5GHZA

Crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "pre-deacylation" intermediate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghzA00
3DTMA 1W79A 3N8RA 2WUQA 3MZEA 4KZ8A 3ZG5A 4XUXA 4PM5A 1PW1A 2X71A 1SDEA 4BENA 1FR6A 1Y54A 1ONGA 4WBGA 3VP3A 5HARA 3NI9A 4S2MA 1H8ZA 5FSRA 4B4XA 3EQVA 4BJPA 2WAEA 1W5DA 1ZKJA 3HL9A 4OQ0A 1YLWA 4R3JA 3CZDA 4X6TA 1XGJA 1MY8A 4JPMA 4JXVA 2ZC6B 2ZQAA 3ZHHA 1GA0A 3JYIA 5E2HA 3A3JA 5EE8A 1BLPA 1BULA 3EQUA 4OH0A 3N4IA 1GHMA 2E8IA 2WKHA 2UWXA 4LCMA 4ZAMA 2PU2A 3UN7A 4OP5A 1L0FA 1NZUA 1PZOA 3RXXA 3VP0A 4CJNA 1SDNA 5TR7A 4PM8A 1ONHA 1H8YA 1XGIA 3HUNA 4PPRA 4KZ6A 1JTDA 1YT4A 4BL3A 5BOHA 4LV1A 2ZQ9A 3CJMA 2R9XA 3IH9A 3BLMA 4KG2A 3MXRA 3MXSA 2IWCA 4K91A 3N8LA 3MBZA 4X68A 5FI7A 4DE2A 3PTEA 2Y2IA 2HP6A 1CI9A 3MZFA 5FAOA 4ZJ1A 1IYOA 5HAPA 3LEZA 4XUZA 2HDRA 1L0EA 2P9VA 3VFHA 3A3IA 3CG5A 3G2YA 3TSGA 3IWQA 1DJAA 1BT5A 3NDGA 3P09A 4OPRA 3UDXA 1MWRA 1YLPA 1SKFA 2WZXA 2VGKA 2WK0A 3ZGAB 1IYQA 1ES2A 4IBRA 5CEBA 1WYBA 1HZOA 5FDHA 2Q9MA 3UY6A 1PI4A 1DY6A 2QZ6A 3BFDA 3G4PA 4X69A 3UPOA 3PBRA 2C5WB 4OLDA 4GN2A 3LY4A 1NZOA 2HPBA 1MKIA 1JVJA 3PBQA 4P0MA 5HL1A 3IXBA 2XH9A 3IHBA 2EX9A 5CHUA 3ISGA 4N1HA 1BSGA 3DW0A 4JF4A 1K55A 3AGDA 4GOGA 1JWPA 1QMEA 4KZ3A 4PM9A 5DTSA 4KZ7A 4O7DA 2Y4AA 4P6BA 3ZFZA 5DTKA 1MPLA 1RGYA 1XXMA 1DJBA 2JCHA 3BECA 1NYYA 3WS0A 3PAEA 2X02A 3O88A 4WMCA 5FQKA 5DF8A 3HBRA 3OPHA 3OCNA 1E3UA 4MEZA 1ZG4A 5CERA 3G35A 1MBLA 2XGNA 4X55A 5CRFA 1G6AA 1YMXA 1LHYA 3HUMA 1KVLA 2JBFA 5M19A 2G2WA 2ZQ8A 4MBFA 1Q2PA 3AGEA 4OOMA 2XEPA 1KGFA 4WYYA 4DXCA 5F1FA 4KZ4A 5GL9A 1N4OA 2A3UA 3BLSA 4H8RA 1N9BA 2Y2MA 1MWUA 1GHIA 3SH9A 3ITAA 2IWDA 3TG9A 3DWZA 4EWFA 3W8KA 3NBLA 3ZNYA 5EOOA 1K56A 4S2OA 5U47A 4DE3A 3IXDA 5A92A 4N9KA 3A3EA 5CGXA 5CECA 1XKZA 1K55C 5CTNA 1J9MA 3MZDA 2ZQDA 5A93A 2EFUA 3M6BA 1GCEA 2ZC3B 4DDSA 1KDWA 5CGSA 4D2OA 4JLFA 2H10A 2WKIA 2IWBA 1MWTA 3BM6A 5E2EA 5DF9A 3N8SA 2J9PA 2RCXA 3MKFA 5CGWA 1ZC2A 3A3FA 1IKGA 3E2LA 2EXBA 3N6IA 4R23A 3S1YA 3GMWA 4S2JA 5HW3A 3WWXA 3IXGA 1K56D 3ITBA 1HTZA 2XFTA 1LI9A 2XQZA 2Y59A 2EX2A 1IYPA 4RA7A 1PIOA 2Y2LA 2J7VA 4MBHA 4KQQA 1K6SA 4OQIA 5AQ7A 5KMWA 4OQGA 3V5MA 1RGZA 4OVDA 3W4QA 3VFFA 4UA9A 5DF7A 1KGEA 4GNUA 3VP4A 4C3QA 4S2PA 4HBUA 4PMAA 2XFSA 1JWZA 5AQ9A 5DVAA 2CC1A 5FAQA 2HP9A 3WRTA 5AQBA 4CPKA 4FCFA 5JYOA 4N92A 4KG6A 3HLDA 4WELA 5CXWA 1FQGA 3FWLA 1EROA 1LLBA 1KE0A 1K4EA 3C5AA 3BFEA 2DRWA 4E3LA 3HLFA 4YFMA 3HLGA 2OLVA 4OLGA 2XDMA 4RX2A 4UAAA 4GB7A 2XK1A 4MNRA 4MLLA 3G31A 1BLCA 1KE4A 3FKWA 3Q7VB 3VP2A 3ZG7B 3IH8A 2HP5A 5EOEA 2V20A 2FFYA 3UNWA 2DNSA 4IEDA 4QJGA 4E6WA 3UPPA 4LV2A 1C3BA 5FA7A 2H0TA 3C7UA 2EXAA 1KVMA 3OC2A 1XA7A 4GKUA 3VOZA 4DXBA 1K57A 4K0XA 5DTTA 1EWZA 3V50A 3BYDA 2BG1A 1WE4A 2Q9NA 3LCEA 5E2FA 3ZG0A 4KQRA 3S22A 1PW8A 3SS3A 4OQHA 4S2KA 5AQAA 5TFQA 1XA1A 3CMZA 3IF5A 4BD1A 1CEFA 1FOFA 2XD5A 2Y2PA 5TGFA 5CTMA 2BLSA 2WGIA 3GV9A 4EV4A 3IQAA 1W7FA 4FD8A 3TOIA 4B88A 3HVFA 3LY3A 4JXSA 1I5QA 3UO9A 3HREA 4BLMA 1E4DA 5EPHA 3M2JA 3ZVWA 1O7EA 1IEMA 1LI0A 5F82A 4OONA 5EECA 3WS4A 4EUZA 3WS1A 4GDNA 5CHMA 4KZ9A 3W4PA 1YLZA 2EX6A 2PBYA 3M6HA 4E3NA 2JC7A 4U0XA 4R1GA 1SHVA 3OZHA 4KENB 3SOIA 4QY6A 4IVIA 1NRFA 1CI8A 4DKIA 1BLHA 3NDEA 3UE1A 1K57C 5EVIB 3PBOA 2ZJ9A 2WZZA 4HEFA 1K6RA 1PI5A 2Y2OA 5E43A 3S4XA 1NJ4A 3FZCA 5GHYA 2EX8A 4IBXA 4LCLA 4UA6A 2Y2KA 4L0LA 4JF5A 4LV0A 1TDLA 4YINA 1BZAA 1YQSA 2Y2HA 2Y2NA 2ZC5B 2ZQ7A 4ZTKA 4EBPA 1LL5A 4WMCD 1YM1A 2EFXA 4XXRA 3D4FA 3Q81A 2V2FF 2WGWB 3LO7A 1E3UD 4R3BA 5FQQA 4ZJ3A 2C6WB 4UHUA 3AGFA 4N9LA 5F1GA 3V39A 4OOYA 5EVLA 5A90A 2Y2JA 3FV7A 2PU4A 3FKVA 3MKEA 2A49A 5HFOA 4OPYA 4P85A 3IXHA 4X53A 3G32A 4GD8A 1LL9A 4OP8A 4P87A 1TDGA 3IHAA 5M1AA 1FSYA 4Y0TA 5FI6A 4X56A 1S6RA 1YLJA 5J8XA 1FR1A 1ZG6A 3C4PA 1M40A 3M2KA 4NK3A 1E25A 5GLBA 2VGJA 1NYMA 5FASA 1MXOA 1K4FA 2QPNA 3OPRA 4ID4A 4RVAA 4ZBEA 2Y91A 4JBFA 3UE3A 3FYZA 5FAPA 1ES4A 3IWOA 2QMIA 2Y55A 3NY4A 5HAIA 1L2SA 1FCOA 1RP5A 2ZQCA 3UE0A 1XP4A 2WYXA 4JF6A 4JXGA 3WRZA 3QNBA 2XLNA 3GR2A 2FFFB 4PM6A 4BQMA 4MBKA 3PBSA 4S2IA 4E3KA 1ALQA 2OSUA 3ZG9B 4KZ5A 4S2NA 5EVIC 5HAQA 1HVBA 2WKEA 3VP1A 3QNCA 5GLCA 3NC8A 1IELA 3SS4A 2DCFA 4WM9A 5F83A 5FQ9A 3PBTA 3DWKA 2R9WA 2XF3A 2JE5A 4JKTA 4WZ5A 3BEBA 4DF6A 5D3OA 5A91A 4BD0A 3MFDA 2V1ZA 1IYSA 1O07A 2ZM0A 3O87A 3PBNA 5EUAA 3NIAA 3C7VA 5CHJA 1TVFA 2P9VB 1TEMA 3N7WA 4HESA 4KG5A 4OPQA 4DRTA 2Y2GA 1NXYA 1Q2QA 4FSFA 1ERMA 3ZVTA 3Q07A 4KQOA 4EBLA 4EQIA 1PYYA 1K54C 3HLCA 5FQMA 4LENA 3SH8A 1L0DA 4GZBA 1BLSA 1PWGA 4C75A 3ZDJA 2Y2QA 4HBTA 4N1XA 4DDYA 1VM1A 3Q82A 4WEJA 1XPBA 2ZMAA 4Z9QA 4BL2A 1ERQA 2G2UA 3P98A 5GHZA 2J8YA 1PWCA 1ESIA 3GTCA 5L2FA 1U60A 4E6XA 1PWDA 5G18A 3SH7A 3Q7VA 1MWSA 1M6KA 3IF6B 1S0WA 4S2NC 1ES5A 1KE3A 3OPLA 2ZC4B 1DJCA 4F94A 3RXWA 4RYEA 5KSCA 3VSKA 4OKPA 4R4RA 2OLUA 1Z6FA 4IVKA 4E3IA 1AXBA 1VQQA 2HDUA 4WZ5C 4DE1A 5FQJA 3BFFA 2GDNA 2I72A 3V3SA 5M18A 1ESUA 3UPNA 1I2WA 3UDFA 1FCNA 4WEKA 4E3JA 3QHYA 2ZD8A 3A3DA 1CK3A 1XX2A 2HDQA 3G2ZA 1YLTA 1KGGA 3NCKA 3ZCZA 1FSWA 2ZM8A 4WZ4A 4Y0OA 4LV3A 5KZHA 5GLAA 3IF6A 2ZLYA 1JWVA 2ZM2A 5KSHA 1HD8A 4PM7A 3SS5A 4QU3A 5E2GA 3WS2A 4RX3A 1SCWA 3UDIA 3G34A 2P74A 3BFCA 3HUOA 3OCLA 4UA7A 4U3TA 4Q8IA 1BTLA 3BRMA 4OOLA 4S2LA 2ZC7A 4FH4A 4U0TA 5HX9A 5IHVA 4ZJ2A 4GDBA 4C6YA 3HLEA 3ZNTA 1NY0A 5I94A 1ES3A 2Z2MB 3B3XA 3GQZA 1FCMA 5GLDA 4E3OA 3RJUA 1OMEA 3IWIA 1W8YA 2RL3A 3W4OA 1IKIA 3GVBA 3V3RA 4FH2A 4E3MA 4B4ZA 3O3VA 5CEDA 3Q1FA 1K25A 1RCJA 2XR0A 1BUEA 1EI5A 3HLBA 2WADA 4Y7PA 5EVIA 4ZDXA 2XD1A 1I2SA 4K0WA 2WAFA 3C4OA 3ZG8B 1PZPA 5JYPA 3VOYA 4QB8A 2X01A 4NETA 1K38A 1W8QA 1YLYA 3Q7ZA 4EBNA 4M3KA 5FI2A 1G68A 3I7JA 3BFGA 3G30A 3VSLA 3PAGA 2HDSA 3IF6C 3IT9A 4A5RA 4Y0UA 4JXWA 4KZBA 4OPZA 1L0GA 3E2KA 2H0YA 3GSGA 4R4SA 2WGWA 4KZAA 5EVID 1CEGA 2Z2LB 5FQIA 4QY5A 1H5XA 4QHCA 3HLWA 2OV5A 2B5RA 1K54A 4GD6A 5GHXA 3VMAA 1GA9A 2H5SA 5FATA 1QMFA 3WS5A 1YMSA 4QD4A 4R0QA 1JTGA 4DE0A 1GHPA 3GRJA 2WGVA 2J9OA 3OPPA 1WYCA 3O86A 1KDSA
chains in the Genus database with same CATH superfamily
