3K2NA

The crystal structure of sigma-54-dependent transcriptional regulator domain from chlorobium tepidum tls
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
177
structure length
177
Chain Sequence
SNAALKLMQYIGDAIGTIRDPQELFRTVTDKLRLLFAFDSAVIITIDRERREASVFFEMLRFELPEQLRHQTRSIAGTWLEGHLDDRTVTVASIARDIPSFGADGAPLLWTLHELGMRQIVLSPLRSGGRVIGFLSFVSAEEKLWSDGDKSLLSGVSSSIAIAVSNALAYEELRQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sigma-54-dependent transcriptional regulator
publication title The crystal structure of sigma-54-dependent transcriptional regulator domain from Chlorobium
rcsb
source organism Chlorobium tepidum tls
molecule tags Transcription regulator
total genus 48
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3k2nA00
3S7OA 2KOIA 2W3FA 5C5KA 2M7VA 2W3GA 4CQHA 4QPRA 2W3HA 1VHMA 3KO6A 1YSPA 3KSIA 2W3EA 4ETXA 4ETZA 4EU0A 4ZRRA 3IBJA 5L8MA 4GW9A 4G3VA 2VKSA 2VZWA 2OOLA 5K5BA 2W1RA 4IJGA 2KLIA 1ZTUA 5I5LA 3CITA 3NOUC 4MCWA 3MQ0A 4DMZA 2LB5A 2XSSA 3S7NA 4BWIA 2VEAA 4YOFA 3KSFA 2GX5A 3VV4A 2LB9A 3EEAA 4Y2FA 2XROA 4YNRA 5LBRA 5HPFA 3E98A 1YKDA 3IBRA 5HPIA 3RFBA 4DN0A 3OOVA 2XRNA 5TJJA 2W1TB 2O9AA 4GLQA 2M7UA 4MMNA 3BJNA 3MMHA 3W2ZA 5AJGA 3C2WA 4G3KA 2O9BA 2VJWA 3R4KA 4LRXC 2ZMFA 3CI6A 3NOTC 4O01A 5HL6A 2B18A 3DBAA 2IA2A 4MDZA 3S7PA 2HGVA 4ME4A 4R70A 2O99A 3OBFA 3K2NA 3E0YA 2K2NA 1STZA 4G3WA 2Y8HA 1TD5A 2W3DA 3HCYA 4FOFA 3D3OA 3G6OA 4Y5FA 3MF0A 3NOPC 4Q0HA 3LFVA 1TF1A 4Y3IA 2O9CA 3S7QA 2G7UA 3KSGA 4Z1WA 4O8GA 1MKMA 4IUHA 4Q0IA 2O0YA 4R6LA 3NHQA 3TRCA 1MC0A 4IUKA 4EUVA 2K31A 2Y79A 2W1TA 4LRZE 4E04A 4MN7A 4LRYC 4PAUA 5HSQA 3ZQ5A 1YSQA 1F5MA 4O0PA 2QYBA 4RQ9A 3O5YA 4Q0JA 3KSHA 5DFYA 5DFXA
chains in the Genus database with same CATH superfamily
1ONGA 2Y2JA 2XA7S 1SCWA 3V5MA 3HJIA 1OT9A 3UN7A 2BG1A 2HP5A 5M18A 1SDNA 3IXDA 2ZC5B 4NXEA 5CRFA 5E43A 3IX8A 1XX2A 3S7NA 3KYZA 4K0WA 3HVFA 2JBFA 4EEUA 3M6HA 2LB9A 2XH9A 4GZBA 1KGEA 5LBRA 2H5SA 2FFYA 4OPRA 1NRJA 1GHMA 2O9AA 4GHIA 4MMNA 2JC7A 3JYIA 3HLEA 1S4SA 1U60A 5A93A 1ACFA 3ZFZA 5I94A 3H9WA 5EECA 1S67L 4BL3A 3ZG9B 1K6RA 4K0XA 5FEGA 1HTZA 5TFQA 1IELA 2OAP1 1UWNX 1YLJA 1JVJA 5E2EA 2ACGA 1YLPA 3DTKA 3FWLA 2V0WA 3BFFA 4EUZA 4C6YA 5FL3A 4FOFA 1K4EA 1TVFA 3D3OA 5J4EA 1Y54A 4LV0A 3T4LA 4E3OA 3QP6A 2XDMA 3LR0A 4HESA 1L0EA 1IKGA 3P98A 3IF5A 1S66L 3ZG5A 2D01A 1PYYA 5HX9A 3HLWA 5GHXA 5FEFA 3IHBA 1W8QA 1JTDA 2Y2PA 1KGFA 1H8YA 3E2KA 3ZVWA 5TBMB 4GB7A 1JWPA 2HP6A 3D72A 5KSCA 4GW9A 1SKOA 4EV4A 3TSGA 3WS4A 4R3BA 1XP4A 3CITA 3BY9A 1K56A 2VEAA 3MS6A 3HL9A 5HPFA 1RGYA 3NBLA 5DJTA 4E6WA 4B4ZA 1ALQA 1ZG4A 2ZQ9A 2VLGA 4EQIA 1IYSA 3LIFA 3W2ZA 1L0GA 3CZDA 3V50A 1DJAA 4BBTA 4FUWA 4X69A 1ZHHB 3P01A 2PRFA 3O88A 5HFOA 3C7VA 2ZOIA 3E4OA 3IX3A 5EE8A 3L7HA 4B9OA 4P6ZM 4S2PA 5HAQA 3T4JA 4P6BA 2L4RA 4FCFA 5EM1A 4EWFA 3IS2B 2XFSA 4MBHA 4Q0HA 1PWCA 2ZJ9A 2Y2OA 2EXBA 3HLGA 4HP4A 4YFMA 3HREA 2WGWB 4PM8A 4X68A 3IWQA 2V0UA 4LRYC 4UA7A 1OJGA 5CEDA 3Q81A 5GLBA 4PMAA 4OLGA 3NDEA 1K6SA 3C8CA 3BEBA 3WWXA 3DTMA 2KOIA 4JPMA 4KZBA 4S2OA 2ZBBA 3R7WB 3HBRA 1VQQA 4M3KA 3SOIA 3IXBA 4R3JA 3IHAA 2FH5A 4Y0OA 3Q7VB 4MBKA 4P87A 1YQSA 3F1NB 1MBLA 4IVKA 4KZ6A 4UEYA 4FD8A 3MKEA 2RCXA 3T1XA 3GR2A 1NLZA 2WKHA 4OVDA 5J8XA 3MXSA 3F1PA 5TJJA 2PYRA 2VGKA 2M7UA 3NDGA 1XJ4A 3GRJA 4ZTKA 1BULA 3UB7A 2PD8A 3QP8A 3VFHA 1G5UA 2JE5A 2VX8A 2EXAA 2V1BA 4R0QA 3OBFA 4OOLA 5FI2A 5CERA 2A24A 4X6TA 2Y8HA 3PAGA 5DKKA 4BBVA 4DE3A 4UAAA 3O86A 2OAQ1 3HCYA 1L2SA 4JF5A 5EVIA 5F1FA 1K54C 4Y5FA 4JXSA 5HDCA 4N9KA 4NXFA 4IUHA 4IEDA 3LICA 1ERMA 3H82A 4EUVA 4N92A 3SZTA 2VA0A 2ZL1A 4CLCD 3ZHHA 4X1MA 2GNXA 4XT2B 4GKUA 4JXWA 5AQ9A 1VM1A 5CTNA 4JF4A 2HZ5A 4Z9QA 1K4FA 4S2NA 3Q07A 5EM0A 1XPBA 5A8BA 5J3WA 1NY0A 3LEZA 5HD5A 1GA0A 5DTKA 3IBJA 4U0XA 2Y2MA 1WA9A 4LGWA 2PD7A 1N9BA 5CHJA 1WE4A 4MCWA 1OJ5A 1MKIA 4HIAA 2XF3A 2WGIA 2WAFA 2A49A 3HLDA 3LR5A 4JF6A 5F69A 2ZQ8A 3GMWA 3T4OA 5A91A 3G32A 2HDSA 1PWGA 4RX2A 3MXQA 3WRTA 3GQZA 3JPUA 2VV8A 3MZFA 5D3OA 2RL3A 1QMEA 2Z6CA 5F5YA 3MJQA 4WZ5A 5HL6A 2Z6DA 2IA2A 3CMZA 4OPZA 2C5WB 5HAPA 2WYXA 4CLCE 5L09A 3LR3A 4E3IA 5GLAA 2VGLS 3A0VA 4CJNA 1PNEA 4HOIA 3DAVA 5FATA 1K38A 1YM1A 3M2KA 4NXGA 5FA7A 1OPXA 1W79A 5HWVA 3VP0A 3BW6A 1C3BA 4GOGA 4EERA 3KSGA 4ZJ1A 2V8CA 1KDWA 2IWDA 3A3EA 4S2KA 4YWZA 4GDNA 4EESA 4I39A 4X56A 4BMWA 3S7OA 1D7EA 4IVIA 3S22A 3EQVA 1F2KA 2D02A 3VSLA 2UWXA 1JWZA 3GSGA 4KZ9A 3QP1A 3LUQA 3KYQA 3DWZA 1J3WA 1NWZA 2OWHA 4R4SA 5L8MA 4YINA 4LV3A 4IJGA 1ZTUA 5I5LA 1KVMA 3GV9A 2ZC3B 3ISGA 2WKIA 3PBRA 3CLOA 4UQIS 1FR1A 4PPRA 5GLDA 1Y4OA 4RA7A 3MMHA 3A3IA 5M19A 5AJGA 3ZG8B 3RJUA 5E2FA 2PBYA 4DE2A 4BLMA 2JHEA 1ESUA 2X02A 1YLYA 1NRFA 1J9MA 2E8JA 2EFUA 2PHYA 1FCOA 4G3WA 3BLSA 3EGDC 5DKLA 3N8LA 3D4FA 4R3AA 5CGWA 2Y2QA 