1FR6A

Refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
361
structure length
361
Chain Sequence
AAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQWQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMSKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPVKADSIISGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of beta-lactamase from Citrobacter freundii indicates a mechanism for beta-lactam hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 105
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fr6A00
4S2NC 3CMZA 1YLTA 4FSFA 1L0EA 3JYIA 4U0XA 1FR6A 3BLSA 1JVJA 4X53A 3TG9A 3MBZA 3P09A 5G18A 3FYZA 3WS1A 4Q8IA 3ITBA 2Y2OA 3AGDA 4LCMA 4JXWA 3IF5A 1SDEA 4O7DA 5EUAA 4BQMA 1MPLA 2QPNA 2V1ZA 4LV2A 4N92A 2Q9MA 3D4FA 4DE0A 4E3KA 3BECA 3C4OA 3GR2A 4GKUA 3A3FA 1GHMA 5F83A 1IKIA 4FD8A 4F94A 2A49A 1FSWA 4Y7PA 3ZNYA 4ZTKA 1K25A 1N9BA 2JE5A 2HP9A 1CI9A 1ONHA 5GHZA 4WYYA 1SDNA 4OQIA 5DF7A 5FI6A 3ZGAB 3S4XA 5KSCA 4KG5A 4GN2A 3V39A 4BL3A 1H5XA 1ALQA 5A91A 2ZQ9A 5CTNA 3ZG5A 2ZQAA 4DF6A 3IF6A 4OONA 3N4IA 1RCJA 4P0MA 1NY0A 1WE4A 3HUMA 1FCOA 3P98A 3OZHA 3FV7A 4GDBA 2HDRA 5CEDA 1NZOA 4OQGA 1W79A 4ZJ3A 4PPRA 5DTSA 3C5AA 3ISGA 2EX6A 5M19A 3AGEA 5DTTA 1PI4A 1VM1A 4MBHA 1MXOA 3BYDA 5DF9A 4FH4A 4QD4A 2XLNA 2ZC3B 2EFUA 1J9MA 3FKVA 1PW8A 1XGIA 3QNCA 2R9WA 4BENA 3NY4A 5F1GA 4B4ZA 4NK3A 4OQHA 2ZM8A 3WRTA 4OPZA 1PW1A 4C3QA 5A93A 3HBRA 5JYPA 4DKIA 2HP6A 2Y2MA 5J8XA 3MZDA 3ZG9B 2FFFB 1WYCA 4JXSA 1XKZA 1ERMA 5D3OA 1AXBA 2WAEA 1GA9A 3N7WA 4MBFA 2V20A 5FDHA 4C6YA 1YLZA 1JWPA 4KZ9A 1TEMA 1SHVA 1FR1A 4KENB 5M1AA 3VP4A 3ZFZA 2X02A 5FASA 1NZUA 3HLFA 1H8ZA 4N9KA 4ZJ2A 1CEFA 3N8SA 3GRJA 1FQGA 2OV5A 3SS5A 2P9VB 2Y2NA 2ZQ8A 1LL5A 3E2KA 1XP4A 3HLEA 4GDNA 4MEZA 3VSLA 3VP1A 5FAQA 4D2OA 2WK0A 4CPKA 3BLMA 2Y59A 4MLLA 4PM7A 3V3RA 1K57A 4OOMA 4OH0A 5FAPA 1VQQA 4S2NA 1PWCA 4KZ7A 5KZHA 4KZ4A 1RGZA 4KZ8A 5TFQA 3ZG8B 3Q07A 5CGWA 4IVKA 2XFTA 1C3BA 1DJCA 3QNBA 5FQJA 4P87A 4R4SA 2Y2GA 1KGGA 4HESA 4QY5A 3W4QA 1PYYA 2XH9A 2HP5A 4DE1A 2P9VA 4JXGA 2IWBA 2PU2A 4S2MA 3G30A 5E2GA 3VP3A 2EFXA 3NBLA 3TSGA 1PIOA 1IYSA 3A3IA 1L0DA 4JF5A 4QHCA 4CJNA 1JTGA 3PBTA 3WS4A 3PBOA 2IWDA 3MXSA 2EXAA 3IHBA 3OCLA 5EVLA 4E6XA 2Y2JA 2JCHA 2Y2LA 3UNWA 3WS2A 1I2WA 2Y2HA 3PAEA 2Y2KA 3ZVTA 2H0YA 4P6BA 5HW3A 3ZHHA 3PBSA 4P85A 1ES4A 1JWVA 1I2SA 4GD6A 3UN7A 3O88A 5GLAA 1K54C 1KGFA 3IQAA 5HAIA 4E3LA 3O3VA 1SKFA 3QHYA 4UA9A 2HDQA 4ZJ1A 3VP2A 5A90A 3E2LA 1ES5A 2WZXA 5EVIC 1RGYA 4KZ3A 5EVID 3HUNA 3OC2A 2H0TA 4OKPA 1CK3A 3UDIA 3BFFA 3HLDA 1XPBA 4X56A 3GSGA 5CHMA 4DE2A 5JYOA 3O87A 3LCEA 5I94A 1Y54A 4IVIA 4NETA 1MBLA 4LCLA 1MWSA 4OP8A 4PM8A 3W8KA 1YLPA 5F1FA 3DW0A 1MWRA 3G31A 4GZBA 3UE1A 1BLSA 4PM5A 1PWDA 4X6TA 5EVIB 4C75A 1PI5A 3BFDA 1LLBA 3M6HA 3Q7VA 3SH8A 1IEMA 1U60A 2R9XA 2Z2LB 3UDXA 4HEFA 3V3SA 2OLVA 5DVAA 1KVMA 4ZBEA 1BUEA 3HREA 2BLSA 3PTEA 1MWTA 3IH8A 2WGWA 3MZEA 4UHUA 4BL2A 1E3UD 1JWZA 3HVFA 4PM9A 4JKTA 4WMCD 4JPMA 1NJ4A 1TVFA 1XA1A 3IF6C 4YFMA 4E3OA 5HARA 4DRTA 1K54A 4LENA 1O07A 4OPYA 4UA6A 2UWXA 3Q1FA 4K91A 1FCMA 4S2IA 3CZDA 2XFSA 3Q81A 4BD0A 5DF8A 4DE3A 4K0XA 1NRFA 4FCFA 5IHVA 4Y0OA 4DXBA 3UY6A 3WWXA 5FQQA 3GTCA 1LI9A 1KGEA 1YMSA 2J9OA 3BRMA 2JBFA 4KG6A 4KZ5A 4M3KA 2DCFA 5GLCA 1NXYA 3A3EA 5M18A 3HLCA 1ERQA 4K0WA 5CHUA 4QB8A 3SH7A 3M2JA 3UPPA 3MFDA 1W7FA 3IWIA 2WGWB 5CXWA 1GHIA 1L0GA 3G4PA 1BSGA 2OLUA 5TR7A 4DXCA 1QMFA 3B3XA 5GLDA 1GA0A 2J7VA 2EX2A 3ZG7B 2C5WB 5FSRA 2WGIA 1PZOA 4GB7A 2J9PA 5HAPA 4JF6A 2ZQ7A 1BT5A 3NIAA 3VP0A 3IXDA 4S2KA 4RX3A 4QY6A 4R3BA 1K6RA 2Q9NA 2ZC7A 4IEDA 4GNUA 3FZCA 1K56D 1XX2A 4R23A 1KDWA 3UE0A 4E6WA 3VSKA 1YM1A 1GHPA 4OLDA 4X68A 1PZPA 3VOYA 3SH9A 1L2SA 1W5DA 4N1HA 4EUZA 1M6KA 2XF3A 4MBKA 3NCKA 4S2PA 3V50A 1K57C 3BFCA 1FCNA 3M6BA 4OQ0A 4OVDA 4BJPA 3G32A 3HLGA 3IHAA 3N6IA 4JF4A 4RX2A 4R4RA 4XUXA 5CHJA 3ZG0A 4WZ4A 1OMEA 5FQ9A 4QJGA 4WEKA 3RJUA 3VOZA 1M40A 2ZM2A 3WS0A 4R1GA 5FQMA 3LO7A 1HD8A 3RXXA 5KSHA 3W4OA 1YMXA 3BEBA 3Q82A 3BFEA 2WGVA 1ES3A 3I7JA 2WADA 3DWKA 1WYBA 1TDLA 2VGKA 1ZC2A 2Y91A 2RL3A 4S2OA 3S22A 3SS3A 4S2LA 1ES2A 2DNSA 4N9LA 2V2FF 3G34A 2Y2PA 1ZG6A 4OP5A 4KQOA 2HPBA 4EBNA 1SCWA 2G2UA 2VGJA 3EQVA 1JTDA 2A3UA 3UO9A 1W8YA 4UA7A 1MWUA 1RP5A 5FI7A 2DRWA 2G2WA 1NYMA 4Y0TA 3Q7VB 4BLMA 2BG1A 2WKHA 3PBRA 2WYXA 3BFGA 1QMEA 3EQUA 3G35A 2EX9A 2Y2QA 3A3JA 2CC1A 2XR0A 1Q2QA 2X01A 5CTMA 3GQZA 4PM6A 3IF6B 1K4EA 1W8QA 1YQSA 3UE3A 4OLGA 4LV0A 3M2KA 2Y2IA 3NDEA 4GOGA 2Y55A 2HDSA 4YINA 3CG5A 4IBXA 2PU4A 1I5QA 1YT4A 5U47A 4R0QA 3IXHA 4L0LA 4S2JA 4R3JA 4HBUA 4EBPA 1K55C 1E4DA 3W4PA 4XXRA 3UDFA 3ZDJA 1DJAA 3OPHA 3HLBA 5EE8A 1FSYA 1LHYA 1Q2PA 3PBNA 1KDSA 4JBFA 2I72A 3V5MA 1S0WA 5GHYA 3Q7ZA 1N4OA 3HLWA 2J8YA 4MNRA 4XUZA 1IYQA 4RA7A 3BM6A 3LEZA 1LL9A 5AQBA 1S6RA 4WM9A 5CRFA 1MKIA 3VMAA 4OPQA 5HAQA 5F82A 4WBGA 4WEJA 5AQ9A 3G2YA 1XGJA 4H8RA 4LV3A 4QU3A 3FWLA 2PBYA 3ITAA 5CGXA 1HZOA 2XK1A 3C7VA 1IELA 5FATA 4B4XA 2XD5A 1G6AA 3ZVWA 1YLWA 1EWZA 4U3TA 2Y4AA 5CGSA 5AQAA 4KQQA 4E3NA 4EBLA 4Z9QA 5GLBA 4FH2A 4ZDXA 1L0FA 2XGNA 3FKWA 2XD1A 5KMWA 3LY3A 4WZ5C 5CECA 4DDSA 3VFFA 3WRZA 1LI0A 4JXVA 3MKFA 5GL9A 1KE4A 4OOLA 5HX9A 4OPRA 1MY8A 2QMIA 5AQ7A 3HUOA 4KQRA 2C6WB 3PBQA 3DTMA 1K38A 5EOEA 5A92A 2Z2MB 2ZC4B 4E3MA 2EX8A 3N8RA 2OSUA 5HFOA 2WAFA 5FI2A 1FOFA 4OOYA 5CERA 2WKIA 1HVBA 5FAOA 2E8IA 4JLFA 3S1YA 3IXBA 2ZJ9A 4KZAA 5FA7A 3OCNA 3NDGA 4UAAA 4B88A 5E2FA 2ZMAA 2ZQDA 3C4PA 4WZ5A 1DY6A 1EI5A 1K6SA 3A3DA 5E43A 3N8LA 5E2EA 1DJBA 4WELA 5EVIA 4E3JA 3C7UA 4KZBA 4RYEA 1IKGA 1ZKJA 1PWGA 5FQKA 1GCEA 3SOIA 3UPNA 4EQIA 5EPHA 3GVBA 4Y0UA 4E3IA 3OPRA 1TDGA 3VFHA 2WZZA 3DWZA 2XEPA 4WMCA 4N1XA 4HBTA 4KG2A 3ZNTA 3AGFA 1E3UA 2ZC6B 4X69A 1K4FA 4EWFA 2ZC5B 3HL9A 3PAGA 4X55A 5DTKA 3G2ZA 5L2FA 3GMWA 4A5RA 5GHXA 1KVLA 1K56A 1YLJA 1YLYA 5E2HA 4U0TA 4GD8A 3MZFA 4ZAMA 4PMAA 4ID4A 2GDNA 4LV1A 1ONGA 1ZG4A 2P74A 3TOIA 4IBRA 1CEGA 2XQZA 5TGFA 4DDYA 3ZCZA 1XA7A 2WUQA 1CI8A 3CJMA 2B5RA 4EV4A 1BLCA 3OPLA 1BLHA 3LY4A 2ZQCA 3MKEA 1K55A 1BTLA 2H5SA 2ZM0A 5FQIA 1H8YA 2XDMA 3MXRA 1BZAA 2JC7A 1ESUA 5HL1A 3IWOA 4BD1A 1BULA 1KE3A 5BOHA 2HDUA 4KZ6A 1E25A 3IT9A 2QZ6A 3IXGA 1BLPA 1G68A 1XXMA 2WKEA 2IWCA 1ESIA 2X71A 3IH9A 5CEBA 1HTZA 3WS5A 1NYYA 3IWQA 3UPOA 3SS4A 1IYOA 3NC8A 2ZLYA 3O86A 1Z6FA 3RXWA 2FFYA 2ZD8A 1IYPA 2EXBA 2H10A 1O7EA 2RCXA 1EROA 3GV9A 3OPPA 4RVAA 1KE0A 3NI9A 5EECA 5EOOA
chains in the Genus database with same CATH superfamily