2WUQA 2XSSA 3LYXA 2X71A 3LIFA 1SDEA 3K2NA 4BENA 2O0YA 4WBGA 3F1PA 4B4XA 1L3LA 2WAEA 4R3JA 1XGJA 1MY8A 4EXOA 2ZC6B 1GA0A 3A0VA 1AWIA 3A3JA 3QP2A 5HSQA 3MR0A 3UN7A 1NZUA 1PZOA 1H8YA 3D72A 3S7NA 2EWVA 3HUNA 1JTDA 3K3DA 3CJMA 2W3DA 3IH9A 4R6LA 1VETA 2VV8A 2HP6A 1NWZA 3DBAA 2V9AA 1DJAA 1OTIA 2PBDP 1YLPA 2WK0A 1IYQA 2JKGA 5FDHA 4O8GA 4LRZE 3PBRA 3CPTA 3LY4A 4F3LB 2HJEA 1MKIA 1JVJA 3IHBA 2EX9A 1JWPA 1S67L 4UQIM 4P6BA 1F5MA 2QHKA 1TS7A 3PAEA 5DKKA 5FQKA 1XFNA 3HBRA 1ZG4A 3EEAA 2VGLS 4X55A 3HUMA 3QP4A 2G2WA 5F6AA 3AGEA 4WYYA 2V8CA 1Y4OA 4KZ4A 3BLSA 1N9BA 1GHIA 3P01A 1LL8A 3DWZA 3NBLA 3ZNYA 2Z6CA 5EOOA 3QP8A 4KUKA 4DE3A 3D3OA 2WKPA 5CGXA 1XKZA 5CTNA 1J9MA 1MKMA 3M6BA 4DN0A 1GCEA 4DDSA 2H10A 2WKIA 2IWBA 1DP8A 5MC7A 3N8SA 3DAVA 3UB8A 2J9PA 1ZC2A 3A3FA 3E2LA 4R23A 2EXBA 4Y3IA 3S1YA 3WWXA 1K56D 2EWWA 4EW7A 1HTZA 4NG2A 1IYPA 2J7VA 2W0NA 2V1AA 4KQQA 5AQ7A 4Y17A 4KUOA 4UA9A 5DF7A 3VP4A 4S2PA 3UPOA 2ZOHA 2PD8A 1JWZA 3H7WB 5FAQA 4CPKA 2HP9A 4LPZA 3BFEA 5IU1A 1XJ2A 2JKTM 4RX2A 2XK1A 3FKWA 2V8FA 3UNWA 2DNSA 3UPPA 4LV2A 3C7UA 4I38A 3GECA 3BY9A 3BYDA 1WE4A 3S22A 1PW8A 1IFQA 1XA1A 3IF5A 2W3EA 2XD5A 2Y2PA 5HZHA 3IQAA 4MN7A 3S7OA 4BLMA 1VEUA 1P0ZA 4EUZA 3CUEA 2EX6A 2PBYA 4D60A 2JC7A 4M4XA 3OZHA 3SOIA 2PYPA 1ACFA 1BLHA 1K57C 3CLOA 3H9WA 2WZZA 2W27A 3BJNA 3S4XA 3MSHA 1ODVA 4JF5A 3TJZC 1BZAA 2Y2HA 4P6ZM 4XXRA 2A2LA 3LO7A 1E3UD 4UHUA 3AGFA 3HCYA 4N9LA 2J3TC 3EGDC 5F1GA 3NOTC 2A49A 4ARZA 4OPYA 4P85A 3IXHA 4RQ9A 4P87A 4OP8A 1LL9A 5HPIA 4ZRRA 5M1AA 1FSYA 5FI6A 1YLJA 3K3CA 5IT5A 3R7WA 1CQAA 1FR1A 4MN5A 2K31A 4NK3A 2XA7S 2VGJA 1TS0A 4R3AA 1K4FA 2QPNA 3IX3A 1LSVA 1XJ4A 3NY4A 5HAIA 2ZQCA 3UE0A 1XP4A 2WYXA 4JF6A 1H3QA 4MBKA 4X1MA 4R70A 4EEPA 1OT9A 3UE6A 2OSUA 2M7UA 5EVIC 1HVBA 2WKEA 3VP1A 3QNCA 2DCFA 3DWKA 1VETB 4JKTA 3BEBA 2D02A 5D3OA 3NOPC 2HJ9C 2V1ZA 1IYSA 3O87A 5EUAA 1TEMA 4OPQA 4KG5A 1VB6A 1PNEA 3EWKA 1Q2QA 5TJJA 4FSFA 1D06A 4EBLA 1K54C 2W3HA 3KSIA 4GZBA 1PWGA 4C75A 3ZDJA 4YOFA 1ESIA 4FTXA 1U60A 3E0YA 4X1LA 5G18A 4ESPA 1KE3A 1IOUA 4F94A 4DJ3A 2VEAA 3RXWA 4RYEA 4IVKA 3OBFA 1N9LA 2GDNA 3V3SA 2GX5A 1I2WA 4DJ2A 4PHTA 3G2ZA 3ZCZA 2ZM8A 4HNBA 3E4OA 3IF6A 1HD8A 3WS2A 2K7SA 2P74A 3HUOA 3OCLA 4CLCE 4U0TA 4K08A 4GDBA 3ZNTA 2GZAA 2Z2MB 3B3XA 2QYBA 5GLDA 1OMEA 1W8YA 2VGLM 3GVBA 4E3MA 3Q1FA 2R78A 2XR0A 1CF0A 3HLBA 2WADA 5EVIA 4ZDXA 1S4RA 3ZG8B 4GHIB 3F1OB 2X01A 4EBNA 4JGQA 4M3KA 5FI2A 3I7JA 3BFGA 3IT9A 4KZBA 3E2KA 2WGWA 3T4SA 4QHCA 4EERA 3HLWA 2OV5A 2B5RA 1K54A 4GD6A 1GA9A 3CWFA 2H5SA 5FATA 4R0QA 2PAVP 3MXQA 4IHQA 3EOIA 3OPPA 3O86A 3DTMA 2XROA 2W1TB 3ZG5A 4PM5A 4CLCD 1ONGA 4S2MA 2PR6A 5DFXA 2E8JA 4LFUA 4X6TA 4JPMA 2P7JA 5E2HA 2ACGA 3EQUA 3PXPA 2E8IA 3QP6A 4LCMA 4ZAMA 3RXXA 4CJNA 4PM8A 1ONHA 3BQ8A 3T4QA 4PPRA 2VA0A 3BLMA 3MXSA 3N8LA 3MBZA 4DE2A 1VEUB 3PTEA 2Y2IA 4GLQA 2VKSA 5FAOA 2HDRA 2P9VA 3A3IA 3IX8A 3G2YA 3TSGA 2GJ3A 3NDGA 3SZTA 1SKFA 2VGKA 3ZGAB 1ES2A 5CEBA 1WYBA 2Q9MA 2WKRA 2QZ6A 3H82A 4P0MA 5HL1A 3IXBA 2EA9A 3AGDA 4PM9A 5DTSA 2Y4AA 3BWLA 3ZFZA 5DTKA 2HGVA 2O9CA 2QKPA 3BECA 1NYYA 3DTEA 4ARZB 5DJTA 5DF8A 4PAUA 1E3UA 3JVUA 1G6AA 1YMXA 2JBFA 2JKRM 4MBFA 5F1FA 1KGFA 3BY8A 5GL9A 5K5BA 2G7UA 4II7A 4H8RA 2IWDA 3TG9A 1HLUP 5U47A 1LT0A 4Y15A 5A92A 4ETXA 1STZA 3BM6A 5DF9A 2RCXA 1PFLA 4H6JB 5HW3A 4S2JA 3A0SA 2XA7M 3CI6A 2XQZA 4RA7A 3KO6A 2ZMVA 3KSFA 3FPVA 4LRXC 5F5YA 3V5MA 2L1MA 3W4QA 1KGEA 4GNUA 1S66L 4Q0IA 4PMAA 5FL3A 4BMWA 5HWVA 1ZHHB 4N92A 5CXWA 1BYWA 3IS2B 1F98A 1TS6A 1EROA 3FWLA 1LLBA 3G6OA 1KE0A 3C5AA 4E3LA 2VLGA 4GCZA 4OLGA 4MNRA 1KE4A 3VP2A 2O9BA 3B47A 2M1CA 1FIKA 3CHWP 3R4KA 2QWSA 3NOUC 4B93A 3QP1A 4JGOA 3VOZA 4GKUA 5DTTA 4ETZA 1EWZA 3V50A 2BG1A 5E2FA 2PR5A 4OQHA 4S2KA 5TFQA 4BD1A 4I3AA 1FOFA 1NLZA 1Y28A 2ZMFA 4JGRA 3UO9A 3M2JA 1O7EA 1LI0A 4OONA 5EECA 4IUHA 3WS4A 4GDNA 4KZ9A 4E3NA 1GSVA 4R1GA 4KENB 4QY6A 4IVIA 1CI8A 4DKIA 1D7EA 5EVIB 2JKFA 1PI5A 2Y2OA 3FZCA 2EX8A 4LCLA 3NJAA 2Y2KA 4NXEA 5J7EA 5HDSA 2Y2NA 4EBPA 1YM1A 3D4FA 5L07A 2WGWB 3LIAA 2C6WB 2LB5A 5A90A 2PU4A 3G32A 3CUEC 5L10A 3LR4A 1M40A 4Q0HA 3M2KA 3MFXA 2OWJA 1E25A 4LRYC 1SKOA 1NYMA 4HHDA 1YPRA 1MC0A 3UE3A 2ZBBA 4CLCA 1ES4A 1L2SA 1FCOA 1J3WA 1RP5A 3WRZA 4LGWA 2XLNA 3GR2A 5AVFA 2DMWA 5GLCA 1IELA 3SS4A 4HQAA 1K0KA 3PBTA 5FQ9A 2R9WA 2XF3A 4WZ5A 4DF6A 5A91A 3MFDA 3PBNA 5CHJA 5C5KA 1TVFA 2P9VB 3TW8A 3RFBA 3HLCA 5FQMA 3VE4A 3SH8A 4BBUA 4DRTA 4DDYA 1VM1A 2VX8A 4BL2A 1XPBA 1ERQA 1XJ3A 2J8YA 1PWCA 3GTCA 5L2FA 4E6XA 2MJ6A 3SH7A 1MWSA 1M6KA 3LIDA 1S0WA 1ES5A 3OPLA 5EVEA 1DJCA 3PR6A 5KSCA 3VSKA 4Y5FA 2OLUA 5FQJA 3BFFA 2I72A 3RH8B 3UDFA 4E3JA 4WEKA 3QHYA 2ZD8A 1OTBA 1TD5A 2IA2A 3NCKA 1FSWA 4WZ4A 5GLAA 2ZLYA 3LIBA 5E2GA 4HH3A 4UA7A 4U3TA 1BTLA 4S2LA 3HLEA 1N9NA 1W63Q 3GQZA 1OTDA 3F1NA 5AJGA 3W4OA 1XFQA 3V3RA 4FH2A 3O3VA 5CEDA 1RCJA 4BBVA 1T1BA 4YNRA 1T1CA 1PZPA 5JYPA 3VOYA 4QB8A 3Q7ZA 1CJFA 1YLYA 3O5YA 4YWZA 2YKFA 3VSLA 2VZWA 3IF6C 4A5RA 4Y0UA 4OPZA 1L0GA 3LR5A 3F1PB 2H0YA 1A0KA 4KZAA 5IS1A 1CEGA 2Z2LB 2Z6DA 5FQIA 2P04A 4QY5A 4AFIA 4HP4A 2AVXA 1P9WA 1YMSA 4QD4A 1JTGA 3RTYA 2FH5A 4DE0A 4JGPA 2WGVA 3LEQA 1KDSA 2B18A 4KZ8A 3MZEA 2V1BA 5HARA 3NI9A 5FSRA 5KIZA 5EV0A 3EQVA 4BJPA 4IJGA 1W5DA 3C8CA 1ZKJA 2VJWA 3HL9A 3CZDA 3JYIA 4WF0A 3NHQA 3P7NA 4HJ6A 1BULA 3N4IA 2WKHA 2KOIA 4OP5A 1L0FA 3VP0A 3PHYA 5HL6A 5TR7A 2J3WA 1OTAA 1OPXA 4X25A 3CPTB 1YT4A 4BL3A 2ZQ9A 2R9XA 4KG2A 3NECA 3MXRA 4K91A 5HDDA 3MZFA 1CI9A 5HAPA 1TF1A 3LEZA 4XUZA 5TBMA 3VFHA 3CG5A 3LR3A 5EM1A 3IWQA 3T50A 2WZXA 4I5SA 4IBRA 2B95A 1DY6A 3C38A 2C5WB 4GN2A 1NZOA 3KYQA 2HPBA 3PBQA 2P08A 4HOIA 4HI4A 3T4OA 2XH9A 3UB7A 3ISGA 1BSGA 3DW0A 4JF4A 1K55A 2J80A 4O7DA 4UQIS 4HJ3A 1MPLA 1XXMA 1H8MA 1DJBA 3C2WA 5DFYA 3OPHA 5CERA 3G35A 2XGNA 5CRFA 5M19A 3LI9A 4DXCA 2XEPA 2OWHA 1N4OA 1YKDA 2A3UA 2KX6A 3T1RA 2Y2MA 3ITAA 4WLAA 4MN6A 4NXGA 1K56A 4CLCB 4NKPA 3MZDA 2UV0E 2ZQDA 2BTFP 2PD7A 5J3WA 1KDWA 3IX4A 5CGSA 2QJ5A 5E2EA 3GDIA 3N6IA 1X0OA 3GMWA 3IXGA 4GJ4A 5L09A 1LI9A 2XFTA 2Y59A 4MBHA 1K6SA 5KMWA 1RGZA 3D9YA 4OVDA 2K2NA 4HBUA 2XFSA 2V0WA 4KG6A 3HLDA 4WELA 1FQGA 1K4EA 4NXFA 2DRWA 3HLFA 2XDMA 4MLLA 1BLCA 4BWIA 3IH8A 2HP5A 5EOEA 2FFYA 3FG8A 5F68A 4QJGA 1H0MA 1LSXA 5FA7A 4EU0A 2EXAA 1KVMA 3OC2A 1XA7A 4DXBA 4K0XA 3LCEA 2Q9NA 3ZG0A 3LFVA 3CMZA 3OLOA 1JNUA 1CEFA 3MJQA 3UMDA 5TGFA 3MS6A 5CTMA 2BLSA 5FEFA 1TS8A 4Q0JA 4QPRA 1W7FA 3T4TA 4FD8A 3HVFA 5HD3A 4BBTA 1I5QA 1YAXA 3VV4A 3ZVWA 3T1QB 5F82A 2PHYA 3IBJA 2W1RA 3WS1A 4HJ4A 1YLZA 3F1NB 4QWOA 4U0XA 1SHVA 1NRFA 3NDEA 2WKQA 4L9FA 3E98A 4EETB 4HEFA 3KSGA 2VV7A 5E43A 1NJ4A 5GHYA 4LLOB 3R7WB 4L0LA 4LV0A 1TDLA 1LL5A 4WMCD 5DKLA 2V2FF 4R3BA 4ZJ3A 3MMHA 3L7HA 3V39A 5EVLA 3FKVA 5HFOA 4X53A 2HF6A 3IHAA 4Y0TA 4X56A 4MMNA 1S6RA 4G3WA 1ZG6A 3C4PA 4EESA 5GLBA 2PDRA 1MXOA 4DMZA 3UB6A 4ZBEA 3OPRA 4RVAA 2Y91A 4JBFA 3JVVA 2KDKA 3IWOA 4MCWA 2FFFB 4BQMA 3BW6A 3JPUA 3E4PA 3PBSA 4E3KA 2M7VA 1ALQA 4PKYA 4KZ5A 4S2NA 3B33A 4ME4A 5F83A 4WM9A 3EGXC 3UB9A 4EUVA 4HP9A 2JE5A 3T1XA 3UMEA 4BD0A 4G3KA 3T4KA 3NIAA 3KSHA 4HESA 5TBMB 2Y2GA 4WL9A 1ERMA 3ZQ5A 3ZVTA 4CLCC 4LENA 1BLSA 3MQOA 4EQ1A 4HBTA 1N9OA 3Q82A 3P98A 1F9IA 1GSWA 3UB5P 3Q7VA 4EEUA 3IF6B 3EEHA 4E3IA 1Z6FA 1AXBA 1VQQA 4WZ5C 5M18A 1ESUA 1UWNX 1FCNA 3ULFA 1CK3A 2O99A 1XX2A 2OAQ1 3L9KA 1KGGA 4Y0OA 2J3TD 2L0WA 4LV3A 2ZM2A 5KSHA 4PM7A 3SS5A 3T4LA 5DJUA 1SCWA 3UDIA 3G34A 3BFCA 1W63M 4Q8IA 5FEGA 4OOLA 2ZC7A 4C6YA 1XJ6A 4E3OA 3RJUA 3IWIA 4I39A 3V67A 4FOFA 4XT2A 4B4ZA 1BUEA 4Y7PA 1NRJA 1V9ZA 2XD1A 4K0WA 4GS9A 1Z09A 2QJ7A 3LUQA 1YSPA 4NETA 4MDZA 1K38A 5AVEA 1NLYA 3G30A 2H28A 3PAGA 3ZYTA 5F69A 3QP5A 4JXWA 3GSGA 3MF0A 2ZL1A 5EVID 5GHXA 2W3GA 4Y2FA 4G3VA 3VOLA 2J9OA 4GHIA 3F1OA 1W79A 3N8RA 