2H0YA 3F1OA 4XXRA 4BL2A 5KIZA 4UA6A 1TDLA 5FQJA 4R38A 3V67A 4Q0IA 3N8RA 2IWBA 4EETB 2ZC7A 3RXXA 1NJ4A 3MZEA 4WF0A 5EVIC 1PZOA 4DXCA 3HUNA 2PDRA 3T1SA 2R9XA 3T4QA 1G6OA 1S6RA 3ZQ5A 1TS6A 2J3WA 5JYOA 4RQ9A 4Q0JA 3VSKA 1YPRA 1XXMA 1BZAA 2XR0A 4E3JA 3CPTB 3ZYTA 2EX2A 1FIKA 3KSIA 1KGGA 3PBTA 4WM9A 1ERQA 3OPRA 3Q82A 5DF9A 3GTCA 1KE4A 3DTIA 1L3LA 2Y2GA 3FKVA 2X01A 5TBMA 3SS4A 4BENA 3O3VA 1PRQA 4QU3A 1VETA 3HLBA 3HLCA 4K08A 2J9PA 4OOMA 3QNBA 4OP8A 4WMCA 2EX8A 2VK3A 1GCEA 2DNSA 3CWFA 3P7NA 4I3JA 1NZOA 3V3RA 3K2NA 4KZ4A 3LI8A 3UPPA 1WYBA 2WUQA 4WZ5C 2BTFP 1H3QA 3B47A 1H5XA 2EA9A 1GHPA 5F68A 2A3UA 5F83A 1TD5A 4O7DA 2JN7A 2J9OA 1D1JA 3PAEA 4HH2A 2VGJA 5CTMA 1FILA 3NJAA 3CJMA 4AFIA 4KZAA 4GD6A 3D9YA 4WBGA 2V1ZA 1GSWA 3MFXA 1ZC2A 3IS2A 1OTDA 3SH7A 3UDIA 4R23A 5C5KA 3TJZC 1H0MA 3MFDA 4KZ5A 1D06A 4L9EA 1LI0A 2OOLA 5EFWA 3G31A 2V8FA 1T1AA 3NCKA 1YLTA 3BFGA 2X71A 3MQ0A 4C75A 2B95A 4LCMA 2XQZA 3R7WA 5G4YA 1LHYA 3ZNTA 4OQIA 4MN5A 3OCNA 1YT4A 4F94A 4P6ZS 4BD0A 5L10A 1K57A 1IKIA 3OPPA 2PR5A 3W4OA 2WADA 3G4PA 1SDEA 4IHQA 1TS7A 4DF6A 1Q2QA 1VB6A 1W63M 5CECA 1TDGA 4E3MA 1CI8A 3LYXA 1LLBA 5U47A 4OPYA 1PZPA 3PXPA 4KQDA 2Q9NA 4JBFA 3CUEA 4HBUA 4EBLA 4PM5A 1LL5A 2JKTI 2P08A 4OQHA 1DY6A 2OWJA 4WEKA 4KZ3A 2Y2IA 3NHQA 3TRCA 4B4XA 2H10A 3G35A 3K3CA 4X53A 2W1TA 5FDHA 4WEJA 5HW3A 3C4OA 3UE1A 4XUZA 1XA1A 4JGPA 4KG5A 1YSQA 1LSWA 1LSVA 4ZRRA 5DFXA 1IYOA 1N9LA 3ULFA 5HWWA 1M40A 4D60A 3IF6C 3KO6A 1A0KA 4OOYA 1JTGA 5KZHA 4XT2A 2JKTM 3BLMA 5AQAA 2MJ6A 3BQAA 4GCZA 4HY8A 3UB6A 1W8YA 4KZ7A 1RP5A 4F3LB 3PBNA 1LI9A 2WKEA 4JKTA 3JVVA 1IFQA 3QHYA 2J3TC 1XJ3A 1KDSA 4PM9A 2ZQCA 3LIAA 3NOTC 3BM6A 1CF0A 2ZD8A 3BECA 2FZ0A 2HGVA 4R70A 3IXGA 3MXRA 5DF8A 3MKFA 1JWVA 1ES2A 5TGFA 3GVBA 2DMWA 3EQUA 1SKOB 4S2JA 1T19A 5IS1A 5E2HA 4S2IA 3UO9A 2OV5A 2G7UA 5A90A 1YMXA 1W7FA 1MC0A 3G2YA 1IOUA 2HV1A 4HJ3A 4QB8A 3A3FA 5EVID 5FQMA 3FC7A 4OPQA 2UV0E 2P04A 4ID4A 4MN7A 4E04A 5FAQA 3FG8A 3MQOA 3TW8A 5EUAA 3RH8B 3FPWA 3WS0A 3LEQA 1K55A 4HQAA 2J7VA 3TE8A 3NECA 3ZDJA 2BLSA 4UA9A 3GECA 2ZC4B 5EPHA 3FZCA 2QJ5A 2ZC6B 3U2AA 3W4QA 4QPRA 2W3HA 3LIEA 3NC8A 1VEUA 4NXBA 4S2MA 1OMEA 5KMWA 5IT5A 1F9IA 4DJ2A 4Y15A 4JXVA 3BY8A 3EEAA 1NYYA 4YNRA 3E98A 1T1BA 3IT9A 1RGZA 3BRMA 2VV7A 4LCLA 4GLQA 1P0ZA 1P9WA 1P9RA 2PR6A 1WYCA 3DW0A 1DP9A 3OCLA 3ITAA 4CLCA 1S0WA 1CEGA 4HNBA 4QD4A 4FTXA 4OP5A 2PAVP 1K57C 2Y2LA 4MDZA 3RXWA 2HP9A 1CEFA 4I38A 3C7UA 4HH3A 3N8SA 5FSRA 1Z09A 4ESPA 1SHVA 3LCEA 1L0DA 3C4PA 1EI5A 4LPZA 3ZNYA 1V9YA 2Y4AA 4P0MA 2WZZA 1ES5A 3CUEC 4QWOA 3Q1FA 3VOLA 4E6XA 1I2SA 3PR6A 4JXGA 4L9FA 4S2LA 4IUKA 2Z2LB 1FOFA 3F1PB 3PBOA 1CJFA 4K91A 3PTEA 1BLSA 2M1CA 4Y17A 3UMEA 4QJGA 5FI6A 3VP3A 1PIOA 4ZBEA 2WKPA 2HF6A 2A2LA 3BYDA 1BLPA 2EFXA 2CC1A 3OZHA 3RTYA 4OLDA 4X55A 2HJEA 3JVUA 1PWDA 4MBFA 5FDSA 4ARZB 3UNWA 4WN5A 2VV6A 3PBQA 1ES4A 1BYWA 4BQMA 5EVIB 4DMZA 3CHWP 3UPNA 3CPTA 1UGUA 1HD8A 3UDXA 3RFBA 3H82B 4OQ0A 2G2UA 3M6BA 1DP6A 2QZ6A 2ZL1B 1EW0A 5HD3A 3T1RA 3IWOA 2B02A 3QP5A 2ZOHA 3MBZA 4O01A 2QHKA 3T4SA 5AVFA 2B18A 1QMFA 4B93A 1DP8A 3T1QB 4ZDXA 1N9OA 5CHUA 4I3AA 5G18A 1MY8A 5EV0A 3ZVTA 5HDDA 2VGLM 2W3DA 2JKRM 3M2JA 3V39A 1ESIA 1W63Q 3P09A 3NOPC 5AQBA 2YKFA 3NULA 2WZXA 5J7EA 2J80A 1MZUA 4Y0TA 4MN6A 4R6LA 2PU4A 2QKPA 1UWPX 1BLHA 3DWKA 2K31A 4R4RA 3W4PA 4GN2A 4WUJA 1OTEA 2V1AA 3EGXC 1F5MA 3WS2A 2QYBA 4IBXA 5EVEA 5CGXA 2W27A 2W3FA 2M7VA 5CGSA 1MPLA 2KDKA 1YLWA 4II7A 1Z6FA 3A3JA 1E3UD 4ZJ2A 2I9VA 1K55C 2ZMAA 4ETXA 2I72A 2QJ7A 2L0WA 4WYYA 5K5BA 4HI4A 1DJCA 4DXBA 2DCFA 1K25A 2JCHA 2LB5A 3IQAA 1BSGA 2XGNA 1XKZA 4JGRA 4A5RA 4JGQA 1XJ2A 3WS5A 4LFUA 3OPLA 3T50A 1TS0A 2Q0OA 4H8RA 1FSYA 2Z2MB 3HUMA 3PHYA 1IYQA 5IHVA 4S2NC 3WS1A 5L2FA 3H7WB 2J3TD 4WELA 2VJWA 3R4KA 1EWZA 3S4XA 4GNUA 4KQQA 4WZ4A 4CLCC 2B5RA 1ZG6A 4QHCA 2V20A 4E3LA 1W5DA 3B42A 4HBTA 5CXWA 3ZG7B 1JNUA 2XD5A 3UE0A 3ZGAB 3MF0A 4B88A 1KVLA 2QPNA 1XGIA 1HVBA 2Y79A 3E2LA 1YLZA 5TR7A 5FQIA 4WL9A 4HJ6A 1PI5A 2ZM8A 3EOIA 3HJKA 4O0PA 2ZM0A 2OLVA 3KSHA 3VOYA 2H0TA 3LIBA 2OSUA 5FQQA 1BTLA 3A3DA 4EBNA 2W3GA 2E8IA 4CQHA 3S1YA 3VFFA 3VE4A 4MLLA 5BOHA 3MQQA 3QNCA 2W0NA 4EU0A 3LGOA 2VZWA 2HPBA 2ZQ7A 4N9LA 3VP4A 3QP4A 3FPVA 1ODVA 4NKPA 3F1OB 5JYPA 4YOFA 4H6JB 2XA7M 3EWKA 2P7JA 3MZDA 4GS9B 4LV1A 1K54A 5AVEA 2V9AA 5L07A 3TG9A 1X0OA 2WGWA 3W8KA 1XFNA 3BJNA 3LY3A 1CK3A 1TS8A 2NUTC 3CI6A 3PYPA 4BJPA 3DBAA 4F3LA 3IF6B 2JKFA 1E4DA 3B3XA 3S7PA 1G6AA 1BT5A 4ME4A 2IWCA 4I5SA 4I3IA 1FCNA 5E2GA 2PYPA 3Q7VA 2BASA 1V9ZA 3UB8A 2P9VB 1K56D 4GDBA 1FCMA 3F1NA 4L0LA 1KOUA 3I7JA 1HLUP 3WRZA 1H8MA 2O9CA 5F6AA 2R9WA 1GA9A 3K3DA 2XEPA 1PFLA 3C38A 1NLYA 1XGJA 5EVLA 3LY4A 5HDSA 4DKIA 1VETB 5FQ9A 3SH8A 3IX4A 5GL9A 4R1GA 4RX3A 3NIAA 3N4IA 5AQ7A 5IU1A 4HP9A 2PU2A 4RYEA 1GSXA 5HARA 1YSPA 2R78A 1PI4A 