4S2NC 1S4RA 2W3GA 1FR6A 3DTKA 3BLSA 4BMWA 5HWVA 3LIDA 2O99A 2PD8A 3FYZA 4Q8IA 2Y2OA 4LCMA 4Y15A 2V1ZA 3L9KA 4LV2A 4N92A 2Q9MA 3D4FA 2BASA 2QYBA 3UB5P 1L3LA 4F94A 2A49A 3EGXC 1FILA 1N9BA 2HP9A 4JGRA 4I39A 5KSCA 3IBJA 2ZQ9A 3RFBA 3IF6A 1RCJA 1VETA 1WE4A 2B95A 3OZHA 1NZOA 2P04A 3E4OA 2EX6A 4CLCB 1VM1A 4MBHA 4Y2FA 3MF0A 3CHWP 2ZC3B 1XGIA 4B4ZA 4EERA 4WL9A 4L9EA 2VGLS 1PW1A 3TJZC 3HBRA 5JYPA 2Y2MA 2FFFB 4JXSA 1ERMA 2JKTM 2XRNA 3EEAA 2VV7A 1GA9A 2XROA 1JWPA 5M1AA 3ZFZA 1ZHHB 1NZUA 5FEGA 2OV5A 4D2OA 4MEZA 3BLMA 1PWCA 4KZ7A 4Q0HA 4KZ8A 5CGWA 4ARZB 4IVKA 4CQHA 2XFTA 1DJCA 4BBVA 1YSPA 3W4QA 2IWBA 4GS9B 3G30A 3NOTC 3NBLA 3TSGA 2GNXA 2HV1A 1JTGA 3HJIA 3LICA 1OT9A 4RQ9A 4PKYA 3UB7A 2Y2HA 5HW3A 3O88A 1KGFA 2VV6A 2HDQA 2HJ9C 2WZXA 4KZ3A 3HUNA 3OC2A 1CK3A 1XPBA 5CHMA 3LCEA 1Y54A 4IUKA 1T1BA 1YAXA 4PM8A 4GZBA 2O0YA 3UE1A 4X6TA 2OWHA 5EVIB 1V9YA 3Q7VA 3M6HA 2W27A 2OLVA 2ZBBA 2WGWA 3MZEA 4UHUA 5J7EA 4LRYC 3UNWA 5HSQA 1TVFA 3IF6C 4E3OA 2JKTI 2PDRA 4DRTA 3D72A 3NULA 3Q1FA 4JGOA 2IA2A 2XFSA 5DF8A 4DE3A 3T4LA 1NRFA 1S66L 4Y0OA 4DMZA 1NRJA 1YMSA 2V9AA 5HDCA 2J9OA 4JGPA 4KZ5A 4R38A 2DCFA 3A3EA 3UPPA 1W7FA 3IWIA 2WGWB 4G3KA 4UQIS 4H6JB 2HZ5A 2L4RA 3HCYA 1L0GA 3G4PA 3VE3A 4DXCA 2EX2A 3NOUC 1PZOA 3G6OA 1BT5A 5AVFA 4RX3A 4R3BA 1K6RA 2P08A 4GNUA 1K56D 1XX2A 1KDWA 3UE0A 4E6WA 2XSSA 3CUEA 3VSKA 4DJ3A 3VOYA 2ZL1B 4L9GA 1T19A 4N1HA 4S2PA 4MBKA 1OTAA 3UB9A 4M4XA 1KOUA 5HDDA 4R4RA 1OMEA 4II7A 4YNRA 3W4OA 5DKKA 2QHKA 2WGVA 2WADA 3S22A 2RL3A 4S2LA 3LIFA 2HPBA 3UO9A 2G2WA 4Y0TA 1NLZA 2WKHA 3LI9A 3BFGA 3NECA 1DP9A 3GQZA 1W8QA 3S7OA 1Y4OA 4GOGA 2J3TD 1I5QA 5L8MA 4WN5A 4EEPA 3IXHA 2Y8HA 4L0LA 2QJ7A 1K55C 1E4DA 3W4PA 4XXRA 1DJAA 5FEFA 5EE8A 2PD7A 4JBFA 2Y79A 1N4OA 2J8YA 3ULFA 1WA9A 3BM6A 4WM9A 5EM1A 3VMAA 5F82A 1XGJA 4QU3A 2PBYA 1XJ4A 1HZOA 2XK1A 3C7VA 1G6AA 2K31A 1LSWA 4Z9QA 4EBLA 4FH2A 1L0FA 2XGNA 3LY3A 4WZ5C 5CECA 1LI0A 3D9YA 1MY8A 3HUOA 4KQRA 1K38A 5EOEA 3LEQA 2EX8A 5HD3A 3N8RA 3IS2A 4ETXA 5FAOA 4JLFA 5FA7A 3OCNA 1AWIA 4B88A 2EA9A 3B47A 4WZ5A 1DY6A 1EI5A 4RYEA 3QP2A 3SOIA 3UPNA 1MC0A 2EWWA 3R4KA 4Y0UA 4EU0A 4WMCA 1TF1A 1K4FA 4Y13A 4EWFA 3HL9A 4X55A 5DTKA 1K56A 1MKMA 3LIBA 4G3VA 4ZAMA 4PMAA 4ID4A 2VA0A 3BY8A 2M7VA 3K3DA 5TGFA 1CI8A 2B5RA 1BLCA 3OPLA 2HF6A 3QP8A 2GZAA 5EV0A 3LY4A 2ZQCA 2H5SA 5FQIA 1BYWA 1H8YA 2XDMA 4NEED 3A0SA 3S7PA 1KE3A 5BOHA 2HDUA 4KZ6A 3IT9A 2OOLA 1XXMA 1ESIA 3IH9A 5CEBA 4NXEA 1HTZA 2OAP1 2PAVP 3SS4A 4Y3IA 3NC8A 1PNEA 2FFYA 2RCXA 1O7EA 1EROA 2W3FA 5GHXA 1KE0A 3MQOA 2ZL1A 3CMZA 4U0XA 4X53A 3P09A 5G18A 3MXQA 3AGDA 4JXWA 4BQMA 1MPLA 2INWA 3BECA 3C4OA 1H8MA 1LT0A 3A3FA 3CWFA 2W3EA 5HWTA 1IKIA 4FD8A 3B42A 4Y7PA 4WYYA 5DF7A 3ZGAB 5FI6A 4F3LA 3S4XA 1F98A 3V39A 4HH3A 3ZG5A 4DF6A 4OONA 3N4IA 3HUMA 3RH8B 1FCOA 3FV7A 5CEDA 3U4LP 5DTSA 3ISGA 2M7UA 1OT6A 5A8BA 2EFUA 1PW8A 3QNCA 4BENA 1ACFA 4NK3A 3WRTA 4UQIM 2ACGA 5J8XA 3A0VA 3MZDA 3HJKA 2WKPA 3H82B 3MQ0A 4GHIB 5L09A 4ZJ2A 4PKYG 1CEFA 5EVEA 2J80A 1LL5A 3HLEA 5L07A 3E4QA 2WK0A 4PM7A 1K57A 4OOMA 1VQQA 2A2LA 4FOFA 3CI6A 3QNBA 5FQJA 1OTBA 4NXFA 2Y2GA 3C8CA 1KGGA 3CAXA 4QY5A 1PYYA 2XH9A 2P9VA 2PYRA 3VP3A 1PIOA 3A3IA 1L0DA 4CJNA 1N9NA 3PBTA 2IWDA 3OCLA 4E6XA 3C30A 2Y2JA 3WS2A 3C38A 1I2WA 2H0YA 3GECA 1CQAA 1JWVA 1I2SA 1XJ6A 4ARZA 1SKFA 3QHYA 5HDSA 3VP2A 2HGVA 1D1JA 4OKPA 3BFFA 3H82A 4FTXA 4LCLA 1MWSA 5F1FA 1YLPA 3DW0A 3FG8A 1PI5A 4B93A 4FUWA 3IH8A 3HVFA 4PM9A 1XA1A 5HARA 3MQQA 1XJ3A 4UA6A 4S2IA 4BBUA 4BD0A 4KUKA 1OTIA 5FQQA 3GTCA 1LI9A 3KYZA 2VLGA 4F3LB 1NXYA 3HLCA 2V8CA 1VETB 3MFDA 1GHIA 4O01A 5TR7A 1H0MA 5HZHA 5GLDA 3ZG7B 2WGIA 4GB7A 2UV0E 5HAPA 3TE8A 5DJUA 3VP0A 3IXDA 1DP8A 2BTFP 1S4SA 4QY6A 1J3WA 2ZC7A 3B33A 4R23A 4AFIA 1GHPA 4OLDA 3SH9A 1W5DA 1A0KA 2XF3A 1K57C 1S1YA 4OVDA 4BJPA 3G32A 2L1MA 4XUXA 4WEKA 3RJUA 1SKOB 2ZM2A 3LO7A 1YMXA 3BEBA 5HWWA 3DAVA 1WYBA 3PR6A 1TDLA 2VGKA 5L10A 1ZC2A 2Y91A 3SS3A 3U2AA 1ES2A 4N9LA 2V2FF 3T4KA 2Y2PA 4MN5A 4ETZA 4EBNA 3UMDA 3EQVA 1HLUP 4WUJA 5FI7A 1CF0A 3Q7VB 4BLMA 3T12B 3JVVA 3KSHA 2WYXA 2PR5A 1OJGA 2EX9A 3A3JA 3LUQA 2XR0A 1Q2QA 3CUEC 4D60A 3OBFA 2VX8A 1YQSA 5G4ZA 5HL6A 3IBRA 5F68A 1SZVA 2NUTC 4S2JA 4O0PA 4HBUA 1G6OA 3T4TA 3OOVA 4MCWA 3HLBA 1FSYA 1Q2PA 3LFVA 5GHYA 3LEZA 4ME4A 1S1ZA 2XA7M 4UEYA 1MKIA 5HAQA 4WEJA 5AQ9A 3G2YA 1P9RA 3FWLA 3ITAA 3ZVWA 3VV4A 2Y4AA 5CGSA 1JNUA 4E3NA 1T1AA 4ZDXA 3FKWA 4DDSA 4OPRA 5AQ7A 3PBQA 5A92A 2WKRA 3F1PA 5HPIA 2WAFA 5CERA 4MN6A 4EW7A 2L0WA 1K6SA 1YKDA 5E2EA 1DJBA 1ODVA 4E3JA 3C7UA 3DBAA 4KZBA 1ZKJA 4EQIA 5FQKA 4E3IA 3OPRA 3VFHA 2XEPA 1E3UA 1GSVA 3G2ZA 3GMWA 4CLCC 1KVLA 4Z1WA 4U0TA 4Y5FA 3MZFA 5TJJA 3ZQ5A 4GW9A 1ONGA 4IBRA 1CEGA 1OPXA 4DDYA 3ZCZA 4EV4A 3H9WA 3T1SA 1BTLA 2ZM0A 3F1PB 5HL1A 3IWOA 4HH2A 3H7WB 3IXGA 2X71A 1NYYA 1XJ2A 1IYOA 2VK3A 3O86A 1Z6FA 4NXGA 3RXWA 3GV9A 1IYPA 2EXBA 2QJ5A 4LV1A 3TRCA 4RVAA 5EECA 4EEUA 5DFYA 4DN0A 1L0EA 1JVJA 3WS1A 3ITBA 1SDEA 4O7DA 5EUAA 4E3KA 3GR2A 4GKUA 1GHMA 2Z6DA 3T4QA 1OJ5A 2PR6A 1Z09A 4ZTKA 2I9VA 2JE5A 2J3WA 2LB5A 4KG5A 5IT5A 4BL3A 1ALQA 5A91A 1OTDA 3P98A 3UMEA 1LL8A 3NHQA 4OQGA 1W79A 4ZJ3A 4PPRA 5M19A 4GHIA 5DTTA 4I3AA 3MS6A 2VGLM 1MXOA 4P6ZS 3T4OA 4FH4A 4QD4A 1VHMA 1GSXA 1J9MA 3EEHA 2R9WA 4K08A 4OQHA 2ZM8A 4OPZA 1XFNA 2HP6A 1WYCA 1XKZA 1AXBA 2WAEA 4MBFA 2V20A 4C6YA 1EW0A 1DP6A 4NXBA 3JPUA 4KZ9A 2PT7A 3PYPA 2ZMVA 1FR1A 3P01A 2EWVA 3HLFA 3N8SA 4YOFA 3GRJA 2XA7S 4Q0IA 3SS5A 2P9VB 3D3OA 2ZQ8A 1XP4A 4HI4A 3VP1A 5FAQA 4CPKA 4MLLA 3V3RA 5FAPA 5KZHA 3OLOA 3E4PA 1RGZA 5TFQA 3ZG8B 1C3BA 4O8GA 4X25A 4R4SA 1NWZA 4P87A 4HESA 4JXGA 4I3IA 1TS8A 5F69A 4JF5A 3K2NA 5G4YA 3WS4A 3PBOA 3MXSA 1LSVA 2EXAA 3IHBA 1VEUB 2JCHA 2Y2LA 3PAEA 5DKLA 3ZVTA 3ZHHA 4P85A 1F9IA 3DTEA 1K54C 5EM0A 4HJ4A 1P9WA 3O3VA 4UA9A 3E2LA 5EVIC 4I38A 3BWLA 5EVID 4DE2A 5JYOA 2D02A 3O87A 2FZ0A 4NETA 4LPZA 4OP8A 3W8KA 1MWRA 3G31A 5FL3A 1BLSA 4PM5A 4C75A 3BFDA 1LLBA 1VB6A 2YKFA 1IEMA 2R9XA 1X0OA 2Z2LB 3UDXA 4HEFA 3ICYA 3TW8A 3BY9A 3V3SA 5DVAA 3HREA 1MWTA 4MDZA 1E3UD 1F2KA 4WMCD 4YFMA 4JPMA 1O07A 1FCMA 5K5BA 2KX6A 4FCFA 5IHVA 4DXBA 3UY6A 1KGEA 3VE4A 1TS0A 2JBFA 3BRMA 4M3KA 1OTEA 3IX4A 4K0WA 5CHUA 3M2JA 5F5YA 3MR0A 2OLUA 1QMFA 3CITA 2VZWA 4G3WA 2V1BA 4HP9A 1XFQA 4JF6A 4S2KA 4IEDA 4CLCE 3FZCA 5HPFA 2NUPC 1YM1A 5KIZA 3CLOA 3QP4A 1L2SA 5EFWA 4KQDA 3V50A 4XT2B 4ESPA 2VKSA 4OQ0A 3HLGA 3IHAA 3ZG0A 4RX2A 5FQ9A 4QJGA 1M40A 4P6ZM 3WS0A 4R1GA 4X1LA 5KSHA 3CPTB 3Q82A 3BFEA 1ES3A 2GJ3A 2JKFA 2JN7A 2PRFA 4HOIA 1YSQA 3MFXA 2D01A 2FH5A 2W1TA 1ZG6A 4OP5A 3V67A 2G2UA 4LFUA 5LBRA 2W3DA 1W8YA 1RP5A 2DRWA 2BG1A 3W2ZA 1QMEA 3G35A 2Y2QA 3KX0X 2KDKA 2X01A 2G7UA 2V0WA 5CTMA 4PM6A 3IF6B 1K4EA 4OLGA 3VOLA 2Y2IA 2Y55A 4YINA 4Q0JA 1YT4A 5U47A 4DJ2A 4R0QA 3BQ8A 4R3JA 4EBPA 4ZRRA 5FDSA 3F1NB 3UDFA 3ZDJA 3OPHA 3PBNA 3LGOA 1KDSA 4QPRA 1PFLA 1GSWA 3BQAA 2PHYA 3V5MA 3Q7ZA 3HLWA 3KYEA 1S6RA 2PYPA 4WBGA 3KSGA 2ZMFA 2J3TC 5CX7A 5FATA 4B4XA 1EWZA 5AQAA 4KQQA 5GLBA 3PHYA 4HHDA 5KMWA 3WRZA 2QKPA 2M1CA 3EWKA 3F1OA 1KE4A 4OOLA 5HX9A 2QMIA 3DTMA 3BJNA 2MJ6A 2Z2MB 2ZC4B 4E3MA 4WF0A 4BBTA 2OSUA 5HFOA 2WKIA 2E8IA 4IUHA 3S1YA 3IXBA 2ZJ9A 4KZAA 3EGDC 2ZMAA 2ZQDA 4HJ6A 3C4PA 5IU1A 4HY8A 5E43A 3N8LA 4WELA 5EVIA 2Z6CA 3KSIA 1IOUA 1IKGA 1GCEA 5EPHA 2K2NA 1TDGA 2WZZA 3DWZA 4N1XA 2A24A 4HBTA 3AGFA 1SKOA 4X69A 2WKQA 3PAGA 4A5RA 1YLJA 1YLYA 5E2HA 1W63M 4GD8A 4QWOA 3C2WA 3F1NA 4EXOA 2VJWA 3PXPA 