4BBTA

The pr1 photocycle intermediate of photoactive yellow protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbtA00
3BY9A 2W0NA 1OJ5A 1MZUA 3ZQ5A 5HZHA 1D7EA 5J7EA 1T1CA 2QHKA 2WKPA 2PD8A 3H9WA 3IS2A 5HD5A 2VV6A 3NJAA 1T19A 5HDDA 3HJKA 5HDSA 3C8CA 2PD7A 3UB7A 3E4OA 2YKFA 2V9AA 4MN5A 4R38A 3NOTC 4LLOB 2PYRA 4LPZA 5HD3A 1UGUA 1T1BA 4LRZE 5F69A 5HWTA 2VEAA 4JGRA 1D06A 5KIZA 4R6LA 3KX0X 3ICYA 1UWPX 1DRMA 4HOIA 3T50A 4M4XA 3FC7A 3F1OB 4HIAA 4HP4A 4WF0A 3UMDA 3IS2B 1V9ZA 2V0UA 4EQ1A 4I39A 3EEHA 3LIAA 1LSWA 4DJ2A 1S1ZA 3UMEA 3MFXA 1DP6A 1DP9A 5J3WA 2PYPA 3A0RA 3UE6A 2KX6A 4BBUA 3VOLA 3D72A 1GSXA 4JGPA 1TS6A 3VE4A 1T1AA 3G6OA 3H7WA 2ZOHA 2PR5A 4NXBA 3LI8A 3RH8B 2H28A 5HWVA 2L0WA 2OOLA 3F1NA 3NHQA 5G4ZA 3LIFA 5F5YA 2A24A 3LICA 3LIDA 3H82A 4HQAA 4L9FA 3GECA 2WKRA 5AVFA 1GSWA 1TS7A 4WN5A 2QWSA 4BBTA 4EEUA 5F6AA 5EFWA 2VLGA 3H7WB 3F1OA 1F9IA 1OTIA 3K3DA 3LI9A 4EEPA 5HDCA 3LIEA 2ZOIA 4RQ9A 3PHYA 2BASA 3IBRA 3MXQA 3CAXA 3F1NB 2V1AA 3UB9A 4K08A 2V0WA 2A24B 4HJ3A 4LRYC 3H82B 1LT0A 3LIBA 1XJ6A 5DKKA 1KOUA 4GCZA 4HH3A 4NXGA 1TS8A 3BWLA 5TBMB 1T18A 2J80A 4WLAA 1LSXA 1OTBA 4GHIB 1XJ2A 1P0ZA 3HJIA 1NWZA 1X0OA 2GJ3A 5G4YA 4HJ4A 1TS0A 1OTAA 4JGQA 1XFNA 4I5SA 3MJQA 3PYPA 2PHYA 2ZBBA 1S1YA 4L9EA 3ULFA 4R70A 5HSQA 4GS9A 1XJ3A 4KQDA 1OTDA 2KDKA 4HH2A 4KUKA 1LSVA 1OT6A 4H6JB 3NOPC 1S66L 4GW9A 4I38A 1EW0A 3UB6A 5AVEA 1S67L 2QJ7A 2M1CA 2Z6CA 3EWKA 4XT2A 1OT9A 1G28A 2YKHA 5HWWA 2L1MA 4HJ6A 3UB8A 2VV8A 4MN6A 4HP9A 5TBMA 1XFQA 5I5LA 4GS9B 5DKLA 2D01A 3CWFA 4DJ3A 2I9VA 2JHEA 2K7SA 4GHIA 5DJUA 1LL8A 2W27A 1F98A 3BY8A 1Y28A 4EW7A 4L9GA 2Z6DA 4NXFA 4EETB 1DP8A 1BYWA 5F68A 3OLOA 4XT2B 5IS1A 2OWHA 2PR6A 5A8BA 4JGOA 2P7JA 4R3AA 2VV7A 4E04A 3F1PA 2D02A 5DJTA 1P97A 3MQOA 2L4RA 2WKQA 2QKPA 4NXEA 4F3LA 2PDRA 4H6JA 1ODVA 2INWA 3NOUC 4LRXC 4HI4A 2OWJA 3A0SA 3K3CA 4I3IA 4YWZA 4B9OA 3GDIA 5IU1A 2R78A 2CMNA 4WL9A 1S4RA 1VB6A 3VE3A 3E4PA 4BBVA 2B02A 2EA9A 3MR0A 4I3AA 1XJ4A 3A0VA 1OTEA 1S4SA 1N9NA 4EERA 3E4QA 3F1PB 1JNUA 4WUJA 4EXOA 4I3JA 3P7NA 4HY8A 3RTYA 4HNBA 4F3LB 1N9LA 4PKYG 2JN7A 2QJ5A 4KUOA 2V1BA 3MQQA 3B33A 1UWNX 4PKYA 4EESA 3FG8A 3SW1A 3CLOA 3C2WA 3LYXA 4HHDA 5J4EA 2HV1A 1OJGA 3LUQA 1V9YA 1GSVA 1N9OA 1WA9A
chains in the Genus database with same CATH superfamily
1KVLA 5TJJA 3E2LA 3ZVWA 1K54A 3ZQ5A 5MC7A 2JKGA 4S2IA 4ETZA 1WYBA 2UWXA 2QHKA 2PD8A 3BECA 3H9WA 3IS2A 1JWZA 4KG6A 3DTEA 4ARZB 2EWVA 3HJKA 4DRTA 2PD7A 4KZ5A 2YKFA 2V9AA 3LR3A 1SDNA 2MJ6A 4H8RA 1XX2A 2ZL1A 4MN5A 1VEUB 4LLOB 2PYRA 1UGUA 3E2KA 5HWTA 2VEAA 4E6XA 1XGJA 2VK3A 1ONHA 4E3KA 2J7VA 1UWPX 1DRMA 4HOIA 3QHYA 3UE0A 2W1TA 3HLDA 2PU2A 3M2JA 3DWKA 4WF0A 2V0UA 4ZBEA 2J3TC 4ZJ2A 3T4OA 3UDXA 1L0GA 2PBYA 3UMEA 2R9XA 4S2PA 1ESUA 3MFXA 3G30A 5EPHA 3ZG0A 2ZMAA 2PYPA 4Z1WA 4BL3A 3IXGA 3D72A 3S7PA 4JGPA 1TS6A 1FCMA 3R4KA 3G6OA 3P01A 4PHTA 3RJUA 1YPRA 4OVDA 2PR5A 4BENA 5FSRA 3RH8B 3CMZA 3JPUA 3LY3A 3DTIA 3LFVA 2LB9A 5CERA 5EECA 5DF7A 3NHQA 2WUQA 2FZ0A 1AXBA 2ZQ7A 2A24A 3LICA 3HREA 1VEUA 2ZQCA 3GECA 2WKRA 5JYPA 5HAPA 1GSWA 1TS7A 2EX2A 3IXHA 4WN5A 4DXBA 1H3QA 4OQ0A 2WK0A 3V67A 3RFBA 3T12B 2A3UA 1ZC2A 4EEUA 1J3WA 4KQQA 2BG1A 5AQ9A 4X25A 1F9IA 5CGSA 3NCKA 2Q9MA 4P6ZS 3S4XA 3UDIA 2G7UA 4EEPA 3FKWA 3PHYA 5CHUA 4KZ8A 2EX9A 4K0WA 2ZM8A 4QB8A 3MXQA 3CAXA 1JTGA 2V1AA 2NUPC 3IWQA 1ZTUA 3VMAA 2P9VB 4MBFA 4FTXA 4OPQA 1YLWA 1E3UD 4LRYC 1YT4A 3AGEA 2ACGA 4YFMA 2Y4AA 2O0YA 3BLMA 3LCEA 4UA9A 4IBRA 4MCWA 3NBLA 1TS8A 4MBKA 1YMSA 3OOVA 3OPPA 1H8ZA 1LSXA 1OTBA 2J8YA 3T4LA 4QY5A 2GJ3A 4DMZA 1OTAA 5AQ7A 2ZMFA 3TG9A 5HPIA 5CTNA 1ALQA 4MDZA 3MJQA 3D3OA 2Y79A 2PHYA 5GLAA 2BTFP 4Y0OA 2WYXA 3WS2A 4OH0A 4R70A 4KZ6A 5HSQA 3BJNA 5HAQA 2ZQ9A 4R23A 3ZG9B 4KQDA 4D60A 1GA9A 4GLQA 1BT5A 4LCLA 3MFDA 3NOPC 4FH4A 1BZAA 4GW9A 4I38A 5KZHA 3QP8A 3LR0A 2JCHA 3UB6A 1HZOA 2QJ7A 2KOIA 2HZ5A 2P9VA 3EWKA 2OV5A 3WRTA 2ZC6B 4S2OA 1OT9A 3IF5A 3VOYA 3BYDA 5HWWA 2J3WA 4JKTA 1SHVA 1BLPA 4MN7A 4MN6A 2JKFA 4HP9A 4OPYA 2XFTA 3SZTA 1J9MA 4OONA 4GS9B 4QWOA 3VSLA 2D01A 5CTMA 4II7A 3IH8A 3CWFA 2PRFA 2Y2JA 4RX2A 3GSGA 3PAGA 3HLEA 4GOGA 1PWDA 2ZC3B 5HFOA 1PWGA 1BYWA 1CI8A 1IEMA 1MC0A 5FI2A 5IS1A 1OPXA 2OWHA 4DE2A 4JGOA 2XA7M 3MMHA 4WEKA 3FPWA 1RGZA 4AFIA 5TR7A 3KSIA 3IHAA 2D02A 4WMCD 3Q81A 2RL3A 2WGWB 1FSWA 3MQOA 4KQOA 2L4RA 3NY4A 2QKPA 4NXEA 4F3LA 3C7UA 1ODVA 2Q0OA 1P9WA 4LRXC 1L0FA 4GB7A 3UPPA 3D4FA 4HI4A 3ZG5A 2OWJA 4BWIA 3GQZA 4YWZA 5IU1A 3KYQA 3RXWA 2CMNA 2HP5A 1VB6A 4CPKA 3VE3A 4F94A 5FDSA 2A2LA 2B02A 1TF1A 3MR0A 3A0VA 4LV2A 3FPVA 1LLBA 3MS6A 3OPRA 4EERA 5FASA 1XPBA 2WGIA 1ESIA 3KSFA 4WUJA 2H10A 3HLFA 5J8XA 2HJEA 4XUXA 4YINA 3C7VA 1PW1A 3Q7ZA 2EXAA 3MKEA 1Y54A 5L8MA 3JVVA 1UWNX 4KENB 4PKYA 3CPTB 1O07A 4WZ5C 4LENA 3HL9A 4EWFA 4U0TA 4E3MA 2V8CA 1IKGA 5CGXA 1MBLA 4ZRRA 3D9YA 1VETA 4U3TA 2GDNA 2W0NA 4RYEA 3DW0A 4E6WA 2E8IA 1MZUA 4PM6A 5J7EA 2HDSA 2WKPA 4GN2A 1YM1A 1NZOA 5HD5A 5GLBA 3ZNTA 1SZVA 1ZKJA 3IH9A 4DDSA 1T19A 2XGNA 1K57A 5KSCA 1D1JA 5HDDA 4CLCE 5GHYA 3IHBA 3PBQA 3S7OA 1XXMA 4XXRA 1H8MA 3QNBA 1U60A 5HARA 3DTMA 