1G28A 4GHIB 4X1LA 2VKSA 3HUOA 4OH0A 2KLIA 3NOUC 3FYZA 3UB5P 2GX5A 4Y2FA 5HAIA 3BWLA 1NZUA 5DJUA 2XRNA 3UPOA 3ITBA 1GSVA 5CEBA 2HDRA 5F1GA 3C2WA 2O9BA 4LRXC 3KX0X 5CHMA 3SS5A 2ZM2A 1SZVA 1E25A 4E3KA 2ZLYA 4GD8A 5GLCA 4JLFA 3ZG0A 1I5QA 1ES3A 2O99A 3E0YA 1ZKJA 3OPHA 4LV2A 4OONA 2INWA 1PW1A 2XFTA 4HEFA 4JGOA 3T4KA 4LLOB 3ZCZA 3LI9A 3DTEA 1TF1A 3UDFA 4ZAMA 5DF7A 3C5AA 3AGEA 4O8GA 4WLAA 4DE1A 1XFQA 3N7WA 5EOOA 3AGFA 3B33A 5FQKA 1DRMA 2FFFB 5HSQA 3U4LP 1FR6A 1DJBA 4EBPA 5DFYA 2HDQA 4NK3A 1N9NA 5KSHA 4Y0UA 4KG6A 5A92A 2C6WB 1TEMA 3O87A 4NEED 3MSHA 4BBUA 4DRTA 3VP1A 3EEHA 1LSXA 3UY6A 3GDIA 4U3TA 1MWUA 4G3VA 1GHIA 4Y13A 3VP2A 4KQOA 3T12B 4XUXA 1O07A 4NETA 2KX6A 1H8ZA 1OTAA 4UHUA 3KSFA 5FASA 1T18A 2XLNA 2XROA 3SW1A 2AVXA 3G30A 5CX7A 2Y2HA 3IBRA 3IH8A 4ARZA 3OOVA 3OLOA 3BQ8A 2W1TB 4ZJ3A 1BUEA 2WK0A 3N6IA 2Y59A 1S1YA 3SS3A 3NI9A 2PBDP 1Q2PA 1AXBA 3VOZA 5M1AA 4OKPA 4Y7PA 4PHTA 1YAXA 2EX9A 4KQRA 1LL8A 2H28A 4PKYG 5HL1A 4PM6A 3KYEA 3NY4A 2G2WA 4D2OA 1LL9A 4N1HA 4KUOA 2GDNA 3LFVA 5HZHA 1EROA 4GJ4A 3IXHA 2O0YA 2WAEA 4C3QA 3FKWA 3A0SA 2JKGA 1BLCA 3AGDA 1G68A 1KE0A 4KZ8A 2Y91A 1CQAA 3E4QA 5EOEA 1N4OA 2EWVA 3CG5A 3L9KA 3UE3A 5DVAA 4U0TA 1PW8A 1AWIA 4OQGA 5FAPA 1T1CA 1SKFA 3ICYA 5FI7A 2NUPC 1VHMA 3VMAA 5HWTA 2W3EA 4ETZA 2EWWA 3IH9A 3G34A 3LR4A 1Y28A 2W1RA 1MWTA 3BFDA 4X25A 4IBRA 4BWIA 4M4XA 3FV7A 1NXYA 1YKDA 1LT0A 5HPIA 4DN0A 4PKYA 2ZQAA 3G2ZA 4DDSA 1YMSA 1XJ6A 2A24B 2JKRI 2V2FF 2CMNA 2QWSA 4QY6A 4HHDA 2OLUA 3TOIA 4P85A 4EEPA 1M6KA 2K7SA 3BFCA 2WKQA 3SH9A 4FH2A 2WGVA 2Y55A 1HZOA 4PM7A 4L9GA 4QY5A 3UB9A 1MXOA 1VEUB 1RCJA 3H7WA 1O7EA 2DRWA 1KE3A 1FSWA 4HJ4A 1OTIA 3LO7A 2ZQDA 5MC7A 4Z1WA 1MKMA 2EX6A 5GHZA 4DDYA 4RVAA 4CPKA 1L0FA 4LRZE 2J8YA 4EW7A 4PAUA 3V3SA 4KUKA 1MWSA 4DJ3A 4EQ1A 3E4PA 4N1XA 5G4ZA 2WKRA 4LENA 3O5YA 5FAOA 4CLCB 1IYPA 3VE3A 1XA7A 3T4TA 2Q9MA 2XK1A 1K0KA 1FQGA 4FSFA 3MR0A 2Y2NA 2XSSA 3VV4A 1OTBA 3UE6A 3PBSA 2GZAA 4FH4A 4DE0A 2QMIA 2ZMVA 2HJ9C 4KG2A 4MEZA 3C30A 2L1MA 3HLFA 3OC2A 4Q8IA 4G3KA 2ZMFA 2Y2KA 1P97A 5F82A 4H6JA 1ONHA 3LIDA 3IWIA 3Q7ZA 4GS9A 1S1ZA 2HDUA 2YKHA 1CI9A 2K2NA 4UQIM 1STZA 3A0RA 4EXOA 1E3UA 1OT6A 4KENB 2PT7A 5GHYA 3QP2A 3G6OA 3IF6A 4MNRA 1IEMA 4Y3IA 1F98A 3S7QA 3CAXA 4E3NA 4BD1A 3UMDA 2P9VA 1S4RA 3BFEA 2XD1A 4WMCD 1MWRA 4NG2A 5DTSA 5DTTA 2GJ3A 1NYMA 2P74A 1I2WA
chains in the Genus database with same CATH topology
4HQAA 3S7OA 2XA7S 1D7EA 3TE8A 3EQVA 5IU1A 2D02A 3GECA 4HP9A 2QJ5A 3HJIA 3U2AA 3LUQA 1OT9A 1GSXA 3KYQA 4QPRA 2W3HA 1NWZA 2OWHA 1YSPA 2R78A 3LIEA 5L8MA 1G28A 4GHIB 2VKSA 4NXEA 4NXBA 5IT5A 4IJGA 2KLIA 1ZTUA 5I5LA 1F9IA 3NOUC 3S7NA 4DJ2A 3KYZA 2GX5A 3BY8A 4EEUA 2LB9A 3EEAA 4Y2FA 4YNRA 5LBRA 3BWLA 3E98A 1T1BA 3PBRA 3CLOA 4UQIS 5DJUA 2XRNA 1NRJA 2VV7A 2O9AA 4GHIA 4GLQA 1GSVA 1P0ZA 1P9WA 1P9RA 3MMHA 4MMNA 2PR6A 1DP9A 1S4SA 3OCLA 5AJGA 3C2WA 2O9BA 4LRXC 4CLCA 4HNBA 3KX0X 2JHEA 3H9WA 4MDZA 1S67L 2O99A 3E0YA 4I38A 2OAP1 4HH3A 1UWNX 2INWA 2PHYA 4G3WA 3EGDC 5DKLA 4JGOA 2V0WA 4R3AA 4LPZA 5FL3A 4FOFA 3T4KA 1V9YA 3D3OA 4LLOB 5J4EA 3F1OA 3LI9A 5KIZA 3T4LA 1TF1A 3CUEC 4R38A 4O8GA 4WLAA 3VOLA 3V67A 3PR6A 4Q0IA 4L9FA 4EETB 3LR0A 1XFQA 4IUKA 4WF0A 3F1PB 3PBOA 3B33A 1DRMA 2PDRA 3T4QA 5HSQA 1G6OA 1S66L 3ZQ5A 1TS6A 2D01A 2M1CA 2J3WA 4RQ9A 4Q0JA 3UMEA 5DFYA 2WKPA 1N9NA 5KSHA 2HF6A 2A2LA 5TBMB 3RTYA 4NEED 3ZYTA 4BBUA 2HJEA 3JVUA 3EEHA 4ARZB 3KSIA 3D72A 3PBTA 4WN5A 1LSXA 3GDIA 4GW9A 4G3VA 2VV6A 3PBQA 1BYWA 5DF9A 4KQOA 3CITA 3BY9A 4DMZA 2KX6A 2VEAA 1OTAA 3KSFA 2XROA 1T18A 3SW1A 5TBMA 5HPFA 1UGUA 5CX7A 5DJTA 3IBRA 3RFBA 3H82B 4ARZA 3OOVA 3OLOA 3BQ8A 2W1TB 1DP6A 2VLGA 1EW0A 5HD3A 4K08A 3LIFA 3W2ZA 4OOMA 2B02A 2ZOHA 4O01A 2QHKA 3T4SA 5AVFA 2B18A 1S1YA 4BBTA 4B93A 1DP8A 1ZHHB 3P01A 3CWFA 3P7NA 4I3JA 2ZOIA 3E4OA 3K2NA 4PHTA 1N9OA 4B9OA 3LI8A 1YAXA 1H3QA 3B47A 1LL8A 2H28A 4I3AA 4P6ZM 2EA9A 4PKYG 5F68A 5HDDA 3T4JA 2VGLM 2L4RA 1TD5A 2W3DA 2JKRM 2JN7A 3IS2B 1W63Q 4KUOA 3NOPC 4Q0HA 4HH2A 3LFVA 2YKFA 5HZHA 5J7EA 4GJ4A 2J80A 3NJAA 1MZUA 4MN6A 2O0YA 4R6LA 4HP4A 2QKPA 1UWPX 4AFIA 2K31A 3A0SA 1GSWA 1OTEA 2V0UA 4WUJA 4LRYC 3MFXA 2V1AA 3EGXC 3IS2A 1OJGA 1F5MA 1OTDA 3E4QA 2QYBA 2EWVA 3C8CA 2W27A 2KOIA 3UE3A 2W3FA 5C5KA 2M7VA 3TJZC 2ZBBA 3R7WB 2KDKA 4II7A 1T1CA 3ICYA 1D06A 2I9VA 4L9EA 2NUPC 1VHMA 5HWTA 2FH5A 2W3EA 4ETXA 4ETZA 2QJ7A 2EWWA 2OOLA 5EFWA 3LR4A 2L0WA 1Y28A 5K5BA 1T1AA 2W1RA 3F1NB 4HI4A 4UEYA 3MQ0A 2LB5A 4BWIA 4M4XA 3R7WA 5G4YA 4JGRA 1NLZA 4JGQA 1XJ2A 1YKDA 1LT0A 3T50A 5HPIA 4MN5A 1TS0A 3OCNA 4DN0A 3F1PA 4P6ZS 4PKYA 5TJJA 2PYRA 2M7UA 3PHYA 1XJ6A 2A24B 2PR5A 1XJ4A 3H7WB 2J3TD 2JKRI 2VJWA 3R4KA 4WELA 3UB7A 4IHQA 1TS7A 2PD8A 2CMNA 2QWSA 4HHDA 1VB6A 4EEPA 2K7SA 1W63M 2VX8A 3LYXA 2WKQA 2V1BA 3OBFA 4CLCC 4OOLA 3PXPA 4KQDA 4L9GA 