4BBTA

The pr1 photocycle intermediate of photoactive yellow protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbtA00
1G28A 1OTBA 3H82A 1D7EA 2INWA 5DJTA 2J80A 4WL9A 3F1OA 4WLAA 3IBRA 4HJ3A 1OTEA 1V9YA 3UMDA 4EERA 4EXOA 3EEHA 3LICA 3E4QA 3MQOA 1P97A 4DJ3A 1Y28A 3UB8A 1ODVA 1GSXA 1N9NA 3H7WA 1XFNA 2V1AA 2JN7A 5J4EA 3F1PB 1TS6A 2A24B 5J7EA 2V9AA 4GW9A 5TBMB 4KQDA 3UB7A 2ZOHA 4LLOB 1UWPX 2OWHA 1OJGA 2OWJA 1GSVA 3FC7A 5EFWA 5F68A 1T1AA 2B02A 3MR0A 4H6JA 1OJ5A 2YKHA 5HWWA 1NWZA 2H28A 1P0ZA 5DKLA 2W0NA 5G4ZA 5HD3A 2QJ7A 5HWTA 1F98A 3ZQ5A 2JHEA 1GSWA 3GDIA 4HP9A 1N9OA 3H9WA 4BBVA 4F3LA 3UB6A 3MJQA 3UMEA 4I5SA 4GHIB 4KUOA 5IS1A 3LUQA 1S4SA 4GS9B 4HH2A 3F1NB 3NOPC 5DKKA 4WN5A 3LIBA 4NXEA 1DP9A 1T1BA 2PD7A 2I9VA 3LIEA 4JGQA 3BY8A 1OT9A 1S4RA 3PYPA 5HDSA 3RTYA 2ZBBA 4RQ9A 3A0SA 1F9IA 4XT2A 2PDRA 4HNBA 3C8CA 2D02A 4NXGA 2PR5A 3A0RA 1LT0A 2PD8A 1S1ZA 1KOUA 4MN6A 3F1PA 1LSWA 3LYXA 5HDCA 3RH8B 5HWVA 2M1CA 5F6AA 2W27A 3ULFA 4GCZA 4I3JA 3K3CA 1T18A 2QKPA 4DJ2A 3P7NA 1OT6A 5AVFA 2QWSA 2P7JA 4L9EA 3PHYA 3KX0X 4BBUA 4I38A 4B9OA 4HIAA 3NOTC 4EW7A 2L0WA 3G6OA 1S67L 3C2WA 1S1YA 1DP8A 1UWNX 4JGOA 4BBTA 3F1OB 4HP4A 4PKYA 2WKQA 4HJ4A 1LSVA 1S66L 4KUKA 4LRYC 1OTAA 4EEUA 1LL8A 1TS8A 4HJ6A 5HDDA 3F1NA 4HQAA 1DRMA 2VV7A 4HI4A 3OLOA 4JGPA 4LRZE 3VOLA 2L4RA 4R6LA 4I39A 3ICYA 4K08A 4EESA 5I5LA 3HJIA 4M4XA 1D06A 4EEPA 1UGUA 4R3AA 1TS0A 3T50A 4L9GA 4R70A 3NJAA 1VB6A 3MFXA 4MN5A 2PR6A 3NOUC 4F3LB 2QHKA 4EQ1A 4HY8A 2ZOIA 2V0WA 2OOLA 2PHYA 2KDKA 2PYRA 2A24A 4NXBA 3A0VA 1XJ6A 5A8BA 4HOIA 5TBMA 3HJKA 1OTDA 3B33A 1XJ2A 1BYWA 1WA9A 3IS2B 4NXFA 3BWLA 1MZUA 4LRXC 2HV1A 3CLOA 1TS7A 4HHDA 4XT2B 1T19A 2Z6CA 4R38A 3BY9A 3H82B 5DJUA 2VV6A 4LPZA 5F5YA 5J3WA 4PKYG 4EETB 2CMNA 5KIZA 2GJ3A 4GHIA 1OTIA 1EW0A 4GS9A 3E4OA 5AVEA 2K7SA 2YKFA 1V9ZA 2V0UA 2D01A 3MXQA 4WUJA 1DP6A 3H7WB 5F69A 2VV8A 2VEAA 2KX6A 2BASA 2EA9A 4YWZA 3LIAA 2PYPA 3NHQA 3EWKA 5HZHA 3GECA 1LSXA 1X0OA 5HSQA 2Z6DA 2WKRA 5HD5A 4H6JB 4I3AA 3VE4A 3UE6A 5IU1A 4WF0A 4E04A 3D72A 3CWFA 1XJ3A 3UB9A 2QJ5A 2L1MA 3VE3A 1N9LA 3E4PA 4I3IA 4JGRA 3LIDA 4HH3A 3IS2A 1T1CA 4L9FA 3FG8A 3LI9A 5G4YA 3LIFA 2V1BA 3K3DA 1XFQA 3LI8A 2VLGA 2R78A 1JNUA 3SW1A 2WKPA 1XJ4A 3MQQA 3CAXA
chains in the Genus database with same CATH superfamily
1MXOA 3T4JA 4R4RA 1OTBA 3WS2A 4DN0A 2INWA 3ZG7B 5DJTA 5A92A 3UE3A 2HP6A 1GHMA 3TRCA 3N8LA 4G3KA 2JKGA 3KYQA 3OOVA 3UMDA 2C5WB 3G2ZA 4EWFA 4IBRA 3EEHA 3LICA 2Y2NA 1W7FA 3E4QA 3KSFA 1W8QA 3UB8A 3O86A 5FSRA 4RYEA 1PWDA 1O7EA 3BFCA 2ZC5B 3ZYTA 5KSHA 5IHVA 1SCWA 3UDFA 4X56A 3P09A 4DE0A 1G5UA 5HPFA 5GHZA 4GW9A 1K56A 3BRMA 4CLCA 5F1GA 3C7VA 1YAXA 1UWPX 2OWHA 2OWJA 3LEQA 3SH8A 1PZPA 5EFWA 1W63M 2YKHA 3UY6A 4UQIS 3OCLA 4BMWA 2V20A 1P0ZA 1I2SA 1ES3A 4WMCD 1DJCA 1G68A 4S2NA 3MBZA 2ZQ7A 2WGWA 3VP0A 4PM6A 3VP1A 1SZVA 3S1YA 3L9KA 1F5MA 3LY4A 4HP9A 1N9OA 3H9WA 4KZ5A 4BBVA 4N92A 1VM1A 3UMEA 4I5SA 2G2WA 3IXDA 1S4SA 3T1SA 3TW8A 4IUHA 4P6ZS 1YLWA 4GDBA 2WK0A 3NOPC 5CGSA 3NECA 1BLCA 3ITBA 4NXEA 1K57A 1DP9A 3T1QB 4ARZB 3WRTA 3LR0A 2GDNA 1OT9A 1S4RA 1XA7A 1YLJA 2ZBBA 4QU3A 3VP4A 3ZVTA 4E3NA 3T4LA 2BTFP 4JXWA 2PDRA 3IWIA 4QJGA 2VGJA 4KZAA 3A0RA 4GD8A 1LT0A 2ZM2A 5KMWA 2HGVA 2XFSA 2XDMA 2ZQ9A 3ZVWA 4BL3A 3LYXA 3IX3A 5CX7A 5HWVA 1ZC2A 3CI6A 5U47A 3T4KA 4DRTA 4IUKA 3HLCA 1IKGA 2PBYA 4DJ2A 4CPKA 2E8JA 4P85A 4O7DA 2O9AA 1G6OA 2P7JA 4BD0A 4JLFA 2ZLYA 3Q81A 4JXSA 3PHYA 2V8CA 5CERA 3DTEA 1CK3A 4JF5A 2X71A 5GL9A 4QWOA 1FOFA 3C2WA 1S1YA 4U0XA 1K25A 1LL5A 1SKOA 4HP4A 1IYSA 4CLCC 3CJMA 2GNXA 5EOEA 1XGIA 3MZFA 4LRYC 1YSPA 4S2JA 1TS8A 3QHYA 4R4SA 3UNWA 3GRJA 4HQAA 3EOIA 1CI9A 3S7QA 1N9BA 2I72A 4JF4A 4S2NC 4F94A 4OLGA 2OV5A 5FAPA 5FEFA 2L4RA 3UPNA 2JC7A 2FFYA 4CLCB 5BOHA 3FKWA 4OQIA 3ICYA 1ES5A 2J9OA 1ZG6A 4M4XA 4WZ4A 2NUTC 4DF6A 2JKFA 1FSYA 3ITAA 4GB7A 2PU4A 3IT9A 3N4IA 3BLSA 4R70A 3S22A 1WYBA 3NJAA 5EE8A 2XSSA 2WGWB 5E2EA 3JPUA 4B4XA 4OPYA 4II7A 1K57C 2K2NA 5GLBA 1TDGA 5GLAA 4Y2FA 3RXXA 1NRJA 4UA7A 4EBNA 2QHKA 4KZ8A 4HY8A 2XF3A 3CITA 2V0WA 2PYRA 2A24A 3E2LA 3W4OA 4NXBA 4OQ0A 3A0VA 5A8BA 4DMZA 3AGEA 4BJPA 2JKTI 4DE3A 3A3FA 1CEGA 4RX3A 3K2NA 1WA9A 5EVEA 4NXFA 3Q7ZA 2A49A 5DF9A 3QP4A 4LRXC 4S2KA 3DTIA 3PTEA 5EM0A 3ZNYA 1YQSA 4PM9A 2BG1A 1PNEA 1T19A 4UA9A 3IXHA 2C6WB 4R38A 5HPIA 3FKVA 3BECA 3BY9A 2XGNA 5FDHA 3PBTA 1IEMA 1MWTA 3PR6A 4R0QA 4RVAA 4GHIA 1EW0A 1Z09A 4BQMA 3E4OA 5DF8A 5HL1A 3GR2A 4MBHA 4FCFA 2YKFA 2WGIA 4KZ6A 2D01A 1N4OA 1QMEA 3TSGA 3CUEA 2DMWA 2XA7M 5FI7A 3LIAA 2WKHA 4DKIA 4OVDA 4KG6A 3EWKA 3V67A 2GX5A 2DCFA 2H10A 3NCKA 4WELA 1SKOB 2HZ5A 2HDQA 2XD5A 4H6JB 2V1ZA 2XROA 4EBPA 3DTMA 4OOLA 4E04A 3VOZA 2WAFA 4PHTA 2W3HA 2XRNA 2L1MA 3E4PA 3LIDA 2JKRI 1XP4A 2H0TA 4GZBA 3DTKA 2Z2MB 3BQAA 2UWXA 3FG8A 5G4YA 1ES2A 1ALQA 3OPLA 3K3DA 3VP2A 2VLGA 3PBQA 5HW3A 4GDNA 1JNUA 1I5QA 2WKPA 4KQRA 3IWOA 2IWBA 2EXBA 3IF6B 5FATA 1G28A 4XUZA 5AJGA 1YMXA 3LGOA 3M6HA 2J80A 3O3VA 2EWVA 4KQOA 1KGGA 4HJ3A 1YSQA 1G6AA 1PW8A 3N7WA 4OPQA 5FQIA 1XA1A 4E3KA 4EERA 5MC7A 4FD8A 1IELA 2HP9A 3E98A 2R9XA 3MQOA 4DJ3A 