5GHZA

Crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "pre-deacylation" intermediate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghzA00
2JC7A 1BULA 4MLLA 4PPRA 3C7UA 1U60A 3IXHA 4OLDA 2VGJA 4BQMA 5FI6A 4ZJ2A 3VMAA 2EFUA 3A3EA 1H8ZA 3JYIA 4PM9A 1RGYA 4E3IA 4OQGA 4ZDXA 4PM6A 1FSWA 4E3LA 1K54A 3Q7VB 4PM7A 2H0TA 4DRTA 1GHPA 3V3SA 1LHYA 5FQMA 4K91A 4EBPA 1CI8A 1KE0A 5E2GA 3VSLA 4Y0TA 2XF3A 1SCWA 1DJAA 2Z2LB 3WRZA 3V3RA 4B4ZA 1WYCA 4OPYA 1M40A 3GRJA 4WZ5C 4GNUA 1YLJA 3C4PA 4E3MA 4PM5A 1PI5A 4QY6A 4BD0A 5U47A 4UA9A 1PIOA 2P9VA 3OPHA 4FSFA 4NETA 3HVFA 2ZQ9A 4S2OA 4S2MA 5FI7A 1LL5A 4BJPA 4HBTA 1K6SA 2Q9NA 1QMFA 1XKZA 3IT9A 4MNRA 3N8SA 1WE4A 3ISGA 2ZM2A 1L0FA 1FCOA 2PBYA 5EE8A 4WMCA 5FQQA 1ESIA 4S2NC 2OV5A 1L0EA 2WAFA 2WZXA 4R1GA 4Z9QA 4R4SA 4E3NA 3EQUA 1KGGA 2WAEA 1RP5A 2Y2OA 2Y2NA 3SH8A 4R3BA 2JBFA 5FQJA 4WEKA 1HTZA 3RJUA 2V2FF 1GA9A 1XA1A 3G32A 5E43A 1IYQA 4M3KA 1JWPA 1PW1A 4OH0A 2ZMAA 4X55A 1WYBA 4ZAMA 4ZBEA 2EX2A 4GB7A 1ZG4A 3UPPA 3IF6C 5L2FA 2HDQA 4FCFA 4Y0OA 4S2PA 3Q7ZA 5CXWA 1TDGA 2XGNA 4N92A 1L0GA 4BENA 4ZJ3A 3HLDA 3OPPA 5D3OA 4R4RA 4IEDA 1H5XA 4U0TA 3VFFA 4B88A 4RYEA 1XGIA 3AGEA 3FYZA 4RX2A 5IHVA 5A92A 2J7VA 3VSKA 5EPHA 2G2WA 1W8YA 2WKHA 2J9PA 2QMIA 4GN2A 2I72A 3ZFZA 1J9MA 1W8QA 1AXBA 4OOMA 4QU3A 4KZ5A 1Q2QA 2H5SA 3O86A 4HBUA 5M18A 1BLSA 5KZHA 1I2WA 3ZG8B 3NIAA 2Y2HA 5KSHA 2Y2KA 4KG6A 3NDGA 3IHAA 5CHMA 2JCHA 3MZFA 3A3DA 3VP4A 5A93A 1DJCA 1MWTA 2ZQDA 1BLHA 1BZAA 3IXGA 1ZG6A 3A3FA 4MBFA 3UDFA 4E6XA 5HW3A 3S4XA 2J9OA 3AGDA 5AQBA 5G18A 2IWCA 3V5MA 1XGJA 2WKEA 3PBSA 4OQIA 2X01A 3HLFA 3O87A 2X71A 2HP9A 1NZOA 3LEZA 2UWXA 5EVIA 1K55C 3ZVTA 4FH4A 4RA7A 4IVIA 4KZ6A 4WEJA 2ZC3B 1S6RA 2Y4AA 3AGFA 3A3IA 3NCKA 4KG2A 4OKPA 2Y55A 4OQHA 4XUZA 3N8LA 2EFXA 1ES2A 4GZBA 4XUXA 3QHYA 1BUEA 2PU4A 4OP5A 2RL3A 3W4OA 3IQAA 1G68A 1ONGA 4BLMA 1KGEA 3HLBA 1Q2PA 3HLCA 4X53A 4KQOA 1BTLA 3MZEA 5EVLA 1RGZA 1K56D 3Q07A 5DF8A 3IWQA 1FSYA 4UA6A 5GLBA 3G2YA 3BRMA 3PBOA 4QY5A 3UPNA 1KVMA 2ZD8A 3G2ZA 1EROA 4DDYA 3IF5A 1DY6A 5EOOA 4R23A 1O7EA 3VP1A 2JE5A 3O3VA 3IWIA 1E3UD 1K38A 1NZUA 3E2KA 3GQZA 2DCFA 4GDBA 4OPQA 2H10A 3SS3A 4P87A 3CJMA 4JXSA 4KZ9A 3HUMA 3HUOA 1YM1A 3PBNA 1K57A 3GVBA 5FAPA 5CERA 2XFSA 3WS0A 5TFQA 2A3UA 3V50A 2WADA 4N1HA 1FOFA 3E2LA 1XP4A 4K0WA 4HEFA 4N9KA 1M6KA 2WGIA 4KZ8A 3WWXA 4EV4A 1SDNA 2QPNA 1FCMA 4DF6A 3FKWA 1JTGA 2ZQCA 4BD1A 2Z2MB 4ZTKA 4JLFA 2BG1A 3BFFA 4KZ4A 4EBLA 3NY4A 3VOYA 3GR2A 1LL9A 3ZHHA 1E4DA 5HX9A 2XQZA 5CTNA 3UDIA 3IF6B 4JPMA 3SS4A 3ZNYA 3IH8A 3MBZA 4OPZA 2R9WA 5GHYA 1YLYA 3ZVWA 5CHJA 4OPRA 4EBNA 1PWCA 4MEZA 4P0MA 3MKEA 3WRTA 3WS5A 5HFOA 3LY3A 4P85A 1XPBA 1LLBA 4QHCA 1GHIA 1KDSA 1O07A 2XEPA 3OZHA 2DNSA 5GHZA 4Y7PA 3HREA 3OCNA 1N4OA 1K4FA 4WMCD 3SS5A 2EX6A 2Y2MA 3FV7A 4LCMA 3ZG9B 5GHXA 5EUAA 2IWDA 5A91A 1ERQA 4QJGA 5EOEA 4WELA 2Y91A 1FR1A 2XK1A 4GDNA 3UO9A 2VGKA 4DXBA 1BSGA 5DF7A 1HVBA 1NRFA 2C6WB 5FI2A 3IWOA 4E3JA 5AQ9A 1KGFA 2CC1A 3IHBA 2WGWA 3EQVA 1IELA 5E2EA 1IYPA 1IEMA 2HP5A 5FQ9A 1XX2A 3PAGA 4KENB 3ZG0A 1TVFA 2HPBA 5FATA 1FQGA 3ITAA 4LV2A 2X02A 2XH9A 3O88A 5I94A 3C4OA 3OPLA 4L0LA 4WYYA 2V20A 3N4IA 5E2FA 1YLZA 3D4FA 4JXGA 3UDXA 4OOLA 1K54C 1PW8A 2XDMA 2ZJ9A 4LCLA 1N9BA 5M1AA 3ZGAB 2ZC4B 2Y2QA 4C3QA 1YLTA 3MZDA 4KZAA 4U3TA 3RXWA 4OQ0A 4FD8A 3WS4A 4KZ7A 3I7JA 1PWGA 3WS2A 3RXXA 2ZQ7A 1ALQA 2EX9A 5A90A 1ES5A 1GHMA 4FH2A 1FCNA 1MWUA 3UE1A 1G6AA 4LV1A 4WZ5A 5CEDA 2XD1A 3M6BA 3Q81A 4ZJ1A 2PU2A 3BYDA 1C3BA 2J8YA 4GKUA 4ID4A 3VP2A 2ZM8A 1XA7A 1PZPA 3LCEA 1ES3A 3GTCA 3DW0A 1GA0A 3DWKA 3QNBA 5FSRA 3M2JA 3FKVA 5HAPA 3TOIA 5GLCA 4X68A 5TGFA 3BLMA 1ESUA 4S2NA 5EVID 1S0WA 1L0DA 2B5RA 3Q7VA 4X69A 3ZG7B 4A5RA 1QMEA 3BFCA 5JYOA 3VP3A 4Q8IA 3ZDJA 1ZKJA 2QZ6A 3BFDA 1TEMA 1IYOA 3G30A 1Y54A 3BEBA 3M6HA 1OMEA 3SH9A 3W8KA 3ZNTA 5M19A 4S2KA 1XXMA 1KE4A 2ZC6B 4JF4A 4UHUA 3NBLA 3BM6A 3IF6A 5KMWA 4GOGA 4D2OA 5J8XA 4RX3A 1LI0A 1MKIA 3M2KA 4S2JA 3G4PA 4IVKA 4S2LA 1Z6FA 4WZ4A 3N7WA 4JF5A 3W4PA 4BL3A 3C7VA 1NYYA 5CGWA 4E6WA 4O7DA 1LI9A 1NJ4A 3PAEA 3ZG5A 1KE3A 3UE0A 4JXWA 4YFMA 1I2SA 1K25A 1W5DA 2WKIA 5EVIB 3W4QA 2C5WB 5JYPA 1W79A 1ONHA 1CI9A 1MWRA 3N8RA 3VP0A 3G34A 3UPOA 4EQIA 1DJBA 4LV0A 4B4XA 2BLSA 4N1XA 3HL9A 2WZZA 4R3JA 1SDEA 4N9LA 1NXYA 3CMZA 1PI4A 4X56A 5HAQA 1SKFA 4DDSA 1MWSA 3WS1A 2WK0A 3IH9A 4QB8A 3UE3A 3V39A 4E3KA 1KVLA 3FWLA 1EI5A 1IKGA 4WM9A 1YT4A 4NK3A 4JF6A 2ZM0A 5E2HA 1YMXA 5FA7A 1JTDA 1ZC2A 2WGVA 3DTMA 1EWZA 3MKFA 2EXBA 2ZC5B 4KZ3A 1CEFA 5EVIC 2XR0A 2RCXA 4RVAA 4CPKA 3G35A 1K55A 2HDSA 1I5QA 5DTSA 3IXDA 5F1FA 2ZQAA 1JWVA 3OC2A 3A3JA 3BFGA 4DXCA 2Y2LA 4IBRA 2Y2IA 3BLSA 3NDEA 2E8IA 4YINA 4OOYA 4E3OA 4KQQA 5AQAA 5HARA 1CEGA 3B3XA 5FQKA 5F1GA 1SHVA 1YMSA 5FDHA 4DKIA 1FR6A 4K0XA 4LV3A 1BLPA 3P98A 3Q82A 3BFEA 2Y59A 4H8RA 5F82A 3HBRA 5CRFA 5FAOA 5CEBA 2OSUA 3S22A 2OLVA 2XFTA 3MFDA 3NC8A 2H0YA 4Y0UA 3CZDA 2ZLYA 2P9VB 2G2UA 3C5AA 4KG5A 1PYYA 5GL9A 2V1ZA 1VQQA 4JKTA 4MBKA 3VOZA 5BOHA 2DRWA 2OLUA 1L2SA 1MPLA 1YQSA 3OCLA 1IYSA 1MBLA 5GLAA 3SOIA 1YLWA 3MXRA 1K57C 4S2IA 3OPRA 1NYMA 3HLGA 5CECA 4DE0A 4OVDA 3FZCA 4X6TA 1RCJA 5FASA 3SH7A 5HAIA 1CK3A 3G31A 3LO7A 3TG9A 4JBFA 4PMAA 4GD8A 2Q9MA 1IKIA 2IWBA 1BT5A 3S1YA 1E25A 1JVJA 1PZOA 2Y2PA 3BECA 3LY4A 1ERMA 3PBRA 3PBTA 3ZCZA 2XLNA 5DF9A 1JWZA 3PTEA 4C75A 4EWFA 5CTMA 4BL2A 3GSGA 4HESA 2XD5A 2EX8A 4WBGA 3QNCA 1VM1A 1TDLA 3CG5A 3HLEA 3TSGA 5CHUA 5KSCA 2Y2GA 2EXAA 5HL1A 4DE1A 3UY6A 4F94A 3ITBA 3GMWA 3Q1FA 4KZBA 2P74A 2GDNA 3UNWA 1MXOA 2ZQ8A 4OLGA 5DVAA 2FFFB 4IBXA 5FAQA 3UN7A 4MBHA 5CGXA 2HDUA 1GCEA 2HP6A 3IXBA 3VFHA 4JXVA 4P6BA 4GD6A 5FQIA 1KDWA 5CGSA 3HUNA 3N6IA 5F83A 5GLDA 2ZC7A 1BLCA 4XXRA 1MY8A 2WGWB 1ES4A 2WUQA 4CJNA 5AQ7A 1W7FA 5EECA 2Y2JA 1PWDA 2HDRA 4U0XA 3HLWA 4DE3A 3PBQA 5TR7A 4OONA 1K56A 1K6RA 4KQRA 4LENA 4PM8A 1YLPA 5DTKA 4OP8A 5DTTA 3MXSA 4QD4A 1NY0A 4EUZA 3GV9A 1K4EA 3P09A 4R0QA 4C6YA 4UAAA 2WYXA 1H8YA 2A49A 3NI9A 2FFYA 1HD8A 4DE2A 4UA7A 1HZOA 1E3UA 3DWZA 2R9XA
chains in the Genus database with same CATH superfamily