2A24A 3CUEA 3UB9A 3B42A 2Y8HA 5DKKA 4BBVA 1JNUA 3H7WA 2JKTI 2P08A 2OAQ1 3HCYA 4Y5FA 3MF0A 4HJ4A 2OWJA 5HDCA 1OTIA 4NXFA 4WEKA 5MC7A 4Z1WA 1MKMA 4IUHA 3LICA 3NHQA 3TRCA 3H82A 4EUVA 3K3CA 2Y79A 2W1TA 4WEJA 2VA0A 4LRZE 4CLCD 4WL9A 4EW7A 2GNXA 4PAUA 4HJ6A 4JGPA 4KUKA 4DJ3A 4EQ1A 3E4PA 3EOIA 4XT2B 1YSQA 5G4ZA 2WKRA 3HJKA 4O0PA 1LSWA 3O5YA 1LSVA 3KSHA 4ZRRA 5DFXA 4CLCB 3LIBA 1N9LA 3VE3A 3ULFA 2W3GA 3T4TA 5A8BA 4CQHA 5HWWA 5J3WA 3VE4A 5HD5A 3MQQA 3KO6A 2W0NA 4EU0A 3IBJA 4FSFA 4XT2A 2VZWA 1WA9A 2JKTM 2PD7A 3MR0A 2MJ6A 3BQAA 3FPVA 4GCZA 4HY8A 1ODVA 4NKPA 3UB6A 3F1OB 4MCWA 1OJ5A 2XSSA 4HIAA 4YOFA 3VV4A 4H6JB 4F3LB 1OTBA 3PBNA 3UE6A 2XA7M 3EWKA 3PBSA 2P7JA 2GZAA 2ZMVA 4GS9B 3LR5A 5AVEA 2V9AA 5F69A 1X0OA 3T4OA 3JVVA 1XFNA 2HJ9C 1IFQA 3C30A 3BJNA 3MXQA 2J3TC 1XJ3A 2L1MA 2VV8A 3OC2A 1TS8A 2Z6CA 5F5YA 4G3KA 3MJQA 3LIAA 2NUTC 2ZMFA 3CI6A 3NOTC 3PYPA 4BJPA 5HL6A 1P97A 2Z6DA 4H6JA 3DBAA 4F3LA 2IA2A 2FZ0A 3LIDA 3S7PA 2HGVA 4ME4A 4GS9A 4I5SA 4R70A 4I3IA 1S1ZA 2YKHA 4CLCE 2K2NA 4UQIM 2PYPA 3LR3A 1STZA 2BASA 1V9ZA 2DMWA 2VGLS 3A0RA 3A0VA 3UB8A 4EXOA 4HOIA 3EQUA 1OT6A 3F1NA 2PT7A 4L0LA 4NXGA 1KOUA 1OPXA 5HWVA 1T19A 3G6OA 5IS1A 3BW6A 1H8MA 4Y3IA 1F98A 2O9CA 5F6AA 3S7QA 2G7UA 4EERA 3KSGA 3CAXA 3K3DA 1MC0A 3C38A 1IOUA 3UMDA 2HV1A 4HJ3A 1NLYA 4YWZA 3FC7A 1S4RA 2P04A 4E04A 4MN7A 4EESA 5HDSA 3FG8A 3MQOA 4I39A 4BMWA 2GJ3A 3TW8A 3RH8B 3FPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7O A;  2KOI A;  2W3F A;  5C5K A;  2M7V A;  2W3G A;  4CQH A;  4QPR A;  2W3H A;  1VHM A;  3KO6 A;  1YSP A;  3KSI A;  2W3E A;  4ETX A;  4ETZ A;  4EU0 A;  4ZRR A;  3IBJ A;  5L8M A;  4GW9 A;  4G3V A;  2VKS A;  2VZW A;  2OOL A;  5K5B A;  2W1R A;  4IJG A;  2KLI A;  1ZTU A;  5I5L A;  3CIT A;  3NOU C;  4MCW A;  3MQ0 A;  4DMZ A;  2LB5 A;  2XSS A;  3S7N A;  4BWI A;  2VEA A;  4YOF A;  3KSF A;  2GX5 A;  3VV4 A;  2LB9 A;  3EEA A;  4Y2F A;  2XRO A;  4YNR A;  5LBR A;  5HPF A;  3E98 A;  1YKD A;  3IBR A;  5HPI A;  3RFB A;  4DN0 A;  3OOV A;  2XRN A;  5TJJ A;  2W1T B;  2O9A A;  4GLQ A;  2M7U A;  4MMN A;  3BJN A;  3MMH A;  3W2Z A;  5AJG A;  3C2W A;  4G3K A;  2O9B A;  2VJW A;  3R4K A;  4LRX C;  2ZMF A;  3CI6 A;  3NOT C;  4O01 A;  5HL6 A;  2B18 A;  3DBA A;  2IA2 A;  4MDZ A;  3S7P A;  2HGV A;  4ME4 A;  4R70 A;  2O99 A;  3OBF A;  3K2N A;  3E0Y A;  2K2N A;  1STZ A;  4G3W A;  2Y8H A;  1TD5 A;  2W3D A;  3HCY A;  4FOF A;  3D3O A;  3G6O A;  4Y5F A;  3MF0 A;  3NOP C;  4Q0H A;  3LFV A;  1TF1 A;  4Y3I A;  2O9C A;  3S7Q A;  2G7U A;  3KSG A;  4Z1W A;  4O8G A;  1MKM A;  4IUH A;  4Q0I A;  2O0Y A;  4R6L A;  3NHQ A;  3TRC A;  1MC0 A;  4IUK A;  4EUV A;  2K31 A;  2Y79 A;  2W1T A;  4LRZ E;  4E04 A;  4MN7 A;  4LRY C;  4PAU A;  5HSQ A;  3ZQ5 A;  1YSQ A;  1F5M A;  4O0P A;  2QYB A;  4RQ9 A;  3O5Y A;  4Q0J A;  3KSH A;  5DFY A;  5DFX A; 
#chains in the Genus database with same CATH topology
 1ONG A;  2Y2J A;  2XA7 S;  1SCW A;  3V5M A;  3HJI A;  1OT9 A;  3UN7 A;  2BG1 A;  2HP5 A;  5M18 A;  1SDN A;  3IXD A;  2ZC5 B;  4NXE A;  5CRF A;  5E43 A;  3IX8 A;  1XX2 A;  3S7N A;  3KYZ A;  4K0W A;  3HVF A;  2JBF A;  4EEU A;  3M6H A;  2LB9 A;  2XH9 A;  4GZB A;  1KGE A;  5LBR A;  2H5S A;  2FFY A;  4OPR A;  1NRJ A;  1GHM A;  2O9A A;  4GHI A;  4MMN A;  2JC7 A;  3JYI A;  3HLE A;  1S4S A;  1U60 A;  5A93 A;  1ACF A;  3ZFZ A;  5I94 A;  3H9W A;  5EEC A;  1S67 L;  4BL3 A;  3ZG9 B;  1K6R A;  4K0X A;  5FEG A;  1HTZ A;  5TFQ A;  1IEL A;  2OAP 1;  1UWN X;  1YLJ A;  1JVJ A;  5E2E A;  2ACG A;  1YLP A;  3DTK A;  3FWL A;  2V0W A;  3BFF A;  4EUZ A;  4C6Y A;  5FL3 A;  4FOF A;  1K4E A;  1TVF A;  3D3O A;  5J4E A;  1Y54 A;  4LV0 A;  3T4L A;  4E3O A;  3QP6 A;  2XDM A;  3LR0 A;  4HES A;  1L0E A;  1IKG A;  3P98 A;  3IF5 A;  1S66 L;  3ZG5 A;  2D01 A;  1PYY A;  5HX9 A;  3HLW A;  5GHX A;  5FEF A;  3IHB A;  1W8Q A;  1JTD A;  2Y2P A;  1KGF A;  1H8Y A;  3E2K A;  3ZVW A;  5TBM B;  4GB7 A;  1JWP A;  2HP6 A;  3D72 A;  5KSC A;  4GW9 A;  1SKO A;  4EV4 A;  3TSG A;  3WS4 A;  4R3B A;  1XP4 A;  3CIT A;  3BY9 A;  1K56 A;  2VEA A;  3MS6 A;  3HL9 A;  5HPF A;  1RGY A;  3NBL A;  5DJT A;  4E6W A;  4B4Z A;  1ALQ A;  1ZG4 A;  2ZQ9 A;  2VLG A;  4EQI A;  1IYS A;  3LIF A;  3W2Z A;  1L0G A;  3CZD A;  3V50 A;  1DJA A;  4BBT A;  4FUW A;  4X69 A;  1ZHH B;  3P01 A;  2PRF A;  3O88 A;  5HFO A;  3C7V A;  2ZOI A;  3E4O A;  3IX3 A;  5EE8 A;  3L7H A;  4B9O A;  4P6Z M;  4S2P A;  5HAQ A;  3T4J A;  4P6B A;  2L4R A;  4FCF A;  5EM1 A;  4EWF A;  3IS2 B;  2XFS A;  4MBH A;  4Q0H A;  1PWC A;  2ZJ9 A;  2Y2O A;  2EXB A;  3HLG A;  4HP4 A;  4YFM A;  3HRE A;  2WGW B;  4PM8 A;  4X68 A;  3IWQ A;  2V0U A;  4LRY C;  4UA7 A;  1OJG A;  5CED A;  3Q81 A;  5GLB A;  4PMA A;  4OLG A;  3NDE A;  1K6S A;  