2B02A 4XUXA 1PW1A 4HY8A 1FR6A 1Y54A 5I5LA 4UEYA 3VP3A 1H8ZA 2INWA 4OQ0A 3S7QA 2JKRI 2PT7A 1YLWA 5HWTA 2CMNA 4JXVA 1V9YA 2ZQAA 3ZHHA 2VK3A 4O01A 5EE8A 1BLPA 5J4EA 4OH0A 1VHMA 2Y8HA 1GHMA 2UWXA 2PU2A 2W1TA 1SDNA 3FPWA 1XGIA 3H82B 2ZOIA 4KZ6A 5BOHA 4LV1A 2IWCA 4X68A 5FI7A 3KYEA 4ZJ1A 1IYOA 1L0EA 1PRQA 3P09A 1BT5A 4OPRA 3UDXA 1MWRA 3U4LP 1P97A 1G5UA 3FC7A 1HZOA 3UY6A 1PI4A 3G4PA 3BFDA 4X69A 3MQ0A 4WUJA 4OLDA 4E04A 4CQHA 5CHUA 4N1HA 4GOGA 1QMEA 4KZ3A 4KZ7A 3CITA 1RGYA 3S7PA 2JCHA 3WS0A 2X02A 3BQAA 3O88A 4WMCA 3LR0A 3OCNA 4MEZA 1MBLA 4HH2A 3B42A 1WA9A 1LHYA 1KVLA 5CECA 2ZQ8A 1Q2PA 4OOMA 1DRMA 4NXBA 1MWUA 3A0RA 3SH9A 4FUWA 4IUKA 1YSQA 4EWFA 3TRCA 3W8KA 4S2OA 2I9VA 3IXDA 4N9KA 3A3EA 1K55C 5A93A 2EFUA 2ZC3B 4D2OA 1DP9A 4JLFA 3DTIA 1MWTA 2O9AA 3MQQA 3MKFA 5CGWA 1IKGA 4HIAA 2L4RA 3ITBA 2EX2A 1LSWA 5L8MA 1PIOA 2Y2LA 1G6OA 4WN5A 4OQIA 5LBRA 4OQGA 2NUTC 2Q0OA 1UWPX 4GW9A 1S4SA 3VFFA 1S1YA 3VE3A 4C3QA 5EFWA 1G28A 5AQ9A 5DVAA 2CC1A 3WRTA 2OAP1 5AQBA 4FCFA 5JYOA 3LIEA 4H6JA 1FILA 4YFMA 3HLGA 2A24A 2OLVA 3W2ZA 2HV1A 4UAAA 4GB7A 3G31A 3Q7VB 3ZG7B 5HWWA 2V20A 3LI8A 2KLIA 1T1AA 4IEDA 2PRFA 4E6WA 1C3BA 3ICYA 2H0TA 5A8BA 3IS2A 1K57A 4KQRA 3SS3A 3T1SA 5AQAA 5FDSA 2Y79A 2JHEA 4O0PA 2WGIA 3GV9A 4EV4A 3TOIA 4B88A 3LY3A 1SZVA 4JXSA 2BASA 3HREA 1E4DA 5EPHA 1IEMA 5CHMA 3W4PA 2JKTI 3M6HA 4I3JA 4XT2B 3DTKA 1T18A 3UE1A 3PBOA 5G4YA 2ZJ9A 3HJIA 1K6RA 4GS9B 4F3LA 1MZUA 4IBXA 4L9GA 4UA6A 4Z1WA 5CX7A 4YINA 1YQSA 2ZC5B 2ZQ7A 4ZTKA 3T4JA 4B9OA 2EFXA 1SKOB 3Q81A 2ZL1B 5FQQA 4OOYA 3T12B 2Y2JA 3FV7A 3MKEA 4GD8A 1TDGA 4Y13A 5J8XA 2OOLA 5FASA 4ID4A 3LICA 3FYZA 5FAPA 1OJ5A 5HD5A 2QMIA 2Y55A 4PKYG 4R38A 4JXGA 3QNBA 5G4ZA 4PM6A 2D01A 4S2IA 3ZG9B 5HAQA 3NC8A 3KYZA 1EW0A 3TE8A 2ZM0A 1O07A 3C7VA 1OJGA 3N7WA 1NXYA 3H7WA 3NULA 3Q07A 4KQOA 4EQIA 1PYYA 3U2AA 1L0DA 2Y2QA 4N1XA 4WEJA 1T19A 3C30A 2ZMAA 4I3IA 4Z9QA 3E4QA 5HDCA 2G2UA 5GHZA 1PWDA 4S2NC 2ZC4B 3KX0X 3HJKA 1OTEA 4R4RA 4OKPA 4KQDA 1ZTUA 1D1JA 4DE1A 2HDUA 1KOUA 3UPNA 2LB9A 1OT6A 3A3DA 2YKHA 2HDQA 1YLTA 5KZHA 1JWVA 3SW1A 4QU3A 5HPFA 4RX3A 2FZ0A 3BRMA 3PYPA 4FH4A 5IHVA 4ZJ2A 1GSXA 1NY0A 1P9RA 1ES3A 5I94A 1FCMA 1F2KA 4P6ZS 2PYRA 2RL3A 2JN7A 1S1ZA 1IKIA 2NUPC 2V0UA 1K25A 1EI5A 1I2SA 4NEED 5EM0A 2WAFA 2HZ5A 3C4OA 3IBRA 2W3FA 1UGUA 1W8QA 1G68A 3LGOA 2VV6A 2HDSA 1DP6A 4R4SA 4L9EA 1H5XA 2GNXA 3VMAA 2XRNA 1QMFA 3WS5A 3OOVA 1GHPA 3GRJA 1WYCA 2A24B 3CAXA 5HX9A
chains in the Genus database with same CATH topology
3DTMA 1W79A 3N8RA 2WUQA 3MZEA 4KZ8A 3ZG5A 4XUXA 4PM5A 1PW1A 2X71A 1SDEA 4BENA 1FR6A 1Y54A 1ONGA 4WBGA 3VP3A 5HARA 3NI9A 4S2MA 1H8ZA 5FSRA 4B4XA 3EQVA 4BJPA 2WAEA 1W5DA 1ZKJA 3HL9A 4OQ0A 1YLWA 4R3JA 3CZDA 4X6TA 1XGJA 1MY8A 4JPMA 4JXVA 2ZC6B 2ZQAA 3ZHHA 1GA0A 3JYIA 5E2HA 3A3JA 5EE8A 1BLPA 1BULA 3EQUA 4OH0A 3N4IA 1GHMA 2E8IA 2WKHA 2UWXA 4LCMA 4ZAMA 2PU2A 3UN7A 4OP5A 1L0FA 1NZUA 1PZOA 3RXXA 3VP0A 4CJNA 1SDNA 5TR7A 4PM8A 1ONHA 1H8YA 1XGIA 3HUNA 4PPRA 4KZ6A 1JTDA 1YT4A 4BL3A 5BOHA 4LV1A 2ZQ9A 3CJMA 2R9XA 3IH9A 3BLMA 4KG2A 3MXRA 3MXSA 2IWCA 4K91A 3N8LA 3MBZA 4X68A 5FI7A 4DE2A 3PTEA 2Y2IA 2HP6A 1CI9A 3MZFA 5FAOA 4ZJ1A 1IYOA 5HAPA 3LEZA 4XUZA 2HDRA 1L0EA 2P9VA 3VFHA 3A3IA 3CG5A 3G2YA 3TSGA 3IWQA 1DJAA 1BT5A 3NDGA 3P09A 4OPRA 3UDXA 1MWRA 1YLPA 1SKFA 2WZXA 2VGKA 2WK0A 3ZGAB 1IYQA 1ES2A 4IBRA 5CEBA 1WYBA 1HZOA 5FDHA 2Q9MA 3UY6A 1PI4A 1DY6A 2QZ6A 3BFDA 3G4PA 4X69A 3UPOA 3PBRA 2C5WB 4OLDA 4GN2A 3LY4A 1NZOA 2HPBA 1MKIA 1JVJA 3PBQA 4P0MA 5HL1A 3IXBA 2XH9A 3IHBA 2EX9A 5CHUA 3ISGA 4N1HA 1BSGA 3DW0A 4JF4A 1K55A 3AGDA 4GOGA 1JWPA 1QMEA 4KZ3A 4PM9A 5DTSA 4KZ7A 4O7DA 2Y4AA 4P6BA 3ZFZA 5DTKA 1MPLA 1RGYA 1XXMA 1DJBA 2JCHA 3BECA 1NYYA 3WS0A 3PAEA 2X02A 3O88A 4WMCA 5FQKA 5DF8A 3HBRA 3OPHA 3OCNA 1E3UA 4MEZA 1ZG4A 5CERA 3G35A 1MBLA 2XGNA 4X55A 5CRFA 1G6AA 1YMXA 1LHYA 3HUMA 1KVLA 2JBFA 5M19A 2G2WA 2ZQ8A 4MBFA 1Q2PA 3AGEA 4OOMA 2XEPA 1KGFA 4WYYA 4DXCA 5F1FA 4KZ4A 5GL9A 1N4OA 2A3UA 3BLSA 4H8RA 1N9BA 2Y2MA 1MWUA 1GHIA 3SH9A 3ITAA 2IWDA 3TG9A 3DWZA 4EWFA 3W8KA 3NBLA 3ZNYA 5EOOA 1K56A 4S2OA 5U47A 4DE3A 3IXDA 5A92A 4N9KA 3A3EA 5CGXA 5CECA 1XKZA 1K55C 5CTNA 1J9MA 3MZDA 2ZQDA 5A93A 2EFUA 3M6BA 1GCEA 2ZC3B 4DDSA 1KDWA 5CGSA 4D2OA 4JLFA 2H10A 2WKIA 2IWBA 1MWTA 3BM6A 5E2EA 5DF9A 3N8SA 2J9PA 2RCXA 3MKFA 5CGWA 1ZC2A 3A3FA 1IKGA 3E2LA 2EXBA 3N6IA 4R23A 3S1YA 3GMWA 4S2JA 5HW3A 3WWXA 3IXGA 1K56D 3ITBA 1HTZA 2XFTA 1LI9A 2XQZA 2Y59A 2EX2A 1IYPA 4RA7A 1PIOA 2Y2LA 2J7VA 4MBHA 4KQQA 1K6SA 4OQIA 5AQ7A 5KMWA 4OQGA 3V5MA 1RGZA 4OVDA 3W4QA 3VFFA 4UA9A 5DF7A 1KGEA 4GNUA 3VP4A 4C3QA 4S2PA 4HBUA 4PMAA 2XFSA 1JWZA 5AQ9A 5DVAA 2CC1A 5FAQA 2HP9A 3WRTA 5AQBA 4CPKA 4FCFA 5JYOA 4N92A 4KG6A 3HLDA 4WELA 5CXWA 1FQGA 3FWLA 1EROA 1LLBA 1KE0A 1K4EA 3C5AA 3BFEA 2DRWA 4E3LA 3HLFA 4YFMA 3HLGA 2OLVA 4OLGA 2XDMA 4RX2A 4UAAA 4GB7A 2XK1A 4MNRA 4MLLA 3G31A 1BLCA 1KE4A 3FKWA 3Q7VB 3VP2A 3ZG7B 3IH8A 2HP5A 5EOEA 2V20A 2FFYA 3UNWA 2DNSA 4IEDA 4QJGA 4E6WA 3UPPA 4LV2A 1C3BA 5FA7A 2H0TA 3C7UA 2EXAA 1KVMA 3OC2A 1XA7A 4GKUA 3VOZA 4DXBA 1K57A 4K0XA 5DTTA 1EWZA 3V50A 3BYDA 2BG1A 1WE4A 2Q9NA 3LCEA 5E2FA 3ZG0A 4KQRA 3S22A 1PW8A 3SS3A 4OQHA 4S2KA 5AQAA 5TFQA 1XA1A 3CMZA 3IF5A 4BD1A 1CEFA 1FOFA 2XD5A 2Y2PA 5TGFA 5CTMA 2BLSA 2WGIA 3GV9A 4EV4A 3IQAA 1W7FA 4FD8A 3TOIA 4B88A 3HVFA 3LY3A 4JXSA 1I5QA 3UO9A 3HREA 4BLMA 1E4DA 5EPHA 3M2JA 3ZVWA 1O7EA 1IEMA 1LI0A 5F82A 4OONA 5EECA 3WS4A 4EUZA 3WS1A 4GDNA 5CHMA 4KZ9A 3W4PA 1YLZA 2EX6A 2PBYA 3M6HA 4E3NA 2JC7A 4U0XA 4R1GA 1SHVA 3OZHA 4KENB 3SOIA 4QY6A 4IVIA 1NRFA 1CI8A 4DKIA 1BLHA 3NDEA 3UE1A 1K57C 5EVIB 3PBOA 2ZJ9A 2WZZA 4HEFA 1K6RA 1PI5A 2Y2OA 5E43A 3S4XA 1NJ4A 3FZCA 5GHYA 2EX8A 4IBXA 4LCLA 4UA6A 2Y2KA 4L0LA 4JF5A 4LV0A 1TDLA 4YINA 1BZAA 1YQSA 2Y2HA 2Y2NA 2ZC5B 2ZQ7A 4ZTKA 4EBPA 1LL5A 4WMCD 1YM1A 2EFXA 4XXRA 3D4FA 3Q81A 2V2FF 2WGWB 3LO7A 1E3UD 4R3BA 5FQQA 4ZJ3A 2C6WB 4UHUA 3AGFA 4N9LA 5F1GA 3V39A 4OOYA 5EVLA 5A90A 2Y2JA 3FV7A 2PU4A 3FKVA 3MKEA 2A49A 5HFOA 4OPYA 4P85A 3IXHA 4X53A 3G32A 4GD8A 1LL9A 4OP8A 4P87A 1TDGA 3IHAA 5M1AA 1FSYA 4Y0TA 5FI6A 4X56A 1S6RA 1YLJA 5J8XA 1FR1A 1ZG6A 3C4PA 1M40A 3M2KA 4NK3A 1E25A 5GLBA 2VGJA 1NYMA 5FASA 1MXOA 1K4FA 2QPNA 3OPRA 4ID4A 4RVAA 4ZBEA 2Y91A 4JBFA 3UE3A 3FYZA 5FAPA 1ES4A 3IWOA 2QMIA 2Y55A 3NY4A 5HAIA 1L2SA 1FCOA 1RP5A 2ZQCA 3UE0A 1XP4A 2WYXA 4JF6A 4JXGA 3WRZA 3QNBA 2XLNA 3GR2A 2FFFB 4PM6A 4BQMA 4MBKA 3PBSA 4S2IA 4E3KA 1ALQA 2OSUA 3ZG9B 4KZ5A 4S2NA 5EVIC 5HAQA 1HVBA 2WKEA 3VP1A 3QNCA 5GLCA 3NC8A 1IELA 3SS4A 2DCFA 4WM9A 5F83A 5FQ9A 3PBTA 3DWKA 2R9WA 2XF3A 2JE5A 4JKTA 4WZ5A 3BEBA 4DF6A 5D3OA 5A91A 4BD0A 3MFDA 2V1ZA 1IYSA 1O07A 2ZM0A 3O87A 3PBNA 5EUAA 3NIAA 3C7VA 5CHJA 1TVFA 2P9VB 1TEMA 3N7WA 4HESA 4KG5A 4OPQA 4DRTA 2Y2GA 1NXYA 1Q2QA 4FSFA 1ERMA 3ZVTA 3Q07A 4KQOA 4EBLA 4EQIA 1PYYA 1K54C 3HLCA 5FQMA 4LENA 3SH8A 1L0DA 4GZBA 1BLSA 1PWGA 