3MQ0A 3F1PB 5FEFA 2O0YA 1BULA 3PYPA 2L1MA 1P97A 2YKHA 3H82B 4PPRA 5EVEA 5LBRA 1U60A 3E4QA 5FI6A 2V0UA 4Y15A 3R7WA 3VMAA 3A3EA 4HP4A 3JYIA 4PM9A 2V9AA 4OQGA 3BQ8A 3LUQA 4PM6A 5TBMB 1L3LA 3IBJA 4E3LA 1K54A 3UMEA 3DAVA 2H0TA 4ARZA 1KE0A 3K2NA 3C4PA 5U47A 4S2MA 4NKPA 4F3LB 4BJPA 2Q9NA 1N9OA 2ZM2A 1FCOA 2PBYA 3BWLA 4WMCA 2VZWA 4WLAA 2WZXA 4R1GA 3C8CA 3EQUA 1KGGA 1RP5A 3SH8A 2JBFA 2Q0OA 1XFNA 1GA9A 3MJQA 4ZAMA 1IYQA 1WYBA 3F1NB 1XJ6A 3ULFA 4FCFA 3Q7ZA 2XGNA 4N92A 3S7PA 3VFFA 4RYEA 3AGEA 2JKTI 1ODVA 2FZ0A 1YKDA 2G2WA 1LSWA 2J9PA 4Q0HA 1P9WA 2QYBA 1W8QA 4QU3A 4OOMA 5HWVA 2W1TB 1I2WA 3NIAA 5L09A 4KG6A 1OTEA 2JKFA 3MZFA 1TF1A 3ZQ5A 1NLZA 5G4YA 4E6XA 1ZG6A 3A3FA 3UDFA 2XSSA 3AGDA 4BBTA 2WKEA 2X01A 2O9BA 4FH4A 4WEJA 1S6RA 3AGFA 4XUZA 2KOIA 3RTYA 3N8LA 4XUXA 1ES2A 2JN7A 1KGEA 3HLBA 1Q2PA 3HLCA 4X53A 4KQOA 4B93A 2JKRI 3IWQA 4UA6A 5GLBA 3G2YA 3UPNA 3TRCA 3LYXA 1NRJA 1O7EA 4X1MA 3VP1A 3CPTA 2JE5A 2OAQ1 1E3UD 1K38A 3E2KA 1ZHHB 4R6LA 2H10A 4JXSA 2HF6A 2HZ5A 5FAPA 1D7EA 1N9LA 2XFSA 3WS0A 2A3UA 3E2LA 4K0WA 2WGIA 3TJZC 3WWXA 3T4TA 2ZQCA 4ZTKA 3BFFA 3VOYA 3ZHHA 2QWSA 4P6ZS 2XQZA 5CTNA 3LICA 4JPMA 2XRNA 4MEZA 2V8FA 3MKEA 5HFOA 4P85A 3LIDA 4QHCA 3OCNA 1K4FA 4L9EA 2EX6A 4LRZE 2V0WA 4CLCB 4KUKA 3F1OA 4QJGA 1LL8A 5EOEA 4WELA 1FR1A 4L9GA 3JVVA 4GDNA 5DF7A 3VOLA 2HJEA 1HVBA 2C6WB 1D1JA 4H6JB 3KSFA 1F9IA 3EQVA 4HI4A 1WA9A 4R70A 1IYPA 2HP5A 4LV2A 2XH9A 3O88A 3C4OA 1YLZA 4PKYA 1K54C 1PW8A 1HLUP 2ZC4B 2K31A 2J3WA 1YLTA 4C3QA 5DFYA 4FD8A 3WS4A 2P08A 1PWGA 3WS2A 2EX9A 4FH2A 1FCNA 2XD1A 4ZJ1A 3VP2A 4ID4A 2ZM8A 1XA7A 1VB6A 1ES3A 3LI8A 2NUTC 5FL3A 3TOIA 5GLCA 4S2NA 3Q7VA 4X69A 3ZG7B 4A5RA 1QMEA 4HJ3A 5JYOA 3VP3A 3ZDJA 3FPVA 1TEMA 1IYOA 1Y54A 3BEBA 3LIAA 3W8KA 4JF4A 4UEYA 4UHUA 5J7EA 2Y79A 4II7A 4GOGA 4D2OA 4RX3A 4S2JA 3G4PA 4LRXC 4S2LA 3LGOA 4WZ4A 3BW6A 4M4XA 2B02A 4BL3A 4DJ3A 2M7UA 4E6WA 4O7DA 3ZG5A 1NJ4A 1KE3A 1JNUA 3KYQA 3QP2A 1K25A 3EWKA 4O0PA 5JYPA 1ONHA 1CI9A 4NXBA 3UPOA 3G34A 4B4XA 3P7NA 1S4RA 4ETXA 1PNEA 4X56A 1Z09A 3CITA 1SKFA 4B9OA 3WS1A 2WK0A 3IH9A 1KVLA 3S7NA 1IKGA 4WM9A 1YT4A 4JF6A 5E2HA 2WGVA 1EWZA 3MKFA 2MJ6A 3LR0A 2XR0A 2HDSA 3IXDA 2ZQAA 1H3QA 3A3JA 3A0RA 3BLSA 3NDEA 2E8IA 4YINA 4OOYA 4E3OA 5HARA 1CEGA 3A0SA 5F1GA 3R4KA 2VV7A 4GHIA 3MFDA 1G5UA 2H0YA 4Y0UA 2VV8A 3CZDA 3C5AA 1SKOA 1PYYA 4JKTA 3VOZA 2GZAA 3SOIA 3HLGA 4DE0A 4MN7A 1RCJA 3SH7A 1CK3A 3LO7A 3TG9A 4GD8A 2B18A 1E25A 2PDRA 3LY4A 1ERMA 3PBTA 3ICYA 4EWFA 3GSGA 4HESA 2J80A 4HQAA 4WBGA 3CG5A 3HLEA 2OAP1 5HL1A 3UY6A 3ITBA 4PAUA 4KZBA 1ACFA 4ZRRA 5DVAA 2FFFB 5CGXA 2HP6A 4JXVA 4GD6A 5FQIA 1KDWA 4GW9A 5CGSA 2WGWB 2Z6DA 2WUQA 5AJGA 1W7FA 5EECA 2Y2JA 3UB6A 2PT7A 1GSVA 3PBQA 3C2WA 5DTKA 4PM8A 3MXSA 1NY0A 3VE3A 2W3HA 3P09A 4R0QA 3QP8A 4C6YA 1H8YA 2A49A 2FFYA 4XT2A 1E3UA 3E0YA 4MLLA 1OTAA 4EESA 2WKQA 3IXHA 3UMDA 4BQMA 5DJUA 3QP4A 2EFUA 5HD3A 1FSWA 3NJAA 2VEAA 2ZMVA 3LI9A 5FQMA 3VSLA 4Y0TA 5DFXA 3WRZA 1WYCA 1YLJA 4E3MA 4BD0A 4UA9A 2P9VA 3OPHA 4S2OA 5AVFA 4I38A 3PR6A 4QWOA 1STZA 5EE8A 4S2NC 2OV5A 2ZL1B 2A24A 1OT6A 1K0KA 4Z9QA 1ZTUA 3W2ZA 2Y2NA 4R3BA 5FQJA 4WEKA 1HTZA 3RJUA 4OH0A 3LR5A 2EX2A 4S2PA 1F2KA 4MCWA 4BENA 3HLDA 3OPPA 4PHTA 3K3CA 5IHVA 1VEUB 4IHQA 2I72A 5F69A 3T4QA 2H5SA 3O86A 1BLSA 3T1RA 3U2AA 1DP8A 3MMHA 2J3TD 3MS6A 2JCHA 2JKRM 3A3DA 3VP4A 5A93A 1OPXA 2P04A 1BLHA 3IXGA 3S4XA 5AQBA 1XGJA 4OQIA 2HP9A 1NZOA 3T12B 3KSGA 3T4SA 4RA7A 4KZ6A 2ZC3B 4KG2A 3NCKA 3VP0A 3FG8A 3W4OA 3EEHA 3IQAA 4BLMA 3L9KA 3MZEA 5EVLA 1FSYA 3BRMA 4QY5A 1EROA 4R38A 4DDYA 1S1YA 1TS7A 5EOOA 2ZOIA 2K2NA 3O3VA 3IWIA 4JGRA 1NZUA 4WN5A 2P7JA 4YWZA 4P87A 1H0MA 3A0VA 1P9RA 3S7QA 3DTEA 3GVBA 1T1AA 5TFQA 4Y13A 2WADA 1FOFA 1XP4A 3HJIA 1M6KA 4DF6A 3EOIA 3FKWA 4KQDA 2Z2MB 3NULA 3KYZA 2CMNA 3F1NA 3UDIA 3IF6B 3ZNYA 3IH8A 2PAVP 2HJ9C 1YLYA 4EBNA 1PWCA 4P0MA 3WRTA 3WS5A 3LY3A 5CX7A 1GHIA 1O07A 2XEPA 3BJNA 4Y7PA 1N4OA 3SS5A 5GHXA 1T19A 2W1TA 3R7WB 1ERQA 4ARZB 1MC0A 1BSGA 5EM1A 1NRFA 4E3JA 4JGQA 1IELA 1YAXA 3ZG0A 2HPBA 5FATA 1FQGA 5I94A 5HL6A 1VETA 3N4IA 3D4FA 4JXGA 4LCLA 1N9BA 1TS0A 5M1AA 3ZGAB 5L10A 3MZDA 4U3TA 3RXWA 4KZ7A 3GECA 2ZMFA 1XFQA 4GKUA 4HNBA 3LCEA 3E4PA 1GA0A 3FKVA 1EW0A 5HAPA 1T1BA 4X68A 2VKSA 5TGFA 5EVID 2W27A 1J3WA 3TW8A 5M19A 3ZNTA 1VHMA 2ZC6B 1UGUA 3NBLA 3VE4A 5J8XA 1PFLA 3M2KA 3L7HA 1Z6FA 3N7WA 4EXOA 4JF5A 3OOVA 3C7VA 1G6OA 3UE0A 1V9ZA 1I2SA 1W5DA 3W4QA 2C5WB 4HH3A 3N8RA 1DJBA 2INWA 4BBUA 2W3GA 3IX8A 4EEUA 4K08A 4N9LA 1NXYA 1H8MA 1PI4A 1CQAA 1OJGA 5HAQA 5L07A 4X1LA 3V39A 3FWLA 2ZOHA 3UB5P 2ZM0A 5FA7A 1JTDA 2R78A 2EXBA 2ZC5B 4KZ3A 1K55A 3IS2A 3FC7A 3OC2A 3MXQA 3BFGA 3LIBA 4DXCA 2Y2LA 4KQQA 5AQAA 3B3XA 5FQKA 4DKIA 1SHVA 5FDHA 3Q82A 4EW7A 2Y59A 2FH5A 5F82A 2OSUA 3NC8A 1IFQA 1BYWA 1CJFA 5K5BA 1TD5A 1TS8A 5BOHA 5HPIA 5GLAA 1FIKA 1YLWA 4S2IA 1NYMA 1X0OA 1S66L 3BY9A 5FASA 4JBFA 1DP9A 2IWBA 2Y8HA 1JVJA 2Y2PA 3BECA 4RQ9A 3NECA 5DKKA 5DF9A 1JWZA 4BL2A 4GJ4A 3F1OB 3TSGA 1TDLA 5KSCA 2Y2GA 2EXAA 2YKFA 4F94A 2M1CA 3GMWA 1UWPX 3UNWA 4IBXA 3UN7A 1GCEA 3VFHA 5C5KA 4P6BA 2V1BA 2ZC7A 4LFUA 4GLQA 5AQ7A 4I39A 3E98A 4U0XA 5TR7A 4MMNA 2PYPA 4Y2FA 2GNXA 4KQRA 5DTTA 4EUZA 4QD4A 1K4EA 3NI9A 3IXBA 3S7OA 2JC7A 1F5MA 3LFVA 3T4LA 2VGJA 3H7WA 3G6OA 1H8ZA 1RGYA 4E3IA 2PR6A 4ZDXA 4R3AA 4QPRA 3Q7VB 4PM7A 4DRTA 5MC7A 3QP1A 1CF0A 4K91A 4EBPA 1CI8A 5E2GA 2XF3A 3V3RA 3GRJA 2VK3A 4QY6A 3TE8A 1LL5A 2L0WA 3JPUA 4HBTA 1QMFA 1XKZA 3IT9A 4MNRA 1MKMA 3N8SA 1WE4A 4GS9B 1ESIA 4DN0A 2WAFA 4R4SA 4E3NA 4O8GA 5DKLA 2WAEA 5HPFA 2Y2OA 3B47A 5HWWA 2I9VA 4I3IA 1XA1A 4I3JA 4IUHA 3G32A 5E43A 4X55A 4M3KA 1PW1A 4GB7A 5L2FA 2HDQA 1TDGA 4ZJ3A 5D3OA 1H5XA 4U0TA 1XGIA 3FYZA 3VSKA 5EPHA 3E4OA 2WKHA 2AVXA 2QMIA 2VJWA 4IJGA 1AXBA 1Q2QA 4HBUA 3ZG8B 4D60A 3T4OA 2O9CA 5KSHA 1DJCA 3KSIA 1BZAA 2J9OA 1MZUA 3OLOA 5HSQA 2IWCA 3O87A 2UWXA 5EVIA 1K55C 3ZVTA 4OKPA 3A3IA 2Y55A 2KX6A 2EFXA 4GZBA 3QHYA 1BUEA 2PU4A 4OP5A 1G68A 1ONGA 3B42A 3U4LP 2PYRA 2QJ5A 1BTLA 3Q07A 1K56D 4HOIA 1KVMA 2ZD8A 4WUJA 1DY6A 3T1QB 3QP5A 4GDBA 2DMWA 4OPQA 3SS3A 3CJMA 3PXPA 1YM1A 3PBNA 1K57A 5CERA 3OBFA 4CLCD 2W3DA 4N1HA 2W3EA 4N9KA 4KZ8A 1SDNA 1FCMA 2J3TC 2OWHA 4JLFA 4KZ4A 4EBLA 4G3KA 1LL9A 4Z1WA 1E4DA 4ME4A 4HHDA 2OOLA 3SS4A 3T4KA 4OPZA 2R9WA 1S1ZA 5GHYA 5CHJA 3P01A 4DMZA 1YSPA 1GSXA 1LLBA 5F68A 1KDSA 3OZHA 5GHZA 3HREA 4O01A 3T4JA 1VEUA 1DP6A 1PRQA 2Y2MA 3FV7A 4LPZA 5A91A 4MDZA 1OTIA 2Y91A 3IX4A 3UO9A 1LT0A 4X25A 4DXBA 4NXFA 5FI2A 5AQ9A 4UQIM 1P0ZA 2CC1A 5DJTA 4ETZA 3UB8A 3PAGA 4KENB 5EV0A 1TVFA 2A2LA 4EU0A 3D72A 2Z6CA 3OPLA 4L0LA 4E04A 2V20A 3UDXA 2D02A 4OOLA 2ZJ9A 1DRMA 2HGVA 4KZAA 4OQ0A 4NEED 3K3DA 3RXXA 2ZQ7A 3F1PA 1MWUA 1G6AA 4LV1A 4WZ5A 5CEDA 3M6BA 3Q81A 3H82A 2W0NA 2PU2A 3BYDA 2J8YA 3VV4A 3DW0A 3QNBA 3DWKA 5FSRA 5TBMA 3RFBA 3BLMA 1ESUA 2UV0E 1S0WA 1L0DA 2B5RA 2HV1A 3BFDA 2H28A 1OMEA 3SH9A 4S2KA 1KE4A 5HDCA 4YNRA 3BM6A 3IF6A 4F3LA 5KMWA 3CI6A 1MKIA 3EGXC 1S67L 3UB9A 3W4PA 2XROA 1OT9A 5CGWA 1LI9A 1T18A 3JVUA 4YFMA 3MR0A 2L4RA 1S4SA 2BLSA 3NOTC 3RH8B 1YPRA 2WZZA 4ESPA 4MN6A 1SZVA 2QKPA 2K7SA 4DDSA 3LR4A 5HZHA 4BWIA 5AVEA 1EI5A 3KYEA 4NK3A 5IU1A 5EVIC 5HD5A 2RCXA 3G35A 4AFIA 1I5QA 4MN5A 1JWVA 4LGWA 4IBRA 2Y2IA 2D01A 2B95A 2VX8A 1FR6A 4Y3IA 4LV3A 3P98A 3BFEA 4H8RA 4CQHA 5FAOA 5CEBA 3S22A 4KG5A 2G2UA 2KDKA 3BY8A 2V1ZA 1VQQA 2EA9A 4MBKA 1L2SA 4GCZA 4L9FA 1MPLA 1YQSA 3OCLA 1IYSA 1MBLA 3IX3A 1K57C 3OPRA 5CECA 4X6TA 5KIZA 5HAIA 2Q9MA 1IKIA 1BT5A 2JHEA 2VLGA 3S1YA 1G28A 3NOPC 3PTEA 4C75A 4G3WA 4LLOB 2EX8A 1VM1A 2XA7S 4KUOA 3Q1FA 5FDSA 1MXOA 4OLGA 3HUNA 5F83A 5GLDA 4XXRA 3LR3A 1PWDA 4BMWA 4DE3A 2W3FA 4UQIS 1K56A 1K6RA 4LENA 1VETB 1YLPA 4OP8A 2V8CA 2WYXA 2PR5A 4UA7A 1HZOA 3DWZA 2R9XA 1D06A 