3K2NA

The crystal structure of sigma-54-dependent transcriptional regulator domain from chlorobium tepidum tls
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
177
structure length
177
Chain Sequence
SNAALKLMQYIGDAIGTIRDPQELFRTVTDKLRLLFAFDSAVIITIDRERREASVFFEMLRFELPEQLRHQTRSIAGTWLEGHLDDRTVTVASIARDIPSFGADGAPLLWTLHELGMRQIVLSPLRSGGRVIGFLSFVSAEEKLWSDGDKSLLSGVSSSIAIAVSNALAYEELRQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Sigma-54-dependent transcriptional regulator
publication title The crystal structure of sigma-54-dependent transcriptional regulator domain from Chlorobium
rcsb
source organism Chlorobium tepidum tls
total genus 48
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3k2nA00
4RQ9A 3TRCA 2XSSA 5DFYA 1STZA 2W1RA 2QYBA 3OOVA 3S7PA 5DFXA 3KO6A 4YOFA 4Q0HA 5LBRA 4R6LA 2ZMFA 3EEAA 2O9BA 1MC0A 3S7NA 3IBJA 5I5LA 2XRNA 4ETXA 4GLQA 4Y5FA 3MQ0A 2W1TA 4ZRRA 3KSHA 2G7UA 3LFVA 2VKSA 3ZQ5A 5K5BA 3S7QA 5HSQA 1ZTUA 3NHQA 2O9CA 4BWIA 4YNRA 4CQHA 2Y79A 3MMHA 4ME4A 4Z1WA 4G3KA 2B18A 5HPFA 2KLIA 3IBRA 1TD5A 3BJNA 3MF0A 3O5YA 4Q0JA 4Y3IA 1YKDA 4IUHA 3HCYA 3E0YA 2XROA 4LRZE 3R4KA 2M7VA 3CI6A 3K2NA 3KSIA 2O9AA 3RFBA 3G6OA 1VHMA 2O0YA 4IUKA 4Y2FA 3E98A 4MMNA 4EU0A 2W3EA 2K31A 2W3FA 3D3OA 2GX5A 4FOFA 4MCWA 4ETZA 2W1TB 4QPRA 5L8MA 5AJGA 2K2NA 3S7OA 2M7UA 3NOUC 3C2WA 3KSGA 2W3GA 5TJJA 1TF1A 3DBAA 4G3VA 2O99A 2VJWA 2VZWA 2W3DA 4DMZA 2IA2A 1F5MA 2VEAA 4O01A 4GW9A 2Y8HA 2KOIA 4LRYC 3KSFA 3NOPC 1YSQA 1YSPA 4MN7A 4E04A 4EUVA 4IJGA 2HGVA 4LRXC 4O0PA 4PAUA 5HPIA 2W3HA 3CITA 2LB9A 4O8GA 2OOLA 1MKMA 3W2ZA 3NOTC 4R70A 4Q0IA 3VV4A 4DN0A 2LB5A 5C5KA 4G3WA 5HL6A 4MDZA 3OBFA
chains in the Genus database with same CATH superfamily
4DXBA 3VSKA 1MWTA 3HLEA 5DFXA 4JGRA 1FIKA 3BQAA 2BASA 5KSCA 1LT0A 3OPHA 4YFMA 2VGKA 2DRWA 1FR6A 4BWIA 1FSYA 3GVBA 1BLSA 5TFQA 3RJUA 4X1MA 4CQHA 3UDIA 4HBTA 1UWNX 3FPWA 4DRTA 2Y4AA 4BENA 4ZTKA 1YKDA 4OP8A 3HJKA 4WEKA 1LSWA 4RX2A 2B02A 4GJ4A 4HJ3A 4HH3A 5HD3A 3T1QB 1TS0A 3BQ8A 4OH0A 1G68A 2L4RA 3IXHA 2WKQA 3IX3A 4OQIA 5DVAA 4KQRA 2OLVA 3A0VA 4B88A 2O99A 2XF3A 1NZOA 3HUNA 1MXOA 1F5MA 2E8JA 3OZHA 3KX0X 3PBQA 2A24A 4WL9A 4OONA 1XFQA 1BUEA 3MXRA 2H28A 5FEFA 4JF6A 3LIAA 3M2JA 1YM1A 4GS9A 2FZ0A 1PI5A 3NOTC 4OQ0A 3LGOA 1VETA 5FASA 1V9YA 5EVID 2ZC7A 2XSSA 1N4OA 3EEAA 3LEZA 4KZ6A 2O9BA 4MNRA 4PM8A 1MC0A 3W8KA 4NKPA 4DE2A 1OTEA 5FQ9A 2ZOIA 1IYQA 3QP2A 2OV5A 3JYIA 2FFYA 2HJ9C 2WGWA 3PYPA 4N92A 1ZKJA 3N8SA 2IWDA 1SDEA 2OWJA 1H0MA 4IBXA 4ZJ2A 4OPQA 