4C75A 3ZDJA 2Y2QA 4HBTA 4N1XA 4DDYA 1VM1A 3Q82A 4WEJA 1XPBA 2ZMAA 4Z9QA 4BL2A 1ERQA 2G2UA 3P98A 5GHZA 2J8YA 1PWCA 1ESIA 3GTCA 5L2FA 1U60A 4E6XA 1PWDA 5G18A 3SH7A 3Q7VA 1MWSA 1M6KA 3IF6B 1S0WA 4S2NC 1ES5A 1KE3A 3OPLA 2ZC4B 1DJCA 4F94A 3RXWA 4RYEA 5KSCA 3VSKA 4OKPA 4R4RA 2OLUA 1Z6FA 4IVKA 4E3IA 1AXBA 1VQQA 2HDUA 4WZ5C 4DE1A 5FQJA 3BFFA 2GDNA 2I72A 3V3SA 5M18A 1ESUA 3UPNA 1I2WA 3UDFA 1FCNA 4WEKA 4E3JA 3QHYA 2ZD8A 3A3DA 1CK3A 1XX2A 2HDQA 3G2ZA 1YLTA 1KGGA 3NCKA 3ZCZA 1FSWA 2ZM8A 4WZ4A 4Y0OA 4LV3A 5KZHA 5GLAA 3IF6A 2ZLYA 1JWVA 2ZM2A 5KSHA 1HD8A 4PM7A 3SS5A 4QU3A 5E2GA 3WS2A 4RX3A 1SCWA 3UDIA 3G34A 2P74A 3BFCA 3HUOA 3OCLA 4UA7A 4U3TA 4Q8IA 1BTLA 3BRMA 4OOLA 4S2LA 2ZC7A 4FH4A 4U0TA 5HX9A 5IHVA 4ZJ2A 4GDBA 4C6YA 3HLEA 3ZNTA 1NY0A 5I94A 1ES3A 2Z2MB 3B3XA 3GQZA 1FCMA 5GLDA 4E3OA 3RJUA 1OMEA 3IWIA 1W8YA 2RL3A 3W4OA 1IKIA 3GVBA 3V3RA 4FH2A 4E3MA 4B4ZA 3O3VA 5CEDA 3Q1FA 1K25A 1RCJA 2XR0A 1BUEA 1EI5A 3HLBA 2WADA 4Y7PA 5EVIA 4ZDXA 2XD1A 1I2SA 4K0WA 2WAFA 3C4OA 3ZG8B 1PZPA 5JYPA 3VOYA 4QB8A 2X01A 4NETA 1K38A 1W8QA 1YLYA 3Q7ZA 4EBNA 4M3KA 5FI2A 1G68A 3I7JA 3BFGA 3G30A 3VSLA 3PAGA 2HDSA 3IF6C 3IT9A 4A5RA 4Y0UA 4JXWA 4KZBA 4OPZA 1L0GA 3E2KA 2H0YA 3GSGA 4R4SA 2WGWA 4KZAA 5EVID 1CEGA 2Z2LB 5FQIA 4QY5A 1H5XA 4QHCA 3HLWA 2OV5A 2B5RA 1K54A 4GD6A 5GHXA 3VMAA 1GA9A 2H5SA 5FATA 1QMFA 3WS5A 1YMSA 4QD4A 4R0QA 1JTGA 4DE0A 1GHPA 3GRJA 2WGVA 2J9OA 3OPPA 1WYCA 3O86A 1KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTM A;  1W79 A;  3N8R A;  2WUQ A;  3MZE A;  4KZ8 A;  3ZG5 A;  4XUX A;  4PM5 A;  1PW1 A;  2X71 A;  1SDE A;  4BEN A;  1FR6 A;  1Y54 A;  1ONG A;  4WBG A;  3VP3 A;  5HAR A;  3NI9 A;  4S2M A;  1H8Z A;  5FSR A;  4B4X A;  3EQV A;  4BJP A;  2WAE A;  1W5D A;  1ZKJ A;  3HL9 A;  4OQ0 A;  1YLW A;  4R3J A;  3CZD A;  4X6T A;  1XGJ A;  1MY8 A;  4JPM A;  4JXV A;  2ZC6 B;  2ZQA A;  3ZHH A;  1GA0 A;  3JYI A;  5E2H A;  3A3J A;  5EE8 A;  1BLP A;  1BUL A;  3EQU A;  4OH0 A;  3N4I A;  1GHM A;  2E8I A;  2WKH A;  2UWX A;  4LCM A;  4ZAM A;  2PU2 A;  3UN7 A;  4OP5 A;  1L0F A;  1NZU A;  1PZO A;  3RXX A;  3VP0 A;  4CJN A;  1SDN A;  5TR7 A;  4PM8 A;  1ONH A;  1H8Y A;  1XGI A;  3HUN A;  4PPR A;  4KZ6 A;  1JTD A;  1YT4 A;  4BL3 A;  5BOH A;  4LV1 A;  2ZQ9 A;  3CJM A;  2R9X A;  3IH9 A;  3BLM A;  4KG2 A;  3MXR A;  3MXS A;  2IWC A;  4K91 A;  3N8L A;  3MBZ A;  4X68 A;  5FI7 A;  4DE2 A;  3PTE A;  2Y2I A;  2HP6 A;  1CI9 A;  3MZF A;  5FAO A;  4ZJ1 A;  1IYO A;  5HAP A;  3LEZ A;  4XUZ A;  2HDR A;  1L0E A;  2P9V A;  3VFH A;  3A3I A;  3CG5 A;  3G2Y A;  3TSG A;  3IWQ A;  1DJA A;  1BT5 A;  3NDG A;  3P09 A;  4OPR A;  3UDX A;  1MWR A;  1YLP A;  1SKF A;  2WZX A;  2VGK A;  2WK0 A;  3ZGA B;  1IYQ A;  1ES2 A;  4IBR A;  5CEB A;  1WYB A;  1HZO A;  5FDH A;  2Q9M A;  3UY6 A;  1PI4 A;  1DY6 A;  2QZ6 A;  3BFD A;  3G4P A;  4X69 A;  3UPO A;  3PBR A;  2C5W B;  4OLD A;  4GN2 A;  3LY4 A;  1NZO A;  2HPB A;  1MKI A;  1JVJ A;  3PBQ A;  4P0M A;  5HL1 A;  3IXB A;  2XH9 A;  3IHB A;  2EX9 A;  5CHU A;  3ISG A;  4N1H A;  1BSG A;  3DW0 A;  4JF4 A;  1K55 A;  3AGD A;  4GOG A;  1JWP A;  1QME A;  4KZ3 A;  4PM9 A;  5DTS A;  4KZ7 A;  4O7D A;  2Y4A A;  4P6B A;  3ZFZ A;  5DTK A;  1MPL A;  1RGY A;  1XXM A;  1DJB A;  2JCH A;  3BEC A;  1NYY A;  3WS0 A;  3PAE A;  2X02 A;  3O88 A;  4WMC A;  5FQK A;  5DF8 A;  3HBR A;  3OPH A;  3OCN A;  1E3U A;  4MEZ A;  1ZG4 A;  5CER A;  3G35 A;  1MBL A;  2XGN A;  4X55 A;  5CRF A;  1G6A A;  1YMX A;  1LHY A;  3HUM A;  1KVL A;  2JBF A;  5M19 A;  2G2W A;  2ZQ8 A;  4MBF A;  1Q2P A;  3AGE A;  4OOM A;  2XEP A;  1KGF A;  4WYY A;  4DXC A;  5F1F A;  4KZ4 A;  5GL9 A;  1N4O A;  2A3U A;  3BLS A;  4H8R A;  1N9B A;  2Y2M A;  1MWU A;  1GHI A;  3SH9 A;  3ITA A;  2IWD A;  3TG9 A;  3DWZ A;  4EWF A;  3W8K A;  3NBL A;  3ZNY A;  5EOO A;  1K56 A;  4S2O A;  5U47 A;  4DE3 A;  3IXD A;  5A92 A;  4N9K A;  3A3E A;  5CGX A;  5CEC A;  1XKZ A;  1K55 C;  5CTN A;  1J9M A;  3MZD A;  2ZQD A;  5A93 A;  2EFU A;  3M6B A;  1GCE A;  2ZC3 B;  4DDS A;  1KDW A;  5CGS A;  4D2O A;  4JLF A;  2H10 A;  2WKI A;  2IWB A;  1MWT A;  3BM6 A;  5E2E A;  5DF9 A;  3N8S A;  2J9P A;  2RCX A;  3MKF A;  5CGW A;  1ZC2 A;  3A3F A;  1IKG A;  3E2L A;  2EXB A;  3N6I A;  4R23 A;  3S1Y A;  3GMW A;  4S2J A;  5HW3 A;  3WWX A;  3IXG A;  1K56 D;  3ITB A;  1HTZ A;  2XFT A;  1LI9 A;  2XQZ A;  2Y59 A;  2EX2 A;  1IYP A;  4RA7 A;  1PIO A;  2Y2L A;  2J7V A;  4MBH A;  4KQQ A;  1K6S A;  4OQI A;  5AQ7 A;  5KMW A;  4OQG A;  3V5M A;  1RGZ A;  4OVD A;  3W4Q A;  3VFF A;  4UA9 A;  5DF7 A;  1KGE A;  4GNU A;  3VP4 A;  4C3Q A;  4S2P A;  4HBU A;  4PMA A;  2XFS A;  1JWZ A;  5AQ9 A;  5DVA A;  2CC1 A;  5FAQ A;  2HP9 A;  3WRT A;  5AQB A;  4CPK A;  4FCF A;  5JYO A;  4N92 A;  4KG6 A;  3HLD A;  4WEL A;  5CXW A;  1FQG A;  3FWL A;  1ERO A;  1LLB A;  1KE0 A;  1K4E A;  3C5A A;  3BFE A;  2DRW A;  4E3L A;  3HLF A;  4YFM A;  3HLG A;  2OLV A;  4OLG A;  2XDM A;  4RX2 A;  4UAA A;  4GB7 A;  2XK1 A;  4MNR A;  4MLL A;  3G31 A;  1BLC A;  1KE4 A;  3FKW A;  3Q7V B;  3VP2 A;  3ZG7 B;  3IH8 A;  2HP5 A;  5EOE A;  2V20 A;  2FFY A;  3UNW A;  2DNS A;  4IED A;  4QJG A;  4E6W A;  3UPP A;  4LV2 A;  1C3B A;  5FA7 A;  2H0T A;  3C7U A;  2EXA A;  1KVM A;  3OC2 A;  1XA7 A;  4GKU A;  3VOZ A;  4DXB A;  1K57 A;  4K0X A;  5DTT A;  1EWZ A;  3V50 A;  3BYD A;  2BG1 A;  1WE4 A;  2Q9N A;  3LCE A;  5E2F A;  3ZG0 A;  4KQR A;  3S22 A;  1PW8 A;  3SS3 A;  4OQH A;  4S2K A;  5AQA A;  5TFQ A;  1XA1 A;  3CMZ A;  3IF5 A;  4BD1 A;  1CEF A;  1FOF A;  2XD5 A;  2Y2P A;  5TGF A;  5CTM A;  2BLS A;  2WGI A;  3GV9 A;  4EV4 A;  3IQA A;  1W7F A;  4FD8 A;  3TOI A;  4B88 A;  3HVF A;  3LY3 A;  4JXS A;  1I5Q A;  3UO9 A;  3HRE A;  4BLM A;  1E4D A;  5EPH A;  3M2J A;  3ZVW A;  1O7E A;  1IEM A;  1LI0 A;  5F82 A;  4OON A;  5EEC A;  3WS4 A;  4EUZ A;  3WS1 A;  4GDN A;  5CHM A;  4KZ9 A;  3W4P A;  1YLZ A;  2EX6 A;  2PBY A;  3M6H A;  4E3N A;  2JC7 A;  4U0X A;  4R1G A;  1SHV A;  3OZH A;  4KEN B;  3SOI A;  4QY6 A;  4IVI A;  1NRF A;  1CI8 A;  4DKI A;  1BLH A;  3NDE A;  3UE1 A;  1K57 C;  5EVI B;  3PBO A;  2ZJ9 A;  2WZZ A;  4HEF A;  1K6R A;  1PI5 A;  2Y2O A;  5E43 A;  3S4X A;  1NJ4 A;  3FZC A;  5GHY A;  2EX8 A;  4IBX A;  4LCL A;  4UA6 A;  2Y2K A;  4L0L A;  4JF5 A;  4LV0 A;  1TDL A;  4YIN A;  1BZA A;  1YQS A;  2Y2H A;  2Y2N A;  2ZC5 B;  2ZQ7 A;  4ZTK A;  4EBP A;  1LL5 A;  4WMC D;  1YM1 A;  2EFX A;  4XXR A;  3D4F A;  3Q81 A;  2V2F F;  2WGW B;  3LO7 A;  1E3U D;  4R3B A;  5FQQ A;  4ZJ3 A;  2C6W B;  4UHU A;  3AGF A;  4N9L A;  5F1G A;  3V39 A;  4OOY A;  5EVL A;  5A90 A;  2Y2J A;  3FV7 A;  2PU4 A;  3FKV A;  3MKE A;  2A49 A;  5HFO A;  4OPY A;  4P85 A;  3IXH A;  4X53 A;  3G32 A;  4GD8 A;  1LL9 A;  4OP8 A;  4P87 A;  1TDG A;  3IHA A;  5M1A A;  1FSY A;  4Y0T A;  5FI6 A;  