1FR6A

Refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
361
structure length
361
Chain Sequence
AAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQWQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMSKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPVKADSIISGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Refined crystal structure of beta-lactamase from Citrobacter freundii indicates a mechanism for beta-lactam hydrolysis.
pubmed doi rcsb
total genus 105
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fr6A00
1L0DA 2JE5A 4S2KA 4NK3A 5GLAA 2Y2KA 3UNWA 5AQ9A 4UA7A 5EVLA 3M6BA 5EOOA 4FH4A 3Q1FA 3W8KA 1BLPA 1NJ4A 3DTMA 2WGWB 3BEBA 1G6AA 1YQSA 1FSYA 2JCHA 2ZC6B 5CHUA 5CGWA 5CERA 4BL2A 3S1YA 3GSGA 3P09A 2XQZA 3VP4A 1PI5A 3UE0A 1MWTA 2DCFA 4IEDA 3UPNA 3LCEA 1PIOA 1IYSA 3G4PA 4WZ5A 3BYDA 3GMWA 2J9OA 4MBFA 4B88A 1MKIA 4GDNA 3VSLA 4S2OA 1KE4A 4IVIA 1VQQA 4K0XA 5KSCA 1SDNA 2EX8A 4X55A 2WGVA 4BQMA 3WS1A 3QNCA 3MZDA 4A5RA 2HP9A 3ISGA 1ERMA 3DWZA 3C5AA 1EWZA 1RGZA 3VSKA 3HLDA 5A93A 1JWVA 3PAGA 2X02A 3M2KA 4DXBA 4BLMA 4DE1A 2EX9A 4IBRA 2VGJA 4KZ7A 4DDYA 5E2HA 1MPLA 4XUZA 1S6RA 4KZ3A 3N8RA 4OQ0A 4R4SA 2WZZA 3BFDA 2WKHA 3C4PA 3S22A 4KZ8A 3P98A 2HDRA 3TOIA 5KSHA 2ZC4B 1ES5A 2Y2HA 4ZAMA 3SOIA 4S2LA 5AQAA 1K57A 4GD6A 3ZG7B 2Y91A 4N92A 4EBNA 4LENA 3G35A 3IWIA 4M3KA 4N1HA 3ZHHA 3N6IA 1YLYA 4P87A 4LCMA 5EECA 1CEFA 2Y2LA 3QHYA 3BLMA 5CHJA 1FCOA 4WZ5C 4JBFA 4JF5A 5F1GA 4CPKA 3IHBA 4QB8A 4JXVA 4KG5A 3IWQA 3OZHA 4XXRA 4OLDA 2X01A 4N9KA 5E2FA 2ZMAA 1Q2PA 3MKFA 5EVID 1AXBA 3UO9A 2ZQDA 2WUQA 4OONA 4Y7PA 4Z9QA 1H8ZA 3TSGA 3A3FA 3C7VA 3V50A 4KZ4A 2EXBA 1GA9A 1YLZA 1K6RA 4C6YA 3AGFA 1JWPA 1K4EA 5GLCA 3SH7A 5JYPA 1PW1A 1PZPA 1XP4A 4LV2A 5TR7A 1PYYA 3NCKA 5FAQA 1IYPA 1K56D 4WZ4A 5FA7A 1PWDA 4E3LA 5JYOA 5AQ7A 3IF6A 5U47A 3W4PA 5FDHA 1XX2A 4LCLA 2C5WB 1L0FA 4K91A 3VFHA 5E43A 5FI6A 1IELA 1BULA 4BL3A 2P9VA 4DE0A 3HUNA 4FH2A 1ALQA 4ZDXA 1NZUA 2H10A 3FYZA 5DF7A 3CG5A 4E6WA 3MXRA 3OPRA 4ZJ3A 5EE8A 2Y2IA 3PTEA 4JKTA 3UDIA 1XXMA 2WAEA 1BLCA 1KGFA 3V3SA 3IXBA 2WK0A 2E8IA 4KZBA 1TDGA 4OOLA 5KMWA 1GCEA 3WS4A 2HDQA 4L0LA 3DW0A 2HP6A 3WS5A 1SKFA 4DKIA 5FI7A 3MKEA 3OCNA 3QNBA 4BJPA 2RCXA 1W8QA 3NIAA 2G2WA 4QY5A 2HP5A 1N9BA 5AQBA 4OLGA 1JTGA 1K38A 1PWGA 3E2LA 5CECA 1I2SA 3JYIA 4YFMA 5HAPA 1YLTA 5HL1A 2ZC5B 3W4QA 1LI0A 3MXSA 3HLGA 4QY6A 3ZG8B 3MFDA 3IWOA 3O86A 3BM6A 1HVBA 1BUEA 3BFGA 3IF6C 2XFTA 5HFOA 3HLCA 4BENA 2EFUA 2Y2OA 3VOYA 1IKGA 1NY0A 4PM7A 4WELA 5A90A 3IH9A 2XDMA 1TEMA 2P74A 3A3IA 3VMAA 2PBYA 3ZDJA 1Z6FA 5DTSA 2OSUA 4E6XA 3V3RA 1SDEA 3GQZA 3ZG9B 4OH0A 1IEMA 1BZAA 3PBRA 3IF6B 4KENB 1JWZA 1CI8A 1J9MA 1FCNA 5DTKA 4PM8A 4FSFA 2Y2QA 3ZVWA 2CC1A 3ZFZA 4KZAA 2OLUA 1BLHA 1DJAA 4S2JA 3ZGAB 1BTLA 2Q9NA 1RCJA 2V2FF 5EVIA 2C6WB 2P9VB 4E3IA 4Y0TA 5FQIA 3V5MA 3IQAA 5G18A 4P0MA 3S4XA 3PAEA 3IF5A 4HBUA 3VP3A 1HTZA 4R4RA 3EQUA 1JTDA 3BFFA 4X68A 1K56A 2QZ6A 4R3BA 5HX9A 3FZCA 2Z2LB 1KDWA 4UA6A 4MLLA 2WZXA 3HREA 4MBKA 5CGSA 4HBTA 3MBZA 4WEKA 1BLSA 1WE4A 3MZEA 3IXDA 4PM6A 4S2NA 5CTMA 1ESUA 4RX2A 5TFQA 4X56A 1RGYA 3IHAA 4GN2A 5CXWA 1O7EA 4QHCA 4EV4A 2R9WA 3WS0A 3O88A 3OPPA 4UA9A 4U0TA 2DNSA 4MEZA 3BFCA 4WBGA 2R9XA 1C3BA 1K55A 2Y4AA 1MWRA 1YM1A 4S2PA 3PBSA 2BLSA 3VP2A 4RYEA 2ZJ9A 5EVIC 2RL3A 2IWDA 2UWXA 1XGJA 3N7WA 5GHYA 1QMEA 5GL9A 1QMFA 2IWBA 3FKVA 4Q8IA 3G34A 4GDBA 5FASA 5HARA 5M19A 2DRWA 3GVBA 4OQGA 5FQKA 4JF6A 1ERQA 4E3MA 5F1FA 2HDSA 5FAOA 5FQJA 3Q7VA 4GNUA 5A92A 3IT9A 4DE2A 4U0XA 5GHZA 3I7JA 1FCMA 2Q9MA 2X71A 2ZQ9A 5EVIB 3VFFA 1ESIA 2A3UA 1MWUA 3FWLA 4GB7A 3PBQA 3HLWA 4S2NC 4E3NA 1H5XA 5F82A 5TGFA 3W4OA 3NDGA 1GHMA 1GA0A 2ZLYA 1WYBA 2WYXA 3FKWA 2H0TA 2XH9A 2XD5A 5M1AA 3PBNA 1BT5A 1G68A 4PM9A 4KZ6A 4LV1A 1CK3A 4QD4A 3WS2A 1EROA 1K55C 4OKPA 4P85A 5BOHA 4RVAA 4KQQA 2HPBA 2I72A 4S2IA 3CMZA 1W79A 1CEGA 1MXOA 3TG9A 1K54A 1I2WA 4IBXA 1TVFA 1ZKJA 2WGIA 2ZC3B 3Q7ZA 4OP5A 5E2GA 4EBLA 3ZG0A 1M40A 1MY8A 1FOFA 4X69A 1NYYA 2WKEA 3G30A 4X53A 4EBPA 3NY4A 4KG6A 3UDFA 4BD0A 1YLPA 2EFXA 1TDLA 4B4XA 5M18A 1H8YA 4RX3A 4OOYA 1DJCA 2J7VA 4FCFA 1SHVA 3ITBA 4MBHA 4OP8A 3PBOA 3E2KA 2ZQAA 4U3TA 3DWKA 4OOMA 1BSGA 4BD1A 4OQIA 2Y2JA 4LV3A 2OV5A 2XK1A 3Q7VB 2XEPA 4P6BA 5EUAA 4ZBEA 3C7UA 4E3OA 4OPRA 5EPHA 2FFYA 2XFSA 2XD1A 3HLFA 3UY6A 3VOZA 1ES3A 1K6SA 1K25A 2Y59A 4GKUA 3MZFA 3O87A 4QJGA 1YMSA 4KZ5A 2ZD8A 2XR0A 1NXYA 3SS4A 4N9LA 1K54C 1E25A 2ZM0A 3OC2A 5DVAA 3IXHA 3BECA 2BG1A 3Q81A 1LHYA 1U60A 1E4DA 3O3VA 1IYOA 1JVJA 2G2UA 2EX6A 3BFEA 5FAPA 4OVDA 3SS5A 1MWSA 4E3KA 5CHMA 5FATA 5HAIA 2A49A 4RA7A 1OMEA 1ZG6A 2WKIA 3RXWA 4E3JA 1SCWA 1FSWA 2QMIA 3Q82A 4QU3A 1L0EA 2PU4A 3M2JA 1ES4A 4JXSA 4R0QA 4ZJ2A 2VGKA 3ZG5A 3Q07A 4ZJ1A 4OPYA 3D4FA 3IH8A 4CJNA 1ZG4A 3ZVTA 1LL9A 3WWXA 2ZQ7A 2ZC7A 4B4ZA 2J9PA 2QPNA 3UE1A 2ZQCA 3AGEA 5F83A 1IYQA 4PPRA 4JPMA 5E2EA 1XA7A 1GHIA 4Y0OA 4OPZA 1GHPA 3LY4A 5I94A 1NYMA 4JXGA 3OPLA 3ZNTA 3G2ZA 1L2SA 2V20A 3A3JA 1E3UD 2B5RA 4DXCA 3IXGA 1Y54A 3BRMA 4WMCD 1S0WA 1WYCA 2ZM8A 1W5DA 4KQOA 3RJUA 4NETA 4KZ9A 2EXAA 3VP0A 5FSRA 2WADA 2Y2NA 1KE3A 4IVKA 4R3JA 3A3DA 1KVMA 1HD8A 4JF4A 1VM1A 1ZC2A 1PWCA 5CEBA 2H0YA 5FI2A 2WAFA 4PM5A 3UPOA 3GV9A 3UPPA 4ID4A 3G32A 5DTTA 2HDUA 5FQMA 3V39A 3GTCA 4DE3A 3HVFA 1YMXA 3HUMA 3HBRA 3FV7A 4HEFA 4UAAA 1PI4A 3HLBA 4DRTA 4DF6A 4K0WA 4WYYA 3RXXA 1LL5A 3VP1A 4N1XA 1XKZA 3LY3A 2JC7A 5A91A 2JBFA 4JXWA 2XGNA 4JLFA 5GHXA 1MBLA 1ONHA 1HZOA 3G2YA 1EI5A 4D2OA 3PBTA 4LV0A 5CEDA 4S2MA 3ITAA 4UHUA 5IHVA 2XLNA 1FQGA 1KGGA 2Y55A 3AGDA 2FFFB 4H8RA 3UN7A 4EQIA 3HUOA 1FR1A 5EOEA 3OCLA 1RP5A 5CTNA 1FR6A 5GLBA 1LI9A 2IWCA 5HAQA 4HESA 1N4OA 2GDNA 4WEJA 3NBLA 1L0GA 3CJMA 3HLEA 5HW3A 4YINA 1YLWA 2EX2A 2WGWA 2Y2GA 1ONGA 4XUXA 3UE3A 3ZNYA 3NDEA 5J8XA 1NZOA 4Y0UA 5D3OA 1K57C 1ES2A 3N4IA 3WRZA 2ZQ8A 1KDSA 3N8LA 3NC8A 3GR2A 3N8SA 1CI9A 5DF8A 1M6KA 3G31A 4DDSA 4MNRA 1XGIA 1XPBA 3BLSA 2PU2A 2ZM2A 5CRFA 5DF9A 2H5SA 1KGEA 3SH9A 1XA1A 1E3UA 4OQHA 4EUZA 2Y2PA 3LO7A 4OPQA 4WMCA 4GZBA 1DY6A 3B3XA 4ZTKA 2XF3A 3A3EA 1W7FA 1IKIA 5CGXA 5FQ9A 2V1ZA 4WM9A 3WRTA 1KVLA 4X6TA 3ZCZA 3GRJA 1I5QA 1YLJA 4O7DA 3CZDA 3NI9A 1NRFA 4KG2A 4F94A 2Z2MB 4C3QA 4GOGA 1Q2QA 3OPHA 5FQQA 3SH8A 4C75A 4GD8A 4KQRA 3M6HA 5L2FA 3C4OA 1DJBA 1PW8A 1YT4A 4R23A 1W8YA 1LLBA 3SS3A 4FD8A 1O07A 2J8YA 1PZOA 4EWFA 2Y2MA 1K4FA 3UDXA 5KZHA 4R1GA 3HL9A 2OLVA 3LEZA 4PMAA 3EQVA 5GLDA 1KE0A
chains in the Genus database with same CATH superfamily