2WUQA 3H7WA 3LR3A 2DMWA 3CJMA 2O9CA 2HJEA 4LLOB 3MKEA 3MXRA 1BZAA 3FPVA 4NKPA 4BWIA 3E98A 4NG2A 4BD1A 1UWPX 2W3HA 3UB6A 1E25A 2QZ6A 1BLPA 3NJAA 2WKEA 5AVEA 3P7NA 3WS5A 3IWQA 2Q0OA 2ZLYA 1DRMA 2ZD8A 3NOPC 2H10A 3EOIA 3SZTA 3NI9A 4YWZA 4HP4A 4E04A 1YLTA 4FSFA 3JYIA 2W1RA 3TG9A 1F5MA 3MBZA 3LR5A 2JKRI 3IF5A 2QPNA 4DE0A 3MMHA 5F83A 1FSWA 3ZNYA 1K25A 5GHZA 1CI9A 1ONHA 1SDNA 1Y28A 4OQIA 3L7HA 4GN2A 1H5XA 5CTNA 2ZQAA 1T18A 4P0MA 1NY0A 2PBDP 4GDBA 2HDRA 2P7JA 3T4JA 3C5AA 1G5UA 5IS1A 3AGEA 3KSFA 4L9FA 1PI4A 3MJQA 3BYDA 5DF9A 2QWSA 3LR0A 5MC7A 2XLNA 3FKVA 3NY4A 5F1GA 2OAQ1 5J3WA 4C3QA 5A93A 1TS6A 4DKIA 2ZOHA 3ZG9B 4EETB 5D3OA 3N7WA 5C5KA 5FDHA 1YLZA 4MMNA 3LR4A 1TEMA 4CLCA 1SHVA 4KENB 3VP4A 2X02A 5FASA 4N9KA 1H8ZA 1FQGA 2Y2NA 1IFQA 3VSLA 3E2KA 4GDNA 3R7WA 2Y59A 4OH0A 4S2NA 4XT2A 3IX8A 4KZ4A 4EQ1A 2W1TB 3T4SA 4HJ3A 3Q07A 2ZOIA 4DE1A 2HP5A 3GDIA 2PU2A 1P97A 4S2MA 2R78A 5E2GA 2EFXA 4GLQA 3QP5A 1IYSA 3K3CA 4QHCA 2K7SA 4MN7A 2H28A 5EVLA 4HNBA 1NLYA 3F1OB 4Y17A 2Y2KA 3R7WB 4P6BA 3PBSA 1D06A 1ES4A 1H3QA 1S67L 2W0NA 4GD6A 3UN7A 5GLAA 3IQAA 5HAIA 2V0UA 4E3LA 4ZJ1A 5A90A 1ES5A 3QP1A 3A0RA 1RGYA 4WLAA 2H0TA 3UDIA 3HLDA 4X56A 3GSGA 5I94A 4X1MA 4IVIA 1MBLA 2E8JA 1PWDA 4EESA 3SH8A 1V9ZA 1U60A 1KVMA 4ZBEA 1BUEA 2BLSA 3PTEA 3UB8A 3BW6A 4H6JA 4BL2A 1JWZA 4JKTA 1NJ4A 1K54A 4LENA 2O9AA 4OPYA 2UWXA 4K91A 3CZDA 3Q81A 1D7EA 4K0XA 4HQAA 3WWXA 3ZYTA 4KG6A 5GLCA 5F6AA 5M18A 1ERQA 3SH7A 4QB8A 2OWJA 5CXWA 4R3AA 5I5LA 1BSGA 3B3XA 1GA0A 2J7VA 3QP6A 2B02A 1FIKA 2C5WB 5FSRA 3E0YA 2J9PA 2ZQ7A 3NIAA 3LIAA 2Q9NA 2VEAA 1P0ZA 4PAUA 2B18A 4X68A 1PZPA 2KLIA 4EUZA 1M6KA 3NCKA 5TBMB 3BFCA 1FCNA 3M6BA 4R70A 3N6IA 5CHJA 4JF4A 4WZ4A 1W63Q 2V8FA 3VOZA 2JKGA 2YKHA 4IJGA 5FQMA 1HD8A 1N9OA 3RXXA 3I7JA 3DWKA 4EUVA 4S2OA 2DNSA 3G34A 1STZA 4PHTA 4B9OA 4KQOA 1SCWA 2VGJA 1JTDA 1CJFA 2A3UA 4GCZA 4UA7A 1MWUA 3IS2B 1NYMA 3S7NA 2LB9A 3PBRA 4GJ4A 3EQUA 3FPWA 3LI8A 3KYQA 2CC1A 5J4EA 3UE3A 4LV0A 3M2KA 3MSHA 3NDEA 2HDSA 3CG5A 4IBXA 2PU4A 1YPRA 2AVXA 3RTYA 4CLCD 1LHYA 2GX5A 2I72A 1S0WA 4MNRA 4XUZA 1IYQA 4RA7A 3JVUA 1LL9A 5AQBA 3CPTA 5AJGA 5CRFA 2JHEA 4OPQA 4H8RA 4LV3A 1UWNX 5HD5A 5CGXA 1IELA 2XD5A 4JGQA 4KUOA 1YLWA 4U3TA 3T1RA 3IX3A 2XD1A 4I5SA 3VFFA 1K0KA 4I3JA 3MKFA 4JXVA 5GL9A 1VEUA 2C6WB 3O5YA 3SW1A 2KOIA 2CMNA 5FI2A 1FOFA 5DFXA 1MZUA 4OOYA 1HVBA 1LSXA 3DTIA 4IHQA 3NDGA 4UAAA 5E2FA 4LRXC 3LYXA 4R6LA 4HIAA 3A3DA 3T1QB 1PWGA 3GVBA 2A24B 4KG2A 3ZNTA 2ZC6B 2ZC5B 5L2FA 3LIEA 2V1AA 2O9BA 1UGUA 3T1XA 2GDNA 1ZG4A 2P74A 3TOIA 1T1CA 5DJTA 3FC7A 2XQZA 1G28A 1XA7A 4LGWA 1BLHA 1TD5A 5TBMA 2VV8A 1K55A 2JC7A 1ESUA 3S7QA 2JKRM 1BULA 1ZTUA 4GS9A 1PRQA 4LRZE 3UE6A 1G68A 3KO6A 2IWCA 3T50A 3UPOA 1N9LA 3OPPA 1TS7A 5EOOA
chains in the Genus database with same CATH topology
4S2NC 3CMZA 1YLTA 4FSFA 1L0EA 3JYIA 4U0XA 1FR6A 3BLSA 1JVJA 4X53A 3TG9A 3MBZA 3P09A 5G18A 3FYZA 3WS1A 4Q8IA 3ITBA 2Y2OA 3AGDA 4LCMA 4JXWA 3IF5A 1SDEA 4O7DA 5EUAA 4BQMA 1MPLA 2QPNA 2V1ZA 4LV2A 4N92A 2Q9MA 3D4FA 4DE0A 4E3KA 3BECA 3C4OA 3GR2A 4GKUA 3A3FA 1GHMA 5F83A 1IKIA 4FD8A 4F94A 2A49A 1FSWA 4Y7PA 3ZNYA 4ZTKA 1K25A 1N9BA 2JE5A 2HP9A 1CI9A 1ONHA 5GHZA 4WYYA 1SDNA 4OQIA 5DF7A 5FI6A 3ZGAB 3S4XA 5KSCA 4KG5A 4GN2A 3V39A 4BL3A 1H5XA 1ALQA 5A91A 2ZQ9A 5CTNA 3ZG5A 2ZQAA 4DF6A 3IF6A 4OONA 3N4IA 1RCJA 4P0MA 1NY0A 1WE4A 3HUMA 1FCOA 3P98A 3OZHA 3FV7A 4GDBA 2HDRA 5CEDA 1NZOA 4OQGA 1W79A 4ZJ3A 4PPRA 5DTSA 3C5AA 3ISGA 2EX6A 5M19A 3AGEA 5DTTA 1PI4A 1VM1A 4MBHA 1MXOA 3BYDA 5DF9A 4FH4A 4QD4A 2XLNA 2ZC3B 2EFUA 1J9MA 3FKVA 1PW8A 1XGIA 3QNCA 2R9WA 4BENA 3NY4A 5F1GA 4B4ZA 4NK3A 4OQHA 2ZM8A 3WRTA 4OPZA 1PW1A 4C3QA 5A93A 3HBRA 5JYPA 4DKIA 2HP6A 2Y2MA 5J8XA 3MZDA 3ZG9B 2FFFB 1WYCA 4JXSA 1XKZA 1ERMA 5D3OA 1AXBA 2WAEA 1GA9A 3N7WA 4MBFA 2V20A 5FDHA 4C6YA 1YLZA 1JWPA 4KZ9A 1TEMA 1SHVA 1FR1A 4KENB 5M1AA 3VP4A 3ZFZA 2X02A 5FASA 1NZUA 3HLFA 1H8ZA 4N9KA 4ZJ2A 1CEFA 3N8SA 3GRJA 1FQGA 2OV5A 3SS5A 2P9VB 2Y2NA 2ZQ8A 1LL5A 3E2KA 1XP4A 3HLEA 4GDNA 4MEZA 3VSLA 3VP1A 5FAQA 4D2OA 2WK0A 4CPKA 3BLMA 2Y59A 4MLLA 4PM7A 3V3RA 1K57A 4OOMA 4OH0A 5FAPA 1VQQA 4S2NA 1PWCA 4KZ7A 5KZHA 4KZ4A 1RGZA 4KZ8A 5TFQA 3ZG8B 3Q07A 5CGWA 4IVKA 2XFTA 1C3BA 1DJCA 3QNBA 5FQJA 4P87A 4R4SA 2Y2GA 1KGGA 4HESA 4QY5A 3W4QA 1PYYA 2XH9A 2HP5A 4DE1A 2P9VA 4JXGA 2IWBA 2PU2A 4S2MA 3G30A 5E2GA 3VP3A 2EFXA 3NBLA 3TSGA 1PIOA 1IYSA 3A3IA 1L0DA 4JF5A 4QHCA 4CJNA 1JTGA 3PBTA 3WS4A 3PBOA 2IWDA 3MXSA 2EXAA 3IHBA 3OCLA 5EVLA 4E6XA 2Y2JA 2JCHA 2Y2LA 3UNWA 3WS2A 1I2WA 2Y2HA 3PAEA 2Y2KA 3ZVTA 2H0YA 4P6BA 5HW3A 3ZHHA 3PBSA 4P85A 1ES4A 1JWVA 1I2SA 4GD6A 3UN7A 3O88A 5GLAA 1K54C 1KGFA 3IQAA 5HAIA 4E3LA 3O3VA 1SKFA 3QHYA 4UA9A 2HDQA 4ZJ1A 3VP2A 5A90A 3E2LA 1ES5A 2WZXA 5EVIC 1RGYA 4KZ3A 5EVID 3HUNA 3OC2A 2H0TA 4OKPA 1CK3A 3UDIA 3BFFA 3HLDA 1XPBA 4X56A 3GSGA 5CHMA 4DE2A 5JYOA 3O87A 3LCEA 5I94A 1Y54A 4IVIA 4NETA 1MBLA 4LCLA 1MWSA 4OP8A 4PM8A 3W8KA 1YLPA 5F1FA 3DW0A 1MWRA 3G31A 4GZBA 3UE1A 1BLSA 4PM5A 1PWDA 4X6TA 5EVIB 4C75A 1PI5A 3BFDA 1LLBA 3M6HA 3Q7VA 3SH8A 1IEMA 1U60A 2R9XA 2Z2LB 3UDXA 4HEFA 3V3SA 2OLVA 5DVAA 1KVMA 4ZBEA 1BUEA 3HREA 2BLSA 3PTEA 1MWTA 3IH8A 2WGWA 3MZEA 4UHUA 4BL2A 1E3UD 1JWZA 3HVFA 4PM9A 4JKTA 4WMCD 4JPMA 1NJ4A 1TVFA 1XA1A 3IF6C 4YFMA 4E3OA 5HARA 4DRTA 1K54A 4LENA 1O07A 4OPYA 4UA6A 2UWXA 3Q1FA 4K91A 1FCMA 4S2IA 3CZDA 2XFSA 3Q81A 4BD0A 5DF8A 4DE3A 4K0XA 1NRFA 4FCFA 5IHVA 4Y0OA 4DXBA 3UY6A 3WWXA 5FQQA 3GTCA 1LI9A 1KGEA 1YMSA 2J9OA 3BRMA 2JBFA 4KG6A 4KZ5A 4M3KA 2DCFA 5GLCA 1NXYA 3A3EA 5M18A 3HLCA 1ERQA 4K0WA 5CHUA 4QB8A 3SH7A 3M2JA 3UPPA 3MFDA 1W7FA 3IWIA 2WGWB 5CXWA 1GHIA 1L0GA 3G4PA 1BSGA 2OLUA 5TR7A 4DXCA 1QMFA 3B3XA 5GLDA 1GA0A 2J7VA 2EX2A 3ZG7B 2C5WB 5FSRA 2WGIA 1PZOA 4GB7A 2J9PA 5HAPA 4JF6A 2ZQ7A 1BT5A 3NIAA 3VP0A 3IXDA 4S2KA 4RX3A 4QY6A 4R3BA 1K6RA 2Q9NA 2ZC7A 4IEDA 4GNUA 3FZCA 1K56D 1XX2A 4R23A 1KDWA 3UE0A 4E6WA 3VSKA 1YM1A 1GHPA 4OLDA 4X68A 1PZPA 3VOYA 3SH9A 1L2SA 1W5DA 4N1HA 4EUZA 1M6KA 2XF3A 4MBKA 3NCKA 4S2PA 3V50A 1K57C 3BFCA 1FCNA 3M6BA 4OQ0A 4OVDA 4BJPA 3G32A 3HLGA 3IHAA 3N6IA 4JF4A 4RX2A 4R4RA 4XUXA 5CHJA 3ZG0A 4WZ4A 1OMEA 5FQ9A 4QJGA 4WEKA 3RJUA 3VOZA 1M40A 2ZM2A 3WS0A 4R1GA 5FQMA 3LO7A 1HD8A 3RXXA 5KSHA 3W4OA 1YMXA 3BEBA 3Q82A 3BFEA 2WGVA 1ES3A 3I7JA 2WADA 3DWKA 1WYBA 1TDLA 2VGKA 1ZC2A 2Y91A 2RL3A 4S2OA 3S22A 3SS3A 4S2LA 1ES2A 2DNSA 4N9LA 2V2FF 3G34A 2Y2PA 1ZG6A 4OP5A 4KQOA 2HPBA 4EBNA 1SCWA 2G2UA 2VGJA 3EQVA 1JTDA 2A3UA 3UO9A 1W8YA 4UA7A 1MWUA 1RP5A 5FI7A 2DRWA 2G2WA 1NYMA 4Y0TA 3Q7VB 4BLMA 2BG1A 2WKHA 3PBRA 2WYXA 3BFGA 1QMEA 3EQUA 3G35A 2EX9A 2Y2QA 3A3JA 2CC1A 2XR0A 1Q2QA 2X01A 5CTMA 3GQZA 4PM6A 3IF6B 1K4EA 1W8QA 1YQSA 3UE3A 4OLGA 4LV0A 3M2KA 2Y2IA 3NDEA 4GOGA 2Y55A 2HDSA 4YINA 3CG5A 4IBXA 2PU4A 1I5QA 1YT4A 5U47A 4R0QA 3IXHA 4L0LA 4S2JA 4R3JA 4HBUA 4EBPA 1K55C 1E4DA 3W4PA 4XXRA 3UDFA 3ZDJA 1DJAA 3OPHA 3HLBA 5EE8A 1FSYA 1LHYA 1Q2PA 3PBNA 1KDSA 