKH A;  3PBN A;  4JXG A;  3RJU A;  4LCM A;  1NYY A;  4KQR A;  4OOL A;  3ZFZ A;  4HEF A;  3G34 A;  2PBY A;  1NJ4 A;  4IVI A;  2HDU A;  4WEJ A;  1EI5 A;  5EEC A;  3BLM A;  4DF6 A;  1XA7 A;  2Y91 A;  3A3D A;  4XXR A;  1KVL A;  4OOM A;  3WS5 A;  3PBS A;  3UE1 A;  3UE0 A;  2P74 A;  2PU2 A;  2Y2I A;  3GMW A;  4BEN A;  4MEZ A;  3QHY A;  4CJN A;  5FQJ A;  4EQI A;  2Y2P A;  3S1Y A;  3VSK A;  1BZA A;  3LCE A;  4GD6 A;  2H5S A;  5TFQ A;  3PBQ A;  3DWZ A;  4UA7 A;  4OPR A;  5EVI C;  2ZQ9 A;  4BD0 A;  3G31 A;  5GLD A;  2V2F F;  4NET A;  4PPR A;  4ZJ1 A;  3IXD A;  2DNS A;  4E3I A;  2H10 A;  4KQQ A;  5GL9 A;  4DXB A;  3ZG8 B;  4RX3 A;  4BQM A;  1SDE A;  2XR0 A;  3MKF A;  3PBO A;  4JF4 A;  4JXW A;  1DJA A;  3AGE A;  5DTK A;  3OPL A;  3EQU A;  4KZ6 A;  5FSR A;  1JWV A;  2P9V A;  1CK3 A;  3IF6 A;  4GKU A;  2JE5 A;  4HBU A;  5IHV A;  2FFY A;  5HAP A;  5J8X A;  3VMA A;  1RGZ A;  2PU4 A;  2QZ6 A;  3HL9 A;  4N9L A;  3SOI A;  4GB7 A;  1JWP A;  1YLJ A;  3PBT A;  2A3U A;  4L0L A;  2QMI A;  3IXH A;  3Q82 A;  4WZ4 A;  2BLS A;  1MPL A;  4E6W A;  2XD1 A;  1XXM A;  3FKW A;  2ZC3 B;  4BJP A;  3HUM A;  3HUN A;  1BT5 A;  5E2F A;  5DF7 A;  1I2W A;  1JWZ A;  5FAQ A;  5GHY A;  3BM6 A;  1BSG A;  3OC2 A;  3VP4 A;  4Y0T A;  3WS1 A;  1GCE A;  2OV5 A;  5E2G A;  5I94 A;  5EVI B;  3WS0 A;  5AQA A;  1HD8 A;  2EX9 A;  1YLZ A;  5E2H A;  3MZF A;  3NBL A;  3V3R A;  3IF5 A;  1ERQ A;  3UO9 A;  3MBZ A;  3C5A A;  5F1F A;  3NIA A;  5CHU A;  4MBH A;  5FA7 A;  1LL9 A;  3P09 A;  4K91 A;  4R0Q A;  3ZCZ A;  4X53 A;  3NI9 A;  5KMW A;  2X01 A;  4F94 A;  3MXR A;  5EOO A;  5U47 A;  3GVB A;  2WUQ A;  5A92 A;  3E2K A;  4BL3 A;  4DXC A;  2P9V B;  2WGV A;  4S2M A;  1ONG A;  4P85 A;  5DTS A;  1TEM A;  3AGD A;  5AQ9 A;  3BFE A;  1MWT A;  3M2J A;  1H8Z A;  1WYB A;  1XA1 A;  2C5W B;  3IHA A;  4OVD A;  1NRF A;  4PMA A;  1KVM A;  1FR1 A;  2EX6 A;  1E4D A;  3B3X A; 
#chains in the Genus database with same CATH topology
 3A3J A;  5DFX A;  4XUZ A;  1P0Z A;  5IS1 A;  5A93 A;  2PAV P;  4N92 A;  5F68 A;  3GTC A;  2ZQ8 A;  2ZJ9 A;  4O01 A;  4P0M A;  1FIK A;  4BL2 A;  1D7E A;  1EW0 A;  1K4E A;  4PM5 A;  5HAR A;  2M1C A;  4ETZ A;  2HP9 A;  1YMX A;  3BJN A;  3P98 A;  4KG2 A;  5C5K A;  2ZOI A;  4R4S A;  1FCO A;  2G2W A;  3S7Q A;  1CJF A;  4OQ0 A;  4KUO A;  3NDG A;  2XA7 M;  4H6J A;  4Q0J A;  1JVJ A;  5KZH A;  4Y15 A;  3SH8 A;  1XJ3 A;  2WAF A;  2DMW A;  5F83 A;  4EXO A;  5EVI A;  3MZE A;  1S4R A;  2M7U A;  5CEB A;  4GHI B;  3BWL A;  4U0X A;  1ZG4 A;  2ZQA A;  3SH7 A;  2R9W A;  2ZC6 B;  4YWZ A;  5A8B A;  3FKV A;  1J9M A;  4QY5 A;  5AQ7 A;  3MXQ A;  1IKI A;  2J3T C;  4U0T A;  3Q7V A;  5M19 A;  2Y2L A;  1OT9 A;  1WA9 A;  1Z6F A;  4Q0I A;  3OZH A;  1H5X A;  2VV8 A;  3HUO A;  1IYQ A;  1YM1 A;  2VEA A;  2XEP A;  2Y2J A;  3CUE A;  3K2N A;  3LEQ A;  1PIO A;  1LI0 A;  2PYR A;  1XFN A;  3Q1F A;  1LSW A;  5CER A;  3AGF A;  2ZC4 B;  3IBR A;  2JHE A;  5TGF A;  3C7V A;  1Y54 A;  4LV0 A;  3G35 A;  1T19 A;  3UMD A;  5HWT A;  5CHJ A;  1OJ5 A;  4ZRR A;  2EA9 A;  5DJT A;  1VB6 A;  3F1P B;  4R3B A;  3VFH A;  1A0K A;  2R9X A;  4QHC A;  1X0O A;  4I3J A;  4OOY A;  2E8J A;  3VSL A;  5EVL A;  3BYD A;  3F1O