4UA6A

Ctx-m-14 class a beta-lactamase apo crystal structure at 0.79 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua6A00
4PPRA 1MPLA 2Y59A 4IVIA 3W4PA 4Z9QA 4DXCA 4JXWA 5CECA 1YLPA 3SOIA 2JBFA 1IYOA 3P09A 1YM1A 2J8YA 5FA7A 2HDQA 1LLBA 3GVBA 5F1GA 3WS2A 2ZM2A 4GD6A 4EBPA 3O86A 5AQ7A 1XXMA 4GB7A 4EBNA 4E3NA 2Z2MB 3A3EA 1JWPA 3RJUA 5HARA 1SDEA 3Q81A 2OLUA 2RCXA 2HP6A 1PZPA 3A3DA 3G2ZA 4OQHA 4KZ9A 3VP1A 5KSCA 2B5RA 1FQGA 3WS5A 1KVLA 1PI5A 4C6YA 2PU4A 1K6SA 2BG1A 1K55C 2XQZA 2ZQ9A 3W4OA 5A92A 2A3UA 4QHCA 2WUQA 3VOZA 4P85A 1S0WA 1YLZA 3PAGA 1XGIA 3ZDJA 4KG6A 3BLMA 1LL5A 1KDSA 1N9BA 4P87A 4X68A 4CJNA 1IEMA 2X02A 4FCFA 4OOLA 1LHYA 1N4OA 3G35A 4HBUA 5F1FA 3IXHA 3O3VA 1Q2PA 1FCOA 2WZXA 3CG5A 1H8YA 1M40A 1JVJA 4OOYA 3IF6A 3MBZA 2XK1A 4RX3A 5GHXA 4OPZA 4S2NA 5EVIA 1L0DA 2OV5A 3Q7ZA 1LI9A 4E3LA 1BT5A 1C3BA 4R3JA 1RGYA 1RP5A 3DWZA 3OPLA 4H8RA 1Q2QA 2ZM0A 3CMZA 3HBRA 4S2KA 5E2FA 2Y2JA 2HP5A 2A49A 1KGEA 2QPNA 4R23A 3V3RA 3C7UA 1QMEA 5GLBA 3W4QA 3VP3A 5CXWA 5EVIB 5HAPA 3TOIA 3Q7VA 5IHVA 1IELA 1IYSA 2GDNA 1SDNA 2OLVA 2P9VA 4OQ0A 4WZ5A 1K4FA 3FKWA 4WZ4A 1MXOA 5FQ9A 3VSLA 4QU3A 5CHMA 2XF3A 2PBYA 4QD4A 1L0EA 5FAOA 1K57C 3ZHHA 1HVBA 4YINA 2HDRA 1L0FA 4WEJA 2QMIA 2WAFA 2ZQDA 3LEZA 1ESUA 1NRFA 3ZG5A 3IF5A 1BLSA 3G2YA 4UA9A 2EX6A 1BZAA 2R9XA 1IKIA 1SKFA 2XDMA 2EFUA 3HLCA 4GN2A 1FOFA 1NYYA 5TFQA 5E2EA 3Q7VB 2XD5A 4ZJ1A 4Y0TA 4ZDXA 1MBLA 1TEMA 2P9VB 3ZGAB 2XD1A 2ZC6B 1PWCA 3VFHA 4X56A 4ZJ3A 3PBNA 3WS1A 3PBOA 2WZZA 3BRMA 4JXSA 5DTKA 4NETA 3ZG8B 1IKGA 3ZVWA 4UA6A 3MXRA 5E2HA 1JTGA 2WKEA 3ZNTA 3GSGA 3OPRA 4LCMA 4U3TA 4OQGA 4MNRA 2C6WB 4EV4A 4LV0A 1I2WA 4OOMA 2ZJ9A 4U0TA 4JF6A 5D3OA 3G34A 5CTMA 4E6WA 5FATA 4PM7A 3FYZA 1LI0A 4MBFA 3UPNA 3VMAA 5CEBA 2H10A 2IWDA 4HEFA 3FZCA 4OLGA 1E3UA 4GKUA 4N92A 1BTLA 3VP2A 4DE0A 5DF9A 4OKPA 3UN7A 1FSYA 3ZG9B 4KG2A 1YMSA 3ZG0A 4BD0A 5HAQA 5DTTA 2Y2NA 4JBFA 1WYBA 3BLSA 1NYMA 1O7EA 2XEPA 5FQJA 3B3XA 2DRWA 3C5AA 3V50A 5F82A 3FKVA 3FV7A 2V1ZA 3FWLA 5A91A 3UY6A 2VGKA 1W8QA 3VSKA 1CEGA 2J9OA 3C7VA 4D2OA 3VP0A 3VFFA 2Y2LA 2ZC3B 4Y7PA 4E3IA 1DJCA 3N8LA 4X69A 1ONHA 4K0WA 3BFEA 3S22A 3UDXA 4P0MA 1BLPA 2WGVA 3LY3A 3ZNYA 4IEDA 1NZUA 4RX2A 1PWGA 5U47A 4X55A 4QY5A 1CEFA 2WK0A 5A93A 1U60A 1BULA 1W7FA 1XGJA 3N8RA 1KDWA 5M19A 1K25A 1SCWA 3UNWA 3CJMA 5EUAA 3G4PA 2ZD8A 2Y2GA 5CHJA 4S2JA 4PM8A 2ZLYA 5EVID 5GHYA 4IBRA 3IXGA 1GHIA 1XP4A 2IWBA 5CERA 1GHMA 3S4XA 5E43A 4QJGA 1GHPA 3O88A 1EWZA 4WMCA 3N4IA 1NY0A 1W8YA 3Q82A 3MKFA 5GHZA 1K54C 2WGWA 4A5RA 5A90A 1TDGA 5AQ9A 1DJBA 4N1XA 4ZJ2A 5HAIA 1K38A 1NJ4A 3HLFA 3GTCA 3MZFA 3RXXA 4E3KA 4UAAA 5M18A 1KGFA 4DDYA 2PU2A 1XX2A 1MWSA 4UHUA 5J8XA 2ZQ8A 2ZQ7A 5DF7A 3BM6A 1K4EA 4KQRA 1I5QA 1GCEA 2Q9MA 4KZBA 3BFCA 4S2IA 4BL2A 5EE8A 1FCMA 4LV2A 3IF6B 1PI4A 3OC2A 1J9MA 5FQKA 1DY6A 3SH7A 2XR0A 3M6HA 2JE5A 1YLTA 2ZM8A 1YLWA 5KMWA 5KSHA 1K55A 1JWVA 3OCNA 5CRFA 3GR2A 4S2LA 5FI2A 2EX9A 2I72A 5EOOA 1OMEA 2WKIA 3IH8A 4CPKA 3A3FA 2IWCA 1O07A 4EQIA 2EX8A 1PWDA 1CI8A 3BFDA 3SS5A 3PBSA 3MZDA 3PBRA 3NBLA 1E4DA 1ZKJA 2HPBA 3M2JA 4QY6A 4RYEA 5CGSA 4B88A 3V3SA 2E8IA 1KVMA 5FQQA 1YLJA 4PM6A 4KG5A 1IYPA 4JF4A 3P98A 1PW8A 5F83A 1BLCA 3A3IA 3BECA 3HUNA 2Y2HA 4M3KA 3ZG7B 2QZ6A 4PMAA 1M6KA 1Z6FA 1MY8A 2JC7A 1L0GA 4DF6A 1YLYA 1K56A 5FQIA 3WRTA 3HLEA 4KZ6A 1YMXA 3WS4A 5EPHA 2XFSA 4KZ7A 4XUZA 3PBQA 2FFYA 1MWTA 5FQMA 4DKIA 5L2FA 1SHVA 4Q8IA 3GRJA 1EROA 1KGGA 3PAEA 1XA7A 4EBLA 3D4FA 3ZCZA 2Y2OA 3ISGA 4IBXA 3NY4A 4BL3A 5EVLA 1L2SA 1E3UD 3EQUA 3TSGA 3VOYA 2WAEA 4Y0UA 3UO9A 4PM9A 2G2UA 3G30A 3IHAA 4F94A 4DE2A 1EI5A 2Q9NA 4JPMA 4FH2A 4XXRA 1IYQA 4B4XA 2Y2IA 3E2KA 3MZEA 2Y55A 5M1AA 1CK3A 1K57A 3IXBA 3DW0A 1PIOA 4C75A 2Y4AA 4R4SA 1RCJA 1JTDA 4FSFA 4HESA 5G18A 4DRTA 3LY4A 4GOGA 2Y2KA 3MXSA 1ERQA 3HLGA 3HL9A 3TG9A 1FCNA 3UPOA 1YT4A 4E3OA 3GQZA 4MBKA 4N1HA 4R0QA 4DXBA 4BJPA 2BLSA 1ES4A 5GLDA 1MKIA 4ID4A 1ES3A 1G6AA 3QNCA 3I7JA 3UE3A 4KZ4A 4N9KA 3M2KA 5EECA 1TVFA 3IF6C 3V5MA 5HFOA 4S2OA 2R9WA 3QNBA 3Q1FA 3ZFZA 2JCHA 4B4ZA 5BOHA 3HUOA 3G31A 3NIAA 4S2NC 5EVIC 2HDSA 1MWRA 1QMFA 1H5XA 3W8KA 2HP9A 4EWFA 1MWUA 4OVDA 4OP5A 5FI7A 1VM1A 5FAQA 4WMCD 3SS4A 3A3JA 3IXDA 1XA1A 3LCEA 5FI6A 1RGZA 3G32A 4GNUA 1CI9A 1DJAA 2FFFB 3AGDA 1I2SA 4OP8A 3UDIA 1HD8A 2Z2LB 3HLWA 1AXBA 3AGFA 2CC1A 2V2FF 3BFFA 1W79A 1ZC2A 3DTMA 3Q07A 1FR6A 1YQSA 1WE4A 2HDUA 3HVFA 2C5WB 4KENB 4KZAA 4KZ8A 2XGNA 4QB8A 4PM5A 1NZOA 4R4RA 4BLMA 1KE4A 5CGWA 1VQQA 4JKTA 2EXBA 3ITAA 1W5DA 4WZ5C 1XKZA 2UWXA 2X71A 3LO7A 5CTNA 4WYYA 4R1GA 1FSWA 1JWZA 3VP4A 2Y91A 2XH9A 3SH8A 2ZQCA 1E25A 1BLHA 1ERMA 1S6RA 4GDNA 3UDFA 4RA7A 1H8ZA 4OH0A 3NDEA 4S2PA 3UE1A 5HX9A 3MFDA 4MBHA 3OZHA 4ZTKA 3IQAA 1KE3A 1HZOA 4E3MA 4LV1A 3V39A 5HW3A 2V20A 2WGWB 3PBTA 4LV3A 4EUZA 4O7DA 1ALQA 4KZ3A 1PYYA 5E2GA 5AQBA 4JLFA 2WGIA 4WELA 4GDBA 4KQOA 5GLCA 3WWXA 1TDLA 2H0TA 5EOEA 5CGXA 5DVAA 5FASA 2J9PA 2ZC7A 3HLDA 3OCLA 4GZBA 2ZC5B 5CEDA 1K56D 4ZBEA 3GV9A 2OSUA 3M6BA 1ONGA 1GA0A 1K6RA 4DE1A 4JXVA 2X01A 3PTEA 4X6TA 4YFMA 3NI9A 3O87A 5FDHA 3BFGA 5TR7A 2XLNA 1GA9A 1PZOA 1ES2A 4K91A 2H0YA 3DWKA 4XUXA 1WYCA 5KZHA 2DCFA 4MEZA 1K54A 4GD8A 5AQAA 4UA7A 3S1YA 1HTZA 4LENA 2EX2A 4KQQA 4BENA 2WKHA 3RXWA 4E6XA 2Y2QA 3OPPA 3ZVTA 3WRZA 1ZG6A 1LL9A 2WADA 5GLAA 4HBTA 4X53A 4OQIA 1PW1A 4OPYA 4WM9A 4K0XA 4L0LA 3BYDA 5FSRA 1BUEA 3NC8A 1KE0A 1Y54A 2ZQAA 4KZ5A 3HUMA 5DTSA 3IWOA 5DF8A 4RVAA 2RL3A 4Y0OA 5JYPA 5I94A 5FAPA 3MKEA 3EQVA 4JF5A 2EXAA 3NCKA 4E3JA 4R3BA 4P6BA 2P74A 4DDSA 4U0XA 3C4OA 5TGFA 3WS0A 4C3QA 3SH9A 4DE3A 4OPQA 1ZG4A 4WEKA 4BD1A 2H5SA 3UPPA 3IH9A 3ITBA 2VGJA 3AGEA 4BQMA 4MLLA 4WBGA 3N7WA 4FH4A 2J7VA 3HREA 3C4PA 2EFXA 2Y2MA 4NK3A 2G2WA 4LCLA 4FD8A 3N8SA 3OPHA 5HL1A 5CHUA 3QHYA 2DNSA 3HLBA 4ZAMA 5JYOA 2WYXA 2ZC4B 4N9LA 1FR1A 3E2LA 5GL9A 2XFTA 1XPBA 3CZDA 4OLDA 1G68A 3NDGA 4OPRA 4OONA 2ZMAA 4IVKA 3BEBA 1BSGA 4S2MA 3GMWA 4JXGA 3JYIA 3IWIA 3IT9A 1ESIA 3SS3A 3IHBA 3N6IA 3UE0A 1NXYA 1ES5A 3IWQA 2Y2PA
chains in the Genus database with same CATH superfamily