5K5BA 2IWDA 5EM0A 5HD3A 5HW3A 1FQGA 3NIAA 2HP6A 1EWZA 1D06A 4CLCB 5KIZA 2JE5A 3ICYA 2NUTC 3VP0A 3TJZC 4P87A 4Y2FA 2Y55A 3PTEA 4EUZA 5CXWA 1NYMA 1IYPA 3UMDA 3IS2B 3QP2A 3EEHA 3O3VA 1LSWA 3HVFA 4G3VA 1S1ZA 2J9OA 1IELA 4LV3A 4WELA 3I7JA 1MWTA 1PI5A 4R3BA 1FR6A 3P09A 2B95A 4O0PA 2A49A 3VOLA 1GSXA 2ZL1B 1W63Q 4PPRA 5EV0A 5L2FA 3H7WA 3IX4A 1K25A 2XD1A 2H28A 2WKHA 2VGJA 2OOLA 4IVKA 5HL6A 2G2UA 2KLIA 4LV1A 5G4ZA 5AQAA 1BLHA 5F5YA 4C6YA 3MSHA 4PM7A 3CUEA 4L9FA 2Y2NA 3PBNA 4KG5A 5AVFA 2O9BA 3G31A 4CLCA 3T1QB 1DJBA 1CK3A 4BJPA 4QPRA 4U0XA 5FAPA 1C3BA 5EVIC 1GHMA 4NG2A 2VLGA 1NY0A 5DTSA 3B3XA 3RXXA 4DE0A 3EGDC 3G32A 3UPOA 2XK1A 5M19A 1K6SA 1K6RA 5HDCA 2EFXA 3LIEA 4RQ9A 2Y2HA 2BASA 3IBRA 2K2NA 3HUOA 5CHJA 3BFFA 5EVID 4OQIA 1KE4A 2XF3A 1E3UA 5G18A 4K08A 2V0WA 2A24B 1LT0A 4X6TA 1Y4OA 1XJ6A 4JXWA 4IBXA 4NXGA 1FR1A 1SKOA 1FCOA 1BLCA 1K4EA 5FQ9A 4OLDA 2ZLYA 5E2GA 2ZQ8A 4QD4A 4ZDXA 5EVEA 4GHIB 1XJ2A 2EX8A 5F82A 3HBRA 4ZTKA 1X0OA 4DKIA 2Z2LB 4EBPA 4HJ4A 5G4YA 3S1YA 3PR6A 3V5MA 4FD8A 5DF8A 3S7NA 4BQMA 5HPFA 1NYYA 4JBFA 4CQHA 3HCYA 3AGFA 5EE8A 5KMWA 3Q82A 2J3TD 2O99A 3VOZA 1XJ3A 2RCXA 1OTDA 2XLNA 2KDKA 4WZ4A 3MF0A 1VM1A 5DTTA 3BM6A 4JXSA 4H6JB 4JXGA 5FI6A 4GKUA 2M1CA 1EROA 1GHIA 1N9BA 4XT2A 3CUEC 1G28A 4QU3A 2YKHA 1STZA 3NI9A 4HJ6A 2VV8A 4IJGA 5FAQA 4BL2A 2WZZA 3ZVTA 1XFQA 5I5LA 1K54C 4X55A 1YSQA 2JKTM 1TVFA 1XA1A 3C4OA 2I9VA 1M6KA 4PM8A 1PIOA 5FA7A 4GHIA 4JF6A 1EI5A 3ZFZA 4UAAA 2W27A 3VP3A 1F98A 4R3JA 5D3OA 4IVIA 4EW7A 1YKDA 1PFLA 2WADA 4FOFA 5FQQA 3OLOA 2WKEA 2M7VA 2K31A 5E2EA 4GD6A 2VV7A 3WWXA 4L0LA 4WMCA 2P08A 2VZWA 1WYCA 3F1PA 3NDGA 5DJTA 1P97A 5EOEA 1KE3A 3PBRA 2OAP1 1K56A 2WKQA 4Q0HA 4N9KA 4H6JA 1ES2A 4WBGA 2JKTI 5CEDA 4MBHA 3UN7A 4HESA 3MZDA 2DCFA 1E25A 3HLWA 4P85A 4N92A 4MEZA 4YNRA 3GDIA 1PWCA 3WRZA 2R78A 3VP1A 3V3SA 3VFFA 3HLBA 1LL9A 5DVAA 1KDSA 2VX8A 2EA9A 5A93A 1XJ4A 5CGWA 4N9LA 5LBRA 1PW8A 4G3KA 3KSGA 1DJAA 1ERMA 3CJMA 3E4QA 1CJFA 4EXOA 4ID4A 3RTYA 3Q07A 4GNUA 4F3LB 1N9LA 2Q9NA 4UHUA 2XDMA 4NETA 3GRJA 5CRFA 2JN7A 2WGVA 4JXVA 2R9WA 3UE1A 4PMAA 1YLTA 3MQQA 3B33A 3WS0A 3T1SA 4KZBA 4EESA 2UV0E 3C4PA 3GV9A 5EOOA 2Y2PA 4O8GA 1V9YA 2XQZA 2H0YA 1LI0A 2X02A 5F83A 1GSVA 5TGFA 1MKIA 1WA9A 5EVLA 2V8FA 4QY6A 3BY9A 4ME4A 1L0EA 3NC8A 3CI6A 1BTLA 1YLJA 1GHPA 1D7EA 1XKZA 1T1CA 3GR2A 2QPNA 1I2WA 4X53A 3MZEA 3T1RA 1Z09A 5M18A 4B4ZA 4Y0TA 1CF0A 1PRQA 2Y2GA 5IHVA 2XEPA 4IEDA 4EBLA 3WS4A 3OPLA 3V39A 3UDFA 5GLCA 1BUEA 2O9AA 3E4OA 4UQIM 3CITA 1VETB 1AWIA 4ZAMA 4EQIA 4NK3A 3FKVA 4P6BA 3IX8A 3NOTC 1PYYA 1T1BA 2XSSA 3SS4A 4QJGA 4B88A 1TDLA 3KX0X 2Y59A 1ES3A 1K0KA 3Q1FA 2XA7S 3FC7A 5CX7A 2C6WB 1IKIA 1V9ZA 4EQ1A 4I39A 3LIAA 3ZDJA 2XH9A 3OZHA 5FAOA 1TDGA 5EUAA 3GVBA 1DP6A 5J3WA 2XR0A 3A0RA 3L7HA 3ZNYA 2DRWA 4BBUA 1PZOA 2ZC4B 3DBAA 3LY4A 4X69A 1ZG6A 3VP4A 1T1AA 4OP8A 3IF6B 4S2JA 5L09A 4ESPA 2ZOHA 4WEJA 3PAEA 4Y0UA 4NXBA 3SS5A 4ZJ3A 2FFFB 3LI8A 3N6IA 2BLSA 3QP1A 5HWVA 2V1ZA 1FIKA 2L0WA 3O87A 3WS1A 4JF5A 3A3DA 2QZ6A 3F1NA 4JPMA 3ITAA 1W5DA 1Q2PA 3H82A 3SH7A 2H5SA 3B42A 4DE3A 4E3NA 1IYQA 1HD8A 2QWSA 3K2NA 4BBTA 2PT7A 5EFWA 1XGIA 3H7WB 5HX9A 3IX3A 2ZC7A 3N7WA 3NECA 1OTIA 1F5MA 3QP6A 5GHZA 3K3DA 4E3OA 2HGVA 4RX3A 3LI9A 5FL3A 4KZ4A 4C75A 4Y3IA 5GLDA 4PAUA 4OOMA 4GDNA 3R7WB 1KGFA 4C3QA 3TW8A 2X01A 3IBJA 1RP5A 3IF6A 2OLUA 4Q8IA 2W3GA 3OC2A 1ONGA 1KOUA 2XFSA 4HH3A 1K38A 5HAIA 1IYSA 4OP5A 2Y91A 3JYIA 2E8JA 1CQAA 5FATA 1P0ZA 3EGXC 1YLYA 2IWCA 4LCMA 2HPBA 1TS0A 3HLCA 4A5RA 4JGQA 4DN0A 3G2ZA 4O7DA 3LR4A 3ZGAB 1HLUP 2ZBBA 3BFGA 4MMNA 3G2YA 4L9EA 2PAVP 5TFQA 1FSYA 3MXRA 1NRJA 1LL5A 1SKOB 2W3DA 5FEGA 4HH2A 4KUKA 1LSVA 2ZJ9A 4BD1A 1JVJA 5AVEA 1S67L 3PBTA 2HDRA 3UY6A 1JWPA 3R7WA 3LGOA 4EUVA 4GJ4A 3LR5A 4LGWA 2L1MA 2ZM0A 3G34A 1MY8A 3TE8A 4X56A 1FCNA 5BOHA 2Y2IA 1CEFA 4D2OA 5IT5A 4DJ3A 1PI4A 2JKRM 1G6AA 5DF9A 5DJUA 3BFDA 4LV0A 5EM1A 1PNEA 1Y28A 2Z6DA 1Q2QA 1K57C 4NXFA 1DP8A 1NZUA 3W8KA 2LB5A 3PBOA 5A92A 3KO6A 3TOIA 3ZHHA 4HEFA 3GMWA 4YOFA 5HL1A 4XT2B 3U2AA 2PR6A 5A8BA 4X1LA 2P7JA 4R3AA 2WKIA 3DWZA 1YLPA 3IF6C 1ZHHB 2HDQA 5FDHA 1ES5A 2GX5A 3CZDA 3B47A 3W4PA 3P98A 4BLMA 1NLZA 3O5YA 4R1GA 4FCFA 3N8LA 2WAEA 1DJCA 2INWA 2Y2QA 3NOUC 4Z9QA 2JKRI 2Y8HA 1JTDA 1BSGA 1BLSA 1NLYA 4K91A 3A0SA 4S2MA 1ZG4A 1YLZA 2EX6A 5CHMA 3QP4A 3ZG7B 3DAVA 2HJ9C 1S4RA 1MWSA 3E4PA 3LO7A 1ACFA 5FQIA 3T4SA 1SKFA 1KGEA 1OTEA 1S4SA 2V2FF 3HUMA 4E3IA 4G3WA 5FI7A 3F1PB 3OBFA 1JNUA 4I3JA 3P7NA 4HY8A 4HNBA 4Y7PA 3BQ8A 2EXBA 4KZAA 2O9CA 3MBZA 1L2SA 4QHCA 2QJ5A 1P9RA 2FFYA 5DTKA 1HTZA 1RCJA 5F1GA 2PBDP 4KG2A 3NULA 3T4JA 5U47A 1Z6FA 5JYOA 3FG8A 3O88A 3SW1A 2XD5A 5GL9A 3C5AA 4KQRA 2VKSA 4WYYA 4ARZA 3KYEA 3SS3A 4P6ZM 4CLCC 3G4PA 4JLFA 4HHDA 2HV1A 1IYOA 3LUQA 3E98A 2X71A 3ITBA 3EEAA 3OPHA 4UEYA 2M7UA 2C5WB 3V50A 1MWUA 3UB5P 1O7EA 1PZPA 2GNXA 1OJ5A 4FUWA 4DF6A 4CLCD 1QMEA 4Q0IA 3FV7A 3EOIA 2V20A 5HZHA 3U4LP 1H5XA 4OQHA 2IA2A 5E43A 3OCLA 4XUZA 2VV6A 3NJAA 1W7FA 4K0XA 3VFHA 3WS5A 3ISGA 3Q7VB 1G5UA 2JC7A 4EV4A 5HDSA 3BFCA 1VQQA 3C8CA 2CC1A 3UB7A 3IWOA 5CEBA 4X68A 2EFUA 4B93A 