4JBFA 2I72A 3V5MA 1S0WA 5GHYA 3Q7ZA 1N4OA 3HLWA 2J8YA 4MNRA 4XUZA 1IYQA 4RA7A 3BM6A 3LEZA 1LL9A 5AQBA 1S6RA 4WM9A 5CRFA 1MKIA 3VMAA 4OPQA 5HAQA 5F82A 4WBGA 4WEJA 5AQ9A 3G2YA 1XGJA 4H8RA 4LV3A 4QU3A 3FWLA 2PBYA 3ITAA 5CGXA 1HZOA 2XK1A 3C7VA 1IELA 5FATA 4B4XA 2XD5A 1G6AA 3ZVWA 1YLWA 1EWZA 4U3TA 2Y4AA 5CGSA 5AQAA 4KQQA 4E3NA 4EBLA 4Z9QA 5GLBA 4FH2A 4ZDXA 1L0FA 2XGNA 3FKWA 2XD1A 5KMWA 3LY3A 4WZ5C 5CECA 4DDSA 3VFFA 3WRZA 1LI0A 4JXVA 3MKFA 5GL9A 1KE4A 4OOLA 5HX9A 4OPRA 1MY8A 2QMIA 5AQ7A 3HUOA 4KQRA 2C6WB 3PBQA 3DTMA 1K38A 5EOEA 5A92A 2Z2MB 2ZC4B 4E3MA 2EX8A 3N8RA 2OSUA 5HFOA 2WAFA 5FI2A 1FOFA 4OOYA 5CERA 2WKIA 1HVBA 5FAOA 2E8IA 4JLFA 3S1YA 3IXBA 2ZJ9A 4KZAA 5FA7A 3OCNA 3NDGA 4UAAA 4B88A 5E2FA 2ZMAA 2ZQDA 3C4PA 4WZ5A 1DY6A 1EI5A 1K6SA 3A3DA 5E43A 3N8LA 5E2EA 1DJBA 4WELA 5EVIA 4E3JA 3C7UA 4KZBA 4RYEA 1IKGA 1ZKJA 1PWGA 5FQKA 1GCEA 3SOIA 3UPNA 4EQIA 5EPHA 3GVBA 4Y0UA 4E3IA 3OPRA 1TDGA 3VFHA 2WZZA 3DWZA 2XEPA 4WMCA 4N1XA 4HBTA 4KG2A 3ZNTA 3AGFA 1E3UA 2ZC6B 4X69A 1K4FA 4EWFA 2ZC5B 3HL9A 3PAGA 4X55A 5DTKA 3G2ZA 5L2FA 3GMWA 4A5RA 5GHXA 1KVLA 1K56A 1YLJA 1YLYA 5E2HA 4U0TA 4GD8A 3MZFA 4ZAMA 4PMAA 4ID4A 2GDNA 4LV1A 1ONGA 1ZG4A 2P74A 3TOIA 4IBRA 1CEGA 2XQZA 5TGFA 4DDYA 3ZCZA 1XA7A 2WUQA 1CI8A 3CJMA 2B5RA 4EV4A 1BLCA 3OPLA 1BLHA 3LY4A 2ZQCA 3MKEA 1K55A 1BTLA 2H5SA 2ZM0A 5FQIA 1H8YA 2XDMA 3MXRA 1BZAA 2JC7A 1ESUA 5HL1A 3IWOA 4BD1A 1BULA 1KE3A 5BOHA 2HDUA 4KZ6A 1E25A 3IT9A 2QZ6A 3IXGA 1BLPA 1G68A 1XXMA 2WKEA 2IWCA 1ESIA 2X71A 3IH9A 5CEBA 1HTZA 3WS5A 1NYYA 3IWQA 3UPOA 3SS4A 1IYOA 3NC8A 2ZLYA 3O86A 1Z6FA 3RXWA 2FFYA 2ZD8A 1IYPA 2EXBA 2H10A 1O7EA 2RCXA 1EROA 3GV9A 3OPPA 4RVAA 1KE0A 3NI9A 5EECA 5EOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2N C;  3CMZ A;  1YLT A;  4FSF A;  1L0E A;  3JYI A;  4U0X A;  1FR6 A;  3BLS A;  1JVJ A;  4X53 A;  3TG9 A;  3MBZ A;  3P09 A;  5G18 A;  3FYZ A;  3WS1 A;  4Q8I A;  3ITB A;  2Y2O A;  3AGD A;  4LCM A;  4JXW A;  3IF5 A;  1SDE A;  4O7D A;  5EUA A;  4BQM A;  1MPL A;  2QPN A;  2V1Z A;  4LV2 A;  4N92 A;  2Q9M A;  3D4F A;  4DE0 A;  4E3K A;  3BEC A;  3C4O A;  3GR2 A;  4GKU A;  3A3F A;  1GHM A;  5F83 A;  1IKI A;  4FD8 A;  4F94 A;  2A49 A;  1FSW A;  4Y7P A;  3ZNY A;  4ZTK A;  1K25 A;  1N9B A;  2JE5 A;  2HP9 A;  1CI9 A;  1ONH A;  5GHZ A;  4WYY A;  1SDN A;  4OQI A;  5DF7 A;  5FI6 A;  3ZGA B;  3S4X A;  5KSC A;  4KG5 A;  4GN2 A;  3V39 A;  4BL3 A;  1H5X A;  1ALQ A;  5A91 A;  2ZQ9 A;  5CTN A;  3ZG5 A;  2ZQA A;  4DF6 A;  3IF6 A;  4OON A;  3N4I A;  1RCJ A;  4P0M A;  1NY0 A;  1WE4 A;  3HUM A;  1FCO A;  3P98 A;  3OZH A;  3FV7 A;  4GDB A;  2HDR A;  5CED A;  1NZO A;  4OQG A;  1W79 A;  4ZJ3 A;  4PPR A;  5DTS A;  3C5A A;  3ISG A;  2EX6 A;  5M19 A;  3AGE A;  5DTT A;  1PI4 A;  1VM1 A;  4MBH A;  1MXO A;  3BYD A;  5DF9 A;  4FH4 A;  4QD4 A;  2XLN A;  2ZC3 B;  2EFU A;  1J9M A;  3FKV A;  1PW8 A;  1XGI A;  3QNC A;  2R9W A;  4BEN A;  3NY4 A;  5F1G A;  4B4Z A;  4NK3 A;  4OQH A;  2ZM8 A;  3WRT A;  4OPZ A;  1PW1 A;  4C3Q A;  5A93 A;  3HBR A;  5JYP A;  4DKI A;  2HP6 A;  2Y2M A;  5J8X A;  3MZD A;  3ZG9 B;  2FFF B;  1WYC A;  4JXS A;  1XKZ A;  1ERM A;  5D3O A;  1AXB A;  2WAE A;  1GA9 A;  3N7W A;  4MBF A;  2V20 A;  5FDH A;  4C6Y A;  1YLZ A;  1JWP A;  4KZ9 A;  1TEM A;  1SHV A;  1FR1 A;  4KEN B;  5M1A A;  3VP4 A;  3ZFZ A;  2X02 A;  5FAS A;  1NZU A;  3HLF A;  1H8Z A;  4N9K A;  4ZJ2 A;  1CEF A;  3N8S A;  3GRJ A;  1FQG A;  2OV5 A;  3SS5 A;  2P9V B;  2Y2N A;  2ZQ8 A;  1LL5 A;  3E2K A;  1XP4 A;  3HLE A;  4GDN A;  4MEZ A;  3VSL A;  3VP1 A;  5FAQ A;  4D2O A;  2WK0 A;  4CPK A;  3BLM A;  2Y59 A;  4MLL A;  4PM7 A;  3V3R A;  1K57 A;  4OOM A;  4OH0 A;  5FAP A;  1VQQ A;  4S2N A;  1PWC A;  4KZ7 A;  5KZH A;  4KZ4 A;  1RGZ A;  4KZ8 A;  5TFQ A;  3ZG8 B;  3Q07 A;  5CGW A;  4IVK A;  2XFT A;  1C3B A;  1DJC A;  3QNB A;  5FQJ A;  4P87 A;  4R4S A;  2Y2G A;  1KGG A;  4HES A;  4QY5 A;  3W4Q A;  1PYY A;  2XH9 A;  2HP5 A;  4DE1 A;  2P9V A;  4JXG A;  2IWB A;  2PU2 A;  4S2M A;  3G30 A;  5E2G A;  3VP3 A;  2EFX A;  3NBL A;  3TSG A;  1PIO A;  1IYS A;  3A3I A;  1L0D A;  4JF5 A;  4QHC A;  4CJN A;  1JTG A;  3PBT A;  3WS4 A;  3PBO A;  2IWD A;  3MXS A;  2EXA A;  3IHB A;  3OCL A;  5EVL A;  4E6X A;  2Y2J A;  2JCH A;  2Y2L A;  3UNW A;  3WS2 A;  1I2W A;  2Y2H A;  3PAE A;  2Y2K A;  3ZVT A;  2H0Y A;  4P6B A;  5HW3 A;  3ZHH A;  3PBS A;  4P85 A;  1ES4 A;  1JWV A;  1I2S A;  4GD6 A;  3UN7 A;  3O88 A;  5GLA A;  1K54 C;  1KGF A;  3IQA A;  5HAI A;  4E3L A;  3O3V A;  1SKF A;  3QHY A;  4UA9 A;  2HDQ A;  4ZJ1 A;  3VP2 A;  5A90 A;  3E2L A;  1ES5 A;  2WZX A;  5EVI C;  1RGY A;  4KZ3 A;  5EVI D;  3HUN A;  3OC2 A;  2H0T A;  4OKP A;  1CK3 A;  3UDI A;  3BFF A;  3HLD A;  1XPB A;  4X56 A;  3GSG A;  5CHM A;  4DE2 A;  5JYO A;  3O87 A;  3LCE A;  5I94 A;  1Y54 A;  4IVI A;  4NET A;  1MBL A;  4LCL A;  1MWS A;  4OP8 A;  4PM8 A;  3W8K A;  1YLP A;  5F1F A;  3DW0 A;  1MWR A;  3G31 A;  4GZB A;  3UE1 A;  1BLS A;  4PM5 A;  1PWD A;  4X6T A;  5EVI B;  4C75 A;  1PI5 A;  3BFD A;  1LLB A;  3M6H A;  3Q7V A;  3SH8 A;  1IEM A;  1U60 A;  2R9X A;  2Z2L B;  3UDX A;  4HEF A;  3V3S A;  2OLV A;  5DVA A;  1KVM A;  4ZBE A;  1BUE A;  3HRE A;  2BLS A;  3PTE A;  1MWT A;  3IH8 A;  2WGW A;  3MZE A;  4UHU A;  4BL2 A;  1E3U D;  1JWZ A;  3HVF A;  4PM9 A;  4JKT A;  4WMC D;  4JPM A;  1NJ4 A;  1TVF A;  1XA1 A;  3IF6 C;  4YFM A;  4E3O A;  5HAR A;  4DRT A;  1K54 A;  4LEN A;  1O07 A;  4OPY A;  4UA6 A;  2UWX A;  3Q1F A;  4K91 A;  1FCM A;  4S2I A;  3CZD A;  2XFS A;  3Q81 A;  4BD0 A;  5DF8 A;  4DE3 A;  4K0X A;  1NRF A;  4FCF A;  5IHV A;  4Y0O A;  4DXB A;  3UY6 A;  3WWX A;  5FQQ A;  3GTC A;  1LI9 A;  1KGE A;  1YMS A;  2J9O A;  3BRM A;  2JBF A;  4KG6 A;  4KZ5 A;  4M3K A;  2DCF A;  5GLC A;  1NXY A;  3A3E A;  5M18 A;  3HLC A;  1ERQ A;  4K0W A;  5CHU A;  4QB8 A;  3SH7 A;  3M2J A;  3UPP A;  3MFD A;  1W7F A;  3IWI A;  2WGW B;  5CXW A;  1GHI A;  1L0G A;  3G4P A;  1BSG A;  2OLU A;  5TR7 A;  4DXC A;  1QMF A;  3B3X A;  5GLD A;  1GA0 A;  2J7V A;  2EX2 A;  3ZG7 B;  2C5W B;  5FSR A;  2WGI A;  1PZO A;  4GB7 A;  2J9P A;  5HAP A;  4JF6 A;  2ZQ7 A;  1BT5 A;  3NIA A;  3VP0 A;  3IXD A;  4S2K A;  4RX3 A;  4QY6 A;  4R3B A;  1K6R A;  2Q9N A;  2ZC7 A;  4IED A;  4GNU A;  3FZC A;  1K56 D;  1XX2 A;  4R23 A;  1KDW A;  3UE0 A;  4E6W A;  3VSK A;  1YM1 A;  1GHP A;  4OLD A;  4X68 A;  1PZP A;  3VOY A;  3SH9 A;  1L2S A;  1W5D A;  4N1H A;  4EUZ A;  1M6K A;  2XF3 A;  4MBK A;  3NCK A;  4S2P A;  3V50 A;  1K57 C;  3BFC A;  1FCN A;  3M6B A;  4OQ0 A;  4OVD A;  4BJP A;  3G32 A;  3HLG A;  3IHA A;  3N6I A;  4JF4 A;  4RX2 A;  4R4R A;  4XUX A;  5CHJ A;  3ZG0 A;  4WZ4 A;  1OME A;  5FQ9 A;  4QJG A;  4WEK A;  3RJU A;  3VOZ A;  1M40 A;  2ZM2 A;  3WS0 A;  4R1G A;  5FQM A;  3LO7 A;  1HD8 A;  3RXX A;  5KSH A;  3W4O A;  1YMX A;  3BEB A;  3Q82 A;  3BFE