3LEQA 4EEPA 1LSVA 3LIFA 3UE6A 2VGLS 5F6AA 3C7UA 4OLDA 5A8BA 4CLCA 4ZJ2A 1N9NA 3KX0X 5HWTA 2QHKA 3CHWP 1GHPA 3CAXA 3V3SA 1LHYA 2PD8A 4H6JA 1SCWA 1DJAA 2Z2LB 5EM0A 5J3WA 4HY8A 4B4ZA 4OPYA 1M40A 4WZ5C 4GNUA 4PM5A 1PI5A 3CPTB 1PIOA 2M7VA 4PKYG 4FSFA 4NETA 3HVFA 2ZQ9A 5FI7A 5FEGA 5TJJA 3T50A 1K6SA 3ISGA 1L0FA 5FQQA 1L0EA 1LSXA 3UB7A 2O99A 2WKPA 2V2FF 4EERA 4NXGA 1XJ3A 1JWPA 2ZMAA 4ZBEA 1ZG4A 3UPPA 3IF6C 2IA2A 2PRFA 4Y0OA 5CXWA 1L0GA 2JKGA 4FUWA 4R4RA 4IEDA 4B88A 1OTDA 1Y28A 3SW1A 4RX2A 5A92A 2J7VA 1OJ5A 1W8YA 4GN2A 4FOFA 3ZFZA 1J9MA 4KZ5A 2O9AA 4HP9A 2WKRA 5M18A 3IS2B 5KZHA 2Y2HA 2Y2KA 3NDGA 3NHQA 3IHAA 5CHMA 5HDSA 1MWTA 2ZQDA 2PHYA 4MBFA 5HW3A 5G18A 3V5MA 2PD7A 3PBSA 3HLFA 2X71A 3ZYTA 3LEZA 3NOUC 4IVIA 4EUVA 2Y4AA 4OQHA 3T1SA 5IS1A 2RL3A 4HIAA 1RGZA 5DF8A 3V67A 3PBOA 3G2ZA 2KLIA 3IF5A 4R23A 1NWZA 2EWWA 3GQZA 2DCFA 3MF0A 5IT5A 4KZ9A 3HUMA 3HUOA 4GS9A 4HJ4A 1V9YA 3V50A 3O5YA 4HEFA 4EV4A 5L8MA 2QPNA 1JTGA 2QJ7A 4BD1A 4G3VA 2BG1A 3NY4A 3GR2A 4NXEA 5HX9A 3H9WA 4BBVA 3MBZA 3ZVWA 4OPRA 1XPBA 2OWJA 3EEAA 2DNSA 4WMCD 1IOUA 4LCMA 3H7WB 1Y4OA 3ZG9B 5EUAA 2IWDA 2EWVA 3GDIA 2XK1A 3HCYA 2VGKA 3IBRA 3CUEA 5J4EA 3IWOA 3CLOA 1KGFA 4DJ2A 3IHBA 1GSWA 2WGWA 4JGOA 3HJKA 2LB9A 5E2EA 3B33A 4IUKA 1IEMA 2E8JA 5FQ9A 1XX2A 4CLCC 3ITAA 5I5LA 2X02A 3MSHA 4WYYA 2W1RA 5E2FA 2XDMA 3KO6A 3MFXA 4JGPA 2Y2QA 3QP6A 3I7JA 1ALQA 5A90A 4Q0IA 1ES5A 1GHMA 3UE1A 4GHIB 1SKOB 1C3BA 5G4ZA 1PZPA 3GTCA 3M2JA 4EETB 2ACGA 2PBDP 2VV6A 3BFCA 4LRYC 4Q8IA 2BTFP 1ZKJA 2QZ6A 3G30A 3M6HA 3PHYA 5EFWA 1XXMA 1XJ2A 3C30A 4FTXA 4Y17A 1LI0A 3SZTA 4IVKA 4Q0JA 3KSHA 1W63Q 1NYYA 2ZL1A 3PAEA 2NUPC 4JXWA 2WKIA 5EVIB 4Y5FA 1W79A 1MWRA 4NG2A 4EQIA 4LV0A 1NLYA 4N1XA 3HL9A 4R3JA 1SDEA 4HH2A 3CMZA 2G7UA 3DTIA 2VA0A 4XT2B 1MWSA 4QB8A 3UE3A 4E3KA 2ZBBA 1YMXA 1ZC2A 3DTMA 2XA7M 3T1XA 4WL9A 1XJ4A 1CEFA 4RVAA 5HDDA 4CPKA 1FILA 1T1CA 1W63M 3CWFA 3C38A 5DTSA 5F1FA 3MQQA 2JKTM 2GX5A 3MQOA 1A0KA 1YMSA 4K0XA 1BLPA 3HBRA 4HJ6A 5CRFA 2OLVA 2XFTA 3BQAA 5F5YA 2ZLYA 2P9VB 5GL9A 2DRWA 2OLUA 3FPWA 3MXRA 2VGLM 4OVDA 3DTKA 3FZCA 2A24B 3G31A 4I3AA 4PMAA 4WF0A 1UWNX 1PZOA 3PBRA 3ZCZA 2XLNA 3D3OA 4EQ1A 1TS6A 5CTMA 2XD5A 3QNCA 5CHUA 1YSQA 4DE1A 3D9YA 2P74A 2GDNA 2ZQ8A 3LIEA 2BASA 5FAQA 4MBHA 2GJ3A 2HDUA 3N6IA 1BLCA 4P6ZM 1MY8A 1ES4A 4CJNA 1KOUA 4YOFA 2HDRA 3HLWA 4OONA 1F98A 2LB5A 4CLCE 1OTBA 3GV9A 4UAAA 1AWIA 4DE2A 1HD8A 3CUEC 3EGDC 4I5SA 3DBAA 2V1AA
chains in the Genus database with same CATH topology
2JC7A 1BULA 4MLLA 4PPRA 3C7UA 1U60A 3IXHA 4OLDA 2VGJA 4BQMA 5FI6A 4ZJ2A 3VMAA 2EFUA 3A3EA 1H8ZA 3JYIA 4PM9A 1RGYA 4E3IA 4OQGA 4ZDXA 4PM6A 1FSWA 4E3LA 1K54A 3Q7VB 4PM7A 2H0TA 4DRTA 1GHPA 3V3SA 1LHYA 5FQMA 4K91A 4EBPA 1CI8A 1KE0A 5E2GA 3VSLA 4Y0TA 2XF3A 1SCWA 1DJAA 2Z2LB 3WRZA 3V3RA 4B4ZA 1WYCA 4OPYA 1M40A 3GRJA 4WZ5C 4GNUA 1YLJA 3C4PA 4E3MA 4PM5A 1PI5A 4QY6A 4BD0A 5U47A 4UA9A 1PIOA 2P9VA 3OPHA 4FSFA 4NETA 3HVFA 2ZQ9A 4S2OA 4S2MA 5FI7A 1LL5A 4BJPA 4HBTA 1K6SA 2Q9NA 1QMFA 1XKZA 3IT9A 4MNRA 3N8SA 1WE4A 3ISGA 2ZM2A 1L0FA 1FCOA 2PBYA 5EE8A 4WMCA 5FQQA 1ESIA 4S2NC 2OV5A 1L0EA 2WAFA 2WZXA 4R1GA 4Z9QA 4R4SA 4E3NA 3EQUA 1KGGA 2WAEA 1RP5A 2Y2OA 2Y2NA 3SH8A 4R3BA 2JBFA 5FQJA 4WEKA 1HTZA 3RJUA 2V2FF 1GA9A 1XA1A 3G32A 5E43A 1IYQA 4M3KA 1JWPA 1PW1A 4OH0A 2ZMAA 4X55A 1WYBA 4ZAMA 4ZBEA 2EX2A 4GB7A 1ZG4A 3UPPA 3IF6C 5L2FA 2HDQA 4FCFA 4Y0OA 4S2PA 3Q7ZA 5CXWA 1TDGA 2XGNA 4N92A 1L0GA 4BENA 4ZJ3A 3HLDA 3OPPA 5D3OA 4R4RA 4IEDA 1H5XA 4U0TA 3VFFA 4B88A 4RYEA 1XGIA 3AGEA 3FYZA 4RX2A 5IHVA 5A92A 2J7VA 3VSKA 5EPHA 2G2WA 1W8YA 2WKHA 2J9PA 2QMIA 4GN2A 2I72A 3ZFZA 1J9MA 1W8QA 1AXBA 4OOMA 4QU3A 4KZ5A 1Q2QA 2H5SA 3O86A 4HBUA 5M18A 1BLSA 5KZHA 1I2WA 3ZG8B 3NIAA 2Y2HA 5KSHA 2Y2KA 4KG6A 3NDGA 3IHAA 5CHMA 2JCHA 3MZFA 3A3DA 3VP4A 5A93A 1DJCA 1MWTA 2ZQDA 1BLHA 1BZAA 3IXGA 1ZG6A 3A3FA 4MBFA 3UDFA 4E6XA 5HW3A 3S4XA 2J9OA 3AGDA 5AQBA 5G18A 2IWCA 3V5MA 1XGJA 2WKEA 3PBSA 4OQIA 2X01A 3HLFA 3O87A 2X71A 2HP9A 1NZOA 3LEZA 2UWXA 5EVIA 1K55C 3ZVTA 4FH4A 4RA7A 4IVIA 4KZ6A 4WEJA 2ZC3B 1S6RA 2Y4AA 3AGFA 3A3IA 3NCKA 4KG2A 4OKPA 2Y55A 4OQHA 4XUZA 3N8LA 2EFXA 1ES2A 4GZBA 4XUXA 3QHYA 1BUEA 2PU4A 4OP5A 2RL3A 3W4OA 3IQAA 1G68A 1ONGA 4BLMA 1KGEA 3HLBA 1Q2PA 3HLCA 4X53A 4KQOA 1BTLA 3MZEA 5EVLA 1RGZA 1K56D 3Q07A 5DF8A 3IWQA 1FSYA 4UA6A 5GLBA 3G2YA 3BRMA 3PBOA 4QY5A 3UPNA 1KVMA 2ZD8A 3G2ZA 1EROA 4DDYA 3IF5A 1DY6A 5EOOA 4R23A 1O7EA 3VP1A 2JE5A 3O3VA 3IWIA 1E3UD 1K38A 1NZUA 3E2KA 3GQZA 2DCFA 4GDBA 4OPQA 2H10A 3SS3A 4P87A 3CJMA 4JXSA 4KZ9A 3HUMA 3HUOA 1YM1A 3PBNA 1K57A 3GVBA 5FAPA 5CERA 2XFSA 3WS0A 5TFQA 2A3UA 3V50A 2WADA 4N1HA 1FOFA 3E2LA 1XP4A 4K0WA 4HEFA 4N9KA 1M6KA 2WGIA 4KZ8A 3WWXA 4EV4A 1SDNA 2QPNA 1FCMA 4DF6A 3FKWA 1JTGA 2ZQCA 4BD1A 2Z2MB 4ZTKA 4JLFA 2BG1A 3BFFA 4KZ4A 4EBLA 3NY4A 3VOYA 3GR2A 1LL9A 3ZHHA 1E4DA 5HX9A 2XQZA 5CTNA 3UDIA 3IF6B 4JPMA 3SS4A 3ZNYA 3IH8A 3MBZA 4OPZA 2R9WA 5GHYA 1YLYA 3ZVWA 5CHJA 4OPRA 4EBNA 1PWCA 4MEZA 4P0MA 3MKEA 3WRTA 3WS5A 5HFOA 3LY3A 4P85A 1XPBA 1LLBA 4QHCA 1GHIA 1KDSA 1O07A 2XEPA 3OZHA 2DNSA 5GHZA 4Y7PA 3HREA 3OCNA 1N4OA 1K4FA 4WMCD 3SS5A 2EX6A 2Y2MA 3FV7A 4LCMA 3ZG9B 5GHXA 5EUAA 2IWDA 5A91A 1ERQA 4QJGA 5EOEA 4WELA 2Y91A 1FR1A 2XK1A 4GDNA 3UO9A 2VGKA 4DXBA 1BSGA 5DF7A 1HVBA 1NRFA 2C6WB 5FI2A 3IWOA 4E3JA 5AQ9A 1KGFA 2CC1A 3IHBA 2WGWA 3EQVA 1IELA 5E2EA 1IYPA 1IEMA 2HP5A 5FQ9A 1XX2A 3PAGA 4KENB 3ZG0A 1TVFA 2HPBA 5FATA 1FQGA 3ITAA 4LV2A 2X02A 2XH9A 3O88A 5I94A 3C4OA 3OPLA 4L0LA 4WYYA 2V20A 3N4IA 5E2FA 1YLZA 3D4FA 4JXGA 3UDXA 4OOLA 1K54C 1PW8A 2XDMA 2ZJ9A 4LCLA 1N9BA 5M1AA 3ZGAB 2ZC4B 2Y2QA 4C3QA 1YLTA 3MZDA 4KZAA 4U3TA 3RXWA 4OQ0A 4FD8A 3WS4A 4KZ7A 3I7JA 1PWGA 3WS2A 3RXXA 2ZQ7A 1ALQA 2EX9A 5A90A 1ES5A 1GHMA 4FH2A 1FCNA 1MWUA 3UE1A 1G6AA 4LV1A 4WZ5A 5CEDA 2XD1A 3M6BA 3Q81A 4ZJ1A 2PU2A 3BYDA 1C3BA 2J8YA 4GKUA 4ID4A 3VP2A 2ZM8A 1XA7A 1PZPA 3LCEA 1ES3A 3GTCA 3DW0A 1GA0A 3DWKA 3QNBA 5FSRA 3M2JA 3FKVA 5HAPA 3TOIA 5GLCA 4X68A 5TGFA 3BLMA 1ESUA 4S2NA 5EVID 1S0WA 1L0DA 2B5RA 3Q7VA 4X69A 3ZG7B 4A5RA 1QMEA 3BFCA 5JYOA 3VP3A 4Q8IA 3ZDJA 1ZKJA 2QZ6A 3BFDA 1TEMA 1IYOA 3G30A 1Y54A 3BEBA 3M6HA 1OMEA 3SH9A 3W8KA 3ZNTA 5M19A 4S2KA 1XXMA 1KE4A 2ZC6B 4JF4A 4UHUA 3NBLA 3BM6A 3IF6A 5KMWA 4GOGA 4D2OA 5J8XA 4RX3A 1LI0A 1MKIA 3M2KA 4S2JA 3G4PA 4IVKA 4S2LA 1Z6FA 4WZ4A 3N7WA 4JF5A 3W4PA 4BL3A 3C7VA 1NYYA 5CGWA 4E6WA 4O7DA 1LI9A 1NJ4A 3PAEA 3ZG5A 1KE3A 3UE0A 4JXWA 4YFMA 1I2SA 1K25A 1W5DA 2WKIA 5EVIB 3W4QA 2C5WB 5JYPA 1W79A 1ONHA 1CI9A 1MWRA 3N8RA 3VP0A 3G34A 3UPOA 4EQIA 1DJBA 4LV0A 4B4XA 2BLSA 4N1XA 3HL9A 2WZZA 4R3JA 1SDEA 4N9LA 1NXYA 3CMZA 1PI4A 4X56A 5HAQA 1SKFA 4DDSA 1MWSA 3WS1A 2WK0A 3IH9A 4QB8A 3UE3A 3V39A 4E3KA 1KVLA 3FWLA 1EI5A 1IKGA 4WM9A 1YT4A 4NK3A 4JF6A 2ZM0A 5E2HA 1YMXA 5FA7A 1JTDA 1ZC2A 2WGVA 3DTMA 1EWZA 3MKFA 2EXBA 2ZC5B 4KZ3A 1CEFA 5EVIC 2XR0A 2RCXA 4RVAA 4CPKA 