4ETXA 1YMXA 2Y2KA 3GTCA 4R38A 1W63M 2P04A 1K4FA 2HDUA 4LPZA 4LRZE 5F69A 1K55A 2B5RA 1S6RA 4JGRA 3SH9A 4R6LA 2W3FA 5A90A 1WE4A 3T50A 4M4XA 3UPNA 3UO9A 3MKFA 2IWBA 1XP4A 3F1OB 4HIAA 4HP4A 4O01A 3T4KA 1MKMA 4UA7A 1QMFA 2Z2MB 4KZ3A 4DJ2A 1G6OA 5AQBA 3V3RA 1DP9A 2H0TA 3HLGA 1L0DA 4OLGA 3T4TA 3UE6A 2KX6A 4NEED 3W2ZA 1XA7A 4JF4A 3BFEA 3VE4A 5C5KA 3QNCA 4E3LA 1H0MA 4OPRA 5KSHA 2VGKA 3N8SA 3MXSA 3W4QA 1KVMA 1L3LA 1YAXA 3O86A 2DNSA 2ZD8A 2AVXA 3Q7VA 2VJWA 3ZG8B 3BQAA 1MPLA 1ERQA 3LIFA 3MZFA 3MQ0A 3LIDA 2WZXA 3KSHA 2ZMVA 4HQAA 2VA0A 4NKPA 1IFQA 4P0MA 4WZ5A 3BRMA 2B18A 4RA7A 4B4XA 5DFYA 5L10A 1VHMA 4OQGA 3KYZA 5F6AA 5A91A 2ZQAA 4OPZA 5CECA 3F1OA 3VP2A 1BULA 3NDEA 1H8YA 4GDBA 5F1FA 4R0QA 1W79A 2WAFA 5M1AA 1S0WA 4HBTA 3EQUA 2ZOIA 2ZQDA 1FILA 3F1NB 2OLVA 2XRNA 3UB9A 1MWRA 3PBSA 5AJGA 1W8YA 4HJ3A 5I94A 3H82B 3VV4A 3LIBA 2W3HA 1E4DA 5DKKA 4GCZA 1K55C 1CEGA 3A3EA 3TSGA 3LEZA 4OOYA 3G35A 4EU0A 3BWLA 1RGYA 4DXCA 3JVUA 5TBMB 1T18A 1K56D 3M6HA 1GA0A 1YSPA 2J80A 4WM9A 3FWLA 4WLAA 3UE3A 1W8QA 1NRFA 5FQMA 3PXPA 3SOIA 3A3FA 3HJIA 1NWZA 4N1XA 3T1XA 3FZCA 3BLSA 4UQIS 5EVIB 1XFNA 4EBNA 4MNRA 1OMEA 4I5SA 3HUNA 3PYPA 4OKPA 3IXDA 3N8RA 3C38A 1TD5A 4Y13A 1S1YA 2GZAA 3ULFA 4GS9A 1GCEA 1HVBA 1IOUA 1I5QA 3S7QA 4KZ9A 3W4OA 1TEMA 1DY6A 3DTKA 4HBUA 1OT6A 1SCWA 3IWIA 4IUHA 5E2HA 2Y2OA 3CG5A 1S66L 3SH8A 1EW0A 4BMWA 2Z6CA 3FYZA 4S2NA 1KGGA 2Y2MA 3A3IA 3TRCA 1KDWA 2G2WA 5FEFA 3UB8A 3BW6A 2WGWA 4UA6A 3M2KA 2ZM2A 5TBMA 1M40A 3M6BA 1NXYA 5DKLA 3UNWA 5FQKA 4PM9A 4FH2A 4PM5A 1SDEA 2JHEA 2K7SA 4BD0A 1KE0A 1LL8A 3BEBA 3BY8A 1YQSA 3IT9A 2J9PA 4L9GA 3ZCZA 4KZ7A 5GHXA 4EETB 5EVIA 1JWVA 2FH5A 5F68A 2Y2LA 4R4RA 3EQVA 4IUKA 4DDYA 4CJNA 2I72A 4E04A 3A3JA 1NJ4A 2PDRA 2OSUA 4RVAA 5DFXA 1N4OA 3IXBA 2W3EA 3K3CA 4I3IA 3CPTA 4IHQA 4B9OA 1I2SA 3S22A 2HF6A 2P74A 3IQAA 4S2KA 4WL9A 1ES4A 4E3JA 4OOLA 4BBVA 3ZYTA 4I3AA 4X1MA 1MXOA 3LEQA 2VGLM 4GZBA 1N9NA 4Y5FA 4Y17A 1CI9A 3QP5A 4M3KA 2QYBA 2HP9A 5E2FA 4Y15A 2XROA 2ZC5B 5FQJA 4PKYG 2PU4A 4S2LA 3CHWP 3E0YA 4KUOA 2V1BA 2OAQ1 2DMWA 3OCNA 4S2NC 1F2KA 2JBFA 4N1HA 2VGLS 3CLOA 4LFUA 1A0KA 2W1RA 3C2WA 4FSFA 4DE1A 2W1TB 3C30A 3LYXA 3AGDA 2EWWA 4MLLA 3T4QA 5J4EA 4GD8A 1OJGA 4ZJ1A 2QMIA 1LHYA 5L07A 4Q0JA 3VSKA 3N4IA 1FOFA 4R4SA 1G68A 1N9OA 3L9KA 1LI9A
chains in the Genus database with same CATH topology
3BY9A 2W0NA 4ME4A 2GNXA 1OJ5A 3CI6A 5TJJA 4CLCD 1MZUA 4Q0IA 3ZQ5A 3EOIA 5MC7A 5HZHA 1D7EA 5J7EA 4ETZA 1T1CA 2QHKA 2WKPA 2IA2A 2PD8A 3OCLA 3H9WA 3IS2A 5HD5A 2VV6A 3NJAA 1T19A 5HDDA 4CLCE 4ARZB 2EWVA 3HJKA 3PBQA 5HDSA 3S7OA 3C8CA 2PD7A 3UB7A 1H8MA 2O9AA 2YKFA 3E4OA 2V9AA 3LR3A 4UQIM 3CITA 4B93A 4ETXA 2MJ6A 4MN5A 4R38A 5K5BA 1W63M 2P04A 3NOTC 4LLOB 2PYRA 4LPZA 5HD3A 1UGUA 1T1BA 2XSSA 4LRZE 5F69A 5HWTA 2VEAA 4JGRA 1D06A 4CLCB 5KIZA 4R6LA 2W3FA 3KX0X 3ICYA 2NUTC 1UWPX 3TJZC 1DRMA 4HOIA 4Y2FA 3T50A 2XA7S 4M4XA 3FC7A 5CX7A 2W1TA 3F1OB 4HIAA 4HP4A 4O01A 3T4KA 4WF0A 3UMDA 1MKMA 1V9ZA 2V0UA 3IS2B 4EQ1A 4I39A 2J3TC 3EEHA 3LIAA 3T4OA 1LSWA 4G3VA 4DJ2A 1S1ZA 1G6OA 3UMEA 3MFXA 1DP6A 1DP9A 5J3WA 2PYPA 3A0RA 4WELA 3T4TA 3UE6A 2KX6A 4NEED 3W2ZA 4O0PA 4Z1WA 4BBUA 3VOLA 3DBAA 3D72A 3S7PA 1GSXA 4JGPA 1TS6A 1W63Q 3VE4A 1T1AA 5C5KA 3R4KA 5KSHA 3G6OA 3H7WA 3P01A 4PHTA 2ZOHA 4WEJA 2PR5A 4NXBA 3LI8A 3RH8B 2H28A 1YAXA 5HWVA 3LFVA 2L0WA 2LB9A 2OOLA 2VJWA 5HL6A 3F1NA 3NHQA 3BQAA 2KLIA 5G4ZA 3LIFA 5F5YA 2FZ0A 3MQ0A 2A24A 3LICA 3CUEA 3LIDA 3H82A 3KSHA 2ZMVA 4HQAA 4L9FA 3GECA 2VA0A 2WKRA 4NKPA 3PBNA 3B42A 5AVFA 1IFQA 1GSWA 1TS7A 2O9BA 4WN5A 2B18A 4CLCA 1H3QA 3V67A 5DFYA 2QWSA 3RFBA 3K2NA 1VHMA 4BBTA 4BJPA 4EEUA 4QPRA 3KYZA 5F6AA 2PT7A 5EFWA 2VLGA 3H7WB 3F1OA 1F9IA 1OTIA 1F5MA 4P6ZS 3EGDC 3K3DA 2HGVA 2G7UA 3LI9A 4EEPA 5HDCA 3EQUA 3LIEA 2ZOIA 4RQ9A 3PHYA 5FL3A 2BASA 3IBRA 2K2NA 4Y3IA 3MXQA 3CAXA 3F1NB 2V1AA 2NUPC 4PAUA 1ZTUA 4OOMA 2XRNA 3R7WB 3UB9A 4K08A 2V0WA 2A24B 3TW8A 3PBSA 5AJGA 4HJ3A 4LRYC 3H82B 1LT0A 3IBJA 3VV4A 3LIBA 2W3HA 2W3GA 1XJ6A 3OC2A 2O0YA 5DKKA 1KOUA 4GCZA 4HH3A 4MCWA 4NXGA 1TS8A 4EU0A 3BWLA 3JVUA 5TBMB 1T18A 3OOVA 1YSPA 2J80A 4WLAA 3UE3A 1LSXA 1OTBA 4GHIB 1XJ2A 3PXPA 1P0ZA 3EGXC 3T4LA 3HJIA 1NWZA 1X0OA 2GJ3A 4HJ4A 5G4YA 4DMZA 1TS0A 1OTAA 2ZMFA 5HPIA 4UQIS 4JGQA 4DN0A 1XFNA 3PR6A 4I5SA 3LR4A 3S7NA 4MDZA 5HPFA 3MJQA 3PYPA 4CQHA 3D3OA 2Y79A 2PHYA 2ZBBA 3C38A 1TD5A 4MMNA 3HCYA 1S1YA 4L9EA 2GZAA 3ULFA 4R70A 5HSQA 4GS9A 2J3TD 2O99A 3BJNA 1IOUA 1XJ3A 3S7QA 4KQDA 1NRJA 1OTDA 2KDKA 2W3DA 3MF0A 4GLQA 4HH2A 4KUKA 1LSVA 1OT6A 4H6JB 3NOPC 4IUHA 1S66L 4GW9A 4I38A 1EW0A 3LR0A 3UB6A 5AVEA 1S67L 3PBTA 4BMWA 2QJ7A 2KOIA 2M1CA 2Z6CA 3R7WA 3EWKA 4XT2A 4EUVA 1OT9A 3CUEC 4GJ4A 1G28A 2YKHA 3LR5A 3TRCA 5HWWA 1STZA 2J3WA 2L1MA 4HJ6A 3UB8A 4MN7A 2VV8A 4IJGA 4MN6A 3BW6A 3TE8A 4HP9A 5TBMA 1XFQA 5I5LA 4GS9B 5IT5A 5DKLA 2D01A 4II7A 1YSQA 2JKTM 3CWFA 4DJ3A 2JKRM 2I9VA 2JHEA 2K7SA 4GHIA 5DF9A 5DJUA 1LL8A 2W27A 1F98A 3BY8A 1Y28A 4EW7A 1YKDA 4L9GA 2Z6DA 4NXFA 4EETB 1DP8A 2LB5A 4FOFA 1BYWA 3PBOA 3KO6A 2FH5A 5F68A 3EQVA 4IUKA 1MC0A 3OLOA 4YOFA 4XT2B 5IS1A 