5HAPA 5GHYA 2J3TC 1GSXA 1KVMA 1BSGA 4PM8A 3H7WA 2JN7A 3SS3A 2A24B 2V9AA 3R7WB 3FV7A 2HDSA 4A5RA 4KQDA 1VETA 3AGDA 3BYDA 3UB7A 2ZOHA 3HUNA 4FOFA 4ZJ1A 2Y55A 2Y2HA 1MWUA 4QPRA 4QY5A 5F68A 2HF6A 3MR0A 1GA9A 3C4OA 3I7JA 2IA2A 2EXAA 5AQ7A 2JBFA 2VZWA 5EVIA 5FQMA 5C5KA 2IWCA 3Q1FA 5G4ZA 5HD3A 2QJ7A 1ONGA 1PI4A 3FPWA 2OLUA 3N6IA 3CUEC 4MEZA 4LV1A 4OPRA 1KE0A 3UDIA 3QP8A 1L3LA 4JKTA 4HESA 3HVFA 4GHIB 2ZC7A 1P9RA 5E2GA 4X6TA 2PU2A 3OPHA 4ZJ2A 5GHXA 3LEZA 3MZDA 4Z1WA 1E3UA 4JPMA 4Y7PA 5DFXA 1T1BA 4PPRA 4Y0TA 2O9CA 2I9VA 2PD7A 4JGQA 3BY8A 3NIAA 2LB5A 5IT5A 4RQ9A 3PBNA 2PAVP 4JXVA 2B95A 5A93A 2D02A 4G3WA 4NXGA 4ETXA 1RCJA 2W1TA 3HUOA 4MN6A 1FCNA 4IHQA 3F1PA 5EVLA 3VMAA 4LV3A 4FUWA 1BZAA 2WAEA 3UPOA 5F6AA 3S7OA 4I3JA 1NRFA 1T18A 3U2AA 3D3OA 3P7NA 1MWRA 2EX2A 5CECA 1TD5A 3GQZA 3KX0X 3LO7A 4BBUA 4X55A 1ES4A 2DNSA 2WZXA 1P9WA 4HIAA 2WADA 2Y2QA 3QP2A 2L0WA 4DXCA 2J8YA 3W4PA 1DP8A 2ZMAA 3KSGA 4JGOA 1WYCA 4EBLA 2V2FF 3IX4A 1YMSA 4JXGA 1S66L 4KUKA 1GHIA 1H5XA 3C30A 2HJ9C 1XPBA 2H0YA 1FSWA 4EEUA 1LL8A 4D60A 5HDDA 4CLCD 3F1NA 3WS1A 4OOYA 5EVIC 3QNBA 3OLOA 1ZHHB 1RGZA 4MMNA 4OPZA 5CRFA 5J8XA 4O01A 3KYZA 2XFTA 4RX2A 4E3MA 2ZD8A 4C3QA 1VETB 3GVBA 3VFHA 4I39A 2BLSA 3MSHA 4EESA 5I5LA 1KGFA 4CLCE 3LCEA 1UGUA 4KZ4A 2Y59A 1TS0A 5A91A 3PAEA 4L9GA 5L07A 3ZDJA 5EVIB 2WYXA 1ACFA 4PAUA 3WS0A 2Y8HA 1YLYA 2HDRA 2CC1A 3ZGAB 2VKSA 2EFUA 5L10A 2ZL1A 1KDSA 2R9WA 3NOUC 2VGLM 3UDXA 2EX9A 2ZM0A 4E3LA 4NK3A 2ZMFA 1XJ6A 4HOIA 1L0EA 3ZG9B 5I94A 1MWSA 5TBMA 3O5YA 1NZOA 2Z2LB 1IOUA 1CI8A 3CMZA 3IS2B 1BT5A 1ZKJA 1DJAA 2OSUA 2P08A 3UE0A 1LHYA 3CLOA 1ONHA 1TS7A 5CEBA 4LGWA 5TR7A 1K0KA 2VV6A 4LPZA 5J3WA 4P0MA 1KVLA 1IYOA 4E3IA 2Y91A 4UQIM 4EETB 2CMNA 4MNRA 1OTIA 3RFBA 1VEUA 3WS4A 1F2KA 5AVEA 1MC0A 3PAGA 3C5AA 3OZHA 3EQVA 2OAP1 4H8RA 3QP6A 4WUJA 2G2UA 5L09A 3ZG0A 3WWXA 3P98A 5F69A 4S2PA 2VV8A 2KX6A 3CG5A 4HBUA 4YWZA 5CHUA 4P6ZM 4EQIA 3MS6A 2W1RA 3W8KA 5HD5A 4I3AA 1PIOA 4YNRA 4KQQA 2XA7S 2HPBA 3D72A 3CWFA 1XJ3A 3JVVA 1W8YA 2WKEA 1VHMA 5HARA 1Z6FA 4CJNA 5A90A 1RP5A 4I3IA 4JGRA 5FA7A 5CEDA 4HH3A 4NEED 1YM1A 1TF1A 2ZMVA 1H0MA 4S2OA 1ESUA 3LI9A 2Y2MA 3IHBA 1PW1A 2V1BA 4Q8IA 3LI8A 3CPTA 3G30A 1A0KA 1BLHA 5EUAA 3NULA 3PBSA 4EUVA 3CAXA 1S67L 4E3JA 3H82A 1D7EA 2Y2GA 3UB5P 2QZ6A 2UV0E 3B3XA 4MBKA 4BENA 3F1OA 4WLAA 3IBRA 5E43A 3ISGA 1OTEA 2JKRM 3PXPA 1Y54A 4S2IA 1BUEA 2P9VA 5D3OA 1NJ4A 1K54A 2QPNA 4EXOA 4Y13A 1K4EA 4LFUA 4KENB 2ZL1B 1ODVA 2GZAA 3PBOA 3EQUA 1N9NA 4YOFA 1IKIA 2VJWA 1GHPA 1XFNA 4KZ9A 3Q07A 5J4EA 3T1RA 1TS6A 5J7EA 2Y2JA 3MKEA 4G3VA 2J3TD 1LI0A 3MXSA 5TBMB 1YT4A 1MPLA 3V3RA 4WYYA 4X25A 2WZZA 3B47A 1OJGA 5AQAA 2B02A 1J9MA 2Y2LA 4FH2A 4MDZA 4Y3IA 4LV0A 3FWLA 2PRFA 1NWZA 3BFDA 1EROA 3C38A 3HLFA 2H28A 5DKLA 3QP5A 4N1XA 4NKPA 2H5SA 4X1MA 1F98A 1OPXA 1PRQA 4B88A 3IH9A 3NI9A 3ZQ5A 3V5MA 5EECA 4QY6A 2JHEA 1L0GA 4F3LA 3UB6A 3T1XA 2X02A 5CHJA 4KUOA 5IS1A 2WGVA 1VEUB 1FIKA 4XUXA 5EOOA 4GLQA 4O8GA 4YFMA 1YLPA 4WZ5A 4MN7A 4FSFA 4GJ4A 1SDEA 5JYOA 4O0PA 4B93A 3G2YA 3VFFA 3A3DA 5M1AA 1CJFA 3G31A 4MLLA 4B4ZA 5DFYA 2WUQA 3LIEA 3PYPA 3QP1A 3RTYA 3IH8A 5HL6A 3LR4A 5CHMA 1FCOA 2Q9NA 3MFDA 3BFGA 4NETA 3A0SA 1F9IA 3VSLA 4IJGA 3VP3A 1NYMA 3C8CA 3TG9A 2PR5A 1BTLA 2PD8A 1RGYA 3OBFA 5KZHA 4Y0OA 5HDCA 1EI5A 5CGWA 5G18A 2W27A 1AXBA 3ULFA 1PI5A 3AGFA 3IXBA 1GA0A 3K3CA 3S7NA 1E4DA 3ZG5A 1H8ZA 1YLZA 5AVFA 5FI6A 1BLPA 1SDNA 4Y15A 4GN2A 2XR0A 2J7VA 4IEDA 4BLMA 5HX9A 1M40A 3MZEA 1K54C 4HBTA 4LCLA 4I38A 4Q0HA 3SS4A 3W2ZA 5KSCA 5TGFA 1D1JA 3G6OA 5FI2A 4ETZA 4E6XA 2VX8A 3T12B 4N9LA 4EUZA 3Q7VA 3DWZA 1PWCA 1FCMA 4ZRRA 4YINA 3F1OB 1LL9A 4PKYA 1LSVA 5FEGA 3A3JA 1MBLA 2W3GA 4DE2A 3S7PA 3IHAA 4HJ6A 4KZ3A 2A3UA 1W63Q 2O99A 3NBLA 1DRMA 4GD6A 4OP8A 5FL3A 2VV7A 4HI4A 3W4QA 3L7HA 4X53A 1OMEA 4OLDA 3MQ0A 3ZG8B 1H8MA 2G7UA 3FPVA 2FH5A 5EVID 4QD4A 1CF0A 3A3EA 1J3WA 4R3BA 4K08A 2MJ6A 2ZQCA 1D06A 5FDSA 4EEPA 4U0TA 4R3AA 2OAQ1 3M6BA 2M7UA 4ZBEA 4CQHA 3T50A 4WZ5C 3TOIA 3UO9A 4P6BA 2M7VA 2W3DA 3O87A 5AQBA 1KE3A 1FR1A 1PZOA 4KZBA 5HAIA 3MFXA 2PR6A 1ZG4A 1CQAA 3IX8A 4F3LB 1STZA 1E3UD 4EQ1A 1JWZA 5FQ9A 1PYYA 1YKDA 2PHYA 2KDKA 4QHCA 3OPPA 4PMAA 3BFEA 4R23A 3HLDA 1BLSA 3U4LP 4EU0A 4Y5FA 3WS5A 3CHWP 3HLEA 3B33A 1BYWA 3FYZA 5EM1A 4ID4A 2VGLS 3G35A 5HFOA 3TE8A 4ME4A 1W79A 4WM9A 1MZUA 2HV1A 1H8YA 3RJUA 4IBXA 4EV4A 5DVAA 2J3WA 4HHDA 4BWIA 1PWGA 4ZTKA 1HTZA 5F5YA 3B42A 1K6SA 1TDLA 2IWDA 1YPRA 2GJ3A 4RA7A 4WMCA 3S4XA 4GS9A 2K7SA 1K56D 2EX8A 2V0UA 4U3TA 1CEFA 2FZ0A 3DBAA 3VSKA 3EEAA 4E6WA 3MXQA 2NUPC 3SZTA 1DP6A 3H7WB 2RL3A 1AWIA 3QNCA 2BASA 2EA9A 1SHVA 2PYPA 1LLBA 4X1LA 3IXGA 5HZHA 5F1FA 1W5DA 4E3OA 3LFVA 2Z6DA 3Q7VB 2P74A 3M2KA 3VE4A 4GNUA 1NZUA 5IU1A 3M2JA 4WF0A 4S2LA 2JE5A 3HL9A 3UB9A 4PM7A 2QJ5A 3OPRA 5CTNA 5K5BA 5TJJA 3VE3A 1DY6A 2Q9MA 1ERMA 4MCWA 5DTTA 1NYYA 5FAOA 4L9FA 3EGDC 3LIFA 5F83A 3BEBA 1SKFA 1XFQA 3TJZC 2FFFB 2ZJ9A 3HLWA 2LB9A 1K6RA 5TFQA 2W3FA 2V8FA 5E2FA 4WL9A 3ZNTA 1NLYA 3G34A 2P04A 2XQZA 1V9YA 1MY8A 1KDWA 5GLCA 4BD1A 2EWWA 1PFLA 1P97A 4KG2A 1Y28A 2VK3A 3MMHA 2WKIA 3BQ8A 