1MPLA 4IVIA 4Z9QA 5CECA 4L9EA 1IYOA 1YM1A 3H82A 5F1GA 5DJTA 4GD6A 4EBPA 1XXMA 4GB7A 4EBNA 4E3NA 4EU0A 5HARA 2HP6A 4GW9A 1DP6A 1X0OA 3A3DA 4HOIA 1PI5A 2MJ6A 1K6SA 3BQAA 4QHCA 4P85A 1S0WA 1TS6A 3T4QA 5TJJA 1XGIA 1KDSA 4P87A 2PYPA 4CJNA 2X02A 3CLOA 3G35A 5F1FA 1Q2PA 4ETXA 1JVJA 3F1NA 4AFIA 3HCYA 1ACFA 1T18A 1L0DA 4O0PA 3UB8A 1LI9A 4YWZA 3HJKA 4CQHA 4R3JA 1RGYA 4QWOA 3QP8A 3HBRA 4S2KA 2A49A 1KGEA 5DKKA 5J3WA 3G6OA 5DFXA 4LLOB 1IFQA 5IHVA 4LRXC 1IYSA 3T4KA 3MSHA 4II7A 3VSLA 5FAOA 1K57C 1HVBA 2HDRA 5KIZA 4WEJA 2WAFA 3ZG5A 1NRFA 3IF5A 4UA9A 1BZAA 2OWJA 5TFQA 5E2EA 3Q7VB 4Y0TA 1LSXA 2P9VB 2XD1A 3TRCA 1GSVA 3WS1A 3PBOA 2VEAA 2WZZA 3KYQA 5HZHA 1JTGA 2VV7A 4EV4A 2B18A 2C6WB 1I2WA 4U0TA 5FATA 3D3OA 3BWLA 3UPNA 2VLGA 4UQIM 2IWDA 4GKUA 4N92A 4DE0A 4Q0JA 5K5BA 3UN7A 5IU1A 3F1OA 4BD0A 5DTTA 3BLSA 4HH3A 2KOIA 3V50A 2GX5A 5F82A 5A91A 1OTBA 1W8QA 1S1YA 3L7HA 3B42A 2ZOHA 2Y2LA 5AVEA 1ONHA 4K0WA 3UDXA 2O9AA 5HD5A 3ZNYA 2QJ5A 5M19A 1K25A 3UNWA 4HIAA 5EUAA 3G4PA 1TS0A 5CHJA 4S2JA 5EVID 3IXGA 1OTEA 4WMCA 2PRFA 1TDGA 4I38A 4ZJ2A 4N1XA 1DP9A 3MZFA 5M18A 4UHUA 5J8XA 2JKFA 1I5QA 1YSQA 5EE8A 3LR4A 4YNRA 1PI4A 5FQKA 4DN0A 3D72A 5KSHA 5FI2A 3GR2A 2WKIA 4KQDA 3MQOA 1PWDA 1TS8A 3PBRA 2HPBA 3V3SA 2XROA 2W3HA 4M3KA 2QZ6A 1M6KA 1Z6FA 1MY8A 2JC7A 4NXFA 4PHTA 3T1RA 5FQIA 3WRTA 3LI9A 3WS4A 3CPTA 2XFSA 4KZ7A 3PBQA 5L2FA 1SHVA 4EBLA 3ZCZA 3NY4A 5EVLA 4G3KA 1XJ2A 1L2SA 1E3UD 4PAUA 2WAEA 3KYZA 1IYQA 4GHIB 3S7NA 1CK3A 1K57A 3IXBA 4NG2A 1T19A 2Y4AA 4IUKA 4R4SA 1RCJA 1JTDA 2W0NA 4DRTA 5HPFA 2FH5A 2OAQ1 3TG9A 2M1CA 1FCNA 3UPOA 1YT4A 1G6OA 4DXBA 5GLDA 1G6AA 3QNCA 4N9KA 4Q0IA 4HJ3A 3IF6C 3V5MA 4S2OA 2R9WA 3Q1FA 5BOHA 4JGQA 1UWNX 3FG8A 4EWFA 5F68A 4OVDA 4OP5A 4Z1WA 1TF1A 1Y28A 3KSFA 4QPRA 3SS4A 1XA1A 1RGZA 4I5SA 4OP8A 3T4TA 3UDIA 1AXBA 2CC1A 1ZC2A 3DTMA 1FR6A 3T4JA 1PNEA 1WE4A 2HDUA 3HVFA 4KZAA 4KZ8A 4PM5A 5CGWA 3UMEA 2EXBA 3ITAA 1W5DA 1XKZA 2UWXA 3LI8A 1EW0A 4NEED 2ZQCA 1E25A 1ERMA 3UDFA 2JKGA 4RA7A 3NDEA 4S2PA 5HX9A 4X1MA 5HW3A 3TJZC 3PBTA 3R7WB 5E2GA 4JLFA 4R38A 5GLCA 1D06A 5DVAA 4HP9A 3HLDA 4ME4A 4GZBA 1K56D 5MC7A 3GV9A 4NKPA 3NHQA 3A0VA 4DE1A 4JXVA 4X6TA 4YFMA 3O87A 1T1AA 4K91A 4FUWA 4MEZA 4H6JA 5EV0A 5EFWA 5AQAA 3A0SA 4EXOA 3JVUA 3B47A 2HF6A 3RXWA 3TE8A 3ZVTA 4UEYA 1LL9A 5GLAA 2W3GA 2PDRA 4K0XA 4L0LA 3QP4A 5LBRA 3VE4A 2B95A 3NC8A 1KE0A 2VGLS 2ZMVA 3MR0A 4HQAA 4Y5FA 4Y0OA 3EWKA 5FEGA 3EQVA 4JF5A 4D60A 2EXAA 1UGUA 4R3BA 4P6BA 4RQ9A 2H5SA 3IH9A 4MLLA 4FH4A 3DTKA 2EFXA 5EM0A 3QP5A 5HPIA 3N8SA 2K7SA 2DNSA 4ZAMA 2WYXA 4WUJA 1FR1A 3E2LA 4LRZE 1G68A 4OPRA 3ZYTA 3JYIA 3IT9A 4EW7A 3IHBA 2W3EA 3W4PA 4JXWA 3PXPA 4FOFA 4ETZA 3P09A 3T12B 1LLBA 3GVBA 4Y2FA 3WS2A 2ZM2A 1TS7A 4L9FA 3CAXA 3O86A 3BQ8A 3A3EA 2QWSA 1XJ4A 3U2AA 2OLUA 1PZPA 4KZ9A 5KSCA 2H28A 1KVLA 3JVVA 2PU4A 5C5KA 2A3UA 3H7WA 2WUQA 2PR6A 1LSWA 3ZDJA 5L8MA 1LL5A 4X68A 2GNXA 3KSHA 4HBUA 3EEHA 3IXHA 4X1LA 2OWHA 1FCOA 2WZXA 1H8YA 1M40A 3IF6A 3HJIA 2L4RA 5GHXA 4OPZA 3Q7ZA 4LGWA 1BT5A 1C3BA 1RP5A 1V9YA 3OPLA 1Q2QA 5E2FA 3C30A 4R23A 3V3RA 2CMNA 5HAPA 3Q7VA 1IELA 2GDNA 1SDNA 2P9VA 4MN7A 4QU3A 2PBYA 4YINA 2QMIA 2EX6A 2R9XA 1IKIA 2XDMA 5CX7A 2EFUA 3HLCA 4GN2A 1FOFA 1N9NA 4ZDXA 2K2NA 1TEMA 3D9YA 4H6JB 2P08A 4Y15A 3ZGAB 3T1QB 1PWCA 3VFHA 2J3TC 1S67L 3NULA 4ESPA 4NETA 3ZG8B 2V0UA 1IKGA 4UA6A 2WKPA 2LB9A 4EUVA 4LCMA 4MNRA 2INWA 4LV0A 4OOMA 5AJGA 4JF6A 4PM7A 4R3AA 2H10A 4I39A 3VP2A 5DFYA 4I3AA 4KG2A 3P7NA 5HAQA 1ODVA 2V0WA 4HNBA 5FQJA 3NOPC 2DRWA 3T4LA 2V1ZA 4JGOA 4CLCB 4GJ4A 3VP0A 4MCWA 3UE6A 4R6LA 1OTDA 2ZC3B 4Y7PA 5F69A 3BFEA 3LY3A 4IEDA 1NZUA 4RX2A 1PWGA 4EEUA 1CEFA 1J3WA 4Y17A 5A93A 3S7OA 3T50A 5A8BA 2ZD8A 2I9VA 4IBRA 1GHIA 5CERA 3B33A 5E43A 4QJGA 1EWZA 3NJAA 1NY0A 3Q82A 1GSWA 1K54C 5AQ9A 3H7WB 5HAIA 1NJ4A 4UAAA 1KGFA 2VV8A 1MWSA 5J4EA 3BM6A 1K4EA 4KQRA 2Q9MA 4KZBA 4S2IA 3CWFA 3IF6B 1XJ3A 1DY6A 1YLWA 1JWVA 4S2LA 2EX9A 2L0WA 5EOOA 1OMEA 1ZKJA 3M2JA 4LPZA 2E8IA 5FQQA 1YLJA 5DJUA 1IYPA 5F83A 1BLCA 3A3IA 2Y2HA 3KSIA 1L0GA 3HLEA 4KZ6A 1YMXA 5FQMA 4GHIA 4HH2A 2VK3A 3K3CA 3D4FA 3T4OA 2Y2OA 3ISGA 1CJFA 1MZUA 4HHDA 3VOYA 4Y0UA 3E4QA 3MQQA 3UO9A 4PM9A 4WF0A 2KDKA 3IHAA 4XXRA 4FH2A 2Y2IA 3VE3A 2Y55A 2A24B 4NXBA 1PIOA 4C75A 4FSFA 3PR6A 4GOGA 2Y2KA 3MXSA 2VA0A 3HLGA 4E3OA 1MC0A 4MBKA 4N1HA 4R0QA 4B93A 2WKQA 2BLSA 1F9IA 1WA9A 4ID4A 3I7JA 3EOIA 4KZ4A 3ZFZA 4B4ZA 3HUOA 1QMFA 1XJ6A 5HWTA 3LIDA 2K31A 1MWUA 3MQ0A 5FI7A 1VM1A 4WMCD 5FI6A 4GNUA 2FFFB 5HWWA 1I2SA 1F2KA 4IUHA 1H0MA 3HLWA 3AGFA 4DMZA 3BFFA 3RH8B 2BTFP 2C5WB 2W1TA 1KE4A 1VQQA 1XFNA 4WZ5C 3R7WA 5CTNA 2VX8A 4WYYA 4O01A 2Y91A 3H9WA 3SH8A 1S6RA 4GDNA 3UE1A 5IT5A 3IQAA 1HZOA 3IS2A 4LV1A 2V20A 2PBDP 1ALQA 3V67A 5AQBA 4GDBA 5EOEA 3OCLA 5IS1A 2JKRM 4ZBEA 2QKPA 1GA0A 1K6RA 2ZL1A 5FDSA 2Y79A 3DBAA 1ES2A 2H0YA 3MJQA 2OOLA 3DWKA 1F98A 4XUXA 4CLCC 5KZHA 1K54A 5HWVA 2V9AA 4KQQA 2Y2QA 1ZG6A 4MN5A 3UB7A 4X53A 4OQIA 4WM9A 3BYDA 1Y54A 2WKRA 2ZQAA 5DTSA 3IWOA 4RVAA 4G3VA 5FAPA 3MKEA 3EGXC 4E3JA 4DDSA 4U0XA 3C4OA 3T1XA 1ZG4A 4L9GA 4IHQA 4WEKA 3UPPA 1SZVA 1S66L 4BQMA 4MDZA 1F5MA 2J7VA 2Q0OA 3C4PA 2Y2MA 4LCLA 4FD8A 5HL1A 5CHUA 2D01A 3HLBA 3QHYA 4MMNA 5F5YA 1XPBA 3CZDA 3NDGA 3BEBA 3NECA 4I3IA 1ESIA 3SS3A 3IWQA 4PPRA 2VGLM 5FA7A 1P9WA 1FIKA 2Z2MB 1JWPA 1D7EA 3Q81A 3G2ZA 2B5RA 2W1RA 4C6YA 1W63M 2BG1A 1K55C 2ZQ9A 3W4OA 5A92A 3LUQA 3VOZA 2PYRA 3FPWA 1YLZA 3PAGA 4KG6A 1N9BA 1IEMA 4FCFA 4OOLA 1S4RA 4OOYA 3O3VA 1G28A 3MBZA 4RX3A 2W1TB 5G4YA 2JKTI 4E3LA 2DMWA 1SKOB 4NXGA 4H8RA 3R4KA 2ZM0A 4Y3IA 2HP5A 2UV0E 2QPNA 3C7UA 3IS2B 3VP3A 5CXWA 3UB6A 5EVIB 3PHYA 2OLVA 4HY8A 4WZ5A 1MXOA 2KX6A 5FQ9A 2XF3A 4QD4A 3ZHHA 1L0EA 2G7UA 1L0FA 2ZQDA 3LEZA 1ESUA 5L10A 1VETA 2ZL1B 3LGOA 3VV4A 3W2ZA 4EEPA 1NLYA 4X56A 3P01A 3PBNA 3SZTA 1NWZA 3BRMA 4JXSA 5DTKA 3IX4A 4ARZB 3ZVWA 3MXRA 5E2HA 3OPRA 4U3TA 4OQGA 3G34A 4E6WA 1LI0A 4MBFA 3T1SA 3MMHA 3VMAA 3KO6A 5CEBA 4CLCA 4HEFA 3FZCA 4OKPA 2EA9A 1FSYA 2O9BA 3ZG0A 1Y4OA 4JBFA 1WYBA 4IJGA 2V8CA 1NYMA 3B3XA 3FKVA 3FWLA 3E98A 2HJEA 2VGKA 1OT6A 2HZ5A 2XA7M 1CEGA 4D2OA 3C7VA 2PD8A 3GECA 4E3IA 1DJCA 2WGVA 1GSXA 5U47A 4X55A 2WK0A 5HDSA 1KDWA 3CJMA 5GHYA 4PM8A 2ZLYA 4GS9B 2IWBA 1XP4A 3S4XA 2W3FA 4HP4A 3N4IA 4CLCE 2IA2A 4A5RA 3EEAA 5A90A 1K38A 1N9LA 3HLFA 3GTCA 3RXXA 5EM1A 4DDYA 2PU2A 2ZQ8A 2ZQ7A 2ZBBA 1GCEA 2PAVP 3A0RA 1DRMA 5HDCA 3SH7A 1S1ZA 2JE5A 4G3WA 2ZM8A 5KMWA 3F1PB 1K55A 5CRFA 2I72A 3IH8A 4EQIA 3A3FA 2IWCA 1YPRA 1CI8A 1T1BA 3PBSA 2M7UA 1E4DA 4QY6A 5CGSA 4RYEA 1T1CA 4P6ZS 4PM6A 4NXEA 1PW8A 3BECA 3HUNA 3ZG7B 3LEQA 4PMAA 2E8JA 1YLYA 5EPHA 3ICYA 3DTEA 4DKIA 1PRQA 3GRJA 1EROA 3PAEA 1VETB 2A24A 3CUEC 4IBXA 3BY8A 4BL3A 4B9OA 2ZMFA 3L9KA 3LIAA 2G2UA 2B02A 4F94A 2Q9NA 4JPMA 5HL6A 4B4XA 3E2KA 3MZEA 4EESA 1D1JA 3MXQA 2EWWA 5FEFA 3LIFA 3VOLA 4KUKA 1FILA 1NRJA 4Y13A 4BWIA 2HJ9C 2D02A 3GQZA 2Y8HA 1AWIA 4BJPA 5EECA 1TVFA 5HFOA 2PHYA 3QNBA 4S2NC 3C8CA 5EVIC 2HDSA 1MWRA 1H5XA 3W8KA 2HP9A 4DJ2A 1S4SA 5FAQA 3A3JA 3IXDA 3O5YA 3LCEA 2VKSA 3G32A 1CI9A 3KYEA 1P0ZA 1HD8A 4BBVA 1UWPX 1YAXA 2Z2LB 2O9CA 3PYPA 1YSPA 2YKFA 2V1AA 1YQSA 3LFVA 3MS6A 3MF0A 4KENB 2XGNA 4R4RA 4WLAA 3LIEA 3LO7A 4EQ1A 3BY9A 4F3LA 4KUOA 4Q0HA 2NUPC 3MFDA 2JKRI 4MBHA 1YKDA 4ZTKA 4E3MA 3V39A 2YKHA 3LIBA 4O7DA 1TD5A 4GLQA 4KZ3A 2A2LA 2JN7A 1PYYA 4WELA 4KQOA 5FL3A 1TDLA 2H0TA 3OOVA 5CGXA 2XRNA 5FASA 5I5LA 3C38A 5CEDA 2OSUA 4FTXA 2X01A 1V9ZA 3PTEA 4WN5A 5TR7A 2L1MA 1GA9A 4PKYG 4GD8A 3U4LP 3S1YA 1HTZA 4LENA 2WKHA 4HJ4A 4HBTA 3CHWP 4OPYA 4KZ5A 3HUMA 3ZQ5A 5DF8A 2RL3A 4EERA 5JYPA 3NOUC 1CF0A 2P74A 3WS0A 2J3WA 5TBMB 2VGJA 3NOTC 4WBGA 3N7WA 3DTIA 2O0YA 2J3TD 3K3DA 4NK3A 2G2WA 3OPHA 3BJNA 2XFTA 4OONA 1K0KA 2ZMAA 1NLZA 1VHMA 4JXGA 3IWIA 2AVXA 