A;  2WGV A;  1ES3 A;  3I7J A;  2WAD A;  3DWK A;  1WYB A;  1TDL A;  2VGK A;  1ZC2 A;  2Y91 A;  2RL3 A;  4S2O A;  3S22 A;  3SS3 A;  4S2L A;  1ES2 A;  2DNS A;  4N9L A;  2V2F F;  3G34 A;  2Y2P A;  1ZG6 A;  4OP5 A;  4KQO A;  2HPB A;  4EBN A;  1SCW A;  2G2U A;  2VGJ A;  3EQV A;  1JTD A;  2A3U A;  3UO9 A;  1W8Y A;  4UA7 A;  1MWU A;  1RP5 A;  5FI7 A;  2DRW A;  2G2W A;  1NYM A;  4Y0T A;  3Q7V B;  4BLM A;  2BG1 A;  2WKH A;  3PBR A;  2WYX A;  3BFG A;  1QME A;  3EQU A;  3G35 A;  2EX9 A;  2Y2Q A;  3A3J A;  2CC1 A;  2XR0 A;  1Q2Q A;  2X01 A;  5CTM A;  3GQZ A;  4PM6 A;  3IF6 B;  1K4E A;  1W8Q A;  1YQS A;  3UE3 A;  4OLG A;  4LV0 A;  3M2K A;  2Y2I A;  3NDE A;  4GOG A;  2Y55 A;  2HDS A;  4YIN A;  3CG5 A;  4IBX A;  2PU4 A;  1I5Q A;  1YT4 A;  5U47 A;  4R0Q A;  3IXH A;  4L0L A;  4S2J A;  4R3J A;  4HBU A;  4EBP A;  1K55 C;  1E4D A;  3W4P A;  4XXR A;  3UDF A;  3ZDJ A;  1DJA A;  3OPH A;  3HLB A;  5EE8 A;  1FSY A;  1LHY A;  1Q2P A;  3PBN A;  1KDS A;  4JBF A;  2I72 A;  3V5M A;  1S0W A;  5GHY A;  3Q7Z A;  1N4O A;  3HLW A;  2J8Y A;  4MNR A;  4XUZ A;  1IYQ A;  4RA7 A;  3BM6 A;  3LEZ A;  1LL9 A;  5AQB A;  1S6R A;  4WM9 A;  5CRF A;  1MKI A;  3VMA A;  4OPQ A;  5HAQ A;  5F82 A;  4WBG A;  4WEJ A;  5AQ9 A;  3G2Y A;  1XGJ A;  4H8R A;  4LV3 A;  4QU3 A;  3FWL A;  2PBY A;  3ITA A;  5CGX A;  1HZO A;  2XK1 A;  3C7V A;  1IEL A;  5FAT A;  4B4X A;  2XD5 A;  1G6A A;  3ZVW A;  1YLW A;  1EWZ A;  4U3T A;  2Y4A A;  5CGS A;  5AQA A;  4KQQ A;  4E3N A;  4EBL A;  4Z9Q A;  5GLB A;  4FH2 A;  4ZDX A;  1L0F A;  2XGN A;  3FKW A;  2XD1 A;  5KMW A;  3LY3 A;  4WZ5 C;  5CEC A;  4DDS A;  3VFF A;  3WRZ A;  1LI0 A;  4JXV A;  3MKF A;  5GL9 A;  1KE4 A;  4OOL A;  5HX9 A;  4OPR A;  1MY8 A;  2QMI A;  5AQ7 A;  3HUO A;  4KQR A;  2C6W B;  3PBQ A;  3DTM A;  1K38 A;  5EOE A;  5A92 A;  2Z2M B;  2ZC4 B;  4E3M A;  2EX8 A;  3N8R A;  2OSU A;  5HFO A;  2WAF A;  5FI2 A;  1FOF A;  4OOY A;  5CER A;  2WKI A;  1HVB A;  5FAO A;  2E8I A;  4JLF A;  3S1Y A;  3IXB A;  2ZJ9 A;  4KZA A;  5FA7 A;  3OCN A;  3NDG A;  4UAA A;  4B88 A;  5E2F A;  2ZMA A;  2ZQD A;  3C4P A;  4WZ5 A;  1DY6 A;  1EI5 A;  1K6S A;  3A3D A;  5E43 A;  3N8L A;  5E2E A;  1DJB A;  4WEL A;  5EVI A;  4E3J A;  3C7U A;  4KZB A;  4RYE A;  1IKG A;  1ZKJ A;  1PWG A;  5FQK A;  1GCE A;  3SOI A;  3UPN A;  4EQI A;  5EPH A;  3GVB A;  4Y0U A;  4E3I A;  3OPR A;  1TDG A;  3VFH A;  2WZZ A;  3DWZ A;  2XEP A;  4WMC A;  4N1X A;  4HBT A;  4KG2 A;  3ZNT A;  3AGF A;  1E3U A;  2ZC6 B;  4X69 A;  1K4F A;  4EWF A;  2ZC5 B;  3HL9 A;  3PAG A;  4X55 A;  5DTK A;  3G2Z A;  5L2F A;  3GMW A;  4A5R A;  5GHX A;  1KVL A;  1K56 A;  1YLJ A;  1YLY A;  5E2H A;  4U0T A;  4GD8 A;  3MZF A;  4ZAM A;  4PMA A;  4ID4 A;  2GDN A;  4LV1 A;  1ONG A;  1ZG4 A;  2P74 A;  3TOI A;  4IBR A;  1CEG A;  2XQZ A;  5TGF A;  4DDY A;  3ZCZ A;  1XA7 A;  2WUQ A;  1CI8 A;  3CJM A;  2B5R A;  4EV4 A;  1BLC A;  3OPL A;  1BLH A;  3LY4 A;  2ZQC A;  3MKE A;  1K55 A;  1BTL A;  2H5S A;  2ZM0 A;  5FQI A;  1H8Y A;  2XDM A;  3MXR A;  1BZA A;  2JC7 A;  1ESU A;  5HL1 A;  3IWO A;  4BD1 A;  1BUL A;  1KE3 A;  5BOH A;  2HDU A;  4KZ6 A;  1E25 A;  3IT9 A;  2QZ6 A;  3IXG A;  1BLP A;  1G68 A;  1XXM A;  2WKE A;  2IWC A;  1ESI A;  2X71 A;  3IH9 A;  5CEB A;  1HTZ A;  3WS5 A;  1NYY A;  3IWQ A;  3UPO A;  3SS4 A;  1IYO A;  3NC8 A;  2ZLY A;  3O86 A;  1Z6F A;  3RXW A;  2FFY A;  2ZD8 A;  1IYP A;  2EXB A;  2H10 A;  1O7E A;  2RCX A;  1ERO A;  3GV9 A;  3OPP A;  4RVA A;  1KE0 A;  3NI9 A;  5EEC A;  5EOO A; 
#chains in the Genus database with same CATH topology
 4S2N C;  1S4R A;  2W3G A;  1FR6 A;  3DTK A;  3BLS A;  4BMW A;  5HWV A;  3LID A;  2O99 A;  2PD8 A;  3FYZ A;  4Q8I A;  2Y2O A;  4LCM A;  4Y15 A;  2V1Z A;  3L9K A;  4LV2 A;  4N92 A;  2Q9M A;  3D4F A;  2BAS A;  2QYB A;  3UB5 P;  1L3L A;  4F94 A;  2A49 A;  3EGX C;  1FIL A;  1N9B A;  2HP9 A;  4JGR A;  4I39 A;  5KSC A;  3IBJ A;  2ZQ9 A;  3RFB A;  3IF6 A;  1RCJ A;  1VET A;  1WE4 A;  2B95 A;  3OZH A;  1NZO A;  2P04 A;  3E4O A;  2EX6 A;  4CLC B;  1VM1 A;  4MBH A;  4Y2F A;  3MF0 A;  3CHW P;  2ZC3 B;  1XGI A;  4B4Z A;  4EER A;  4WL9 A;  4L9E A;  2VGL S;  1PW1 A;  3TJZ C;  3HBR A;  5JYP A;  2Y2M A;  2FFF B;  4JXS A;  1ERM A;  2JKT M;  2XRN A;  3EEA A;  2VV7 A;  1GA9 A;  2XRO A;  1JWP A;  5M1A A;  3ZFZ A;  1ZHH B;  1NZU A;  5FEG A;  2OV5 A;  4D2O A;  4MEZ A;  3BLM A;  1PWC A;  4KZ7 A;  4Q0H A;  4KZ8 A;  5CGW A;  4ARZ B;  4IVK A;  4CQH A;  2XFT A;  1DJC A;  4BBV A;  1YSP A;  3W4Q A;  2IWB A;  4GS9 B;  3G30 A;  3NOT C;  3NBL A;  3TSG A;  2GNX A;  2HV1 A;  1JTG A;  3HJI A;  3LIC A;  1OT9 A;  4RQ9 A;  4PKY A;  3UB7 A;  2Y2H A;  5HW3 A;  3O88 A;  1KGF A;  2VV6 A;  2HDQ A;  2HJ9 C;  2WZX A;  4KZ3 A;  3HUN A;  3OC2 A;  1CK3 A;  1XPB A;  5CHM A;  3LCE A;  1Y54 A;  4IUK A;  1T1B A;  1YAX A;  4PM8 A;  4GZB A;  2O0Y A;  3UE1 A;  4X6T A;  2OWH A;  5EVI B;  1V9Y A;  3Q7V A;  3M6H A;  2W27 A;  2OLV A;  2ZBB A;  2WGW A;  3MZE A;  4UHU A;  5J7E A;  4LRY C;  3UNW A;  5HSQ A;  1TVF A;  3IF6 C;  4E3O A;  2JKT I;  2PDR A;  4DRT A;  3D72 A;  3NUL A;  3Q1F A;  4JGO A;  2IA2 A;  2XFS A;  5DF8 A;  4DE3 A;  3T4L A;  1NRF A;  1S66 L;  4Y0O A;  4DMZ A;  1NRJ A;  1YMS A;  2V9A A;  5HDC A;  2J9O A;  4JGP A;  4KZ5 A;  4R38 A;  2DCF A;  3A3E A;  3UPP A;  1W7F A;  3IWI A;  2WGW B;  4G3K A;  4UQI S;  4H6J B;  2HZ5 A;  2L4R A;  3HCY A;  1L0G A;  3G4P A;  3VE3 A;  4DXC A;  2EX2 A;  3NOU C;  1PZO A;  3G6O A;  1BT5 A;  5AVF A;  4RX3 A;  4R3B A;  1K6R A;  2P08 A;  4GNU A;  1K56 D;  1XX2 A;  1KDW A;  3UE0 A;  4E6W A;  2XSS A;  3CUE A;  3VSK A;  4DJ3 A;  3VOY A;  2ZL1 B;  4L9G A;  1T19 A;  4N1H A;  4S2P A;  4MBK A;  1OTA A;  3UB9 A;  4M4X A;  1KOU A;  5HDD A;  4R4R A;  1OME A;  4II7 A;  4YNR A;  3W4O A;  5DKK A;  2QHK A;  2WGV A;  2WAD A;  3S22 A;  2RL3 A;  4S2L A;  3LIF A;  2HPB A;  3UO9 A;  2G2W A;  4Y0T A;  1NLZ A;  2WKH A;  3LI9 A;  3BFG A;  3NEC A;  1DP9 A;  3GQZ A;  1W8Q A;  3S7O A;  1Y4O A;  4GOG A;  2J3T D;  1I5Q A;  5L8M A;  4WN5 A;  4EEP A;  3IXH A;  2Y8H A;  4L0L A;  2QJ7 A;  1K55 C;  1E4D A;  3W4P A;  4XXR A;  1DJA A;  5FEF A;  5EE8 A;  2PD7 A;  4JBF A;  2Y79 A;  1N4O A;  2J8Y A;  3ULF A;  1WA9 A;  3BM6 A;  4WM9 A;  5EM1 A;  3VMA A;  5F82 A;  1XGJ A;  4QU3 A;  2PBY A;  1XJ4 A;  1HZO A;  2XK1 A;  3C7V A;  1G6A A;  2K31 A;  1LSW A;  4Z9Q A;  4EBL A;  4FH2 A;  1L0F A;  2XGN A;  3LY3 A;  4WZ5 C;  5CEC A;  1LI0 A;  3D9Y A;  1MY8 A;  3HUO A;  4KQR A;  1K38 A;  5EOE A;  3LEQ A;  2EX8 A;  5HD3 A;  3N8R A;  3IS2 A;  4ETX A;  5FAO A;  4JLF A;  5FA7 A;  3OCN A;  1AWI A;  4B88 A;  2EA9 A;  3B47 A;  4WZ5 A;  1DY6 A;  1EI5 A;  4RYE A;  3QP2 A;  3SOI A;  3UPN A;  1MC0 A;  2EWW A;  3R4K A;  4Y0U A;  4EU0 A;  4WMC A;  1TF1 A;  1K4F A;  4Y13 A;  4EWF A;  3HL9 A;  4X55 A;  5DTK A;  1K56 A;  1MKM