4X56 A;  1S6R A;  1YLJ A;  5J8X A;  1FR1 A;  1ZG6 A;  3C4P A;  1M40 A;  3M2K A;  4NK3 A;  1E25 A;  5GLB A;  2VGJ A;  1NYM A;  5FAS A;  1MXO A;  1K4F A;  2QPN A;  3OPR A;  4ID4 A;  4RVA A;  4ZBE A;  2Y91 A;  4JBF A;  3UE3 A;  3FYZ A;  5FAP A;  1ES4 A;  3IWO A;  2QMI A;  2Y55 A;  3NY4 A;  5HAI A;  1L2S A;  1FCO A;  1RP5 A;  2ZQC A;  3UE0 A;  1XP4 A;  2WYX A;  4JF6 A;  4JXG A;  3WRZ A;  3QNB A;  2XLN A;  3GR2 A;  2FFF B;  4PM6 A;  4BQM A;  4MBK A;  3PBS A;  4S2I A;  4E3K A;  1ALQ A;  2OSU A;  3ZG9 B;  4KZ5 A;  4S2N A;  5EVI C;  5HAQ A;  1HVB A;  2WKE A;  3VP1 A;  3QNC A;  5GLC A;  3NC8 A;  1IEL A;  3SS4 A;  2DCF A;  4WM9 A;  5F83 A;  5FQ9 A;  3PBT A;  3DWK A;  2R9W A;  2XF3 A;  2JE5 A;  4JKT A;  4WZ5 A;  3BEB A;  4DF6 A;  5D3O A;  5A91 A;  4BD0 A;  3MFD A;  2V1Z A;  1IYS A;  1O07 A;  2ZM0 A;  3O87 A;  3PBN A;  5EUA A;  3NIA A;  3C7V A;  5CHJ A;  1TVF A;  2P9V B;  1TEM A;  3N7W A;  4HES A;  4KG5 A;  4OPQ A;  4DRT A;  2Y2G A;  1NXY A;  1Q2Q A;  4FSF A;  1ERM A;  3ZVT A;  3Q07 A;  4KQO A;  4EBL A;  4EQI A;  1PYY A;  1K54 C;  3HLC A;  5FQM A;  4LEN A;  3SH8 A;  1L0D A;  4GZB A;  1BLS A;  1PWG A;  4C75 A;  3ZDJ A;  2Y2Q A;  4HBT A;  4N1X A;  4DDY A;  1VM1 A;  3Q82 A;  4WEJ A;  1XPB A;  2ZMA A;  4Z9Q A;  4BL2 A;  1ERQ A;  2G2U A;  3P98 A;  5GHZ A;  2J8Y A;  1PWC A;  1ESI A;  3GTC A;  5L2F A;  1U60 A;  4E6X A;  1PWD A;  5G18 A;  3SH7 A;  3Q7V A;  1MWS A;  1M6K A;  3IF6 B;  1S0W A;  4S2N C;  1ES5 A;  1KE3 A;  3OPL A;  2ZC4 B;  1DJC A;  4F94 A;  3RXW A;  4RYE A;  5KSC A;  3VSK A;  4OKP A;  4R4R A;  2OLU A;  1Z6F A;  4IVK A;  4E3I A;  1AXB A;  1VQQ A;  2HDU A;  4WZ5 C;  4DE1 A;  5FQJ A;  3BFF A;  2GDN A;  2I72 A;  3V3S A;  5M18 A;  1ESU A;  3UPN A;  1I2W A;  3UDF A;  1FCN A;  4WEK A;  4E3J A;  3QHY A;  2ZD8 A;  3A3D A;  1CK3 A;  1XX2 A;  2HDQ A;  3G2Z A;  1YLT A;  1KGG A;  3NCK A;  3ZCZ A;  1FSW A;  2ZM8 A;  4WZ4 A;  4Y0O A;  4LV3 A;  5KZH A;  5GLA A;  3IF6 A;  2ZLY A;  1JWV A;  2ZM2 A;  5KSH A;  1HD8 A;  4PM7 A;  3SS5 A;  4QU3 A;  5E2G A;  3WS2 A;  4RX3 A;  1SCW A;  3UDI A;  3G34 A;  2P74 A;  3BFC A;  3HUO A;  3OCL A;  4UA7 A;  4U3T A;  4Q8I A;  1BTL A;  3BRM A;  4OOL A;  4S2L A;  2ZC7 A;  4FH4 A;  4U0T A;  5HX9 A;  5IHV A;  4ZJ2 A;  4GDB A;  4C6Y A;  3HLE A;  3ZNT A;  1NY0 A;  5I94 A;  1ES3 A;  2Z2M B;  3B3X A;  3GQZ A;  1FCM A;  5GLD A;  4E3O A;  3RJU A;  1OME A;  3IWI A;  1W8Y A;  2RL3 A;  3W4O A;  1IKI A;  3GVB A;  3V3R A;  4FH2 A;  4E3M A;  4B4Z A;  3O3V A;  5CED A;  3Q1F A;  1K25 A;  1RCJ A;  2XR0 A;  1BUE A;  1EI5 A;  3HLB A;  2WAD A;  4Y7P A;  5EVI A;  4ZDX A;  2XD1 A;  1I2S A;  4K0W A;  2WAF A;  3C4O A;  3ZG8 B;  1PZP A;  5JYP A;  3VOY A;  4QB8 A;  2X01 A;  4NET A;  1K38 A;  1W8Q A;  1YLY A;  3Q7Z A;  4EBN A;  4M3K A;  5FI2 A;  1G68 A;  3I7J A;  3BFG A;  3G30 A;  3VSL A;  3PAG A;  2HDS A;  3IF6 C;  3IT9 A;  4A5R A;  4Y0U A;  4JXW A;  4KZB A;  4OPZ A;  1L0G A;  3E2K A;  2H0Y A;  3GSG A;  4R4S A;  2WGW A;  4KZA A;  5EVI D;  1CEG A;  2Z2L B;  5FQI A;  4QY5 A;  1H5X A;  4QHC A;  3HLW A;  2OV5 A;  2B5R A;  1K54 A;  4GD6 A;  5GHX A;  3VMA A;  1GA9 A;  2H5S A;  5FAT A;  1QMF A;  3WS5 A;  1YMS A;  4QD4 A;  4R0Q A;  1JTG A;  4DE0 A;  1GHP A;  3GRJ A;  2WGV A;  2J9O A;  3OPP A;  1WYC A;  3O86 A;  1KDS A; 
#chains in the Genus database with same CATH topology
 2WUQ A;  2XSS A;  3LYX A;  2X71 A;  3LIF A;  1SDE A;  3K2N A;  4BEN A;  2O0Y A;  4WBG A;  3F1P A;  4B4X A;  1L3L A;  2WAE A;  4R3J A;  1XGJ A;  1MY8 A;  4EXO A;  2ZC6 B;  1GA0 A;  3A0V A;  1AWI A;  3A3J A;  3QP2 A;  5HSQ A;  3MR0 A;  3UN7 A;  1NZU A;  1PZO A;  1H8Y A;  3D72 A;  3S7N A;  2EWV A;  3HUN A;  1JTD A;  3K3D A;  3CJM A;  2W3D A;  3IH9 A;  4R6L A;  1VET A;  2VV8 A;  2HP6 A;  1NWZ A;  3DBA A;  2V9A A;  1DJA A;  1OTI A;  2PBD P;  1YLP A;  2WK0 A;  1IYQ A;  2JKG A;  5FDH A;  4O8G A;  4LRZ E;  3PBR A;  3CPT A;  3LY4 A;  4F3L B;  2HJE A;  1MKI A;  1JVJ A;  3IHB A;  2EX9 A;  1JWP A;  1S67 L;  4UQI M;  4P6B A;  1F5M A;  2QHK A;  1TS7 A;  3PAE A;  5DKK A;  5FQK A;  1XFN A;  3HBR A;  1ZG4 A;  3EEA A;  2VGL S;  4X55 A;  3HUM A;  3QP4 A;  2G2W A;  5F6A A;  3AGE A;  4WYY A;  2V8C A;  1Y4O A;  4KZ4 A;  3BLS A;  1N9B A;  1GHI A;  3P01 A;  1LL8 A;  3DWZ A;  3NBL A;  3ZNY A;  2Z6C A;  5EOO A;  3QP8 A;  4KUK A;  4DE3 A;  3D3O A;  2WKP A;  5CGX A;  1XKZ A;  5CTN A;  1J9M A;  1MKM A;  3M6B A;  4DN0 A;  1GCE A;  4DDS A;  2H10 A;  2WKI A;  2IWB A;  1DP8 A;  5MC7 A;  3N8S A;  3DAV A;  3UB8 A;  2J9P A;  1ZC2 A;  3A3F A;  3E2L A;  4R23 A;  2EXB A;  4Y3I A;  3S1Y A;  3WWX A;  1K56 D;  2EWW A;  4EW7 A;  1HTZ A;  4NG2 A;  1IYP A;  2J7V A;  2W0N A;  2V1A A;  4KQQ A;  5AQ7 A;  4Y17 A;  4KUO A;  4UA9 A;  5DF7 A;  3VP4 A;  4S2P A;  3UPO A;  2ZOH A;  2PD8 A;  1JWZ A;  3H7W B;  5FAQ A;  4CPK A;  2HP9 A;  4LPZ A;  3BFE A;  5IU1 A;  1XJ2 A;  2JKT M;  4RX2 A;  2XK1 A;  3FKW A;  2V8F A;  3UNW A;  2DNS A;  3UPP A;  4LV2 A;  3C7U A;  4I38 A;  3GEC A;  3BY9 A;  3BYD A;  1WE4 A;  3S22 A;  1PW8 A;  1IFQ A;  1XA1 A;  3IF5 A;  2W3E A;  2XD5 A;  2Y2P A;  5HZH A;  3IQA A;  4MN7 A;  3S7O A;  4BLM A;  1VEU A;  1P0Z A;  4EUZ A;  3CUE A;  2EX6 A;  2PBY A;  4D60 A;  2JC7 A;  4M4X A;  3OZH A;  3SOI A;  2PYP A;  1ACF A;  1BLH A;  1K57 C;  3CLO A;  3H9W A;  2WZZ A;  2W27 A;  3BJN A;  3S4X A;  3MSH A;  1ODV A;  4JF5 A;  3TJZ C;  1BZA A;  2Y2H A;  4P6Z M;  4XXR A;  2A2L A;  3LO7 A;  1E3U D;  4UHU A;  3AGF A;  3HCY A;  4N9L A;  2J3T C;  3EGD C;  5F1G A;  3NOT C;  2A49 A;  4ARZ A;  4OPY A;  4P85 A;  3IXH A;  4RQ9 A;  4P87 A;  4OP8 A;  1LL9 A;  5HPI A;  4ZRR A;  5M1A A;  1FSY A;  5FI6 A;  1YLJ A;  3K3C A;  5IT5 A;  3R7W A;  1CQA A;  1FR1 A;  4MN5 A;  2K31 A;  4NK3 A;  2XA7 S;  2VGJ A;  1TS0 A;  4R3A A;  1K4F A;  2QPN A;  3IX3 A;  1LSV A;  1XJ4 A;  3NY4 A;  5HAI A;  2ZQC A;  3UE0 A;  1XP4 A;  2WYX A;  4JF6 A;  1H3Q A;  4MBK A;  4X1M A;  4R70 A;  4EEP A;  1OT9 A;  3UE6 A;  2OSU A;  2M7U A;  5EVI C;  1HVB A;  2WKE A;  3VP1 A;  3QNC A;  2DCF A;  3DWK A;  1VET B;  4JKT A;  3BEB A;  2D02 A;  5D3O A;  3NOP C;  2HJ9 C;  2V1Z A;  1IYS A;  3O87 A;  5EUA A;  1TEM A;  4OPQ A;  4KG5 A;  1VB6 A;  1PNE A;  3EWK A;  1Q2Q A;  5TJJ A;  4FSF A;  1D06 A;  4EBL A;  1K54 C;  2W3H A;  3KSI A;  4GZB A;  1PWG A;  4C75 A;  3ZDJ A;  4YOF A;  1ESI A;  4FTX A;  1U60 A;  3E0Y A;  4X1L A;  5G18 A;  4ESP A;  1KE3 A;  1IOU A;  4F94 A;  4DJ3 A;  2VEA A;  3RXW A;  4RYE A;  4IVK A;  3OBF A;  1N9L A;  2GDN A;  3V3S A;  2GX5 A;  1I2W A;  4DJ2 A;  4PHT A;  3G2Z A;  3ZCZ A;  2ZM8 A;  4HNB A;  3E4O A;  3IF6 A;  1HD8 A;  3WS2 A;  2K7S A;  2P74 A;  3HUO A;  3OCL A;  4CLC E;  4U0T A;  4K08 A;  4GDB A;  3ZNT A;  2GZA A;  2Z2M B;  3B3X A;  2QYB A;  5GLD A;  1OME A;  