A;  3UNW A;  2WZZ A;  1CI8 A;  3S22 A;  2RL3 A;  1OTI A;  3T4L A;  3CI6 A;  2XQZ A;  5HDD A;  4P6Z S;  2HDR A;  4S2N A;  3ZNT A;  4M4X A;  3G2Z A;  1AWI A;  4Y7P A;  1UGU A;  3OCL A;  2Z2L B;  2QJ7 A;  4WLA A;  4C3Q A;  2KX6 A;  4FOF A;  4KQD A;  1K38 A;  3GQZ A;  3LO7 A;  1BUE A;  3MQ0 A;  4NEE D;  2CMN A;  3ZNY A;  4LEN A;  3VP2 A;  4S2J A;  3RXW A;  4EW7 A;  3DWK A;  4WN5 A;  4IUH A;  1I5Q A;  2YKH A;  4S2I A;  3EEA A;  1N9O A;  4Y5F A;  1PZP A;  1K6R A;  3VOL A;  5GLB A;  4OLD A;  1GSX A;  3PTE A;  1ERM A;  3W4P A;  2W1R A;  3UDF A;  3G2Y A;  4S2K A;  4X1M A;  2H0Y A;  3BLS A;  4MNR A;  4B4Z A;  1IYP A;  4R38 A;  3VP3 A;  2FFF B;  4GOG A;  3D4F A;  2EXA A;  3IF6 C;  3SS4 A;  3HLW A;  4GCZ A;  5DKK A;  2DCF A;  2HJ9 C;  4XT2 A;  1FIL A;  1MWS A;  5FEG A;  4ZAM A;  2BAS A;  2Y79 A;  4GLQ A;  4I5S A;  4Y17 A;  5FAT A;  3LI8 A;  4F3L A;  3DTI A;  3H9W A;  4NG2 A;  4DE3 A;  4BBU A;  1FOF A;  3G6O A;  3EGD C;  1IEM A;  4KEN B;  3MMH A;  2UV0 E;  4RVA A;  1Y4O A;  1PWG A;  3IF6 B;  2OLU A;  1ES4 A;  3E4P A;  1ZG6 A;  3ZGA B;  5KIZ A;  4KQO A;  1ES2 A;  4KZ5 A;  3VP0 A;  4CLC C;  1SKF A;  2JN7 A;  1DRM A;  2O9A A;  4WBG A;  3HLC A;  4N1H A;  3CJM A;  2Y2O A;  1MWU A;  3WS4 A;  4WMC D;  1TS7 A;  1DJB A;  3N8R A;  4U3T A;  1IYS A;  4ZJ2 A;  1HTZ A;  5HPF A;  2JKT M;  4KG6 A;  1TS0 A;  4WEK A;  2W0N A;  1ZHH B;  3BFC A;  2XFT A;  5DF9 A;  2Y55 A;  4FD8 A;  2QJ5 A;  2INW A;  3R7W B;  2OAP 1;  5EE8 A;  3B33 A;  2Q0O A;  4HBT A;  4JF5 A;  3V39 A;  4L9F A;  1QMF A;  3BEC A;  1T1B A;  3CIT A;  4CPK A;  3HLF A;  3RJU A;  2W3E A;  4LCM A;  4L9G A;  2K7S A;  3H82 B;  4HJ6 A;  2ZBB A;  2PBY A;  2HV1 A;  5EEC A;  3A0S A;  4ARZ A;  4OOM A;  4QPR A;  2PU2 A;  3CPT A;  3QHY A;  3NUL A;  3DWZ A;  3NEC A;  3G31 A;  5GLD A;  4PPR A;  4ZJ1 A;  4DXB A;  5GL9 A;  3PR6 A;  3NHQ A;  2HZ5 A;  3EQU A;  1JWV A;  1CK3 A;  2JE5 A;  5HAP A;  5J8X A;  4QWO A;  4E04 A;  3T1R A;  1YLJ A;  3NOT C;  5EM0 A;  3Q82 A;  4WZ4 A;  2B02 A;  2D02 A;  2XD1 A;  1XXM A;  2ZC3 B;  4GW9 A;  5E2F A;  5DF7 A;  1I2W A;  5IU1 A;  3OC2 A;  2NUP C;  4EES A;  1CF0 A;  5J4E A;  3V3R A;  1F98 A;  1ERQ A;  3LR3 A;  2W1T B;  5CHU A;  3LI9 A;  4MBH A;  5HL6 A;  3ZCZ A;  2MJ6 A;  5EFW A;  2X01 A;  3MXR A;  5EOO A;  3GVB A;  1SKO A;  1ACF A;  3KX0 X;  4G3V A;  1VEU A;  3DAV A;  4EER A;  1MWT A;  1S4S A;  4LGW A;  4OVD A;  4Y3I A;  4YNR A;  5J3W A;  1NLY A;  2EX6 A;  1KDW A;  4PM7 A;  4E3O A;  3MF0 A;  1FSW A;  1F9I A;  4OPZ A;  2VGK A;  1S67 L;  1UWN X;  4KZ3 A;  3A3I A;  3C30 A;  3DW0 A;  3L9K A;  4HP4 A;  1ZTU A;  4WL9 A;  5G4Z A;  4X25 A;  3IWI A;  4EUV A;  4OKP A;  1TF1 A;  3FYZ A;  1G28 A;  1K25 A;  2VKS A;  3DTM A;  3B42 A;  5EM1 A;  5HW3 A;  5FAP A;  2WAE A;  3H7W A;  5CX7 A;  1ERO A;  4Q0H A;  1XP4 A;  3D9Y A;  2X71 A;  3T12 B;  3M2K A;  2IWB A;  3KSI A;  3O87 A;  2J80 A;  1OTA A;  5FQI A;  2OSU A;  3G4P A;  4H8R A;  3S7O A;  3B47 A;  4WMC A;  1NY0 A;  5JYP A;  3MSH A;  3M6B A;  2V8C A;  3KSG A;  5A91 A;  4JBF A;  1W8Y A;  1K54 C;  2EX2 A;  2VGL S;  4OP8 A;  1N9L A;  5TR7 A;  4X6T A;  3MXS A;  3JVV A;  3MZD A;  3C8C A;  1O07 A;  2PHY A;  3LR5 A;  4DJ3 