A;  3LIB A;  4G3V A;  4ZAM A;  4PMA A;  4ID4 A;  2VA0 A;  3BY8 A;  2M7V A;  3K3D A;  5TGF A;  1CI8 A;  2B5R A;  1BLC A;  3OPL A;  2HF6 A;  3QP8 A;  2GZA A;  5EV0 A;  3LY4 A;  2ZQC A;  2H5S A;  5FQI A;  1BYW A;  1H8Y A;  2XDM A;  4NEE D;  3A0S A;  3S7P A;  1KE3 A;  5BOH A;  2HDU A;  4KZ6 A;  3IT9 A;  2OOL A;  1XXM A;  1ESI A;  3IH9 A;  5CEB A;  4NXE A;  1HTZ A;  2OAP 1;  2PAV P;  3SS4 A;  4Y3I A;  3NC8 A;  1PNE A;  2FFY A;  2RCX A;  1O7E A;  1ERO A;  2W3F A;  5GHX A;  1KE0 A;  3MQO A;  2ZL1 A;  3CMZ A;  4U0X A;  4X53 A;  3P09 A;  5G18 A;  3MXQ A;  3AGD A;  4JXW A;  4BQM A;  1MPL A;  2INW A;  3BEC A;  3C4O A;  1H8M A;  1LT0 A;  3A3F A;  3CWF A;  2W3E A;  5HWT A;  1IKI A;  4FD8 A;  3B42 A;  4Y7P A;  4WYY A;  5DF7 A;  3ZGA B;  5FI6 A;  4F3L A;  3S4X A;  1F98 A;  3V39 A;  4HH3 A;  3ZG5 A;  4DF6 A;  4OON A;  3N4I A;  3HUM A;  3RH8 B;  1FCO A;  3FV7 A;  5CED A;  3U4L P;  5DTS A;  3ISG A;  2M7U A;  1OT6 A;  5A8B A;  2EFU A;  1PW8 A;  3QNC A;  4BEN A;  1ACF A;  4NK3 A;  3WRT A;  4UQI M;  2ACG A;  5J8X A;  3A0V A;  3MZD A;  3HJK A;  2WKP A;  3H82 B;  3MQ0 A;  4GHI B;  5L09 A;  4ZJ2 A;  4PKY G;  1CEF A;  5EVE A;  2J80 A;  1LL5 A;  3HLE A;  5L07 A;  3E4Q A;  2WK0 A;  4PM7 A;  1K57 A;  4OOM A;  1VQQ A;  2A2L A;  4FOF A;  3CI6 A;  3QNB A;  5FQJ A;  1OTB A;  4NXF A;  2Y2G A;  3C8C A;  1KGG A;  3CAX A;  4QY5 A;  1PYY A;  2XH9 A;  2P9V A;  2PYR A;  3VP3 A;  1PIO A;  3A3I A;  1L0D A;  4CJN A;  1N9N A;  3PBT A;  2IWD A;  3OCL A;  4E6X A;  3C30 A;  2Y2J A;  3WS2 A;  3C38 A;  1I2W A;  2H0Y A;  3GEC A;  1CQA A;  1JWV A;  1I2S A;  1XJ6 A;  4ARZ A;  1SKF A;  3QHY A;  5HDS A;  3VP2 A;  2HGV A;  1D1J A;  4OKP A;  3BFF A;  3H82 A;  4FTX A;  4LCL A;  1MWS A;  5F1F A;  1YLP A;  3DW0 A;  3FG8 A;  1PI5 A;  4B93 A;  4FUW A;  3IH8 A;  3HVF A;  4PM9 A;  1XA1 A;  5HAR A;  3MQQ A;  1XJ3 A;  4UA6 A;  4S2I A;  4BBU A;  4BD0 A;  4KUK A;  1OTI A;  5FQQ A;  3GTC A;  1LI9 A;  3KYZ A;  2VLG A;  4F3L B;  1NXY A;  3HLC A;  2V8C A;  1VET B;  3MFD A;  1GHI A;  4O01 A;  5TR7 A;  1H0M A;  5HZH A;  5GLD A;  3ZG7 B;  2WGI A;  4GB7 A;  2UV0 E;  5HAP A;  3TE8 A;  5DJU A;  3VP0 A;  3IXD A;  1DP8 A;  2BTF P;  1S4S A;  4QY6 A;  1J3W A;  2ZC7 A;  3B33 A;  4R23 A;  4AFI A;  1GHP A;  4OLD A;  3SH9 A;  1W5D A;  1A0K A;  2XF3 A;  1K57 C;  1S1Y A;  4OVD A;  4BJP A;  3G32 A;  2L1M A;  4XUX A;  4WEK A;  3RJU A;  1SKO B;  2ZM2 A;  3LO7 A;  1YMX A;  3BEB A;  5HWW A;  3DAV A;  1WYB A;  3PR6 A;  1TDL A;  2VGK A;  5L10 A;  1ZC2 A;  2Y91 A;  3SS3 A;  3U2A A;  1ES2 A;  4N9L A;  2V2F F;  3T4K A;  2Y2P A;  4MN5 A;  4ETZ A;  4EBN A;  3UMD A;  3EQV A;  1HLU P;  4WUJ A;  5FI7 A;  1CF0 A;  3Q7V B;  4BLM A;  3T12 B;  3JVV A;  3KSH A;  2WYX A;  2PR5 A;  1OJG A;  2EX9 A;  3A3J A;  3LUQ A;  2XR0 A;  1Q2Q A;  3CUE C;  4D60 A;  3OBF A;  2VX8 A;  1YQS A;  5G4Z A;  5HL6 A;  3IBR A;  5F68 A;  1SZV A;  2NUT C;  4S2J A;  4O0P A;  4HBU A;  1G6O A;  3T4T A;  3OOV A;  4MCW A;  3HLB A;  1FSY A;  1Q2P A;  3LFV A;  5GHY A;  3LEZ A;  4ME4 A;  1S1Z A;  2XA7 M;  4UEY A;  1MKI A;  5HAQ A;  4WEJ A;  5AQ9 A;  3G2Y A;  1P9R A;  3FWL A;  3ITA A;  3ZVW A;  3VV4 A;  2Y4A A;  5CGS A;  1JNU A;  4E3N A;  1T1A A;  4ZDX A;  3FKW A;  4DDS A;  4OPR A;  5AQ7 A;  3PBQ A;  5A92 A;  2WKR A;  3F1P A;  5HPI A;  2WAF A;  5CER A;  4MN6 A;  4EW7 A;  2L0W A;  1K6S A;  1YKD A;  5E2E A;  1DJB A;  1ODV A;  4E3J A;  3C7U A;  3DBA A;  4KZB A;  1ZKJ A;  4EQI A;  5FQK A;  4E3I A;  3OPR A;  3VFH A;  2XEP A;  1E3U A;  1GSV A;  3G2Z A;  3GMW A;  4CLC C;  1KVL A;  4Z1W A;  4U0T A;  4Y5F A;  3MZF A;  5TJJ A;  3ZQ5 A;  4GW9 A;  1ONG A;  4IBR A;  1CEG A;  1OPX A;  4DDY A;  3ZCZ A;  4EV4 A;  3H9W A;  3T1S A;  1BTL A;  2ZM0 A;  3F1P B;  5HL1 A;  3IWO A;  4HH2 A;  3H7W B;  3IXG A;  2X71 A;  1NYY A;  1XJ2 A;  1IYO A;  2VK3 A;  3O86 A;  1Z6F A;  4NXG A;  3RXW A;  3GV9 A;  1IYP A;  2EXB A;  2QJ5 A;  4LV1 A;  3TRC A;  4RVA A;  5EEC A;  4EEU A;  5DFY A;  4DN0 A;  1L0E A;  1JVJ A;  3WS1 A;  3ITB A;  1SDE A;  4O7D A;  5EUA A;  4E3K A;  3GR2 A;  4GKU A;  1GHM A;  2Z6D A;  3T4Q A;  1OJ5 A;  2PR6 A;  1Z09 A;  4ZTK A;  2I9V A;  2JE5 A;  2J3W A;  2LB5 A;  4KG5 A;  5IT5 A;  4BL3 A;  1ALQ A;  5A91 A;  1OTD A;  3P98 A;  3UME A;  1LL8 A;  3NHQ A;  4OQG A;  1W79 A;  4ZJ3 A;  4PPR A;  5M19 A;  4GHI A;  5DTT A;  4I3A A;  3MS6 A;  2VGL M;  1MXO A;  4P6Z S;  3T4O A;  4FH4 A;  4QD4 A;  1VHM A;  1GSX A;  1J9M A;  3EEH A;  2R9W A;  4K08 A;  4OQH A;  2ZM8 A;  4OPZ A;  1XFN A;  2HP6 A;  1WYC A;  1XKZ A;  1AXB A;  2WAE A;  4MBF A;  2V20 A;  4C6Y A;  1EW0 A;  1DP6 A;  4NXB A;  3JPU A;  4KZ9 A;  2PT7 A;  3PYP A;  2ZMV A;  1FR1 A;  3P01 A;  2EWV A;  3HLF A;  3N8S A;  4YOF A;  3GRJ A;  2XA7 S;  4Q0I A;  3SS5 A;  2P9V B;  3D3O A;  2ZQ8 A;  1XP4 A;  4HI4 A;  3VP1 A;  5FAQ A;  4CPK A;  4MLL A;  3V3R A;  5FAP A;  5KZH A;  3OLO A;  3E4P A;  1RGZ A;  5TFQ A;  3ZG8 B;  1C3B A;  4O8G A;  4X25 A;  4R4S A;  1NWZ A;  4P87 A;  4HES A;  4JXG A;  4I3I A;  1TS8 A;  5F69 A;  4JF5 A;  3K2N A;  5G4Y A;  3WS4 A;  3PBO A;  3MXS A;  1LSV A;  2EXA A;  3IHB A;  1VEU B;  2JCH A;  2Y2L A;  3PAE A;  5DKL A;  3ZVT A;  3ZHH A;  4P85 A;  1F9I A;  3DTE A;  1K54 C;  5EM0 A;  4HJ4 A;  1P9W A;  3O3V A;  4UA9 A;  3E2L A;  5EVI C;  4I38 A;  3BWL A;  5EVI D;  4DE2 A;  5JYO A;  2D02 A;  3O87 A;  2FZ0 A;  4NET A;  4LPZ A;  4OP8 A;  3W8K A;  1MWR A;  3G31 A;  5FL3 A;  1BLS A;  4PM5 A;  4C75 A;  3BFD A;  1LLB A;  1VB6 A;  2YKF A;  1IEM A;  2R9X A;  1X0O A;  2Z2L B;  3UDX A;  4HEF A;  3ICY A;  3TW8 A;  3BY9 A;  3V3S A;  5DVA A;  3HRE A;  1MWT A;  4MDZ A;  1E3U D;  1F2K A;  4WMC D;  4YFM A;  4JPM A;  1O07 A;  1FCM A;  5K5B A;  2KX6 A;  4FCF A;  5IHV A;  4DXB A;  3UY6 A;  1KGE A;  3VE4 A;  1TS0 A;  2JBF A;  3BRM A;  4M3K A;  1OTE A;  3IX4 A;  4K0W A;  5CHU A;  3M2J A;  5F5Y A;  3MR0 A;  2OLU A;  1QMF A;  3CIT A;  2VZW A;  4G3W A;  2V1B A;  4HP9 A;  1XFQ A;  4JF6 A;  4S2K A;  4IED A;  4CLC E;  3FZC A;  5HPF A;  2NUP C;  1YM1 A;  5KIZ A;  3CLO A;  3QP4 A;  1L2S A;  5EFW A;  4KQD A;  3V50 A;  4XT2 B;  4ESP A;  2VKS A;  4OQ0 A;  3HLG A;  3IHA A;  3ZG0 A;  4RX2 A;  5FQ9 A;  4QJG A;  1M40 A;  4P6Z M;  3WS0 A;  4R1G A;  4X1L A;  5KSH A;  3CPT B;  3Q82 A;  3BFE A;  1ES3 A;  2GJ3 A;  2JKF A;  2JN7 A;  2PRF A;  4HOI A;  1YSQ A;  3MFX A;  2D01 A;  2FH5 A;  2W1T A;  1ZG6 A;  4OP5 A;  3V67 A;  2G2U A;  4LFU A;  5LBR A;  2W3D A;  1W8Y A;  1RP5 A;  2DRW A;  2BG1 A;  3W2Z A;  1QME A;  3G35 A;  2Y2Q A;  3KX0 X;  2KDK A;  2X01 A;  2G7U A;  2V0W A;  5CTM A;  4PM6 A;  3IF6 B;  1K4E A;  4OLG A;  3VOL A;  2Y2I A;  2Y55 A;  4YIN A;  4Q0J A;  1YT4 A;  5U47 A;  4DJ2 A;  4R0Q A;  3BQ8 A;  4R3J A;  4EBP A;  4ZRR A;  5FDS A;  3F1N B;  3UDF A;  3ZDJ A;  3OPH A;  3PBN A;  3LGO A;  1KDS A;  4QPR A;  