1OPXA 2OWHA 3U2AA 2PR6A 5A8BA 4JGOA 2M7VA 2K31A 2XA7M 2P7JA 3MMHA 2VV7A 4R3AA 4E04A 4L0LA 1ZHHB 3FPWA 4WEKA 2P08A 2VZWA 2GX5A 4AFIA 3B47A 3F1PA 3KSIA 2D02A 5DJTA 1P97A 3PBRA 3MQOA 4KQOA 2L4RA 2OAP1 2WKQA 1NLZA 3O5YA 2QKPA 4Q0HA 4NXEA 4F3LA 2PDRA 4H6JA 1ODVA 2INWA 5DFXA 2JKTI 3NOUC 2JKRI 2Y8HA 1P9WA 4LRXC 4HI4A 1NLYA 2W3EA 2OWJA 3A0SA 3K3CA 4I3IA 4BWIA 4YWZA 4IHQA 4B9OA 4YNRA 3GDIA 5IU1A 2HJ9C 2HF6A 3KYQA 2R78A 2CMNA 4WL9A 1S4RA 1VB6A 3VE3A 3E4PA 3T4SA 2A2LA 4OOLA 4BBVA 2VX8A 2B02A 2EA9A 3ZYTA 1TF1A 3MR0A 4I3AA 1XJ4A 3A0VA 1OTEA 2VGLM 1S4SA 3FPVA 5LBRA 4G3KA 1N9NA 3KSGA 4G3WA 4EERA 4Y5FA 3E4QA 3F1PB 3OBFA 1JNUA 3KSFA 4WUJA 4EXOA 4I3JA 3P7NA 4HY8A 2HJEA 3RTYA 4HNBA 2QYBA 3BQ8A 4F3LB 1N9LA 2XROA 2O9CA 4PKYG 5L8MA 2JN7A 2QJ5A 3E0YA 4KUOA 1P9RA 2V1BA 2OAQ1 3JVVA 3MQQA 2DMWA 3B33A 1UWNX 3OCNA 4PKYA 3T4JA 4EESA 2VGLS 3FG8A 3SW1A 3CLOA 2W1RA 2VKSA 3C2WA 4FSFA 2W1TB 3C30A 4ARZA 3LYXA 4P6ZM 4CLCC 2EWWA 4HHDA 5J4EA 3T4QA 2HV1A 1OJGA 3LUQA 3E98A 4O8GA 4Q0JA 3EEAA 1V9YA 4ZRRA 4UEYA 2M7UA 1GSVA 1N9OA 1WA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY9 A;  2W0N A;  1OJ5 A;  1MZU A;  3ZQ5 A;  5HZH A;  1D7E A;  5J7E A;  1T1C A;  2QHK A;  2WKP A;  2PD8 A;  3H9W A;  3IS2 A;  5HD5 A;  2VV6 A;  3NJA A;  1T19 A;  5HDD A;  3HJK A;  5HDS A;  3C8C A;  2PD7 A;  3UB7 A;  3E4O A;  2YKF A;  2V9A A;  4MN5 A;  4R38 A;  3NOT C;  4LLO B;  2PYR A;  4LPZ A;  5HD3 A;  1UGU A;  1T1B A;  4LRZ E;  5F69 A;  5HWT A;  2VEA A;  4JGR A;  1D06 A;  5KIZ A;  4R6L A;  3KX0 X;  3ICY A;  1UWP X;  1DRM A;  4HOI A;  3T50 A;  4M4X A;  3FC7 A;  3F1O B;  4HIA A;  4HP4 A;  4WF0 A;  3UMD A;  3IS2 B;  1V9Z A;  2V0U A;  4EQ1 A;  4I39 A;  3EEH A;  3LIA A;  1LSW A;  4DJ2 A;  1S1Z A;  3UME A;  3MFX A;  1DP6 A;  1DP9 A;  5J3W A;  2PYP A;  3A0R A;  3UE6 A;  2KX6 A;  4BBU A;  3VOL A;  3D72 A;  1GSX A;  4JGP A;  1TS6 A;  3VE4 A;  1T1A A;  3G6O A;  3H7W A;  2ZOH A;  2PR5 A;  4NXB A;  3LI8 A;  3RH8 B;  2H28 A;  5HWV A;  2L0W A;  2OOL A;  3F1N A;  3NHQ A;  5G4Z A;  3LIF A;  5F5Y A;  2A24 A;  3LIC A;  3LID A;  3H82 A;  4HQA A;  4L9F A;  3GEC A;  2WKR A;  5AVF A;  1GSW A;  1TS7 A;  4WN5 A;  2QWS A;  4BBT A;  4EEU A;  5F6A A;  5EFW A;  2VLG A;  3H7W B;  3F1O A;  1F9I A;  1OTI A;  3K3D A;  3LI9 A;  4EEP A;  5HDC A;  3LIE A;  2ZOI A;  4RQ9 A;  3PHY A;  2BAS A;  3IBR A;  3MXQ A;  3CAX A;  3F1N B;  2V1A A;  3UB9 A;  4K08 A;  2V0W A;  2A24 B;  4HJ3 A;  4LRY C;  3H82 B;  1LT0 A;  3LIB A;  1XJ6 A;  5DKK A;  1KOU A;  4GCZ A;  4HH3 A;  4NXG A;  1TS8 A;  3BWL A;  5TBM B;  1T18 A;  2J80 A;  4WLA A;  1LSX A;  1OTB A;  4GHI B;  1XJ2 A;  1P0Z A;  3HJI A;  1NWZ A;  1X0O A;  2GJ3 A;  5G4Y A;  4HJ4 A;  1TS0 A;  1OTA A;  4JGQ A;  1XFN A;  4I5S A;  3MJQ A;  3PYP A;  2PHY A;  2ZBB A;  1S1Y A;  4L9E A;  3ULF A;  4R70 A;  5HSQ A;  4GS9 A;  1XJ3 A;  4KQD A;  1OTD A;  2KDK A;  4HH2 A;  4KUK A;  1LSV A;  1OT6 A;  4H6J B;  3NOP C;  1S66 L;  4GW9 A;  4I38 A;  1EW0 A;  3UB6 A;  5AVE A;  1S67 L;  2QJ7 A;  2M1C A;  2Z6C A;  3EWK A;  4XT2 A;  1OT9 A;  1G28 A;  2YKH A;  5HWW A;  2L1M A;  4HJ6 A;  3UB8 A;  2VV8 A;  4MN6 A;  4HP9 A;  5TBM A;  1XFQ A;  5I5L A;  4GS9 B;  5DKL A;  2D01 A;  3CWF A;  4DJ3 A;  2I9V A;  2JHE A;  2K7S A;  4GHI A;  5DJU A;  1LL8 A;  2W27 A;  1F98 A;  3BY8 A;  1Y28 A;  4EW7 A;  4L9G A;  2Z6D A;  4NXF A;  4EET B;  1DP8 A;  1BYW A;  5F68 A;  3OLO A;  4XT2 B;  5IS1 A;  2OWH A;  2PR6 A;  5A8B A;  4JGO A;  2P7J A;  4R3A A;  2VV7 A;  4E04 A;  3F1P A;  2D02 A;  5DJT A;  1P97 A;  3MQO A;  2L4R A;  2WKQ A;  2QKP A;  4NXE A;  4F3L A;  2PDR A;  4H6J A;  1ODV A;  2INW A;  3NOU C;  4LRX C;  4HI4 A;  2OWJ A;  3A0S A;  3K3C A;  4I3I A;  4YWZ A;  4B9O A;  3GDI A;  5IU1 A;  2R78 A;  2CMN A;  4WL9 A;  1S4R A;  1VB6 A;  3VE3 A;  3E4P A;  4BBV A;  2B02 A;  2EA9 A;  3MR0 A;  4I3A A;  1XJ4 A;  3A0V A;  1OTE A;  1S4S A;  1N9N A;  4EER A;  3E4Q A;  3F1P B;  1JNU A;  4WUJ A;  4EXO A;  4I3J A;  3P7N A;  4HY8 A;  3RTY A;  4HNB A;  4F3L B;  1N9L A;  4PKY G;  2JN7 A;  2QJ5 A;  4KUO A;  2V1B A;  3MQQ A;  3B33 A;  1UWN X;  4PKY A;  4EES A;  3FG8 A;  3SW1 A;  3CLO A;  3C2W A;  3LYX A;  4HHD A;  5J4E A;  2HV1 A;  1OJG A;  3LUQ A;  1V9Y A;  1GSV A;  1N9O A;  1WA9 A; 
#chains in the Genus database with same CATH topology