3C8C A;  3BEB A;  3WWX A;  3DTM A;  2KOI A;  4JPM A;  4KZB A;  4S2O A;  2ZBB A;  3R7W B;  3HBR A;  1VQQ A;  4M3K A;  3SOI A;  3IXB A;  4R3J A;  3IHA A;  2FH5 A;  4Y0O A;  3Q7V B;  4MBK A;  4P87 A;  1YQS A;  3F1N B;  1MBL A;  4IVK A;  4KZ6 A;  4UEY A;  4FD8 A;  3MKE A;  2RCX A;  3T1X A;  3GR2 A;  1NLZ A;  2WKH A;  4OVD A;  5J8X A;  3MXS A;  3F1P A;  5TJJ A;  2PYR A;  2VGK A;  2M7U A;  3NDG A;  1XJ4 A;  3GRJ A;  4ZTK A;  1BUL A;  3UB7 A;  2PD8 A;  3QP8 A;  3VFH A;  1G5U A;  2JE5 A;  2VX8 A;  2EXA A;  2V1B A;  4R0Q A;  3OBF A;  4OOL A;  5FI2 A;  5CER A;  2A24 A;  4X6T A;  2Y8H A;  3PAG A;  5DKK A;  4BBV A;  4DE3 A;  4UAA A;  3O86 A;  2OAQ 1;  3HCY A;  1L2S A;  4JF5 A;  5EVI A;  5F1F A;  1K54 C;  4Y5F A;  4JXS A;  5HDC A;  4N9K A;  4NXF A;  4IUH A;  4IED A;  3LIC A;  1ERM A;  3H82 A;  4EUV A;  4N92 A;  3SZT A;  2VA0 A;  2ZL1 A;  4CLC D;  3ZHH A;  4X1M A;  2GNX A;  4XT2 B;  4GKU A;  4JXW A;  5AQ9 A;  1VM1 A;  5CTN A;  4JF4 A;  2HZ5 A;  4Z9Q A;  1K4F A;  4S2N A;  3Q07 A;  5EM0 A;  1XPB A;  5A8B A;  5J3W A;  1NY0 A;  3LEZ A;  5HD5 A;  1GA0 A;  5DTK A;  3IBJ A;  4U0X A;  2Y2M A;  1WA9 A;  4LGW A;  2PD7 A;  1N9B A;  5CHJ A;  1WE4 A;  4MCW A;  1OJ5 A;  1MKI A;  4HIA A;  2XF3 A;  2WGI A;  2WAF A;  2A49 A;  3HLD A;  3LR5 A;  4JF6 A;  5F69 A;  2ZQ8 A;  3GMW A;  3T4O A;  5A91 A;  3G32 A;  2HDS A;  1PWG A;  4RX2 A;  3MXQ A;  3WRT A;  3GQZ A;  3JPU A;  2VV8 A;  3MZF A;  5D3O A;  2RL3 A;  1QME A;  2Z6C A;  5F5Y A;  3MJQ A;  4WZ5 A;  5HL6 A;  2Z6D A;  2IA2 A;  3CMZ A;  4OPZ A;  2C5W B;  5HAP A;  2WYX A;  4CLC E;  5L09 A;  3LR3 A;  4E3I A;  5GLA A;  2VGL S;  3A0V A;  4CJN A;  1PNE A;  4HOI A;  3DAV A;  5FAT A;  1K38 A;  1YM1 A;  3M2K A;  4NXG A;  5FA7 A;  1OPX A;  1W79 A;  5HWV A;  3VP0 A;  3BW6 A;  1C3B A;  4GOG A;  4EER A;  3KSG A;  4ZJ1 A;  2V8C A;  1KDW A;  2IWD A;  3A3E A;  4S2K A;  4YWZ A;  4GDN A;  4EES A;  4I39 A;  4X56 A;  4BMW A;  3S7O A;  1D7E A;  4IVI A;  3S22 A;  3EQV A;  1F2K A;  2D02 A;  3VSL A;  2UWX A;  1JWZ A;  3GSG A;  4KZ9 A;  3QP1 A;  3LUQ A;  3KYQ A;  3DWZ A;  1J3W A;  1NWZ A;  2OWH A;  4R4S A;  5L8M A;  4YIN A;  4LV3 A;  4IJG A;  1ZTU A;  5I5L A;  1KVM A;  3GV9 A;  2ZC3 B;  3ISG A;  2WKI A;  3PBR A;  3CLO A;  4UQI S;  1FR1 A;  4PPR A;  5GLD A;  1Y4O A;  4RA7 A;  3MMH A;  3A3I A;  5M19 A;  5AJG A;  3ZG8 B;  3RJU A;  5E2F A;  2PBY A;  4DE2 A;  4BLM A;  2JHE A;  1ESU A;  2X02 A;  1YLY A;  1NRF A;  1J9M A;  2E8J A;  2EFU A;  2PHY A;  1FCO A;  4G3W A;  3BLS A;  3EGD C;  5DKL A;  3N8L A;  3D4F A;  4R3A A;  5CGW A;  2Y2Q A;  2H0Y A;  3F1O A;  4XXR A;  4BL2 A;  5KIZ A;  4UA6 A;  1TDL A;  5FQJ A;  4R38 A;  3V67 A;  4Q0I A;  3N8R A;  2IWB A;  4EET B;  2ZC7 A;  3RXX A;  1NJ4 A;  3MZE A;  4WF0 A;  5EVI C;  1PZO A;  4DXC A;  3HUN A;  2PDR A;  3T1S A;  2R9X A;  3T4Q A;  1G6O A;  1S6R A;  3ZQ5 A;  1TS6 A;  2J3W A;  5JYO A;  4RQ9 A;  4Q0J A;  3VSK A;  1YPR A;  1XXM A;  1BZA A;  2XR0 A;  4E3J A;  3CPT B;  3ZYT A;  2EX2 A;  1FIK A;  3KSI A;  1KGG A;  3PBT A;  4WM9 A;  1ERQ A;  3OPR A;  3Q82 A;  5DF9 A;  3GTC A;  1KE4 A;  3DTI A;  1L3L A;  2Y2G A;  3FKV A;  2X01 A;  5TBM A;  3SS4 A;  4BEN A;  3O3V A;  1PRQ A;  4QU3 A;  1VET A;  3HLB A;  3HLC A;  4K08 A;  2J9P A;  4OOM A;  3QNB A;  4OP8 A;  4WMC A;  2EX8 A;  2VK3 A;  1GCE A;  2DNS A;  3CWF A;  3P7N A;  4I3J A;  1NZO A;  3V3R A;  3K2N A;  4KZ4 A;  3LI8 A;  3UPP A;  1WYB A;  2WUQ A;  4WZ5 C;  2BTF P;  1H3Q A;  3B47 A;  1H5X A;  2EA9 A;  1GHP A;  5F68 A;  2A3U A;  5F83 A;  1TD5 A;  4O7D A;  2JN7 A;  2J9O A;  1D1J A;  3PAE A;  4HH2 A;  2VGJ A;  5CTM A;  1FIL A;  3NJA A;  3CJM A;  4AFI A;  4KZA A;  4GD6 A;  3D9Y A;  4WBG A;  2V1Z A;  1GSW A;  3MFX A;  1ZC2 A;  3IS2 A;  1OTD A;  3SH7 A;  3UDI A;  4R23 A;  5C5K A;  3TJZ C;  1H0M A;  3MFD A;  4KZ5 A;  1D06 A;  4L9E A;  1LI0 A;  2OOL A;  5EFW A;  3G31 A;  2V8F A;  1T1A A;  3NCK A;  1YLT A;  3BFG A;  2X71 A;  3MQ0 A;  4C75 A;  2B95 A;  4LCM A;  2XQZ A;  3R7W A;  5G4Y A;  1LHY A;  3ZNT A;  4OQI A;  4MN5 A;  3OCN A;  1YT4 A;  4F94 A;  4P6Z S;  4BD0 A;  5L10 A;  1K57 A;  1IKI A;  3OPP A;  2PR5 A;  3W4O A;  2WAD A;  3G4P A;  1SDE A;  4IHQ A;  1TS7 A;  4DF6 A;  1Q2Q A;  1VB6 A;  1W63 M;  5CEC A;  1TDG A;  4E3M A;  1CI8 A;  3LYX A;  1LLB A;  5U47 A;  4OPY A;  1PZP A;  3PXP A;  4KQD A;  2Q9N A;  4JBF A;  3CUE A;  4HBU A;  4EBL A;  4PM5 A;  1LL5 A;  2JKT I;  2P08 A;  4OQH A;  1DY6 A;  2OWJ A;  4WEK A;  4KZ3 A;  2Y2I A;  3NHQ A;  3TRC A;  4B4X A;  2H10 A;  3G35 A;  3K3C A;  4X53 A;  2W1T A;  5FDH A;  4WEJ A;  5HW3 A;  3C4O A;  3UE1 A;  4XUZ A;  1XA1 A;  4JGP A;  4KG5 A;  1YSQ A;  1LSW A;  1LSV A;  4ZRR A;  5DFX A;  1IYO A;  1N9L A;  3ULF A;  