1L0DA 3TE8A 3L9KA 2OAQ1 1VETB 4FH4A 1N9OA 1XFNA 1YQSA 2JCHA 4DJ3A 4R38A 2PD7A 2NUPC 3KSIA 4BL2A 1YSQA 3GSGA 2YKHA 2QKPA 3D3OA 3VP4A 2DCFA 3CUEC 3LCEA 3G4PA 2EWVA 1AWIA 3GMWA 4K0XA 3W2ZA 2WGVA 5F69A 4L9EA 3HLDA 5A93A 4Y5FA 3M2KA 4BLMA 5TBMA 2H28A 4OQ0A 2WZZA 3S22A 1OTEA 3LR3A 3P98A 2ZC4B 2INWA 4HHDA 1P0ZA 4GD6A 2VK3A 3ZHHA 4N1HA 4FOFA 2OWJA 1CEFA 5HSQA 5CHJA 5F1GA 4DJ2A 3UB7A 2W3DA 5E2FA 2ZMAA 3MKFA 1OT6A 4MDZA 3S7OA 5FAQA 5FA7A 3W4PA 1XX2A 4EQ1A 3VFHA 4FH2A 1ALQA 1NZUA 2J3TC 3BQAA 2K7SA 2M7UA 3MXRA 4ZRRA 4ZJ3A 2Y2IA 2WAEA 3KSGA 3A0VA 2K31A 4KZBA 1GCEA 4IUHA 1V9YA 3B42A 3MKEA 1D06A 2WKPA 2XA7S 4QY5A 3E2LA 5CECA 3W4QA 1LI0A 3MXSA 4MN5A 1BUEA 3IF6C 2ZOHA 4KQDA 1XJ3A 5HFOA 4LRYC 4BENA 3VOYA 1NY0A 4PM7A 1TEMA 2PBYA 3ZDJA 3V3RA 1IEMA 3E0YA 3IF6B 1JWZA 1FCNA 4PM8A 4FSFA 2CC1A 4KZAA 2HV1A 1DJAA 4S2JA 4E3IA 1VEUB 2VJWA 5FQIA 2B02A 5CX7A 4X68A 1JTDA 3QP6A 4AFIA 1KDWA 1S1YA 3T4QA 1G28A 3OOVA 3MBZA 4WEKA 2JKTM 4PM6A 3IHAA 5HPIA 3B33A 3QP1A 1O7EA 4QHCA 5CXWA 2W0NA 4EV4A 3OPPA 2DNSA 4ARZB 1C3BA 4EUVA 4HI4A 4S2PA 3DTEA 2IWDA 3N7WA 1XGJA 4Q8IA 3E4QA 5FASA 5HARA 5M19A 2HDSA 5FQJA 3T4JA 3CITA 4WUJA 4R3AA 1MWUA 5HD5A 1H8MA 1STZA 4S2NC 1H5XA 1S1ZA 2ZLYA 3T1QB 2W3GA 2XH9A 2XD5A 3PBNA 4PM9A 1CK3A 1EROA 1K55C 5BOHA 4Q0IA 2V8FA 4KQQA 2HPBA 2I72A 3TG9A 3NHQA 1I2WA 2ZC3B 1ZKJA 4OP5A 1H0MA 5E2GA 4ME4A 3ZG0A 5F68A 1M40A 3TW8A 3RFBA 1NYYA 4O01A 4X1MA 4EBPA 4KG6A 2OWHA 1H8YA 4RX3A 1DJCA 4MBHA 5EFWA 3UMDA 3PBOA 3ICYA 3E2KA 4U3TA 5FEFA 4OQIA 5IU1A 3MXQA 1Z09A 1MZUA 2XD1A 3UY6A 1K6SA 1K25A 3O87A 1YSPA 4KZ5A 3D9YA 1HLUP 1E25A 1Y28A 3OC2A 5DVAA 1E4DA 3VE3A 3BFEA 4E3KA 4RA7A 1ZG6A 2ZOIA 3Q82A 1OJGA 1OTIA 4ZJ2A 2HF6A 3Q07A 4OPYA 3IH8A 3ZVTA 1LL9A 3WWXA 4P6ZM 2ACGA 4Y15A 3CPTB 4JGQA 4GJ4A 1IYQA 4PPRA 5E2EA 4Y0OA 3MJQA 1SKOA 1S0WA 4KQOA 4NETA 5J7EA 5TJJA 2EXAA 5FSRA 4IVKA 3LFVA 3F1PA 4PM5A 3DTIA 5FQMA 3V39A 2WKQA 2A2LA 1PI4A 4Q0JA 3HLBA 4HP4A 3RXXA 1LL5A 4N1XA 1XKZA 2PAVP 3LY3A 5A91A 4Y17A 2QYBA 5GHXA 5DKLA 1HZOA 3G2YA 5CEDA 4UHUA 4L9FA 5HD3A 2XLNA 2Y55A 1KGGA 4H8RA 4EQIA 2L0WA 1UWPX 3LIFA 5A8BA 3LI9A 3S7PA 1UGUA 1LI9A 2IWCA 1OJ5A 2Y8HA 2JKFA 2LB5A 1F9IA 3CJMA 3CWFA 4YINA 2EX2A 3NDEA 1OPXA 3WRZA 3GDIA 2ZQ8A 2FH5A 4JGOA 3NC8A 3GR2A 2JKRM 1M6KA 3CLOA 1XGIA 4X25A 4GHIB 1XPBA 3QP8A 4I38A 1PNEA 3C8CA 1F5MA 1XA1A 3UB5P 3F1NB 4OQHA 3HCYA 2O9AA 1DY6A 4ZTKA 2ZL1B 2XF3A 3A3EA 4YWZA 3ZCZA 1D1JA 1XJ4A 3CUEA 1YLJA 2J3TD 3NI9A 4F94A 4C3QA 1Q2QA 2VV8A 4C75A 2EWWA 3NJAA 4GD8A 3NOTC 3M6HA 3FPVA 1DJBA 2QWSA 3K3CA 1W8YA 3LIEA 2W3FA 1O07A 2KX6A 5KZHA 3VP0A 2JE5A 5AVEA 3IX3A 2O99A 3Q1FA 1NJ4A 3TRCA 1G6AA 1YKDA 4Y2FA 2R78A 5CERA 2VZWA 2W1TB 3S1YA 3UE0A 1IYSA 2V9AA 3C2WA 4DMZA 2EA9A 3L7HA 2J9OA 4MBFA 4BWIA 1MKIA 4GDNA 3T4TA 1KE4A 4HNBA 3R7WB 3ISGA 1ERMA 3DWZA 3C5AA 1EWZA 1RGZA 1JWVA 3UE6A 4DXBA 4XT2B 3ULFA 2VGJA 4XUZA 1S6RA 3LICA 3C4PA 3NECA 1F98A 1GSXA 5KSHA 1ES5A 2Y2HA 3SOIA 3MF0A 1K57A 2VEAA 5G4ZA 4MN6A 4LENA 3G35A 3IWIA 3N6IA 3QHYA 3BLMA 3OZHA 4XXRA 4OLDA 3EGXC 3T4LA 4EERA 2ZQDA 3TSGA 4Z9QA 1H8ZA 2FZ0A 3V50A 1YLZA 3AGFA 1JWPA 3LGOA 1K4EA 5GLCA 5EM0A 5JYPA 1PW1A 3LIAA 2MJ6A 2L1MA 2W3HA 1K56D 2LB9A 1PWDA 4E3LA 1Y4OA 5AQ7A 3IF6A 5U47A 4JGRA 5FDHA 2C5WB 1L0FA 2PHYA 1VEUA 4DE0A 4LGWA 4ZDXA 5HL6A 4WF0A 5EE8A 3PTEA 4JKTA 3LUQA 2QJ7A 1TDGA 3WS4A 2HDQA 4DKIA 3LIDA 2W3EA 4BJPA 2RCXA 2D02A 4OLGA 1YLTA 4EETB 4QY6A 2XFTA 2EFUA 1IKGA 4G3KA 2XDMA 3BJNA 3KYZA 3A3IA 4CQHA 3VMAA 2OSUA 4NKPA 1T1BA 4OH0A 4KENB 1CI8A 3ZVWA 2OLUA 2V2FF 2P9VB 2VV6A 4GS9B 2HGVA 3IQAA 5G18A 4F3LB 1SZVA 3S4XA 1LSVA 4HBUA 1HTZA 4GW9A 3EQUA 3BFFA 5HX9A 1K56A 3BY8A 4MBKA 3IBRA 3IXDA 3BWLA 4S2NA 4II7A 1ESUA 4RX2A 5TFQA 2UV0E 1W63M 1RGYA 4WLAA 4X56A 2VGLM 3O88A 4U0TA 3S7NA 4MEZA 3T1SA 3BFCA 1K55A 4IJGA 2Y4AA 2W1RA 3RH8B 4I39A 2PYPA 2GJ3A 2ZJ9A 5EVIC 4X1LA 2IWBA 3EOIA 3EGDC 2DRWA 3GVBA 4NXGA 4JF6A 5FAOA 3MQQA 3IT9A 4QPRA 4U0XA 1X0OA 4FUWA 1ZHHB 2ZQ9A 2X71A 5EVIB 1ESIA 2A3UA 3BY9A 4GB7A 3PBQA 5HWWA 4DN0A 3OBFA 3HLWA 4E3NA 3NDGA 1WYBA 5M1AA 1BT5A 3WS2A 4P85A 1W79A 1CEGA 3RTYA 4IBXA 4EBLA 1MY8A 2WKEA 4X53A 5DFYA 1TS7A 3UDFA 5L10A 1YLPA 5M18A 3CPTA 3ZQ5A 3QP5A 4OP8A 2O9CA 2ZQAA 1G5UA 3DWKA 3O5YA 3EEAA 2Y2JA 4Q0HA 2OV5A 4P6BA 5EUAA 4E3OA 4ZBEA 3C30A 2XFSA 3T4KA 3VOZA 1ES3A 1T19A 4GKUA 2XR0A 1NXYA 3SS4A 4N9LA 1K54C 4ETXA 4NXFA 3BECA 3Q81A 1LHYA 1JVJA 2EX6A 2KLIA 4OVDA 5C5KA 1MWSA 5CHMA 2A49A 1MC0A 1FSWA 3M2JA 1ZG4A 4YNRA 4B4ZA 2ZQCA 1JNUA 3AGEA 5F83A 3PYPA 3TJZC 5J3WA 4HOIA 3K3DA 3OPLA 3ZNTA 3G2ZA 1L2SA 3A3JA 1CQAA 1E3UD 1TS8A 1GSWA 2B5RA 3BRMA 1XJ6A 4I5SA 4WMCD 1WYCA 3MQOA 2ZM8A 3KYEA 3H7WB 2E8JA 2WADA 4R3JA 3A3DA 2GX5A 4L9GA 4GHIA 1PRQA 3T4OA 3H9WA 5FI2A 3GV9A 1N9LA 4NEED 4H6JA 4ID4A 5DTTA 3F1NA 3GTCA 1YMXA 4UAAA 2ZL1A 4LFUA 4O8GA 4DF6A 4K0WA 4WYYA 3JVVA 4RQ9A 1S66L 3PBTA 3QP2A 3NULA 3MSHA 4EEUA 3E98A 3HUOA 5DJTA 2A24B 5EOEA 1TS0A 3EWKA 3NOUC 4EW7A 4PAUA 5HAQA 4HY8A 2GDNA 4WEJA 3MMHA 3NBLA 4KUOA 1ONGA 3UE3A 1V9ZA 2W1TA 3D72A 1KDSA 3N8SA 1CI9A 3IX4A 1N9NA 1T1AA 3FC7A 2ZM2A 5DF9A 2H5SA 4CLCC 1E3UA 4EUZA 2Y2PA 3LO7A 5J4EA 4WMCA 3R7WA 1W7FA 5FQ9A 2V1ZA 4WM9A 4NG2A 3GRJA 1I5QA 1ODVA 4XT2A 2O9BA 4KG2A 3SH8A 2JHEA 4EU0A 4CLCB 1H3QA 3SZTA 4I3JA 1YT4A 4R23A 2P08A 4FD8A 3G6OA 4R1GA 3LEZA 2OLVA 4PMAA 4S2KA 1VB6A 4NK3A 5GLAA 3VV4A 2Y2KA 3CI6A 4UA7A 5EOOA 1BLPA 1UWNX 3BEBA 1FSYA 2ZC6B 4R6LA 4UQIM 5CHUA 5CGWA 4E04A 3P7NA 4BBTA 4JGPA 3P09A 2XQZA 1IFQA 5MC7A 4KUKA 3LYXA 3BYDA 2PYRA 4S2OA 3BW6A 1VQQA 4X55A 4BQMA 3WS1A 3QNCA 4NXBA 3VSKA 5FL3A 3PAGA 2X02A 2EX9A 4DDYA 1MPLA 4KZ3A 3N8RA 3BFDA 2WKHA 4NXEA 3TOIA 2B18A 4S2LA 5AQAA 1LSXA 3ZG7B 4EBNA 4M3KA 1YLYA 4P87A 4LCMA 2Y2LA 5FEGA 1FCOA 4WZ5C 4JF5A 4CPKA 3IHBA 4QB8A 4JXVA 3IWQA 3UB8A 3MR0A 1Q2PA 5G4YA 5EVID 3UO9A 2WUQA 4Y7PA 5L8MA 4KZ4A 2EXBA 1K6RA 1L3LA 1PZPA 2YKFA 4LV2A 5TR7A 3NCKA 1IYPA 4WZ4A 3MS6A 5JYOA 4I3AA 3MQ0A 1GSVA 4LRZE 5E43A 5FI6A 4BL3A 1BULA 2P9VA 4GS9A 3HUNA 3FYZA 2H10A 2Z6DA 5HZHA 4F3LA 4E6WA 4H6JB 3OPRA 4LPZA 3UDIA 1BLCA 1KGFA 2Y79A 2WK0A 1A0KA 5KMWA 4OOLA 4L0LA 3DW0A 3WS5A 1SKFA 3OCNA 3QNBA 2GZAA 2ZMVA 1W8QA 3NIAA 2G2WA 1N9BA 5AQBA 1K38A 1I2SA 3JYIA 4YFMA 2V1BA 2ZC5B 3A0RA 3ZG8B 1ACFA 1FILA 3B47A 4I3IA 3BFGA 1K0KA 1NRJA 2Y2OA 1OT9A 3F1OB 3IH9A 2P74A 1VHMA 5DTSA 4LRXC 1SDEA 1BZAA 3PBRA 2Y2QA 3ZFZA 3ZGAB 5EVIA 4WL9A 3PAEA 3IF5A 1NWZA 4R4RA 2QZ6A 2WZXA 3HREA 4HBTA 2XRNA 4G3VA 3MZEA 3HJIA 4PKYA 4GN2A 5L07A 2R9WA 3WS0A 4LLOB 4UA9A 3K2NA 2R9XA 2XA7M 2HZ5A 1YM1A 2Z6CA 3PBSA 3VP2A 4M4XA 4RYEA 5HDCA 3SW1A 2RL3A 2UWXA 3C38A 1QMFA 4GDBA 5FQKA 5F1FA 5K5BA 3LI8A 1DP9A 5GHZA 3VFFA 1ZTUA 1GA0A 3FKWA 2H0TA 4FTXA 4RVAA 4S2IA 3CMZA 3V67A 1K54A 4P6ZS 2VV7A 3VOLA 5LBRA 2PT7A 4X69A 3G30A 4MCWA 4GLQA 4BD0A 2EFXA 1TDLA 4B4XA 4OOYA 2J7VA 4FCFA 3LIBA 2AVXA 4IHQA 1BSGA 4EXOA 4LV3A 3Q7VB 3VE4A 3H7WA 4OPRA 3HLFA 2D01A 3MZFA 5I5LA 3T12B 4CLCD 2ZMFA 2BG1A 1U60A 4Y13A 3O3VA 1IYOA 2XSSA 1TS6A 3SS5A 2V0WA 1OMEA 4HJ3A 2WKIA 3RXWA 4E3JA 5HPFA 5EVEA 1EW0A 2M1CA 2KOIA 3OLOA 1S4SA 2PU4A 3ZG5A 1ES4A 4R0QA 4ZJ1A 3D4FA 2ZQ7A 2ZC7A 3UE1A 1IOUA 2A24A 1GHIA 4OPZA 1GHPA 3HJKA 1MKMA 4DXCA 5AJGA 1Y54A 1J3WA 1W5DA 3RJUA 2P7JA 3H82B 5KIZA 2XROA 1HD8A 4JF4A 3UPOA 3UPPA 2HDUA 3BQ8A 3HBRA 3FV7A 4BBVA 2I9VA 3VP1A 1WA9A 3LEQA 1T18A 2JC7A 2JBFA 2XGNA 4JLFA 4CLCA 2JN7A 2JKTI 1MBLA 2CMNA 1FQGA 2BTFP 2FFFB 