4HI4A 1NXYA 1ES5A 2Y2PA 3JPUA 1MKMA 2Y59A 2FZ0A 4DXCA 1LSVA 1YLPA 3SOIA 2JBFA 3LICA 3CUEA 2J8YA 2HDQA 4BMWA 1OTAA 5EVEA 5AQ7A 3MFXA 2JHEA 3RJUA 1SDEA 2RCXA 5J7EA 4OQHA 5F6AA 2KLIA 3VP1A 1FQGA 3WS5A 5HD3A 2XQZA 3CITA 3IX3A 3H82B 3FC7A 1CQAA 1SKOA 2GZAA 3BLMA 4X25A 1LHYA 1N4OA 3UB5P 3CG5A 1A0KA 2P7JA 2XK1A 4S2NA 5EVIA 2OV5A 3E4PA 5G4ZA 3DWZA 4F3LB 3CMZA 2Y2JA 2QHKA 3LR3A 3UB9A 1OJGA 1QMEA 3F1NB 5GLBA 3W4QA 4JGPA 3TOIA 4OQ0A 4WZ4A 1K4FA 3FKWA 5CHMA 2GJ3A 4HJ6A 2NUTC 4UQIS 2M7VA 1BLSA 3G2YA 4ARZA 1SKFA 1NYYA 4ZJ1A 2XD5A 1MBLA 3LR5A 2ZC6B 4ZJ3A 1Z09A 2WKEA 1OTIA 5AVFA 3ZNTA 3GSGA 2ZJ9A 4R70A 5D3OA 5CTMA 3FYZA 4M4XA 2VJWA 4OLGA 1E3UA 1BTLA 5DF9A 4BBUA 4ZRRA 3QP2A 3ZG9B 1YMSA 3CI6A 4JGRA 2Y2NA 2BASA 4LRYC 1O7EA 2XEPA 3C5AA 3FV7A 4I3JA 3UY6A 3VSKA 1KOUA 2Z6CA 4GS9A 2J9OA 3VFFA 4XT2A 3N8LA 3F1OB 4X69A 3S22A 4P0MA 2XSSA 1BLPA 1BYWA 4E04A 4QY5A 1U60A 1BULA 1W7FA 1XGJA 3N8RA 1SCWA 2Y2GA 3QP6A 1GHMA 1GHPA 3O88A 1W8YA 3MKFA 5GHZA 1VEUA 2WGWA 1DJBA 2P04A 3F1PA 3TW8A 4E3KA 4MN6A 4GCZA 1XX2A 1N9OA 5DF7A 4BL2A 3BFCA 1FCMA 4LV2A 1H8MA 3OC2A 1J9MA 4WL9A 2XR0A 3M6HA 1YLTA 4DJ3A 3OCNA 3ULFA 2ZOIA 4CPKA 1LL8A 1O07A 2EX8A 3UMDA 3BFDA 3SS5A 3MZDA 3NBLA 4B88A 1KVMA 3DAVA 3GDIA 4KG5A 4JF4A 3P98A 2ACGA 2LB5A 1DP8A 4DF6A 1ZHHB 1K56A 3SW1A 4XUZA 2FFYA 1MWTA 2V8FA 4EETB 4Q8IA 1KGGA 1XA7A 1LT0A 4CLCD 2HV1A 2W3DA 3EQUA 3RFBA 3TSGA 1P9RA 2VV6A 3FPVA 2VZWA 3OLOA 3CPTB 2J80A 3G30A 2W27A 4DE2A 1EI5A 5M1AA 2OAP1 4P6ZM 3DW0A 4BBTA 3IX8A 4HESA 5G18A 3LY4A 3LYXA 1ERQA 3C2WA 3HL9A 3E4OA 1OT9A 1ES4A 1MKIA 1ES3A 3UE3A 3M2KA 4YOFA 2JCHA 2EWVA 3G31A 3NIAA 1HLUP 5HSQA 1OPXA 1XFQA 1VB6A 1DJAA 3AGDA 4K08A 1OJ5A 2V2FF 4XT2B 1W79A 3QP1A 3Q07A 5DKLA 3KX0X 3T4SA 3LR0A 1L3LA 4QB8A 1NZOA 4BLMA 4JKTA 2PR5A 2X71A 3EGDC 4R1GA 1FSWA 1JWZA 3VP4A 3S7QA 1H3QA 3S7PA 2XH9A 1BLHA 1H8ZA 4OH0A 2QJ7A 3RTYA 2HGVA 5L09A 3OZHA 1KE3A 4PKYA 5HDDA 1VEUB 2WGWB 4EUZA 4LV3A 1PFLA 1ZTUA 2WGIA 3BW6A 3WWXA 1P97A 2J9PA 2V1BA 2ZC7A 2ZC5B 3M6BA 1ONGA 2QYBA 4LFUA 2JKTM 3NI9A 5FDHA 3BFGA 2XLNA 1PZOA 1WYCA 2DCFA 4UA7A 2EX2A 2Z6DA 4BENA 4E6XA 1STZA 3OPPA 3WRZA 5TBMA 2WADA 1PW1A 5FSRA 1BUEA 1W63Q 2PD7A 5I94A 2PT7A 5L07A 3NCKA 5TGFA 4C3QA 4DE3A 2XA7S 3SH9A 4OPQA 4BD1A 3IBJA 3ITBA 3AGEA 1G5UA 3KSGA 4O8GA 3OBFA 3HREA 3E0YA 3IBRA 5JYOA 1IOUA 2ZC4B 4N9LA 2O99A 5GL9A 4OLDA 2R78A 4IVKA 4S2MA 1BSGA 3GMWA 3K2NA 3N6IA 1JNUA 3UE0A
chains in the Genus database with same CATH topology
4PPRA 1MPLA 2Y59A 4IVIA 3W4PA 4Z9QA 4DXCA 4JXWA 5CECA 1YLPA 3SOIA 2JBFA 1IYOA 3P09A 1YM1A 2J8YA 5FA7A 2HDQA 1LLBA 3GVBA 5F1GA 3WS2A 2ZM2A 4GD6A 4EBPA 3O86A 5AQ7A 1XXMA 4GB7A 4EBNA 4E3NA 2Z2MB 3A3EA 1JWPA 3RJUA 5HARA 1SDEA 3Q81A 2OLUA 2RCXA 2HP6A 1PZPA 3A3DA 3G2ZA 4OQHA 4KZ9A 3VP1A 5KSCA 2B5RA 1FQGA 3WS5A 1KVLA 1PI5A 4C6YA 2PU4A 1K6SA 2BG1A 1K55C 2XQZA 2ZQ9A 3W4OA 5A92A 2A3UA 4QHCA 2WUQA 3VOZA 4P85A 1S0WA 1YLZA 3PAGA 1XGIA 3ZDJA 4KG6A 3BLMA 1LL5A 1KDSA 1N9BA 4P87A 4X68A 4CJNA 1IEMA 2X02A 4FCFA 4OOLA 1LHYA 1N4OA 3G35A 4HBUA 5F1FA 3IXHA 3O3VA 1Q2PA 1FCOA 2WZXA 3CG5A 1H8YA 1M40A 1JVJA 4OOYA 3IF6A 3MBZA 2XK1A 4RX3A 5GHXA 4OPZA 4S2NA 5EVIA 1L0DA 2OV5A 3Q7ZA 1LI9A 4E3LA 1BT5A 1C3BA 4R3JA 1RGYA 1RP5A 3DWZA 3OPLA 4H8RA 1Q2QA 2ZM0A 3CMZA 3HBRA 4S2KA 5E2FA 2Y2JA 2HP5A 2A49A 1KGEA 2QPNA 4R23A 3V3RA 3C7UA 1QMEA 5GLBA 3W4QA 3VP3A 5CXWA 5EVIB 5HAPA 3TOIA 3Q7VA 5IHVA 1IELA 1IYSA 2GDNA 1SDNA 2OLVA 2P9VA 4OQ0A 4WZ5A 1K4FA 3FKWA 4WZ4A 1MXOA 5FQ9A 3VSLA 4QU3A 5CHMA 2XF3A 2PBYA 4QD4A 1L0EA 5FAOA 1K57C 3ZHHA 1HVBA 4YINA 2HDRA 1L0FA 4WEJA 2QMIA 2WAFA 2ZQDA 3LEZA 1ESUA 1NRFA 3ZG5A 3IF5A 1BLSA 3G2YA 4UA9A 2EX6A 1BZAA 2R9XA 1IKIA 1SKFA 2XDMA 2EFUA 3HLCA 4GN2A 1FOFA 1NYYA 5TFQA 5E2EA 3Q7VB 2XD5A 4ZJ1A 4Y0TA 4ZDXA 1MBLA 1TEMA 2P9VB 3ZGAB 2XD1A 2ZC6B 1PWCA 3VFHA 4X56A 4ZJ3A 3PBNA 3WS1A 3PBOA 2WZZA 3BRMA 4JXSA 5DTKA 4NETA 3ZG8B 1IKGA 3ZVWA 4UA6A 3MXRA 5E2HA 1JTGA 2WKEA 3ZNTA 3GSGA 3OPRA 4LCMA 4U3TA 4OQGA 4MNRA 2C6WB 4EV4A 4LV0A 1I2WA 4OOMA 2ZJ9A 4U0TA 4JF6A 5D3OA 3G34A 5CTMA 4E6WA 5FATA 4PM7A 3FYZA 1LI0A 4MBFA 3UPNA 3VMAA 5CEBA 2H10A 2IWDA 4HEFA 3FZCA 4OLGA 1E3UA 4GKUA 4N92A 1BTLA 3VP2A 4DE0A 5DF9A 4OKPA 3UN7A 1FSYA 3ZG9B 4KG2A 1YMSA 3ZG0A 4BD0A 5HAQA 5DTTA 2Y2NA 4JBFA 1WYBA 3BLSA 1NYMA 1O7EA 2XEPA 5FQJA 3B3XA 2DRWA 3C5AA 3V50A 5F82A 3FKVA 3FV7A 2V1ZA 3FWLA 5A91A 3UY6A 2VGKA 1W8QA 3VSKA 1CEGA 2J9OA 3C7VA 4D2OA 3VP0A 3VFFA 2Y2LA 2ZC3B 4Y7PA 4E3IA 1DJCA 3N8LA 4X69A 1ONHA 4K0WA 3BFEA 3S22A 3UDXA 4P0MA 1BLPA 2WGVA 3LY3A 3ZNYA 4IEDA 1NZUA 4RX2A 1PWGA 5U47A 4X55A 4QY5A 1CEFA 2WK0A 5A93A 1U60A 1BULA 1W7FA 1XGJA 3N8RA 1KDWA 5M19A 1K25A 1SCWA 3UNWA 3CJMA 5EUAA 3G4PA 2ZD8A 2Y2GA 5CHJA 4S2JA 4PM8A 2ZLYA 5EVID 5GHYA 4IBRA 3IXGA 1GHIA 1XP4A 2IWBA 5CERA 1GHMA 3S4XA 5E43A 4QJGA 1GHPA 3O88A 1EWZA 4WMCA 3N4IA 1NY0A 1W8YA 3Q82A 3MKFA 5GHZA 1K54C 2WGWA 4A5RA 5A90A 1TDGA 5AQ9A 1DJBA 4N1XA 4ZJ2A 5HAIA 1K38A 1NJ4A 3HLFA 3GTCA 3MZFA 3RXXA 4E3KA 4UAAA 5M18A 1KGFA 4DDYA 2PU2A 1XX2A 1MWSA 4UHUA 5J8XA 2ZQ8A 2ZQ7A 5DF7A 3BM6A 1K4EA 4KQRA 1I5QA 1GCEA 2Q9MA 4KZBA 3BFCA 4S2IA 4BL2A 5EE8A 1FCMA 4LV2A 3IF6B 1PI4A 3OC2A 1J9MA 5FQKA 1DY6A 3SH7A 2XR0A 3M6HA 2JE5A 1YLTA 2ZM8A 1YLWA 5KMWA 5KSHA 1K55A 1JWVA 3OCNA 5CRFA 3GR2A 4S2LA 5FI2A 2EX9A 2I72A 5EOOA 1OMEA 2WKIA 3IH8A 4CPKA 3A3FA 2IWCA 1O07A 4EQIA 2EX8A 1PWDA 1CI8A 3BFDA 3SS5A 3PBSA 3MZDA 3PBRA 3NBLA 1E4DA 1ZKJA 2HPBA 3M2JA 4QY6A 4RYEA 5CGSA 4B88A 3V3SA 2E8IA 1KVMA 5FQQA 1YLJA 4PM6A 4KG5A 1IYPA 4JF4A 3P98A 1PW8A 5F83A 1BLCA 3A3IA 3BECA 3HUNA 2Y2HA 4M3KA 3ZG7B 2QZ6A 4PMAA 1M6KA 1Z6FA 1MY8A 2JC7A 1L0GA 4DF6A 1YLYA 1K56A 5FQIA 3WRTA 3HLEA 4KZ6A 1YMXA 3WS4A 5EPHA 2XFSA 4KZ7A 4XUZA 3PBQA 2FFYA 1MWTA 5FQMA 4DKIA 5L2FA 1SHVA 4Q8IA 3GRJA 1EROA 1KGGA 3PAEA 1XA7A 4EBLA 3D4FA 3ZCZA 2Y2OA 3ISGA 4IBXA 3NY4A 4BL3A 5EVLA 1L2SA 1E3UD 3EQUA 3TSGA 3VOYA 2WAEA 4Y0UA 3UO9A 4PM9A 2G2UA 3G30A 3IHAA 4F94A 4DE2A 1EI5A 2Q9NA 4JPMA 4FH2A 4XXRA 1IYQA 4B4XA 2Y2IA 3E2KA 3MZEA 2Y55A 5M1AA 1CK3A 1K57A 3IXBA 3DW0A 1PIOA 4C75A 2Y4AA 4R4SA 1RCJA 1JTDA 4FSFA 4HESA 5G18A 4DRTA 3LY4A 4GOGA 2Y2KA 3MXSA 1ERQA 3HLGA 3HL9A 3TG9A 1FCNA 3UPOA 1YT4A 4E3OA 3GQZA 4MBKA 4N1HA 4R0QA 4DXBA 4BJPA 2BLSA 1ES4A 5GLDA 1MKIA 4ID4A 1ES3A 1G6AA 3QNCA 3I7JA 3UE3A 4KZ4A 4N9KA 3M2KA 5EECA 1TVFA 3IF6C 3V5MA 5HFOA 4S2OA 2R9WA 3QNBA 3Q1FA 3ZFZA 2JCHA 4B4ZA 5BOHA 3HUOA 3G31A 3NIAA 4S2NC 5EVIC 2HDSA 1MWRA 1QMFA 1H5XA 3W8KA 2HP9A 4EWFA 1MWUA 4OVDA 4OP5A 5FI7A 1VM1A 5FAQA 4WMCD 3SS4A 3A3JA 3IXDA 1XA1A 3LCEA 5FI6A 1RGZA 3G32A 4GNUA 1CI9A 1DJAA 2FFFB 3AGDA 1I2SA 4OP8A 3UDIA 1HD8A 2Z2LB 3HLWA 1AXBA 3AGFA 2CC1A 2V2FF 3BFFA 1W79A 1ZC2A 3DTMA 3Q07A 1FR6A 1YQSA 1WE4A 2HDUA 3HVFA 2C5WB 4KENB 4KZAA 4KZ8A 2XGNA 4QB8A 4PM5A 1NZOA 4R4RA 4BLMA 1KE4A 5CGWA 1VQQA 4JKTA 2EXBA 3ITAA 1W5DA 4WZ5C 1XKZA 2UWXA 2X71A 3LO7A 5CTNA 4WYYA 