A;  1VET A;  3DBA A;  1IOU A;  4JXV A;  4KZ9 A;  5G18 A;  3F1P A;  5L10 A;  3T4K A;  4WM9 A;  4JKT A;  2HDS A;  3KO6 A;  5CGW A;  2KOI A;  4NXE A;  5L2F A;  5HWW A;  4BLM A;  3WS2 A;  4MN7 A;  1F2K A;  1E25 A;  3EQV A;  1KE3 A;  5FAS A;  1KOU A;  1E3U A;  2DRW A;  3IH9 A;  3LUQ A;  3ZYT A;  4QY6 A;  3T4Q A;  1KGF A;  3TOI A;  1ALQ A;  2XA7 S;  4HP9 A;  5I5L A;  3UDI A;  2WGW A;  1PW1 A;  2H0T A;  3QP5 A;  4GN2 A;  3NOP C;  4R3A A;  2WYX A;  2OLV A;  4UEY A;  5BOH A;  3UE3 A;  4PHT A;  5L09 A;  4S2O A;  5TJJ A;  1T1C A;  2WKI A;  5EVE A;  2P08 A;  2VA0 A;  3CWF A;  4GS9 B;  4Y2F A;  1SZV A;  2Y4A A;  1PNE A;  4II7 A;  3A0V A;  4MN6 A;  2Q9N A;  4MMN A;  1G5U A;  3IWQ A;  4FSF A;  4Q8I A;  3OLO A;  5HL1 A;  4UHU A;  4Z9Q A;  1LI9 A;  5CXW A;  5FL3 A;  3BFG A;  1YLY A;  3KSH A;  1LHY A;  2VGJ A;  2ZC7 A;  2GDN A;  2XH9 A;  4GNU A;  5CGS A;  1XGJ A;  5CED A;  1T1A A;  4Y13 A;  5DVA A;  4X55 A;  3RTY A;  1MBL A;  4HQA A;  5HAI A;  4E3L A;  4UQI M;  3M6H A;  1S1Z A;  1ODV A;  2ZM8 A;  2QYB A;  5L07 A;  4QJG A;  1ONH A;  1S66 L;  2PDR A;  3IQA A;  4JXS A;  5FAO A;  3QP6 A;  3IBJ A;  4N1X A;  5TBM A;  3A3E A;  4FTX A;  1MXO A;  4NK3 A;  4OQI A;  4IVK A;  3CG5 A;  3N6I A;  1N9B A;  3T4S A;  5F82 A;  2JKG A;  1ZKJ A;  4WUJ A;  4EWF A;  3OCN A;  5CRF A;  3IX8 A;  2WZX A;  4PM9 A;  5DF8 A;  5F1G A;  3GRJ A;  2D01 A;  3NJA A;  1ES5 A;  4UA9 A;  5EV0 A;  2V20 A;  3ZG0 A;  4DDS A;  4CLC A;  1XJ6 A;  1DJC A;  4HHD A;  4DE2 A;  5EOE A;  3VP1 A;  2OWH A;  5JYO A;  2J9P A;  4OQG A;  5GHZ A;  4EBP A;  3ITB A;  5M1A A;  3PBR A;  3PAG A;  1L3L A;  5EPH A;  1PWC A;  4LRZ E;  1TDL A;  1YPR A;  2ZQD A;  3O3V A;  2EFU A;  4YOF A;  3F1N A;  4HH2 A;  3LIB A;  3C2W A;  3ITA A;  1XGI A;  4G3K A;  3SZT A;  4PM6 A;  3RH8 B;  4Y0O A;  3I7J A;  2PT7 A;  1NYY A;  4KQR A;  4LFU A;  2HDU A;  4WEJ A;  2ZL1 B;  1EI5 A;  4DF6 A;  2Y91 A;  1NWZ A;  3WS5 A;  3KYZ A;  3PBS A;  3UE1 A;  3GMW A;  4BEN A;  2W3H A;  3LCE A;  3RFB A;  2H5S A;  3T1S A;  2B18 A;  5EVI C;  2W1T A;  3MS6 A;  2V2F F;  2DNS A;  2H10 A;  2A24 B;  1SDE A;  3PBO A;  4JF4 A;  2K31 A;  3P7N A;  1OJG A;  5DTK A;  4KZ6 A;  5FSR A;  3LYX A;  2PU4 A;  4R6L A;  2QZ6 A;  4N9L A;  1JWP A;  4LRY C;  1OTB A;  4L0L A;  2O9C A;  3IS2 A;  3CHW P;  1LSX A;  3FKW A;  4BJP A;  3HUN A;  1BT5 A;  2IA2 A;  3VE4 A;  3E4Q A;  1BSG A;  3VP4 A;  1GSV A;  1NLZ A;  4Y0T A;  3WS1 A;  5E2G A;  5EVI B;  3UO9 A;  3C5A A;  2J3W A;  3NIA A;  4ME4 A;  5FA7 A;  1LL9 A;  3P09 A;  4R0Q A;  3GEC A;  5KMW A;  2Y8H A;  4F94 A;  3E2K A;  4BL3 A;  2P9V B;  3MQQ A;  3D72 A;  4S2M A;  4P85 A;  3TJZ C;  1TEM A;  4BBV A;  1TS6 A;  3M2J A;  1WYB A;  3LR0 A;  1XA1 A;  1NRF A;  4PMA A;  2B95 A;  3B3X A;  4IBR A;  2VX8 A;  3A3F A;  4N9K A;  4EBN A;  1DP8 A;  2EX8 A;  2VV6 A;  3Q7V B;  4L9E A;  1MKI A;  4D60 A;  3NC8 A;  2PD8 A;  4NXG A;  3HCY A;  1W8Q A;  4HH3 A;  4HJ4 A;  3KYQ A;  3ZHH A;  1JTD A;  3UB8 A;  2VV7 A;  3EOI A;  5FDH A;  1KGE A;  1TVF A;  1ZC2 A;  2L0W A;  4XUX A;  4E3J A;  1VHM A;  3R4K A;  3HBR A;  3BRM A;  4LV3 A;  4DE1 A;  2ACG A;  4QU3 A;  3QP1 A;  3NY4 A;  4HJ3 A;  1K0K A;  1KE4 A;  2XLN A;  2JBF A;  