3UN7A 2Q0OA 4ESPA 5CTNA 1FR6A 1F2KA 3PHYA 1N4OA 1L0GA 1P9RA 3HLEA 2GNXA 5HW3A 1YLWA 2Y2GA 3ZNYA 1NZOA 4Y0UA 1K57C 1ES2A 5DF8A 4DDSA 4MNRA 3BLSA 5CRFA 1KGEA 3SH9A 2QHKA 4HP9A 4OPQA 4HIAA 4GZBA 1CF0A 3A0SA 5CGXA 3T4SA 3WRTA 4X6TA 3UB6A 3GECA 4O7DA 4Y3IA 1P97A 2Z2MB 4GOGA 1DRMA 1YAXA 5L2FA 1XJ2A 3C4OA 1PW8A 2J8YA 2Y2MA 1K4FA 3HL9A 5GLDA 1KE0A 3P01A 3UNWA 5AQ9A 5EVLA 1OTDA 3M6BA 3W8KA 3DTMA 4QWOA 2WGWB 3IS2B 1PI5A 3PR6A 4D60A 1MWTA 4IEDA 3UPNA 1PIOA 4WZ5A 2L4RA 4B88A 3VSLA 4IVIA 5KSCA 3FPWA 1SDNA 2EX8A 4A5RA 3MZDA 2HP9A 4B93A 3EEHA 1S67L 4R70A 3UMEA 4DE1A 4BBUA 4IBRA 3MFXA 4KZ7A 5E2HA 3E4PA 4R4SA 4KZ8A 2HDRA 4ZAMA 2KDKA 4HH3A 2Y91A 4N92A 3LR5A 5EECA 4JBFA 1D7EA 4KG5A 5DKKA 5DJUA 2X01A 4N9KA 1G6OA 5AVFA 4HJ4A 1AXBA 4OONA 3A3FA 3C7VA 1GA9A 3F1OA 4C6YA 2HJ9C 3SH7A 1XP4A 5IS1A 1PYYA 3KSHA 2PDRA 1OTBA 5DFXA 5HWTA 4LCLA 4K91A 5TBMB 1IELA 2IA2A 5DF7A 3CG5A 4MMNA 3ZYTA 4PHTA 1XXMA 3V3SA 2OOLA 3IXBA 3QP4A 2E8IA 2PRFA 2HP6A 2PR5A 5FI7A 2VGLS 3UB9A 2HP5A 1JTGA 1PWGA 5HAPA 2VA0A 5HL1A 4O0PA 3HLGA 3MFDA 3IWOA 3O86A 1TF1A 3BM6A 1HVBA 3CHWP 3KX0X 5L09A 3HLCA 2O0YA 2P04A 4WELA 5A90A 3DAVA 1Z6FA 2JKRI 4E6XA 3GQZA 3ZG9B 4ETZA 1J9MA 4WN5A 5DTKA 5IT5A 1BLHA 1BTLA 2Q9NA 1RCJA 2C6WB 4Y0TA 3V5MA 4IUKA 4P0MA 1LT0A 3VP3A 4HQAA 4R3BA 3FZCA 2Z2LB 4UA6A 4MLLA 5CGSA 2VLGA 1BLSA 1WE4A 5CTMA 2BASA 1CJFA 3T1XA 4WBGA 2G7UA 1MWRA 2JKGA 4UEYA 2BLSA 3IX8A 1P9WA 5GHYA 1QMEA 5GL9A 3FKVA 3G34A 4OQGA 1ERQA 4E3MA 5A92A 3Q7VA 4GNUA 4DE2A 1DP6A 3I7JA 1FCMA 2Q9MA 3PXPA 3FWLA 5EV0A 4HH2A 1KOUA 2K2NA 5TGFA 5F82A 3W4OA 1GHMA 2B95A 4CLCE 2ZBBA 2WYXA 1OTAA 5FDSA 2WKRA 1G68A 4KZ6A 4LV1A 4QD4A 4Z1WA 4OKPA 2J3WA 1MXOA 1LSWA 2DMWA 1TVFA 2WGIA 3Q7ZA 3R4KA 1FOFA 4BMWA 1VETA 4HJ6A 3NY4A 4B9OA 3KO6A 3KSFA 1SHVA 3ITBA 3NOPC 2V8CA 1TD5A 5HDSA 4OOMA 4BD1A 2XK1A 2XEPA 4YOFA 5EPHA 2FFYA 3H82A 3LR0A 4G3WA 2Y59A 4QJGA 1YMSA 2ZD8A 1T1CA 4EESA 2HJEA 2ZM0A 3IXHA 3CAXA 1BYWA 1DP8A 2G2UA 5FAPA 5FATA 5HAIA 1SCWA 2QMIA 1W63Q 4QU3A 1L0EA 4JXSA 1S4RA 2VGKA 4CJNA 3E4OA 2PD8A 1NLYA 1PFLA 2J9PA 2QPNA 2QJ5A 3LR4A 4JPMA 4MN7A 1XA7A 1YPRA 5I94A 1NLZA 3LY4A 1NYMA 4JXGA 2V20A 3IXGA 2VX8A 1FIKA 4KZ9A 5F6AA 3JVUA 2Y2NA 1KE3A 3DBAA 1KVMA 1VM1A 1ZC2A 1PWCA 5CEBA 2V0UA 4EEPA 2H0YA 2WAFA 2V1AA 3G32A 3IBJA 4DE3A 3HVFA 3HUMA 4HEFA 4DRTA 2PR6A 3U4LP 4JXWA 1ONHA 4PKYG 1EI5A 4D2OA 3JPUA 4LV0A 4S2MA 3ITAA 5IHVA 3KYQA 1XFQA 3AGDA 5HWVA 1FR1A 3OCLA 1RP5A 3FG8A 1SKOB 5GLBA 4GCZA 4UQIS 4HESA 5F5YA 2J80A 5HDDA 2WGWA 5EM1A 4XUXA 3IS2A 5J8XA 2PBDP 5D3OA 3T50A 3N4IA 3U2AA 2VKSA 3N8LA 3F1PB 3G31A 2PU2A 3S7QA 2M7VA 4K08A 3B3XA 1IKIA 3T1RA 1KVLA 3CZDA 1NRFA 2OAP1 3OPHA 5FQQA 3DTKA 2W27A 4KQRA 1LL8A 3SS3A 1LLBA 4ARZA 1PZOA 4EWFA 3UDXA 3EQVA 2NUTC 3C7UA
chains in the Genus database with same CATH topology
1L0DA 2JE5A 4S2KA 4NK3A 5GLAA 2Y2KA 3UNWA 5AQ9A 4UA7A 5EVLA 3M6BA 5EOOA 4FH4A 3Q1FA 3W8KA 1BLPA 1NJ4A 3DTMA 2WGWB 3BEBA 1G6AA 1YQSA 1FSYA 2JCHA 2ZC6B 5CHUA 5CGWA 5CERA 4BL2A 3S1YA 3GSGA 3P09A 2XQZA 3VP4A 1PI5A 3UE0A 1MWTA 2DCFA 4IEDA 3UPNA 3LCEA 1PIOA 1IYSA 3G4PA 4WZ5A 3BYDA 3GMWA 2J9OA 4MBFA 4B88A 1MKIA 4GDNA 3VSLA 4S2OA 1KE4A 4IVIA 1VQQA 4K0XA 5KSCA 1SDNA 2EX8A 4X55A 2WGVA 4BQMA 3WS1A 3QNCA 3MZDA 4A5RA 2HP9A 3ISGA 1ERMA 3DWZA 3C5AA 1EWZA 1RGZA 3VSKA 3HLDA 5A93A 1JWVA 3PAGA 2X02A 3M2KA 4DXBA 4BLMA 4DE1A 2EX9A 4IBRA 2VGJA 4KZ7A 4DDYA 5E2HA 1MPLA 4XUZA 1S6RA 4KZ3A 3N8RA 4OQ0A 4R4SA 2WZZA 3BFDA 2WKHA 3C4PA 3S22A 4KZ8A 3P98A 2HDRA 3TOIA 5KSHA 2ZC4B 1ES5A 2Y2HA 4ZAMA 3SOIA 4S2LA 5AQAA 1K57A 4GD6A 3ZG7B 2Y91A 4N92A 4EBNA 4LENA 3G35A 3IWIA 4M3KA 4N1HA 3ZHHA 3N6IA 1YLYA 4P87A 4LCMA 5EECA 1CEFA 2Y2LA 3QHYA 3BLMA 5CHJA 1FCOA 4WZ5C 4JBFA 4JF5A 5F1GA 4CPKA 3IHBA 4QB8A 4JXVA 4KG5A 3IWQA 3OZHA 4XXRA 4OLDA 2X01A 4N9KA 5E2FA 2ZMAA 1Q2PA 3MKFA 5EVID 1AXBA 3UO9A 2ZQDA 2WUQA 4OONA 4Y7PA 4Z9QA 1H8ZA 3TSGA 3A3FA 3C7VA 3V50A 4KZ4A 2EXBA 1GA9A 1YLZA 1K6RA 4C6YA 3AGFA 1JWPA 1K4EA 5GLCA 3SH7A 5JYPA 1PW1A 1PZPA 1XP4A 4LV2A 5TR7A 1PYYA 3NCKA 5FAQA 1IYPA 1K56D 4WZ4A 5FA7A 1PWDA 4E3LA 5JYOA 5AQ7A 3IF6A 5U47A 3W4PA 5FDHA 1XX2A 4LCLA 2C5WB 1L0FA 4K91A 3VFHA 5E43A 5FI6A 1IELA 1BULA 4BL3A 2P9VA 4DE0A 3HUNA 4FH2A 1ALQA 4ZDXA 1NZUA 2H10A 3FYZA 5DF7A 3CG5A 4E6WA 3MXRA 3OPRA 4ZJ3A 5EE8A 2Y2IA 3PTEA 4JKTA 3UDIA 1XXMA 2WAEA 1BLCA 1KGFA 3V3SA 3IXBA 2WK0A 2E8IA 4KZBA 1TDGA 4OOLA 5KMWA 1GCEA 3WS4A 2HDQA 4L0LA 3DW0A 2HP6A 3WS5A 1SKFA 4DKIA 5FI7A 3MKEA 3OCNA 3QNBA 4BJPA 2RCXA 1W8QA 3NIAA 2G2WA 4QY5A 2HP5A 1N9BA 5AQBA 4OLGA 1JTGA 1K38A 1PWGA 3E2LA 5CECA 1I2SA 3JYIA 4YFMA 5HAPA 1YLTA 5HL1A 2ZC5B 3W4QA 1LI0A 3MXSA 3HLGA 4QY6A 3ZG8B 3MFDA 3IWOA 3O86A 3BM6A 1HVBA 1BUEA 3BFGA 3IF6C 2XFTA 5HFOA 3HLCA 4BENA 2EFUA 2Y2OA 3VOYA 1IKGA 1NY0A 4PM7A 4WELA 5A90A 3IH9A 2XDMA 1TEMA 2P74A 3A3IA 3VMAA 2PBYA 3ZDJA 1Z6FA 5DTSA 2OSUA 4E6XA 3V3RA 1SDEA 3GQZA 3ZG9B 4OH0A 1IEMA 1BZAA 3PBRA 3IF6B 4KENB 1JWZA 1CI8A 1J9MA 1FCNA 5DTKA 4PM8A 4FSFA 2Y2QA 3ZVWA 2CC1A 3ZFZA 4KZAA 2OLUA 1BLHA 1DJAA 4S2JA 3ZGAB 1BTLA 2Q9NA 1RCJA 2V2FF 5EVIA 2C6WB 2P9VB 4E3IA 4Y0TA 5FQIA 3V5MA 3IQAA 5G18A 4P0MA 3S4XA 3PAEA 3IF5A 4HBUA 3VP3A 1HTZA 4R4RA 3EQUA 1JTDA 3BFFA 4X68A 1K56A 2QZ6A 4R3BA 5HX9A 3FZCA 2Z2LB 1KDWA 4UA6A 4MLLA 2WZXA 3HREA 4MBKA 5CGSA 4HBTA 3MBZA 4WEKA 1BLSA 1WE4A 3MZEA 3IXDA 4PM6A 4S2NA 5CTMA 1ESUA 4RX2A 5TFQA 4X56A 1RGYA 3IHAA 4GN2A 5CXWA 1O7EA 4QHCA 4EV4A 2R9WA 3WS0A 3O88A 3OPPA 4UA9A 4U0TA 2DNSA 4MEZA 3BFCA 4WBGA 2R9XA 1C3BA 1K55A 2Y4AA 1MWRA 1YM1A 4S2PA 3PBSA 2BLSA 3VP2A 4RYEA 2ZJ9A 5EVIC 2RL3A 2IWDA 2UWXA 1XGJA 3N7WA 5GHYA 1QMEA 5GL9A 1QMFA 2IWBA 3FKVA 4Q8IA 3G34A 4GDBA 5FASA 5HARA 5M19A 2DRWA 3GVBA 4OQGA 5FQKA 4JF6A 1ERQA 4E3MA 5F1FA 2HDSA 5FAOA 5FQJA 3Q7VA 4GNUA 5A92A 3IT9A 4DE2A 4U0XA 5GHZA 3I7JA 1FCMA 2Q9MA 2X71A 2ZQ9A 5EVIB 3VFFA 1ESIA 2A3UA 1MWUA 3FWLA 4GB7A 3PBQA 3HLWA 4S2NC 4E3NA 1H5XA 5F82A 5TGFA 3W4OA 3NDGA 1GHMA 1GA0A 2ZLYA 1WYBA 2WYXA 3FKWA 2H0TA 2XH9A 2XD5A 5M1AA 3PBNA 1BT5A 1G68A 4PM9A 4KZ6A 4LV1A 1CK3A 4QD4A 3WS2A 1EROA 1K55C 4OKPA 4P85A 5BOHA 4RVAA 4KQQA 2HPBA 2I72A 4S2IA 3CMZA 1W79A 1CEGA 1MXOA 3TG9A 1K54A 1I2WA 4IBXA 1TVFA 1ZKJA 2WGIA 2ZC3B 3Q7ZA 4OP5A 5E2GA 4EBLA 3ZG0A 1M40A 1MY8A 1FOFA 4X69A 1NYYA 2WKEA 3G30A 4X53A 4EBPA 3NY4A 4KG6A 3UDFA 4BD0A 1YLPA 2EFXA 1TDLA 4B4XA 5M18A 1H8YA 4RX3A 4OOYA 1DJCA 2J7VA 4FCFA 1SHVA 3ITBA 4MBHA 4OP8A 3PBOA 3E2KA 2ZQAA 4U3TA 3DWKA 4OOMA 1BSGA 4BD1A 4OQIA 2Y2JA 4LV3A 2OV5A 2XK1A 3Q7VB 2XEPA 4P6BA 5EUAA 4ZBEA 3C7UA 4E3OA 4OPRA 5EPHA 2FFYA 2XFSA 2XD1A 3HLFA 3UY6A 3VOZA 1ES3A 1K6SA 1K25A 2Y59A 4GKUA 3MZFA 3O87A 4QJGA 1YMSA 4KZ5A 2ZD8A 2XR0A 1NXYA 3SS4A 4N9LA 1K54C 1E25A 2ZM0A 3OC2A 5DVAA 3IXHA 3BECA 2BG1A 3Q81A 1LHYA 1U60A 1E4DA 3O3VA 1IYOA 1JVJA 2G2UA 2EX6A 3BFEA 5FAPA 4OVDA 3SS5A 1MWSA 4E3KA 5CHMA 5FATA 5HAIA 2A49A 4RA7A 1OMEA 1ZG6A 2WKIA 3RXWA 4E3JA 1SCWA 1FSWA 2QMIA 3Q82A 4QU3A 1L0EA 2PU4A 3M2JA 