5HWW A;  1M40 A;  4D60 A;  3IF6 C;  3KO6 A;  1A0K A;  4OOY A;  1JTG A;  5KZH A;  4XT2 A;  2JKT M;  3BLM A;  5AQA A;  2MJ6 A;  3BQA A;  4GCZ A;  4HY8 A;  3UB6 A;  1W8Y A;  4KZ7 A;  1RP5 A;  4F3L B;  3PBN A;  1LI9 A;  2WKE A;  4JKT A;  3JVV A;  1IFQ A;  3QHY A;  2J3T C;  1XJ3 A;  1KDS A;  4PM9 A;  2ZQC A;  3LIA A;  3NOT C;  3BM6 A;  1CF0 A;  2ZD8 A;  3BEC A;  2FZ0 A;  2HGV A;  4R70 A;  3IXG A;  3MXR A;  5DF8 A;  3MKF A;  1JWV A;  1ES2 A;  5TGF A;  3GVB A;  2DMW A;  3EQU A;  1SKO B;  4S2J A;  1T19 A;  5IS1 A;  5E2H A;  4S2I A;  3UO9 A;  2OV5 A;  2G7U A;  5A90 A;  1YMX A;  1W7F A;  1MC0 A;  3G2Y A;  1IOU A;  2HV1 A;  4HJ3 A;  4QB8 A;  3A3F A;  5EVI D;  5FQM A;  3FC7 A;  4OPQ A;  2UV0 E;  2P04 A;  4ID4 A;  4MN7 A;  4E04 A;  5FAQ A;  3FG8 A;  3MQO A;  3TW8 A;  5EUA A;  3RH8 B;  3FPW A;  3WS0 A;  3LEQ A;  1K55 A;  4HQA A;  2J7V A;  3TE8 A;  3NEC A;  3ZDJ A;  2BLS A;  4UA9 A;  3GEC A;  2ZC4 B;  5EPH A;  3FZC A;  2QJ5 A;  2ZC6 B;  3U2A A;  3W4Q A;  4QPR A;  2W3H A;  3LIE A;  3NC8 A;  1VEU A;  4NXB A;  4S2M A;  1OME A;  5KMW A;  5IT5 A;  1F9I A;  4DJ2 A;  4Y15 A;  4JXV A;  3BY8 A;  3EEA A;  1NYY A;  4YNR A;  3E98 A;  1T1B A;  3IT9 A;  1RGZ A;  3BRM A;  2VV7 A;  4LCL A;  4GLQ A;  1P0Z A;  1P9W A;  1P9R A;  2PR6 A;  1WYC A;  3DW0 A;  1DP9 A;  3OCL A;  3ITA A;  4CLC A;  1S0W A;  1CEG A;  4HNB A;  4QD4 A;  4FTX A;  4OP5 A;  2PAV P;  1K57 C;  2Y2L A;  4MDZ A;  3RXW A;  2HP9 A;  1CEF A;  4I38 A;  3C7U A;  4HH3 A;  3N8S A;  5FSR A;  1Z09 A;  4ESP A;  1SHV A;  3LCE A;  1L0D A;  3C4P A;  1EI5 A;  4LPZ A;  3ZNY A;  1V9Y A;  2Y4A A;  4P0M A;  2WZZ A;  1ES5 A;  3CUE C;  4QWO A;  3Q1F A;  3VOL A;  4E6X A;  1I2S A;  3PR6 A;  4JXG A;  4L9F A;  4S2L A;  4IUK A;  2Z2L B;  1FOF A;  3F1P B;  3PBO A;  1CJF A;  4K91 A;  3PTE A;  1BLS A;  2M1C A;  4Y17 A;  3UME A;  4QJG A;  5FI6 A;  3VP3 A;  1PIO A;  4ZBE A;  2WKP A;  2HF6 A;  2A2L A;  3BYD A;  1BLP A;  2EFX A;  2CC1 A;  3OZH A;  3RTY A;  4OLD A;  4X55 A;  2HJE A;  3JVU A;  1PWD A;  4MBF A;  5FDS A;  4ARZ B;  3UNW A;  4WN5 A;  2VV6 A;  3PBQ A;  1ES4 A;  1BYW A;  4BQM A;  5EVI B;  4DMZ A;  3CHW P;  3UPN A;  3CPT A;  1UGU A;  1HD8 A;  3UDX A;  3RFB A;  3H82 B;  4OQ0 A;  2G2U A;  3M6B A;  1DP6 A;  2QZ6 A;  2ZL1 B;  1EW0 A;  5HD3 A;  3T1R A;  3IWO A;  2B02 A;  3QP5 A;  2ZOH A;  3MBZ A;  4O01 A;  2QHK A;  3T4S A;  5AVF A;  2B18 A;  1QMF A;  4B93 A;  1DP8 A;  3T1Q B;  4ZDX A;  1N9O A;  5CHU A;  4I3A A;  5G18 A;  1MY8 A;  5EV0 A;  3ZVT A;  5HDD A;  2VGL M;  2W3D A;  2JKR M;  3M2J A;  3V39 A;  1ESI A;  1W63 Q;  3P09 A;  3NOP C;  5AQB A;  2YKF A;  3NUL A;  2WZX A;  5J7E A;  2J80 A;  1MZU A;  4Y0T A;  4MN6 A;  4R6L A;  2PU4 A;  2QKP A;  1UWP X;  1BLH A;  3DWK A;  2K31 A;  4R4R A;  3W4P A;  4GN2 A;  4WUJ A;  1OTE A;  2V1A A;  3EGX C;  1F5M A;  3WS2 A;  2QYB A;  4IBX A;  5EVE A;  5CGX A;  2W27 A;  2W3F A;  2M7V A;  5CGS A;  1MPL A;  2KDK A;  1YLW A;  4II7 A;  1Z6F A;  3A3J A;  1E3U D;  4ZJ2 A;  2I9V A;  1K55 C;  2ZMA A;  4ETX A;  2I72 A;  2QJ7 A;  2L0W A;  4WYY A;  5K5B A;  4HI4 A;  1DJC A;  4DXB A;  2DCF A;  1K25 A;  2JCH A;  2LB5 A;  3IQA A;  1BSG A;  2XGN A;  1XKZ A;  4JGR A;  4A5R A;  4JGQ A;  1XJ2 A;  3WS5 A;  4LFU A;  3OPL A;  3T50 A;  1TS0 A;  2Q0O A;  4H8R A;  1FSY A;  2Z2M B;  3HUM A;  3PHY A;  1IYQ A;  5IHV A;  4S2N C;  3WS1 A;  5L2F A;  3H7W B;  2J3T D;  4WEL A;  2VJW A;  3R4K A;  1EWZ A;  3S4X A;  4GNU A;  4KQQ A;  4WZ4 A;  4CLC C;  2B5R A;  1ZG6 A;  4QHC A;  2V20 A;  4E3L A;  1W5D A;  3B42 A;  4HBT A;  5CXW A;  3ZG7 B;  1JNU A;  2XD5 A;  3UE0 A;  3ZGA B;  3MF0 A;  4B88 A;  1KVL A;  2QPN A;  1XGI A;  1HVB A;  2Y79 A;  3E2L A;  1YLZ A;  5TR7 A;  5FQI A;  4WL9 A;  4HJ6 A;  1PI5 A;  2ZM8 A;  3EOI A;  3HJK A;  4O0P A;  2ZM0 A;  2OLV A;  3KSH A;  3VOY A;  2H0T A;  3LIB A;  2OSU A;  5FQQ A;  1BTL A;  3A3D A;  4EBN A;  2W3G A;  2E8I A;  4CQH A;  3S1Y A;  3VFF A;  3VE4 A;  4MLL A;  5BOH A;  3MQQ A;  3QNC A;  2W0N A;  4EU0 A;  3LGO A;  2VZW A;  2HPB A;  2ZQ7 A;  4N9L A;  3VP4 A;  3QP4 A;  3FPV A;  1ODV A;  4NKP A;  3F1O B;  5JYP A;  4YOF A;  4H6J B;  2XA7 M;  3EWK A;  2P7J A;  3MZD A;  4GS9 B;  4LV1 A;  1K54 A;  5AVE A;  2V9A A;  5L07 A;  3TG9 A;  1X0O A;  2WGW A;  3W8K A;  1XFN A;  3BJN A;  3LY3 A;  1CK3 A;  1TS8 A;  2NUT C;  3CI6 A;  3PYP A;  4BJP A;  3DBA A;  4F3L A;  3IF6 B;  2JKF A;  1E4D A;  3B3X A;  3S7P A;  1G6A A;  1BT5 A;  4ME4 A;  2IWC A;  4I5S A;  4I3I A;  1FCN A;  5E2G A;  2PYP A;  3Q7V A;  2BAS A;  1V9Z A;  3UB8 A;  2P9V B;  1K56 D;  4GDB A;  1FCM A;  3F1N A;  4L0L A;  1KOU A;  3I7J A;  1HLU P;  3WRZ A;  1H8M A;  2O9C A;  5F6A A;  2R9W A;  1GA9 A;  3K3D A;  2XEP A;  1PFL A;  3C38 