 1KVL A;  5TJJ A;  3E2L A;  3ZVW A;  1K54 A;  3ZQ5 A;  5MC7 A;  2JKG A;  4S2I A;  4ETZ A;  1WYB A;  2UWX A;  2QHK A;  2PD8 A;  3BEC A;  3H9W A;  3IS2 A;  1JWZ A;  4KG6 A;  3DTE A;  4ARZ B;  2EWV A;  3HJK A;  4DRT A;  2PD7 A;  4KZ5 A;  2YKF A;  2V9A A;  3LR3 A;  1SDN A;  2MJ6 A;  4H8R A;  1XX2 A;  2ZL1 A;  4MN5 A;  1VEU B;  4LLO B;  2PYR A;  1UGU A;  3E2K A;  5HWT A;  2VEA A;  4E6X A;  1XGJ A;  2VK3 A;  1ONH A;  4E3K A;  2J7V A;  1UWP X;  1DRM A;  4HOI A;  3QHY A;  3UE0 A;  2W1T A;  3HLD A;  2PU2 A;  3M2J A;  3DWK A;  4WF0 A;  2V0U A;  4ZBE A;  2J3T C;  4ZJ2 A;  3T4O A;  3UDX A;  1L0G A;  2PBY A;  3UME A;  2R9X A;  4S2P A;  1ESU A;  3MFX A;  3G30 A;  5EPH A;  3ZG0 A;  2ZMA A;  2PYP A;  4Z1W A;  4BL3 A;  3IXG A;  3D72 A;  3S7P A;  4JGP A;  1TS6 A;  1FCM A;  3R4K A;  3G6O A;  3P01 A;  4PHT A;  3RJU A;  1YPR A;  4OVD A;  2PR5 A;  4BEN A;  5FSR A;  3RH8 B;  3CMZ A;  3JPU A;  3LY3 A;  3DTI A;  3LFV A;  2LB9 A;  5CER A;  5EEC A;  5DF7 A;  3NHQ A;  2WUQ A;  2FZ0 A;  1AXB A;  2ZQ7 A;  2A24 A;  3LIC A;  3HRE A;  1VEU A;  2ZQC A;  3GEC A;  2WKR A;  5JYP A;  5HAP A;  1GSW A;  1TS7 A;  2EX2 A;  3IXH A;  4WN5 A;  4DXB A;  1H3Q A;  4OQ0 A;  2WK0 A;  3V67 A;  3RFB A;  3T12 B;  2A3U A;  1ZC2 A;  4EEU A;  1J3W A;  4KQQ A;  2BG1 A;  5AQ9 A;  4X25 A;  1F9I A;  5CGS A;  3NCK A;  2Q9M A;  4P6Z S;  3S4X A;  3UDI A;  2G7U A;  4EEP A;  3FKW A;  3PHY A;  5CHU A;  4KZ8 A;  2EX9 A;  4K0W A;  2ZM8 A;  4QB8 A;  3MXQ A;  3CAX A;  1JTG A;  2V1A A;  2NUP C;  3IWQ A;  1ZTU A;  3VMA A;  2P9V B;  4MBF A;  4FTX A;  4OPQ A;  1YLW A;  1E3U D;  4LRY C;  1YT4 A;  3AGE A;  2ACG A;  4YFM A;  2Y4A A;  2O0Y A;  3BLM A;  3LCE A;  4UA9 A;  4IBR A;  4MCW A;  3NBL A;  1TS8 A;  4MBK A;  1YMS A;  3OOV A;  3OPP A;  1H8Z A;  1LSX A;  1OTB A;  2J8Y A;  3T4L A;  4QY5 A;  2GJ3 A;  4DMZ A;  1OTA A;  5AQ7 A;  2ZMF A;  3TG9 A;  5HPI A;  5CTN A;  1ALQ A;  4MDZ A;  3MJQ A;  3D3O A;  2Y79 A;  2PHY A;  5GLA A;  2BTF P;  4Y0O A;  2WYX A;  3WS2 A;  4OH0 A;  4R70 A;  4KZ6 A;  5HSQ A;  3BJN A;  5HAQ A;  2ZQ9 A;  4R23 A;  3ZG9 B;  4KQD A;  4D60 A;  1GA9 A;  4GLQ A;  1BT5 A;  4LCL A;  3MFD A;  3NOP C;  4FH4 A;  1BZA A;  4GW9 A;  4I38 A;  5KZH A;  3QP8 A;  3LR0 A;  2JCH A;  3UB6 A;  1HZO A;  2QJ7 A;  2KOI A;  2HZ5 A;  2P9V A;  3EWK A;  2OV5 A;  3WRT A;  2ZC6 B;  4S2O A;  1OT9 A;  3IF5 A;  3VOY A;  3BYD A;  5HWW A;  2J3W A;  4JKT A;  1SHV A;  1BLP A;  4MN7 A;  4MN6 A;  2JKF A;  4HP9 A;  4OPY A;  2XFT A;  3SZT A;  1J9M A;  4OON A;  4GS9 B;  4QWO A;  3VSL A;  2D01 A;  5CTM A;  4II7 A;  3IH8 A;  3CWF A;  2PRF A;  2Y2J A;  4RX2 A;  3GSG A;  3PAG A;  3HLE A;  4GOG A;  1PWD A;  2ZC3 B;  5HFO A;  1PWG A;  1BYW A;  1CI8 A;  1IEM A;  1MC0 A;  5FI2 A;  5IS1 A;  1OPX A;  2OWH A;  4DE2 A;  4JGO A;  2XA7 M;  3MMH A;  4WEK A;  3FPW A;  1RGZ A;  4AFI A;  5TR7 A;  3KSI A;  3IHA A;  2D02 A;  4WMC D;  3Q81 A;  2RL3 A;  2WGW B;  1FSW A;  3MQO A;  4KQO A;  2L4R A;  3NY4 A;  2QKP A;  4NXE A;  4F3L A;  3C7U A;  1ODV A;  2Q0O A;  1P9W A;  4LRX C;  1L0F A;  4GB7 A;  3UPP A;  3D4F A;  4HI4 A;  3ZG5 A;  2OWJ A;  4BWI A;  3GQZ A;  4YWZ A;  5IU1 A;  3KYQ A;  3RXW A;  2CMN A;  2HP5 A;  1VB6 A;  4CPK A;  3VE3 A;  4F94 A;  5FDS A;  2A2L A;  2B02 A;  1TF1 A;  3MR0 A;  3A0V A;  4LV2 A;  3FPV A;  1LLB A;  3MS6 A;  3OPR A;  4EER A;  5FAS A;  1XPB A;  2WGI A;  1ESI A;  3KSF A;  4WUJ A;  2H10 A;  3HLF A;  5J8X A;  2HJE A;  4XUX A;  4YIN A;  3C7V A;  1PW1 A;  3Q7Z A;  2EXA A;  3MKE A;  1Y54 A;  5L8M A;  3JVV A;  1UWN X;  4KEN B;  4PKY A;  3CPT B;  1O07 A;  4WZ5 C;  4LEN A;  3HL9 A;  4EWF A;  4U0T A;  4E3M A;  2V8C A;  1IKG A;  5CGX A;  1MBL A;  4ZRR A;  3D9Y A;  1VET A;  4U3T A;  2GDN A;  2W0N A;  4RYE A;  3DW0 A;  4E6W A;  2E8I A;  1MZU A;  4PM6 A;  5J7E A;  2HDS A;  2WKP A;  4GN2 A;  1YM1 A;  1NZO A;  5HD5 A;  5GLB A;  3ZNT A;  1SZV A;  1ZKJ A;  3IH9 A;  4DDS A;  1T19 A;  2XGN A;  1K57 A;  5KSC A;  1D1J A;  5HDD A;  4CLC E;  5GHY A;  3IHB A;  3PBQ A;  3S7O A;  1XXM A;  4XXR A;  1H8M A;  3QNB A;  1U60 A;  5HAR A;  3DTM A;  5K5B A;  2IWD A;  5EM0 A;  5HD3 A;  5HW3 A;  1FQG A;  3NIA A;  2HP6 A;  1EWZ A;  1D06 A;  4CLC B;  5KIZ A;  2JE5 A;  3ICY A;  2NUT C;  3VP0 A;  3TJZ C;  4P87 A;  4Y2F A;  2Y55 A;  3PTE A;  4EUZ A;  5CXW A;  1NYM A;  1IYP A;  3UMD A;  3IS2 B;  3QP2 A;  3EEH A;  3O3V A;  1LSW A;  3HVF A;  4G3V A;  1S1Z A;  2J9O A;  1IEL A;  4LV3 A;  4WEL A;  3I7J A;  1MWT A;  1PI5 A;  4R3B A;  1FR6 A;  3P09 A;  2B95 A;  4O0P A;  2A49 A;  3VOL A;  1GSX A;  2ZL1 B;  1W63 Q;  4PPR A;  5EV0 A;  5L2F A;  3H7W A;  3IX4 A;  1K25 A;  2XD1 A;  2H28 A;  2WKH A;  2VGJ A;  2OOL A;  4IVK A;  5HL6 A;  2G2U A;  2KLI A;  4LV1 A;  5G4Z A;  5AQA A;  1BLH A;  5F5Y A;  4C6Y A;  3MSH A;  4PM7 A;  3CUE A;  4L9F A;  2Y2N A;  3PBN A;  4KG5 A;  5AVF A;  2O9B A;  3G31 A;  4CLC A;  3T1Q B;  1DJB A;  1CK3 A;  4BJP A;  4QPR A;  4U0X A;  5FAP A;  1C3B A;  5EVI C;  1GHM A;  4NG2 A;  2VLG A;  1NY0 A;  5DTS A;  3B3X A;  3RXX A;  4DE0 A;  3EGD C;  3G32 A;  3UPO A;  2XK1 A;  5M19 A;  1K6S A;  1K6R A;  5HDC A;  2EFX A;  3LIE A;  4RQ9 A;  2Y2H A;  2BAS A;  3IBR A;  2K2N A;  3HUO A;  5CHJ A;  3BFF A;  5EVI D;  4OQI A;  1KE4 A;  2XF3 A;  1E3U A;  5G18 A;  4K08 A;  2V0W A;  2A24 B;  1LT0 A;  4X6T A;  1Y4O A;  1XJ6 A;  4JXW A;  4IBX A;  4NXG A;  1FR1 A;  1SKO A;  1FCO A;  1BLC A;  1K4E A;  5FQ9 A;  4OLD A;  2ZLY A;  5E2G A;  2ZQ8 A;  4QD4 A;  4ZDX A;  5EVE A;  4GHI B;  1XJ2 A;  2EX8 A;  5F82 A;  3HBR A;  4ZTK A;  1X0O A;  4DKI A;  2Z2L B;  4EBP A;  4HJ4 A;  5G4Y A;  3S1Y A;  3PR6 A;  3V5M A;  4FD8 A;  5DF8 A;  3S7N A;  4BQM A;  5HPF A;  1NYY A;  4JBF A;  4CQH A;  3HCY A;  