1PFL A;  1GSW A;  3BQA A;  2PHY A;  3V5M A;  3Q7Z A;  3HLW A;  3KYE A;  1S6R A;  2PYP A;  4WBG A;  3KSG A;  2ZMF A;  2J3T C;  5CX7 A;  5FAT A;  4B4X A;  1EWZ A;  5AQA A;  4KQQ A;  5GLB A;  3PHY A;  4HHD A;  5KMW A;  3WRZ A;  2QKP A;  2M1C A;  3EWK A;  3F1O A;  1KE4 A;  4OOL A;  5HX9 A;  2QMI A;  3DTM A;  3BJN A;  2MJ6 A;  2Z2M B;  2ZC4 B;  4E3M A;  4WF0 A;  4BBT A;  2OSU A;  5HFO A;  2WKI A;  2E8I A;  4IUH A;  3S1Y A;  3IXB A;  2ZJ9 A;  4KZA A;  3EGD C;  2ZMA A;  2ZQD A;  4HJ6 A;  3C4P A;  5IU1 A;  4HY8 A;  5E43 A;  3N8L A;  4WEL A;  5EVI A;  2Z6C A;  3KSI A;  1IOU A;  1IKG A;  1GCE A;  5EPH A;  2K2N A;  1TDG A;  2WZZ A;  3DWZ A;  4N1X A;  2A24 A;  4HBT A;  3AGF A;  1SKO A;  4X69 A;  2WKQ A;  3PAG A;  4A5R A;  1YLJ A;  1YLY A;  5E2H A;  1W63 M;  4GD8 A;  4QWO A;  3C2W A;  3F1N A;  4EXO A;  2VJW A;  3PXP A;  2WUQ A;  3H7W A;  3LR3 A;  2DMW A;  3CJM A;  2O9C A;  2HJE A;  4LLO B;  3MKE A;  3MXR A;  1BZA A;  3FPV A;  4NKP A;  4BWI A;  3E98 A;  4NG2 A;  4BD1 A;  1UWP X;  2W3H A;  3UB6 A;  1E25 A;  2QZ6 A;  1BLP A;  3NJA A;  2WKE A;  5AVE A;  3P7N A;  3WS5 A;  3IWQ A;  2Q0O A;  2ZLY A;  1DRM A;  2ZD8 A;  3NOP C;  2H10 A;  3EOI A;  3SZT A;  3NI9 A;  4YWZ A;  4HP4 A;  4E04 A;  1YLT A;  4FSF A;  3JYI A;  2W1R A;  3TG9 A;  1F5M A;  3MBZ A;  3LR5 A;  2JKR I;  3IF5 A;  2QPN A;  4DE0 A;  3MMH A;  5F83 A;  1FSW A;  3ZNY A;  1K25 A;  5GHZ A;  1CI9 A;  1ONH A;  1SDN A;  1Y28 A;  4OQI A;  3L7H A;  4GN2 A;  1H5X A;  5CTN A;  2ZQA A;  1T18 A;  4P0M A;  1NY0 A;  2PBD P;  4GDB A;  2HDR A;  2P7J A;  3T4J A;  3C5A A;  1G5U A;  5IS1 A;  3AGE A;  3KSF A;  4L9F A;  1PI4 A;  3MJQ A;  3BYD A;  5DF9 A;  2QWS A;  3LR0 A;  5MC7 A;  2XLN A;  3FKV A;  3NY4 A;  5F1G A;  2OAQ 1;  5J3W A;  4C3Q A;  5A93 A;  1TS6 A;  4DKI A;  2ZOH A;  3ZG9 B;  4EET B;  5D3O A;  3N7W A;  5C5K A;  5FDH A;  1YLZ A;  4MMN A;  3LR4 A;  1TEM A;  4CLC A;  1SHV A;  4KEN B;  3VP4 A;  2X02 A;  5FAS A;  4N9K A;  1H8Z A;  1FQG A;  2Y2N A;  1IFQ A;  3VSL A;  3E2K A;  4GDN A;  3R7W A;  2Y59 A;  4OH0 A;  4S2N A;  4XT2 A;  3IX8 A;  4KZ4 A;  4EQ1 A;  2W1T B;  3T4S A;  4HJ3 A;  3Q07 A;  2ZOI A;  4DE1 A;  2HP5 A;  3GDI A;  2PU2 A;  1P97 A;  4S2M A;  2R78 A;  5E2G A;  2EFX A;  4GLQ A;  3QP5 A;  1IYS A;  3K3C A;  4QHC A;  2K7S A;  4MN7 A;  2H28 A;  5EVL A;  4HNB A;  1NLY A;  3F1O B;  4Y17 A;  2Y2K A;  3R7W B;  4P6B A;  3PBS A;  1D06 A;  1ES4 A;  1H3Q A;  1S67 L;  2W0N A;  4GD6 A;  3UN7 A;  5GLA A;  3IQA A;  5HAI A;  2V0U A;  4E3L A;  4ZJ1 A;  5A90 A;  1ES5 A;  3QP1 A;  3A0R A;  1RGY A;  4WLA A;  2H0T A;  3UDI A;  3HLD A;  4X56 A;  3GSG A;  5I94 A;  4X1M A;  4IVI A;  1MBL A;  2E8J A;  1PWD A;  4EES A;  3SH8 A;  1V9Z A;  1U60 A;  1KVM A;  4ZBE A;  1BUE A;  2BLS A;  3PTE A;  3UB8 A;  3BW6 A;  4H6J A;  4BL2 A;  1JWZ A;  4JKT A;  1NJ4 A;  1K54 A;  4LEN A;  2O9A A;  4OPY A;  2UWX A;  4K91 A;  3CZD A;  3Q81 A;  1D7E A;  4K0X A;  4HQA A;  3WWX A;  3ZYT A;  4KG6 A;  5GLC A;  5F6A A;  5M18 A;  1ERQ A;  3SH7 A;  4QB8 A;  2OWJ A;  5CXW A;  4R3A A;  5I5L A;  1BSG A;  3B3X A;  1GA0 A;  2J7V A;  3QP6 A;  2B02 A;  1FIK A;  2C5W B;  5FSR A;  3E0Y A;  2J9P A;  2ZQ7 A;  3NIA A;  3LIA A;  2Q9N A;  2VEA A;  1P0Z A;  4PAU A;  2B18 A;  4X68 A;  1PZP A;  2KLI A;  4EUZ A;  1M6K A;  3NCK A;  5TBM B;  3BFC A;  1FCN A;  3M6B A;  4R70 A;  3N6I A;  5CHJ A;  4JF4 A;  4WZ4 A;  1W63 Q;  2V8F A;  3VOZ A;  2JKG A;  2YKH A;  4IJG A;  5FQM A;  1HD8 A;  1N9O A;  3RXX A;  3I7J A;  3DWK A;  4EUV A;  4S2O A;  2DNS A;  3G34 A;  1STZ A;  4PHT A;  4B9O A;  4KQO A;  1SCW A;  2VGJ A;  1JTD A;  1CJF A;  2A3U A;  4GCZ A;  4UA7 A;  1MWU A;  3IS2 B;  1NYM A;  3S7N A;  2LB9 A;  3PBR A;  4GJ4 A;  3EQU A;  3FPW A;  3LI8 A;  3KYQ A;  2CC1 A;  5J4E A;  3UE3 A;  4LV0 A;  3M2K A;  3MSH A;  3NDE A;  2HDS A;  3CG5 A;  4IBX A;  2PU4 A;  1YPR A;  2AVX A;  3RTY A;  4CLC D;  1LHY A;  2GX5 A;  2I72 A;  1S0W A;  4MNR A;  4XUZ A;  1IYQ A;  4RA7 A;  3JVU A;  1LL9 A;  5AQB A;  3CPT A;  5AJG A;  5CRF A;  2JHE A;  4OPQ A;  4H8R A;  4LV3 A;  1UWN X;  5HD5 A;  5CGX A;  1IEL A;  2XD5 A;  4JGQ A;  4KUO A;  1YLW A;  4U3T A;  3T1R A;  3IX3 A;  2XD1 A;  4I5S A;  3VFF A;  1K0K A;  4I3J A;  3MKF A;  4JXV A;  5GL9 A;  1VEU A;  2C6W B;  3O5Y A;  3SW1 A;  2KOI A;  2CMN A;  5FI2 A;  1FOF A;  5DFX A;  1MZU A;  4OOY A;  1HVB A;  1LSX A;  3DTI A;  4IHQ A;  3NDG A;  4UAA A;  5E2F A;  4LRX C;  3LYX A;  4R6L A;  4HIA A;  3A3D A;  3T1Q B;  1PWG A;  3GVB A;  2A24 B;  4KG2 A;  3ZNT A;  2ZC6 B;  2ZC5 B;  5L2F A;  3LIE A;  2V1A A;  2O9B A;  1UGU A;  3T1X A;  2GDN A;  1ZG4 A;  2P74 A;  3TOI A;  1T1C A;  5DJT A;  3FC7 A;  2XQZ A;  1G28 A;  1XA7 A;  4LGW A;  1BLH A;  1TD5 A;  5TBM A;  2VV8 A;  1K55 A;  2JC7 A;  1ESU A;  3S7Q A;  2JKR M;  1BUL A;  1ZTU A;  4GS9 A;  1PRQ A;  4LRZ E;  3UE6 A;  1G68 A;  3KO6 A;  2IWC A;  3T50 A;  3UPO A;  1N9L A;  3OPP A;  1TS7 A;  5EOO A; 
#chains in the Genus database with same CATH homology
 4S2N C;  3CMZ A;  1YLT A;  4FSF A;  1L0E A;  3JYI A;  4U0X A;  1FR6 A;  3BLS A;  1JVJ A;  4X53 A;  3TG9 A;  3MBZ A;  3P09 A;  5G18 A;  3FYZ A;  3WS1 A;  4Q8I A;  3ITB A;  2Y2O A;  3AGD A;  4LCM A;  4JXW A;  3IF5 A;  1SDE A;  4O7D A;  5EUA A;  4BQM A;  1MPL A;  2QPN A;  2V1Z A;  4LV2 A;  4N92 A;  2Q9M A;  3D4F A;  4DE0 A;  4E3K A;  3BEC A;  3C4O A;  3GR2 A;  4GKU A;  3A3F A;  1GHM A;  5F83 A;  1IKI A;  4FD8 A;  4F94 A;  2A49 A;  1FSW A;  4Y7P A;  3ZNY A;  4ZTK A;  1K25 A;  1N9B A;  2JE5 A;  2HP9 A;  1CI9 A;  1ONH A;  5GHZ A;  4WYY A;  1SDN A;  4OQI A;  5DF7 A;  5FI6 A;  3ZGA B;  3S4X A;  5KSC A;  4KG5 A;  4GN2 A;  3V39 A;  4BL3 A;  1H5X A;  1ALQ A;  5A91 A;  2ZQ9 A;  5CTN A;  3ZG5 A;  2ZQA A;  4DF6 A;  3IF6 A;  4OON A;  3N4I A;  1RCJ A;  4P0M A;  1NY0 A;  1WE4 A;  3HUM A;  1FCO A;  3P98 A;  3OZH A;  3FV7 A;  4GDB A;  2HDR A;  5CED A;  1NZO A;  4OQG A;  1W79 A;  4ZJ3 A;  4PPR A;  5DTS A;  3C5A A;  3ISG A;  2EX6 A;  5M19 A;  3AGE A;  5DTT A;  1PI4 A;  1VM1 A;  4MBH A;  1MXO A;  3BYD A;  5DF9 A;  4FH4 A;  4QD4 A;  2XLN A;  2ZC3 B;  2EFU A;  1J9M A;  3FKV A;  1PW8 A;  1XGI A;  3QNC A;  2R9W A;  4BEN A;  3NY4 A;  5F1G A;  4B4Z A;  4NK3 A;  4OQH A;  2ZM8 A;  3WRT A;  4OPZ A;  1PW1 A;  4C3Q A;  5A93 A;  3HBR A;  5JYP A;  4DKI A;  2HP6 A;  2Y2M A;  5J8X A;  3MZD A;  3ZG9 B;  2FFF B;  1WYC A;  4JXS A;  1XKZ A;  1ERM A;  5D3O A;  1AXB A;  2WAE A;  1GA9 A;  3N7W A;  4MBF A;  2V20 A;  5FDH A;  4C6Y A;  1YLZ A;  1JWP A;  4KZ9 A;  1TEM A;  1SHV A;  1FR1 A;  4KEN B;  5M1A A;  3VP4 A;  3ZFZ A;  2X02 A;  5FAS A;  1NZU A;  3HLF A;  1H8Z A;  4N9K A;  4ZJ2 A;  1CEF A;  3N8S A;  3GRJ A;  1FQG A;  2OV5 A;  3SS5 A;  2P9V B;  2Y2N A;  2ZQ8 A;  1LL5 A;  3E2K A;  1XP4 A;  3HLE A;  4GDN A;  4MEZ A;  3VSL A;  3VP1 A;  5FAQ A;  4D2O A;  2WK0 