2O0YA 2W1TB 2JKTM 3T4TA 2V1AA 3F1PB 1WE4A 2J9PA 1L0DA 3G4PA 5M19A 1K38A 3Q82A 4LLOB 3E0YA 4Q0JA 1FR6A 4OP5A 2XEPA 3LR3A 1GSVA 3FC7A 1T1AA 3SH7A 3MXRA 4H6JA 5CTMA 1OJ5A 5HWWA 3VOYA 3MKFA 3HLGA 3A3IA 4Y0UA 1IFQA 2W0NA 1JVJA 3KYEA 5HWTA 3G32A 1XGJA 1YLTA 2ZQ8A 1S6RA 1JTDA 1L2SA 1GSWA 3GDIA 1NLZA 1K55A 4OQGA 3MJQA 4OQHA 5EPHA 4C6YA 3LUQA 1NXYA 2ZC6B 2DRWA 4GS9B 1HVBA 5CGXA 4Q0IA 4DE1A 4HH2A 3C4PA 4MBFA 2A2LA 3F1NB 3PBRA 2PBDP 3IF6A 3N8SA 5DKKA 4WN5A 4FH4A 3LIBA 3D9YA 3BJNA 3ZCZA 4FTXA 5HDSA 4UA6A 2B5RA 2KLIA 1TEMA 2XH9A 4R3JA 1L0FA 2Q0OA 1IYQA 4OOMA 4XT2A 5E2HA 2HJEA 1HLUP 4HNBA 3HBRA 1HD8A 2QYBA 1S1ZA 1KOUA 3LR5A 1O07A 3NC8A 3V39A 4QB8A 1K4FA 1LSWA 4OKPA 3R7WA 2ACGA 3KSIA 2PT7A 3RH8B 2M1CA 1Q2PA 3HCYA 3IF5A 4GCZA 1XX2A 2ZQAA 4C75A 1ZTUA 2B18A 2QKPA 1OT6A 1JWPA 1XKZA 1XXMA 2Y2OA 3BLMA 1Q2QA 2QWSA 5EV0A 4Y17A 4L9EA 5CXWA 4ZJ3A 3GMWA 4IVIA 2HDUA 4DDYA 5F82A 3UE1A 1JTGA 4B9OA 3NOTC 4DXBA 4K0WA 4EW7A 4K91A 2E8IA 4UEYA 3E2KA 1UWNX 2VGKA 2ZM8A 2XLNA 3NDEA 3IWQA 4BBTA 1GCEA 2VA0A 2WKQA 3OC2A 4HJ4A 1OTAA 4KG5A 5M18A 3EGXC 3KO6A 5DTKA 3UN7A 4ZDXA 4NG2A 5FASA 2JCHA 3P01A 1BULA 2ZC4B 3HLBA 4JGPA 4N9KA 2QMIA 1KE4A 4LRZE 3VOLA 5FQKA 3GV9A 2KOIA 1MKMA 5FQJA 3JVUA 3LY3A 4R6LA 4OH0A 5L8MA 2Y2PA 1K55C 4ZAMA 3HJIA 4GKUA 3T4SA 2XD1A 2Y79A 4X69A 4M3KA 1VB6A 3IF6C 3DAVA 4Z9QA 4WEJA 3SS5A 4XXRA 1EWZA 1H3QA 3DWKA 1KGEA 5AQ9A 3V3SA 4L0LA 4MN5A 3BM6A 4LV2A 3SOIA 4S2MA 3ZHHA 3D4FA 2ZOIA 2OOLA 1VQQA 5GLDA 4OONA 3GSGA 3HJKA 3BFFA 1OTDA 5JYPA 1XJ2A 2EFXA 4DDSA 5FQQA 3NDGA 3T4OA 3VV4A 1IYPA 1HZOA 4JF6A 3GTCA 4WEKA 4LCMA 3BWLA 4KZ7A 1MKIA 4N1HA 4ESPA 1I2WA 3CPTB 1FILA 1U60A 4XT2B 2Z6CA 2Y2KA 3IQAA 3H82B 5DJUA 5L2FA 3NY4A 2XK1A 3N8RA 1NY0A 3V50A 1ESIA 2HP5A 5HAQA 4PKYG 5DTSA 3BW6A 5KIZA 2AVXA 4UHUA 3T4QA 2P9VB 3JYIA 1V9ZA 5FAQA 3WRZA 1TVFA 2EX6A 1LI9A 4HEFA 3MF0A 4ARZA 3C7UA 3CZDA 2VEAA 3OCNA 2ZC3B 2Y4AA 1ERQA 3NHQA 4BL2A 1JWVA 5LBRA 1S0WA 3GECA 1LSXA 2RCXA 3FZCA 1C3BA 1X0OA 5HSQA 3ZFZA 1DJBA 1M6KA 2WKRA 4K0XA 3SH9A 4JBFA 3UE6A 4WBGA 4P87A 2O9BA 5DF7A 3IBJA 3HUMA 2OLVA 4R1GA 3RXWA 1N9LA 4UAAA 4PM5A 4IVKA 4GOGA 2K31A 1Y4OA 4D2OA 4AFIA 1FQGA 3DW0A 4LENA 3IS2A 1T1CA 1QMFA 2Y2IA 1E25A 2W3EA 3UPPA 2X01A 4X68A 3R4KA 2ZQDA 2R78A 3O88A 3SW1A 3HREA 1XJ4A 3MQQA 3KSHA
chains in the Genus database with same CATH topology
3T4JA 1G28A 1OTBA 2W3FA 1D7EA 3H82A 2INWA 5AJGA 4DN0A 5DJTA 3UE3A 2J80A 4WL9A 3F1OA 3TRCA 2EWVA 4KQOA 4G3KA 4WLAA 3IBRA 4HJ3A 1YSQA 1OTEA 1NLYA 2JKRM 2P04A 3PXPA 3KYQA 1V9YA 3OOVA 3UMDA 4EERA 5MC7A 2EWWA 3E98A 4EXOA 3EEHA 3LICA 3E4QA 3MQOA 1P97A 3KSFA 4DJ3A 1Y28A 3MMHA 3UB8A 1ODVA 3BQ8A 2GZAA 2J3TC 2O0YA 3PBOA 1GSXA 3EQUA 1N9NA 4YOFA 3ZYTA 5KSHA 3H7WA 2VJWA 2JKTM 1XFNA 2W1TB 3T4TA 2V1AA 2JN7A 5J4EA 3F1PB 1TS6A 2A24B 5J7EA 5HPFA 2V9AA 3R7WB 4G3VA 4GW9A 2J3TD 5TBMB 4KQDA 4CLCA 3UB7A 2ZOHA 1YAXA 4LLOB 3E0YA 4FOFA 4Q0JA 1UWPX 2OWHA 1OJGA 2OWJA 3B47A 3LR3A 1GSVA 4QPRA 3FC7A 5EFWA 5F68A 1T1AA 2HF6A 2B02A 1W63M 3MR0A 4MDZA 4H6JA 4Y3IA 1OJ5A 2YKHA 2IA2A 5HWWA 4UQIS 3OCLA 1NWZA 3C38A 4BMWA 2VZWA 2H28A 1P0ZA 1IFQA 5DKLA 5C5KA 2W0NA 5G4ZA 5HD3A 2QJ7A 5HWTA 4NKPA 1F98A 1OPXA 3FPWA 3CAXA 3ZQ5A 3CUEC 2JHEA 1F5MA 1GSWA 3GDIA 4HP9A 1N9OA 3H9WA 1NLZA 4BBVA 4F3LA 3UB6A 3MJQA 3UMEA 4I5SA 4GHIB 4KUOA 1P9RA 5IS1A 3LUQA 1S4SA 4GS9B 3TW8A 4GLQA 4O8GA 4Q0IA 4IUHA 4HH2A 4P6ZS 4MN7A 2A2LA 4FSFA 4GJ4A 3F1NB 3PBRA 4O0PA 3NOPC 4B93A 5DKKA 4WN5A 3LIBA 4Z1WA 4NXEA 1DP9A 1T1BA 5DFXA 5DFYA 2O9CA 2I9VA 2PD7A 3BJNA 3LIEA 4JGQA 4ARZB 3BY8A 3LR0A 1OT9A 1S4RA 2LB5A 3PYPA 5HDSA 3RTYA 5HL6A 3LR4A 2KLIA 5IT5A 2ZBBA 4RQ9A 3PBNA 3T4LA 3A0SA 1F9IA 4OOMA 4XT2A 2PDRA 4IJGA 2HJEA 4HNBA 3C8CA 2D02A 4G3WA 4NXGA 2PR5A 3A0RA 4ETXA 1LT0A 2QYBA 2PD8A 1S1ZA 1KOUA 2W1TA 3OBFA 3LR5A 4MN6A 4IHQA 2HGVA 3F1PA 1LSWA 3LYXA 5HDCA 3KSIA 3R7WA 2PT7A 3RH8B 5CX7A 5HWVA 2M1CA 5F6AA 3S7OA 2W27A 3HCYA 3ULFA 4GCZA 4I3JA 3CI6A 3K3CA 3S7NA 1T18A 1ZTUA 3U2AA 3T4KA 4IUKA 2B18A 2QKPA 3D3OA 4DJ2A 3P7NA 1OT6A 5AVFA 2O9AA 2QWSA 1G6OA 2P7JA 1TD5A 4L9EA 3PHYA 3KX0X 4BBUA 3W2ZA 4I38A 4Q0HA 4B9OA 1P9WA 4HIAA 3NOTC 4EW7A 2L0WA 3G6OA 4ETZA 1S67L 2VX8A 3C2WA 4UEYA 1S1YA 1DP8A 3KSGA 1UWNX 4JGOA 4ZRRA 4BBTA 3F1OB 4HP4A 4CLCC 4PKYA 2VA0A 2WKQA 3OC2A 2GNXA 1LSVA 4HJ4A 1S66L 4KUKA 4LRYC 3C30A 1YSPA 2HJ9C 1OTAA 2W3GA 4EEUA 3EGXC 3KO6A 1LL8A 1TS8A 3S7PA 4HJ6A 5HDDA 4CLCD 1W63Q 3F1NA 2O99A 3P01A 4HQAA 1DRMA 3EOIA 3S7QA 5FL3A 2VV7A 4HI4A 3OLOA 1ZHHB 4JGPA 3MQ0A 1H8MA 2G7UA 4MMNA 4LRZE 3VOLA 4O01A 3KYZA 2L4RA 2KOIA 3FPVA 1MKMA 2FH5A 3JVUA 4R6LA 5L8MA 4CLCB 4I39A 3ICYA 4K08A 4EESA 5I5LA 3HJIA 4CLCE 4M4XA 2MJ6A 1D06A 3T4SA 2NUTC 4EEPA 1UGUA 4R3AA 2Y79A 2OAQ1 2M7UA 1TS0A 4CQHA 3T50A 4L9GA 4R70A 3NJAA 4PAUA 1VB6A 2Y8HA 2M7VA 2W3DA 4WEJA 2XSSA 1H3QA 4II7A 2VKSA 2K2NA 3MFXA 4L0LA 4MN5A 2PR6A 3NOUC 4Y2FA 2VGLM 4F3LB 1STZA 1NRJA 2QHKA 4EQ1A 4HY8A 3CITA 2ZOIA 2V0WA 1YKDA 2OOLA 2PHYA 2KDKA 2PYRA 2A24A 4NXBA 3A0VA 2ZMFA 1XJ6A 5A8BA 4DMZA 4HOIA 5TBMA 3HJKA 4BJPA 2JKTI 4EU0A 1OTDA 3O5YA 4Y5FA 3B33A 1XJ2A 1BYWA 