1ES4A 4JXSA 4R0QA 4ZJ2A 2VGKA 3ZG5A 3Q07A 4ZJ1A 4OPYA 3D4FA 3IH8A 4CJNA 1ZG4A 3ZVTA 1LL9A 3WWXA 2ZQ7A 2ZC7A 4B4ZA 2J9PA 2QPNA 3UE1A 2ZQCA 3AGEA 5F83A 1IYQA 4PPRA 4JPMA 5E2EA 1XA7A 1GHIA 4Y0OA 4OPZA 1GHPA 3LY4A 5I94A 1NYMA 4JXGA 3OPLA 3ZNTA 3G2ZA 1L2SA 2V20A 3A3JA 1E3UD 2B5RA 4DXCA 3IXGA 1Y54A 3BRMA 4WMCD 1S0WA 1WYCA 2ZM8A 1W5DA 4KQOA 3RJUA 4NETA 4KZ9A 2EXAA 3VP0A 5FSRA 2WADA 2Y2NA 1KE3A 4IVKA 4R3JA 3A3DA 1KVMA 1HD8A 4JF4A 1VM1A 1ZC2A 1PWCA 5CEBA 2H0YA 5FI2A 2WAFA 4PM5A 3UPOA 3GV9A 3UPPA 4ID4A 3G32A 5DTTA 2HDUA 5FQMA 3V39A 3GTCA 4DE3A 3HVFA 1YMXA 3HUMA 3HBRA 3FV7A 4HEFA 4UAAA 1PI4A 3HLBA 4DRTA 4DF6A 4K0WA 4WYYA 3RXXA 1LL5A 3VP1A 4N1XA 1XKZA 3LY3A 2JC7A 5A91A 2JBFA 4JXWA 2XGNA 4JLFA 5GHXA 1MBLA 1ONHA 1HZOA 3G2YA 1EI5A 4D2OA 3PBTA 4LV0A 5CEDA 4S2MA 3ITAA 4UHUA 5IHVA 2XLNA 1FQGA 1KGGA 2Y55A 3AGDA 2FFFB 4H8RA 3UN7A 4EQIA 3HUOA 1FR1A 5EOEA 3OCLA 1RP5A 5CTNA 1FR6A 5GLBA 1LI9A 2IWCA 5HAQA 4HESA 1N4OA 2GDNA 4WEJA 3NBLA 1L0GA 3CJMA 3HLEA 5HW3A 4YINA 1YLWA 2EX2A 2WGWA 2Y2GA 1ONGA 4XUXA 3UE3A 3ZNYA 3NDEA 5J8XA 1NZOA 4Y0UA 5D3OA 1K57C 1ES2A 3N4IA 3WRZA 2ZQ8A 1KDSA 3N8LA 3NC8A 3GR2A 3N8SA 1CI9A 5DF8A 1M6KA 3G31A 4DDSA 4MNRA 1XGIA 1XPBA 3BLSA 2PU2A 2ZM2A 5CRFA 5DF9A 2H5SA 1KGEA 3SH9A 1XA1A 1E3UA 4OQHA 4EUZA 2Y2PA 3LO7A 4OPQA 4WMCA 4GZBA 1DY6A 3B3XA 4ZTKA 2XF3A 3A3EA 1W7FA 1IKIA 5CGXA 5FQ9A 2V1ZA 4WM9A 3WRTA 1KVLA 4X6TA 3ZCZA 3GRJA 1I5QA 1YLJA 4O7DA 3CZDA 3NI9A 1NRFA 4KG2A 4F94A 2Z2MB 4C3QA 4GOGA 1Q2QA 3OPHA 5FQQA 3SH8A 4C75A 4GD8A 4KQRA 3M6HA 5L2FA 3C4OA 1DJBA 1PW8A 1YT4A 4R23A 1W8YA 1LLBA 3SS3A 4FD8A 1O07A 2J8YA 1PZOA 4EWFA 2Y2MA 1K4FA 3UDXA 5KZHA 4R1GA 3HL9A 2OLVA 3LEZA 4PMAA 3EQVA 5GLDA 1KE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0D A;  2JE5 A;  4S2K A;  4NK3 A;  5GLA A;  2Y2K A;  3UNW A;  5AQ9 A;  4UA7 A;  5EVL A;  3M6B A;  5EOO A;  4FH4 A;  3Q1F A;  3W8K A;  1BLP A;  1NJ4 A;  3DTM A;  2WGW B;  3BEB A;  1G6A A;  1YQS A;  1FSY A;  2JCH A;  2ZC6 B;  5CHU A;  5CGW A;  5CER A;  4BL2 A;  3S1Y A;  3GSG A;  3P09 A;  2XQZ A;  3VP4 A;  1PI5 A;  3UE0 A;  1MWT A;  2DCF A;  4IED A;  3UPN A;  3LCE A;  1PIO A;  1IYS A;  3G4P A;  4WZ5 A;  3BYD A;  3GMW A;  2J9O A;  4MBF A;  4B88 A;  1MKI A;  4GDN A;  3VSL A;  4S2O A;  1KE4 A;  4IVI A;  1VQQ A;  4K0X A;  5KSC A;  1SDN A;  2EX8 A;  4X55 A;  2WGV A;  4BQM A;  3WS1 A;  3QNC A;  3MZD A;  4A5R A;  2HP9 A;  3ISG A;  1ERM A;  3DWZ A;  3C5A A;  1EWZ A;  1RGZ A;  3VSK A;  3HLD A;  5A93 A;  1JWV A;  3PAG A;  2X02 A;  3M2K A;  4DXB A;  4BLM A;  4DE1 A;  2EX9 A;  4IBR A;  2VGJ A;  4KZ7 A;  4DDY A;  5E2H A;  1MPL A;  4XUZ A;  1S6R A;  4KZ3 A;  3N8R A;  4OQ0 A;  4R4S A;  2WZZ A;  3BFD A;  2WKH A;  3C4P A;  3S22 A;  4KZ8 A;  3P98 A;  2HDR A;  3TOI A;  5KSH A;  2ZC4 B;  1ES5 A;  2Y2H A;  4ZAM A;  3SOI A;  4S2L A;  5AQA A;  1K57 A;  4GD6 A;  3ZG7 B;  2Y91 A;  4N92 A;  4EBN A;  4LEN A;  3G35 A;  3IWI A;  4M3K A;  4N1H A;  3ZHH A;  3N6I A;  1YLY A;  4P87 A;  4LCM A;  5EEC A;  1CEF A;  2Y2L A;  3QHY A;  3BLM A;  5CHJ A;  1FCO A;  4WZ5 C;  4JBF A;  4JF5 A;  5F1G A;  4CPK A;  3IHB A;  4QB8 A;  4JXV A;  4KG5 A;  3IWQ A;  3OZH A;  4XXR A;  4OLD A;  2X01 A;  4N9K A;  5E2F A;  2ZMA A;  1Q2P A;  3MKF A;  5EVI D;  1AXB A;  3UO9 A;  2ZQD A;  2WUQ A;  4OON A;  4Y7P A;  4Z9Q A;  1H8Z A;  3TSG A;  3A3F A;  3C7V A;  3V50 A;  4KZ4 A;  2EXB A;  1GA9 A;  1YLZ A;  1K6R A;  4C6Y A;  3AGF A;  1JWP A;  1K4E A;  5GLC A;  3SH7 A;  5JYP A;  1PW1 A;  1PZP A;  1XP4 A;  4LV2 A;  5TR7 A;  1PYY A;  3NCK A;  5FAQ A;  1IYP A;  1K56 D;  4WZ4 A;  5FA7 A;  1PWD A;  4E3L A;  5JYO A;  5AQ7 A;  3IF6 A;  5U47 A;  3W4P A;  5FDH A;  1XX2 A;  4LCL A;  2C5W B;  1L0F A;  4K91 A;  3VFH A;  5E43 A;  5FI6 A;  1IEL A;  1BUL A;  4BL3 A;  2P9V A;  4DE0 A;  3HUN A;  4FH2 A;  1ALQ A;  4ZDX A;  1NZU A;  2H10 A;  3FYZ A;  5DF7 A;  3CG5 A;  4E6W A;  3MXR A;  3OPR A;  4ZJ3 A;  5EE8 A;  2Y2I A;  3PTE A;  4JKT A;  3UDI A;  1XXM A;  2WAE A;  1BLC A;  1KGF A;  3V3S A;  3IXB A;  2WK0 A;  2E8I A;  4KZB A;  1TDG A;  4OOL A;  5KMW A;  1GCE A;  3WS4 A;  2HDQ A;  4L0L A;  3DW0 A;  2HP6 A;  3WS5 A;  1SKF A;  4DKI A;  5FI7 A;  3MKE A;  3OCN A;  3QNB A;  4BJP A;  2RCX A;  1W8Q A;  3NIA A;  2G2W A;  4QY5 A;  2HP5 A;  1N9B A;  5AQB A;  4OLG A;  1JTG A;  1K38 A;  1PWG A;  3E2L A;  5CEC A;  1I2S A;  3JYI A;  4YFM A;  5HAP A;  1YLT A;  5HL1 A;  2ZC5 B;  3W4Q A;  1LI0 A;  3MXS A;  3HLG A;  4QY6 A;  3ZG8 B;  3MFD A;  3IWO A;  3O86 A;  3BM6 A;  1HVB A;  1BUE A;  3BFG A;  3IF6 C;  2XFT A;  5HFO A;  3HLC A;  4BEN A;  2EFU A;  2Y2O A;  3VOY A;  1IKG A;  1NY0 A;  4PM7 A;  4WEL A;  5A90 A;  3IH9 A;  2XDM A;  1TEM A;  2P74 A;  3A3I A;  3VMA A;  2PBY A;  3ZDJ A;  1Z6F A;  5DTS A;  2OSU A;  4E6X A;  3V3R A;  1SDE A;  3GQZ A;  3ZG9 B;  4OH0 A;  1IEM A;  1BZA A;  3PBR A;  3IF6 B;  4KEN B;  1JWZ A;  1CI8 A;  1J9M A;  1FCN A;  5DTK A;  4PM8 A;  4FSF A;  2Y2Q A;  3ZVW A;  2CC1 A;  3ZFZ A;  4KZA A;  2OLU A;  1BLH A;  1DJA A;  4S2J A;  3ZGA B;  1BTL A;  2Q9N A;  1RCJ A;  2V2F F;  5EVI A;  2C6W B;  2P9V B;  4E3I A;  4Y0T A;  5FQI A;  3V5M A;  3IQA A;  5G18 A;  4P0M A;  3S4X A;  3PAE A;  3IF5 A;  4HBU A;  3VP3 A;  1HTZ A;  4R4R A;  3EQU A;  1JTD A;  3BFF A;  4X68 A;  1K56 A;  2QZ6 A;  4R3B A;  5HX9 A;  3FZC A;  2Z2L B;  1KDW A;  4UA6 A;  4MLL A;  2WZX A;  3HRE A;  4MBK A;  5CGS A;  4HBT A;  3MBZ A;  4WEK A;  1BLS A;  1WE4 A;  3MZE A;  3IXD A;  4PM6 A;  4S2N A;  5CTM A;  1ESU A;  4RX2 A;  5TFQ A;  4X56 A;  1RGY A;  3IHA A;  4GN2 A;  5CXW A;  1O7E A;  4QHC A;  4EV4 A;  2R9W A;  3WS0 A;  3O88 A;  3OPP A;  4UA9 A;  4U0T A;  2DNS A;  4MEZ A;  3BFC A;  4WBG A;  2R9X A;  1C3B A;  1K55 A;  2Y4A A;  1MWR A;  1YM1 A;  4S2P A;  3PBS A;  2BLS A;  3VP2 A;  4RYE A;  2ZJ9 A;  5EVI C;  2RL3 A;  2IWD A;  2UWX A;  1XGJ A;  3N7W A;  5GHY A;  1QME A;  5GL9 A;  1QMF A;  2IWB A;  3FKV A;  4Q8I A;  3G34 A;  4GDB A;  5FAS A;  5HAR A;  5M19 A;  2DRW A;  3GVB A;  4OQG A;  5FQK A;  4JF6 A;  1ERQ A;  4E3M A;  5F1F A;  2HDS A;  5FAO A;  5FQJ A;  3Q7V A;  4GNU A;  5A92 A;  3IT9 A;  4DE2 A;  4U0X A;  5GHZ A;  3I7J A;  1FCM A;  2Q9M A;  2X71 A;  2ZQ9 A;  5EVI B;  3VFF A;  1ESI A;  2A3U A;  1MWU A;  3FWL A;  4GB7 A;  3PBQ A;  3HLW A;  4S2N C;  4E3N A;  1H5X A;  5F82 A;  5TGF A;  3W4O A;  3NDG A;  1GHM A;  1GA0 A;  2ZLY A;  1WYB A;  2WYX A;  3FKW A;  2H0T A;  2XH9 A;  2XD5 A;  5M1A A;  3PBN A;  1BT5 A;  1G68 A;  4PM9 A;  4KZ6 A;  4LV1 A;  1CK3 A;  4QD4 A;  3WS2 A;  1ERO A;  1K55 C;  4OKP A;  4P85 A;  5BOH A;  4RVA A;  4KQQ A;  2HPB A;  2I72 A;  4S2I A;  3CMZ A;  1W79 A;  1CEG A;  1MXO A;  3TG9 A;  1K54 A;  1I2W A;  4IBX A;  1TVF A;  1ZKJ A;  2WGI A;  2ZC3 B;  3Q7Z A;  4OP5 A;  5E2G A;  4EBL A;  3ZG0 A;  1M40 A;  1MY8 A;  1FOF A;  4X69 A;  1NYY A;  2WKE A;  3G30 A;  4X53 A;  