3AGF A;  5EE8 A;  5KMW A;  3Q82 A;  2J3T D;  2O99 A;  3VOZ A;  1XJ3 A;  2RCX A;  1OTD A;  2XLN A;  2KDK A;  4WZ4 A;  3MF0 A;  1VM1 A;  5DTT A;  3BM6 A;  4JXS A;  4H6J B;  4JXG A;  5FI6 A;  4GKU A;  2M1C A;  1ERO A;  1GHI A;  1N9B A;  4XT2 A;  3CUE C;  1G28 A;  4QU3 A;  2YKH A;  1STZ A;  3NI9 A;  4HJ6 A;  2VV8 A;  4IJG A;  5FAQ A;  4BL2 A;  2WZZ A;  3ZVT A;  1XFQ A;  5I5L A;  1K54 C;  4X55 A;  1YSQ A;  2JKT M;  1TVF A;  1XA1 A;  3C4O A;  2I9V A;  1M6K A;  4PM8 A;  1PIO A;  5FA7 A;  4GHI A;  4JF6 A;  1EI5 A;  3ZFZ A;  4UAA A;  2W27 A;  3VP3 A;  1F98 A;  4R3J A;  5D3O A;  4IVI A;  4EW7 A;  1YKD A;  1PFL A;  2WAD A;  4FOF A;  5FQQ A;  3OLO A;  2WKE A;  2M7V A;  2K31 A;  5E2E A;  4GD6 A;  2VV7 A;  3WWX A;  4L0L A;  4WMC A;  2P08 A;  2VZW A;  1WYC A;  3F1P A;  3NDG A;  5DJT A;  1P97 A;  5EOE A;  1KE3 A;  3PBR A;  2OAP 1;  1K56 A;  2WKQ A;  4Q0H A;  4N9K A;  4H6J A;  1ES2 A;  4WBG A;  2JKT I;  5CED A;  4MBH A;  3UN7 A;  4HES A;  3MZD A;  2DCF A;  1E25 A;  3HLW A;  4P85 A;  4N92 A;  4MEZ A;  4YNR A;  3GDI A;  1PWC A;  3WRZ A;  2R78 A;  3VP1 A;  3V3S A;  3VFF A;  3HLB A;  1LL9 A;  5DVA A;  1KDS A;  2VX8 A;  2EA9 A;  5A93 A;  1XJ4 A;  5CGW A;  4N9L A;  5LBR A;  1PW8 A;  4G3K A;  3KSG A;  1DJA A;  1ERM A;  3CJM A;  3E4Q A;  1CJF A;  4EXO A;  4ID4 A;  3RTY A;  3Q07 A;  4GNU A;  4F3L B;  1N9L A;  2Q9N A;  4UHU A;  2XDM A;  4NET A;  3GRJ A;  5CRF A;  2JN7 A;  2WGV A;  4JXV A;  2R9W A;  3UE1 A;  4PMA A;  1YLT A;  3MQQ A;  3B33 A;  3WS0 A;  3T1S A;  4KZB A;  4EES A;  2UV0 E;  3C4P A;  3GV9 A;  5EOO A;  2Y2P A;  4O8G A;  1V9Y A;  2XQZ A;  2H0Y A;  1LI0 A;  2X02 A;  5F83 A;  1GSV A;  5TGF A;  1MKI A;  1WA9 A;  5EVL A;  2V8F A;  4QY6 A;  3BY9 A;  4ME4 A;  1L0E A;  3NC8 A;  3CI6 A;  1BTL A;  1YLJ A;  1GHP A;  1D7E A;  1XKZ A;  1T1C A;  3GR2 A;  2QPN A;  1I2W A;  4X53 A;  3MZE A;  3T1R A;  1Z09 A;  5M18 A;  4B4Z A;  4Y0T A;  1CF0 A;  1PRQ A;  2Y2G A;  5IHV A;  2XEP A;  4IED A;  4EBL A;  3WS4 A;  3OPL A;  3V39 A;  3UDF A;  5GLC A;  1BUE A;  2O9A A;  3E4O A;  4UQI M;  3CIT A;  1VET B;  1AWI A;  4ZAM A;  4EQI A;  4NK3 A;  3FKV A;  4P6B A;  3IX8 A;  3NOT C;  1PYY A;  1T1B A;  2XSS A;  3SS4 A;  4QJG A;  4B88 A;  1TDL A;  3KX0 X;  2Y59 A;  1ES3 A;  1K0K A;  3Q1F A;  2XA7 S;  3FC7 A;  5CX7 A;  2C6W B;  1IKI A;  1V9Z A;  4EQ1 A;  4I39 A;  3LIA A;  3ZDJ A;  2XH9 A;  3OZH A;  5FAO A;  1TDG A;  5EUA A;  3GVB A;  1DP6 A;  5J3W A;  2XR0 A;  3A0R A;  3L7H A;  3ZNY A;  2DRW A;  4BBU A;  1PZO A;  2ZC4 B;  3DBA A;  3LY4 A;  4X69 A;  1ZG6 A;  3VP4 A;  1T1A A;  4OP8 A;  3IF6 B;  4S2J A;  5L09 A;  4ESP A;  2ZOH A;  4WEJ A;  3PAE A;  4Y0U A;  4NXB A;  3SS5 A;  4ZJ3 A;  2FFF B;  3LI8 A;  3N6I A;  2BLS A;  3QP1 A;  5HWV A;  2V1Z A;  1FIK A;  2L0W A;  3O87 A;  3WS1 A;  4JF5 A;  3A3D A;  2QZ6 A;  3F1N A;  4JPM A;  3ITA A;  1W5D A;  1Q2P A;  3H82 A;  3SH7 A;  2H5S A;  3B42 A;  4DE3 A;  4E3N A;  1IYQ A;  1HD8 A;  2QWS A;  3K2N A;  4BBT A;  2PT7 A;  5EFW A;  1XGI A;  3H7W B;  5HX9 A;  3IX3 A;  2ZC7 A;  3N7W A;  3NEC A;  1OTI A;  1F5M A;  3QP6 A;  5GHZ A;  3K3D A;  4E3O A;  2HGV A;  4RX3 A;  3LI9 A;  5FL3 A;  4KZ4 A;  4C75 A;  4Y3I A;  5GLD A;  4PAU A;  4OOM A;  4GDN A;  3R7W B;  1KGF A;  4C3Q A;  3TW8 A;  2X01 A;  3IBJ A;  1RP5 A;  3IF6 A;  2OLU A;  4Q8I A;  2W3G A;  3OC2 A;  1ONG A;  1KOU A;  2XFS A;  4HH3 A;  1K38 A;  5HAI A;  1IYS A;  4OP5 A;  2Y91 A;  3JYI A;  2E8J A;  1CQA A;  5FAT A;  1P0Z A;  3EGX C;  1YLY A;  2IWC A;  4LCM A;  2HPB A;  1TS0 A;  3HLC A;  4A5R A;  4JGQ A;  4DN0 A;  3G2Z A;  4O7D A;  3LR4 A;  3ZGA B;  1HLU P;  2ZBB A;  3BFG A;  4MMN A;  3G2Y A;  4L9E A;  2PAV P;  5TFQ A;  1FSY A;  3MXR A;  1NRJ A;  1LL5 A;  1SKO B;  2W3D A;  5FEG A;  4HH2 A;  4KUK A;  1LSV A;  2ZJ9 A;  4BD1 A;  1JVJ A;  5AVE A;  1S67 L;  3PBT A;  2HDR A;  3UY6 A;  1JWP A;  3R7W A;  3LGO A;  4EUV A;  4GJ4 A;  3LR5 A;  4LGW A;  2L1M A;  2ZM0 A;  3G34 A;  1MY8 A;  3TE8 A;  4X56 A;  1FCN A;  5BOH A;  2Y2I A;  1CEF A;  4D2O A;  5IT5 A;  4DJ3 A;  1PI4 A;  2JKR M;  1G6A A;  5DF9 A;  5DJU A;  3BFD A;  4LV0 A;  5EM1 A;  1PNE A;  1Y28 A;  2Z6D A;  1Q2Q A;  1K57 C;  4NXF A;  1DP8 A;  1NZU A;  3W8K A;  2LB5 A;  3PBO A;  5A92 A;  3KO6 A;  3TOI A;  3ZHH A;  4HEF A;  3GMW A;  4YOF A;  5HL1 A;  4XT2 B;  3U2A A;  2PR6 A;  5A8B A;  4X1L A;  2P7J A;  4R3A A;  2WKI A;  3DWZ A;  1YLP A;  3IF6 C;  1ZHH B;  2HDQ A;  5FDH A;  1ES5 A;  2GX5 A;  3CZD A;  3B47 A;  3W4P A;  3P98 A;  4BLM A;  1NLZ A;  3O5Y A;  4R1G A;  4FCF A;  3N8L A;  2WAE A;  1DJC A;  2INW A;  2Y2Q A;  3NOU C;  4Z9Q A;  2JKR I;  2Y8H A;  1JTD A;  1BSG A;  1BLS A;  1NLY A;  4K91 A;  3A0S A;  4S2M A;  1ZG4 A;  1YLZ A;  2EX6 A;  5CHM A;  3QP4 A;  3ZG7 B;  3DAV A;  2HJ9 C;  1S4R A;  1MWS A;  3E4P A;  3LO7 A;  1ACF A;  5FQI A;  3T4S A;  1SKF A;  1KGE A;  1OTE A;  1S4S A;  2V2F F;  3HUM A;  4E3I A;  4G3W A;  5FI7 A;  3F1P B;  3OBF A;  1JNU A;  4I3J A;  3P7N A;  4HY8 A;  4HNB A;  4Y7P A;  3BQ8 A;  