3G35A 1K55A 2HDSA 1I5QA 5DTSA 3IXDA 5F1FA 2ZQAA 1JWVA 3OC2A 3A3JA 3BFGA 4DXCA 2Y2LA 4IBRA 2Y2IA 3BLSA 3NDEA 2E8IA 4YINA 4OOYA 4E3OA 4KQQA 5AQAA 5HARA 1CEGA 3B3XA 5FQKA 5F1GA 1SHVA 1YMSA 5FDHA 4DKIA 1FR6A 4K0XA 4LV3A 1BLPA 3P98A 3Q82A 3BFEA 2Y59A 4H8RA 5F82A 3HBRA 5CRFA 5FAOA 5CEBA 2OSUA 3S22A 2OLVA 2XFTA 3MFDA 3NC8A 2H0YA 4Y0UA 3CZDA 2ZLYA 2P9VB 2G2UA 3C5AA 4KG5A 1PYYA 5GL9A 2V1ZA 1VQQA 4JKTA 4MBKA 3VOZA 5BOHA 2DRWA 2OLUA 1L2SA 1MPLA 1YQSA 3OCLA 1IYSA 1MBLA 5GLAA 3SOIA 1YLWA 3MXRA 1K57C 4S2IA 3OPRA 1NYMA 3HLGA 5CECA 4DE0A 4OVDA 3FZCA 4X6TA 1RCJA 5FASA 3SH7A 5HAIA 1CK3A 3G31A 3LO7A 3TG9A 4JBFA 4PMAA 4GD8A 2Q9MA 1IKIA 2IWBA 1BT5A 3S1YA 1E25A 1JVJA 1PZOA 2Y2PA 3BECA 3LY4A 1ERMA 3PBRA 3PBTA 3ZCZA 2XLNA 5DF9A 1JWZA 3PTEA 4C75A 4EWFA 5CTMA 4BL2A 3GSGA 4HESA 2XD5A 2EX8A 4WBGA 3QNCA 1VM1A 1TDLA 3CG5A 3HLEA 3TSGA 5CHUA 5KSCA 2Y2GA 2EXAA 5HL1A 4DE1A 3UY6A 4F94A 3ITBA 3GMWA 3Q1FA 4KZBA 2P74A 2GDNA 3UNWA 1MXOA 2ZQ8A 4OLGA 5DVAA 2FFFB 4IBXA 5FAQA 3UN7A 4MBHA 5CGXA 2HDUA 1GCEA 2HP6A 3IXBA 3VFHA 4JXVA 4P6BA 4GD6A 5FQIA 1KDWA 5CGSA 3HUNA 3N6IA 5F83A 5GLDA 2ZC7A 1BLCA 4XXRA 1MY8A 2WGWB 1ES4A 2WUQA 4CJNA 5AQ7A 1W7FA 5EECA 2Y2JA 1PWDA 2HDRA 4U0XA 3HLWA 4DE3A 3PBQA 5TR7A 4OONA 1K56A 1K6RA 4KQRA 4LENA 4PM8A 1YLPA 5DTKA 4OP8A 5DTTA 3MXSA 4QD4A 1NY0A 4EUZA 3GV9A 1K4EA 3P09A 4R0QA 4C6YA 4UAAA 2WYXA 1H8YA 2A49A 3NI9A 2FFYA 1HD8A 4DE2A 4UA7A 1HZOA 1E3UA 3DWZA 2R9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC7 A;  1BUL A;  4MLL A;  4PPR A;  3C7U A;  1U60 A;  3IXH A;  4OLD A;  2VGJ A;  4BQM A;  5FI6 A;  4ZJ2 A;  3VMA A;  2EFU A;  3A3E A;  1H8Z A;  3JYI A;  4PM9 A;  1RGY A;  4E3I A;  4OQG A;  4ZDX A;  4PM6 A;  1FSW A;  4E3L A;  1K54 A;  3Q7V B;  4PM7 A;  2H0T A;  4DRT A;  1GHP A;  3V3S A;  1LHY A;  5FQM A;  4K91 A;  4EBP A;  1CI8 A;  1KE0 A;  5E2G A;  3VSL A;  4Y0T A;  2XF3 A;  1SCW A;  1DJA A;  2Z2L B;  3WRZ A;  3V3R A;  4B4Z A;  1WYC A;  4OPY A;  1M40 A;  3GRJ A;  4WZ5 C;  4GNU A;  1YLJ A;  3C4P A;  4E3M A;  4PM5 A;  1PI5 A;  4QY6 A;  4BD0 A;  5U47 A;  4UA9 A;  1PIO A;  2P9V A;  3OPH A;  4FSF A;  4NET A;  3HVF A;  2ZQ9 A;  4S2O A;  4S2M A;  5FI7 A;  1LL5 A;  4BJP A;  4HBT A;  1K6S A;  2Q9N A;  1QMF A;  1XKZ A;  3IT9 A;  4MNR A;  3N8S A;  1WE4 A;  3ISG A;  2ZM2 A;  1L0F A;  1FCO A;  2PBY A;  5EE8 A;  4WMC A;  5FQQ A;  1ESI A;  4S2N C;  2OV5 A;  1L0E A;  2WAF A;  2WZX A;  4R1G A;  4Z9Q A;  4R4S A;  4E3N A;  3EQU A;  1KGG A;  2WAE A;  1RP5 A;  2Y2O A;  2Y2N A;  3SH8 A;  4R3B A;  2JBF A;  5FQJ A;  4WEK A;  1HTZ A;  3RJU A;  2V2F F;  1GA9 A;  1XA1 A;  3G32 A;  5E43 A;  1IYQ A;  4M3K A;  1JWP A;  1PW1 A;  4OH0 A;  2ZMA A;  4X55 A;  1WYB A;  4ZAM A;  4ZBE A;  2EX2 A;  4GB7 A;  1ZG4 A;  3UPP A;  3IF6 C;  5L2F A;  2HDQ A;  4FCF A;  4Y0O A;  4S2P A;  3Q7Z A;  5CXW A;  1TDG A;  2XGN A;  4N92 A;  1L0G A;  4BEN A;  4ZJ3 A;  3HLD A;  3OPP A;  5D3O A;  4R4R A;  4IED A;  1H5X A;  4U0T A;  3VFF A;  4B88 A;  4RYE A;  1XGI A;  3AGE A;  3FYZ A;  4RX2 A;  5IHV A;  5A92 A;  2J7V A;  3VSK A;  5EPH A;  2G2W A;  1W8Y A;  2WKH A;  2J9P A;  2QMI A;  4GN2 A;  2I72 A;  3ZFZ A;  1J9M A;  1W8Q A;  1AXB A;  4OOM A;  4QU3 A;  4KZ5 A;  1Q2Q A;  2H5S A;  3O86 A;  4HBU A;  5M18 A;  1BLS A;  5KZH A;  1I2W A;  3ZG8 B;  3NIA A;  2Y2H A;  5KSH A;  2Y2K A;  4KG6 A;  3NDG A;  3IHA A;  5CHM A;  2JCH A;  3MZF A;  3A3D A;  3VP4 A;  5A93 A;  1DJC A;  1MWT A;  2ZQD A;  1BLH A;  1BZA A;  3IXG A;  1ZG6 A;  3A3F A;  4MBF A;  3UDF A;  4E6X A;  5HW3 A;  3S4X A;  2J9O A;  3AGD A;  5AQB A;  5G18 A;  2IWC A;  3V5M A;  1XGJ A;  2WKE A;  3PBS A;  4OQI A;  2X01 A;  3HLF A;  3O87 A;  2X71 A;  2HP9 A;  1NZO A;  3LEZ A;  2UWX A;  5EVI A;  1K55 C;  3ZVT A;  4FH4 A;  4RA7 A;  4IVI A;  4KZ6 A;  4WEJ A;  2ZC3 B;  1S6R A;  2Y4A A;  3AGF A;  3A3I A;  3NCK A;  4KG2 A;  4OKP A;  2Y55 A;  4OQH A;  4XUZ A;  3N8L A;  2EFX A;  1ES2 A;  4GZB A;  4XUX A;  3QHY A;  1BUE A;  2PU4 A;  4OP5 A;  2RL3 A;  3W4O A;  3IQA A;  1G68 A;  1ONG A;  4BLM A;  1KGE A;  3HLB A;  1Q2P A;  3HLC A;  4X53 A;  4KQO A;  1BTL A;  3MZE A;  5EVL A;  1RGZ A;  1K56 D;  3Q07 A;  5DF8 A;  3IWQ A;  1FSY A;  4UA6 A;  5GLB A;  3G2Y A;  3BRM A;  3PBO A;  4QY5 A;  3UPN A;  1KVM A;  2ZD8 A;  3G2Z A;  1ERO A;  4DDY A;  3IF5 A;  1DY6 A;  5EOO A;  4R23 A;  1O7E A;  3VP1 A;  2JE5 A;  3O3V A;  3IWI A;  1E3U D;  1K38 A;  1NZU A;  3E2K A;  3GQZ A;  2DCF A;  4GDB A;  4OPQ A;  2H10 A;  3SS3 A;  4P87 A;  3CJM A;  4JXS A;  4KZ9 A;  3HUM A;  3HUO A;  1YM1 A;  3PBN A;  1K57 A;  3GVB A;  5FAP A;  5CER A;  2XFS A;  3WS0 A;  5TFQ A;  2A3U A;  3V50 A;  2WAD A;  4N1H A;  1FOF A;  3E2L A;  1XP4 A;  4K0W A;  4HEF A;  4N9K A;  1M6K A;  2WGI A;  4KZ8 A;  3WWX A;  4EV4 A;  1SDN A;  2QPN A;  1FCM A;  4DF6 A;  3FKW A;  1JTG A;  2ZQC A;  4BD1 A;  2Z2M B;  4ZTK A;  4JLF A;  2BG1 A;  3BFF A;  4KZ4 A;  4EBL A;  3NY4 A;  3VOY A;  3GR2 A;  1LL9 A;  3ZHH A;  1E4D A;  5HX9 A;  2XQZ A;  5CTN A;  3UDI A;  3IF6 B;  4JPM A;  3SS4 A;  3ZNY A;  3IH8 A;  3MBZ A;  4OPZ A;  2R9W A;  5GHY A;  1YLY A;  3ZVW A;  5CHJ A;  4OPR A;  4EBN A;  1PWC A;  4MEZ A;  4P0M A;  3MKE A;  3WRT A;  3WS5 A;  5HFO A;  3LY3 A;  4P85 A;  1XPB A;  1LLB A;  4QHC A;  1GHI A;  1KDS A;  1O07 A;  2XEP A;  3OZH A;  2DNS A;  5GHZ A;  4Y7P A;  3HRE A;  3OCN A;  1N4O A;  1K4F A;  4WMC D;  3SS5 A;  2EX6 A;  2Y2M A;  3FV7 A;  4LCM A;  3ZG9 B;  5GHX A;  5EUA A;  2IWD A;  5A91 A;  1ERQ A;  4QJG A;  5EOE A;  4WEL A;  2Y91 A;  1FR1 A;  2XK1 A;  4GDN A;  3UO9 A;  2VGK A;  4DXB A;  1BSG A;  5DF7 A;  1HVB A;  1NRF A;  2C6W B;  5FI2 A;  3IWO A;  4E3J A;  5AQ9 A;  1KGF A;  2CC1 A;  3IHB A;  2WGW A;  3EQV A;  1IEL A;  5E2E A;  1IYP A;  1IEM A;  2HP5 A;  5FQ9 A;  1XX2 A;  3PAG A;  4KEN B;  3ZG0 A;  1TVF A;  2HPB A;  5FAT A;  1FQG A;  3ITA A;  4LV2 A;  2X02 A;  2XH9 A;  3O88 A;  5I94 A;  3C4O A;  3OPL A;  4L0L A;  4WYY A;  2V20 A;  3N4I A;  5E2F A;  1YLZ A;  3D4F A;  4JXG A;  3UDX A;  4OOL A;  1K54 C;  1PW8 A;  2XDM A;  2ZJ9 A;  4LCL A;  1N9B A;  5M1A A;  3ZGA B;  2ZC4 B;  2Y2Q A;  4C3Q A;  1YLT A;  3MZD A;  4KZA A;  4U3T A;  3RXW A;  4OQ0 A;  4FD8 A;  3WS4 A;  4KZ7 A;  3I7J A;  1PWG A;  3WS2 A;  3RXX A;  2ZQ7 A;  1ALQ A;  2EX9 A;  5A90 A;  1ES5 A;  1GHM A;  4FH2 A;  1FCN A;  1MWU A;  3UE1 A;  1G6A A;  4LV1 A;  4WZ5 A;  5CED A;  2XD1 A;  3M6B A;  3Q81 A;  4ZJ1 A;  2PU2 A;  3BYD A;  1C3B A;  2J8Y A;  4GKU A;  4ID4 A;  3VP2 A;  2ZM8 A;  1XA7 A;  1PZP A;  3LCE A;  1ES3 A;  3GTC A;  3DW0 A;  1GA0 A;  3DWK A;  3QNB A;  5FSR A;  3M2J A;  3FKV A;  5HAP A;  3TOI A;  5GLC A;  4X68 A;  5TGF A;  3BLM A;  1ESU A;  4S2N A;  5EVI D;  1S0W A;  1L0D A;  2B5R A;  3Q7V A;  4X69 A;  3ZG7 B;  4A5R A;  1QME A;  3BFC A;  5JYO A;  3VP3 A;  4Q8I A;  3ZDJ A;  