1IOUA 3K2NA 1WA9A 2VGLS 3IS2B 3T4OA 3VV4A 4NXFA 3TE8A 4WEKA 4ME4A 3BWLA 2P08A 1MZUA 5DF9A 4LRXC 2HV1A 3CLOA 2J3WA 1TS7A 4HHDA 4XT2B 4BWIA 1T19A 2Z6CA 4R38A 5HPIA 3BY9A 3H82B 5DJUA 2VV6A 3PBTA 4LPZA 5F5YA 5J3WA 4UQIM 3B42A 3PR6A 4PKYG 4EETB 2CMNA 3BW6A 5KIZA 2GJ3A 4GHIA 1OTIA 3RFBA 1EW0A 4GS9A 3T4QA 3E4OA 5AVEA 2K7SA 1MC0A 2YKFA 1V9ZA 2V0UA 2FZ0A 3EQVA 3DBAA 2D01A 2OAP1 3EEAA 3MXQA 4WUJA 2NUPC 1DP6A 3H7WB 3MF0A 5F69A 4ARZA 3CUEA 2DMWA 2VV8A 2VEAA 2KX6A 2XA7M 2BASA 2EA9A 3OCNA 4YWZA 3LIAA 2PYPA 3NHQA 3EWKA 5LBRA 4P6ZM 3V67A 5HZHA 2GX5A 3GECA 1LSXA 4WELA 1X0OA 3LFVA 5HSQA 2W1RA 2Z6DA 2WKRA 5HD5A 4H6JB 4I3AA 3VE4A 3UE6A 5IU1A 2XROA 2O9BA 4YNRA 4OOLA 4WF0A 2XA7S 4E04A 3IBJA 3D72A 3CWFA 1XJ3A 3UB9A 3JVVA 4PHTA 2QJ5A 2W3HA 2XRNA 1VHMA 5K5BA 2L1MA 5TJJA 3VE3A 1N9LA 3E4PA 2K31A 4MCWA 4I3IA 4AFIA 4JGRA 3LIDA 2JKRI 4HH3A 4NEED 3IS2A 1TF1A 1T1CA 3BQAA 2ZMVA 4L9FA 3FG8A 2W3EA 3EGDC 3LI9A 5G4YA 3LIFA 2V1BA 3K3DA 1XFQA 3LI8A 3R4KA 2VLGA 2R78A 3PBQA 3TJZC 1JNUA 3SW1A 2WKPA 3PBSA 1XJ4A 3MQQA 4EUVA 3KSHA 2LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G28 A;  1OTB A;  3H82 A;  1D7E A;  2INW A;  5DJT A;  2J80 A;  4WL9 A;  3F1O A;  4WLA A;  3IBR A;  4HJ3 A;  1OTE A;  1V9Y A;  3UMD A;  4EER A;  4EXO A;  3EEH A;  3LIC A;  3E4Q A;  3MQO A;  1P97 A;  4DJ3 A;  1Y28 A;  3UB8 A;  1ODV A;  1GSX A;  1N9N A;  3H7W A;  1XFN A;  2V1A A;  2JN7 A;  5J4E A;  3F1P B;  1TS6 A;  2A24 B;  5J7E A;  2V9A A;  4GW9 A;  5TBM B;  4KQD A;  3UB7 A;  2ZOH A;  4LLO B;  1UWP X;  2OWH A;  1OJG A;  2OWJ A;  1GSV A;  3FC7 A;  5EFW A;  5F68 A;  1T1A A;  2B02 A;  3MR0 A;  4H6J A;  1OJ5 A;  2YKH A;  5HWW A;  1NWZ A;  2H28 A;  1P0Z A;  5DKL A;  2W0N A;  5G4Z A;  5HD3 A;  2QJ7 A;  5HWT A;  1F98 A;  3ZQ5 A;  2JHE A;  1GSW A;  3GDI A;  4HP9 A;  1N9O A;  3H9W A;  4BBV A;  4F3L A;  3UB6 A;  3MJQ A;  3UME A;  4I5S A;  4GHI B;  4KUO A;  5IS1 A;  3LUQ A;  1S4S A;  4GS9 B;  4HH2 A;  3F1N B;  3NOP C;  5DKK A;  4WN5 A;  3LIB A;  4NXE A;  1DP9 A;  1T1B A;  2PD7 A;  2I9V A;  3LIE A;  4JGQ A;  3BY8 A;  1OT9 A;  1S4R A;  3PYP A;  5HDS A;  3RTY A;  2ZBB A;  4RQ9 A;  3A0S A;  1F9I A;  4XT2 A;  2PDR A;  4HNB A;  3C8C A;  2D02 A;  4NXG A;  2PR5 A;  3A0R A;  1LT0 A;  2PD8 A;  1S1Z A;  1KOU A;  4MN6 A;  3F1P A;  1LSW A;  3LYX A;  5HDC A;  3RH8 B;  5HWV A;  2M1C A;  5F6A A;  2W27 A;  3ULF A;  4GCZ A;  4I3J A;  3K3C A;  1T18 A;  2QKP A;  4DJ2 A;  3P7N A;  1OT6 A;  5AVF A;  2QWS A;  2P7J A;  4L9E A;  3PHY A;  3KX0 X;  4BBU A;  4I38 A;  4B9O A;  4HIA A;  3NOT C;  4EW7 A;  2L0W A;  3G6O A;  1S67 L;  3C2W A;  1S1Y A;  1DP8 A;  1UWN X;  4JGO A;  4BBT A;  3F1O B;  4HP4 A;  4PKY A;  2WKQ A;  4HJ4 A;  1LSV A;  1S66 L;  4KUK A;  4LRY C;  1OTA A;  4EEU A;  1LL8 A;  1TS8 A;  4HJ6 A;  5HDD A;  3F1N A;  4HQA A;  1DRM A;  2VV7 A;  4HI4 A;  3OLO A;  4JGP A;  4LRZ E;  3VOL A;  2L4R A;  4R6L A;  4I39 A;  3ICY A;  4K08 A;  4EES A;  5I5L A;  3HJI A;  4M4X A;  1D06 A;  4EEP A;  1UGU A;  4R3A A;  1TS0 A;  3T50 A;  4L9G A;  4R70 A;  3NJA A;  1VB6 A;  3MFX A;  4MN5 A;  2PR6 A;  3NOU C;  4F3L B;  2QHK A;  4EQ1 A;  4HY8 A;  2ZOI A;  2V0W A;  2OOL A;  2PHY A;  2KDK A;  2PYR A;  2A24 A;  4NXB A;  3A0V A;  1XJ6 A;  5A8B A;  4HOI A;  5TBM A;  3HJK A;  1OTD A;  3B33 A;  1XJ2 A;  1BYW A;  1WA9 A;  3IS2 B;  4NXF A;  3BWL A;  1MZU A;  4LRX C;  2HV1 A;  3CLO A;  1TS7 A;  4HHD A;  4XT2 B;  1T19 A;  2Z6C A;  4R38 A;  3BY9 A;  3H82 B;  5DJU A;  2VV6 A;  4LPZ A;  5F5Y A;  5J3W A;  4PKY G;  4EET B;  2CMN A;  5KIZ A;  2GJ3 A;  4GHI A;  1OTI A;  1EW0 A;  4GS9 A;  3E4O A;  5AVE A;  2K7S A;  2YKF A;  1V9Z A;  2V0U A;  2D01 A;  3MXQ A;  4WUJ A;  1DP6 A;  3H7W B;  5F69 A;  2VV8 A;  2VEA A;  2KX6 A;  2BAS A;  2EA9 A;  4YWZ A;  3LIA A;  2PYP A;  3NHQ A;  3EWK A;  5HZH A;  3GEC A;  1LSX A;  1X0O A;  5HSQ A;  2Z6D A;  2WKR A;  5HD5 A;  4H6J B;  4I3A A;  3VE4 A;  3UE6 A;  5IU1 A;  4WF0 A;  4E04 A;  3D72 A;  3CWF A;  1XJ3 A;  3UB9 A;  2QJ5 A;  2L1M A;  3VE3 A;  1N9L A;  3E4P A;  4I3I A;  4JGR A;  3LID A;  4HH3 A;  3IS2 A;  1T1C A;  4L9F A;  3FG8 A;  3LI9 A;  5G4Y A;  3LIF A;  2V1B A;  3K3D A;  1XFQ A;  3LI8 A;  2VLG A;  2R78 A;  1JNU A;  3SW1 A;  2WKP A;  1XJ4 A;  3MQQ A;  3CAX A; 
#chains in the Genus database with same CATH topology