4R1GA 1FSWA 1JWZA 3VP4A 2Y91A 2XH9A 3SH8A 2ZQCA 1E25A 1BLHA 1ERMA 1S6RA 4GDNA 3UDFA 4RA7A 1H8ZA 4OH0A 3NDEA 4S2PA 3UE1A 5HX9A 3MFDA 4MBHA 3OZHA 4ZTKA 3IQAA 1KE3A 1HZOA 4E3MA 4LV1A 3V39A 5HW3A 2V20A 2WGWB 3PBTA 4LV3A 4EUZA 4O7DA 1ALQA 4KZ3A 1PYYA 5E2GA 5AQBA 4JLFA 2WGIA 4WELA 4GDBA 4KQOA 5GLCA 3WWXA 1TDLA 2H0TA 5EOEA 5CGXA 5DVAA 5FASA 2J9PA 2ZC7A 3HLDA 3OCLA 4GZBA 2ZC5B 5CEDA 1K56D 4ZBEA 3GV9A 2OSUA 3M6BA 1ONGA 1GA0A 1K6RA 4DE1A 4JXVA 2X01A 3PTEA 4X6TA 4YFMA 3NI9A 3O87A 5FDHA 3BFGA 5TR7A 2XLNA 1GA9A 1PZOA 1ES2A 4K91A 2H0YA 3DWKA 4XUXA 1WYCA 5KZHA 2DCFA 4MEZA 1K54A 4GD8A 5AQAA 4UA7A 3S1YA 1HTZA 4LENA 2EX2A 4KQQA 4BENA 2WKHA 3RXWA 4E6XA 2Y2QA 3OPPA 3ZVTA 3WRZA 1ZG6A 1LL9A 2WADA 5GLAA 4HBTA 4X53A 4OQIA 1PW1A 4OPYA 4WM9A 4K0XA 4L0LA 3BYDA 5FSRA 1BUEA 3NC8A 1KE0A 1Y54A 2ZQAA 4KZ5A 3HUMA 5DTSA 3IWOA 5DF8A 4RVAA 2RL3A 4Y0OA 5JYPA 5I94A 5FAPA 3MKEA 3EQVA 4JF5A 2EXAA 3NCKA 4E3JA 4R3BA 4P6BA 2P74A 4DDSA 4U0XA 3C4OA 5TGFA 3WS0A 4C3QA 3SH9A 4DE3A 4OPQA 1ZG4A 4WEKA 4BD1A 2H5SA 3UPPA 3IH9A 3ITBA 2VGJA 3AGEA 4BQMA 4MLLA 4WBGA 3N7WA 4FH4A 2J7VA 3HREA 3C4PA 2EFXA 2Y2MA 4NK3A 2G2WA 4LCLA 4FD8A 3N8SA 3OPHA 5HL1A 5CHUA 3QHYA 2DNSA 3HLBA 4ZAMA 5JYOA 2WYXA 2ZC4B 4N9LA 1FR1A 3E2LA 5GL9A 2XFTA 1XPBA 3CZDA 4OLDA 1G68A 3NDGA 4OPRA 4OONA 2ZMAA 4IVKA 3BEBA 1BSGA 4S2MA 3GMWA 4JXGA 3JYIA 3IWIA 3IT9A 1ESIA 3SS3A 3IHBA 3N6IA 3UE0A 1NXYA 1ES5A 3IWQA 2Y2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PPR A;  1MPL A;  2Y59 A;  4IVI A;  3W4P A;  4Z9Q A;  4DXC A;  4JXW A;  5CEC A;  1YLP A;  3SOI A;  2JBF A;  1IYO A;  3P09 A;  1YM1 A;  2J8Y A;  5FA7 A;  2HDQ A;  1LLB A;  3GVB A;  5F1G A;  3WS2 A;  2ZM2 A;  4GD6 A;  4EBP A;  3O86 A;  5AQ7 A;  1XXM A;  4GB7 A;  4EBN A;  4E3N A;  2Z2M B;  3A3E A;  1JWP A;  3RJU A;  5HAR A;  1SDE A;  3Q81 A;  2OLU A;  2RCX A;  2HP6 A;  1PZP A;  3A3D A;  3G2Z A;  4OQH A;  4KZ9 A;  3VP1 A;  5KSC A;  2B5R A;  1FQG A;  3WS5 A;  1KVL A;  1PI5 A;  4C6Y A;  2PU4 A;  1K6S A;  2BG1 A;  1K55 C;  2XQZ A;  2ZQ9 A;  3W4O A;  5A92 A;  2A3U A;  4QHC A;  2WUQ A;  3VOZ A;  4P85 A;  1S0W A;  1YLZ A;  3PAG A;  1XGI A;  3ZDJ A;  4KG6 A;  3BLM A;  1LL5 A;  1KDS A;  1N9B A;  4P87 A;  4X68 A;  4CJN A;  1IEM A;  2X02 A;  4FCF A;  4OOL A;  1LHY A;  1N4O A;  3G35 A;  4HBU A;  5F1F A;  3IXH A;  3O3V A;  1Q2P A;  1FCO A;  2WZX A;  3CG5 A;  1H8Y A;  1M40 A;  1JVJ A;  4OOY A;  3IF6 A;  3MBZ A;  2XK1 A;  4RX3 A;  5GHX A;  4OPZ A;  4S2N A;  5EVI A;  1L0D A;  2OV5 A;  3Q7Z A;  1LI9 A;  4E3L A;  1BT5 A;  1C3B A;  4R3J A;  1RGY A;  1RP5 A;  3DWZ A;  3OPL A;  4H8R A;  1Q2Q A;  2ZM0 A;  3CMZ A;  3HBR A;  4S2K A;  5E2F A;  2Y2J A;  2HP5 A;  2A49 A;  1KGE A;  2QPN A;  4R23 A;  3V3R A;  3C7U A;  1QME A;  5GLB A;  3W4Q A;  3VP3 A;  5CXW A;  5EVI B;  5HAP A;  3TOI A;  3Q7V A;  5IHV A;  1IEL A;  1IYS A;  2GDN A;  1SDN A;  2OLV A;  2P9V A;  4OQ0 A;  4WZ5 A;  1K4F A;  3FKW A;  4WZ4 A;  1MXO A;  5FQ9 A;  3VSL A;  4QU3 A;  5CHM A;  2XF3 A;  2PBY A;  4QD4 A;  1L0E A;  5FAO A;  1K57 C;  3ZHH A;  1HVB A;  4YIN A;  2HDR A;  1L0F A;  4WEJ A;  2QMI A;  2WAF A;  2ZQD A;  3LEZ A;  1ESU A;  1NRF A;  3ZG5 A;  3IF5 A;  1BLS A;  3G2Y A;  4UA9 A;  2EX6 A;  1BZA A;  2R9X A;  1IKI A;  1SKF A;  2XDM A;  2EFU A;  3HLC A;  4GN2 A;  1FOF A;  1NYY A;  5TFQ A;  5E2E A;  3Q7V B;  2XD5 A;  4ZJ1 A;  4Y0T A;  4ZDX A;  1MBL A;  1TEM A;  2P9V B;  3ZGA B;  2XD1 A;  2ZC6 B;  1PWC A;  3VFH A;  4X56 A;  4ZJ3 A;  3PBN A;  3WS1 A;  3PBO A;  2WZZ A;  3BRM A;  4JXS A;  5DTK A;  4NET A;  3ZG8 B;  1IKG A;  3ZVW A;  4UA6 A;  3MXR A;  5E2H A;  1JTG A;  2WKE A;  3ZNT A;  3GSG A;  3OPR A;  4LCM A;  4U3T A;  4OQG A;  4MNR A;  2C6W B;  4EV4 A;  4LV0 A;  1I2W A;  4OOM A;  2ZJ9 A;  4U0T A;  4JF6 A;  5D3O A;  3G34 A;  5CTM A;  4E6W A;  5FAT A;  4PM7 A;  3FYZ A;  1LI0 A;  4MBF A;  3UPN A;  3VMA A;  5CEB A;  2H10 A;  2IWD A;  4HEF A;  3FZC A;  4OLG A;  1E3U A;  4GKU A;  4N92 A;  1BTL A;  3VP2 A;  4DE0 A;  5DF9 A;  4OKP A;  3UN7 A;  1FSY A;  3ZG9 B;  4KG2 A;  1YMS A;  3ZG0 A;  4BD0 A;  5HAQ A;  5DTT A;  2Y2N A;  4JBF A;  1WYB A;  3BLS A;  1NYM A;  1O7E A;  2XEP A;  5FQJ A;  3B3X A;  2DRW A;  3C5A A;  3V50 A;  5F82 A;  3FKV A;  3FV7 A;  2V1Z A;  3FWL A;  5A91 A;  3UY6 A;  2VGK A;  1W8Q A;  3VSK A;  1CEG A;  2J9O A;  3C7V A;  4D2O A;  3VP0 A;  3VFF A;  2Y2L A;  2ZC3 B;  4Y7P A;  4E3I A;  1DJC A;  3N8L A;  4X69 A;  1ONH A;  4K0W A;  3BFE A;  3S22 A;  3UDX A;  4P0M A;  1BLP A;  2WGV A;  3LY3 A;  3ZNY A;  4IED A;  1NZU A;  4RX2 A;  1PWG A;  5U47 A;  4X55 A;  4QY5 A;  1CEF A;  2WK0 A;  5A93 A;  1U60 A;  1BUL A;  1W7F A;  1XGJ A;  3N8R A;  1KDW A;  5M19 A;  1K25 A;  1SCW A;  3UNW A;  3CJM A;  5EUA A;  3G4P A;  2ZD8 A;  2Y2G A;  5CHJ A;  4S2J A;  4PM8 A;  2ZLY A;  5EVI D;  5GHY A;  4IBR A;  3IXG A;  1GHI A;  1XP4 A;  2IWB A;  5CER A;  1GHM A;  3S4X A;  5E43 A;  4QJG A;  1GHP A;  3O88 A;  1EWZ A;  4WMC A;  3N4I A;  1NY0 A;  1W8Y A;  3Q82 A;  3MKF A;  5GHZ A;  1K54 C;  2WGW A;  4A5R A;  5A90 A;  1TDG A;  5AQ9 A;  1DJB A;  4N1X A;  4ZJ2 A;  5HAI A;  1K38 A;  1NJ4 A;  3HLF A;  3GTC A;  3MZF A;  3RXX A;  4E3K A;  4UAA A;  5M18 A;  1KGF A;  4DDY A;  2PU2 A;  1XX2 A;  1MWS A;  4UHU A;  5J8X A;  2ZQ8 A;  2ZQ7 A;  5DF7 A;  3BM6 A;  1K4E A;  4KQR A;  1I5Q A;  1GCE A;  2Q9M A;  4KZB A;  3BFC A;  4S2I A;  4BL2 A;  5EE8 A;  1FCM A;  4LV2 A;  3IF6 B;  1PI4 A;  3OC2 A;  1J9M A;  5FQK A;  1DY6 A;  3SH7 A;  2XR0 A;  3M6H A;  2JE5 A;  1YLT A;  2ZM8 A;  1YLW A;  5KMW A;  5KSH A;  1K55 A;  1JWV A;  3OCN A;  5CRF A;  3GR2 A;  4S2L A;  5FI2 A;  2EX9 A;  2I72 A;  5EOO A;  1OME A;  2WKI A;  3IH8 A;  4CPK A;  3A3F A;  2IWC A;  1O07 A;  4EQI A;  2EX8 A;  1PWD A;  1CI8 A;  3BFD A;  3SS5 A;  3PBS A;  3MZD A;  3PBR A;  3NBL A;  1E4D A;  1ZKJ A;  2HPB A;  3M2J A;  4QY6 A;  4RYE A;  5CGS A;  4B88 A;  3V3S A;  2E8I A;  1KVM A;  5FQQ A;  1YLJ A;  4PM6 A;  4KG5 A;  1IYP A;  4JF4 A;  3P98 A;  1PW8 A;  5F83 A;  1BLC A;  3A3I A;  3BEC A;  3HUN A;  2Y2H A;  4M3K A;  3ZG7 B;  2QZ6 A;  4PMA A;  1M6K A;  1Z6F A;  1MY8 A;  2JC7 A;  1L0G A;  4DF6 A;  1YLY A;  1K56 A;  5FQI A;  3WRT A;  3HLE A;  4KZ6 A;  1YMX A;  3WS4 A;  5EPH A;  2XFS A;  4KZ7 A;  4XUZ A;  3PBQ A;  2FFY A;  1MWT A;  5FQM A;  4DKI A;  5L2F A;  1SHV A;  4Q8I A;  3GRJ A;  1ERO A;  1KGG A;  3PAE A;  1XA7 A;  4EBL A;  3D4F A;  3ZCZ A;  2Y2O A;  3ISG A;  4IBX A;  3NY4 A;  4BL3 A;  5EVL A;  1L2S A;  1E3U D;  3EQU A;  3TSG A;  3VOY A;  2WAE A;  4Y0U A;  3UO9 A;  4PM9 A;  2G2U A;  3G30 A;  3IHA A;  4F94 A;  4DE2 A;  1EI5 A;  2Q9N A;  4JPM A;  4FH2 A;  4XXR A;  1IYQ A;  4B4X A;  2Y2I A;  3E2K A;  3MZE A;  2Y55 A;  5M1A A;  1CK3 A;  1K57 A;  3IXB A;  3DW0 A;  1PIO A;  4C75 A;  2Y4A A;  4R4S A;  1RCJ A;  