1ZKJ A;  2QZ6 A;  3BFD A;  1TEM A;  1IYO A;  3G30 A;  1Y54 A;  3BEB A;  3M6H A;  1OME A;  3SH9 A;  3W8K A;  3ZNT A;  5M19 A;  4S2K A;  1XXM A;  1KE4 A;  2ZC6 B;  4JF4 A;  4UHU A;  3NBL A;  3BM6 A;  3IF6 A;  5KMW A;  4GOG A;  4D2O A;  5J8X A;  4RX3 A;  1LI0 A;  1MKI A;  3M2K A;  4S2J A;  3G4P A;  4IVK A;  4S2L A;  1Z6F A;  4WZ4 A;  3N7W A;  4JF5 A;  3W4P A;  4BL3 A;  3C7V A;  1NYY A;  5CGW A;  4E6W A;  4O7D A;  1LI9 A;  1NJ4 A;  3PAE A;  3ZG5 A;  1KE3 A;  3UE0 A;  4JXW A;  4YFM A;  1I2S A;  1K25 A;  1W5D A;  2WKI A;  5EVI B;  3W4Q A;  2C5W B;  5JYP A;  1W79 A;  1ONH A;  1CI9 A;  1MWR A;  3N8R A;  3VP0 A;  3G34 A;  3UPO A;  4EQI A;  1DJB A;  4LV0 A;  4B4X A;  2BLS A;  4N1X A;  3HL9 A;  2WZZ A;  4R3J A;  1SDE A;  4N9L A;  1NXY A;  3CMZ A;  1PI4 A;  4X56 A;  5HAQ A;  1SKF A;  4DDS A;  1MWS A;  3WS1 A;  2WK0 A;  3IH9 A;  4QB8 A;  3UE3 A;  3V39 A;  4E3K A;  1KVL A;  3FWL A;  1EI5 A;  1IKG A;  4WM9 A;  1YT4 A;  4NK3 A;  4JF6 A;  2ZM0 A;  5E2H A;  1YMX A;  5FA7 A;  1JTD A;  1ZC2 A;  2WGV A;  3DTM A;  1EWZ A;  3MKF A;  2EXB A;  2ZC5 B;  4KZ3 A;  1CEF A;  5EVI C;  2XR0 A;  2RCX A;  4RVA A;  4CPK A;  3G35 A;  1K55 A;  2HDS A;  1I5Q A;  5DTS A;  3IXD A;  5F1F A;  2ZQA A;  1JWV A;  3OC2 A;  3A3J A;  3BFG A;  4DXC A;  2Y2L A;  4IBR A;  2Y2I A;  3BLS A;  3NDE A;  2E8I A;  4YIN A;  4OOY A;  4E3O A;  4KQQ A;  5AQA A;  5HAR A;  1CEG A;  3B3X A;  5FQK A;  5F1G A;  1SHV A;  1YMS A;  5FDH A;  4DKI A;  1FR6 A;  4K0X A;  4LV3 A;  1BLP A;  3P98 A;  3Q82 A;  3BFE A;  2Y59 A;  4H8R A;  5F82 A;  3HBR A;  5CRF A;  5FAO A;  5CEB A;  2OSU A;  3S22 A;  2OLV A;  2XFT A;  3MFD A;  3NC8 A;  2H0Y A;  4Y0U A;  3CZD A;  2ZLY A;  2P9V B;  2G2U A;  3C5A A;  4KG5 A;  1PYY A;  5GL9 A;  2V1Z A;  1VQQ A;  4JKT A;  4MBK A;  3VOZ A;  5BOH A;  2DRW A;  2OLU A;  1L2S A;  1MPL A;  1YQS A;  3OCL A;  1IYS A;  1MBL A;  5GLA A;  3SOI A;  1YLW A;  3MXR A;  1K57 C;  4S2I A;  3OPR A;  1NYM A;  3HLG A;  5CEC A;  4DE0 A;  4OVD A;  3FZC A;  4X6T A;  1RCJ A;  5FAS A;  3SH7 A;  5HAI A;  1CK3 A;  3G31 A;  3LO7 A;  3TG9 A;  4JBF A;  4PMA A;  4GD8 A;  2Q9M A;  1IKI A;  2IWB A;  1BT5 A;  3S1Y A;  1E25 A;  1JVJ A;  1PZO A;  2Y2P A;  3BEC A;  3LY4 A;  1ERM A;  3PBR A;  3PBT A;  3ZCZ A;  2XLN A;  5DF9 A;  1JWZ A;  3PTE A;  4C75 A;  4EWF A;  5CTM A;  4BL2 A;  3GSG A;  4HES A;  2XD5 A;  2EX8 A;  4WBG A;  3QNC A;  1VM1 A;  1TDL A;  3CG5 A;  3HLE A;  3TSG A;  5CHU A;  5KSC A;  2Y2G A;  2EXA A;  5HL1 A;  4DE1 A;  3UY6 A;  4F94 A;  3ITB A;  3GMW A;  3Q1F A;  4KZB A;  2P74 A;  2GDN A;  3UNW A;  1MXO A;  2ZQ8 A;  4OLG A;  5DVA A;  2FFF B;  4IBX A;  5FAQ A;  3UN7 A;  4MBH A;  5CGX A;  2HDU A;  1GCE A;  2HP6 A;  3IXB A;  3VFH A;  4JXV A;  4P6B A;  4GD6 A;  5FQI A;  1KDW A;  5CGS A;  3HUN A;  3N6I A;  5F83 A;  5GLD A;  2ZC7 A;  1BLC A;  4XXR A;  1MY8 A;  2WGW B;  1ES4 A;  2WUQ A;  4CJN A;  5AQ7 A;  1W7F A;  5EEC A;  2Y2J A;  1PWD A;  2HDR A;  4U0X A;  3HLW A;  4DE3 A;  3PBQ A;  5TR7 A;  4OON A;  1K56 A;  1K6R A;  4KQR A;  4LEN A;  4PM8 A;  1YLP A;  5DTK A;  4OP8 A;  5DTT A;  3MXS A;  4QD4 A;  1NY0 A;  4EUZ A;  3GV9 A;  1K4E A;  3P09 A;  4R0Q A;  4C6Y A;  4UAA A;  2WYX A;  1H8Y A;  2A49 A;  3NI9 A;  2FFY A;  1HD8 A;  4DE2 A;  4UA7 A;  1HZO A;  1E3U A;  3DWZ A;  2R9X A; 
#chains in the Genus database with same CATH topology
 3MQ0 A;  3F1P B;  5FEF A;  2O0Y A;  1BUL A;  3PYP A;  2L1M A;  1P97 A;  2YKH A;  3H82 B;  4PPR A;  5EVE A;  5LBR A;  1U60 A;  3E4Q A;  5FI6 A;  2V0U A;  4Y15 A;  3R7W A;  3VMA A;  3A3E A;  4HP4 A;  3JYI A;  4PM9 A;  2V9A A;  4OQG A;  3BQ8 A;  3LUQ A;  4PM6 A;  5TBM B;  1L3L A;  3IBJ A;  4E3L A;  1K54 A;  3UME A;  3DAV A;  2H0T A;  4ARZ A;  1KE0 A;  3K2N A;  3C4P A;  5U47 A;  4S2M A;  4NKP A;  4F3L B;  4BJP A;  2Q9N A;  1N9O A;  2ZM2 A;  1FCO A;  2PBY A;  3BWL A;  4WMC A;  2VZW A;  4WLA A;  2WZX A;  4R1G A;  3C8C A;  3EQU A;  1KGG A;  1RP5 A;  3SH8 A;  2JBF A;  2Q0O A;  1XFN A;  1GA9 A;  3MJQ A;  4ZAM A;  1IYQ A;  1WYB A;  3F1N B;  1XJ6 A;  3ULF A;  4FCF A;  3Q7Z A;  2XGN A;  4N92 A;  3S7P A;  3VFF A;  4RYE A;  3AGE A;  2JKT I;  1ODV A;  2FZ0 A;  1YKD A;  2G2W A;  1LSW A;  2J9P A;  4Q0H A;  1P9W A;  2QYB A;  1W8Q A;  4QU3 A;  4OOM A;  5HWV A;  2W1T B;  1I2W A;  3NIA A;  5L09 A;  4KG6 A;  1OTE A;  2JKF A;  3MZF A;  1TF1 A;  3ZQ5 A;  1NLZ A;  5G4Y A;  4E6X A;  1ZG6 A;  3A3F A;  3UDF A;  2XSS A;  3AGD A;  4BBT A;  2WKE A;  2X01 A;  2O9B A;  4FH4 A;  4WEJ A;  1S6R A;  3AGF A;  4XUZ A;  2KOI A;  3RTY A;  3N8L A;  4XUX A;  1ES2 A;  2JN7 A;  1KGE A;  3HLB A;  1Q2P A;  3HLC A;  4X53 A;  4KQO A;  4B93 A;  2JKR I;  3IWQ A;  4UA6 A;  5GLB A;  3G2Y A;  3UPN A;  3TRC A;  3LYX A;  1NRJ A;  1O7E A;  4X1M A;  3VP1 A;  3CPT A;  2JE5 A;  2OAQ 1;  1E3U D;  1K38 A;  3E2K A;  1ZHH B;  4R6L A;  2H10 A;  4JXS A;  2HF6 A;  2HZ5 A;  5FAP A;  1D7E A;  1N9L A;  2XFS A;  3WS0 A;  2A3U A;  3E2L A;  4K0W A;  2WGI A;  3TJZ C;  3WWX A;  3T4T A;  2ZQC A;  4ZTK A;  3BFF A;  3VOY A;  3ZHH A;  2QWS A;  4P6Z S;  2XQZ A;  5CTN A;  3LIC A;  4JPM A;  2XRN A;  4MEZ A;  2V8F A;  3MKE A;  5HFO A;  4P85 A;  3LID A;  4QHC A;  3OCN A;  1K4F A;  4L9E A;  2EX6 A;  4LRZ E;  2V0W A;  4CLC B;  4KUK A;  3F1O A;  4QJG A;  1LL8 A;  5EOE A;  4WEL A;  1FR1 A;  4L9G A;  3JVV A;  4GDN A;  5DF7 A;  3VOL A;  2HJE A;  1HVB A;  2C6W B;  1D1J A;  4H6J B;  3KSF A;  1F9I A;  3EQV A;  4HI4 A;  1WA9 A;  4R70 A;  1IYP A;  2HP5 A;  4LV2 A;  2XH9 A;  3O88 A;  3C4O A;  1YLZ A;  4PKY A;  1K54 C;  1PW8 A;  1HLU P;  2ZC4 B;  2K31 A;  2J3W A;  1YLT A;  4C3Q A;  5DFY A;  4FD8 A;  3WS4 A;  2P08 A;  1PWG A;  3WS2 A;  2EX9 A;  4FH2 A;  1FCN A;  2XD1 A;  4ZJ1 A;  3VP2 A;  4ID4 A;  2ZM8 A;  1XA7 A;  1VB6 A;  1ES3 A;  3LI8 A;  2NUT C;  5FL3 A;  3TOI A;  5GLC A;  4S2N A;  3Q7V A;  4X69 A;  3ZG7 B;  4A5R A;  1QME A;  4HJ3 A;  5JYO A;  3VP3 A;  3ZDJ A;  3FPV A;  1TEM A;  1IYO A;  1Y54 A;  3BEB A;  3LIA A;  3W8K A;  4JF4 A;  4UEY A;  4UHU A;  5J7E A;  2Y79 A;  4II7 A;  4GOG A;  4D2O A;  4RX3 A;  4S2J A;  3G4P A;  4LRX C;  4S2L A;  3LGO A;  4WZ4 A;  3BW6 A;  4M4X A;  2B02 A;  4BL3 A;  4DJ3 A;  2M7U A;  4E6W A;  4O7D A;  3ZG5 A;  1NJ4 A;  1KE3 A;  1JNU A;  3KYQ A;  3QP2 A;  1K25 A;  3EWK A;  4O0P A;  5JYP A;  1ONH A;  1CI9 A;  4NXB A;  3UPO A;  3G34 A;  4B4X A;  3P7N A;  1S4R A;  4ETX A;  1PNE A;  4X56 A;  1Z09 A;  3CIT A;  1SKF A;  4B9O A;  3WS1 A;  2WK0 A;  3IH9 A;  1KVL A;  3S7N A;  1IKG A;  4WM9 A;  1YT4 A;  4JF6 A;  5E2H A;  2WGV A;  1EWZ A;  3MKF A;  2MJ6 A;  3LR0 A;  2XR0 A;  2HDS A;  3IXD A;  2ZQA A;  1H3Q A;  3A3J A;  3A0R A;  3BLS A;  3NDE A;  2E8I A;  4YIN A;  4OOY A;  4E3O A;  5HAR A;  1CEG A;  3A0S A;  5F1G A;  3R4K A;  2VV7 A;  4GHI A;  3MFD A;  