A;  4CPK A;  3BLM A;  2Y59 A;  4MLL A;  4PM7 A;  3V3R A;  1K57 A;  4OOM A;  4OH0 A;  5FAP A;  1VQQ A;  4S2N A;  1PWC A;  4KZ7 A;  5KZH A;  4KZ4 A;  1RGZ A;  4KZ8 A;  5TFQ A;  3ZG8 B;  3Q07 A;  5CGW A;  4IVK A;  2XFT A;  1C3B A;  1DJC A;  3QNB A;  5FQJ A;  4P87 A;  4R4S A;  2Y2G A;  1KGG A;  4HES A;  4QY5 A;  3W4Q A;  1PYY A;  2XH9 A;  2HP5 A;  4DE1 A;  2P9V A;  4JXG A;  2IWB A;  2PU2 A;  4S2M A;  3G30 A;  5E2G A;  3VP3 A;  2EFX A;  3NBL A;  3TSG A;  1PIO A;  1IYS A;  3A3I A;  1L0D A;  4JF5 A;  4QHC A;  4CJN A;  1JTG A;  3PBT A;  3WS4 A;  3PBO A;  2IWD A;  3MXS A;  2EXA A;  3IHB A;  3OCL A;  5EVL A;  4E6X A;  2Y2J A;  2JCH A;  2Y2L A;  3UNW A;  3WS2 A;  1I2W A;  2Y2H A;  3PAE A;  2Y2K A;  3ZVT A;  2H0Y A;  4P6B A;  5HW3 A;  3ZHH A;  3PBS A;  4P85 A;  1ES4 A;  1JWV A;  1I2S A;  4GD6 A;  3UN7 A;  3O88 A;  5GLA A;  1K54 C;  1KGF A;  3IQA A;  5HAI A;  4E3L A;  3O3V A;  1SKF A;  3QHY A;  4UA9 A;  2HDQ A;  4ZJ1 A;  3VP2 A;  5A90 A;  3E2L A;  1ES5 A;  2WZX A;  5EVI C;  1RGY A;  4KZ3 A;  5EVI D;  3HUN A;  3OC2 A;  2H0T A;  4OKP A;  1CK3 A;  3UDI A;  3BFF A;  3HLD A;  1XPB A;  4X56 A;  3GSG A;  5CHM A;  4DE2 A;  5JYO A;  3O87 A;  3LCE A;  5I94 A;  1Y54 A;  4IVI A;  4NET A;  1MBL A;  4LCL A;  1MWS A;  4OP8 A;  4PM8 A;  3W8K A;  1YLP A;  5F1F A;  3DW0 A;  1MWR A;  3G31 A;  4GZB A;  3UE1 A;  1BLS A;  4PM5 A;  1PWD A;  4X6T A;  5EVI B;  4C75 A;  1PI5 A;  3BFD A;  1LLB A;  3M6H A;  3Q7V A;  3SH8 A;  1IEM A;  1U60 A;  2R9X A;  2Z2L B;  3UDX A;  4HEF A;  3V3S A;  2OLV A;  5DVA A;  1KVM A;  4ZBE A;  1BUE A;  3HRE A;  2BLS A;  3PTE A;  1MWT A;  3IH8 A;  2WGW A;  3MZE A;  4UHU A;  4BL2 A;  1E3U D;  1JWZ A;  3HVF A;  4PM9 A;  4JKT A;  4WMC D;  4JPM A;  1NJ4 A;  1TVF A;  1XA1 A;  3IF6 C;  4YFM A;  4E3O A;  5HAR A;  4DRT A;  1K54 A;  4LEN A;  1O07 A;  4OPY A;  4UA6 A;  2UWX A;  3Q1F A;  4K91 A;  1FCM A;  4S2I A;  3CZD A;  2XFS A;  3Q81 A;  4BD0 A;  5DF8 A;  4DE3 A;  4K0X A;  1NRF A;  4FCF A;  5IHV A;  4Y0O A;  4DXB A;  3UY6 A;  3WWX A;  5FQQ A;  3GTC A;  1LI9 A;  1KGE A;  1YMS A;  2J9O A;  3BRM A;  2JBF A;  4KG6 A;  4KZ5 A;  4M3K A;  2DCF A;  5GLC A;  1NXY A;  3A3E A;  5M18 A;  3HLC A;  1ERQ A;  4K0W A;  5CHU A;  4QB8 A;  3SH7 A;  3M2J A;  3UPP A;  3MFD A;  1W7F A;  3IWI A;  2WGW B;  5CXW A;  1GHI A;  1L0G A;  3G4P A;  1BSG A;  2OLU A;  5TR7 A;  4DXC A;  1QMF A;  3B3X A;  5GLD A;  1GA0 A;  2J7V A;  2EX2 A;  3ZG7 B;  2C5W B;  5FSR A;  2WGI A;  1PZO A;  4GB7 A;  2J9P A;  5HAP A;  4JF6 A;  2ZQ7 A;  1BT5 A;  3NIA A;  3VP0 A;  3IXD A;  4S2K A;  4RX3 A;  4QY6 A;  4R3B A;  1K6R A;  2Q9N A;  2ZC7 A;  4IED A;  4GNU A;  3FZC A;  1K56 D;  1XX2 A;  4R23 A;  1KDW A;  3UE0 A;  4E6W A;  3VSK A;  1YM1 A;  1GHP A;  4OLD A;  4X68 A;  1PZP A;  3VOY A;  3SH9 A;  1L2S A;  1W5D A;  4N1H A;  4EUZ A;  1M6K A;  2XF3 A;  4MBK A;  3NCK A;  4S2P A;  3V50 A;  1K57 C;  3BFC A;  1FCN A;  3M6B A;  4OQ0 A;  4OVD A;  4BJP A;  3G32 A;  3HLG A;  3IHA A;  3N6I A;  4JF4 A;  4RX2 A;  4R4R A;  4XUX A;  5CHJ A;  3ZG0 A;  4WZ4 A;  1OME A;  5FQ9 A;  4QJG A;  4WEK A;  3RJU A;  3VOZ A;  1M40 A;  2ZM2 A;  3WS0 A;  4R1G A;  5FQM A;  3LO7 A;  1HD8 A;  3RXX A;  5KSH A;  3W4O A;  1YMX A;  3BEB A;  3Q82 A;  3BFE A;  2WGV A;  1ES3 A;  3I7J A;  2WAD A;  3DWK A;  1WYB A;  1TDL A;  2VGK A;  1ZC2 A;  2Y91 A;  2RL3 A;  4S2O A;  3S22 A;  3SS3 A;  4S2L A;  1ES2 A;  2DNS A;  4N9L A;  2V2F F;  3G34 A;  2Y2P A;  1ZG6 A;  4OP5 A;  4KQO A;  2HPB A;  4EBN A;  1SCW A;  2G2U A;  2VGJ A;  3EQV A;  1JTD A;  2A3U A;  3UO9 A;  1W8Y A;  4UA7 A;  1MWU A;  1RP5 A;  5FI7 A;  2DRW A;  2G2W A;  1NYM A;  4Y0T A;  3Q7V B;  4BLM A;  2BG1 A;  2WKH A;  3PBR A;  2WYX A;  3BFG A;  1QME A;  3EQU A;  3G35 A;  2EX9 A;  2Y2Q A;  3A3J A;  2CC1 A;  2XR0 A;  1Q2Q A;  2X01 A;  5CTM A;  3GQZ A;  4PM6 A;  3IF6 B;  1K4E A;  1W8Q A;  1YQS A;  3UE3 A;  4OLG A;  4LV0 A;  3M2K A;  2Y2I A;  3NDE A;  4GOG A;  2Y55 A;  2HDS A;  4YIN A;  3CG5 A;  4IBX A;  2PU4 A;  1I5Q A;  1YT4 A;  5U47 A;  4R0Q A;  3IXH A;  4L0L A;  4S2J A;  4R3J A;  4HBU A;  4EBP A;  1K55 C;  1E4D A;  3W4P A;  4XXR A;  3UDF A;  3ZDJ A;  1DJA A;  3OPH A;  3HLB A;  5EE8 A;  1FSY A;  1LHY A;  1Q2P A;  3PBN A;  1KDS A;  4JBF A;  2I72 A;  3V5M A;  1S0W A;  5GHY A;  3Q7Z A;  1N4O A;  3HLW A;  2J8Y A;  4MNR A;  4XUZ A;  1IYQ A;  4RA7 A;  3BM6 A;  3LEZ A;  1LL9 A;  5AQB A;  1S6R A;  4WM9 A;  5CRF A;  1MKI A;  3VMA A;  4OPQ A;  5HAQ A;  5F82 A;  4WBG A;  4WEJ A;  5AQ9 A;  3G2Y A;  1XGJ A;  4H8R A;  4LV3 A;  4QU3 A;  3FWL A;  2PBY A;  3ITA A;  5CGX A;  1HZO A;  2XK1 A;  3C7V A;  1IEL A;  5FAT A;  4B4X A;  2XD5 A;  1G6A A;  3ZVW A;  1YLW A;  1EWZ A;  4U3T A;  2Y4A A;  5CGS A;  5AQA A;  4KQQ A;  4E3N A;  4EBL A;  4Z9Q A;  5GLB A;  4FH2 A;  4ZDX A;  1L0F A;  2XGN A;  3FKW A;  2XD1 A;  5KMW A;  3LY3 A;  4WZ5 C;  5CEC A;  4DDS A;  3VFF A;  3WRZ A;  1LI0 A;  4JXV A;  3MKF A;  5GL9 A;  1KE4 A;  4OOL A;  5HX9 A;  4OPR A;  1MY8 A;  2QMI A;  5AQ7 A;  3HUO A;  4KQR A;  2C6W B;  3PBQ A;  3DTM A;  1K38 A;  5EOE A;  5A92 A;  2Z2M B;  2ZC4 B;  4E3M A;  2EX8 A;  3N8R A;  2OSU A;  5HFO A;  2WAF A;  5FI2 A;  1FOF A;  4OOY A;  5CER A;  2WKI A;  1HVB A;  5FAO A;  2E8I A;  4JLF A;  3S1Y A;  3IXB A;  2ZJ9 A;  4KZA A;  5FA7 A;  3OCN A;  3NDG A;  4UAA A;  4B88 A;  5E2F A;  2ZMA A;  2ZQD A;  3C4P A;  4WZ5 A;  1DY6 A;  1EI5 A;  1K6S A;  3A3D A;  5E43 A;  3N8L A;  5E2E A;  1DJB A;  4WEL A;  5EVI A;  4E3J A;  3C7U A;  4KZB A;  4RYE A;  1IKG A;  1ZKJ A;  1PWG A;  5FQK A;  1GCE A;  3SOI A;  3UPN A;  4EQI A;  5EPH A;  3GVB A;  4Y0U A;  4E3I A;  3OPR A;  1TDG A;  3VFH A;  2WZZ A;  3DWZ A;  2XEP A;  4WMC A;  4N1X A;  4HBT A;  4KG2 A;  3ZNT A;  3AGF A;  1E3U A;  2ZC6 B;  4X69 A;  1K4F A;  4EWF A;  2ZC5 B;  3HL9 A;  3PAG A;  4X55 A;  5DTK A;  3G2Z A;  5L2F A;  3GMW A;  4A5R A;  5GHX A;  1KVL A;  1K56 A;  1YLJ A;  1YLY A;  5E2H A;  4U0T A;  4GD8 A;  3MZF A;  4ZAM A;  4PMA A;  4ID4 A;  2GDN A;  4LV1 A;  1ONG A;  1ZG4 A;  2P74 A;  3TOI A;  4IBR A;  1CEG A;  2XQZ A;  5TGF A;  4DDY A;  3ZCZ A;  1XA7 A;  2WUQ A;  1CI8 A;  3CJM A;  2B5R A;  4EV4 A;  1BLC A;  3OPL A;  1BLH A;  3LY4 A;  2ZQC A;  3MKE A;  1K55 A;  1BTL A;  2H5S A;  2ZM0 A;  5FQI A;  1H8Y A;  2XDM A;  3MXR A;  1BZA A;  2JC7 A;  1ESU A;  5HL1 A;  3IWO A;  4BD1 A;  1BUL A;  1KE3 A;  5BOH A;  2HDU A;  4KZ6 A;  1E25 A;  3IT9 A;  2QZ6 A;  3IXG A;  1BLP A;  1G68 A;  1XXM A;  2WKE A;  2IWC A;  1ESI A;  2X71 A;  3IH9 A;  5CEB A;  1HTZ A;  3WS5 A;  1NYY A;  3IWQ A;  3UPO A;  3SS4 A;  1IYO A;  3NC8 A;  2ZLY A;  3O86 A;  1Z6F A;  3RXW A;  2FFY A;  2ZD8 A;  1IYP A;  2EXB A;  2H10 A;  1O7E A;  2RCX A;  1ERO A;  3GV9 A;  3OPP A;  4RVA A;  1KE0 A;  3NI9 A;  5EEC A;  5EOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...