 1MXO A;  3T4J A;  4R4R A;  1OTB A;  3WS2 A;  4DN0 A;  2INW A;  3ZG7 B;  5DJT A;  5A92 A;  3UE3 A;  2HP6 A;  1GHM A;  3TRC A;  3N8L A;  4G3K A;  2JKG A;  3KYQ A;  3OOV A;  3UMD A;  2C5W B;  3G2Z A;  4EWF A;  4IBR A;  3EEH A;  3LIC A;  2Y2N A;  1W7F A;  3E4Q A;  3KSF A;  1W8Q A;  3UB8 A;  3O86 A;  5FSR A;  4RYE A;  1PWD A;  1O7E A;  3BFC A;  2ZC5 B;  3ZYT A;  5KSH A;  5IHV A;  1SCW A;  3UDF A;  4X56 A;  3P09 A;  4DE0 A;  1G5U A;  5HPF A;  5GHZ A;  4GW9 A;  1K56 A;  3BRM A;  4CLC A;  5F1G A;  3C7V A;  1YAX A;  1UWP X;  2OWH A;  2OWJ A;  3LEQ A;  3SH8 A;  1PZP A;  5EFW A;  1W63 M;  2YKH A;  3UY6 A;  4UQI S;  3OCL A;  4BMW A;  2V20 A;  1P0Z A;  1I2S A;  1ES3 A;  4WMC D;  1DJC A;  1G68 A;  4S2N A;  3MBZ A;  2ZQ7 A;  2WGW A;  3VP0 A;  4PM6 A;  3VP1 A;  1SZV A;  3S1Y A;  3L9K A;  1F5M A;  3LY4 A;  4HP9 A;  1N9O A;  3H9W A;  4KZ5 A;  4BBV A;  4N92 A;  1VM1 A;  3UME A;  4I5S A;  2G2W A;  3IXD A;  1S4S A;  3T1S A;  3TW8 A;  4IUH A;  4P6Z S;  1YLW A;  4GDB A;  2WK0 A;  3NOP C;  5CGS A;  3NEC A;  1BLC A;  3ITB A;  4NXE A;  1K57 A;  1DP9 A;  3T1Q B;  4ARZ B;  3WRT A;  3LR0 A;  2GDN A;  1OT9 A;  1S4R A;  1XA7 A;  1YLJ A;  2ZBB A;  4QU3 A;  3VP4 A;  3ZVT A;  4E3N A;  3T4L A;  2BTF P;  4JXW A;  2PDR A;  3IWI A;  4QJG A;  2VGJ A;  4KZA A;  3A0R A;  4GD8 A;  1LT0 A;  2ZM2 A;  5KMW A;  2HGV A;  2XFS A;  2XDM A;  2ZQ9 A;  3ZVW A;  4BL3 A;  3LYX A;  3IX3 A;  5CX7 A;  5HWV A;  1ZC2 A;  3CI6 A;  5U47 A;  3T4K A;  4DRT A;  4IUK A;  3HLC A;  1IKG A;  2PBY A;  4DJ2 A;  4CPK A;  2E8J A;  4P85 A;  4O7D A;  2O9A A;  1G6O A;  2P7J A;  4BD0 A;  4JLF A;  2ZLY A;  3Q81 A;  4JXS A;  3PHY A;  2V8C A;  5CER A;  3DTE A;  1CK3 A;  4JF5 A;  2X71 A;  5GL9 A;  4QWO A;  1FOF A;  3C2W A;  1S1Y A;  4U0X A;  1K25 A;  1LL5 A;  1SKO A;  4HP4 A;  1IYS A;  4CLC C;  3CJM A;  2GNX A;  5EOE A;  1XGI A;  3MZF A;  4LRY C;  1YSP A;  4S2J A;  1TS8 A;  3QHY A;  4R4S A;  3UNW A;  3GRJ A;  4HQA A;  3EOI A;  1CI9 A;  3S7Q A;  1N9B A;  2I72 A;  4JF4 A;  4S2N C;  4F94 A;  4OLG A;  2OV5 A;  5FAP A;  5FEF A;  2L4R A;  3UPN A;  2JC7 A;  2FFY A;  4CLC B;  5BOH A;  3FKW A;  4OQI A;  3ICY A;  1ES5 A;  2J9O A;  1ZG6 A;  4M4X A;  4WZ4 A;  2NUT C;  4DF6 A;  2JKF A;  1FSY A;  3ITA A;  4GB7 A;  2PU4 A;  3IT9 A;  3N4I A;  3BLS A;  4R70 A;  3S22 A;  1WYB A;  3NJA A;  5EE8 A;  2XSS A;  2WGW B;  5E2E A;  3JPU A;  4B4X A;  4OPY A;  4II7 A;  1K57 C;  2K2N A;  5GLB A;  1TDG A;  5GLA A;  4Y2F A;  3RXX A;  1NRJ A;  4UA7 A;  4EBN A;  2QHK A;  4KZ8 A;  4HY8 A;  2XF3 A;  3CIT A;  2V0W A;  2PYR A;  2A24 A;  3E2L A;  3W4O A;  4NXB A;  4OQ0 A;  3A0V A;  5A8B A;  4DMZ A;  3AGE A;  4BJP A;  2JKT I;  4DE3 A;  3A3F A;  1CEG A;  4RX3 A;  3K2N A;  1WA9 A;  5EVE A;  4NXF A;  3Q7Z A;  2A49 A;  5DF9 A;  3QP4 A;  4LRX C;  4S2K A;  3DTI A;  3PTE A;  5EM0 A;  3ZNY A;  1YQS A;  4PM9 A;  2BG1 A;  1PNE A;  1T19 A;  4UA9 A;  3IXH A;  2C6W B;  4R38 A;  5HPI A;  3FKV A;  3BEC A;  3BY9 A;  2XGN A;  5FDH A;  3PBT A;  1IEM A;  1MWT A;  3PR6 A;  4R0Q A;  4RVA A;  4GHI A;  1EW0 A;  1Z09 A;  4BQM A;  3E4O A;  5DF8 A;  5HL1 A;  3GR2 A;  4MBH A;  4FCF A;  2YKF A;  2WGI A;  4KZ6 A;  2D01 A;  1N4O A;  1QME A;  3TSG A;  3CUE A;  2DMW A;  2XA7 M;  5FI7 A;  3LIA A;  2WKH A;  4DKI A;  4OVD A;  4KG6 A;  3EWK A;  3V67 A;  2GX5 A;  2DCF A;  2H10 A;  3NCK A;  4WEL A;  1SKO B;  2HZ5 A;  2HDQ A;  2XD5 A;  4H6J B;  2V1Z A;  2XRO A;  4EBP A;  3DTM A;  4OOL A;  4E04 A;  3VOZ A;  2WAF A;  4PHT A;  2W3H A;  2XRN A;  2L1M A;  3E4P A;  3LID A;  2JKR I;  1XP4 A;  2H0T A;  4GZB A;  3DTK A;  2Z2M B;  3BQA A;  2UWX A;  3FG8 A;  5G4Y A;  1ES2 A;  1ALQ A;  3OPL A;  3K3D A;  3VP2 A;  2VLG A;  3PBQ A;  5HW3 A;  4GDN A;  1JNU A;  1I5Q A;  2WKP A;  4KQR A;  3IWO A;  2IWB A;  2EXB A;  3IF6 B;  5FAT A;  1G28 A;  4XUZ A;  5AJG A;  1YMX A;  3LGO A;  3M6H A;  2J80 A;  3O3V A;  2EWV A;  4KQO A;  1KGG A;  4HJ3 A;  1YSQ A;  1G6A A;  1PW8 A;  3N7W A;  4OPQ A;  5FQI A;  1XA1 A;  4E3K A;  4EER A;  5MC7 A;  4FD8 A;  1IEL A;  2HP9 A;  3E98 A;  2R9X A;  3MQO A;  4DJ3 A;  5HAP A;  5GHY A;  2J3T C;  1GSX A;  1KVM A;  1BSG A;  4PM8 A;  3H7W A;  2JN7 A;  3SS3 A;  2A24 B;  2V9A A;  3R7W B;  3FV7 A;  2HDS A;  4A5R A;  4KQD A;  1VET A;  3AGD A;  3BYD A;  3UB7 A;  2ZOH A;  3HUN A;  4FOF A;  4ZJ1 A;  2Y55 A;  2Y2H A;  1MWU A;  4QPR A;  4QY5 A;  5F68 A;  2HF6 A;  3MR0 A;  1GA9 A;  3C4O A;  3I7J A;  2IA2 A;  2EXA A;  5AQ7 A;  2JBF A;  2VZW A;  5EVI A;  5FQM A;  5C5K A;  2IWC A;  3Q1F A;  5G4Z A;  5HD3 A;  2QJ7 A;  1ONG A;  1PI4 A;  3FPW A;  2OLU A;  3N6I A;  3CUE C;  4MEZ A;  4LV1 A;  4OPR A;  1KE0 A;  3UDI A;  3QP8 A;  1L3L A;  4JKT A;  4HES A;  3HVF A;  4GHI B;  2ZC7 A;  1P9R A;  5E2G A;  4X6T A;  2PU2 A;  3OPH A;  4ZJ2 A;  5GHX A;  3LEZ A;  3MZD A;  4Z1W A;  1E3U A;  4JPM A;  4Y7P A;  5DFX A;  1T1B A;  4PPR A;  4Y0T A;  2O9C A;  2I9V A;  2PD7 A;  4JGQ A;  3BY8 A;  3NIA A;  2LB5 A;  5IT5 A;  4RQ9 A;  3PBN A;  2PAV P;  4JXV A;  2B95 A;  5A93 A;  2D02 A;  4G3W A;  4NXG A;  4ETX A;  1RCJ A;  2W1T A;  3HUO A;  4MN6 A;  1FCN A;  4IHQ A;  3F1P A;  5EVL A;  3VMA A;  4LV3 A;  4FUW A;  1BZA A;  2WAE A;  3UPO A;  5F6A A;  3S7O A;  4I3J A;  1NRF A;  1T18 A;  3U2A A;  3D3O A;  3P7N A;  1MWR A;  2EX2 A;  5CEC A;  1TD5 A;  3GQZ A;  3KX0 X;  3LO7 A;  4BBU A;  4X55 A;  1ES4 A;  2DNS A;  2WZX A;  1P9W A;  4HIA A;  2WAD A;  2Y2Q A;  3QP2 A;  2L0W A;  4DXC A;  2J8Y A;  3W4P A;  1DP8 A;  2ZMA A;  3KSG A;  4JGO A;  1WYC A;  4EBL A;  2V2F F;  3IX4 A;  1YMS A;  4JXG A;  1S66 L;  4KUK A;  1GHI A;  1H5X A;  3C30 A;  2HJ9 C;  1XPB A;  2H0Y A;  1FSW A;  4EEU A;  1LL8 A;  4D60 A;  5HDD A;  4CLC D;  3F1N A;  3WS1 A;  