4EBP A;  3NY4 A;  4KG6 A;  3UDF A;  4BD0 A;  1YLP A;  2EFX A;  1TDL A;  4B4X A;  5M18 A;  1H8Y A;  4RX3 A;  4OOY A;  1DJC A;  2J7V A;  4FCF A;  1SHV A;  3ITB A;  4MBH A;  4OP8 A;  3PBO A;  3E2K A;  2ZQA A;  4U3T A;  3DWK A;  4OOM A;  1BSG A;  4BD1 A;  4OQI A;  2Y2J A;  4LV3 A;  2OV5 A;  2XK1 A;  3Q7V B;  2XEP A;  4P6B A;  5EUA A;  4ZBE A;  3C7U A;  4E3O A;  4OPR A;  5EPH A;  2FFY A;  2XFS A;  2XD1 A;  3HLF A;  3UY6 A;  3VOZ A;  1ES3 A;  1K6S A;  1K25 A;  2Y59 A;  4GKU A;  3MZF A;  3O87 A;  4QJG A;  1YMS A;  4KZ5 A;  2ZD8 A;  2XR0 A;  1NXY A;  3SS4 A;  4N9L A;  1K54 C;  1E25 A;  2ZM0 A;  3OC2 A;  5DVA A;  3IXH A;  3BEC A;  2BG1 A;  3Q81 A;  1LHY A;  1U60 A;  1E4D A;  3O3V A;  1IYO A;  1JVJ A;  2G2U A;  2EX6 A;  3BFE A;  5FAP A;  4OVD A;  3SS5 A;  1MWS A;  4E3K A;  5CHM A;  5FAT A;  5HAI A;  2A49 A;  4RA7 A;  1OME A;  1ZG6 A;  2WKI A;  3RXW A;  4E3J A;  1SCW A;  1FSW A;  2QMI A;  3Q82 A;  4QU3 A;  1L0E A;  2PU4 A;  3M2J A;  1ES4 A;  4JXS A;  4R0Q A;  4ZJ2 A;  2VGK A;  3ZG5 A;  3Q07 A;  4ZJ1 A;  4OPY A;  3D4F A;  3IH8 A;  4CJN A;  1ZG4 A;  3ZVT A;  1LL9 A;  3WWX A;  2ZQ7 A;  2ZC7 A;  4B4Z A;  2J9P A;  2QPN A;  3UE1 A;  2ZQC A;  3AGE A;  5F83 A;  1IYQ A;  4PPR A;  4JPM A;  5E2E A;  1XA7 A;  1GHI A;  4Y0O A;  4OPZ A;  1GHP A;  3LY4 A;  5I94 A;  1NYM A;  4JXG A;  3OPL A;  3ZNT A;  3G2Z A;  1L2S A;  2V20 A;  3A3J A;  1E3U D;  2B5R A;  4DXC A;  3IXG A;  1Y54 A;  3BRM A;  4WMC D;  1S0W A;  1WYC A;  2ZM8 A;  1W5D A;  4KQO A;  3RJU A;  4NET A;  4KZ9 A;  2EXA A;  3VP0 A;  5FSR A;  2WAD A;  2Y2N A;  1KE3 A;  4IVK A;  4R3J A;  3A3D A;  1KVM A;  1HD8 A;  4JF4 A;  1VM1 A;  1ZC2 A;  1PWC A;  5CEB A;  2H0Y A;  5FI2 A;  2WAF A;  4PM5 A;  3UPO A;  3GV9 A;  3UPP A;  4ID4 A;  3G32 A;  5DTT A;  2HDU A;  5FQM A;  3V39 A;  3GTC A;  4DE3 A;  3HVF A;  1YMX A;  3HUM A;  3HBR A;  3FV7 A;  4HEF A;  4UAA A;  1PI4 A;  3HLB A;  4DRT A;  4DF6 A;  4K0W A;  4WYY A;  3RXX A;  1LL5 A;  3VP1 A;  4N1X A;  1XKZ A;  3LY3 A;  2JC7 A;  5A91 A;  2JBF A;  4JXW A;  2XGN A;  4JLF A;  5GHX A;  1MBL A;  1ONH A;  1HZO A;  3G2Y A;  1EI5 A;  4D2O A;  3PBT A;  4LV0 A;  5CED A;  4S2M A;  3ITA A;  4UHU A;  5IHV A;  2XLN A;  1FQG A;  1KGG A;  2Y55 A;  3AGD A;  2FFF B;  4H8R A;  3UN7 A;  4EQI A;  3HUO A;  1FR1 A;  5EOE A;  3OCL A;  1RP5 A;  5CTN A;  1FR6 A;  5GLB A;  1LI9 A;  2IWC A;  5HAQ A;  4HES A;  1N4O A;  2GDN A;  4WEJ A;  3NBL A;  1L0G A;  3CJM A;  3HLE A;  5HW3 A;  4YIN A;  1YLW A;  2EX2 A;  2WGW A;  2Y2G A;  1ONG A;  4XUX A;  3UE3 A;  3ZNY A;  3NDE A;  5J8X A;  1NZO A;  4Y0U A;  5D3O A;  1K57 C;  1ES2 A;  3N4I A;  3WRZ A;  2ZQ8 A;  1KDS A;  3N8L A;  3NC8 A;  3GR2 A;  3N8S A;  1CI9 A;  5DF8 A;  1M6K A;  3G31 A;  4DDS A;  4MNR A;  1XGI A;  1XPB A;  3BLS A;  2PU2 A;  2ZM2 A;  5CRF A;  5DF9 A;  2H5S A;  1KGE A;  3SH9 A;  1XA1 A;  1E3U A;  4OQH A;  4EUZ A;  2Y2P A;  3LO7 A;  4OPQ A;  4WMC A;  4GZB A;  1DY6 A;  3B3X A;  4ZTK A;  2XF3 A;  3A3E A;  1W7F A;  1IKI A;  5CGX A;  5FQ9 A;  2V1Z A;  4WM9 A;  3WRT A;  1KVL A;  4X6T A;  3ZCZ A;  3GRJ A;  1I5Q A;  1YLJ A;  4O7D A;  3CZD A;  3NI9 A;  1NRF A;  4KG2 A;  4F94 A;  2Z2M B;  4C3Q A;  4GOG A;  1Q2Q A;  3OPH A;  5FQQ A;  3SH8 A;  4C75 A;  4GD8 A;  4KQR A;  3M6H A;  5L2F A;  3C4O A;  1DJB A;  1PW8 A;  1YT4 A;  4R23 A;  1W8Y A;  1LLB A;  3SS3 A;  4FD8 A;  1O07 A;  2J8Y A;  1PZO A;  4EWF A;  2Y2M A;  1K4F A;  3UDX A;  5KZH A;  4R1G A;  3HL9 A;  2OLV A;  3LEZ A;  4PMA A;  3EQV A;  5GLD A;  1KE0 A; 
#chains in the Genus database with same CATH topology
 1L0D A;  3TE8 A;  3L9K A;  2OAQ 1;  1VET B;  4FH4 A;  1N9O A;  1XFN A;  1YQS A;  2JCH A;  4DJ3 A;  4R38 A;  2PD7 A;  2NUP C;  3KSI A;  4BL2 A;  1YSQ A;  3GSG A;  2YKH A;  2QKP A;  3D3O A;  3VP4 A;  2DCF A;  3CUE C;  3LCE A;  3G4P A;  2EWV A;  1AWI A;  3GMW A;  4K0X A;  3W2Z A;  2WGV A;  5F69 A;  4L9E A;  3HLD A;  5A93 A;  4Y5F A;  3M2K A;  4BLM A;  5TBM A;  2H28 A;  4OQ0 A;  2WZZ A;  3S22 A;  1OTE A;  3LR3 A;  3P98 A;  2ZC4 B;  2INW A;  4HHD A;  1P0Z A;  4GD6 A;  2VK3 A;  3ZHH A;  4N1H A;  4FOF A;  2OWJ A;  1CEF A;  5HSQ A;  5CHJ A;  5F1G A;  4DJ2 A;  3UB7 A;  2W3D A;  5E2F A;  2ZMA A;  3MKF A;  1OT6 A;  4MDZ A;  3S7O A;  5FAQ A;  5FA7 A;  3W4P A;  1XX2 A;  4EQ1 A;  3VFH A;  4FH2 A;  1ALQ A;  1NZU A;  2J3T C;  3BQA A;  2K7S A;  2M7U A;  3MXR A;  4ZRR A;  4ZJ3 A;  2Y2I A;  2WAE A;  3KSG A;  3A0V A;  2K31 A;  4KZB A;  1GCE A;  4IUH A;  1V9Y A;  3B42 A;  3MKE A;  1D06 A;  2WKP A;  2XA7 S;  4QY5 A;  3E2L A;  5CEC A;  3W4Q A;  1LI0 A;  3MXS A;  4MN5 A;  1BUE A;  3IF6 C;  2ZOH A;  4KQD A;  1XJ3 A;  5HFO A;  4LRY C;  4BEN A;  3VOY A;  1NY0 A;  4PM7 A;  1TEM A;  2PBY A;  3ZDJ A;  3V3R A;  1IEM A;  3E0Y A;  3IF6 B;  1JWZ A;  1FCN A;  4PM8 A;  4FSF A;  2CC1 A;  4KZA A;  2HV1 A;  1DJA A;  4S2J A;  4E3I A;  1VEU B;  2VJW A;  5FQI A;  2B02 A;  5CX7 A;  4X68 A;  1JTD A;  3QP6 A;  4AFI A;  1KDW A;  1S1Y A;  3T4Q A;  1G28 A;  3OOV A;  3MBZ A;  4WEK A;  2JKT M;  4PM6 A;  3IHA A;  5HPI A;  3B33 A;  3QP1 A;  1O7E A;  4QHC A;  5CXW A;  2W0N A;  4EV4 A;  3OPP A;  2DNS A;  4ARZ B;  1C3B A;  4EUV A;  4HI4 A;  4S2P A;  3DTE A;  2IWD A;  3N7W A;  1XGJ A;  4Q8I A;  3E4Q A;  5FAS A;  5HAR A;  5M19 A;  2HDS A;  5FQJ A;  3T4J A;  3CIT A;  4WUJ A;  4R3A A;  1MWU A;  5HD5 A;  1H8M A;  1STZ A;  4S2N C;  1H5X A;  1S1Z A;  2ZLY A;  3T1Q B;  2W3G A;  2XH9 A;  2XD5 A;  3PBN A;  4PM9 A;  1CK3 A;  1ERO A;  1K55 C;  5BOH A;  4Q0I A;  2V8F A;  4KQQ A;  2HPB A;  2I72 A;  3TG9 A;  3NHQ A;  1I2W A;  2ZC3 B;  1ZKJ A;  4OP5 A;  1H0M A;  5E2G A;  4ME4 A;  3ZG0 A;  5F68 A;  1M40 A;  3TW8 A;  3RFB A;  1NYY A;  4O01 A;  4X1M A;  4EBP A;  4KG6 A;  2OWH A;  1H8Y A;  4RX3 A;  1DJC A;  4MBH A;  5EFW A;  3UMD A;  3PBO A;  3ICY A;  3E2K A;  4U3T A;  5FEF A;  4OQI A;  5IU1 A;  3MXQ A;  1Z09 A;  1MZU A;  2XD1 A;  3UY6 A;  1K6S A;  1K25 A;  3O87 A;  1YSP A;  4KZ5 A;  3D9Y A;  1HLU P;  1E25 A;  1Y28 A;  3OC2 A;  5DVA A;  1E4D A;  3VE3 A;  3BFE A;  4E3K A;  4RA7 A;  1ZG6 A;  2ZOI A;  3Q82 A;  1OJG A;  1OTI A;  4ZJ2 A;  2HF6 A;  3Q07 A;  4OPY A;  3IH8 A;  3ZVT A;  1LL9 A;  3WWX A;  4P6Z M;  2ACG A;  4Y15 A;  3CPT B;  4JGQ A;  4GJ4 A;  1IYQ A;  4PPR A;  5E2E A;  4Y0O A;  3MJQ A;  1SKO A;  1S0W A;  4KQO A;  4NET A;  5J7E A;  5TJJ A;  2EXA A;  5FSR A;  4IVK A;  3LFV A;  3F1P A;  4PM5 A;  3DTI A;  5FQM A;  3V39 A;  2WKQ A;  2A2L A;  1PI4 A;  4Q0J A;  3HLB A;  4HP4 A;  3RXX A;  1LL5 A;  4N1X A;  1XKZ A;  2PAV P;  3LY3 A;  5A91 A;  4Y17 A;  2QYB A;  5GHX A;  5DKL A;  1HZO A;  3G2Y A;  5CED A;  4UHU A;  4L9F A;  5HD3 A;  2XLN A;  2Y55 A;  1KGG A;  4H8R A;  4EQI A;  2L0W A;  1UWP X;  3LIF A;  5A8B A;  3LI9 A;  3S7P A;  1UGU A;  1LI9 A;  2IWC A;  1OJ5 A;  2Y8H A;  2JKF A;  2LB5 A;  1F9I A;  3CJM A;  