2EXB A;  4KZA A;  2O9C A;  3MBZ A;  1L2S A;  4QHC A;  2QJ5 A;  1P9R A;  2FFY A;  5DTK A;  1HTZ A;  1RCJ A;  5F1G A;  2PBD P;  4KG2 A;  3NUL A;  3T4J A;  5U47 A;  1Z6F A;  5JYO A;  3FG8 A;  3O88 A;  3SW1 A;  2XD5 A;  5GL9 A;  3C5A A;  4KQR A;  2VKS A;  4WYY A;  4ARZ A;  3KYE A;  3SS3 A;  4P6Z M;  4CLC C;  3G4P A;  4JLF A;  4HHD A;  2HV1 A;  1IYO A;  3LUQ A;  3E98 A;  2X71 A;  3ITB A;  3EEA A;  3OPH A;  4UEY A;  2M7U A;  2C5W B;  3V50 A;  1MWU A;  3UB5 P;  1O7E A;  1PZP A;  2GNX A;  1OJ5 A;  4FUW A;  4DF6 A;  4CLC D;  1QME A;  4Q0I A;  3FV7 A;  3EOI A;  2V20 A;  5HZH A;  3U4L P;  1H5X A;  4OQH A;  2IA2 A;  5E43 A;  3OCL A;  4XUZ A;  2VV6 A;  3NJA A;  1W7F A;  4K0X A;  3VFH A;  3WS5 A;  3ISG A;  3Q7V B;  1G5U A;  2JC7 A;  4EV4 A;  5HDS A;  3BFC A;  1VQQ A;  3C8C A;  2CC1 A;  3UB7 A;  3IWO A;  5CEB A;  4X68 A;  2EFU A;  4B93 A;  4ETX A;  1YMX A;  2Y2K A;  3GTC A;  4R38 A;  1W63 M;  2P04 A;  1K4F A;  2HDU A;  4LPZ A;  4LRZ E;  5F69 A;  1K55 A;  2B5R A;  1S6R A;  4JGR A;  3SH9 A;  4R6L A;  2W3F A;  5A90 A;  1WE4 A;  3T50 A;  4M4X A;  3UPN A;  3UO9 A;  3MKF A;  2IWB A;  1XP4 A;  3F1O B;  4HIA A;  4HP4 A;  4O01 A;  3T4K A;  1MKM A;  4UA7 A;  1QMF A;  2Z2M B;  4KZ3 A;  4DJ2 A;  1G6O A;  5AQB A;  3V3R A;  1DP9 A;  2H0T A;  3HLG A;  1L0D A;  4OLG A;  3T4T A;  3UE6 A;  2KX6 A;  4NEE D;  3W2Z A;  1XA7 A;  4JF4 A;  3BFE A;  3VE4 A;  5C5K A;  3QNC A;  4E3L A;  1H0M A;  4OPR A;  5KSH A;  2VGK A;  3N8S A;  3MXS A;  3W4Q A;  1KVM A;  1L3L A;  1YAX A;  3O86 A;  2DNS A;  2ZD8 A;  2AVX A;  3Q7V A;  2VJW A;  3ZG8 B;  3BQA A;  1MPL A;  1ERQ A;  3LIF A;  3MZF A;  3MQ0 A;  3LID A;  2WZX A;  3KSH A;  2ZMV A;  4HQA A;  2VA0 A;  4NKP A;  1IFQ A;  4P0M A;  4WZ5 A;  3BRM A;  2B18 A;  4RA7 A;  4B4X A;  5DFY A;  5L10 A;  1VHM A;  4OQG A;  3KYZ A;  5F6A A;  5A91 A;  2ZQA A;  4OPZ A;  5CEC A;  3F1O A;  3VP2 A;  1BUL A;  3NDE A;  1H8Y A;  4GDB A;  5F1F A;  4R0Q A;  1W79 A;  2WAF A;  5M1A A;  1S0W A;  4HBT A;  3EQU A;  2ZOI A;  2ZQD A;  1FIL A;  3F1N B;  2OLV A;  2XRN A;  3UB9 A;  1MWR A;  3PBS A;  5AJG A;  1W8Y A;  4HJ3 A;  5I94 A;  3H82 B;  3VV4 A;  3LIB A;  2W3H A;  1E4D A;  5DKK A;  4GCZ A;  1K55 C;  1CEG A;  3A3E A;  3TSG A;  3LEZ A;  4OOY A;  3G35 A;  4EU0 A;  3BWL A;  1RGY A;  4DXC A;  3JVU A;  5TBM B;  1T18 A;  1K56 D;  3M6H A;  1GA0 A;  1YSP A;  2J80 A;  4WM9 A;  3FWL A;  4WLA A;  3UE3 A;  1W8Q A;  1NRF A;  5FQM A;  3PXP A;  3SOI A;  3A3F A;  3HJI A;  1NWZ A;  4N1X A;  3T1X A;  3FZC A;  3BLS A;  4UQI S;  5EVI B;  1XFN A;  4EBN A;  4MNR A;  1OME A;  4I5S A;  3HUN A;  3PYP A;  4OKP A;  3IXD A;  3N8R A;  3C38 A;  1TD5 A;  4Y13 A;  1S1Y A;  2GZA A;  3ULF A;  4GS9 A;  1GCE A;  1HVB A;  1IOU A;  1I5Q A;  3S7Q A;  4KZ9 A;  3W4O A;  1TEM A;  1DY6 A;  3DTK A;  4HBU A;  1OT6 A;  1SCW A;  3IWI A;  4IUH A;  5E2H A;  2Y2O A;  3CG5 A;  1S66 L;  3SH8 A;  1EW0 A;  4BMW A;  2Z6C A;  3FYZ A;  4S2N A;  1KGG A;  2Y2M A;  3A3I A;  3TRC A;  1KDW A;  2G2W A;  5FEF A;  3UB8 A;  3BW6 A;  2WGW A;  4UA6 A;  3M2K A;  2ZM2 A;  5TBM A;  1M40 A;  3M6B A;  1NXY A;  5DKL A;  3UNW A;  5FQK A;  4PM9 A;  4FH2 A;  4PM5 A;  1SDE A;  2JHE A;  2K7S A;  4BD0 A;  1KE0 A;  1LL8 A;  3BEB A;  3BY8 A;  1YQS A;  3IT9 A;  2J9P A;  4L9G A;  3ZCZ A;  4KZ7 A;  5GHX A;  4EET B;  5EVI A;  1JWV A;  2FH5 A;  5F68 A;  2Y2L A;  4R4R A;  3EQV A;  4IUK A;  4DDY A;  4CJN A;  2I72 A;  4E04 A;  3A3J A;  1NJ4 A;  2PDR A;  2OSU A;  4RVA A;  5DFX A;  1N4O A;  3IXB A;  2W3E A;  3K3C A;  4I3I A;  3CPT A;  4IHQ A;  4B9O A;  1I2S A;  3S22 A;  2HF6 A;  2P74 A;  3IQA A;  4S2K A;  4WL9 A;  1ES4 A;  4E3J A;  4OOL A;  4BBV A;  3ZYT A;  4I3A A;  4X1M A;  1MXO A;  3LEQ A;  2VGL M;  4GZB A;  1N9N A;  4Y5F A;  4Y17 A;  1CI9 A;  3QP5 A;  4M3K A;  2QYB A;  2HP9 A;  5E2F A;  4Y15 A;  2XRO A;  2ZC5 B;  5FQJ A;  4PKY G;  2PU4 A;  4S2L A;  3CHW P;  3E0Y A;  4KUO A;  2V1B A;  2OAQ 1;  2DMW A;  3OCN A;  4S2N C;  1F2K A;  2JBF A;  4N1H A;  2VGL S;  3CLO A;  4LFU A;  1A0K A;  2W1R A;  3C2W A;  4FSF A;  4DE1 A;  2W1T B;  3C30 A;  3LYX A;  3AGD A;  2EWW A;  4MLL A;  3T4Q A;  5J4E A;  4GD8 A;  1OJG A;  4ZJ1 A;  2QMI A;  1LHY A;  5L07 A;  4Q0J A;  3VSK A;  3N4I A;  1FOF A;  4R4S A;  1G68 A;  1N9O A;  3L9K A;  1LI9 A; 
#chains in the Genus database with same CATH homology