1I2S A;  1W63 Q;  4I39 A;  2ZM2 A;  3UN7 A;  1OPX A;  4IBX A;  4DE0 A;  4EUZ A;  3OPP A;  1SDN A;  4ZDX A;  5FI2 A;  4M3K A;  2ZLY A;  5FQM A;  2W3F A;  2XK1 A;  3BEB A;  1YMS A;  5J7E A;  1W5D A;  1PI4 A;  1XPB A;  1K6S A;  4NKP A;  1N4O A;  1OTD A;  2CC1 A;  3BW6 A;  3F1O B;  1FSY A;  2BG1 A;  4O7D A;  4QD4 A;  4EQ1 A;  1MKM A;  1P97 A;  1K54 A;  2LB9 A;  4P87 A;  4HES A;  4KZA A;  2WAD A;  2GZA A;  1NYM A;  1EWZ A;  2Y2K A;  1BUL A;  1ESU A;  1VQQ A;  4P6B A;  2OOL A;  2R78 A;  4X56 A;  3TRC A;  2JC7 A;  1NZO A;  3MR0 A;  3WRZ A;  3MKE A;  2GJ3 A;  3IXB A;  2Z2M B;  5M18 A;  5L8M A;  4WZ5 C;  1PZO A;  3S4X A;  2ZC5 B;  3VOY A;  3TG9 A;  3IHB A;  4R23 A;  4C75 A;  1ESI A;  2OAQ 1;  4GZB A;  2EXB A;  3UE6 A;  3LIE A;  3BQ8 A;  5G4Y A;  1VM1 A;  4DMZ A;  5KSH A;  3PHY A;  2Y2G A;  4GD8 A;  2Y2Q A;  1D06 A;  3N8S A;  3O5Y A;  2EWV A;  3SS5 A;  2O9B A;  2J9O A;  5DJU A;  3Q07 A;  4ID4 A;  1FCN A;  1K55 C;  3PAE A;  4ZTK A;  3W2Z A;  4FCF A;  3HLG A;  3BFF A;  4F3L B;  4MBK A;  1XJ2 A;  3JPU A;  4ESP A;  1QME A;  3HLE A;  5EVI D;  1NZU A;  4GHI A;  2WGI A;  4EEU A;  4LPZ A;  2P7J A;  5FQK A;  4AFI A;  4EU0 A;  1KE0 A;  3ZG9 B;  3FC7 A;  2J8Y A;  1PFL A;  1L0D A;  1YAX A;  3EEH A;  1S0W A;  3C4P A;  2ZQ7 A;  2EWW A;  2WKE A;  1H0M A;  1H3Q A;  1FQG A;  3ZVW A;  4DJ2 A;  1YT4 A;  3EGX C;  2Z6C A;  3T50 A;  4JF6 A;  2C6W B;  3N8L A;  4R4R A;  4WEL A;  1TDG A;  2HF6 A;  3GR2 A;  3DTE A;  3QNB A;  1D1J A;  4Z1W A;  3TW8 A;  1GSW A;  4KZB A;  1JTG A;  1W79 A;  3OOV A;  3C4O A;  3VOZ A;  2XRN A;  2JKF A;  1KGG A;  3HJI A;  4IJG A;  4LV1 A;  1RGY A;  1BLH A;  1C3B A;  5F6A A;  3NDE A;  3GV9 A;  5HFO A;  3QP8 A;  2WKP A;  4GDB A;  4OON A;  4ARZ B;  3CPT B;  3U4L P;  2IWD A;  3LIF A;  1GHM A;  1DP6 A;  4E6X A;  3HLD A;  4E3K A;  2W3G A;  3OPH A;  4LLO B;  3W8K A;  4CQH A;  4Y0U A;  4K08 A;  4FH2 A;  1Q2Q A;  2HPB A;  4MN5 A;  4JPM A;  4R3J A;  3LR4 A;  2ZQC A;  1K56 D;  5A90 A;  4KZ8 A;  5GLC A;  2WKQ A;  1H8M A;  1ES3 A;  1XKZ A;  2XF3 A;  4I38 A;  4YIN A;  3LY3 A;  5FI7 A;  5HPI A;  5GHX A;  3OBF A;  3IXG A;  4X69 A;  1G6O A;  4BMW A;  3V5M A;  4A5R A;  1L0F A;  4KUK A;  3HLB A;  2Y2N A;  2ZL1 A;  1SKO B;  4OH0 A;  4MBF A;  3IH8 A;  1BLP A;  1YLT A;  2YKF A;  1VEU B;  1IKG A;  4B88 A;  4UQI S;  1BTL A;  3BQA A;  5CEC A;  3UY6 A;  1FR6 A;  5FQ9 A;  3SH9 A;  2IWC A;  1F5M A;  1K57 C;  3E0Y A;  2A24 A;  4OPQ A;  2WKH A;  3PBN A;  4EEP A;  4OOL A;  4MCW A;  4HEF A;  1NJ4 A;  1HLU P;  2G7U A;  5IT5 A;  1KVL A;  2P74 A;  5K5B A;  1UWP X;  2VJW A;  2Y2P A;  3S1Y A;  4EQI A;  3EWK A;  3VSK A;  4GD6 A;  5TFQ A;  3PBQ A;  3H7W B;  3IXD A;  5DFY A;  3IX3 A;  4KQQ A;  4B9O A;  4E3I A;  3ZG8 B;  3C38 A;  1DJA A;  3AGE A;  3OPL A;  2P9V A;  3IF6 A;  4GKU A;  4HBU A;  3KSF A;  4GB7 A;  4NXB A;  5AJG A;  2A3U A;  3FPV A;  3IXH A;  2BLS A;  4JGP A;  3PYP A;  1JWZ A;  5GHY A;  4BBT A;  1GCE A;  5I94 A;  5AQA A;  2EX9 A;  1V9Z A;  3NBL A;  1CQA A;  3IF5 A;  3MBZ A;  2K2N A;  5F1F A;  4K91 A;  4X53 A;  2M7V A;  1Y28 A;  5U47 A;  3S7N A;  3A0R A;  2WUQ A;  4DXC A;  1V9Y A;  4BWI A;  5DTS A;  3AGD A;  5AQ9 A;  4HI4 A;  3BFE A;  3SW1 