1JTD A;  4FSF A;  4HES A;  5G18 A;  4DRT A;  3LY4 A;  4GOG A;  2Y2K A;  3MXS A;  1ERQ A;  3HLG A;  3HL9 A;  3TG9 A;  1FCN A;  3UPO A;  1YT4 A;  4E3O A;  3GQZ A;  4MBK A;  4N1H A;  4R0Q A;  4DXB A;  4BJP A;  2BLS A;  1ES4 A;  5GLD A;  1MKI A;  4ID4 A;  1ES3 A;  1G6A A;  3QNC A;  3I7J A;  3UE3 A;  4KZ4 A;  4N9K A;  3M2K A;  5EEC A;  1TVF A;  3IF6 C;  3V5M A;  5HFO A;  4S2O A;  2R9W A;  3QNB A;  3Q1F A;  3ZFZ A;  2JCH A;  4B4Z A;  5BOH A;  3HUO A;  3G31 A;  3NIA A;  4S2N C;  5EVI C;  2HDS A;  1MWR A;  1QMF A;  1H5X A;  3W8K A;  2HP9 A;  4EWF A;  1MWU A;  4OVD A;  4OP5 A;  5FI7 A;  1VM1 A;  5FAQ A;  4WMC D;  3SS4 A;  3A3J A;  3IXD A;  1XA1 A;  3LCE A;  5FI6 A;  1RGZ A;  3G32 A;  4GNU A;  1CI9 A;  1DJA A;  2FFF B;  3AGD A;  1I2S A;  4OP8 A;  3UDI A;  1HD8 A;  2Z2L B;  3HLW A;  1AXB A;  3AGF A;  2CC1 A;  2V2F F;  3BFF A;  1W79 A;  1ZC2 A;  3DTM A;  3Q07 A;  1FR6 A;  1YQS A;  1WE4 A;  2HDU A;  3HVF A;  2C5W B;  4KEN B;  4KZA A;  4KZ8 A;  2XGN A;  4QB8 A;  4PM5 A;  1NZO A;  4R4R A;  4BLM A;  1KE4 A;  5CGW A;  1VQQ A;  4JKT A;  2EXB A;  3ITA A;  1W5D A;  4WZ5 C;  1XKZ A;  2UWX A;  2X71 A;  3LO7 A;  5CTN A;  4WYY A;  4R1G A;  1FSW A;  1JWZ A;  3VP4 A;  2Y91 A;  2XH9 A;  3SH8 A;  2ZQC A;  1E25 A;  1BLH A;  1ERM A;  1S6R A;  4GDN A;  3UDF A;  4RA7 A;  1H8Z A;  4OH0 A;  3NDE A;  4S2P A;  3UE1 A;  5HX9 A;  3MFD A;  4MBH A;  3OZH A;  4ZTK A;  3IQA A;  1KE3 A;  1HZO A;  4E3M A;  4LV1 A;  3V39 A;  5HW3 A;  2V20 A;  2WGW B;  3PBT A;  4LV3 A;  4EUZ A;  4O7D A;  1ALQ A;  4KZ3 A;  1PYY A;  5E2G A;  5AQB A;  4JLF A;  2WGI A;  4WEL A;  4GDB A;  4KQO A;  5GLC A;  3WWX A;  1TDL A;  2H0T A;  5EOE A;  5CGX A;  5DVA A;  5FAS A;  2J9P A;  2ZC7 A;  3HLD A;  3OCL A;  4GZB A;  2ZC5 B;  5CED A;  1K56 D;  4ZBE A;  3GV9 A;  2OSU A;  3M6B A;  1ONG A;  1GA0 A;  1K6R A;  4DE1 A;  4JXV A;  2X01 A;  3PTE A;  4X6T A;  4YFM A;  3NI9 A;  3O87 A;  5FDH A;  3BFG A;  5TR7 A;  2XLN A;  1GA9 A;  1PZO A;  1ES2 A;  4K91 A;  2H0Y A;  3DWK A;  4XUX A;  1WYC A;  5KZH A;  2DCF A;  4MEZ A;  1K54 A;  4GD8 A;  5AQA A;  4UA7 A;  3S1Y A;  1HTZ A;  4LEN A;  2EX2 A;  4KQQ A;  4BEN A;  2WKH A;  3RXW A;  4E6X A;  2Y2Q A;  3OPP A;  3ZVT A;  3WRZ A;  1ZG6 A;  1LL9 A;  2WAD A;  5GLA A;  4HBT A;  4X53 A;  4OQI A;  1PW1 A;  4OPY A;  4WM9 A;  4K0X A;  4L0L A;  3BYD A;  5FSR A;  1BUE A;  3NC8 A;  1KE0 A;  1Y54 A;  2ZQA A;  4KZ5 A;  3HUM A;  5DTS A;  3IWO A;  5DF8 A;  4RVA A;  2RL3 A;  4Y0O A;  5JYP A;  5I94 A;  5FAP A;  3MKE A;  3EQV A;  4JF5 A;  2EXA A;  3NCK A;  4E3J A;  4R3B A;  4P6B A;  2P74 A;  4DDS A;  4U0X A;  3C4O A;  5TGF A;  3WS0 A;  4C3Q A;  3SH9 A;  4DE3 A;  4OPQ A;  1ZG4 A;  4WEK A;  4BD1 A;  2H5S A;  3UPP A;  3IH9 A;  3ITB A;  2VGJ A;  3AGE A;  4BQM A;  4MLL A;  4WBG A;  3N7W A;  4FH4 A;  2J7V A;  3HRE A;  3C4P A;  2EFX A;  2Y2M A;  4NK3 A;  2G2W A;  4LCL A;  4FD8 A;  3N8S A;  3OPH A;  5HL1 A;  5CHU A;  3QHY A;  2DNS A;  3HLB A;  4ZAM A;  5JYO A;  2WYX A;  2ZC4 B;  4N9L A;  1FR1 A;  3E2L A;  5GL9 A;  2XFT A;  1XPB A;  3CZD A;  4OLD A;  1G68 A;  3NDG A;  4OPR A;  4OON A;  2ZMA A;  4IVK A;  3BEB A;  1BSG A;  4S2M A;  3GMW A;  4JXG A;  3JYI A;  3IWI A;  3IT9 A;  1ESI A;  3SS3 A;  3IHB A;  3N6I A;  3UE0 A;  1NXY A;  1ES5 A;  3IWQ A;  2Y2P A; 
#chains in the Genus database with same CATH topology
 1MPL A;  4IVI A;  4Z9Q A;  5CEC A;  4L9E A;  1IYO A;  1YM1 A;  3H82 A;  5F1G A;  5DJT A;  4GD6 A;  4EBP A;  1XXM A;  4GB7 A;  4EBN A;  4E3N A;  4EU0 A;  5HAR A;  2HP6 A;  4GW9 A;  1DP6 A;  1X0O A;  3A3D A;  4HOI A;  1PI5 A;  2MJ6 A;  1K6S A;  3BQA A;  4QHC A;  4P85 A;  1S0W A;  1TS6 A;  3T4Q A;  5TJJ A;  1XGI A;  1KDS A;  4P87 A;  2PYP A;  4CJN A;  2X02 A;  3CLO A;  3G35 A;  5F1F A;  1Q2P A;  4ETX A;  1JVJ A;  3F1N A;  4AFI A;  3HCY A;  1ACF A;  1T18 A;  1L0D A;  4O0P A;  3UB8 A;  1LI9 A;  4YWZ A;  3HJK A;  4CQH A;  4R3J A;  1RGY A;  4QWO A;  3QP8 A;  3HBR A;  4S2K A;  2A49 A;  1KGE A;  5DKK A;  5J3W A;  3G6O A;  5DFX A;  4LLO B;  1IFQ A;  5IHV A;  4LRX C;  1IYS A;  3T4K A;  3MSH A;  4II7 A;  3VSL A;  5FAO A;  1K57 C;  1HVB A;  2HDR A;  5KIZ A;  4WEJ A;  2WAF A;  3ZG5 A;  1NRF A;  3IF5 A;  4UA9 A;  1BZA A;  2OWJ A;  5TFQ A;  5E2E A;  3Q7V B;  4Y0T A;  1LSX A;  2P9V B;  2XD1 A;  3TRC A;  1GSV A;  3WS1 A;  3PBO A;  2VEA A;  2WZZ A;  3KYQ A;  5HZH A;  1JTG A;  2VV7 A;  4EV4 A;  2B18 A;  2C6W B;  1I2W A;  4U0T A;  5FAT A;  3D3O A;  3BWL A;  3UPN A;  2VLG A;  4UQI M;  2IWD A;  4GKU A;  4N92 A;  4DE0 A;  4Q0J A;  5K5B A;  3UN7 A;  5IU1 A;  3F1O A;  4BD0 A;  5DTT A;  3BLS A;  4HH3 A;  2KOI A;  3V50 A;  2GX5 A;  5F82 A;  5A91 A;  1OTB A;  1W8Q A;  1S1Y A;  3L7H A;  3B42 A;  2ZOH A;  2Y2L A;  5AVE A;  1ONH A;  4K0W A;  3UDX A;  2O9A A;  5HD5 A;  3ZNY A;  2QJ5 A;  5M19 A;  1K25 A;  3UNW A;  4HIA A;  5EUA A;  3G4P A;  1TS0 A;  5CHJ A;  4S2J A;  5EVI D;  3IXG A;  1OTE A;  4WMC A;  2PRF A;  1TDG A;  4I38 A;  4ZJ2 A;  4N1X A;  1DP9 A;  3MZF A;  5M18 A;  4UHU A;  5J8X A;  2JKF A;  1I5Q A;  1YSQ A;  5EE8 A;  3LR4 A;  4YNR A;  1PI4 A;  5FQK A;  4DN0 A;  3D72 A;  5KSH A;  5FI2 A;  3GR2 A;  2WKI A;  4KQD A;  3MQO A;  1PWD A;  1TS8 A;  3PBR A;  2HPB A;  3V3S A;  2XRO A;  2W3H A;  4M3K A;  2QZ6 A;  1M6K A;  1Z6F A;  1MY8 A;  2JC7 A;  4NXF A;  4PHT A;  3T1R A;  5FQI A;  3WRT A;  3LI9 A;  3WS4 A;  3CPT A;  2XFS A;  4KZ7 A;  3PBQ A;  5L2F A;  1SHV A;  4EBL A;  3ZCZ A;  3NY4 A;  5EVL A;  4G3K A;  1XJ2 A;  1L2S A;  1E3U D;  4PAU A;  2WAE A;  3KYZ A;  1IYQ A;  4GHI B;  3S7N A;  1CK3 A;  1K57 A;  3IXB A;  4NG2 A;  1T19 A;  2Y4A A;  4IUK A;  4R4S A;  1RCJ A;  1JTD A;  2W0N A;  4DRT A;  5HPF A;  2FH5 A;  2OAQ 1;  3TG9 A;  2M1C A;  1FCN A;  3UPO A;  1YT4 A;  1G6O A;  4DXB A;  5GLD A;  1G6A A;  3QNC A;  4N9K A;  4Q0I A;  4HJ3 A;  3IF6 C;  3V5M A;  4S2O A;  2R9W A;  3Q1F A;  5BOH A;  4JGQ A;  1UWN X;  3FG8 A;  4EWF A;  5F68 A;  4OVD A;  4OP5 A;  4Z1W A;  1TF1 A;  1Y28 A;  3KSF A;  4QPR A;  3SS4 A;  1XA1 A;  1RGZ A;  4I5S A;  4OP8 A;  3T4T A;  3UDI A;  1AXB A;  2CC1 A;  1ZC2 A;  3DTM A;  1FR6 A;  3T4J A;  1PNE A;  1WE4 A;  2HDU A;  3HVF A;  4KZA A;  4KZ8 A;  4PM5 A;  5CGW A;  3UME A;  2EXB A;  3ITA A;  1W5D A;  1XKZ A;  2UWX A;  3LI8 A;  1EW0 A;  4NEE D;  2ZQC A;  1E25 A;  1ERM A;  3UDF A;  2JKG A;  4RA7 A;  3NDE A;  4S2P A;  5HX9 A;  4X1M A;  5HW3 A;  3TJZ C;  3PBT A;  3R7W B;  5E2G A;  4JLF A;  4R38 A;  5GLC A;  1D06 A;  5DVA A;  4HP9 A;  3HLD A;  4ME4 A;  4GZB A;  1K56 D;  5MC7 A;  3GV9 A;  4NKP A;  3NHQ A;  3A0V A;  4DE1 A;  4JXV A;  4X6T A;  4YFM A;  3O87 A;  1T1A A;  4K91 A;  4FUW A;  4MEZ A;  4H6J A;  5EV0 A;  5EFW A;  5AQA A;  3A0S A;  4EXO A;  3JVU A;  3B47 A;  2HF6 A;  3RXW A;  3TE8 A;  3ZVT A;  4UEY A;  