4OOY A;  5EVI C;  3QNB A;  3OLO A;  1ZHH B;  1RGZ A;  4MMN A;  4OPZ A;  5CRF A;  5J8X A;  4O01 A;  3KYZ A;  2XFT A;  4RX2 A;  4E3M A;  2ZD8 A;  4C3Q A;  1VET B;  3GVB A;  3VFH A;  4I39 A;  2BLS A;  3MSH A;  4EES A;  5I5L A;  1KGF A;  4CLC E;  3LCE A;  1UGU A;  4KZ4 A;  2Y59 A;  1TS0 A;  5A91 A;  3PAE A;  4L9G A;  5L07 A;  3ZDJ A;  5EVI B;  2WYX A;  1ACF A;  4PAU A;  3WS0 A;  2Y8H A;  1YLY A;  2HDR A;  2CC1 A;  3ZGA B;  2VKS A;  2EFU A;  5L10 A;  2ZL1 A;  1KDS A;  2R9W A;  3NOU C;  2VGL M;  3UDX A;  2EX9 A;  2ZM0 A;  4E3L A;  4NK3 A;  2ZMF A;  1XJ6 A;  4HOI A;  1L0E A;  3ZG9 B;  5I94 A;  1MWS A;  5TBM A;  3O5Y A;  1NZO A;  2Z2L B;  1IOU A;  1CI8 A;  3CMZ A;  3IS2 B;  1BT5 A;  1ZKJ A;  1DJA A;  2OSU A;  2P08 A;  3UE0 A;  1LHY A;  3CLO A;  1ONH A;  1TS7 A;  5CEB A;  4LGW A;  5TR7 A;  1K0K A;  2VV6 A;  4LPZ A;  5J3W A;  4P0M A;  1KVL A;  1IYO A;  4E3I A;  2Y91 A;  4UQI M;  4EET B;  2CMN A;  4MNR A;  1OTI A;  3RFB A;  1VEU A;  3WS4 A;  1F2K A;  5AVE A;  1MC0 A;  3PAG A;  3C5A A;  3OZH A;  3EQV A;  2OAP 1;  4H8R A;  3QP6 A;  4WUJ A;  2G2U A;  5L09 A;  3ZG0 A;  3WWX A;  3P98 A;  5F69 A;  4S2P A;  2VV8 A;  2KX6 A;  3CG5 A;  4HBU A;  4YWZ A;  5CHU A;  4P6Z M;  4EQI A;  3MS6 A;  2W1R A;  3W8K A;  5HD5 A;  4I3A A;  1PIO A;  4YNR A;  4KQQ A;  2XA7 S;  2HPB A;  3D72 A;  3CWF A;  1XJ3 A;  3JVV A;  1W8Y A;  2WKE A;  1VHM A;  5HAR A;  1Z6F A;  4CJN A;  5A90 A;  1RP5 A;  4I3I A;  4JGR A;  5FA7 A;  5CED A;  4HH3 A;  4NEE D;  1YM1 A;  1TF1 A;  2ZMV A;  1H0M A;  4S2O A;  1ESU A;  3LI9 A;  2Y2M A;  3IHB A;  1PW1 A;  2V1B A;  4Q8I A;  3LI8 A;  3CPT A;  3G30 A;  1A0K A;  1BLH A;  5EUA A;  3NUL A;  3PBS A;  4EUV A;  3CAX A;  1S67 L;  4E3J A;  3H82 A;  1D7E A;  2Y2G A;  3UB5 P;  2QZ6 A;  2UV0 E;  3B3X A;  4MBK A;  4BEN A;  3F1O A;  4WLA A;  3IBR A;  5E43 A;  3ISG A;  1OTE A;  2JKR M;  3PXP A;  1Y54 A;  4S2I A;  1BUE A;  2P9V A;  5D3O A;  1NJ4 A;  1K54 A;  2QPN A;  4EXO A;  4Y13 A;  1K4E A;  4LFU A;  4KEN B;  2ZL1 B;  1ODV A;  2GZA A;  3PBO A;  3EQU A;  1N9N A;  4YOF A;  1IKI A;  2VJW A;  1GHP A;  1XFN A;  4KZ9 A;  3Q07 A;  5J4E A;  3T1R A;  1TS6 A;  5J7E A;  2Y2J A;  3MKE A;  4G3V A;  2J3T D;  1LI0 A;  3MXS A;  5TBM B;  1YT4 A;  1MPL A;  3V3R A;  4WYY A;  4X25 A;  2WZZ A;  3B47 A;  1OJG A;  5AQA A;  2B02 A;  1J9M A;  2Y2L A;  4FH2 A;  4MDZ A;  4Y3I A;  4LV0 A;  3FWL A;  2PRF A;  1NWZ A;  3BFD A;  1ERO A;  3C38 A;  3HLF A;  2H28 A;  5DKL A;  3QP5 A;  4N1X A;  4NKP A;  2H5S A;  4X1M A;  1F98 A;  1OPX A;  1PRQ A;  4B88 A;  3IH9 A;  3NI9 A;  3ZQ5 A;  3V5M A;  5EEC A;  4QY6 A;  2JHE A;  1L0G A;  4F3L A;  3UB6 A;  3T1X A;  2X02 A;  5CHJ A;  4KUO A;  5IS1 A;  2WGV A;  1VEU B;  1FIK A;  4XUX A;  5EOO A;  4GLQ A;  4O8G A;  4YFM A;  1YLP A;  4WZ5 A;  4MN7 A;  4FSF A;  4GJ4 A;  1SDE A;  5JYO A;  4O0P A;  4B93 A;  3G2Y A;  3VFF A;  3A3D A;  5M1A A;  1CJF A;  3G31 A;  4MLL A;  4B4Z A;  5DFY A;  2WUQ A;  3LIE A;  3PYP A;  3QP1 A;  3RTY A;  3IH8 A;  5HL6 A;  3LR4 A;  5CHM A;  1FCO A;  2Q9N A;  3MFD A;  3BFG A;  4NET A;  3A0S A;  1F9I A;  3VSL A;  4IJG A;  3VP3 A;  1NYM A;  3C8C A;  3TG9 A;  2PR5 A;  1BTL A;  2PD8 A;  1RGY A;  3OBF A;  5KZH A;  4Y0O A;  5HDC A;  1EI5 A;  5CGW A;  5G18 A;  2W27 A;  1AXB A;  3ULF A;  1PI5 A;  3AGF A;  3IXB A;  1GA0 A;  3K3C A;  3S7N A;  1E4D A;  3ZG5 A;  1H8Z A;  1YLZ A;  5AVF A;  5FI6 A;  1BLP A;  1SDN A;  4Y15 A;  4GN2 A;  2XR0 A;  2J7V A;  4IED A;  4BLM A;  5HX9 A;  1M40 A;  3MZE A;  1K54 C;  4HBT A;  4LCL A;  4I38 A;  4Q0H A;  3SS4 A;  3W2Z A;  5KSC A;  5TGF A;  1D1J A;  3G6O A;  5FI2 A;  4ETZ A;  4E6X A;  2VX8 A;  3T12 B;  4N9L A;  4EUZ A;  3Q7V A;  3DWZ A;  1PWC A;  1FCM A;  4ZRR A;  4YIN A;  3F1O B;  1LL9 A;  4PKY A;  1LSV A;  5FEG A;  3A3J A;  1MBL A;  2W3G A;  4DE2 A;  3S7P A;  3IHA A;  4HJ6 A;  4KZ3 A;  2A3U A;  1W63 Q;  2O99 A;  3NBL A;  1DRM A;  4GD6 A;  4OP8 A;  5FL3 A;  2VV7 A;  4HI4 A;  3W4Q A;  3L7H A;  4X53 A;  1OME A;  4OLD A;  3MQ0 A;  3ZG8 B;  1H8M A;  2G7U A;  3FPV A;  2FH5 A;  5EVI D;  4QD4 A;  1CF0 A;  3A3E A;  1J3W A;  4R3B A;  4K08 A;  2MJ6 A;  2ZQC A;  1D06 A;  5FDS A;  4EEP A;  4U0T A;  4R3A A;  2OAQ 1;  3M6B A;  2M7U A;  4ZBE A;  4CQH A;  3T50 A;  4WZ5 C;  3TOI A;  3UO9 A;  4P6B A;  2M7V A;  2W3D A;  3O87 A;  5AQB A;  1KE3 A;  1FR1 A;  1PZO A;  4KZB A;  5HAI A;  3MFX A;  2PR6 A;  1ZG4 A;  1CQA A;  3IX8 A;  4F3L B;  1STZ A;  1E3U D;  4EQ1 A;  1JWZ A;  5FQ9 A;  1PYY A;  1YKD A;  2PHY A;  2KDK A;  4QHC A;  3OPP A;  4PMA A;  3BFE A;  4R23 A;  3HLD A;  1BLS A;  3U4L P;  4EU0 A;  4Y5F A;  3WS5 A;  3CHW P;  3HLE A;  3B33 A;  1BYW A;  3FYZ A;  5EM1 A;  4ID4 A;  2VGL S;  3G35 A;  5HFO A;  3TE8 A;  4ME4 A;  1W79 A;  4WM9 A;  1MZU A;  2HV1 A;  1H8Y A;  3RJU A;  4IBX A;  4EV4 A;  5DVA A;  2J3W A;  4HHD A;  4BWI A;  1PWG A;  4ZTK A;  1HTZ A;  5F5Y A;  3B42 A;  1K6S A;  1TDL A;  2IWD A;  1YPR A;  2GJ3 A;  4RA7 A;  4WMC A;  3S4X A;  4GS9 A;  2K7S A;  1K56 D;  2EX8 A;  