A;  2C5W B;  2FH5 A;  1FR1 A;  1T18 A;  3R7W A;  1E4D A;  4G3W A;  4GJ4 A;  2ZOH A;  1VET B;  3KYE A;  4KZ7 A;  3ZG7 B;  1SHV A;  2QWS A;  3ZQ5 A;  3UB9 A;  2J7V A;  4UA6 A;  5GLA A;  5DTT A;  1GHI A;  3LEZ A;  5E43 A;  3H82 A;  1H8Y A;  1AXB A;  3VV4 A;  3G32 A;  2LB5 A;  2XFS A;  3N4I A;  3Q81 A;  3BFD A;  4ETX A;  1CEG A;  1STZ A;  3CZD A;  2A49 A;  2HGV A;  4K0X A;  1DY6 A;  3T1Q B;  1U60 A;  3UB6 A;  3UDX A;  5AVE A;  4FUW A;  1K56 A;  2WK0 A;  5EUA A;  2AVX A;  1PI5 A;  1SCW A;  1BLC A;  4RX2 A;  2WGW B;  4O0P A;  1LT0 A;  5CTM A;  2I72 A;  4I3A A;  2X02 A;  4OQH A;  4O8G A;  2Y2M A;  3ISG A;  4LCL A;  1W63 M;  2GNX A;  4DDY A;  3MJQ A;  3E4O A;  2QKP A;  3CAX A;  3Q7Z A;  4ZJ3 A;  3D3O A;  1N9N A;  4HIA A;  1PW8 A;  2HP5 A;  3FV7 A;  4OPY A;  3T1X A;  1K4F A;  1YKD A;  3LGO A;  4I3I A;  3IX4 A;  1J3W A;  3BY8 A;  3K3C A;  1BLS A;  2A2L A;  1S1Y A;  3UPP A;  1IYO A;  3LIA A;  1XFQ A;  4H6J B;  2ZD8 A;  4P6Z M;  1L2S A;  3QP2 A;  2VLG A;  5HAQ A;  2Q9M A;  4RA7 A;  3UB7 A;  5F69 A;  3HVF A;  2ZMA A;  4DN0 A;  2H28 A;  4X68 A;  2PD7 A;  2PBD P;  2RCX A;  1M6K A;  4WZ5 A;  3O88 A;  1IEL A;  2Y59 A;  4OLG A;  1IFQ A;  2GX5 A;  1TD5 A;  3V3S A;  3G30 A;  2BTF P;  4KZ4 A;  2O0Y A;  3JVU A;  1NXY A;  1JNU A;  3UPN A;  1XJ4 A;  1L0G A;  2V1A A;  3CUE C;  2XD5 A;  3TSG A;  1PYY A;  3IWO A;  4QB8 A;  1DP9 A;  4FH4 A;  2HDQ A;  1GHP A;  3L7H A;  1P9R A;  5CGX A;  2W27 A;  3TE8 A;  2JCH A;  3IT9 A;  3HJK A;  2EFX A;  2PR6 A;  2P04 A;  2E8I A;  1YSP A;  1K55 A;  5TBM B;  3RXX A;  4K0W A;  1FCM A;  3U2A A;  1HVB A;  1YLW A;  3ZDJ A;  4UAA A;  5AQB A;  2HP6 A;  3VFF A;  1TS8 A;  3ICY A;  2V1B A;  1CI9 A;  3FZC A;  4S2P A;  1W7F A;  4LV2 A;  4X1L A;  1RCJ A;  1KDS A;  3W4O A;  1GA9 A;  5HDC A;  5AVF A;  3DTK A;  4EET B;  2PYP A;  4S2L A;  1LL8 A;  4S2N C;  3JYI A;  3QNC A;  1YSQ A;  3LID A;  2VK3 A;  5E2E A;  4CLC B;  2G2U A;  3VE3 A;  3BY9 A;  2FZ0 A;  2I9V A;  3WWX A;  1Q2P A;  5HZH A;  1GA0 A;  5MC7 A;  3NCK A;  3N7W A;  4PKY G;  1MY8 A;  2J3T D;  4RYE A;  4PAU A;  1G68 A;  4R1G A;  4B4X A;  4JGQ A;  2ZMV A;  4LRX C;  3WRT A;  3MFD A;  4C6Y A;  2WKR A;  1MWR A;  2JKR M;  2KLI A;  5HX9 A;  3SS3 A;  4WYY A;  1PWD A;  3FWL A;  4ZBE A;  1Z09 A;  3F1N B;  1NRJ A;  5HWV A;  1P9W A;  4JGR A;  1OME A;  2NUT C;  4IHQ A;  4GDN A;  5HDS A;  3CMZ A;  2UWX A;  4HOI A;  1E3U D;  2V9A A;  3V50 A;  1YQS A;  3UME A;  5FEF A;  2B5R A;  1LL5 A;  2V0U A;  2Y2H A;  2XGN A;  2KDK A;  4IUK A;  4EV4 A;  3E2L A;  4BD1 A;  4MLL A;  4E3M A;  4E3N A;  4R70 A;  2OWJ A;  3T4O A;  2W3D A;  3ZVT A;  4D2O A;  4PM8 A;  4MDZ A;  4GS9 A;  1O7E A;  1L0E A;  2ZM0 A;  5D3O A;  2Z6D A;  1XX2 A;  4DKI A;  4CLC E;  5FI6 A;  4NXF A;  3V67 A;  3K3D A;  2QPN A;  3GSG A;  4HNB A;  3O86 A;  2VZW A;  1PRQ A;  3IS2 B;  3QP4 A;  3T4J A;  4XT2 B;  5KSC A;  1CEF A;  3HRE A;  4DRT A;  5CTN A;  1BYW A;  3FPW A;  3W4Q A;  1S6R A;  2PR5 A;  1WYC A;  3MFX A;  4EBL A;  1RP5 A;  1LLB A;  2V1Z A;  2V0W A;  1MZU A;  5HD5 A;  1M40 A;  4JLF A;  5CHM A;  3LY4 A;  4YFM A;  2XDM A;  3UPO A;  4OP5 A;  1G6A A;  1YLP A;  1HZO A;  4WF0 A;  4KG5 A;  5LBR A;  3ZG5 A;  1WE4 