1W8Y A;  2VGL M;  3GVB A;  4E3M A;  3Q1F A;  2R78 A;  2XR0 A;  1CF0 A;  3HLB A;  2WAD A;  5EVI A;  4ZDX A;  1S4R A;  3ZG8 B;  4GHI B;  3F1O B;  2X01 A;  4EBN A;  4JGQ A;  4M3K A;  5FI2 A;  3I7J A;  3BFG A;  3IT9 A;  4KZB A;  3E2K A;  2WGW A;  3T4S A;  4QHC A;  4EER A;  3HLW A;  2OV5 A;  2B5R A;  1K54 A;  4GD6 A;  1GA9 A;  3CWF A;  2H5S A;  5FAT A;  4R0Q A;  2PAV P;  3MXQ A;  4IHQ A;  3EOI A;  3OPP A;  3O86 A;  3DTM A;  2XRO A;  2W1T B;  3ZG5 A;  4PM5 A;  4CLC D;  1ONG A;  4S2M A;  2PR6 A;  5DFX A;  2E8J A;  4LFU A;  4X6T A;  4JPM A;  2P7J A;  5E2H A;  2ACG A;  3EQU A;  3PXP A;  2E8I A;  3QP6 A;  4LCM A;  4ZAM A;  3RXX A;  4CJN A;  4PM8 A;  1ONH A;  3BQ8 A;  3T4Q A;  4PPR A;  2VA0 A;  3BLM A;  3MXS A;  3N8L A;  3MBZ A;  4DE2 A;  1VEU B;  3PTE A;  2Y2I A;  4GLQ A;  2VKS A;  5FAO A;  2HDR A;  2P9V A;  3A3I A;  3IX8 A;  3G2Y A;  3TSG A;  2GJ3 A;  3NDG A;  3SZT A;  1SKF A;  2VGK A;  3ZGA B;  1ES2 A;  5CEB A;  1WYB A;  2Q9M A;  2WKR A;  2QZ6 A;  3H82 A;  4P0M A;  5HL1 A;  3IXB A;  2EA9 A;  3AGD A;  4PM9 A;  5DTS A;  2Y4A A;  3BWL A;  3ZFZ A;  5DTK A;  2HGV A;  2O9C A;  2QKP A;  3BEC A;  1NYY A;  3DTE A;  4ARZ B;  5DJT A;  5DF8 A;  4PAU A;  1E3U A;  3JVU A;  1G6A A;  1YMX A;  2JBF A;  2JKR M;  4MBF A;  5F1F A;  1KGF A;  3BY8 A;  5GL9 A;  5K5B A;  2G7U A;  4II7 A;  4H8R A;  2IWD A;  3TG9 A;  1HLU P;  5U47 A;  1LT0 A;  4Y15 A;  5A92 A;  4ETX A;  1STZ A;  3BM6 A;  5DF9 A;  2RCX A;  1PFL A;  4H6J B;  5HW3 A;  4S2J A;  3A0S A;  2XA7 M;  3CI6 A;  2XQZ A;  4RA7 A;  3KO6 A;  2ZMV A;  3KSF A;  3FPV A;  4LRX C;  5F5Y A;  3V5M A;  2L1M A;  3W4Q A;  1KGE A;  4GNU A;  1S66 L;  4Q0I A;  4PMA A;  5FL3 A;  4BMW A;  5HWV A;  1ZHH B;  4N92 A;  5CXW A;  1BYW A;  3IS2 B;  1F98 A;  1TS6 A;  1ERO A;  3FWL A;  1LLB A;  3G6O A;  1KE0 A;  3C5A A;  4E3L A;  2VLG A;  4GCZ A;  4OLG A;  4MNR A;  1KE4 A;  3VP2 A;  2O9B A;  3B47 A;  2M1C A;  1FIK A;  3CHW P;  3R4K A;  2QWS A;  3NOU C;  4B93 A;  3QP1 A;  4JGO A;  3VOZ A;  4GKU A;  5DTT A;  4ETZ A;  1EWZ A;  3V50 A;  2BG1 A;  5E2F A;  2PR5 A;  4OQH A;  4S2K A;  5TFQ A;  4BD1 A;  4I3A A;  1FOF A;  1NLZ A;  1Y28 A;  2ZMF A;  4JGR A;  3UO9 A;  3M2J A;  1O7E A;  1LI0 A;  4OON A;  5EEC A;  4IUH A;  3WS4 A;  4GDN A;  4KZ9 A;  4E3N A;  1GSV A;  4R1G A;  4KEN B;  4QY6 A;  4IVI A;  1CI8 A;  4DKI A;  1D7E A;  5EVI B;  2JKF A;  1PI5 A;  2Y2O A;  3FZC A;  2EX8 A;  4LCL A;  3NJA A;  2Y2K A;  4NXE A;  5J7E A;  5HDS A;  2Y2N A;  4EBP A;  1YM1 A;  3D4F A;  5L07 A;  2WGW B;  3LIA A;  2C6W B;  2LB5 A;  5A90 A;  2PU4 A;  3G32 A;  3CUE C;  5L10 A;  3LR4 A;  1M40 A;  4Q0H A;  3M2K A;  3MFX A;  2OWJ A;  1E25 A;  4LRY C;  1SKO A;  1NYM A;  4HHD A;  1YPR A;  1MC0 A;  3UE3 A;  2ZBB A;  4CLC A;  1ES4 A;  1L2S A;  1FCO A;  1J3W A;  1RP5 A;  3WRZ A;  4LGW A;  2XLN A;  3GR2 A;  5AVF A;  2DMW A;  5GLC A;  1IEL A;  3SS4 A;  4HQA A;  1K0K A;  3PBT A;  5FQ9 A;  2R9W A;  2XF3 A;  4WZ5 A;  4DF6 A;  5A91 A;  3MFD A;  3PBN A;  5CHJ A;  5C5K A;  1TVF A;  2P9V B;  3TW8 A;  3RFB A;  3HLC A;  5FQM A;  3VE4 A;  3SH8 A;  4BBU A;  4DRT A;  4DDY A;  1VM1 A;  2VX8 A;  4BL2 A;  1XPB A;  1ERQ A;  1XJ3 A;  2J8Y A;  1PWC A;  3GTC A;  5L2F A;  4E6X A;  2MJ6 A;  3SH7 A;  1MWS A;  1M6K A;  3LID A;  1S0W A;  1ES5 A;  3OPL A;  5EVE A;  1DJC A;  3PR6 A;  5KSC A;  3VSK A;  4Y5F A;  2OLU A;  5FQJ A;  3BFF A;  2I72 A;  3RH8 B;  3UDF A;  4E3J A;  4WEK A;  3QHY A;  2ZD8 A;  1OTB A;  1TD5 A;  2IA2 A;  3NCK A;  1FSW A;  4WZ4 A;  5GLA A;  2ZLY A;  3LIB A;  5E2G A;  4HH3 A;  4UA7 A;  4U3T A;  1BTL A;  4S2L A;  3HLE A;  1N9N A;  1W63 Q;  3GQZ A;  1OTD A;  3F1N A;  5AJG A;  3W4O A;  1XFQ A;  3V3R A;  4FH2 A;  3O3V A;  5CED A;  1RCJ A;  4BBV A;  1T1B A;  4YNR A;  1T1C A;  1PZP A;  5JYP A;  3VOY A;  4QB8 A;  3Q7Z A;  1CJF A;  1YLY A;  3O5Y A;  4YWZ A;  2YKF A;  3VSL A;  2VZW A;  3IF6 C;  4A5R A;  4Y0U A;  4OPZ A;  1L0G A;  3LR5 A;  3F1P B;  2H0Y A;  1A0K A;  4KZA A;  5IS1 A;  1CEG A;  2Z2L B;  2Z6D A;  5FQI A;  2P04 A;  4QY5 A;  4AFI A;  4HP4 A;  2AVX A;  1P9W A;  1YMS A;  4QD4 A;  1JTG A;  3RTY A;  2FH5 A;  4DE0 A;  4JGP A;  2WGV A;  3LEQ A;  1KDS A;  2B18 A;  4KZ8 A;  3MZE A;  2V1B A;  5HAR A;  3NI9 A;  5FSR A;  5KIZ A;  5EV0 A;  3EQV A;  4BJP A;  4IJG A;  1W5D A;  3C8C A;  1ZKJ A;  2VJW A;  3HL9 A;  3CZD A;  3JYI A;  4WF0 A;  3NHQ A;  3P7N A;  4HJ6 A;  1BUL A;  3N4I A;  2WKH A;  2KOI A;  4OP5 A;  1L0F A;  3VP0 A;  3PHY A;  5HL6 A;  5TR7 A;  2J3W A;  1OTA A;  1OPX A;  4X25 A;  3CPT B;  1YT4 A;  4BL3 A;  2ZQ9 A;  2R9X A;  4KG2 A;  3NEC A;  3MXR A;  4K91 A;  5HDD A;  3MZF A;  1CI9 A;  5HAP A;  1TF1 A;  3LEZ A;  4XUZ A;  5TBM A;  3VFH A;  3CG5 A;  3LR3 A;  5EM1 A;  3IWQ A;  3T50 A;  2WZX A;  4I5S A;  4IBR A;  2B95 A;  1DY6 A;  3C38 A;  2C5W B;  4GN2 A;  1NZO A;  3KYQ A;  2HPB A;  3PBQ A;  2P08 A;  4HOI A;  4HI4 A;  3T4O A;  2XH9 A;  3UB7 A;  3ISG A;  1BSG A;  3DW0 A;  4JF4 A;  1K55 A;  2J80 A;  4O7D A;  4UQI S;  4HJ3 A;  1MPL A;  1XXM A;  1H8M A;  1DJB A;  3C2W A;  5DFY A;  3OPH A;  5CER A;  3G35 A;  2XGN A;  5CRF A;  5M19 A;  3LI9 A;  4DXC A;  2XEP A;  2OWH A;  1N4O A;  1YKD A;  2A3U A;  2KX6 A;  3T1R A;  2Y2M A;  3ITA A;  4WLA A;  4MN6 A;  4NXG A;  1K56 A;  4CLC B;  4NKP A;  3MZD A;  2UV0 E;  2ZQD A;  2BTF P;  2PD7 A;  5J3W A;  1KDW A;  3IX4 A;  5CGS A;  2QJ5 A;  5E2E A;  3GDI A;  3N6I A;  1X0O A;  3GMW A;  3IXG A;  4GJ4 A;  5L09 A;  1LI9 A;  2XFT A;  2Y59 A;  4MBH A;  1K6S A;  5KMW A;  1RGZ A;  3D9Y A;  4OVD A;  2K2N A;  4HBU A;  2XFS A;  2V0W A;  4KG6 A;  3HLD A;  4WEL A;  1FQG A;  1K4E A;  4NXF A;  2DRW A;  3HLF A;  2XDM A;  4MLL A;  1BLC A;  4BWI A;  3IH8 A;  2HP5 A;  5EOE A;  2FFY A;  3FG8 A;  5F68 A;  4QJG A;  1H0M A;  1LSX A;  5FA7 A;  4EU0 A;  2EXA A;  1KVM A;  3OC2 A;  1XA7 A;  4DXB A;  4K0X A;  3LCE A;  2Q9N A;  3ZG0 A;  3LFV A;  3CMZ A;  3OLO A;  1JNU A;  1CEF A;  3MJQ A;  3UMD A;  5TGF A;  3MS6 A;  5CTM A;  2BLS A;  5FEF A;  1TS8 A;  4Q0J A;  4QPR A;  1W7F A;  3T4T A;  4FD8 A;  3HVF A;  5HD3 A;  4BBT A;  1I5Q A;  1YAX A;  3VV4 A;  3ZVW A;  3T1Q B;  5F82 A;  2PHY A;  3IBJ A;  2W1R A;  3WS1 A;  4HJ4 A;  1YLZ A;  3F1N B;  4QWO A;  4U0X A;  1SHV A;  1NRF A;  3NDE A;  2WKQ A;  4L9F A;  3E98 A;  4EET B;  4HEF A;  3KSG A;  2VV7 A;  5E43 A;  1NJ4 A;  5GHY A;  4LLO B;  3R7W B;  4L0L A;  4LV0 A;  1TDL A;  1LL5 A;  4WMC D;  5DKL A;  2V2F F;  4R3B A;  4ZJ3 A;  3MMH A;  3L7H A;  3V39 A;  5EVL A;  3FKV A;  5HFO A;  4X53 A;  2HF6 A;  3IHA A;  4Y0T A;  4X56 A;  4MMN A;  1S6R A;  4G3W A;  1ZG6 A;  3C4P A;  4EES A;  5GLB A;  2PDR A;  1MXO A;  4DMZ A;  3UB6 A;  4ZBE A;  3OPR A;  4RVA A;  2Y91 A;  4JBF A;  3JVV A;  2KDK A;  3IWO A;  4MCW A;  2FFF B;  4BQM A;  3BW6 A;  3JPU A;  3E4P