3CWF A;  4YIN A;  2EX2 A;  3NDE A;  1OPX A;  3WRZ A;  3GDI A;  2ZQ8 A;  2FH5 A;  4JGO A;  3NC8 A;  3GR2 A;  2JKR M;  1M6K A;  3CLO A;  1XGI A;  4X25 A;  4GHI B;  1XPB A;  3QP8 A;  4I38 A;  1PNE A;  3C8C A;  1F5M A;  1XA1 A;  3UB5 P;  3F1N B;  4OQH A;  3HCY A;  2O9A A;  1DY6 A;  4ZTK A;  2ZL1 B;  2XF3 A;  3A3E A;  4YWZ A;  3ZCZ A;  1D1J A;  1XJ4 A;  3CUE A;  1YLJ A;  2J3T D;  3NI9 A;  4F94 A;  4C3Q A;  1Q2Q A;  2VV8 A;  4C75 A;  2EWW A;  3NJA A;  4GD8 A;  3NOT C;  3M6H A;  3FPV A;  1DJB A;  2QWS A;  3K3C A;  1W8Y A;  3LIE A;  2W3F A;  1O07 A;  2KX6 A;  5KZH A;  3VP0 A;  2JE5 A;  5AVE A;  3IX3 A;  2O99 A;  3Q1F A;  1NJ4 A;  3TRC A;  1G6A A;  1YKD A;  4Y2F A;  2R78 A;  5CER A;  2VZW A;  2W1T B;  3S1Y A;  3UE0 A;  1IYS A;  2V9A A;  3C2W A;  4DMZ A;  2EA9 A;  3L7H A;  2J9O A;  4MBF A;  4BWI A;  1MKI A;  4GDN A;  3T4T A;  1KE4 A;  4HNB A;  3R7W B;  3ISG A;  1ERM A;  3DWZ A;  3C5A A;  1EWZ A;  1RGZ A;  1JWV A;  3UE6 A;  4DXB A;  4XT2 B;  3ULF A;  2VGJ A;  4XUZ A;  1S6R A;  3LIC A;  3C4P A;  3NEC A;  1F98 A;  1GSX A;  5KSH A;  1ES5 A;  2Y2H A;  3SOI A;  3MF0 A;  1K57 A;  2VEA A;  5G4Z A;  4MN6 A;  4LEN A;  3G35 A;  3IWI A;  3N6I A;  3QHY A;  3BLM A;  3OZH A;  4XXR A;  4OLD A;  3EGX C;  3T4L A;  4EER A;  2ZQD A;  3TSG A;  4Z9Q A;  1H8Z A;  2FZ0 A;  3V50 A;  1YLZ A;  3AGF A;  1JWP A;  3LGO A;  1K4E A;  5GLC A;  5EM0 A;  5JYP A;  1PW1 A;  3LIA A;  2MJ6 A;  2L1M A;  2W3H A;  1K56 D;  2LB9 A;  1PWD A;  4E3L A;  1Y4O A;  5AQ7 A;  3IF6 A;  5U47 A;  4JGR A;  5FDH A;  2C5W B;  1L0F A;  2PHY A;  1VEU A;  4DE0 A;  4LGW A;  4ZDX A;  5HL6 A;  4WF0 A;  5EE8 A;  3PTE A;  4JKT A;  3LUQ A;  2QJ7 A;  1TDG A;  3WS4 A;  2HDQ A;  4DKI A;  3LID A;  2W3E A;  4BJP A;  2RCX A;  2D02 A;  4OLG A;  1YLT A;  4EET B;  4QY6 A;  2XFT A;  2EFU A;  1IKG A;  4G3K A;  2XDM A;  3BJN A;  3KYZ A;  3A3I A;  4CQH A;  3VMA A;  2OSU A;  4NKP A;  1T1B A;  4OH0 A;  4KEN B;  1CI8 A;  3ZVW A;  2OLU A;  2V2F F;  2P9V B;  2VV6 A;  4GS9 B;  2HGV A;  3IQA A;  5G18 A;  4F3L B;  1SZV A;  3S4X A;  1LSV A;  4HBU A;  1HTZ A;  4GW9 A;  3EQU A;  3BFF A;  5HX9 A;  1K56 A;  3BY8 A;  4MBK A;  3IBR A;  3IXD A;  3BWL A;  4S2N A;  4II7 A;  1ESU A;  4RX2 A;  5TFQ A;  2UV0 E;  1W63 M;  1RGY A;  4WLA A;  4X56 A;  2VGL M;  3O88 A;  4U0T A;  3S7N A;  4MEZ A;  3T1S A;  3BFC A;  1K55 A;  4IJG A;  2Y4A A;  2W1R A;  3RH8 B;  4I39 A;  2PYP A;  2GJ3 A;  2ZJ9 A;  5EVI C;  4X1L A;  2IWB A;  3EOI A;  3EGD C;  2DRW A;  3GVB A;  4NXG A;  4JF6 A;  5FAO A;  3MQQ A;  3IT9 A;  4QPR A;  4U0X A;  1X0O A;  4FUW A;  1ZHH B;  2ZQ9 A;  2X71 A;  5EVI B;  1ESI A;  2A3U A;  3BY9 A;  4GB7 A;  3PBQ A;  5HWW A;  4DN0 A;  3OBF A;  3HLW A;  4E3N A;  3NDG A;  1WYB A;  5M1A A;  1BT5 A;  3WS2 A;  4P85 A;  1W79 A;  1CEG A;  3RTY A;  4IBX A;  4EBL A;  1MY8 A;  2WKE A;  4X53 A;  5DFY A;  1TS7 A;  3UDF A;  5L10 A;  1YLP A;  5M18 A;  3CPT A;  3ZQ5 A;  3QP5 A;  4OP8 A;  2O9C A;  2ZQA A;  1G5U A;  3DWK A;  3O5Y A;  3EEA A;  2Y2J A;  4Q0H A;  2OV5 A;  4P6B A;  5EUA A;  4E3O A;  4ZBE A;  3C30 A;  2XFS A;  3T4K A;  3VOZ A;  1ES3 A;  1T19 A;  4GKU A;  2XR0 A;  1NXY A;  3SS4 A;  4N9L A;  1K54 C;  4ETX A;  4NXF A;  3BEC A;  3Q81 A;  1LHY A;  1JVJ A;  2EX6 A;  2KLI A;  4OVD A;  5C5K A;  1MWS A;  5CHM A;  2A49 A;  1MC0 A;  1FSW A;  3M2J A;  1ZG4 A;  4YNR A;  4B4Z A;  2ZQC A;  1JNU A;  3AGE A;  5F83 A;  3PYP A;  3TJZ C;  5J3W A;  4HOI A;  3K3D A;  3OPL A;  3ZNT A;  3G2Z A;  1L2S A;  3A3J A;  1CQA A;  1E3U D;  1TS8 A;  1GSW A;  2B5R A;  3BRM A;  1XJ6 A;  4I5S A;  4WMC D;  1WYC A;  3MQO A;  2ZM8 A;  3KYE A;  3H7W B;  2E8J A;  2WAD A;  4R3J A;  3A3D A;  2GX5 A;  4L9G A;  4GHI A;  1PRQ A;  3T4O A;  3H9W A;  5FI2 A;  3GV9 A;  1N9L A;  4NEE D;  4H6J A;  4ID4 A;  5DTT A;  3F1N A;  3GTC A;  1YMX A;  4UAA A;  2ZL1 A;  4LFU A;  4O8G A;  4DF6 A;  4K0W A;  4WYY A;  3JVV A;  4RQ9 A;  1S66 L;  3PBT A;  3QP2 A;  3NUL A;  3MSH A;  4EEU A;  3E98 A;  3HUO A;  5DJT A;  2A24 B;  5EOE A;  1TS0 A;  3EWK A;  3NOU C;  4EW7 A;  4PAU A;  5HAQ A;  4HY8 A;  2GDN A;  4WEJ A;  3MMH A;  3NBL A;  4KUO A;  1ONG A;  3UE3 A;  1V9Z A;  2W1T A;  3D72 A;  1KDS A;  3N8S A;  1CI9 A;  3IX4 A;  1N9N A;  1T1A A;  3FC7 A;  2ZM2 A;  5DF9 A;  2H5S A;  4CLC C;  1E3U A;  4EUZ A;  2Y2P A;  3LO7 A;  5J4E A;  4WMC A;  3R7W A;  1W7F A;  5FQ9 A;  2V1Z A;  4WM9 A;  4NG2 A;  3GRJ A;  1I5Q A;  1ODV A;  4XT2 A;  2O9B A;  4KG2 A;  3SH8 A;  2JHE A;  4EU0 A;  4CLC B;  1H3Q A;  3SZT A;  4I3J A;  1YT4 A;  4R23 A;  2P08 A;  4FD8 A;  3G6O A;  4R1G A;  3LEZ A;  2OLV A;  4PMA A;  4S2K A;  1VB6 A;  4NK3 A;  5GLA A;  3VV4 A;  2Y2K A;  3CI6 A;  4UA7 A;  5EOO A;  1BLP A;  1UWN X;  3BEB A;  1FSY A;  2ZC6 B;  4R6L A;  4UQI M;  5CHU A;  5CGW A;  4E04 A;  3P7N A;  4BBT A;  4JGP A;  3P09 A;  2XQZ A;  1IFQ A;  5MC7 A;  4KUK A;  3LYX A;  3BYD A;  2PYR A;  4S2O A;  3BW6 A;  1VQQ A;  4X55 A;  4BQM A;  3WS1 A;  3QNC A;  4NXB A;  3VSK A;  5FL3 A;  3PAG A;  2X02 A;  2EX9 A;  4DDY A;  1MPL A;  4KZ3 A;  3N8R A;  3BFD A;  2WKH A;  4NXE A;  3TOI A;  2B18 A;  4S2L A;  5AQA A;  1LSX A;  3ZG7 B;  4EBN A;  4M3K A;  1YLY A;  4P87 A;  4LCM A;  2Y2L A;  5FEG A;  1FCO A;  4WZ5 C;  4JF5 A;  4CPK A;  3IHB A;  4QB8 A;  4JXV A;  3IWQ A;  3UB8 A;  3MR0 A;  1Q2P A;  5G4Y A;  5EVI D;  3UO9 A;  2WUQ A;  4Y7P A;  5L8M A;  4KZ4 A;  2EXB A;  1K6R A;  1L3L A;  1PZP A;  2YKF A;  4LV2 A;  5TR7 A;  3NCK A;  1IYP A;  4WZ4 A;  3MS6 A;  5JYO A;  4I3A A;  3MQ0 A;  1GSV A;  4LRZ E;  5E43 A;  5FI6 A;  4BL3 A;  1BUL A;  2P9V A;  4GS9 A;  3HUN A;  3FYZ A;  2H10 A;  2Z6D A;  5HZH A;  4F3L A;  4E6W A;  4H6J B;  3OPR A;  4LPZ A;  3UDI A;  1BLC A;  1KGF A;  2Y79 A;  2WK0 A;  1A0K A;  5KMW A;  4OOL A;  4L0L A;  3DW0 A;  3WS5 A;  1SKF A;  3OCN A;  3QNB A;  2GZA A;  2ZMV A;  1W8Q A;  3NIA A;  2G2W A;  1N9B A;  5AQB A;  1K38 A;  1I2S A;  3JYI A;  4YFM A;  2V1B A;  2ZC5 B;  3A0R A;  3ZG8 B;  1ACF A;  1FIL A;  3B47 A;  4I3I A;  3BFG A;  1K0K A;  1NRJ A;  2Y2O A;  1OT9 A;  3F1O B;  3IH9 A;  2P74 A;  1VHM A;  5DTS A;  4LRX C;  1SDE A;  1BZA A;  3PBR A;  2Y2Q A;  3ZFZ A;  3ZGA B;  5EVI A;  4WL9 A;  3PAE A;  3IF5 A;  1NWZ A;  4R4R A;  2QZ6 A;  2WZX A;  3HRE A;  4HBT A;  2XRN A;  4G3V A;  3MZE A;  3HJI A;  4PKY A;  4GN2 A;  5L07 A;  2R9W A;  3WS0 A;  4LLO B;  4UA9 A;  3K2N A;  2R9X A;  2XA7 M;  2HZ5 A;  1YM1 A;  2Z6C A;  3PBS A;  3VP2 A;  4M4X A;  4RYE A;  5HDC A;  3SW1 A;  2RL3 A;  2UWX A;  3C38 A;  1QMF A;  4GDB A;  5FQK A;  5F1F A;  5K5B A;  3LI8 A;  1DP9 A;  5GHZ A;  3VFF A;  1ZTU A;  1GA0 A;  3FKW A;  2H0T A;  4FTX A;  4RVA A;  4S2I A;  3CMZ A;  3V67 A;  1K54 A;  4P6Z S;  2VV7 A;  3VOL A;  5LBR A;  2PT7 A;  4X69 A;  3G30 A;  4MCW A;  4GLQ A;  4BD0 A;  2EFX A;  1TDL A;  4B4X A;  4OOY A;  2J7V A;  4FCF A;  3LIB