A;  3NOU C;  1K57 A;  3OPR A;  3C7U A;  5FDS A;  4IED A;  3P01 A;  5FQQ A;  5HSQ A;  4JXG A;  2O99 A;  2L4R A;  4HY8 A;  1OT6 A;  1LSV A;  3E98 A;  3ZFZ A;  3G34 A;  4IVI A;  2L1M A;  3FG8 A;  3BLM A;  1XA7 A;  3A3D A;  4XXR A;  1MC0 A;  3UE0 A;  2Y2I A;  4MEZ A;  3T4T A;  4CJN A;  5FQJ A;  3UB5 P;  1BZA A;  4UA7 A;  4OPR A;  4BD0 A;  2ZQ9 A;  4JGO A;  4RQ9 A;  4NET A;  3S7P A;  4B93 A;  4BQM A;  4RX3 A;  2XSS A;  2XR0 A;  3GDI A;  3MKF A;  2V8F A;  4JXW A;  2QHK A;  5IHV A;  2FFY A;  3VMA A;  1RGZ A;  3HL9 A;  3SOI A;  3PBT A;  2QMI A;  4E6W A;  1MPL A;  2JKT I;  3HUM A;  4CLC D;  5FAQ A;  3LFV A;  3BM6 A;  5HD3 A;  2OV5 A;  3WS0 A;  1HD8 A;  1YLZ A;  3MQO A;  3MZF A;  5E2H A;  2PRF A;  2HJE A;  5F5Y A;  5DKL A;  1OTE A;  3LIC A;  3NI9 A;  5A92 A;  2VGL M;  3ULF A;  2WGV A;  2XRO A;  1ONG A;  4PKY A;  2ZMF A;  3PXP A;  1H8Z A;  3IHA A;  1KVM A;  2JKR I;  3CLO A; 
#chains in the Genus database with same CATH homology
 4IBR A;  3A3F A;  1KDW A;  3A3J A;  4PM7 A;  4KZ7 A;  3ZG7 B;  4N9K A;  1SHV A;  4XUZ A;  4E3O A;  1FSW A;  4EBN A;  5A93 A;  4OPZ A;  4N92 A;  2J7V A;  3GTC A;  2EX8 A;  4UA6 A;  2VGK A;  3Q7V B;  5DTT A;  2ZQ8 A;  1GHI A;  3LEZ A;  5E43 A;  1MKI A;  2ZJ9 A;  3NC8 A;  4KZ3 A;  3A3I A;  3DW0 A;  1H8Y A;  1AXB A;  3G32 A;  3IWI A;  2XFS A;  4P0M A;  1W8Q A;  4OKP A;  3FYZ A;  3N4I A;  3Q81 A;  3ZHH A;  3BFD A;  1JTD A;  4BL2 A;  1K25 A;  1K4E A;  3DTM A;  4PM5 A;  1CEG A;  3CZD A;  5FDH A;  5HAR A;  1KGE A;  1TVF A;  1ZC2 A;  5HW3 A;  4XUX A;  4E3J A;  2HP9 A;  2A49 A;  1YMX A;  3HBR A;  3BRM A;  3P98 A;  4LV3 A;  5FAP A;  4KG2 A;  4DE1 A;  4K0X A;  4QU3 A;  1DY6 A;  3NY4 A;  2WAE A;  1U60 A;  4R4S A;  3UDX A;  1FCO A;  2G2W A;  1ERO A;  1XP4 A;  1KE4 A;  1K56 A;  2XLN A;  2WK0 A;  4OQ0 A;  5EUA A;  1PI5 A;  1SCW A;  1I2S A;  2JBF A;  2X71 A;  3NDG A;  1BLC A;  2ZM2 A;  4RX2 A;  2WGW B;  3UN7 A;  3M2K A;  5CTM A;  2IWB A;  2I72 A;  4IBX A;  2X02 A;  4OQH A;  4DE0 A;  4EUZ A;  2Y2M A;  1JVJ A;  3O87 A;  3ISG A;  3OPP A;  1SDN A;  4LCL A;  5KZH A;  4ZDX A;  5FI2 A;  4DDY A;  4M3K A;  2ZLY A;  5FQI A;  5FQM A;  2OSU A;  3Q7Z A;  4ZJ3 A;  3G4P A;  2XK1 A;  1PW8 A;  2HP5 A;  3BEB A;  4H8R A;  1YMS A;  3FV7 A;  3SH8 A;  1W5D A;  1PI4 A;  1XPB A;  4OPY A;  1K6S A;  4WMC A;  1N4O A;  1NY0 A;  2CC1 A;  2WAF A;  5JYP A;  5F83 A;  5EVI A;  3M6B A;  1FSY A;  2BG1 A;  1K4F A;  4O7D A;  4QD4 A;  3MZE A;  1K54 A;  5A91 A;  4JBF A;  4P87 A;  5CEB A;  1W8Y A;  4HES A;  4KZA A;  1K54 C;  2EX2 A;  4OP8 A;  2WAD A;  5GLA A;  1BLS A;  1NYM A;  1EWZ A;  2Y2K A;  4U0X A;  1ZG4 A;  2ZQA A;  5TR7 A;  3SH7 A;  3UPP A;  1BUL A;  1IYO A;  1ESU A;  2R9W A;  2ZC6 B;  4X6T A;  3MXS A;  1VQQ A;  4P6B A;  4X56 A;  2ZD8 A;  3MZD A;  1L2S A;  3FKV A;  2JC7 A;  1NZO A;  1J9M A;  4QY5 A;  1O07 A;  5HAQ A;  5AQ7 A;  2Q9M A;  4RA7 A;  3WRZ A;  1IKI A;  3HVF A;  2ZMA A;  3MKE A;  4X68 A;  4JXV A;  4KZ9 A;  2RCX A;  3IXB A;  4U0T A;  2Z2M B;  1M6K A;  5G18 A;  4WZ5 A;  5M18 A;  3O88 A;  1IEL A;  2Y59 A;  3Q7V A;  2Y2L A;  4OLG A;  5M19 A;  4WZ5 C;  1Z6F A;  1PZO A;  3OZH A;  3V3S A;  3S4X A;  1H5X A;  3G30 A;  2ZC5 B;  2HDS A;  