A;  1NLY A;  1XGJ A;  5EVL A;  3LY4 A;  5HDS A;  4DKI A;  1VET B;  5FQ9 A;  3SH8 A;  3IX4 A;  5GL9 A;  4R1G A;  4RX3 A;  3NIA A;  3N4I A;  5AQ7 A;  5IU1 A;  4HP9 A;  2PU2 A;  4RYE A;  1GSX A;  5HAR A;  1YSP A;  2R78 A;  1PI4 A;  1G28 A;  4GHI B;  4X1L A;  2VKS A;  3HUO A;  4OH0 A;  2KLI A;  3NOU C;  3FYZ A;  3UB5 P;  2GX5 A;  4Y2F A;  5HAI A;  3BWL A;  1NZU A;  5DJU A;  2XRN A;  3UPO A;  3ITB A;  1GSV A;  5CEB A;  2HDR A;  5F1G A;  3C2W A;  2O9B A;  4LRX C;  3KX0 X;  5CHM A;  3SS5 A;  2ZM2 A;  1SZV A;  1E25 A;  4E3K A;  2ZLY A;  4GD8 A;  5GLC A;  4JLF A;  3ZG0 A;  1I5Q A;  1ES3 A;  2O99 A;  3E0Y A;  1ZKJ A;  3OPH A;  4LV2 A;  4OON A;  2INW A;  1PW1 A;  2XFT A;  4HEF A;  4JGO A;  3T4K A;  4LLO B;  3ZCZ A;  3LI9 A;  3DTE A;  1TF1 A;  3UDF A;  4ZAM A;  5DF7 A;  3C5A A;  3AGE A;  4O8G A;  4WLA A;  4DE1 A;  1XFQ A;  3N7W A;  5EOO A;  3AGF A;  3B33 A;  5FQK A;  1DRM A;  2FFF B;  5HSQ A;  3U4L P;  1FR6 A;  1DJB A;  4EBP A;  5DFY A;  2HDQ A;  4NK3 A;  1N9N A;  5KSH A;  4Y0U A;  4KG6 A;  5A92 A;  2C6W B;  1TEM A;  3O87 A;  4NEE D;  3MSH A;  4BBU A;  4DRT A;  3VP1 A;  3EEH A;  1LSX A;  3UY6 A;  3GDI A;  4U3T A;  1MWU A;  4G3V A;  1GHI A;  4Y13 A;  3VP2 A;  4KQO A;  3T12 B;  4XUX A;  1O07 A;  4NET A;  2KX6 A;  1H8Z A;  1OTA A;  4UHU A;  3KSF A;  5FAS A;  1T18 A;  2XLN A;  2XRO A;  3SW1 A;  2AVX A;  3G30 A;  5CX7 A;  2Y2H A;  3IBR A;  3IH8 A;  4ARZ A;  3OOV A;  3OLO A;  3BQ8 A;  2W1T B;  4ZJ3 A;  1BUE A;  2WK0 A;  3N6I A;  2Y59 A;  1S1Y A;  3SS3 A;  3NI9 A;  2PBD P;  1Q2P A;  1AXB A;  3VOZ A;  5M1A A;  4OKP A;  4Y7P A;  4PHT A;  1YAX A;  2EX9 A;  4KQR A;  1LL8 A;  2H28 A;  4PKY G;  5HL1 A;  4PM6 A;  3KYE A;  3NY4 A;  2G2W A;  4D2O A;  1LL9 A;  4N1H A;  4KUO A;  2GDN A;  3LFV A;  5HZH A;  1ERO A;  4GJ4 A;  3IXH A;  2O0Y A;  2WAE A;  4C3Q A;  3FKW A;  3A0S A;  2JKG A;  1BLC A;  3AGD A;  1G68 A;  1KE0 A;  4KZ8 A;  2Y91 A;  1CQA A;  3E4Q A;  5EOE A;  1N4O A;  2EWV A;  3CG5 A;  3L9K A;  3UE3 A;  5DVA A;  4U0T A;  1PW8 A;  1AWI A;  4OQG A;  5FAP A;  1T1C A;  1SKF A;  3ICY A;  5FI7 A;  2NUP C;  1VHM A;  3VMA A;  5HWT A;  2W3E A;  4ETZ A;  2EWW A;  3IH9 A;  3G34 A;  3LR4 A;  1Y28 A;  2W1R A;  1MWT A;  3BFD A;  4X25 A;  4IBR A;  4BWI A;  4M4X A;  3FV7 A;  1NXY A;  1YKD A;  1LT0 A;  5HPI A;  4DN0 A;  4PKY A;  2ZQA A;  3G2Z A;  4DDS A;  1YMS A;  1XJ6 A;  2A24 B;  2JKR I;  2V2F F;  2CMN A;  2QWS A;  4QY6 A;  4HHD A;  2OLU A;  3TOI A;  4P85 A;  4EEP A;  1M6K A;  2K7S A;  3BFC A;  2WKQ A;  3SH9 A;  4FH2 A;  2WGV A;  2Y55 A;  1HZO A;  4PM7 A;  4L9G A;  4QY5 A;  3UB9 A;  1MXO A;  1VEU B;  1RCJ A;  3H7W A;  1O7E A;  2DRW A;  1KE3 A;  1FSW A;  4HJ4 A;  1OTI A;  3LO7 A;  2ZQD A;  5MC7 A;  4Z1W A;  1MKM A;  2EX6 A;  5GHZ A;  4DDY A;  4RVA A;  4CPK A;  1L0F A;  4LRZ E;  2J8Y A;  4EW7 A;  4PAU A;  3V3S A;  4KUK A;  1MWS A;  4DJ3 A;  4EQ1 A;  3E4P A;  4N1X A;  5G4Z A;  2WKR A;  4LEN A;  3O5Y A;  5FAO A;  4CLC B;  1IYP A;  3VE3 A;  1XA7 A;  3T4T A;  2Q9M A;  2XK1 A;  1K0K A;  1FQG A;  4FSF A;  3MR0 A;  2Y2N A;  2XSS A;  3VV4 A;  1OTB A;  3UE6 A;  3PBS A;  2GZA A;  4FH4 A;  4DE0 A;  2QMI A;  2ZMV A;  2HJ9 C;  4KG2 A;  4MEZ A;  3C30 A;  2L1M A;  3HLF A;  3OC2 A;  4Q8I A;  4G3K A;  2ZMF A;  2Y2K A;  1P97 A;  5F82 A;  4H6J A;  1ONH A;  3LID A;  3IWI A;  3Q7Z A;  4GS9 A;  1S1Z A;  2HDU A;  2YKH A;  1CI9 A;  2K2N A;  4UQI M;  1STZ A;  3A0R A;  4EXO A;  1E3U A;  1OT6 A;  4KEN B;  2PT7 A;  5GHY A;  3QP2 A;  3G6O A;  3IF6 A;  4MNR A;  1IEM A;  4Y3I A;  1F98 A;  3S7Q A;  3CAX A;  4E3N A;  4BD1 A;  3UMD A;  2P9V A;  1S4R A;  3BFE A;  2XD1 A;  4WMC D;  1MWR A;  4NG2 A;  5DTS A;  5DTT A;  2GJ3 A;  1NYM A;  2P74 A;  1I2W A; 
#chains in the Genus database with same CATH homology
 4HQA A;  3S7O A;  2XA7 S;  1D7E A;  3TE8 A;  3EQV A;  5IU1 A;  2D02 A;  3GEC A;  4HP9 A;  2QJ5 A;  3HJI A;  3U2A A;  3LUQ A;  1OT9 A;  1GSX A;  3KYQ A;  4QPR A;  2W3H A;  1NWZ A;  2OWH A;  1YSP A;  2R78 A;  3LIE A;  5L8M A;  1G28 A;  4GHI B;  2VKS A;  4NXE A;  4NXB A;  5IT5 A;  4IJG A;  2KLI A;  1ZTU A;  5I5L A;  1F9I A;  3NOU C;  3S7N A;  4DJ2 A;  3KYZ A;  2GX5 A;  3BY8 A;  4EEU A;  2LB9 A;  3EEA A;  4Y2F A;  4YNR A;  5LBR A;  3BWL A;  3E98 A;  1T1B A;  3PBR A;  3CLO A;  4UQI S;  5DJU A;  2XRN A;  1NRJ A;  2VV7 A;  2O9A A;  4GHI A;  4GLQ A;  1GSV A;  1P0Z A;  1P9W A;  1P9R A;  3MMH A;  4MMN A;  2PR6 A;  1DP9 A;  1S4S A;  3OCL A;  5AJG A;  3C2W A;  2O9B A;  4LRX C;  4CLC A;  4HNB A;  3KX0 X;  2JHE A;  3H9W A;  4MDZ A;  1S67 L;  2O99 A;  3E0Y A;  4I38 A;  2OAP 1;  4HH3 A;  1UWN X;  2INW A;  2PHY A;  4G3W A;  3EGD C;  5DKL A;  4JGO A;  2V0W A;  4R3A A;  4LPZ A;  5FL3 A;  4FOF A;  3T4K