 3BY9 A;  2W0N A;  4ME4 A;  2GNX A;  1OJ5 A;  3CI6 A;  5TJJ A;  4CLC D;  1MZU A;  4Q0I A;  3ZQ5 A;  3EOI A;  5MC7 A;  5HZH A;  1D7E A;  5J7E A;  4ETZ A;  1T1C A;  2QHK A;  2WKP A;  2IA2 A;  2PD8 A;  3OCL A;  3H9W A;  3IS2 A;  5HD5 A;  2VV6 A;  3NJA A;  1T19 A;  5HDD A;  4CLC E;  4ARZ B;  2EWV A;  3HJK A;  3PBQ A;  5HDS A;  3S7O A;  3C8C A;  2PD7 A;  3UB7 A;  1H8M A;  2O9A A;  2YKF A;  3E4O A;  2V9A A;  3LR3 A;  4UQI M;  3CIT A;  4B93 A;  4ETX A;  2MJ6 A;  4MN5 A;  4R38 A;  5K5B A;  1W63 M;  2P04 A;  3NOT C;  4LLO B;  2PYR A;  4LPZ A;  5HD3 A;  1UGU A;  1T1B A;  2XSS A;  4LRZ E;  5F69 A;  5HWT A;  2VEA A;  4JGR A;  1D06 A;  4CLC B;  5KIZ A;  4R6L A;  2W3F A;  3KX0 X;  3ICY A;  2NUT C;  1UWP X;  3TJZ C;  1DRM A;  4HOI A;  4Y2F A;  3T50 A;  2XA7 S;  4M4X A;  3FC7 A;  5CX7 A;  2W1T A;  3F1O B;  4HIA A;  4HP4 A;  4O01 A;  3T4K A;  4WF0 A;  3UMD A;  1MKM A;  1V9Z A;  2V0U A;  3IS2 B;  4EQ1 A;  4I39 A;  2J3T C;  3EEH A;  3LIA A;  3T4O A;  1LSW A;  4G3V A;  4DJ2 A;  1S1Z A;  1G6O A;  3UME A;  3MFX A;  1DP6 A;  1DP9 A;  5J3W A;  2PYP A;  3A0R A;  4WEL A;  3T4T A;  3UE6 A;  2KX6 A;  4NEE D;  3W2Z A;  4O0P A;  4Z1W A;  4BBU A;  3VOL A;  3DBA A;  3D72 A;  3S7P A;  1GSX A;  4JGP A;  1TS6 A;  1W63 Q;  3VE4 A;  1T1A A;  5C5K A;  3R4K A;  5KSH A;  3G6O A;  3H7W A;  3P01 A;  4PHT A;  2ZOH A;  4WEJ A;  2PR5 A;  4NXB A;  3LI8 A;  3RH8 B;  2H28 A;  1YAX A;  5HWV A;  3LFV A;  2L0W A;  2LB9 A;  2OOL A;  2VJW A;  5HL6 A;  3F1N A;  3NHQ A;  3BQA A;  2KLI A;  5G4Z A;  3LIF A;  5F5Y A;  2FZ0 A;  3MQ0 A;  2A24 A;  3LIC A;  3CUE A;  3LID A;  3H82 A;  3KSH A;  2ZMV A;  4HQA A;  4L9F A;  3GEC A;  2VA0 A;  2WKR A;  4NKP A;  3PBN A;  3B42 A;  5AVF A;  1IFQ A;  1GSW A;  1TS7 A;  2O9B A;  4WN5 A;  2B18 A;  4CLC A;  1H3Q A;  3V67 A;  5DFY A;  2QWS A;  3RFB A;  3K2N A;  1VHM A;  4BBT A;  4BJP A;  4EEU A;  4QPR A;  3KYZ A;  5F6A A;  2PT7 A;  5EFW A;  2VLG A;  3H7W B;  3F1O A;  1F9I A;  1OTI A;  1F5M A;  4P6Z S;  3EGD C;  3K3D A;  2HGV A;  2G7U A;  3LI9 A;  4EEP A;  5HDC A;  3EQU A;  3LIE A;  2ZOI A;  4RQ9 A;  3PHY A;  5FL3 A;  2BAS A;  3IBR A;  2K2N A;  4Y3I A;  3MXQ A;  3CAX A;  3F1N B;  2V1A A;  2NUP C;  4PAU A;  1ZTU A;  4OOM A;  2XRN A;  3R7W B;  3UB9 A;  4K08 A;  2V0W A;  2A24 B;  3TW8 A;  3PBS A;  5AJG A;  4HJ3 A;  4LRY C;  3H82 B;  1LT0 A;  3IBJ A;  3VV4 A;  3LIB A;  2W3H A;  2W3G A;  1XJ6 A;  3OC2 A;  2O0Y A;  5DKK A;  1KOU A;  4GCZ A;  4HH3 A;  4MCW A;  4NXG A;  1TS8 A;  4EU0 A;  3BWL A;  3JVU A;  5TBM B;  1T18 A;  3OOV A;  1YSP A;  2J80 A;  4WLA A;  3UE3 A;  1LSX A;  1OTB A;  4GHI B;  1XJ2 A;  3PXP A;  1P0Z A;  3EGX C;  3T4L A;  3HJI A;  1NWZ A;  1X0O A;  2GJ3 A;  4HJ4 A;  5G4Y A;  4DMZ A;  1TS0 A;  1OTA A;  2ZMF A;  5HPI A;  4UQI S;  4JGQ A;  4DN0 A;  1XFN A;  3PR6 A;  4I5S A;  3LR4 A;  3S7N A;  4MDZ A;  5HPF A;  3MJQ A;  3PYP A;  4CQH A;  3D3O A;  2Y79 A;  2PHY A;  2ZBB A;  3C38 A;  1TD5 A;  4MMN A;  3HCY A;  1S1Y A;  4L9E A;  2GZA A;  3ULF A;  4R70 A;  5HSQ A;  4GS9 A;  2J3T D;  2O99 A;  3BJN A;  1IOU A;  1XJ3 A;  3S7Q A;  4KQD A;  1NRJ A;  1OTD A;  2KDK A;  2W3D A;  3MF0 A;  4GLQ A;  4HH2 A;  4KUK A;  1LSV A;  1OT6 A;  4H6J B;  3NOP C;  4IUH A;  1S66 L;  4GW9 A;  4I38 A;  1EW0 A;  3LR0 A;  3UB6 A;  5AVE A;  1S67 L;  3PBT A;  4BMW A;  2QJ7 A;  2KOI A;  2M1C A;  2Z6C A;  3R7W A;  3EWK A;  4XT2 A;  4EUV A;  1OT9 A;  3CUE C;  4GJ4 A;  1G28 A;  2YKH A;  3LR5 A;  3TRC A;  5HWW A;  1STZ A;  2J3W A;  2L1M A;  4HJ6 A;  3UB8 A;  4MN7 A;  2VV8 A;  4IJG A;  4MN6 A;  3BW6 A;  3TE8 A;  4HP9 A;  5TBM A;  1XFQ A;  5I5L A;  4GS9 B;  5IT5 A;  5DKL A;  2D01 A;  4II7 A;  1YSQ A;  2JKT M;  3CWF A;  4DJ3 A;  2JKR M;  2I9V A;  2JHE A;  2K7S A;  4GHI A;  5DF9 A;  5DJU A;  1LL8 A;  2W27 A;  1F98 A;  3BY8 A;  1Y28 A;  4EW7 A;  1YKD A;  4L9G A;  2Z6D A;  4NXF A;  4EET B;  1DP8 A;  2LB5 A;  4FOF A;  1BYW A;  3PBO A;  3KO6 A;  2FH5 A;  5F68 A;  3EQV A;  4IUK A;  1MC0 A;  3OLO A;  4YOF A;  4XT2 B;  5IS1 A;  1OPX A;  2OWH A;  3U2A A;  2PR6 A;  5A8B A;  4JGO A;  2M7V A;  2K31 A;  2XA7 M;  2P7J A;  3MMH A;  2VV7 A;  4R3A A;  4E04 A;  4L0L A;  1ZHH B;  3FPW A;  4WEK A;  2P08 A;  2VZW A;  2GX5 A;  4AFI A;  3B47 A;  3F1P A;  3KSI A;  2D02 A;  5DJT A;  1P97 A;  3PBR A;  3MQO A;  4KQO A;  2L4R A;  2OAP 1;  2WKQ A;  1NLZ A;  3O5Y A;  2QKP A;  4Q0H A;  4NXE A;  4F3L A;  2PDR A;  4H6J A;  1ODV A;  2INW A;  5DFX A;  2JKT I;  3NOU C;  2JKR I;  2Y8H A;  1P9W A;  4LRX C;  4HI4 A;  1NLY A;  2W3E A;  2OWJ A;  3A0S A;  3K3C A;  4I3I A;  4BWI A;  4YWZ A;  4IHQ A;  4B9O A;  4YNR A;  3GDI A;  5IU1 A;  2HJ9 C;  2HF6 A;  3KYQ A;  2R78 A;  2CMN A;  4WL9 A;  1S4R A;  1VB6 A;  3VE3 A;  3E4P A;  3T4S A;  2A2L A;  4OOL A;  4BBV A;  2VX8 A;  2B02 A;  2EA9 A;  3ZYT A;  1TF1 A;  3MR0 A;  4I3A A;  1XJ4 A;  3A0V A;  1OTE A;  2VGL M;  1S4S A;  3FPV A;  5LBR A;  4G3K A;  1N9N A;  3KSG A;  4G3W A;  4EER A;  4Y5F A;  3E4Q A;  3F1P B;  3OBF A;  1JNU A;  3KSF A;  4WUJ A;  4EXO A;  4I3J A;  3P7N A;  4HY8 A;  2HJE A;  3RTY A;  4HNB A;  2QYB A;  3BQ8 A;  4F3L B;  1N9L A;  2XRO A;  2O9C A;  4PKY G;  5L8M A;  2JN7 A;  2QJ5 A;  3E0Y A;  4KUO A;  1P9R A;  2V1B A;  2OAQ 1;  3JVV A;  3MQQ A;  2DMW A;  3B33 A;  1UWN X;  3OCN A;  4PKY A;  3T4J A;  4EES A;  2VGL S;  3FG8 A;  3SW1 A;  3CLO A;  2W1R A;  2VKS A;  3C2W A;  4FSF A;  2W1T B;  3C30 A;  4ARZ A;  3LYX A;  4P6Z M;  4CLC C;  2EWW A;  4HHD A;  5J4E A;  3T4Q A;  2HV1 A;  1OJG A;  3LUQ A;  3E98 A;  4O8G A;  4Q0J A;  3EEA A;  1V9Y A;  4ZRR A;  4UEY A;  2M7U A;  1GSV A;  1N9O A;  1WA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...