4JKT A;  4WM9 A;  3VOY A;  4KZ4 A;  3TG9 A;  3HUO A;  3IHB A;  4R23 A;  5CGW A;  4C75 A;  5L2F A;  1NXY A;  1ESI A;  1IYQ A;  1YM1 A;  2XEP A;  4GZB A;  2Y2J A;  1L0G A;  2EXB A;  3UPN A;  1PIO A;  1LI0 A;  4BLM A;  3WS2 A;  2XD5 A;  3TSG A;  1E25 A;  1PYY A;  3IWO A;  3Q1F A;  4QB8 A;  4FH4 A;  3EQV A;  1KE3 A;  2HDQ A;  5CER A;  3AGF A;  5FAS A;  2ZC4 B;  1GHP A;  1VM1 A;  5TGF A;  3C7V A;  1Y54 A;  1E3U A;  2DRW A;  3IH9 A;  5CGX A;  5KSH A;  4LV0 A;  3G35 A;  4QY6 A;  2Y2G A;  2JCH A;  3IT9 A;  1KGF A;  3TOI A;  1ALQ A;  5CHJ A;  4GD8 A;  2EFX A;  2Y2Q A;  3N8S A;  3UDI A;  2E8I A;  2WGW A;  1PW1 A;  3SS5 A;  4R3B A;  2H0T A;  3VFH A;  2J9O A;  1K55 A;  4GN2 A;  3RXX A;  3Q07 A;  4K0W A;  4ID4 A;  1FCN A;  1K55 C;  1FCM A;  2WYX A;  2OLV A;  2R9X A;  1HVB A;  1YLW A;  5BOH A;  4QHC A;  3PAE A;  3ZDJ A;  4UAA A;  4ZTK A;  4FCF A;  5AQB A;  2HP6 A;  3UE3 A;  3VFF A;  3HLG A;  4OOY A;  3BFF A;  4MBK A;  3VSL A;  5EVL A;  3BYD A;  4S2O A;  2WKI A;  1QME A;  3UNW A;  1CI9 A;  3HLE A;  2WZZ A;  3FZC A;  1CI8 A;  2Y4A A;  4S2P A;  5EVI D;  3S22 A;  2RL3 A;  1NZU A;  2WGI A;  1W7F A;  4LV2 A;  1RCJ A;  2XQZ A;  2Q9N A;  1KDS A;  3W4O A;  1GA9 A;  2HDR A;  4S2N A;  5FQK A;  3ZNT A;  3G2Z A;  4S2L A;  3IWQ A;  3JYI A;  4FSF A;  3QNC A;  4S2N C;  1KE0 A;  3ZG9 B;  5E2E A;  4Y7P A;  4Q8I A;  2G2U A;  3OCL A;  2Z2L B;  2J8Y A;  4C3Q A;  1L0D A;  3WWX A;  1Q2P A;  1S0W A;  5HL1 A;  1GA0 A;  1K38 A;  3C4P A;  1BUE A;  3GQZ A;  3LO7 A;  2ZQ7 A;  4UHU A;  3NCK A;  4Z9Q A;  3N7W A;  3ZNY A;  2WKE A;  1FQG A;  1LI9 A;  3ZVW A;  5CXW A;  4LEN A;  3VP2 A;  4S2J A;  1MY8 A;  4RYE A;  3RXW A;  3DWK A;  3BFG A;  1YLY A;  1YT4 A;  1LHY A;  1I5Q A;  1G68 A;  2VGJ A;  2ZC7 A;  4R1G A;  2GDN A;  4S2I A;  4B4X A;  2XH9 A;  4GNU A;  1PZP A;  3WRT A;  1K6R A;  4JF6 A;  2C6W B;  3MFD A;  5GLB A;  3N8L A;  4R4R A;  4OLD A;  4WEL A;  4C6Y A;  1MWR A;  5HX9 A;  1TDG A;  3QNB A;  3GR2 A;  3SS3 A;  4WYY A;  1PWD A;  5CGS A;  1XGJ A;  3FWL A;  5JYO A;  4ZBE A;  5CED A;  3PTE A;  4KZB A;  1JTG A;  1ERM A;  1W79 A;  3W4P A;  3C4O A;  5DVA A;  4X55 A;  3UDF A;  1MBL A;  1OME A;  5HAI A;  3VOZ A;  4E3L A;  3G2Y A;  3M6H A;  4S2K A;  2H0Y A;  3BLS A;  1KGG A;  4MNR A;  2ZM8 A;  4B4Z A;  4LV1 A;  1IYP A;  4GDN A;  4QJG A;  3CMZ A;  2UWX A;  1E3U D;  1ONH A;  3V50 A;  1RGY A;  1YQS A;  3VP3 A;  1BLH A;  2B5R A;  1C3B A;  2FFF B;  1LL5 A;  3D4F A;  4GOG A;  3IQA A;  3NDE A;  2Y2H A;  4JXS A;  5FAO A;  2EXA A;  3GV9 A;  2XGN A;  3IF6 C;  3SS4 A;  4N1X A;  3HLW A;  4EV4 A;  2DCF A;  3E2L A;  5HFO A;  4BD1 A;  3A3E A;  4MLL A;  1MXO A;  4E3M A;  4GDB A;  4NK3 A;  4OQI A;  4IVK A;  4OON A;  4E3N A;  1MWS A;  3CG5 A;  4ZAM A;  3N6I A;  1N9B A;  5F82 A;  5FAT A;  2IWD A;  1GHM A;  3ZVT A;  4D2O A;  4E6X A;  4DE3 A;  3HLD A;  1ZKJ A;  4E3K A;  4PM8 A;  1FOF A;  4EWF A;  3OPH A;  3OCN A;  1IEM A;  3W8K A;  4Y0U A;  4KEN B;  1O7E A;  1L0E A;  5CRF A;  2ZM0 A;  5D3O A;  2WZX A;  4FH2 A;  4PM9 A;  5DF8 A;  1XX2 A;  4RVA A;  5F1G A;  3GRJ A;  1Q2Q A;  4DKI A;  5FI6 A;  1PWG A;  1ES5 A;  2HPB A;  4UA9 A;  2V20 A;  3IF6 B;  3ZG0 A;  4JPM A;  2OLU A;  