1G5U A;  2H0Y A;  4Y0U A;  2VV8 A;  3CZD A;  3C5A A;  1SKO A;  1PYY A;  4JKT A;  3VOZ A;  2GZA A;  3SOI A;  3HLG A;  4DE0 A;  4MN7 A;  1RCJ A;  3SH7 A;  1CK3 A;  3LO7 A;  3TG9 A;  4GD8 A;  2B18 A;  1E25 A;  2PDR A;  3LY4 A;  1ERM A;  3PBT A;  3ICY A;  4EWF A;  3GSG A;  4HES A;  2J80 A;  4HQA A;  4WBG A;  3CG5 A;  3HLE A;  2OAP 1;  5HL1 A;  3UY6 A;  3ITB A;  4PAU A;  4KZB A;  1ACF A;  4ZRR A;  5DVA A;  2FFF B;  5CGX A;  2HP6 A;  4JXV A;  4GD6 A;  5FQI A;  1KDW A;  4GW9 A;  5CGS A;  2WGW B;  2Z6D A;  2WUQ A;  5AJG A;  1W7F A;  5EEC A;  2Y2J A;  3UB6 A;  2PT7 A;  1GSV A;  3PBQ A;  3C2W A;  5DTK A;  4PM8 A;  3MXS A;  1NY0 A;  3VE3 A;  2W3H A;  3P09 A;  4R0Q A;  3QP8 A;  4C6Y A;  1H8Y A;  2A49 A;  2FFY A;  4XT2 A;  1E3U A;  3E0Y A;  4MLL A;  1OTA A;  4EES A;  2WKQ A;  3IXH A;  3UMD A;  4BQM A;  5DJU A;  3QP4 A;  2EFU A;  5HD3 A;  1FSW A;  3NJA A;  2VEA A;  2ZMV A;  3LI9 A;  5FQM A;  3VSL A;  4Y0T A;  5DFX A;  3WRZ A;  1WYC A;  1YLJ A;  4E3M A;  4BD0 A;  4UA9 A;  2P9V A;  3OPH A;  4S2O A;  5AVF A;  4I38 A;  3PR6 A;  4QWO A;  1STZ A;  5EE8 A;  4S2N C;  2OV5 A;  2ZL1 B;  2A24 A;  1OT6 A;  1K0K A;  4Z9Q A;  1ZTU A;  3W2Z A;  2Y2N A;  4R3B A;  5FQJ A;  4WEK A;  1HTZ A;  3RJU A;  4OH0 A;  3LR5 A;  2EX2 A;  4S2P A;  1F2K A;  4MCW A;  4BEN A;  3HLD A;  3OPP A;  4PHT A;  3K3C A;  5IHV A;  1VEU B;  4IHQ A;  2I72 A;  5F69 A;  3T4Q A;  2H5S A;  3O86 A;  1BLS A;  3T1R A;  3U2A A;  1DP8 A;  3MMH A;  2J3T D;  3MS6 A;  2JCH A;  2JKR M;  3A3D A;  3VP4 A;  5A93 A;  1OPX A;  2P04 A;  1BLH A;  3IXG A;  3S4X A;  5AQB A;  1XGJ A;  4OQI A;  2HP9 A;  1NZO A;  3T12 B;  3KSG A;  3T4S A;  4RA7 A;  4KZ6 A;  2ZC3 B;  4KG2 A;  3NCK A;  3VP0 A;  3FG8 A;  3W4O A;  3EEH A;  3IQA A;  4BLM A;  3L9K A;  3MZE A;  5EVL A;  1FSY A;  3BRM A;  4QY5 A;  1ERO A;  4R38 A;  4DDY A;  1S1Y A;  1TS7 A;  5EOO A;  2ZOI A;  2K2N A;  3O3V A;  3IWI A;  4JGR A;  1NZU A;  4WN5 A;  2P7J A;  4YWZ A;  4P87 A;  1H0M A;  3A0V A;  1P9R A;  3S7Q A;  3DTE A;  3GVB A;  1T1A A;  5TFQ A;  4Y13 A;  2WAD A;  1FOF A;  1XP4 A;  3HJI A;  1M6K A;  4DF6 A;  3EOI A;  3FKW A;  4KQD A;  2Z2M B;  3NUL A;  3KYZ A;  2CMN A;  3F1N A;  3UDI A;  3IF6 B;  3ZNY A;  3IH8 A;  2PAV P;  2HJ9 C;  1YLY A;  4EBN A;  1PWC A;  4P0M A;  3WRT A;  3WS5 A;  3LY3 A;  5CX7 A;  1GHI A;  1O07 A;  2XEP A;  3BJN A;  4Y7P A;  1N4O A;  3SS5 A;  5GHX A;  1T19 A;  2W1T A;  3R7W B;  1ERQ A;  4ARZ B;  1MC0 A;  1BSG A;  5EM1 A;  1NRF A;  4E3J A;  4JGQ A;  1IEL A;  1YAX A;  3ZG0 A;  2HPB A;  5FAT A;  1FQG A;  5I94 A;  5HL6 A;  1VET A;  3N4I A;  3D4F A;  4JXG A;  4LCL A;  1N9B A;  1TS0 A;  5M1A A;  3ZGA B;  5L10 A;  3MZD A;  4U3T A;  3RXW A;  4KZ7 A;  3GEC A;  2ZMF A;  1XFQ A;  4GKU A;  4HNB A;  3LCE A;  3E4P A;  1GA0 A;  3FKV A;  1EW0 A;  5HAP A;  1T1B A;  4X68 A;  2VKS A;  5TGF A;  5EVI D;  2W27 A;  1J3W A;  3TW8 A;  5M19 A;  3ZNT A;  1VHM A;  2ZC6 B;  1UGU A;  3NBL A;  3VE4 A;  5J8X A;  1PFL A;  3M2K A;  3L7H A;  1Z6F A;  3N7W A;  4EXO A;  4JF5 A;  3OOV A;  3C7V A;  1G6O A;  3UE0 A;  1V9Z A;  1I2S A;  1W5D A;  3W4Q A;  2C5W B;  4HH3 A;  3N8R A;  1DJB A;  2INW A;  4BBU A;  2W3G A;  3IX8 A;  4EEU A;  4K08 A;  4N9L A;  1NXY A;  1H8M A;  1PI4 A;  1CQA A;  1OJG A;  5HAQ A;  5L07 A;  4X1L A;  3V39 A;  3FWL A;  2ZOH A;  3UB5 P;  2ZM0 A;  5FA7 A;  1JTD A;  2R78 A;  2EXB A;  2ZC5 B;  4KZ3 A;  1K55 A;  3IS2 A;  3FC7 A;  3OC2 A;  3MXQ A;  3BFG A;  3LIB A;  4DXC A;  2Y2L A;  4KQQ A;  5AQA A;  3B3X A;  5FQK A;  4DKI A;  1SHV A;  5FDH A;  3Q82 A;  4EW7 A;  2Y59 A;  2FH5 A;  5F82 A;  2OSU A;  3NC8 A;  1IFQ A;  1BYW A;  1CJF A;  5K5B A;  1TD5 A;  1TS8 A;  5BOH A;  5HPI A;  5GLA A;  1FIK A;  1YLW A;  4S2I A;  1NYM A;  1X0O A;  1S66 L;  3BY9 A;  5FAS A;  4JBF A;  1DP9 A;  2IWB A;  2Y8H A;  1JVJ A;  2Y2P A;  3BEC A;  4RQ9 A;  3NEC A;  5DKK A;  5DF9 A;  1JWZ A;  4BL2 A;  4GJ4 A;  3F1O B;  3TSG A;  1TDL A;  5KSC A;  2Y2G A;  2EXA A;  2YKF A;  4F94 A;  2M1C A;  3GMW A;  1UWP X;  3UNW A;  4IBX A;  3UN7 A;  1GCE A;  3VFH A;  5C5K A;  4P6B A;  2V1B A;  2ZC7 A;  4LFU A;  4GLQ A;  5AQ7 A;  4I39 A;  3E98 A;  4U0X A;  5TR7 A;  4MMN A;  2PYP A;  4Y2F A;  2GNX A;  4KQR A;  5DTT A;  4EUZ A;  4QD4 A;  1K4E A;  3NI9 A;  3IXB A;  3S7O A;  2JC7 A;  1F5M A;  3LFV A;  3T4L A;  2VGJ A;  3H7W A;  3G6O A;  1H8Z A;  1RGY A;  4E3I A;  2PR6 A;  4ZDX A;  4R3A A;  4QPR A;  3Q7V B;  4PM7 A;  4DRT A;  5MC7 A;  3QP1 A;  1CF0 A;  4K91 A;  4EBP A;  1CI8 A;  5E2G A;  2XF3 A;  3V3R A;  3GRJ A;  2VK3 A;  4QY6 A;  3TE8 A;  1LL5 A;  2L0W A;  3JPU A;  4HBT A;  1QMF A;  1XKZ A;  3IT9 A;  4MNR A;  1MKM A;  3N8S A;  1WE4 A;  4GS9 B;  1ESI A;  4DN0 A;  2WAF A;  4R4S A;  4E3N A;  4O8G A;  5DKL A;  2WAE A;  5HPF A;  2Y2O A;  3B47 A;  5HWW A;  2I9V A;  4I3I A;  1XA1 A;  4I3J A;  4IUH A;  3G32 A;  5E43 A;  4X55 A;  4M3K A;  1PW1 A;  4GB7 A;  5L2F A;  2HDQ A;  1TDG A;  4ZJ3 A;  5D3O A;  1H5X A;  4U0T A;  1XGI A;  3FYZ A;  3VSK A;  5EPH A;  3E4O A;  2WKH A;  2AVX A;  2QMI A;  2VJW A;  4IJG A;  1AXB A;  1Q2Q A;  4HBU A;  3ZG8 B;  4D60 A;  3T4O A;  2O9C A;  5KSH A;  1DJC A;  3KSI A;  1BZA A;  2J9O A;  1MZU A;  3OLO A;  5HSQ A;  2IWC A;  3O87 A;  2UWX A;  5EVI A;  1K55 C;  3ZVT A;  4OKP A;  3A3I A;  2Y55 A;  2KX6 A;  2EFX A;  4GZB A;  3QHY A;  1BUE A;  2PU4 A;  4OP5 A;  1G68 A;  1ONG A;  3B42 A;  3U4L P;  2PYR A;  2QJ5 A;  1BTL A;  3Q07 A;  1K56 D;  4HOI A;  1KVM A;  2ZD8 A;  4WUJ A;  1DY6 A;  3T1Q B;  3QP5 A;  4GDB A;  2DMW A;  4OPQ A;  3SS3 A;  3CJM A;  3PXP A;  1YM1 A;  3PBN A;  1K57 A;  5CER A;  3OBF A;  4CLC D;  2W3D A;  4N1H A;  2W3E A;  4N9K A;  4KZ8 A;  1SDN A;  1FCM A;  2J3T C;  2OWH A;  4JLF A;  4KZ4 A;  4EBL A;  4G3K A;  1LL9 A;  4Z1W A;  1E4D A;  4ME4 A;  4HHD A;  2OOL A;  3SS4 A;  3T4K A;  4OPZ A;  2R9W A;  1S1Z A;  5GHY A;  5CHJ A;  3P01 A;  4DMZ A;  1YSP A;  1GSX A;  1LLB A;  5F68 A;  1KDS A;  3OZH A;  5GHZ A;  3HRE A;  4O01 A;  3T4J A;  1VEU A;  1DP6 A;  1PRQ A;  2Y2M A;  3FV7 A;  4LPZ A;  5A91 A;  4MDZ A;  1OTI A;  2Y91 A;  3IX4 A;  3UO9 A;  1LT0 A;  4X25 A;  4DXB A;  4NXF A;  5FI2 A;  5AQ9 A;  4UQI M;  1P0Z A;  2CC1 A;  5DJT A;  4ETZ A;  3UB8 A;  3PAG A;  4KEN B;  5EV0 A;  1TVF A;  2A2L A;  4EU0 A;  3D72 A;  2Z6C A;  3OPL A;  4L0L A;  4E04 A;  2V20 A;  3UDX A;  2D02 A;  4OOL A;  2ZJ9 A;  1DRM A;  2HGV A;  4KZA A;  4OQ0 A;  4NEE D;  3K3D A;  3RXX A;  2ZQ7 A;  3F1P A;  1MWU A;  1G6A A;  4LV1 A;  4WZ5 A;  5CED A;  3M6B A;  3Q81 A;  3H82 A;  2W0N A;  2PU2 A;  3BYD A;  2J8Y A;  3VV4 A;  3DW0 A;  3QNB A;  3DWK A;  5FSR A;  5TBM A;  3RFB A;  3BLM A;  1ESU A;  2UV0 E;  1S0W A;  1L0D A;  2B5R A;  2HV1 A;  3BFD A;  2H28 A;  1OME A;  3SH9 A;  4S2K A;  1KE4 A;  5HDC A;  4YNR A;  3BM6 A;  3IF6 