A;  3PBS A;  4E3K A;  2M7V A;  1ALQ A;  4PKY A;  4KZ5 A;  4S2N A;  3B33 A;  4ME4 A;  5F83 A;  4WM9 A;  3EGX C;  3UB9 A;  4EUV A;  4HP9 A;  2JE5 A;  3T1X A;  3UME A;  4BD0 A;  4G3K A;  3T4K A;  3NIA A;  3KSH A;  4HES A;  5TBM B;  2Y2G A;  4WL9 A;  1ERM A;  3ZQ5 A;  3ZVT A;  4CLC C;  4LEN A;  1BLS A;  3MQO A;  4EQ1 A;  4HBT A;  1N9O A;  3Q82 A;  3P98 A;  1F9I A;  1GSW A;  3UB5 P;  3Q7V A;  4EEU A;  3IF6 B;  3EEH A;  4E3I A;  1Z6F A;  1AXB A;  1VQQ A;  4WZ5 C;  5M18 A;  1ESU A;  1UWN X;  1FCN A;  3ULF A;  1CK3 A;  2O99 A;  1XX2 A;  2OAQ 1;  3L9K A;  1KGG A;  4Y0O A;  2J3T D;  2L0W A;  4LV3 A;  2ZM2 A;  5KSH A;  4PM7 A;  3SS5 A;  3T4L A;  5DJU A;  1SCW A;  3UDI A;  3G34 A;  3BFC A;  1W63 M;  4Q8I A;  5FEG A;  4OOL A;  2ZC7 A;  4C6Y A;  1XJ6 A;  4E3O A;  3RJU A;  3IWI A;  4I39 A;  3V67 A;  4FOF A;  4XT2 A;  4B4Z A;  1BUE A;  4Y7P A;  1NRJ A;  1V9Z A;  2XD1 A;  4K0W A;  4GS9 A;  1Z09 A;  2QJ7 A;  3LUQ A;  1YSP A;  4NET A;  4MDZ A;  1K38 A;  5AVE A;  1NLY A;  3G30 A;  2H28 A;  3PAG A;  3ZYT A;  5F69 A;  3QP5 A;  4JXW A;  3GSG A;  3MF0 A;  2ZL1 A;  5EVI D;  5GHX A;  2W3G A;  4Y2F A;  4G3V A;  3VOL A;  2J9O A;  4GHI A;  3F1O A;  1W79 A;  3N8R A;  2B02 A;  4XUX A;  1PW1 A;  4HY8 A;  1FR6 A;  1Y54 A;  5I5L A;  4UEY A;  3VP3 A;  1H8Z A;  2INW A;  4OQ0 A;  3S7Q A;  2JKR I;  2PT7 A;  1YLW A;  5HWT A;  2CMN A;  4JXV A;  1V9Y A;  2ZQA A;  3ZHH A;  2VK3 A;  4O01 A;  5EE8 A;  1BLP A;  5J4E A;  4OH0 A;  1VHM A;  2Y8H A;  1GHM A;  2UWX A;  2PU2 A;  2W1T A;  1SDN A;  3FPW A;  1XGI A;  3H82 B;  2ZOI A;  4KZ6 A;  5BOH A;  4LV1 A;  2IWC A;  4X68 A;  5FI7 A;  3KYE A;  4ZJ1 A;  1IYO A;  1L0E A;  1PRQ A;  3P09 A;  1BT5 A;  4OPR A;  3UDX A;  1MWR A;  3U4L P;  1P97 A;  1G5U A;  3FC7 A;  1HZO A;  3UY6 A;  1PI4 A;  3G4P A;  3BFD A;  4X69 A;  3MQ0 A;  4WUJ A;  4OLD A;  4E04 A;  4CQH A;  5CHU A;  4N1H A;  4GOG A;  1QME A;  4KZ3 A;  4KZ7 A;  3CIT A;  1RGY A;  3S7P A;  2JCH A;  3WS0 A;  2X02 A;  3BQA A;  3O88 A;  4WMC A;  3LR0 A;  3OCN A;  4MEZ A;  1MBL A;  4HH2 A;  3B42 A;  1WA9 A;  1LHY A;  1KVL A;  5CEC A;  2ZQ8 A;  1Q2P A;  4OOM A;  1DRM A;  4NXB A;  1MWU A;  3A0R A;  3SH9 A;  4FUW A;  4IUK A;  1YSQ A;  4EWF A;  3TRC A;  3W8K A;  4S2O A;  2I9V A;  3IXD A;  4N9K A;  3A3E A;  1K55 C;  5A93 A;  2EFU A;  2ZC3 B;  4D2O A;  1DP9 A;  4JLF A;  3DTI A;  1MWT A;  2O9A A;  3MQQ A;  3MKF A;  5CGW A;  1IKG A;  4HIA A;  2L4R A;  3ITB A;  2EX2 A;  1LSW A;  5L8M A;  1PIO A;  2Y2L A;  1G6O A;  4WN5 A;  4OQI A;  5LBR A;  4OQG A;  2NUT C;  2Q0O A;  1UWP X;  4GW9 A;  1S4S A;  3VFF A;  1S1Y A;  3VE3 A;  4C3Q A;  5EFW A;  1G28 A;  5AQ9 A;  5DVA A;  2CC1 A;  3WRT A;  2OAP 1;  5AQB A;  4FCF A;  5JYO A;  3LIE A;  4H6J A;  1FIL A;  4YFM A;  3HLG A;  2A24 A;  2OLV A;  3W2Z A;  2HV1 A;  4UAA A;  4GB7 A;  3G31 A;  3Q7V B;  3ZG7 B;  5HWW A;  2V20 A;  3LI8 A;  2KLI A;  1T1A A;  4IED A;  2PRF A;  4E6W A;  1C3B A;  3ICY A;  2H0T A;  5A8B A;  3IS2 A;  1K57 A;  4KQR A;  3SS3 A;  3T1S A;  5AQA A;  5FDS A;  2Y79 A;  2JHE A;  4O0P A;  2WGI A;  3GV9 A;  4EV4 A;  3TOI A;  4B88 A;  3LY3 A;  1SZV A;  4JXS A;  2BAS A;  3HRE A;  1E4D A;  5EPH A;  1IEM A;  5CHM A;  3W4P A;  2JKT I;  3M6H A;  4I3J A;  4XT2 B;  3DTK A;  1T18 A;  3UE1 A;  3PBO A;  5G4Y A;  2ZJ9 A;  3HJI A;  1K6R A;  4GS9 B;  4F3L A;  1MZU A;  4IBX A;  4L9G A;  4UA6 A;  4Z1W A;  5CX7 A;  4YIN A;  1YQS A;  2ZC5 B;  2ZQ7 A;  4ZTK A;  3T4J A;  4B9O A;  2EFX A;  1SKO B;  3Q81 A;  2ZL1 B;  5FQQ A;  4OOY A;  3T12 B;  2Y2J A;  3FV7 A;  3MKE A;  4GD8 A;  1TDG A;  4Y13 A;  5J8X A;  2OOL A;  5FAS A;  4ID4 A;  3LIC A;  3FYZ A;  5FAP A;  1OJ5 A;  5HD5 A;  2QMI A;  2Y55 A;  4PKY G;  4R38 A;  4JXG A;  3QNB A;  5G4Z A;  4PM6 A;  2D01 A;  4S2I A;  3ZG9 B;  5HAQ A;  3NC8 A;  3KYZ A;  1EW0 A;  3TE8 A;  2ZM0 A;  1O07 A;  3C7V A;  1OJG A;  3N7W A;  1NXY A;  3H7W A;  3NUL A;  3Q07 A;  4KQO A;  4EQI A;  1PYY A;  3U2A A;  1L0D A;  2Y2Q A;  4N1X A;  4WEJ A;  1T19 A;  3C30 A;  2ZMA A;  4I3I A;  4Z9Q A;  3E4Q A;  5HDC A;  2G2U A;  5GHZ A;  1PWD A;  4S2N C;  2ZC4 B;  3KX0 X;  3HJK A;  1OTE A;  4R4R A;  4OKP A;  4KQD A;  1ZTU A;  1D1J A;  4DE1 A;  2HDU A;  1KOU A;  3UPN A;  2LB9 A;  1OT6 A;  3A3D A;  2YKH A;  2HDQ A;  1YLT A;  5KZH A;  1JWV A;  3SW1 A;  4QU3 A;  5HPF A;  4RX3 A;  2FZ0 A;  3BRM A;  3PYP A;  4FH4 A;  5IHV A;  4ZJ2 A;  1GSX A;  1NY0 A;  1P9R A;  1ES3 A;  5I94 A;  1FCM A;  1F2K A;  4P6Z S;  2PYR A;  2RL3 A;  2JN7 A;  1S1Z A;  1IKI A;  2NUP C;  2V0U A;  1K25 A;  1EI5 A;  1I2S A;  4NEE D;  5EM0 A;  2WAF A;  2HZ5 A;  3C4O A;  3IBR A;  2W3F A;  1UGU A;  1W8Q A;  1G68 A;  3LGO A;  2VV6 A;  2HDS A;  1DP6 A;  4R4S A;  4L9E A;  1H5X A;  2GNX A;  3VMA A;  2XRN A;  1QMF A;  3WS5 A;  3OOV A;  1GHP A;  3GRJ A;  1WYC A;  2A24 B;  3CAX A;  5HX9 A; 
#chains in the Genus database with same CATH homology
 3DTM A;  1W79 A;  3N8R A;  2WUQ A;  3MZE A;  4KZ8 A;  3ZG5 A;  4XUX A;  4PM5 A;  1PW1 A;  2X71 A;  1SDE A;  4BEN A;  1FR6 A;  1Y54 A;  1ONG A;  4WBG A;  3VP3 A;  5HAR A;  3NI9 A;  4S2M A;  1H8Z A;  5FSR A;  4B4X A;  3EQV A;  4BJP A;  2WAE A;  1W5D A;  1ZKJ A;  3HL9 A;  4OQ0 A;  1YLW A;  4R3J A;  3CZD A;  4X6T A;  1XGJ A;  1MY8 A;  4JPM A;  4JXV A;  2ZC6 B;  2ZQA A;  3ZHH A;  1GA0 A;  3JYI A;  5E2H A;  3A3J A;  5EE8 A;  1BLP A;  1BUL A;  3EQU A;  4OH0 A;  3N4I A;  1GHM A;  2E8I A;  2WKH A;  2UWX A;  4LCM A;  4ZAM A;  2PU2 A;  3UN7 A;  4OP5 A;  1L0F A;  1NZU A;  1PZO A;  3RXX A;  3VP0 A;  4CJN A;  1SDN A;  5TR7 A;  4PM8 A;  1ONH A;  1H8Y A;  1XGI A;  3HUN A;  4PPR A;  4KZ6 A;  1JTD A;  1YT4 A;  4BL3 A;  5BOH A;  4LV1 A;  2ZQ9 A;  3CJM A;  2R9X A;  3IH9 A;  3BLM A;  4KG2 A;  3MXR A;  3MXS A;  2IWC A;  4K91 A;  3N8L A;  3MBZ A;  4X68 A;  5FI7 A;  4DE2 A;  3PTE A;  2Y2I A;  2HP6 A;  1CI9 A;  3MZF A;  5FAO A;  4ZJ1 A;  1IYO A;  5HAP A;  3LEZ A;  4XUZ A;  2HDR A;  1L0E A;  2P9V A;  3VFH A;  3A3I A;  3CG5 A;  3G2Y A;  3TSG A;  3IWQ A;  1DJA A;  1BT5 A;  3NDG A;  3P09 A;  4OPR A;  3UDX A;  1MWR A;  1YLP A;  1SKF A;  2WZX A;  2VGK A;  2WK0 A;  3ZGA B;  1IYQ A;  1ES2 A;  4IBR A;  5CEB A;  1WYB A;  1HZO A;  5FDH A;  2Q9M A;  3UY6 A;  1PI4 A;  1DY6 A;  2QZ6 A;  3BFD A;  3G4P A;  4X69 A;  3UPO A;  3PBR A;  2C5W B;  4OLD A;  4GN2 A;  3LY4 A;  1NZO A;  2HPB A;  1MKI A;  1JVJ A;  3PBQ A;  4P0M A;  5HL1 A;  3IXB A;  2XH9 A;  3IHB A;  2EX9 A;  5CHU A;  3ISG A;  4N1H A;  1BSG A;  3DW0 A;  4JF4 A;  1K55 A;  3AGD A;  4GOG A;  1JWP A;  1QME A;  4KZ3 A;  4PM9 A;  5DTS A;  4KZ7 A;  4O7D A;  2Y4A A;  4P6B A;  3ZFZ A;  5DTK A;  1MPL A;  1RGY A;  1XXM A;  1DJB A;  2JCH A;  3BEC A;  1NYY A;  3WS0 A;  3PAE A;  2X02 A;  3O88 A;  4WMC A;  5FQK A;  5DF8 A;  3HBR A;  3OPH A;  3OCN A;  1E3U A;  