A;  1V9Y A;  3D3O A;  4LLO B;  5J4E A;  3F1O A;  3LI9 A;  5KIZ A;  3T4L A;  1TF1 A;  3CUE C;  4R38 A;  4O8G A;  4WLA A;  3VOL A;  3V67 A;  3PR6 A;  4Q0I A;  4L9F A;  4EET B;  3LR0 A;  1XFQ A;  4IUK A;  4WF0 A;  3F1P B;  3PBO A;  3B33 A;  1DRM A;  2PDR A;  3T4Q A;  5HSQ A;  1G6O A;  1S66 L;  3ZQ5 A;  1TS6 A;  2D01 A;  2M1C A;  2J3W A;  4RQ9 A;  4Q0J A;  3UME A;  5DFY A;  2WKP A;  1N9N A;  5KSH A;  2HF6 A;  2A2L A;  5TBM B;  3RTY A;  4NEE D;  3ZYT A;  4BBU A;  2HJE A;  3JVU A;  3EEH A;  4ARZ B;  3KSI A;  3D72 A;  3PBT A;  4WN5 A;  1LSX A;  3GDI A;  4GW9 A;  4G3V A;  2VV6 A;  3PBQ A;  1BYW A;  5DF9 A;  4KQO A;  3CIT A;  3BY9 A;  4DMZ A;  2KX6 A;  2VEA A;  1OTA A;  3KSF A;  2XRO A;  1T18 A;  3SW1 A;  5TBM A;  5HPF A;  1UGU A;  5CX7 A;  5DJT A;  3IBR A;  3RFB A;  3H82 B;  4ARZ A;  3OOV A;  3OLO A;  3BQ8 A;  2W1T B;  1DP6 A;  2VLG A;  1EW0 A;  5HD3 A;  4K08 A;  3LIF A;  3W2Z A;  4OOM A;  2B02 A;  2ZOH A;  4O01 A;  2QHK A;  3T4S A;  5AVF A;  2B18 A;  1S1Y A;  4BBT A;  4B93 A;  1DP8 A;  1ZHH B;  3P01 A;  3CWF A;  3P7N A;  4I3J A;  2ZOI A;  3E4O A;  3K2N A;  4PHT A;  1N9O A;  4B9O A;  3LI8 A;  1YAX A;  1H3Q A;  3B47 A;  1LL8 A;  2H28 A;  4I3A A;  4P6Z M;  2EA9 A;  4PKY G;  5F68 A;  5HDD A;  3T4J A;  2VGL M;  2L4R A;  1TD5 A;  2W3D A;  2JKR M;  2JN7 A;  3IS2 B;  1W63 Q;  4KUO A;  3NOP C;  4Q0H A;  4HH2 A;  3LFV A;  2YKF A;  5HZH A;  5J7E A;  4GJ4 A;  2J80 A;  3NJA A;  1MZU A;  4MN6 A;  2O0Y A;  4R6L A;  4HP4 A;  2QKP A;  1UWP X;  4AFI A;  2K31 A;  3A0S A;  1GSW A;  1OTE A;  2V0U A;  4WUJ A;  4LRY C;  3MFX A;  2V1A A;  3EGX C;  3IS2 A;  1OJG A;  1F5M A;  1OTD A;  3E4Q A;  2QYB A;  2EWV A;  3C8C A;  2W27 A;  2KOI A;  3UE3 A;  2W3F A;  5C5K A;  2M7V A;  3TJZ C;  2ZBB A;  3R7W B;  2KDK A;  4II7 A;  1T1C A;  3ICY A;  1D06 A;  2I9V A;  4L9E A;  2NUP C;  1VHM A;  5HWT A;  2FH5 A;  2W3E A;  4ETX A;  4ETZ A;  2QJ7 A;  2EWW A;  2OOL A;  5EFW A;  3LR4 A;  2L0W A;  1Y28 A;  5K5B A;  1T1A A;  2W1R A;  3F1N B;  4HI4 A;  4UEY A;  3MQ0 A;  2LB5 A;  4BWI A;  4M4X A;  3R7W A;  5G4Y A;  4JGR A;  1NLZ A;  4JGQ A;  1XJ2 A;  1YKD A;  1LT0 A;  3T50 A;  5HPI A;  4MN5 A;  1TS0 A;  3OCN A;  4DN0 A;  3F1P A;  4P6Z S;  4PKY A;  5TJJ A;  2PYR A;  2M7U A;  3PHY A;  1XJ6 A;  2A24 B;  2PR5 A;  1XJ4 A;  3H7W B;  2J3T D;  2JKR I;  2VJW A;  3R4K A;  4WEL A;  3UB7 A;  4IHQ A;  1TS7 A;  2PD8 A;  2CMN A;  2QWS A;  4HHD A;  1VB6 A;  4EEP A;  2K7S A;  1W63 M;  2VX8 A;  3LYX A;  2WKQ A;  2V1B A;  3OBF A;  4CLC C;  4OOL A;  3PXP A;  4KQD A;  4L9G A;  2A24 A;  3CUE A;  3UB9 A;  3B42 A;  2Y8H A;  5DKK A;  4BBV A;  1JNU A;  3H7W A;  2JKT I;  2P08 A;  2OAQ 1;  3HCY A;  4Y5F A;  3MF0 A;  4HJ4 A;  2OWJ A;  5HDC A;  1OTI A;  4NXF A;  4WEK A;  5MC7 A;  4Z1W A;  1MKM A;  4IUH A;  3LIC A;  3NHQ A;  3TRC A;  3H82 A;  4EUV A;  3K3C A;  2Y79 A;  2W1T A;  4WEJ A;  2VA0 A;  4LRZ E;  4CLC D;  4WL9 A;  4EW7 A;  2GNX A;  4PAU A;  4HJ6 A;  4JGP A;  4KUK A;  4DJ3 A;  4EQ1 A;  3E4P A;  3EOI A;  4XT2 B;  1YSQ A;  5G4Z A;  2WKR A;  3HJK A;  4O0P A;  1LSW A;  3O5Y A;  1LSV A;  3KSH A;  4ZRR A;  5DFX A;  4CLC B;  3LIB A;  1N9L A;  3VE3 A;  3ULF A;  2W3G A;  3T4T A;  5A8B A;  4CQH A;  5HWW A;  5J3W A;  3VE4 A;  5HD5 A;  3MQQ A;  3KO6 A;  2W0N A;  4EU0 A;  3IBJ A;  4FSF A;  4XT2 A;  2VZW A;  1WA9 A;  2JKT M;  2PD7 A;  3MR0 A;  2MJ6 A;  3BQA A;  3FPV A;  4GCZ A;  4HY8 A;  1ODV A;  4NKP A;  3UB6 A;  3F1O B;  4MCW A;  1OJ5 A;  2XSS A;  4HIA A;  4YOF A;  3VV4 A;  4H6J B;  4F3L B;  1OTB A;  3PBN A;  3UE6 A;  2XA7 M;  3EWK A;  3PBS A;  2P7J A;  2GZA A;  2ZMV A;  4GS9 B;  3LR5 A;  5AVE A;  2V9A A;  5F69 A;  1X0O A;  3T4O A;  3JVV A;  1XFN A;  2HJ9 C;  1IFQ A;  3C30 A;  3BJN A;  3MXQ A;  2J3T C;  1XJ3 A;  2L1M A;  2VV8 A;  3OC2 A;  1TS8 A;  2Z6C A;  5F5Y A;  4G3K A;  3MJQ A;  3LIA A;  2NUT C;  2ZMF A;  3CI6 A;  3NOT C;  3PYP A;  4BJP A;  5HL6 A;  1P97 A;  2Z6D A;  4H6J A;  3DBA A;  4F3L A;  2IA2 A;  2FZ0 A;  3LID A;  3S7P A;  2HGV A;  4ME4 A;  4GS9 A;  4I5S A;  4R70 A;  4I3I A;  1S1Z A;  2YKH A;  4CLC E;  2K2N A;  4UQI M;  2PYP A;  3LR3 A;  1STZ A;  2BAS A;  1V9Z A;  2DMW A;  2VGL S;  3A0R A;  3A0V A;  3UB8 A;  4EXO A;  4HOI A;  3EQU A;  1OT6 A;  3F1N A;  2PT7 A;  4L0L A;  4NXG A;  1KOU A;  1OPX A;  5HWV A;  1T19 A;  3G6O A;  5IS1 A;  3BW6 A;  1H8M A;  4Y3I A;  1F98 A;  2O9C A;  5F6A A;  3S7Q A;  2G7U A;  4EER A;  3KSG A;  3CAX A;  3K3D A;  1MC0 A;  3C38 A;  1IOU A;  3UMD A;  2HV1 A;  4HJ3 A;  1NLY A;  4YWZ A;  3FC7 A;  1S4R A;  2P04 A;  4E04 A;  4MN7 A;  4EES A;  5HDS A;  3FG8 A;  3MQO A;  4I39 A;  4BMW A;  2GJ3 A;  3TW8 A;  3RH8 B;  3FPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...