1LL9 A;  5GLA A;  2W3G A;  2PDR A;  4K0X A;  4L0L A;  3QP4 A;  5LBR A;  3VE4 A;  2B95 A;  3NC8 A;  1KE0 A;  2VGL S;  2ZMV A;  3MR0 A;  4HQA A;  4Y5F A;  4Y0O A;  3EWK A;  5FEG A;  3EQV A;  4JF5 A;  4D60 A;  2EXA A;  1UGU A;  4R3B A;  4P6B A;  4RQ9 A;  2H5S A;  3IH9 A;  4MLL A;  4FH4 A;  3DTK A;  2EFX A;  5EM0 A;  3QP5 A;  5HPI A;  3N8S A;  2K7S A;  2DNS A;  4ZAM A;  2WYX A;  4WUJ A;  1FR1 A;  3E2L A;  4LRZ E;  1G68 A;  4OPR A;  3ZYT A;  3JYI A;  3IT9 A;  4EW7 A;  3IHB A;  2W3E A;  3W4P A;  4JXW A;  3PXP A;  4FOF A;  4ETZ A;  3P09 A;  3T12 B;  1LLB A;  3GVB A;  4Y2F A;  3WS2 A;  2ZM2 A;  1TS7 A;  4L9F A;  3CAX A;  3O86 A;  3BQ8 A;  3A3E A;  2QWS A;  1XJ4 A;  3U2A A;  2OLU A;  1PZP A;  4KZ9 A;  5KSC A;  2H28 A;  1KVL A;  3JVV A;  2PU4 A;  5C5K A;  2A3U A;  3H7W A;  2WUQ A;  2PR6 A;  1LSW A;  3ZDJ A;  5L8M A;  1LL5 A;  4X68 A;  2GNX A;  3KSH A;  4HBU A;  3EEH A;  3IXH A;  4X1L A;  2OWH A;  1FCO A;  2WZX A;  1H8Y A;  1M40 A;  3IF6 A;  3HJI A;  2L4R A;  5GHX A;  4OPZ A;  3Q7Z A;  4LGW A;  1BT5 A;  1C3B A;  1RP5 A;  1V9Y A;  3OPL A;  1Q2Q A;  5E2F A;  3C30 A;  4R23 A;  3V3R A;  2CMN A;  5HAP A;  3Q7V A;  1IEL A;  2GDN A;  1SDN A;  2P9V A;  4MN7 A;  4QU3 A;  2PBY A;  4YIN A;  2QMI A;  2EX6 A;  2R9X A;  1IKI A;  2XDM A;  5CX7 A;  2EFU A;  3HLC A;  4GN2 A;  1FOF A;  1N9N A;  4ZDX A;  2K2N A;  1TEM A;  3D9Y A;  4H6J B;  2P08 A;  4Y15 A;  3ZGA B;  3T1Q B;  1PWC A;  3VFH A;  2J3T C;  1S67 L;  3NUL A;  4ESP A;  4NET A;  3ZG8 B;  2V0U A;  1IKG A;  4UA6 A;  2WKP A;  2LB9 A;  4EUV A;  4LCM A;  4MNR A;  2INW A;  4LV0 A;  4OOM A;  5AJG A;  4JF6 A;  4PM7 A;  4R3A A;  2H10 A;  4I39 A;  3VP2 A;  5DFY A;  4I3A A;  4KG2 A;  3P7N A;  5HAQ A;  1ODV A;  2V0W A;  4HNB A;  5FQJ A;  3NOP C;  2DRW A;  3T4L A;  2V1Z A;  4JGO A;  4CLC B;  4GJ4 A;  3VP0 A;  4MCW A;  3UE6 A;  4R6L A;  1OTD A;  2ZC3 B;  4Y7P A;  5F69 A;  3BFE A;  3LY3 A;  4IED A;  1NZU A;  4RX2 A;  1PWG A;  4EEU A;  1CEF A;  1J3W A;  4Y17 A;  5A93 A;  3S7O A;  3T50 A;  5A8B A;  2ZD8 A;  2I9V A;  4IBR A;  1GHI A;  5CER A;  3B33 A;  5E43 A;  4QJG A;  1EWZ A;  3NJA A;  1NY0 A;  3Q82 A;  1GSW A;  1K54 C;  5AQ9 A;  3H7W B;  5HAI A;  1NJ4 A;  4UAA A;  1KGF A;  2VV8 A;  1MWS A;  5J4E A;  3BM6 A;  1K4E A;  4KQR A;  2Q9M A;  4KZB A;  4S2I A;  3CWF A;  3IF6 B;  1XJ3 A;  1DY6 A;  1YLW A;  1JWV A;  4S2L A;  2EX9 A;  2L0W A;  5EOO A;  1OME A;  1ZKJ A;  3M2J A;  4LPZ A;  2E8I A;  5FQQ A;  1YLJ A;  5DJU A;  1IYP A;  5F83 A;  1BLC A;  3A3I A;  2Y2H A;  3KSI A;  1L0G A;  3HLE A;  4KZ6 A;  1YMX A;  5FQM A;  4GHI A;  4HH2 A;  2VK3 A;  3K3C A;  3D4F A;  3T4O A;  2Y2O A;  3ISG A;  1CJF A;  1MZU A;  4HHD A;  3VOY A;  4Y0U A;  3E4Q A;  3MQQ A;  3UO9 A;  4PM9 A;  4WF0 A;  2KDK A;  3IHA A;  4XXR A;  4FH2 A;  2Y2I A;  3VE3 A;  2Y55 A;  2A24 B;  4NXB A;  1PIO A;  4C75 A;  4FSF A;  3PR6 A;  4GOG A;  2Y2K A;  3MXS A;  2VA0 A;  3HLG A;  4E3O A;  1MC0 A;  4MBK A;  4N1H A;  4R0Q A;  4B93 A;  2WKQ A;  2BLS A;  1F9I A;  1WA9 A;  4ID4 A;  3I7J A;  3EOI A;  4KZ4 A;  3ZFZ A;  4B4Z A;  3HUO A;  1QMF A;  1XJ6 A;  5HWT A;  3LID A;  2K31 A;  1MWU A;  3MQ0 A;  5FI7 A;  1VM1 A;  4WMC D;  5FI6 A;  4GNU A;  2FFF B;  5HWW A;  1I2S A;  1F2K A;  4IUH A;  1H0M A;  3HLW A;  3AGF A;  4DMZ A;  3BFF A;  3RH8 B;  2BTF P;  2C5W B;  2W1T A;  1KE4 A;  1VQQ A;  1XFN A;  4WZ5 C;  3R7W A;  5CTN A;  2VX8 A;  4WYY A;  4O01 A;  2Y91 A;  3H9W A;  3SH8 A;  1S6R A;  4GDN A;  3UE1 A;  5IT5 A;  3IQA A;  1HZO A;  3IS2 A;  4LV1 A;  2V20 A;  2PBD P;  1ALQ A;  3V67 A;  5AQB A;  4GDB A;  5EOE A;  3OCL A;  5IS1 A;  2JKR M;  4ZBE A;  2QKP A;  1GA0 A;  1K6R A;  2ZL1 A;  5FDS A;  2Y79 A;  3DBA A;  1ES2 A;  2H0Y A;  3MJQ A;  2OOL A;  3DWK A;  1F98 A;  4XUX A;  4CLC C;  5KZH A;  1K54 A;  5HWV A;  2V9A A;  4KQQ A;  2Y2Q A;  1ZG6 A;  4MN5 A;  3UB7 A;  4X53 A;  4OQI A;  4WM9 A;  3BYD A;  1Y54 A;  2WKR A;  2ZQA A;  5DTS A;  3IWO A;  4RVA A;  4G3V A;  5FAP A;  3MKE A;  3EGX C;  4E3J A;  4DDS A;  4U0X A;  3C4O A;  3T1X A;  1ZG4 A;  4L9G A;  4IHQ A;  4WEK A;  3UPP A;  1SZV A;  1S66 L;  4BQM A;  4MDZ A;  1F5M A;  2J7V A;  2Q0O A;  3C4P A;  2Y2M A;  4LCL A;  4FD8 A;  5HL1 A;  5CHU A;  2D01 A;  3HLB A;  3QHY A;  4MMN A;  5F5Y A;  1XPB A;  3CZD A;  3NDG A;  3BEB A;  3NEC A;  4I3I A;  1ESI A;  3SS3 A;  3IWQ A;  4PPR A;  2VGL M;  5FA7 A;  1P9W A;  1FIK A;  2Z2M B;  1JWP A;  1D7E A;  3Q81 A;  3G2Z A;  2B5R A;  2W1R A;  4C6Y A;  1W63 M;  2BG1 A;  1K55 C;  2ZQ9 A;  3W4O A;  5A92 A;  3LUQ A;  3VOZ A;  2PYR A;  3FPW A;  1YLZ A;  3PAG A;  4KG6 A;  1N9B A;  1IEM A;  4FCF A;  4OOL A;  1S4R A;  4OOY A;  3O3V A;  1G28 A;  3MBZ A;  4RX3 A;  2W1T B;  5G4Y A;  2JKT I;  4E3L A;  2DMW A;  1SKO B;  4NXG A;  4H8R A;  3R4K A;  2ZM0 A;  4Y3I A;  2HP5 A;  2UV0 E;  2QPN A;  3C7U A;  3IS2 B;  3VP3 A;  5CXW A;  3UB6 A;  5EVI B;  3PHY A;  2OLV A;  4HY8 A;  4WZ5 A;  1MXO A;  2KX6 A;  5FQ9 A;  2XF3 A;  4QD4 A;  3ZHH A;  1L0E A;  2G7U A;  1L0F A;  2ZQD A;  3LEZ A;  1ESU A;  5L10 A;  1VET A;  2ZL1 B;  3LGO A;  3VV4 A;  3W2Z A;  4EEP A;  1NLY A;  4X56 A;  3P01 A;  3PBN A;  3SZT A;  1NWZ A;  3BRM A;  4JXS A;  5DTK A;  3IX4 A;  4ARZ B;  3ZVW A;  3MXR A;  5E2H A;  3OPR A;  4U3T A;  4OQG A;  3G34 A;  4E6W A;  1LI0 A;  4MBF A;  3T1S A;  3MMH A;  3VMA A;  3KO6 A;  5CEB A;  4CLC A;  4HEF A;  3FZC A;  4OKP A;  2EA9 A;  1FSY A;  2O9B A;  3ZG0 A;  1Y4O A;  4JBF A;  1WYB A;  4IJG A;  2V8C A;  1NYM A;  3B3X A;  3FKV A;  3FWL A;  3E98 A;  2HJE A;  2VGK A;  1OT6 A;  2HZ5 A;  2XA7 M;  1CEG A;  4D2O A;  3C7V A;  2PD8 A;  3GEC A;  4E3I A;  1DJC A;  2WGV A;  1GSX A;  5U47 A;  4X55 A;  2WK0 A;  5HDS A;  1KDW A;  3CJM A;  5GHY A;  4PM8 A;  2ZLY A;  4GS9 B;  2IWB A;  1XP4 A;  3S4X A;  2W3F A;  4HP4 A;  3N4I A;  4CLC E;  2IA2 A;  4A5R A;  3EEA A;  5A90 A;  1K38 A;  1N9L A;  3HLF A;  3GTC A;  3RXX A;  5EM1 A;  4DDY A;  2PU2 A;  2ZQ8 A;  2ZQ7 A;  2ZBB A;  1GCE A;  2PAV P;  3A0R A;  1DRM A;  5HDC A;  3SH7 A;  1S1Z A;  2JE5 A;  4G3W A;  2ZM8 A;  5KMW A;  3F1P B;  1K55 A;  5CRF A;  2I72 A;  3IH8 A;  4EQI A;  3A3F A;  2IWC A;  1YPR A;  1CI8 A;  1T1B A;  3PBS A;  2M7U A;  1E4D A;  4QY6 A;  5CGS A;  4RYE A;  1T1C A;  4P6Z S;  4PM6 A;  4NXE A;  1PW8 A;  3BEC A;  3HUN A;  3ZG7 B;  3LEQ A;  4PMA A;  2E8J A;  1YLY A;  5EPH A;  3ICY A;  3DTE A;  4DKI A;  1PRQ A;  3GRJ A;  1ERO A;  3PAE A;  1VET B;  2A24 A;  3CUE C;  4IBX A;  3BY8 A;  4BL3 A;  4B9O A;  2ZMF A;  3L9K A;  3LIA A;  2G2U A;  2B02 A;  4F94 A;  2Q9N A;  4JPM A;  5HL6 A;  4B4X A;  3E2K A;  3MZE A;  4EES A;  1D1J A;  3MXQ A;  2EWW A;  5FEF A;  3LIF A;  3VOL A;  4KUK A;  1FIL A;  1NRJ A;  4Y13 A;  4BWI A;  2HJ9 C;  2D02 A;  3GQZ A;  2Y8H A;  1AWI A;  4BJP A;  5EEC A;  1TVF A;  5HFO