2V0U A;  4U3T A;  1CEF A;  2FZ0 A;  3DBA A;  3VSK A;  3EEA A;  4E6W A;  3MXQ A;  2NUP C;  3SZT A;  1DP6 A;  3H7W B;  2RL3 A;  1AWI A;  3QNC A;  2BAS A;  2EA9 A;  1SHV A;  2PYP A;  1LLB A;  4X1L A;  3IXG A;  5HZH A;  5F1F A;  1W5D A;  4E3O A;  3LFV A;  2Z6D A;  3Q7V B;  2P74 A;  3M2K A;  3VE4 A;  4GNU A;  1NZU A;  5IU1 A;  3M2J A;  4WF0 A;  4S2L A;  2JE5 A;  3HL9 A;  3UB9 A;  4PM7 A;  2QJ5 A;  3OPR A;  5CTN A;  5K5B A;  5TJJ A;  3VE3 A;  1DY6 A;  2Q9M A;  1ERM A;  4MCW A;  5DTT A;  1NYY A;  5FAO A;  4L9F A;  3EGD C;  3LIF A;  5F83 A;  3BEB A;  1SKF A;  1XFQ A;  3TJZ C;  2FFF B;  2ZJ9 A;  3HLW A;  2LB9 A;  1K6R A;  5TFQ A;  2W3F A;  2V8F A;  5E2F A;  4WL9 A;  3ZNT A;  1NLY A;  3G34 A;  2P04 A;  2XQZ A;  1V9Y A;  1MY8 A;  1KDW A;  5GLC A;  4BD1 A;  2EWW A;  1PFL A;  1P97 A;  4KG2 A;  1Y28 A;  2VK3 A;  3MMH A;  2WKI A;  3BQ8 A;  2O0Y A;  2W1T B;  2JKT M;  3T4T A;  2V1A A;  3F1P B;  1WE4 A;  2J9P A;  1L0D A;  3G4P A;  5M19 A;  1K38 A;  3Q82 A;  4LLO B;  3E0Y A;  4Q0J A;  1FR6 A;  4OP5 A;  2XEP A;  3LR3 A;  1GSV A;  3FC7 A;  1T1A A;  3SH7 A;  3MXR A;  4H6J A;  5CTM A;  1OJ5 A;  5HWW A;  3VOY A;  3MKF A;  3HLG A;  3A3I A;  4Y0U A;  1IFQ A;  2W0N A;  1JVJ A;  3KYE A;  5HWT A;  3G32 A;  1XGJ A;  1YLT A;  2ZQ8 A;  1S6R A;  1JTD A;  1L2S A;  1GSW A;  3GDI A;  1NLZ A;  1K55 A;  4OQG A;  3MJQ A;  4OQH A;  5EPH A;  4C6Y A;  3LUQ A;  1NXY A;  2ZC6 B;  2DRW A;  4GS9 B;  1HVB A;  5CGX A;  4Q0I A;  4DE1 A;  4HH2 A;  3C4P A;  4MBF A;  2A2L A;  3F1N B;  3PBR A;  2PBD P;  3IF6 A;  3N8S A;  5DKK A;  4WN5 A;  4FH4 A;  3LIB A;  3D9Y A;  3BJN A;  3ZCZ A;  4FTX A;  5HDS A;  4UA6 A;  2B5R A;  2KLI A;  1TEM A;  2XH9 A;  4R3J A;  1L0F A;  2Q0O A;  1IYQ A;  4OOM A;  4XT2 A;  5E2H A;  2HJE A;  1HLU P;  4HNB A;  3HBR A;  1HD8 A;  2QYB A;  1S1Z A;  1KOU A;  3LR5 A;  1O07 A;  3NC8 A;  3V39 A;  4QB8 A;  1K4F A;  1LSW A;  4OKP A;  3R7W A;  2ACG A;  3KSI A;  2PT7 A;  3RH8 B;  2M1C A;  1Q2P A;  3HCY A;  3IF5 A;  4GCZ A;  1XX2 A;  2ZQA A;  4C75 A;  1ZTU A;  2B18 A;  2QKP A;  1OT6 A;  1JWP A;  1XKZ A;  1XXM A;  2Y2O A;  3BLM A;  1Q2Q A;  2QWS A;  5EV0 A;  4Y17 A;  4L9E A;  5CXW A;  4ZJ3 A;  3GMW A;  4IVI A;  2HDU A;  4DDY A;  5F82 A;  3UE1 A;  1JTG A;  4B9O A;  3NOT C;  4DXB A;  4K0W A;  4EW7 A;  4K91 A;  2E8I A;  4UEY A;  3E2K A;  1UWN X;  2VGK A;  2ZM8 A;  2XLN A;  3NDE A;  3IWQ A;  4BBT A;  1GCE A;  2VA0 A;  2WKQ A;  3OC2 A;  4HJ4 A;  1OTA A;  4KG5 A;  5M18 A;  3EGX C;  3KO6 A;  5DTK A;  3UN7 A;  4ZDX A;  4NG2 A;  5FAS A;  2JCH A;  3P01 A;  1BUL A;  2ZC4 B;  3HLB A;  4JGP A;  4N9K A;  2QMI A;  1KE4 A;  4LRZ E;  3VOL A;  5FQK A;  3GV9 A;  2KOI A;  1MKM A;  5FQJ A;  3JVU A;  3LY3 A;  4R6L A;  4OH0 A;  5L8M A;  2Y2P A;  1K55 C;  4ZAM A;  3HJI A;  4GKU A;  3T4S A;  2XD1 A;  2Y79 A;  4X69 A;  4M3K A;  1VB6 A;  3IF6 C;  3DAV A;  4Z9Q A;  4WEJ A;  3SS5 A;  4XXR A;  1EWZ A;  1H3Q A;  3DWK A;  1KGE A;  5AQ9 A;  3V3S A;  4L0L A;  4MN5 A;  3BM6 A;  4LV2 A;  3SOI A;  4S2M A;  3ZHH A;  3D4F A;  2ZOI A;  2OOL A;  1VQQ A;  5GLD A;  4OON A;  3GSG A;  3HJK A;  3BFF A;  1OTD A;  5JYP A;  1XJ2 A;  2EFX A;  4DDS A;  5FQQ A;  3NDG A;  3T4O A;  3VV4 A;  1IYP A;  1HZO A;  4JF6 A;  3GTC A;  4WEK A;  4LCM A;  3BWL A;  4KZ7 A;  1MKI A;  4N1H A;  4ESP A;  1I2W A;  3CPT B;  1FIL A;  1U60 A;  4XT2 B;  2Z6C A;  2Y2K A;  3IQA A;  3H82 B;  5DJU A;  5L2F A;  3NY4 A;  2XK1 A;  3N8R A;  1NY0 A;  3V50 A;  1ESI A;  2HP5 A;  5HAQ A;  4PKY G;  5DTS A;  3BW6 A;  5KIZ A;  2AVX A;  4UHU A;  3T4Q A;  2P9V B;  3JYI A;  1V9Z A;  5FAQ A;  3WRZ A;  1TVF A;  2EX6 A;  1LI9 A;  4HEF A;  3MF0 A;  4ARZ A;  3C7U A;  3CZD A;  2VEA A;  3OCN A;  2ZC3 B;  2Y4A A;  1ERQ A;  3NHQ A;  4BL2 A;  1JWV A;  5LBR A;  1S0W A;  3GEC A;  1LSX A;  2RCX A;  3FZC A;  1C3B A;  1X0O A;  5HSQ A;  3ZFZ A;  1DJB A;  1M6K A;  2WKR A;  4K0X A;  3SH9 A;  4JBF A;  3UE6 A;  4WBG A;  4P87 A;  2O9B A;  5DF7 A;  3IBJ A;  3HUM A;  2OLV A;  4R1G A;  3RXW A;  1N9L A;  4UAA A;  4PM5 A;  4IVK A;  4GOG A;  2K31 A;  1Y4O A;  4D2O A;  4AFI A;  1FQG A;  3DW0 A;  4LEN A;  3IS2 A;  1T1C A;  1QMF A;  2Y2I A;  1E25 A;  2W3E A;  3UPP A;  2X01 A;  4X68 A;  3R4K A;  2ZQD A;  2R78 A;  3O88 A;  3SW1 A;  3HRE A;  1XJ4 A;  3MQQ A;  3KSH A; 
#chains in the Genus database with same CATH homology