A;  2AVX A;  4IHQ A;  1BSG A;  4EXO A;  4LV3 A;  3Q7V B;  3VE4 A;  3H7W A;  4OPR A;  3HLF A;  2D01 A;  3MZF A;  5I5L A;  3T12 B;  4CLC D;  2ZMF A;  2BG1 A;  1U60 A;  4Y13 A;  3O3V A;  1IYO A;  2XSS A;  1TS6 A;  3SS5 A;  2V0W A;  1OME A;  4HJ3 A;  2WKI A;  3RXW A;  4E3J A;  5HPF A;  5EVE A;  1EW0 A;  2M1C A;  2KOI A;  3OLO A;  1S4S A;  2PU4 A;  3ZG5 A;  1ES4 A;  4R0Q A;  4ZJ1 A;  3D4F A;  2ZQ7 A;  2ZC7 A;  3UE1 A;  1IOU A;  2A24 A;  1GHI A;  4OPZ A;  1GHP A;  3HJK A;  1MKM A;  4DXC A;  5AJG A;  1Y54 A;  1J3W A;  1W5D A;  3RJU A;  2P7J A;  3H82 B;  5KIZ A;  2XRO A;  1HD8 A;  4JF4 A;  3UPO A;  3UPP A;  2HDU A;  3BQ8 A;  3HBR A;  3FV7 A;  4BBV A;  2I9V A;  3VP1 A;  1WA9 A;  3LEQ A;  1T18 A;  2JC7 A;  2JBF A;  2XGN A;  4JLF A;  4CLC A;  2JN7 A;  2JKT I;  1MBL A;  2CMN A;  1FQG A;  2BTF P;  2FFF B;  3UN7 A;  2Q0O A;  4ESP A;  5CTN A;  1FR6 A;  1F2K A;  3PHY A;  1N4O A;  1L0G A;  1P9R A;  3HLE A;  2GNX A;  5HW3 A;  1YLW A;  2Y2G A;  3ZNY A;  1NZO A;  4Y0U A;  1K57 C;  1ES2 A;  5DF8 A;  4DDS A;  4MNR A;  3BLS A;  5CRF A;  1KGE A;  3SH9 A;  2QHK A;  4HP9 A;  4OPQ A;  4HIA A;  4GZB A;  1CF0 A;  3A0S A;  5CGX A;  3T4S A;  3WRT A;  4X6T A;  3UB6 A;  3GEC A;  4O7D A;  4Y3I A;  1P97 A;  2Z2M B;  4GOG A;  1DRM A;  1YAX A;  5L2F A;  1XJ2 A;  3C4O A;  1PW8 A;  2J8Y A;  2Y2M A;  1K4F A;  3HL9 A;  5GLD A;  1KE0 A;  3P01 A;  3UNW A;  5AQ9 A;  5EVL A;  1OTD A;  3M6B A;  3W8K A;  3DTM A;  4QWO A;  2WGW B;  3IS2 B;  1PI5 A;  3PR6 A;  4D60 A;  1MWT A;  4IED A;  3UPN A;  1PIO A;  4WZ5 A;  2L4R A;  4B88 A;  3VSL A;  4IVI A;  5KSC A;  3FPW A;  1SDN A;  2EX8 A;  4A5R A;  3MZD A;  2HP9 A;  4B93 A;  3EEH A;  1S67 L;  4R70 A;  3UME A;  4DE1 A;  4BBU A;  4IBR A;  3MFX A;  4KZ7 A;  5E2H A;  3E4P A;  4R4S A;  4KZ8 A;  2HDR A;  4ZAM A;  2KDK A;  4HH3 A;  2Y91 A;  4N92 A;  3LR5 A;  5EEC A;  4JBF A;  1D7E A;  4KG5 A;  5DKK A;  5DJU A;  2X01 A;  4N9K A;  1G6O A;  5AVF A;  4HJ4 A;  1AXB A;  4OON A;  3A3F A;  3C7V A;  1GA9 A;  3F1O A;  4C6Y A;  2HJ9 C;  3SH7 A;  1XP4 A;  5IS1 A;  1PYY A;  3KSH A;  2PDR A;  1OTB A;  5DFX A;  5HWT A;  4LCL A;  4K91 A;  5TBM B;  1IEL A;  2IA2 A;  5DF7 A;  3CG5 A;  4MMN A;  3ZYT A;  4PHT A;  1XXM A;  3V3S A;  2OOL A;  3IXB A;  3QP4 A;  2E8I A;  2PRF A;  2HP6 A;  2PR5 A;  5FI7 A;  2VGL S;  3UB9 A;  2HP5 A;  1JTG A;  1PWG A;  5HAP A;  2VA0 A;  5HL1 A;  4O0P A;  3HLG A;  3MFD A;  3IWO A;  3O86 A;  1TF1 A;  3BM6 A;  1HVB A;  3CHW P;  3KX0 X;  5L09 A;  3HLC A;  2O0Y A;  2P04 A;  4WEL A;  5A90 A;  3DAV A;  1Z6F A;  2JKR I;  4E6X A;  3GQZ A;  3ZG9 B;  4ETZ A;  1J9M A;  4WN5 A;  5DTK A;  5IT5 A;  1BLH A;  1BTL A;  2Q9N A;  1RCJ A;  2C6W B;  4Y0T A;  3V5M A;  4IUK A;  4P0M A;  1LT0 A;  3VP3 A;  4HQA A;  4R3B A;  3FZC A;  2Z2L B;  4UA6 A;  4MLL A;  5CGS A;  2VLG A;  1BLS A;  1WE4 A;  5CTM A;  2BAS A;  1CJF A;  3T1X A;  4WBG A;  2G7U A;  1MWR A;  2JKG A;  4UEY A;  2BLS A;  3IX8 A;  1P9W A;  5GHY A;  1QME A;  5GL9 A;  3FKV A;  3G34 A;  4OQG A;  1ERQ A;  4E3M A;  5A92 A;  3Q7V A;  4GNU A;  4DE2 A;  1DP6 A;  3I7J A;  1FCM A;  2Q9M A;  3PXP A;  3FWL A;  5EV0 A;  4HH2 A;  1KOU A;  2K2N A;  5TGF A;  5F82 A;  3W4O A;  1GHM A;  2B95 A;  4CLC E;  2ZBB A;  2WYX A;  1OTA A;  5FDS A;  2WKR A;  1G68 A;  4KZ6 A;  4LV1 A;  4QD4 A;  4Z1W A;  4OKP A;  2J3W A;  1MXO A;  1LSW A;  2DMW A;  1TVF A;  2WGI A;  3Q7Z A;  3R4K A;  1FOF A;  4BMW A;  1VET A;  4HJ6 A;  3NY4 A;  4B9O A;  3KO6 A;  3KSF A;  1SHV A;  3ITB A;  3NOP C;  2V8C A;  1TD5 A;  5HDS A;  4OOM A;  4BD1 A;  2XK1 A;  2XEP A;  4YOF A;  5EPH A;  2FFY A;  3H82 A;  3LR0 A;  4G3W A;  2Y59 A;  4QJG A;  1YMS A;  2ZD8 A;  1T1C A;  4EES A;  2HJE A;  2ZM0 A;  3IXH A;  3CAX A;  1BYW A;  1DP8 A;  2G2U A;  5FAP A;  5FAT A;  5HAI A;  1SCW A;  2QMI A;  1W63 Q;  4QU3 A;  1L0E A;  4JXS A;  1S4R A;  2VGK A;  4CJN A;  3E4O A;  2PD8 A;  1NLY A;  1PFL A;  2J9P A;  2QPN A;  2QJ5 A;  3LR4 A;  4JPM A;  4MN7 A;  1XA7 A;  1YPR A;  5I94 A;  1NLZ A;  3LY4 A;  1NYM A;  4JXG A;  2V20 A;  3IXG A;  2VX8 A;  1FIK A;  4KZ9 A;  5F6A A;  3JVU A;  2Y2N A;  1KE3 A;  3DBA A;  1KVM A;  1VM1 A;  1ZC2 A;  1PWC A;  5CEB A;  2V0U A;  4EEP A;  2H0Y A;  2WAF A;  2V1A A;  3G32 A;  3IBJ A;  4DE3 A;  3HVF A;  3HUM A;  4HEF A;  4DRT A;  2PR6 A;  3U4L P;  4JXW A;  1ONH A;  4PKY G;  1EI5 A;  4D2O A;  3JPU A;  4LV0 A;  4S2M A;  3ITA A;  5IHV A;  3KYQ A;  1XFQ A;  3AGD A;  5HWV A;  1FR1 A;  3OCL A;  1RP5 A;  3FG8 A;  1SKO B;  5GLB A;  4GCZ A;  4UQI S;  4HES A;  5F5Y A;  2J80 A;  5HDD A;  2WGW A;  5EM1 A;  4XUX A;  3IS2 A;  5J8X A;  2PBD P;  5D3O A;  3T50 A;  3N4I A;  3U2A A;  2VKS A;  3N8L A;  3F1P B;  3G31 A;  2PU2 A;  3S7Q A;  2M7V A;  4K08 A;  3B3X A;  1IKI A;  3T1R A;  1KVL A;  3CZD A;  1NRF A;  2OAP 1;  3OPH A;  5FQQ A;  3DTK A;  2W27 A;  4KQR A;  1LL8 A;  3SS3 A;  1LLB A;  4ARZ A;  1PZO A;  4EWF A;  3UDX A;  3EQV A;  2NUT C;  3C7U A; 
#chains in the Genus database with same CATH homology
 1L0D A;  2JE5 A;  4S2K A;  4NK3 A;  5GLA A;  2Y2K A;  3UNW A;  5AQ9 A;  4UA7 A;  5EVL A;  3M6B A;  5EOO A;  4FH4 A;  3Q1F A;  3W8K A;  1BLP A;  1NJ4 A;  3DTM A;  2WGW B;  3BEB A;  1G6A A;  1YQS A;  1FSY A;  2JCH A;  2ZC6 B;  5CHU A;  5CGW A;  5CER A;  4BL2 A;  3S1Y A;  3GSG A;  3P09 A;  2XQZ A;  3VP4 A;  1PI5 A;  3UE0 A;  1MWT A;  2DCF A;  4IED A;  3UPN A;  3LCE A;  1PIO A;  1IYS A;  3G4P A;  4WZ5 A;  3BYD A;  3GMW A;  2J9O A;  4MBF A;  4B88 A;  1MKI A;  4GDN A;  3VSL A;  4S2O A;  1KE4 A;  4IVI A;  1VQQ A;  4K0X A;  5KSC A;  1SDN A;  2EX8 A;  4X55 A;  2WGV A;  4BQM A;  3WS1 A;  3QNC A;  3MZD A;  4A5R A;  2HP9 A;  3ISG A;  1ERM A;  3DWZ A;  3C5A A;  1EWZ A;  1RGZ A;  3VSK A;  3HLD A;  5A93 A;  1JWV A;  3PAG A;  2X02 A;  3M2K A;  4DXB A;  4BLM A;  4DE1 A;  2EX9 A;  4IBR A;  2VGJ A;  4KZ7 A;  4DDY A;  5E2H A;  1MPL A;  4XUZ A;  1S6R A;  4KZ3 A;  3N8R A;  4OQ0 A;  4R4S A;  2WZZ A;  3BFD A;  2WKH A;  3C4P A;  3S22 A;  4KZ8 A;  3P98 A;  2HDR A;  3TOI A;  5KSH A;  2ZC4 B;  1ES5 A;  2Y2H A;  4ZAM A;  3SOI A;  4S2L A;  5AQA A;  1K57 A;  4GD6 A;  3ZG7 B;  2Y91 A;  4N92 A;  4EBN A;  4LEN A;  3G35 A;  3IWI A;  4M3K A;  4N1H A;  3ZHH A;  3N6I A;  1YLY A;  4P87 A;  4LCM A;  5EEC A;  1CEF A;  2Y2L A;  3QHY A;  3BLM A;  5CHJ A;  1FCO A;  4WZ5 C;  4JBF A;  4JF5 A;  5F1G A;  4CPK A;  3IHB A;  4QB8 A;  4JXV A;  4KG5 A;  3IWQ A;  3OZH A;  4XXR A;  4OLD A;  2X01 A;  4N9K A;  5E2F A;  2ZMA A;  1Q2P A;  3MKF A;  5EVI D;  1AXB A;  3UO9 A;  2ZQD A;  2WUQ A;  4OON A;  4Y7P A;  4Z9Q A;  1H8Z A;  3TSG A;  3A3F A;  3C7V A;  3V50 A;  4KZ4 A;  2EXB A;  1GA9 A;  1YLZ A;  1K6R A;  4C6Y A;  3AGF A;  1JWP A;  1K4E A;  5GLC A;  3SH7 A;  5JYP A;  1PW1 A;  1PZP A;  1XP4 A;  4LV2 A;  5TR7 A;  1PYY A;  3NCK A;  5FAQ A;  1IYP A;  1K56 D;  4WZ4 A;  5FA7 