4R3J A;  1ES4 A;  4DDS A;  1ZG6 A;  2ZQC A;  2QPN A;  3ZGA B;  1K56 D;  3GSG A;  4KQO A;  3O86 A;  1DJC A;  5A90 A;  4KZ8 A;  1ES2 A;  4KZ5 A;  5GLC A;  3VP0 A;  5KSC A;  1CEF A;  4DE2 A;  1SKF A;  3HRE A;  4DRT A;  5CTN A;  5EOE A;  1ES3 A;  1XKZ A;  2XF3 A;  4WBG A;  4YIN A;  3LY3 A;  2J9P A;  3HLC A;  4OQG A;  5FI7 A;  3VP1 A;  5GHX A;  4N1H A;  3CJM A;  5GHZ A;  4EBP A;  2Y2O A;  3W4Q A;  1S6R A;  1WYC A;  3IXG A;  4EBL A;  4X69 A;  1MWU A;  1RP5 A;  3ITB A;  5M1A A;  1LLB A;  2V1Z A;  3PBR A;  4WMC D;  3WS4 A;  1DJB A;  3N8R A;  4U3T A;  3V5M A;  4A5R A;  1L0F A;  3PAG A;  1IYS A;  4ZJ2 A;  3HLB A;  2Y2N A;  1M40 A;  5EPH A;  1PWC A;  1HTZ A;  4JLF A;  5CHM A;  3LY4 A;  4KG6 A;  1TDL A;  4YFM A;  4WEK A;  4OH0 A;  2XDM A;  2ZQD A;  4MBF A;  3IH8 A;  1BLP A;  3O3V A;  3UPO A;  1YLT A;  2EFU A;  4OP5 A;  1IKG A;  4B88 A;  3BFC A;  2XFT A;  1BTL A;  5DF9 A;  2Y55 A;  1G6A A;  4FD8 A;  1YLP A;  1HZO A;  3ITA A;  5CEC A;  3UY6 A;  1FR6 A;  4KG5 A;  3ZG5 A;  1XGI A;  1WE4 A;  5FQ9 A;  3SH9 A;  1K57 A;  3OPR A;  2IWC A;  3C7U A;  5EE8 A;  1K57 C;  4IED A;  4PM6 A;  4HBT A;  4JF5 A;  4Y0O A;  3V39 A;  1QMF A;  3BEC A;  3I7J A;  5FQQ A;  4OPQ A;  4CPK A;  3HLF A;  2WKH A;  3PBN A;  4JXG A;  3RJU A;  4LCM A;  1NYY A;  4KQR A;  4OOL A;  3ZFZ A;  4HEF A;  3G34 A;  2PBY A;  1NJ4 A;  4IVI A;  2HDU A;  4WEJ A;  1EI5 A;  5EEC A;  3BLM A;  4DF6 A;  1XA7 A;  2Y91 A;  3A3D A;  4XXR A;  1KVL A;  4OOM A;  3WS5 A;  3PBS A;  3UE1 A;  3UE0 A;  2P74 A;  2PU2 A;  2Y2I A;  3GMW A;  4BEN A;  4MEZ A;  3QHY A;  4CJN A;  5FQJ A;  4EQI A;  2Y2P A;  3S1Y A;  3VSK A;  1BZA A;  3LCE A;  4GD6 A;  2H5S A;  5TFQ A;  3PBQ A;  3DWZ A;  4UA7 A;  4OPR A;  5EVI C;  2ZQ9 A;  4BD0 A;  3G31 A;  5GLD A;  2V2F F;  4NET A;  4PPR A;  4ZJ1 A;  3IXD A;  2DNS A;  4E3I A;  2H10 A;  4KQQ A;  5GL9 A;  4DXB A;  3ZG8 B;  4RX3 A;  4BQM A;  1SDE A;  2XR0 A;  3MKF A;  3PBO A;  4JF4 A;  4JXW A;  1DJA A;  3AGE A;  5DTK A;  3OPL A;  3EQU A;  4KZ6 A;  5FSR A;  1JWV A;  2P9V A;  1CK3 A;  3IF6 A;  4GKU A;  2JE5 A;  4HBU A;  5IHV A;  2FFY A;  5HAP A;  5J8X A;  3VMA A;  1RGZ A;  2PU4 A;  2QZ6 A;  3HL9 A;  4N9L A;  3SOI A;  4GB7 A;  1JWP A;  1YLJ A;  3PBT A;  2A3U A;  4L0L A;  2QMI A;  3IXH A;  3Q82 A;  4WZ4 A;  2BLS A;  1MPL A;  4E6W A;  2XD1 A;  1XXM A;  3FKW A;  2ZC3 B;  4BJP A;  3HUM A;  3HUN A;  1BT5 A;  5E2F A;  5DF7 A;  1I2W A;  1JWZ A;  5FAQ A;  5GHY A;  3BM6 A;  1BSG A;  3OC2 A;  3VP4 A;  4Y0T A;  3WS1 A;  1GCE A;  2OV5 A;  5E2G A;  5I94 A;  5EVI B;  3WS0 A;  5AQA A;  1HD8 A;  2EX9 A;  1YLZ A;  5E2H A;  3MZF A;  3NBL A;  3V3R A;  3IF5 A;  1ERQ A;  3UO9 A;  3MBZ A;  3C5A A;  5F1F A;  3NIA A;  5CHU A;  4MBH A;  5FA7 A;  1LL9 A;  3P09 A;  4K91 A;  4R0Q A;  3ZCZ A;  4X53 A;  3NI9 A;  5KMW A;  2X01 A;  4F94 A;  3MXR A;  5EOO A;  5U47 A;  3GVB A;  2WUQ A;  5A92 A;  3E2K A;  4BL3 A;  4DXC A;  2P9V B;  2WGV A;  4S2M A;  1ONG A;  4P85 A;  5DTS A;  1TEM A;  3AGD A;  5AQ9 A;  3BFE A;  1MWT A;  3M2J A;  1H8Z A;  1WYB A;  1XA1 A;  2C5W B;  3IHA A;  4OVD A;  1NRF A;  4PMA A;  1KVM A;  1FR1 A;  2EX6 A;  1E4D A;  3B3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...