A;  2PHY A;  3QNB A;  4S2N C;  3C8C A;  5EVI C;  2HDS A;  1MWR A;  1H5X A;  3W8K A;  2HP9 A;  4DJ2 A;  1S4S A;  5FAQ A;  3A3J A;  3IXD A;  3O5Y A;  3LCE A;  2VKS A;  3G32 A;  1CI9 A;  3KYE A;  1P0Z A;  1HD8 A;  4BBV A;  1UWP X;  1YAX A;  2Z2L B;  2O9C A;  3PYP A;  1YSP A;  2YKF A;  2V1A A;  1YQS A;  3LFV A;  3MS6 A;  3MF0 A;  4KEN B;  2XGN A;  4R4R A;  4WLA A;  3LIE A;  3LO7 A;  4EQ1 A;  3BY9 A;  4F3L A;  4KUO A;  4Q0H A;  2NUP C;  3MFD A;  2JKR I;  4MBH A;  1YKD A;  4ZTK A;  4E3M A;  3V39 A;  2YKH A;  3LIB A;  4O7D A;  1TD5 A;  4GLQ A;  4KZ3 A;  2A2L A;  2JN7 A;  1PYY A;  4WEL A;  4KQO A;  5FL3 A;  1TDL A;  2H0T A;  3OOV A;  5CGX A;  2XRN A;  5FAS A;  5I5L A;  3C38 A;  5CED A;  2OSU A;  4FTX A;  2X01 A;  1V9Z A;  3PTE A;  4WN5 A;  5TR7 A;  2L1M A;  1GA9 A;  4PKY G;  4GD8 A;  3U4L P;  3S1Y A;  1HTZ A;  4LEN A;  2WKH A;  4HJ4 A;  4HBT A;  3CHW P;  4OPY A;  4KZ5 A;  3HUM A;  3ZQ5 A;  5DF8 A;  2RL3 A;  4EER A;  5JYP A;  3NOU C;  1CF0 A;  2P74 A;  3WS0 A;  2J3W A;  5TBM B;  2VGJ A;  3NOT C;  4WBG A;  3N7W A;  3DTI A;  2O0Y A;  2J3T D;  3K3D A;  4NK3 A;  2G2W A;  3OPH A;  3BJN A;  2XFT A;  4OON A;  1K0K A;  2ZMA A;  1NLZ A;  1VHM A;  4JXG A;  3IWI A;  2AVX A;  4HI4 A;  1NXY A;  1ES5 A;  2Y2P A;  3JPU A;  1MKM A;  2Y59 A;  2FZ0 A;  4DXC A;  1LSV A;  1YLP A;  3SOI A;  2JBF A;  3LIC A;  3CUE A;  2J8Y A;  2HDQ A;  4BMW A;  1OTA A;  5EVE A;  5AQ7 A;  3MFX A;  2JHE A;  3RJU A;  1SDE A;  2RCX A;  5J7E A;  4OQH A;  5F6A A;  2KLI A;  3VP1 A;  1FQG A;  3WS5 A;  5HD3 A;  2XQZ A;  3CIT A;  3IX3 A;  3H82 B;  3FC7 A;  1CQA A;  1SKO A;  2GZA A;  3BLM A;  4X25 A;  1LHY A;  1N4O A;  3UB5 P;  3CG5 A;  1A0K A;  2P7J A;  2XK1 A;  4S2N A;  5EVI A;  2OV5 A;  3E4P A;  5G4Z A;  3DWZ A;  4F3L B;  3CMZ A;  2Y2J A;  2QHK A;  3LR3 A;  3UB9 A;  1OJG A;  1QME A;  3F1N B;  5GLB A;  3W4Q A;  4JGP A;  3TOI A;  4OQ0 A;  4WZ4 A;  1K4F A;  3FKW A;  5CHM A;  2GJ3 A;  4HJ6 A;  2NUT C;  4UQI S;  2M7V A;  1BLS A;  3G2Y A;  4ARZ A;  1SKF A;  1NYY A;  4ZJ1 A;  2XD5 A;  1MBL A;  3LR5 A;  2ZC6 B;  4ZJ3 A;  1Z09 A;  2WKE A;  1OTI A;  5AVF A;  3ZNT A;  3GSG A;  2ZJ9 A;  4R70 A;  5D3O A;  5CTM A;  3FYZ A;  4M4X A;  2VJW A;  4OLG A;  1E3U A;  1BTL A;  5DF9 A;  4BBU A;  4ZRR A;  3QP2 A;  3ZG9 B;  1YMS A;  3CI6 A;  4JGR A;  2Y2N A;  2BAS A;  4LRY C;  1O7E A;  2XEP A;  3C5A A;  3FV7 A;  4I3J A;  3UY6 A;  3VSK A;  1KOU A;  2Z6C A;  4GS9 A;  2J9O A;  3VFF A;  4XT2 A;  3N8L A;  3F1O B;  4X69 A;  3S22 A;  4P0M A;  2XSS A;  1BLP A;  1BYW A;  4E04 A;  4QY5 A;  1U60 A;  1BUL A;  1W7F A;  1XGJ A;  3N8R A;  1SCW A;  2Y2G A;  3QP6 A;  1GHM A;  1GHP A;  3O88 A;  1W8Y A;  3MKF A;  5GHZ A;  1VEU A;  2WGW A;  1DJB A;  2P04 A;  3F1P A;  3TW8 A;  4E3K A;  4MN6 A;  4GCZ A;  1XX2 A;  1N9O A;  5DF7 A;  4BL2 A;  3BFC A;  1FCM A;  4LV2 A;  1H8M A;  3OC2 A;  1J9M A;  4WL9 A;  2XR0 A;  3M6H A;  1YLT A;  4DJ3 A;  3OCN A;  3ULF A;  2ZOI A;  4CPK A;  1LL8 A;  1O07 A;  2EX8 A;  3UMD A;  3BFD A;  3SS5 A;  3MZD A;  3NBL A;  4B88 A;  1KVM A;  3DAV A;  3GDI A;  4KG5 A;  4JF4 A;  3P98 A;  2ACG A;  2LB5 A;  1DP8 A;  4DF6 A;  1ZHH B;  1K56 A;  3SW1 A;  4XUZ A;  2FFY A;  1MWT A;  2V8F A;  4EET B;  4Q8I A;  1KGG A;  1XA7 A;  1LT0 A;  4CLC D;  2HV1 A;  2W3D A;  3EQU A;  3RFB A;  3TSG A;  1P9R A;  2VV6 A;  3FPV A;  2VZW A;  3OLO A;  3CPT B;  2J80 A;  3G30 A;  2W27 A;  4DE2 A;  1EI5 A;  5M1A A;  2OAP 1;  4P6Z M;  3DW0 A;  4BBT A;  3IX8 A;  4HES A;  5G18 A;  3LY4 A;  3LYX A;  1ERQ A;  3C2W A;  3HL9 A;  3E4O A;  1OT9 A;  1ES4 A;  1MKI A;  1ES3 A;  3UE3 A;  3M2K A;  4YOF A;  2JCH A;  2EWV A;  3G31 A;  3NIA A;  1HLU P;  5HSQ A;  1OPX A;  1XFQ A;  1VB6 A;  1DJA A;  3AGD A;  4K08 A;  1OJ5 A;  2V2F F;  4XT2 B;  1W79 A;  3QP1 A;  3Q07 A;  5DKL A;  3KX0 X;  3T4S A;  3LR0 A;  1L3L A;  4QB8 A;  1NZO A;  4BLM A;  4JKT A;  2PR5 A;  2X71 A;  3EGD C;  4R1G A;  1FSW A;  1JWZ A;  3VP4 A;  3S7Q A;  1H3Q A;  3S7P A;  2XH9 A;  1BLH A;  1H8Z A;  4OH0 A;  2QJ7 A;  3RTY A;  2HGV A;  5L09 A;  3OZH A;  1KE3 A;  4PKY A;  5HDD A;  1VEU B;  2WGW B;  4EUZ A;  4LV3 A;  1PFL A;  1ZTU A;  2WGI A;  3BW6 A;  3WWX A;  1P97 A;  2J9P A;  2V1B A;  2ZC7 A;  2ZC5 B;  3M6B A;  1ONG A;  2QYB A;  4LFU A;  2JKT M;  3NI9 A;  5FDH A;  3BFG A;  2XLN A;  1PZO A;  1WYC A;  2DCF A;  4UA7 A;  2EX2 A;  2Z6D A;  4BEN A;  4E6X A;  1STZ A;  3OPP A;  3WRZ A;  5TBM A;  2WAD A;  1PW1 A;  5FSR A;  1BUE A;  1W63 Q;  2PD7 A;  5I94 A;  2PT7 A;  5L07 A;  3NCK A;  5TGF A;  4C3Q A;  4DE3 A;  2XA7 S;  3SH9 A;  4OPQ A;  4BD1 A;  3IBJ A;  3ITB A;  3AGE A;  1G5U A;  3KSG A;  4O8G A;  3OBF A;  3HRE A;  3E0Y A;  3IBR A;  5JYO A;  1IOU A;  2ZC4 B;  4N9L A;  2O99 A;  5GL9 A;  4OLD A;  2R78 A;  4IVK A;  4S2M A;  1BSG A;  3GMW A;  3K2N A;  3N6I A;  1JNU A;  3UE0 A; 
#chains in the Genus database with same CATH homology
 4PPR A;  1MPL A;  2Y59 A;  4IVI A;  3W4P A;  4Z9Q A;  4DXC A;  4JXW A;  5CEC A;  1YLP A;  3SOI A;  2JBF A;  1IYO A;  3P09 A;  1YM1 A;  2J8Y A;  5FA7 A;  2HDQ A;  1LLB A;  3GVB A;  5F1G A;  3WS2 A;  2ZM2 A;  4GD6 A;  4EBP A;  3O86 A;  5AQ7 A;  1XXM A;  4GB7 A;  4EBN A;  4E3N A;  2Z2M B;  3A3E A;  1JWP A;  3RJU A;  5HAR A;  1SDE A;  3Q81 A;  2OLU A;  2RCX A;  2HP6 A;  1PZP A;  3A3D A;  3G2Z A;  4OQH A;  4KZ9 A;  3VP1 A;  5KSC A;  2B5R A;  1FQG A;  3WS5 A;  1KVL A;  1PI5 A;  4C6Y A;  2PU4 A;  1K6S A;  2BG1 A;  1K55 C;  2XQZ A;  2ZQ9 A;  3W4O A;  5A92 A;  2A3U A;  4QHC A;  2WUQ A;  3VOZ A;  4P85 A;  1S0W A;  1YLZ A;  3PAG A;  1XGI A;  3ZDJ A;  4KG6 A;  3BLM A;  1LL5 A;  1KDS A;  1N9B A;  4P87 A;  4X68 A;  4CJN A;  1IEM A;  2X02 A;  4FCF A;  4OOL A;  1LHY A;  1N4O A;  3G35 A;  4HBU A;  5F1F A;  3IXH A;  3O3V A;  1Q2P A;  1FCO A;  2WZX A;  3CG5 A;  1H8Y A;  1M40 A;  1JVJ A;  4OOY A;  3IF6 A;  3MBZ A;  2XK1 A;  4RX3 A;  5GHX A;  4OPZ A;  4S2N A;  5EVI A;  1L0D A;  2OV5 A;  3Q7Z A;  1LI9 A;  4E3L A;  1BT5 A;  1C3B A;  4R3J A;  1RGY A;  1RP5 A;  3DWZ A;  3OPL A;  4H8R A;  1Q2Q A;  2ZM0 A;  3CMZ A;  3HBR A;  4S2K A;  5E2F A;  2Y2J A;  2HP5 A;  2A49 A;  1KGE A;  2QPN A;  4R23 A;  3V3R A;  3C7U A;  1QME A;  5GLB A;  3W4Q A;  3VP3 A;  5CXW A;  5EVI B;  5HAP A;  3TOI A;  3Q7V A;  5IHV A;  1IEL A;  1IYS A;  2GDN A;  1SDN A;  2OLV A;  2P9V A;  4OQ0 A;  4WZ5 A;  1K4F A;  3FKW A;  4WZ4 A;  1MXO A;  5FQ9 A;  3VSL A;  4QU3 A;  5CHM A;  2XF3 A;  2PBY A;  4QD4 A;  1L0E A;  5FAO A;  1K57 C;  3ZHH A;  1HVB A;  4YIN A;  2HDR A;  1L0F A;  4WEJ A;  2QMI A;  2WAF A;  2ZQD A;  3LEZ A;  1ESU A;  1NRF A;  3ZG5 A;  3IF5 A;  1BLS A;  3G2Y A;  4UA9 A;  2EX6 A;  1BZA A;  2R9X A;  1IKI A;  1SKF A;  2XDM A;  2EFU A;  3HLC A;  4GN2 A;  1FOF A;  1NYY A;  5TFQ A;  5E2E A;  3Q7V B;  2XD5 A;  4ZJ1 A;  4Y0T