 3T4J A;  1G28 A;  1OTB A;  2W3F A;  1D7E A;  3H82 A;  2INW A;  5AJG A;  4DN0 A;  5DJT A;  3UE3 A;  2J80 A;  4WL9 A;  3F1O A;  3TRC A;  2EWV A;  4KQO A;  4G3K A;  4WLA A;  3IBR A;  4HJ3 A;  1YSQ A;  1OTE A;  1NLY A;  2JKR M;  2P04 A;  3PXP A;  3KYQ A;  1V9Y A;  3OOV A;  3UMD A;  4EER A;  5MC7 A;  2EWW A;  3E98 A;  4EXO A;  3EEH A;  3LIC A;  3E4Q A;  3MQO A;  1P97 A;  3KSF A;  4DJ3 A;  1Y28 A;  3MMH A;  3UB8 A;  1ODV A;  3BQ8 A;  2GZA A;  2J3T C;  2O0Y A;  3PBO A;  1GSX A;  3EQU A;  1N9N A;  4YOF A;  3ZYT A;  5KSH A;  3H7W A;  2VJW A;  2JKT M;  1XFN A;  2W1T B;  3T4T A;  2V1A A;  2JN7 A;  5J4E A;  3F1P B;  1TS6 A;  2A24 B;  5J7E A;  5HPF A;  2V9A A;  3R7W B;  4G3V A;  4GW9 A;  2J3T D;  5TBM B;  4KQD A;  4CLC A;  3UB7 A;  2ZOH A;  1YAX A;  4LLO B;  3E0Y A;  4FOF A;  4Q0J A;  1UWP X;  2OWH A;  1OJG A;  2OWJ A;  3B47 A;  3LR3 A;  1GSV A;  4QPR A;  3FC7 A;  5EFW A;  5F68 A;  1T1A A;  2HF6 A;  2B02 A;  1W63 M;  3MR0 A;  4MDZ A;  4H6J A;  4Y3I A;  1OJ5 A;  2YKH A;  2IA2 A;  5HWW A;  4UQI S;  3OCL A;  1NWZ A;  3C38 A;  4BMW A;  2VZW A;  2H28 A;  1P0Z A;  1IFQ A;  5DKL A;  5C5K A;  2W0N A;  5G4Z A;  5HD3 A;  2QJ7 A;  5HWT A;  4NKP A;  1F98 A;  1OPX A;  3FPW A;  3CAX A;  3ZQ5 A;  3CUE C;  2JHE A;  1F5M A;  1GSW A;  3GDI A;  4HP9 A;  1N9O A;  3H9W A;  1NLZ A;  4BBV A;  4F3L A;  3UB6 A;  3MJQ A;  3UME A;  4I5S A;  4GHI B;  4KUO A;  1P9R A;  5IS1 A;  3LUQ A;  1S4S A;  4GS9 B;  3TW8 A;  4GLQ A;  4O8G A;  4Q0I A;  4IUH A;  4HH2 A;  4P6Z S;  4MN7 A;  2A2L A;  4FSF A;  4GJ4 A;  3F1N B;  3PBR A;  4O0P A;  3NOP C;  4B93 A;  5DKK A;  4WN5 A;  3LIB A;  4Z1W A;  4NXE A;  1DP9 A;  1T1B A;  5DFX A;  5DFY A;  2O9C A;  2I9V A;  2PD7 A;  3BJN A;  3LIE A;  4JGQ A;  4ARZ B;  3BY8 A;  3LR0 A;  1OT9 A;  1S4R A;  2LB5 A;  3PYP A;  5HDS A;  3RTY A;  5HL6 A;  3LR4 A;  2KLI A;  5IT5 A;  2ZBB A;  4RQ9 A;  3PBN A;  3T4L A;  3A0S A;  1F9I A;  4OOM A;  4XT2 A;  2PDR A;  4IJG A;  2HJE A;  4HNB A;  3C8C A;  2D02 A;  4G3W A;  4NXG A;  2PR5 A;  3A0R A;  4ETX A;  1LT0 A;  2QYB A;  2PD8 A;  1S1Z A;  1KOU A;  2W1T A;  3OBF A;  3LR5 A;  4MN6 A;  4IHQ A;  2HGV A;  3F1P A;  1LSW A;  3LYX A;  5HDC A;  3KSI A;  3R7W A;  2PT7 A;  3RH8 B;  5CX7 A;  5HWV A;  2M1C A;  5F6A A;  3S7O A;  2W27 A;  3HCY A;  3ULF A;  4GCZ A;  4I3J A;  3CI6 A;  3K3C A;  3S7N A;  1T18 A;  1ZTU A;  3U2A A;  3T4K A;  4IUK A;  2B18 A;  2QKP A;  3D3O A;  4DJ2 A;  3P7N A;  1OT6 A;  5AVF A;  2O9A A;  2QWS A;  1G6O A;  2P7J A;  1TD5 A;  4L9E A;  3PHY A;  3KX0 X;  4BBU A;  3W2Z A;  4I38 A;  4Q0H A;  4B9O A;  1P9W A;  4HIA A;  3NOT C;  4EW7 A;  2L0W A;  3G6O A;  4ETZ A;  1S67 L;  2VX8 A;  3C2W A;  4UEY A;  1S1Y A;  1DP8 A;  3KSG A;  1UWN X;  4JGO A;  4ZRR A;  4BBT A;  3F1O B;  4HP4 A;  4CLC C;  4PKY A;  2VA0 A;  2WKQ A;  3OC2 A;  2GNX A;  1LSV A;  4HJ4 A;  1S66 L;  4KUK A;  4LRY C;  3C30 A;  1YSP A;  2HJ9 C;  1OTA A;  2W3G A;  4EEU A;  3EGX C;  3KO6 A;  1LL8 A;  1TS8 A;  3S7P A;  4HJ6 A;  5HDD A;  4CLC D;  1W63 Q;  3F1N A;  2O99 A;  3P01 A;  4HQA A;  1DRM A;  3EOI A;  3S7Q A;  5FL3 A;  2VV7 A;  4HI4 A;  3OLO A;  1ZHH B;  4JGP A;  3MQ0 A;  1H8M A;  2G7U A;  4MMN A;  4LRZ E;  3VOL A;  4O01 A;  3KYZ A;  2L4R A;  2KOI A;  3FPV A;  1MKM A;  2FH5 A;  3JVU A;  4R6L A;  5L8M A;  4CLC B;  4I39 A;  3ICY A;  4K08 A;  4EES A;  5I5L A;  3HJI A;  4CLC E;  4M4X A;  2MJ6 A;  1D06 A;  3T4S A;  2NUT C;  4EEP A;  1UGU A;  4R3A A;  2Y79 A;  2OAQ 1;  2M7U A;  1TS0 A;  4CQH A;  3T50 A;  4L9G A;  4R70 A;  3NJA A;  4PAU A;  1VB6 A;  2Y8H A;  2M7V A;  2W3D A;  4WEJ A;  2XSS A;  1H3Q A;  4II7 A;  2VKS A;  2K2N A;  3MFX A;  4L0L A;  4MN5 A;  2PR6 A;  3NOU C;  4Y2F A;  2VGL M;  4F3L B;  1STZ A;  1NRJ A;  2QHK A;  4EQ1 A;  4HY8 A;  3CIT A;  2ZOI A;  2V0W A;  1YKD A;  2OOL A;  2PHY A;  2KDK A;  2PYR A;  2A24 A;  4NXB A;  3A0V A;  2ZMF A;  1XJ6 A;  5A8B A;  4DMZ A;  4HOI A;  5TBM A;  3HJK A;  4BJP A;  2JKT I;  4EU0 A;  1OTD A;  3O5Y A;  4Y5F A;  3B33 A;  1XJ2 A;  1BYW A;  1IOU A;  3K2N A;  1WA9 A;  2VGL S;  3IS2 B;  3T4O A;  3VV4 A;  4NXF A;  3TE8 A;  4WEK A;  4ME4 A;  3BWL A;  2P08 A;  1MZU A;  5DF9 A;  4LRX C;  2HV1 A;  3CLO A;  2J3W A;  1TS7 A;  4HHD A;  4XT2 B;  4BWI A;  1T19 A;  2Z6C A;  4R38 A;  5HPI A;  3BY9 A;  3H82 B;  5DJU A;  2VV6 A;  3PBT A;  4LPZ A;  5F5Y A;  5J3W A;  4UQI M;  3B42 A;  3PR6 A;  4PKY G;  4EET B;  2CMN A;  3BW6 A;  5KIZ A;  2GJ3 A;  4GHI A;  1OTI A;  3RFB A;  1EW0 A;  4GS9 A;  3T4Q A;  3E4O A;  5AVE A;  2K7S A;  1MC0 A;  2YKF A;  1V9Z A;  2V0U A;  2FZ0 A;  3EQV A;  3DBA A;  2D01 A;  2OAP 1;  3EEA A;  3MXQ A;  4WUJ A;  2NUP C;  1DP6 A;  3H7W B;  3MF0 A;  5F69 A;  4ARZ A;  3CUE A;  2DMW A;  2VV8 A;  2VEA A;  2KX6 A;  2XA7 M;  2BAS A;  2EA9 A;  3OCN A;  4YWZ A;  3LIA A;  2PYP A;  3NHQ A;  3EWK A;  5LBR A;  4P6Z M;  3V67 A;  5HZH A;  2GX5 A;  3GEC A;  1LSX A;  4WEL A;  1X0O A;  3LFV A;  5HSQ A;  2W1R A;  2Z6D A;  2WKR A;  5HD5 A;  4H6J B;  4I3A A;  3VE4 A;  3UE6 A;  5IU1 A;  2XRO A;  2O9B A;  4YNR A;  4OOL A;  4WF0 A;  2XA7 S;  4E04 A;  3IBJ A;  3D72 A;  3CWF A;  1XJ3 A;  3UB9 A;  3JVV A;  4PHT A;  2QJ5 A;  2W3H A;  2XRN A;  1VHM A;  5K5B A;  2L1M A;  5TJJ A;  3VE3 A;  1N9L A;  3E4P A;  2K31 A;  4MCW A;  4I3I A;  4AFI A;  4JGR A;  3LID A;  2JKR I;  4HH3 A;  4NEE D;  3IS2 A;  1TF1 A;  1T1C A;  3BQA A;  2ZMV A;  4L9F A;  3FG8 A;  2W3E A;  3EGD C;  3LI9 A;  5G4Y A;  3LIF A;  2V1B A;  3K3D A;  1XFQ A;  3LI8 A;  3R4K A;  2VLG A;  2R78 A;  3PBQ A;  3TJZ C;  1JNU A;  3SW1 A;  2WKP A;  3PBS A;  1XJ4 A;  3MQQ A;  4EUV A;  3KSH A;  2LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...