A;  4F3L A;  5KMW A;  3CI6 A;  1MKI A;  3EGX C;  1S67 L;  3UB9 A;  3W4P A;  2XRO A;  1OT9 A;  5CGW A;  1LI9 A;  1T18 A;  3JVU A;  4YFM A;  3MR0 A;  2L4R A;  1S4S A;  2BLS A;  3NOT C;  3RH8 B;  1YPR A;  2WZZ A;  4ESP A;  4MN6 A;  1SZV A;  2QKP A;  2K7S A;  4DDS A;  3LR4 A;  5HZH A;  4BWI A;  5AVE A;  1EI5 A;  3KYE A;  4NK3 A;  5IU1 A;  5EVI C;  5HD5 A;  2RCX A;  3G35 A;  4AFI A;  1I5Q A;  4MN5 A;  1JWV A;  4LGW A;  4IBR A;  2Y2I A;  2D01 A;  2B95 A;  2VX8 A;  1FR6 A;  4Y3I A;  4LV3 A;  3P98 A;  3BFE A;  4H8R A;  4CQH A;  5FAO A;  5CEB A;  3S22 A;  4KG5 A;  2G2U A;  2KDK A;  3BY8 A;  2V1Z A;  1VQQ A;  2EA9 A;  4MBK A;  1L2S A;  4GCZ A;  4L9F A;  1MPL A;  1YQS A;  3OCL A;  1IYS A;  1MBL A;  3IX3 A;  1K57 C;  3OPR A;  5CEC A;  4X6T A;  5KIZ A;  5HAI A;  2Q9M A;  1IKI A;  1BT5 A;  2JHE A;  2VLG A;  3S1Y A;  1G28 A;  3NOP C;  3PTE A;  4C75 A;  4G3W A;  4LLO B;  2EX8 A;  1VM1 A;  2XA7 S;  4KUO A;  3Q1F A;  5FDS A;  1MXO A;  4OLG A;  3HUN A;  5F83 A;  5GLD A;  4XXR A;  3LR3 A;  1PWD A;  4BMW A;  4DE3 A;  2W3F A;  4UQI S;  1K56 A;  1K6R A;  4LEN A;  1VET B;  1YLP A;  4OP8 A;  2V8C A;  2WYX A;  2PR5 A;  4UA7 A;  1HZO A;  3DWZ A;  2R9X A;  1D06 A;  3LEQ A;  4EEP A;  1LSV A;  3LIF A;  3UE6 A;  2VGL S;  5F6A A;  3C7U A;  4OLD A;  5A8B A;  4CLC A;  4ZJ2 A;  1N9N A;  3KX0 X;  5HWT A;  2QHK A;  3CHW P;  1GHP A;  3CAX A;  3V3S A;  1LHY A;  2PD8 A;  4H6J A;  1SCW A;  1DJA A;  2Z2L B;  5EM0 A;  5J3W A;  4HY8 A;  4B4Z A;  4OPY A;  1M40 A;  4WZ5 C;  4GNU A;  4PM5 A;  1PI5 A;  3CPT B;  1PIO A;  2M7V A;  4PKY G;  4FSF A;  4NET A;  3HVF A;  2ZQ9 A;  5FI7 A;  5FEG A;  5TJJ A;  3T50 A;  1K6S A;  3ISG A;  1L0F A;  5FQQ A;  1L0E A;  1LSX A;  3UB7 A;  2O99 A;  2WKP A;  2V2F F;  4EER A;  4NXG A;  1XJ3 A;  1JWP A;  2ZMA A;  4ZBE A;  1ZG4 A;  3UPP A;  3IF6 C;  2IA2 A;  2PRF A;  4Y0O A;  5CXW A;  1L0G A;  2JKG A;  4FUW A;  4R4R A;  4IED A;  4B88 A;  1OTD A;  1Y28 A;  3SW1 A;  4RX2 A;  5A92 A;  2J7V A;  1OJ5 A;  1W8Y A;  4GN2 A;  4FOF A;  3ZFZ A;  1J9M A;  4KZ5 A;  2O9A A;  4HP9 A;  2WKR A;  5M18 A;  3IS2 B;  5KZH A;  2Y2H A;  2Y2K A;  3NDG A;  3NHQ A;  3IHA A;  5CHM A;  5HDS A;  1MWT A;  2ZQD A;  2PHY A;  4MBF A;  5HW3 A;  5G18 A;  3V5M A;  2PD7 A;  3PBS A;  3HLF A;  2X71 A;  3ZYT A;  3LEZ A;  3NOU C;  4IVI A;  4EUV A;  2Y4A A;  4OQH A;  3T1S A;  5IS1 A;  2RL3 A;  4HIA A;  1RGZ A;  5DF8 A;  3V67 A;  3PBO A;  3G2Z A;  2KLI A;  3IF5 A;  4R23 A;  1NWZ A;  2EWW A;  3GQZ A;  2DCF A;  3MF0 A;  5IT5 A;  4KZ9 A;  3HUM A;  3HUO A;  4GS9 A;  4HJ4 A;  1V9Y A;  3V50 A;  3O5Y A;  4HEF A;  4EV4 A;  5L8M A;  2QPN A;  1JTG A;  2QJ7 A;  4BD1 A;  4G3V A;  2BG1 A;  3NY4 A;  3GR2 A;  4NXE A;  5HX9 A;  3H9W A;  4BBV A;  3MBZ A;  3ZVW A;  4OPR A;  1XPB A;  2OWJ A;  3EEA A;  2DNS A;  4WMC D;  1IOU A;  4LCM A;  3H7W B;  1Y4O A;  3ZG9 B;  5EUA A;  2IWD A;  2EWV A;  3GDI A;  2XK1 A;  3HCY A;  2VGK A;  3IBR A;  3CUE A;  5J4E A;  3IWO A;  3CLO A;  1KGF A;  4DJ2 A;  3IHB A;  1GSW A;  2WGW A;  4JGO A;  3HJK A;  2LB9 A;  5E2E A;  3B33 A;  4IUK A;  1IEM A;  2E8J A;  5FQ9 A;  1XX2 A;  4CLC C;  3ITA A;  5I5L A;  2X02 A;  3MSH A;  4WYY A;  2W1R A;  5E2F A;  2XDM A;  3KO6 A;  3MFX A;  4JGP A;  2Y2Q A;  3QP6 A;  3I7J A;  1ALQ A;  5A90 A;  4Q0I A;  1ES5 A;  1GHM A;  3UE1 A;  4GHI B;  1SKO B;  1C3B A;  5G4Z A;  1PZP A;  3GTC A;  3M2J A;  4EET B;  2ACG A;  2PBD P;  2VV6 A;  3BFC A;  4LRY C;  4Q8I A;  2BTF P;  1ZKJ A;  2QZ6 A;  3G30 A;  3M6H A;  3PHY A;  5EFW A;  1XXM A;  1XJ2 A;  3C30 A;  4FTX A;  4Y17 A;  1LI0 A;  3SZT A;  4IVK A;  4Q0J A;  3KSH A;  1W63 Q;  1NYY A;  2ZL1 A;  3PAE A;  2NUP C;  4JXW A;  2WKI A;  5EVI B;  4Y5F A;  1W79 A;  1MWR A;  4NG2 A;  4EQI A;  4LV0 A;  1NLY A;  4N1X A;  3HL9 A;  4R3J A;  1SDE A;  4HH2 A;  3CMZ A;  2G7U A;  3DTI A;  2VA0 A;  4XT2 B;  1MWS A;  4QB8 A;  3UE3 A;  4E3K A;  2ZBB A;  1YMX A;  1ZC2 A;  3DTM A;  2XA7 M;  3T1X A;  4WL9 A;  1XJ4 A;  1CEF A;  4RVA A;  5HDD A;  4CPK A;  1FIL A;  1T1C A;  1W63 M;  3CWF A;  3C38 A;  5DTS A;  5F1F A;  3MQQ A;  2JKT M;  2GX5 A;  3MQO A;  1A0K A;  1YMS A;  4K0X A;  1BLP A;  3HBR A;  4HJ6 A;  5CRF A;  2OLV A;  2XFT A;  3BQA A;  5F5Y A;  2ZLY A;  2P9V B;  5GL9 A;  2DRW A;  2OLU A;  3FPW A;  3MXR A;  2VGL M;  4OVD A;  3DTK A;  3FZC A;  2A24 B;  3G31 A;  4I3A A;  4PMA A;  4WF0 A;  1UWN X;  1PZO A;  3PBR A;  3ZCZ A;  2XLN A;  3D3O A;  4EQ1 A;  1TS6 A;  5CTM A;  2XD5 A;  3QNC A;  5CHU A;  1YSQ A;  4DE1 A;  3D9Y A;  2P74 A;  2GDN A;  2ZQ8 A;  3LIE A;  2BAS A;  5FAQ A;  4MBH A;  2GJ3 A;  2HDU A;  3N6I A;  1BLC A;  4P6Z M;  1MY8 A;  1ES4 A;  4CJN A;  1KOU A;  4YOF A;  2HDR A;  3HLW A;  4OON A;  1F98 A;  2LB5 A;  4CLC E;  1OTB A;  3GV9 A;  4UAA A;  1AWI A;  4DE2 A;  1HD8 A;  3CUE C;  3EGD C;  4I5S A;  3DBA A;  2V1A A; 
#chains in the Genus database with same CATH homology
 2JC7 A;  1BUL A;  4MLL A;  4PPR A;  3C7U A;  1U60 A;  3IXH A;  4OLD A;  2VGJ A;  4BQM A;  5FI6 A;  4ZJ2 A;  3VMA A;  2EFU A;  3A3E A;  1H8Z A;  3JYI A;  4PM9 A;  1RGY A;  4E3I A;  4OQG A;  4ZDX A;  4PM6 A;  1FSW A;  4E3L A;  1K54 A;  3Q7V B;  4PM7 A;  2H0T A;  4DRT A;  1GHP A;  3V3S A;  1LHY A;  5FQM A;  4K91 A;  4EBP A;  1CI8 A;  1KE0 A;  5E2G A;  3VSL A;  4Y0T A;  2XF3 A;  1SCW A;  1DJA A;  2Z2L B;  3WRZ A;  3V3R A;  4B4Z A;  1WYC A;  4OPY A;  1M40 A;  3GRJ A;  4WZ5 C;  4GNU A;  1YLJ A;  3C4P A;  4E3M A;  4PM5 A;  1PI5 A;  4QY6 A;  4BD0 A;  5U47 A;  4UA9 A;  1PIO A;  2P9V A;  3OPH A;  4FSF A;  4NET A;  3HVF A;  2ZQ9 A;  4S2O A;  4S2M A;  5FI7 A;  1LL5 A;  4BJP A;  4HBT A;  1K6S A;  2Q9N A;  1QMF A;  1XKZ A;  3IT9 A;  4MNR A;  3N8S A;  1WE4 A;  3ISG A;  2ZM2 A;  1L0F A;  1FCO A;  2PBY A;  5EE8 A;  4WMC A;  5FQQ A;  1ESI A;  4S2N C;  2OV5 A;  1L0E A;  2WAF A;  2WZX A;  4R1G A;  4Z9Q A;  4R4S A;  4E3N A;  3EQU A;  1KGG A;  2WAE A;  1RP5 A;  2Y2O A;  2Y2N A;  3SH8 A;  4R3B A;  2JBF A;  5FQJ A;  4WEK A;  1HTZ A;  3RJU A;  2V2F F;  1GA9 A;  1XA1 A;  3G32 A;  5E43 A;  1IYQ A;  4M3K A;  1JWP A;  1PW1 A;  4OH0 A;  2ZMA A;  4X55 A;  1WYB A;  4ZAM A;  4ZBE A;  2EX2 A;  4GB7 A;  1ZG4 A;  3UPP A;  3IF6 C;  5L2F A;  2HDQ A;  4FCF A;  4Y0O A;  4S2P A;  3Q7Z A;  5CXW A;  1TDG A;  2XGN A;  4N92 A;  1L0G A;  4BEN A;  4ZJ3 A;  3HLD A;  3OPP A;  5D3O A;  4R4R A;  4IED A;  1H5X A;  4U0T A;  3VFF A;  4B88 A;  4RYE A;  1XGI A;  3AGE A;  3FYZ A;  4RX2 A;  5IHV A;  5A92 A;  2J7V A;  3VSK A;  5EPH A;  2G2W A;  1W8Y A;  2WKH A;  2J9P A;  2QMI A;  4GN2 A;  2I72 A;  3ZFZ A;  1J9M A;  1W8Q A;  1AXB A;  4OOM A;  4QU3 A;  4KZ5 A;  1Q2Q A;  2H5S A;  3O86 A;  4HBU A;  5M18 A;  1BLS A;  5KZH A;  1I2W A;  3ZG8 B;  3NIA A;  2Y2H A;  5KSH A;  2Y2K A;  4KG6 A;  3NDG A;  3IHA A;  5CHM A;  2JCH A;  