A;  4ZDX A;  1MBL A;  1TEM A;  2P9V B;  3ZGA B;  2XD1 A;  2ZC6 B;  1PWC A;  3VFH A;  4X56 A;  4ZJ3 A;  3PBN A;  3WS1 A;  3PBO A;  2WZZ A;  3BRM A;  4JXS A;  5DTK A;  4NET A;  3ZG8 B;  1IKG A;  3ZVW A;  4UA6 A;  3MXR A;  5E2H A;  1JTG A;  2WKE A;  3ZNT A;  3GSG A;  3OPR A;  4LCM A;  4U3T A;  4OQG A;  4MNR A;  2C6W B;  4EV4 A;  4LV0 A;  1I2W A;  4OOM A;  2ZJ9 A;  4U0T A;  4JF6 A;  5D3O A;  3G34 A;  5CTM A;  4E6W A;  5FAT A;  4PM7 A;  3FYZ A;  1LI0 A;  4MBF A;  3UPN A;  3VMA A;  5CEB A;  2H10 A;  2IWD A;  4HEF A;  3FZC A;  4OLG A;  1E3U A;  4GKU A;  4N92 A;  1BTL A;  3VP2 A;  4DE0 A;  5DF9 A;  4OKP A;  3UN7 A;  1FSY A;  3ZG9 B;  4KG2 A;  1YMS A;  3ZG0 A;  4BD0 A;  5HAQ A;  5DTT A;  2Y2N A;  4JBF A;  1WYB A;  3BLS A;  1NYM A;  1O7E A;  2XEP A;  5FQJ A;  3B3X A;  2DRW A;  3C5A A;  3V50 A;  5F82 A;  3FKV A;  3FV7 A;  2V1Z A;  3FWL A;  5A91 A;  3UY6 A;  2VGK A;  1W8Q A;  3VSK A;  1CEG A;  2J9O A;  3C7V A;  4D2O A;  3VP0 A;  3VFF A;  2Y2L A;  2ZC3 B;  4Y7P A;  4E3I A;  1DJC A;  3N8L A;  4X69 A;  1ONH A;  4K0W A;  3BFE A;  3S22 A;  3UDX A;  4P0M A;  1BLP A;  2WGV A;  3LY3 A;  3ZNY A;  4IED A;  1NZU A;  4RX2 A;  1PWG A;  5U47 A;  4X55 A;  4QY5 A;  1CEF A;  2WK0 A;  5A93 A;  1U60 A;  1BUL A;  1W7F A;  1XGJ A;  3N8R A;  1KDW A;  5M19 A;  1K25 A;  1SCW A;  3UNW A;  3CJM A;  5EUA A;  3G4P A;  2ZD8 A;  2Y2G A;  5CHJ A;  4S2J A;  4PM8 A;  2ZLY A;  5EVI D;  5GHY A;  4IBR A;  3IXG A;  1GHI A;  1XP4 A;  2IWB A;  5CER A;  1GHM A;  3S4X A;  5E43 A;  4QJG A;  1GHP A;  3O88 A;  1EWZ A;  4WMC A;  3N4I A;  1NY0 A;  1W8Y A;  3Q82 A;  3MKF A;  5GHZ A;  1K54 C;  2WGW A;  4A5R A;  5A90 A;  1TDG A;  5AQ9 A;  1DJB A;  4N1X A;  4ZJ2 A;  5HAI A;  1K38 A;  1NJ4 A;  3HLF A;  3GTC A;  3MZF A;  3RXX A;  4E3K A;  4UAA A;  5M18 A;  1KGF A;  4DDY A;  2PU2 A;  1XX2 A;  1MWS A;  4UHU A;  5J8X A;  2ZQ8 A;  2ZQ7 A;  5DF7 A;  3BM6 A;  1K4E A;  4KQR A;  1I5Q A;  1GCE A;  2Q9M A;  4KZB A;  3BFC A;  4S2I A;  4BL2 A;  5EE8 A;  1FCM A;  4LV2 A;  3IF6 B;  1PI4 A;  3OC2 A;  1J9M A;  5FQK A;  1DY6 A;  3SH7 A;  2XR0 A;  3M6H A;  2JE5 A;  1YLT A;  2ZM8 A;  1YLW A;  5KMW A;  5KSH A;  1K55 A;  1JWV A;  3OCN A;  5CRF A;  3GR2 A;  4S2L A;  5FI2 A;  2EX9 A;  2I72 A;  5EOO A;  1OME A;  2WKI A;  3IH8 A;  4CPK A;  3A3F A;  2IWC A;  1O07 A;  4EQI A;  2EX8 A;  1PWD A;  1CI8 A;  3BFD A;  3SS5 A;  3PBS A;  3MZD A;  3PBR A;  3NBL A;  1E4D A;  1ZKJ A;  2HPB A;  3M2J A;  4QY6 A;  4RYE A;  5CGS A;  4B88 A;  3V3S A;  2E8I A;  1KVM A;  5FQQ A;  1YLJ A;  4PM6 A;  4KG5 A;  1IYP A;  4JF4 A;  3P98 A;  1PW8 A;  5F83 A;  1BLC A;  3A3I A;  3BEC A;  3HUN A;  2Y2H A;  4M3K A;  3ZG7 B;  2QZ6 A;  4PMA A;  1M6K A;  1Z6F A;  1MY8 A;  2JC7 A;  1L0G A;  4DF6 A;  1YLY A;  1K56 A;  5FQI A;  3WRT A;  3HLE A;  4KZ6 A;  1YMX A;  3WS4 A;  5EPH A;  2XFS A;  4KZ7 A;  4XUZ A;  3PBQ A;  2FFY A;  1MWT A;  5FQM A;  4DKI A;  5L2F A;  1SHV A;  4Q8I A;  3GRJ A;  1ERO A;  1KGG A;  3PAE A;  1XA7 A;  4EBL A;  3D4F A;  3ZCZ A;  2Y2O A;  3ISG A;  4IBX A;  3NY4 A;  4BL3 A;  5EVL A;  1L2S A;  1E3U D;  3EQU A;  3TSG A;  3VOY A;  2WAE A;  4Y0U A;  3UO9 A;  4PM9 A;  2G2U A;  3G30 A;  3IHA A;  4F94 A;  4DE2 A;  1EI5 A;  2Q9N A;  4JPM A;  4FH2 A;  4XXR A;  1IYQ A;  4B4X A;  2Y2I A;  3E2K A;  3MZE A;  2Y55 A;  5M1A A;  1CK3 A;  1K57 A;  3IXB A;  3DW0 A;  1PIO A;  4C75 A;  2Y4A A;  4R4S A;  1RCJ A;  1JTD A;  4FSF A;  4HES A;  5G18 A;  4DRT A;  3LY4 A;  4GOG A;  2Y2K A;  3MXS A;  1ERQ A;  3HLG A;  3HL9 A;  3TG9 A;  1FCN A;  3UPO A;  1YT4 A;  4E3O A;  3GQZ A;  4MBK A;  4N1H A;  4R0Q A;  4DXB A;  4BJP A;  2BLS A;  1ES4 A;  5GLD A;  1MKI A;  4ID4 A;  1ES3 A;  1G6A A;  3QNC A;  3I7J A;  3UE3 A;  4KZ4 A;  4N9K A;  3M2K A;  5EEC A;  1TVF A;  3IF6 C;  3V5M A;  5HFO A;  4S2O A;  2R9W A;  3QNB A;  3Q1F A;  3ZFZ A;  2JCH A;  4B4Z A;  5BOH A;  3HUO A;  3G31 A;  3NIA A;  4S2N C;  5EVI C;  2HDS A;  1MWR A;  1QMF A;  1H5X A;  3W8K A;  2HP9 A;  4EWF A;  1MWU A;  4OVD A;  4OP5 A;  5FI7 A;  1VM1 A;  5FAQ A;  4WMC D;  3SS4 A;  3A3J A;  3IXD A;  1XA1 A;  3LCE A;  5FI6 A;  1RGZ A;  3G32 A;  4GNU A;  1CI9 A;  1DJA A;  2FFF B;  3AGD A;  1I2S A;  4OP8 A;  3UDI A;  1HD8 A;  2Z2L B;  3HLW A;  1AXB A;  3AGF A;  2CC1 A;  2V2F F;  3BFF A;  1W79 A;  1ZC2 A;  3DTM A;  3Q07 A;  1FR6 A;  1YQS A;  1WE4 A;  2HDU A;  3HVF A;  2C5W B;  4KEN B;  4KZA A;  4KZ8 A;  2XGN A;  4QB8 A;  4PM5 A;  1NZO A;  4R4R A;  4BLM A;  1KE4 A;  5CGW A;  1VQQ A;  4JKT A;  2EXB A;  3ITA A;  1W5D A;  4WZ5 C;  1XKZ A;  2UWX A;  2X71 A;  3LO7 A;  5CTN A;  4WYY A;  4R1G A;  1FSW A;  1JWZ A;  3VP4 A;  2Y91 A;  2XH9 A;  3SH8 A;  2ZQC A;  1E25 A;  1BLH A;  1ERM A;  1S6R A;  4GDN A;  3UDF A;  4RA7 A;  1H8Z A;  4OH0 A;  3NDE A;  4S2P A;  3UE1 A;  5HX9 A;  3MFD A;  4MBH A;  3OZH A;  4ZTK A;  3IQA A;  1KE3 A;  1HZO A;  4E3M A;  4LV1 A;  3V39 A;  5HW3 A;  2V20 A;  2WGW B;  3PBT A;  4LV3 A;  4EUZ A;  4O7D A;  1ALQ A;  4KZ3 A;  1PYY A;  5E2G A;  5AQB A;  4JLF A;  2WGI A;  4WEL A;  4GDB A;  4KQO A;  5GLC A;  3WWX A;  1TDL A;  2H0T A;  5EOE A;  5CGX A;  5DVA A;  5FAS A;  2J9P A;  2ZC7 A;  3HLD A;  3OCL A;  4GZB A;  2ZC5 B;  5CED A;  1K56 D;  4ZBE A;  3GV9 A;  2OSU A;  3M6B A;  1ONG A;  1GA0 A;  1K6R A;  4DE1 A;  4JXV A;  2X01 A;  3PTE A;  4X6T A;  4YFM A;  3NI9 A;  3O87 A;  5FDH A;  3BFG A;  5TR7 A;  2XLN A;  1GA9 A;  1PZO A;  1ES2 A;  4K91 A;  2H0Y A;  3DWK A;  4XUX A;  1WYC A;  5KZH A;  2DCF A;  4MEZ A;  1K54 A;  4GD8 A;  5AQA A;  4UA7 A;  3S1Y A;  1HTZ A;  4LEN A;  2EX2 A;  4KQQ A;  4BEN A;  2WKH A;  3RXW A;  4E6X A;  2Y2Q A;  3OPP A;  3ZVT A;  3WRZ A;  1ZG6 A;  1LL9 A;  2WAD A;  5GLA A;  4HBT A;  4X53 A;  4OQI A;  1PW1 A;  4OPY A;  4WM9 A;  4K0X A;  4L0L A;  3BYD A;  5FSR A;  1BUE A;  3NC8 A;  1KE0 A;  1Y54 A;  2ZQA A;  4KZ5 A;  3HUM A;  5DTS A;  3IWO A;  5DF8 A;  4RVA A;  2RL3 A;  4Y0O A;  5JYP A;  5I94 A;  5FAP A;  3MKE A;  3EQV A;  4JF5 A;  2EXA A;  3NCK A;  4E3J A;  4R3B A;  4P6B A;  2P74 A;  4DDS A;  4U0X A;  3C4O A;  5TGF A;  3WS0 A;  4C3Q A;  3SH9 A;  4DE3 A;  4OPQ A;  1ZG4 A;  4WEK A;  4BD1 A;  2H5S A;  3UPP A;  3IH9 A;  3ITB A;  2VGJ A;  3AGE A;  4BQM A;  4MLL A;  4WBG A;  3N7W A;  4FH4 A;  2J7V A;  3HRE A;  3C4P A;  2EFX A;  2Y2M A;  4NK3 A;  2G2W A;  4LCL A;  4FD8 A;  3N8S A;  3OPH A;  5HL1 A;  5CHU A;  3QHY A;  2DNS A;  3HLB A;  4ZAM A;  5JYO A;  2WYX A;  2ZC4 B;  4N9L A;  1FR1 A;  3E2L A;  5GL9 A;  2XFT A;  1XPB A;  3CZD A;  4OLD A;  1G68 A;  3NDG A;  4OPR A;  4OON A;  2ZMA A;  4IVK A;  3BEB A;  1BSG A;  4S2M A;  3GMW A;  4JXG A;  3JYI A;  3IWI A;  3IT9 A;  1ESI A;  3SS3 A;  3IHB A;  3N6I A;  3UE0 A;  1NXY A;  1ES5 A;  3IWQ A;  2Y2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...