A;  1PWD A;  4E3L A;  5JYO A;  5AQ7 A;  3IF6 A;  5U47 A;  3W4P A;  5FDH A;  1XX2 A;  4LCL A;  2C5W B;  1L0F A;  4K91 A;  3VFH A;  5E43 A;  5FI6 A;  1IEL A;  1BUL A;  4BL3 A;  2P9V A;  4DE0 A;  3HUN A;  4FH2 A;  1ALQ A;  4ZDX A;  1NZU A;  2H10 A;  3FYZ A;  5DF7 A;  3CG5 A;  4E6W A;  3MXR A;  3OPR A;  4ZJ3 A;  5EE8 A;  2Y2I A;  3PTE A;  4JKT A;  3UDI A;  1XXM A;  2WAE A;  1BLC A;  1KGF A;  3V3S A;  3IXB A;  2WK0 A;  2E8I A;  4KZB A;  1TDG A;  4OOL A;  5KMW A;  1GCE A;  3WS4 A;  2HDQ A;  4L0L A;  3DW0 A;  2HP6 A;  3WS5 A;  1SKF A;  4DKI A;  5FI7 A;  3MKE A;  3OCN A;  3QNB A;  4BJP A;  2RCX A;  1W8Q A;  3NIA A;  2G2W A;  4QY5 A;  2HP5 A;  1N9B A;  5AQB A;  4OLG A;  1JTG A;  1K38 A;  1PWG A;  3E2L A;  5CEC A;  1I2S A;  3JYI A;  4YFM A;  5HAP A;  1YLT A;  5HL1 A;  2ZC5 B;  3W4Q A;  1LI0 A;  3MXS A;  3HLG A;  4QY6 A;  3ZG8 B;  3MFD A;  3IWO A;  3O86 A;  3BM6 A;  1HVB A;  1BUE A;  3BFG A;  3IF6 C;  2XFT A;  5HFO A;  3HLC A;  4BEN A;  2EFU A;  2Y2O A;  3VOY A;  1IKG A;  1NY0 A;  4PM7 A;  4WEL A;  5A90 A;  3IH9 A;  2XDM A;  1TEM A;  2P74 A;  3A3I A;  3VMA A;  2PBY A;  3ZDJ A;  1Z6F A;  5DTS A;  2OSU A;  4E6X A;  3V3R A;  1SDE A;  3GQZ A;  3ZG9 B;  4OH0 A;  1IEM A;  1BZA A;  3PBR A;  3IF6 B;  4KEN B;  1JWZ A;  1CI8 A;  1J9M A;  1FCN A;  5DTK A;  4PM8 A;  4FSF A;  2Y2Q A;  3ZVW A;  2CC1 A;  3ZFZ A;  4KZA A;  2OLU A;  1BLH A;  1DJA A;  4S2J A;  3ZGA B;  1BTL A;  2Q9N A;  1RCJ A;  2V2F F;  5EVI A;  2C6W B;  2P9V B;  4E3I A;  4Y0T A;  5FQI A;  3V5M A;  3IQA A;  5G18 A;  4P0M A;  3S4X A;  3PAE A;  3IF5 A;  4HBU A;  3VP3 A;  1HTZ A;  4R4R A;  3EQU A;  1JTD A;  3BFF A;  4X68 A;  1K56 A;  2QZ6 A;  4R3B A;  5HX9 A;  3FZC A;  2Z2L B;  1KDW A;  4UA6 A;  4MLL A;  2WZX A;  3HRE A;  4MBK A;  5CGS A;  4HBT A;  3MBZ A;  4WEK A;  1BLS A;  1WE4 A;  3MZE A;  3IXD A;  4PM6 A;  4S2N A;  5CTM A;  1ESU A;  4RX2 A;  5TFQ A;  4X56 A;  1RGY A;  3IHA A;  4GN2 A;  5CXW A;  1O7E A;  4QHC A;  4EV4 A;  2R9W A;  3WS0 A;  3O88 A;  3OPP A;  4UA9 A;  4U0T A;  2DNS A;  4MEZ A;  3BFC A;  4WBG A;  2R9X A;  1C3B A;  1K55 A;  2Y4A A;  1MWR A;  1YM1 A;  4S2P A;  3PBS A;  2BLS A;  3VP2 A;  4RYE A;  2ZJ9 A;  5EVI C;  2RL3 A;  2IWD A;  2UWX A;  1XGJ A;  3N7W A;  5GHY A;  1QME A;  5GL9 A;  1QMF A;  2IWB A;  3FKV A;  4Q8I A;  3G34 A;  4GDB A;  5FAS A;  5HAR A;  5M19 A;  2DRW A;  3GVB A;  4OQG A;  5FQK A;  4JF6 A;  1ERQ A;  4E3M A;  5F1F A;  2HDS A;  5FAO A;  5FQJ A;  3Q7V A;  4GNU A;  5A92 A;  3IT9 A;  4DE2 A;  4U0X A;  5GHZ A;  3I7J A;  1FCM A;  2Q9M A;  2X71 A;  2ZQ9 A;  5EVI B;  3VFF A;  1ESI A;  2A3U A;  1MWU A;  3FWL A;  4GB7 A;  3PBQ A;  3HLW A;  4S2N C;  4E3N A;  1H5X A;  5F82 A;  5TGF A;  3W4O A;  3NDG A;  1GHM A;  1GA0 A;  2ZLY A;  1WYB A;  2WYX A;  3FKW A;  2H0T A;  2XH9 A;  2XD5 A;  5M1A A;  3PBN A;  1BT5 A;  1G68 A;  4PM9 A;  4KZ6 A;  4LV1 A;  1CK3 A;  4QD4 A;  3WS2 A;  1ERO A;  1K55 C;  4OKP A;  4P85 A;  5BOH A;  4RVA A;  4KQQ A;  2HPB A;  2I72 A;  4S2I A;  3CMZ A;  1W79 A;  1CEG A;  1MXO A;  3TG9 A;  1K54 A;  1I2W A;  4IBX A;  1TVF A;  1ZKJ A;  2WGI A;  2ZC3 B;  3Q7Z A;  4OP5 A;  5E2G A;  4EBL A;  3ZG0 A;  1M40 A;  1MY8 A;  1FOF A;  4X69 A;  1NYY A;  2WKE A;  3G30 A;  4X53 A;  4EBP A;  3NY4 A;  4KG6 A;  3UDF A;  4BD0 A;  1YLP A;  2EFX A;  1TDL A;  4B4X A;  5M18 A;  1H8Y A;  4RX3 A;  4OOY A;  1DJC A;  2J7V A;  4FCF A;  1SHV A;  3ITB A;  4MBH A;  4OP8 A;  3PBO A;  3E2K A;  2ZQA A;  4U3T A;  3DWK A;  4OOM A;  1BSG A;  4BD1 A;  4OQI A;  2Y2J A;  4LV3 A;  2OV5 A;  2XK1 A;  3Q7V B;  2XEP A;  4P6B A;  5EUA A;  4ZBE A;  3C7U A;  4E3O A;  4OPR A;  5EPH A;  2FFY A;  2XFS A;  2XD1 A;  3HLF A;  3UY6 A;  3VOZ A;  1ES3 A;  1K6S A;  1K25 A;  2Y59 A;  4GKU A;  3MZF A;  3O87 A;  4QJG A;  1YMS A;  4KZ5 A;  2ZD8 A;  2XR0 A;  1NXY A;  3SS4 A;  4N9L A;  1K54 C;  1E25 A;  2ZM0 A;  3OC2 A;  5DVA A;  3IXH A;  3BEC A;  2BG1 A;  3Q81 A;  1LHY A;  1U60 A;  1E4D A;  3O3V A;  1IYO A;  1JVJ A;  2G2U A;  2EX6 A;  3BFE A;  5FAP A;  4OVD A;  3SS5 A;  1MWS A;  4E3K A;  5CHM A;  5FAT A;  5HAI A;  2A49 A;  4RA7 A;  1OME A;  1ZG6 A;  2WKI A;  3RXW A;  4E3J A;  1SCW A;  1FSW A;  2QMI A;  3Q82 A;  4QU3 A;  1L0E A;  2PU4 A;  3M2J A;  1ES4 A;  4JXS A;  4R0Q A;  4ZJ2 A;  2VGK A;  3ZG5 A;  3Q07 A;  4ZJ1 A;  4OPY A;  3D4F A;  3IH8 A;  4CJN A;  1ZG4 A;  3ZVT A;  1LL9 A;  3WWX A;  2ZQ7 A;  2ZC7 A;  4B4Z A;  2J9P A;  2QPN A;  3UE1 A;  2ZQC A;  3AGE A;  5F83 A;  1IYQ A;  4PPR A;  4JPM A;  5E2E A;  1XA7 A;  1GHI A;  4Y0O A;  4OPZ A;  1GHP A;  3LY4 A;  5I94 A;  1NYM A;  4JXG A;  3OPL A;  3ZNT A;  3G2Z A;  1L2S A;  2V20 A;  3A3J A;  1E3U D;  2B5R A;  4DXC A;  3IXG A;  1Y54 A;  3BRM A;  4WMC D;  1S0W A;  1WYC A;  2ZM8 A;  1W5D A;  4KQO A;  3RJU A;  4NET A;  4KZ9 A;  2EXA A;  3VP0 A;  5FSR A;  2WAD A;  2Y2N A;  1KE3 A;  4IVK A;  4R3J A;  3A3D A;  1KVM A;  1HD8 A;  4JF4 A;  1VM1 A;  1ZC2 A;  1PWC A;  5CEB A;  2H0Y A;  5FI2 A;  2WAF A;  4PM5 A;  3UPO A;  3GV9 A;  3UPP A;  4ID4 A;  3G32 A;  5DTT A;  2HDU A;  5FQM A;  3V39 A;  3GTC A;  4DE3 A;  3HVF A;  1YMX A;  3HUM A;  3HBR A;  3FV7 A;  4HEF A;  4UAA A;  1PI4 A;  3HLB A;  4DRT A;  4DF6 A;  4K0W A;  4WYY A;  3RXX A;  1LL5 A;  3VP1 A;  4N1X A;  1XKZ A;  3LY3 A;  2JC7 A;  5A91 A;  2JBF A;  4JXW A;  2XGN A;  4JLF A;  5GHX A;  1MBL A;  1ONH A;  1HZO A;  3G2Y A;  1EI5 A;  4D2O A;  3PBT A;  4LV0 A;  5CED A;  4S2M A;  3ITA A;  4UHU A;  5IHV A;  2XLN A;  1FQG A;  1KGG A;  2Y55 A;  3AGD A;  2FFF B;  4H8R A;  3UN7 A;  4EQI A;  3HUO A;  1FR1 A;  5EOE A;  3OCL A;  1RP5 A;  5CTN A;  1FR6 A;  5GLB A;  1LI9 A;  2IWC A;  5HAQ A;  4HES A;  1N4O A;  2GDN A;  4WEJ A;  3NBL A;  1L0G A;  3CJM A;  3HLE A;  5HW3 A;  4YIN A;  1YLW A;  2EX2 A;  2WGW A;  2Y2G A;  1ONG A;  4XUX A;  3UE3 A;  3ZNY A;  3NDE A;  5J8X A;  1NZO A;  4Y0U A;  5D3O A;  1K57 C;  1ES2 A;  3N4I A;  3WRZ A;  2ZQ8 A;  1KDS A;  3N8L A;  3NC8 A;  3GR2 A;  3N8S A;  1CI9 A;  5DF8 A;  1M6K A;  3G31 A;  4DDS A;  4MNR A;  1XGI A;  1XPB A;  3BLS A;  2PU2 A;  2ZM2 A;  5CRF A;  5DF9 A;  2H5S A;  1KGE A;  3SH9 A;  1XA1 A;  1E3U A;  4OQH A;  4EUZ A;  2Y2P A;  3LO7 A;  4OPQ A;  4WMC A;  4GZB A;  1DY6 A;  3B3X A;  4ZTK A;  2XF3 A;  3A3E A;  1W7F A;  1IKI A;  5CGX A;  5FQ9 A;  2V1Z A;  4WM9 A;  3WRT A;  1KVL A;  4X6T A;  3ZCZ A;  3GRJ A;  1I5Q A;  1YLJ A;  4O7D A;  3CZD A;  3NI9 A;  1NRF A;  4KG2 A;  4F94 A;  2Z2M B;  4C3Q A;  4GOG A;  1Q2Q A;  3OPH A;  5FQQ A;  3SH8 A;  4C75 A;  4GD8 A;  4KQR A;  3M6H A;  5L2F A;  3C4O A;  1DJB A;  1PW8 A;  1YT4 A;  4R23 A;  1W8Y A;  1LLB A;  3SS3 A;  4FD8 A;  1O07 A;  2J8Y A;  1PZO A;  4EWF A;  2Y2M A;  1K4F A;  3UDX A;  5KZH A;  4R1G A;  3HL9 A;  2OLV A;  3LEZ A;  4PMA A;  3EQV A;  5GLD A;  1KE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...