4MEZ A;  1ZG4 A;  5CER A;  3G35 A;  1MBL A;  2XGN A;  4X55 A;  5CRF A;  1G6A A;  1YMX A;  1LHY A;  3HUM A;  1KVL A;  2JBF A;  5M19 A;  2G2W A;  2ZQ8 A;  4MBF A;  1Q2P A;  3AGE A;  4OOM A;  2XEP A;  1KGF A;  4WYY A;  4DXC A;  5F1F A;  4KZ4 A;  5GL9 A;  1N4O A;  2A3U A;  3BLS A;  4H8R A;  1N9B A;  2Y2M A;  1MWU A;  1GHI A;  3SH9 A;  3ITA A;  2IWD A;  3TG9 A;  3DWZ A;  4EWF A;  3W8K A;  3NBL A;  3ZNY A;  5EOO A;  1K56 A;  4S2O A;  5U47 A;  4DE3 A;  3IXD A;  5A92 A;  4N9K A;  3A3E A;  5CGX A;  5CEC A;  1XKZ A;  1K55 C;  5CTN A;  1J9M A;  3MZD A;  2ZQD A;  5A93 A;  2EFU A;  3M6B A;  1GCE A;  2ZC3 B;  4DDS A;  1KDW A;  5CGS A;  4D2O A;  4JLF A;  2H10 A;  2WKI A;  2IWB A;  1MWT A;  3BM6 A;  5E2E A;  5DF9 A;  3N8S A;  2J9P A;  2RCX A;  3MKF A;  5CGW A;  1ZC2 A;  3A3F A;  1IKG A;  3E2L A;  2EXB A;  3N6I A;  4R23 A;  3S1Y A;  3GMW A;  4S2J A;  5HW3 A;  3WWX A;  3IXG A;  1K56 D;  3ITB A;  1HTZ A;  2XFT A;  1LI9 A;  2XQZ A;  2Y59 A;  2EX2 A;  1IYP A;  4RA7 A;  1PIO A;  2Y2L A;  2J7V A;  4MBH A;  4KQQ A;  1K6S A;  4OQI A;  5AQ7 A;  5KMW A;  4OQG A;  3V5M A;  1RGZ A;  4OVD A;  3W4Q A;  3VFF A;  4UA9 A;  5DF7 A;  1KGE A;  4GNU A;  3VP4 A;  4C3Q A;  4S2P A;  4HBU A;  4PMA A;  2XFS A;  1JWZ A;  5AQ9 A;  5DVA A;  2CC1 A;  5FAQ A;  2HP9 A;  3WRT A;  5AQB A;  4CPK A;  4FCF A;  5JYO A;  4N92 A;  4KG6 A;  3HLD A;  4WEL A;  5CXW A;  1FQG A;  3FWL A;  1ERO A;  1LLB A;  1KE0 A;  1K4E A;  3C5A A;  3BFE A;  2DRW A;  4E3L A;  3HLF A;  4YFM A;  3HLG A;  2OLV A;  4OLG A;  2XDM A;  4RX2 A;  4UAA A;  4GB7 A;  2XK1 A;  4MNR A;  4MLL A;  3G31 A;  1BLC A;  1KE4 A;  3FKW A;  3Q7V B;  3VP2 A;  3ZG7 B;  3IH8 A;  2HP5 A;  5EOE A;  2V20 A;  2FFY A;  3UNW A;  2DNS A;  4IED A;  4QJG A;  4E6W A;  3UPP A;  4LV2 A;  1C3B A;  5FA7 A;  2H0T A;  3C7U A;  2EXA A;  1KVM A;  3OC2 A;  1XA7 A;  4GKU A;  3VOZ A;  4DXB A;  1K57 A;  4K0X A;  5DTT A;  1EWZ A;  3V50 A;  3BYD A;  2BG1 A;  1WE4 A;  2Q9N A;  3LCE A;  5E2F A;  3ZG0 A;  4KQR A;  3S22 A;  1PW8 A;  3SS3 A;  4OQH A;  4S2K A;  5AQA A;  5TFQ A;  1XA1 A;  3CMZ A;  3IF5 A;  4BD1 A;  1CEF A;  1FOF A;  2XD5 A;  2Y2P A;  5TGF A;  5CTM A;  2BLS A;  2WGI A;  3GV9 A;  4EV4 A;  3IQA A;  1W7F A;  4FD8 A;  3TOI A;  4B88 A;  3HVF A;  3LY3 A;  4JXS A;  1I5Q A;  3UO9 A;  3HRE A;  4BLM A;  1E4D A;  5EPH A;  3M2J A;  3ZVW A;  1O7E A;  1IEM A;  1LI0 A;  5F82 A;  4OON A;  5EEC A;  3WS4 A;  4EUZ A;  3WS1 A;  4GDN A;  5CHM A;  4KZ9 A;  3W4P A;  1YLZ A;  2EX6 A;  2PBY A;  3M6H A;  4E3N A;  2JC7 A;  4U0X A;  4R1G A;  1SHV A;  3OZH A;  4KEN B;  3SOI A;  4QY6 A;  4IVI A;  1NRF A;  1CI8 A;  4DKI A;  1BLH A;  3NDE A;  3UE1 A;  1K57 C;  5EVI B;  3PBO A;  2ZJ9 A;  2WZZ A;  4HEF A;  1K6R A;  1PI5 A;  2Y2O A;  5E43 A;  3S4X A;  1NJ4 A;  3FZC A;  5GHY A;  2EX8 A;  4IBX A;  4LCL A;  4UA6 A;  2Y2K A;  4L0L A;  4JF5 A;  4LV0 A;  1TDL A;  4YIN A;  1BZA A;  1YQS A;  2Y2H A;  2Y2N A;  2ZC5 B;  2ZQ7 A;  4ZTK A;  4EBP A;  1LL5 A;  4WMC D;  1YM1 A;  2EFX A;  4XXR A;  3D4F A;  3Q81 A;  2V2F F;  2WGW B;  3LO7 A;  1E3U D;  4R3B A;  5FQQ A;  4ZJ3 A;  2C6W B;  4UHU A;  3AGF A;  4N9L A;  5F1G A;  3V39 A;  4OOY A;  5EVL A;  5A90 A;  2Y2J A;  3FV7 A;  2PU4 A;  3FKV A;  3MKE A;  2A49 A;  5HFO A;  4OPY A;  4P85 A;  3IXH A;  4X53 A;  3G32 A;  4GD8 A;  1LL9 A;  4OP8 A;  4P87 A;  1TDG A;  3IHA A;  5M1A A;  1FSY A;  4Y0T A;  5FI6 A;  4X56 A;  1S6R A;  1YLJ A;  5J8X A;  1FR1 A;  1ZG6 A;  3C4P A;  1M40 A;  3M2K A;  4NK3 A;  1E25 A;  5GLB A;  2VGJ A;  1NYM A;  5FAS A;  1MXO A;  1K4F A;  2QPN A;  3OPR A;  4ID4 A;  4RVA A;  4ZBE A;  2Y91 A;  4JBF A;  3UE3 A;  3FYZ A;  5FAP A;  1ES4 A;  3IWO A;  2QMI A;  2Y55 A;  3NY4 A;  5HAI A;  1L2S A;  1FCO A;  1RP5 A;  2ZQC A;  3UE0 A;  1XP4 A;  2WYX A;  4JF6 A;  4JXG A;  3WRZ A;  3QNB A;  2XLN A;  3GR2 A;  2FFF B;  4PM6 A;  4BQM A;  4MBK A;  3PBS A;  4S2I A;  4E3K A;  1ALQ A;  2OSU A;  3ZG9 B;  4KZ5 A;  4S2N A;  5EVI C;  5HAQ A;  1HVB A;  2WKE A;  3VP1 A;  3QNC A;  5GLC A;  3NC8 A;  1IEL A;  3SS4 A;  2DCF A;  4WM9 A;  5F83 A;  5FQ9 A;  3PBT A;  3DWK A;  2R9W A;  2XF3 A;  2JE5 A;  4JKT A;  4WZ5 A;  3BEB A;  4DF6 A;  5D3O A;  5A91 A;  4BD0 A;  3MFD A;  2V1Z A;  1IYS A;  1O07 A;  2ZM0 A;  3O87 A;  3PBN A;  5EUA A;  3NIA A;  3C7V A;  5CHJ A;  1TVF A;  2P9V B;  1TEM A;  3N7W A;  4HES A;  4KG5 A;  4OPQ A;  4DRT A;  2Y2G A;  1NXY A;  1Q2Q A;  4FSF A;  1ERM A;  3ZVT A;  3Q07 A;  4KQO A;  4EBL A;  4EQI A;  1PYY A;  1K54 C;  3HLC A;  5FQM A;  4LEN A;  3SH8 A;  1L0D A;  4GZB A;  1BLS A;  1PWG A;  4C75 A;  3ZDJ A;  2Y2Q A;  4HBT A;  4N1X A;  4DDY A;  1VM1 A;  3Q82 A;  4WEJ A;  1XPB A;  2ZMA A;  4Z9Q A;  4BL2 A;  1ERQ A;  2G2U A;  3P98 A;  5GHZ A;  2J8Y A;  1PWC A;  1ESI A;  3GTC A;  5L2F A;  1U60 A;  4E6X A;  1PWD A;  5G18 A;  3SH7 A;  3Q7V A;  1MWS A;  1M6K A;  3IF6 B;  1S0W A;  4S2N C;  1ES5 A;  1KE3 A;  3OPL A;  2ZC4 B;  1DJC A;  4F94 A;  3RXW A;  4RYE A;  5KSC A;  3VSK A;  4OKP A;  4R4R A;  2OLU A;  1Z6F A;  4IVK A;  4E3I A;  1AXB A;  1VQQ A;  2HDU A;  4WZ5 C;  4DE1 A;  5FQJ A;  3BFF A;  2GDN A;  2I72 A;  3V3S A;  5M18 A;  1ESU A;  3UPN A;  1I2W A;  3UDF A;  1FCN A;  4WEK A;  4E3J A;  3QHY A;  2ZD8 A;  3A3D A;  1CK3 A;  1XX2 A;  2HDQ A;  3G2Z A;  1YLT A;  1KGG A;  3NCK A;  3ZCZ A;  1FSW A;  2ZM8 A;  4WZ4 A;  4Y0O A;  4LV3 A;  5KZH A;  5GLA A;  3IF6 A;  2ZLY A;  1JWV A;  2ZM2 A;  5KSH A;  1HD8 A;  4PM7 A;  3SS5 A;  4QU3 A;  5E2G A;  3WS2 A;  4RX3 A;  1SCW A;  3UDI A;  3G34 A;  2P74 A;  3BFC A;  3HUO A;  3OCL A;  4UA7 A;  4U3T A;  4Q8I A;  1BTL A;  3BRM A;  4OOL A;  4S2L A;  2ZC7 A;  4FH4 A;  4U0T A;  5HX9 A;  5IHV A;  4ZJ2 A;  4GDB A;  4C6Y A;  3HLE A;  3ZNT A;  1NY0 A;  5I94 A;  1ES3 A;  2Z2M B;  3B3X A;  3GQZ A;  1FCM A;  5GLD A;  4E3O A;  3RJU A;  1OME A;  3IWI A;  1W8Y A;  2RL3 A;  3W4O A;  1IKI A;  3GVB A;  3V3R A;  4FH2 A;  4E3M A;  4B4Z A;  3O3V A;  5CED A;  3Q1F A;  1K25 A;  1RCJ A;  2XR0 A;  1BUE A;  1EI5 A;  3HLB A;  2WAD A;  4Y7P A;  5EVI A;  4ZDX A;  2XD1 A;  1I2S A;  4K0W A;  2WAF A;  3C4O A;  3ZG8 B;  1PZP A;  5JYP A;  3VOY A;  4QB8 A;  2X01 A;  4NET A;  1K38 A;  1W8Q A;  1YLY A;  3Q7Z A;  4EBN A;  4M3K A;  5FI2 A;  1G68 A;  3I7J A;  3BFG A;  3G30 A;  3VSL A;  3PAG A;  2HDS A;  3IF6 C;  3IT9 A;  4A5R A;  4Y0U A;  4JXW A;  4KZB A;  4OPZ A;  1L0G A;  3E2K A;  2H0Y A;  3GSG A;  4R4S A;  2WGW A;  4KZA A;  5EVI D;  1CEG A;  2Z2L B;  5FQI A;  4QY5 A;  1H5X A;  4QHC A;  3HLW A;  2OV5 A;  2B5R A;  1K54 A;  4GD6 A;  5GHX A;  3VMA A;  1GA9 A;  2H5S A;  5FAT A;  1QMF A;  3WS5 A;  1YMS A;  4QD4 A;  4R0Q A;  1JTG A;  4DE0 A;  1GHP A;  3GRJ A;  2WGV A;  2J9O A;  3OPP A;  1WYC A;  3O86 A;  1KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...