3MZF A;  3A3D A;  3VP4 A;  5A93 A;  1DJC A;  1MWT A;  2ZQD A;  1BLH A;  1BZA A;  3IXG A;  1ZG6 A;  3A3F A;  4MBF A;  3UDF A;  4E6X A;  5HW3 A;  3S4X A;  2J9O A;  3AGD A;  5AQB A;  5G18 A;  2IWC A;  3V5M A;  1XGJ A;  2WKE A;  3PBS A;  4OQI A;  2X01 A;  3HLF A;  3O87 A;  2X71 A;  2HP9 A;  1NZO A;  3LEZ A;  2UWX A;  5EVI A;  1K55 C;  3ZVT A;  4FH4 A;  4RA7 A;  4IVI A;  4KZ6 A;  4WEJ A;  2ZC3 B;  1S6R A;  2Y4A A;  3AGF A;  3A3I A;  3NCK A;  4KG2 A;  4OKP A;  2Y55 A;  4OQH A;  4XUZ A;  3N8L A;  2EFX A;  1ES2 A;  4GZB A;  4XUX A;  3QHY A;  1BUE A;  2PU4 A;  4OP5 A;  2RL3 A;  3W4O A;  3IQA A;  1G68 A;  1ONG A;  4BLM A;  1KGE A;  3HLB A;  1Q2P A;  3HLC A;  4X53 A;  4KQO A;  1BTL A;  3MZE A;  5EVL A;  1RGZ A;  1K56 D;  3Q07 A;  5DF8 A;  3IWQ A;  1FSY A;  4UA6 A;  5GLB A;  3G2Y A;  3BRM A;  3PBO A;  4QY5 A;  3UPN A;  1KVM A;  2ZD8 A;  3G2Z A;  1ERO A;  4DDY A;  3IF5 A;  1DY6 A;  5EOO A;  4R23 A;  1O7E A;  3VP1 A;  2JE5 A;  3O3V A;  3IWI A;  1E3U D;  1K38 A;  1NZU A;  3E2K A;  3GQZ A;  2DCF A;  4GDB A;  4OPQ A;  2H10 A;  3SS3 A;  4P87 A;  3CJM A;  4JXS A;  4KZ9 A;  3HUM A;  3HUO A;  1YM1 A;  3PBN A;  1K57 A;  3GVB A;  5FAP A;  5CER A;  2XFS A;  3WS0 A;  5TFQ A;  2A3U A;  3V50 A;  2WAD A;  4N1H A;  1FOF A;  3E2L A;  1XP4 A;  4K0W A;  4HEF A;  4N9K A;  1M6K A;  2WGI A;  4KZ8 A;  3WWX A;  4EV4 A;  1SDN A;  2QPN A;  1FCM A;  4DF6 A;  3FKW A;  1JTG A;  2ZQC A;  4BD1 A;  2Z2M B;  4ZTK A;  4JLF A;  2BG1 A;  3BFF A;  4KZ4 A;  4EBL A;  3NY4 A;  3VOY A;  3GR2 A;  1LL9 A;  3ZHH A;  1E4D A;  5HX9 A;  2XQZ A;  5CTN A;  3UDI A;  3IF6 B;  4JPM A;  3SS4 A;  3ZNY A;  3IH8 A;  3MBZ A;  4OPZ A;  2R9W A;  5GHY A;  1YLY A;  3ZVW A;  5CHJ A;  4OPR A;  4EBN A;  1PWC A;  4MEZ A;  4P0M A;  3MKE A;  3WRT A;  3WS5 A;  5HFO A;  3LY3 A;  4P85 A;  1XPB A;  1LLB A;  4QHC A;  1GHI A;  1KDS A;  1O07 A;  2XEP A;  3OZH A;  2DNS A;  5GHZ A;  4Y7P A;  3HRE A;  3OCN A;  1N4O A;  1K4F A;  4WMC D;  3SS5 A;  2EX6 A;  2Y2M A;  3FV7 A;  4LCM A;  3ZG9 B;  5GHX A;  5EUA A;  2IWD A;  5A91 A;  1ERQ A;  4QJG A;  5EOE A;  4WEL A;  2Y91 A;  1FR1 A;  2XK1 A;  4GDN A;  3UO9 A;  2VGK A;  4DXB A;  1BSG A;  5DF7 A;  1HVB A;  1NRF A;  2C6W B;  5FI2 A;  3IWO A;  4E3J A;  5AQ9 A;  1KGF A;  2CC1 A;  3IHB A;  2WGW A;  3EQV A;  1IEL A;  5E2E A;  1IYP A;  1IEM A;  2HP5 A;  5FQ9 A;  1XX2 A;  3PAG A;  4KEN B;  3ZG0 A;  1TVF A;  2HPB A;  5FAT A;  1FQG A;  3ITA A;  4LV2 A;  2X02 A;  2XH9 A;  3O88 A;  5I94 A;  3C4O A;  3OPL A;  4L0L A;  4WYY A;  2V20 A;  3N4I A;  5E2F A;  1YLZ A;  3D4F A;  4JXG A;  3UDX A;  4OOL A;  1K54 C;  1PW8 A;  2XDM A;  2ZJ9 A;  4LCL A;  1N9B A;  5M1A A;  3ZGA B;  2ZC4 B;  2Y2Q A;  4C3Q A;  1YLT A;  3MZD A;  4KZA A;  4U3T A;  3RXW A;  4OQ0 A;  4FD8 A;  3WS4 A;  4KZ7 A;  3I7J A;  1PWG A;  3WS2 A;  3RXX A;  2ZQ7 A;  1ALQ A;  2EX9 A;  5A90 A;  1ES5 A;  1GHM A;  4FH2 A;  1FCN A;  1MWU A;  3UE1 A;  1G6A A;  4LV1 A;  4WZ5 A;  5CED A;  2XD1 A;  3M6B A;  3Q81 A;  4ZJ1 A;  2PU2 A;  3BYD A;  1C3B A;  2J8Y A;  4GKU A;  4ID4 A;  3VP2 A;  2ZM8 A;  1XA7 A;  1PZP A;  3LCE A;  1ES3 A;  3GTC A;  3DW0 A;  1GA0 A;  3DWK A;  3QNB A;  5FSR A;  3M2J A;  3FKV A;  5HAP A;  3TOI A;  5GLC A;  4X68 A;  5TGF A;  3BLM A;  1ESU A;  4S2N A;  5EVI D;  1S0W A;  1L0D A;  2B5R A;  3Q7V A;  4X69 A;  3ZG7 B;  4A5R A;  1QME A;  3BFC A;  5JYO A;  3VP3 A;  4Q8I A;  3ZDJ A;  1ZKJ A;  2QZ6 A;  3BFD A;  1TEM A;  1IYO A;  3G30 A;  1Y54 A;  3BEB A;  3M6H A;  1OME A;  3SH9 A;  3W8K A;  3ZNT A;  5M19 A;  4S2K A;  1XXM A;  1KE4 A;  2ZC6 B;  4JF4 A;  4UHU A;  3NBL A;  3BM6 A;  3IF6 A;  5KMW A;  4GOG A;  4D2O A;  5J8X A;  4RX3 A;  1LI0 A;  1MKI A;  3M2K A;  4S2J A;  3G4P A;  4IVK A;  4S2L A;  1Z6F A;  4WZ4 A;  3N7W A;  4JF5 A;  3W4P A;  4BL3 A;  3C7V A;  1NYY A;  5CGW A;  4E6W A;  4O7D A;  1LI9 A;  1NJ4 A;  3PAE A;  3ZG5 A;  1KE3 A;  3UE0 A;  4JXW A;  4YFM A;  1I2S A;  1K25 A;  1W5D A;  2WKI A;  5EVI B;  3W4Q A;  2C5W B;  5JYP A;  1W79 A;  1ONH A;  1CI9 A;  1MWR A;  3N8R A;  3VP0 A;  3G34 A;  3UPO A;  4EQI A;  1DJB A;  4LV0 A;  4B4X A;  2BLS A;  4N1X A;  3HL9 A;  2WZZ A;  4R3J A;  1SDE A;  4N9L A;  1NXY A;  3CMZ A;  1PI4 A;  4X56 A;  5HAQ A;  1SKF A;  4DDS A;  1MWS A;  3WS1 A;  2WK0 A;  3IH9 A;  4QB8 A;  3UE3 A;  3V39 A;  4E3K A;  1KVL A;  3FWL A;  1EI5 A;  1IKG A;  4WM9 A;  1YT4 A;  4NK3 A;  4JF6 A;  2ZM0 A;  5E2H A;  1YMX A;  5FA7 A;  1JTD A;  1ZC2 A;  2WGV A;  3DTM A;  1EWZ A;  3MKF A;  2EXB A;  2ZC5 B;  4KZ3 A;  1CEF A;  5EVI C;  2XR0 A;  2RCX A;  4RVA A;  4CPK A;  3G35 A;  1K55 A;  2HDS A;  1I5Q A;  5DTS A;  3IXD A;  5F1F A;  2ZQA A;  1JWV A;  3OC2 A;  3A3J A;  3BFG A;  4DXC A;  2Y2L A;  4IBR A;  2Y2I A;  3BLS A;  3NDE A;  2E8I A;  4YIN A;  4OOY A;  4E3O A;  4KQQ A;  5AQA A;  5HAR A;  1CEG A;  3B3X A;  5FQK A;  5F1G A;  1SHV A;  1YMS A;  5FDH A;  4DKI A;  1FR6 A;  4K0X A;  4LV3 A;  1BLP A;  3P98 A;  3Q82 A;  3BFE A;  2Y59 A;  4H8R A;  5F82 A;  3HBR A;  5CRF A;  5FAO A;  5CEB A;  2OSU A;  3S22 A;  2OLV A;  2XFT A;  3MFD A;  3NC8 A;  2H0Y A;  4Y0U A;  3CZD A;  2ZLY A;  2P9V B;  2G2U A;  3C5A A;  4KG5 A;  1PYY A;  5GL9 A;  2V1Z A;  1VQQ A;  4JKT A;  4MBK A;  3VOZ A;  5BOH A;  2DRW A;  2OLU A;  1L2S A;  1MPL A;  1YQS A;  3OCL A;  1IYS A;  1MBL A;  5GLA A;  3SOI A;  1YLW A;  3MXR A;  1K57 C;  4S2I A;  3OPR A;  1NYM A;  3HLG A;  5CEC A;  4DE0 A;  4OVD A;  3FZC A;  4X6T A;  1RCJ A;  5FAS A;  3SH7 A;  5HAI A;  1CK3 A;  3G31 A;  3LO7 A;  3TG9 A;  4JBF A;  4PMA A;  4GD8 A;  2Q9M A;  1IKI A;  2IWB A;  1BT5 A;  3S1Y A;  1E25 A;  1JVJ A;  1PZO A;  2Y2P A;  3BEC A;  3LY4 A;  1ERM A;  3PBR A;  3PBT A;  3ZCZ A;  2XLN A;  5DF9 A;  1JWZ A;  3PTE A;  4C75 A;  4EWF A;  5CTM A;  4BL2 A;  3GSG A;  4HES A;  2XD5 A;  2EX8 A;  4WBG A;  3QNC A;  1VM1 A;  1TDL A;  3CG5 A;  3HLE A;  3TSG A;  5CHU A;  5KSC A;  2Y2G A;  2EXA A;  5HL1 A;  4DE1 A;  3UY6 A;  4F94 A;  3ITB A;  3GMW A;  3Q1F A;  4KZB A;  2P74 A;  2GDN A;  3UNW A;  1MXO A;  2ZQ8 A;  4OLG A;  5DVA A;  2FFF B;  4IBX A;  5FAQ A;  3UN7 A;  4MBH A;  5CGX A;  2HDU A;  1GCE A;  2HP6 A;  3IXB A;  3VFH A;  4JXV A;  4P6B A;  4GD6 A;  5FQI A;  1KDW A;  5CGS A;  3HUN A;  3N6I A;  5F83 A;  5GLD A;  2ZC7 A;  1BLC A;  4XXR A;  1MY8 A;  2WGW B;  1ES4 A;  2WUQ A;  4CJN A;  5AQ7 A;  1W7F A;  5EEC A;  2Y2J A;  1PWD A;  2HDR A;  4U0X A;  3HLW A;  4DE3 A;  3PBQ A;  5TR7 A;  4OON A;  1K56 A;  1K6R A;  4KQR A;  4LEN A;  4PM8 A;  1YLP A;  5DTK A;  4OP8 A;  5DTT A;  3MXS A;  4QD4 A;  1NY0 A;  4EUZ A;  3GV9 A;  1K4E A;  3P09 A;  4R0Q A;  4C6Y A;  4UAA A;  2WYX A;  1H8Y A;  2A49 A;  3NI9 A;  2FFY A;  1HD8 A;  4DE2 A;  4UA7 A;  1HZO A;  1E3U A;  3DWZ A;  2R9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...