2CC1A 2G2WA 2R9XA 1D7EA 1K54C 1SHVA 3R4KA 2O9AA 5HDSA 3G6OA 1SCWA 3RXXA 4EV4A 2XDMA 3E98A 1SKOB 4DE3A 4GDBA 2Z6CA 4XUZA 1GHMA 1PI4A 4QY6A 4EBPA 3P09A 1NLYA 1PYYA 1H8MA 1OJGA 3LI8A 5IU1A 2Y2GA 4NETA 4EETB 2PR5A 3PAEA 1SKFA 1Y54A 5EM0A 2Y55A 4B4XA 1YSQA 3ZVWA 1ACFA 2PU2A 4JBFA 3CLOA 3VOLA 1P9RA 1KDWA 2ZC4B 4C75A 2V1BA 2XD1A 4KUKA 4JLFA 2A3UA 3FKWA 1T19A 1GA9A 2WKRA 2LB9A 3W2ZA 4OLDA 5FQQA 2C6WB 2HJEA 3C5AA 4XT2A 3VV4A 2OAP1 1RP5A 1L0FA 4S2NA 5FDSA 1OTBA 3CPTB 5MC7A 3UB8A 1OMEA 1PZPA 2W1RA 3IHBA 4UA9A 3MZDA 1YLWA 1S4SA 2E8IA 4C3QA 4Y0UA 4YOFA 1N9LA 3UE3A 1H3QA 2UWXA 4ZRRA 5K5BA 2W27A 4NXBA 2HV1A 2OSUA 3T12B 5FL3A 1YLPA 4JGOA 4HIAA 3HLDA 3IWOA 5DKKA 3Q7VB 5IHVA 3EWKA 2ZL1A 3BY8A 4EW7A 2WKEA 4IVKA 4DKIA 1K57A 4DDSA 2QWSA 5EVIC 3FZCA 3CJMA 1LL5A 1XP4A 1XJ3A 1G6OA 3LYXA 5U47A 3N7WA 2ZQ7A 4K08A 2HP5A 5AVEA 2GX5A 4HH2A 2RL3A 4JXGA 4IHQA 2AVXA 4R0QA 1YLTA 3ULFA 1VEUB 3IXBA 3DBAA 2Q9NA 1X0OA 3T1XA 5EFWA 3F1PB 4CLCE 1KE3A 2HDSA 3IF6B 1FQGA 3T50A 1Y4OA 1NLZA 4HOIA 1LLBA 5E43A 1GA0A 3CUEC 2VA0A 1GSVA 3MKEA 2ZQ9A 5C5KA 2HZ5A 3Q07A 3DAVA 1PZOA 2V2FF 5BOHA 3B3XA 2WGVA 3B33A 2J80A 3DTIA 2FFFB 3IBJA 3NECA 1YQSA 5I5LA 2CMNA 1RGZA 1OTAA 5EUAA 3L7HA 3S7QA 2G2UA 5FI7A 5J7EA 1TS8A 4U3TA 3BECA 3H7WB 1P97A 3FC7A 4PMAA 4OP5A 1HD8A 3W4QA 2WK0A 4UA6A 3A3EA 4LFUA 2W0NA 5KSHA 3AGEA 3N8LA 4S2OA 5G18A 4QD4A 4FH2A 5FATA 2ZD8A 4XUXA 3NJAA 1DP8A 3MQQA 3BWLA 1D1JA 1YMXA 3NDEA 3R7WA 1DRMA 1IYOA 2VLGA 2Y2MA 3WS2A 4WZ5A 3U2AA 2V8FA 4HNBA 1S1ZA 2ZC3B 3VE3A 3G35A 2J9PA 2XD5A 2WAEA 4I39A 1XGIA 1ZHHB 2D01A 3H82B 5TJJA 5AQ9A 5M19A 2NUPC 4KZ9A 3EGXC 5CGSA 1E25A 4D2OA 4XXRA 5CGXA 3LR4A 2VGJA 1ESIA 4OOLA 5HPIA 2W3HA 1WA9A 4ARZA 1IKIA 3IT9A 1TDLA 4KG6A 4OVDA 4R3JA 3WS5A 3V39A 3HL9A 4U0XA 2JBFA 4I3AA 3OOVA 4HJ4A 2GNXA 4L0LA 3NY4A 3W4OA 1KGGA 3UB5P 3UPNA 1CJFA 3UE6A 2Y91A 2FH5A 2HF6A 1S66L 2VGLS 3C8CA 3QP5A 1OJ5A 3BY9A 4MBHA 1T1BA 2EX9A 5E2FA 3FWLA 3O3VA 1UGUA 3G31A 4JXVA 1S67L 4D60A 2J3TD 1W8QA 4JXSA 4MCWA 2Y2IA 1E3UD 4NG2A 3MZEA 3SH9A 4QPRA 2Y2QA 5AJGA 2Y2KA 3QP1A 3UDFA 5G4YA 3TG9A 3PAGA 4PKYG 3GV9A 1XA7A 2P04A 3EEHA 2VJWA 2IA2A 5L07A 4EESA 1OTIA 5F6AA 3V5MA 4DE1A 4E3OA 4OQGA 3IXGA 3LR3A 2X01A 3VOZA 4EBNA 4O0PA 3MXQA 5CEDA 5DF9A 3SS5A 3MR0A 3F1OB 1PRQA 3ZHHA 2P7JA 3IXDA 2Q0OA 1K0KA 4G3WA 2EA9A 2PD8A 3BFFA 4MEZA 2ZLYA 4JGQA 2B5RA 2XFSA 1FR1A 4OPRA 4GCZA 4ZDXA 4DJ3A 1LSXA 3UB7A 4LV0A 5CGWA 3EGDC 1DP6A 2BG1A 4NXEA 3VE4A 3OPPA 4II7A 1OTDA 4GS9B 4OPYA 5EE8A 5HD5A 1L3LA 5M1AA 4OQHA 2VV8A 1VHMA 2H10A 4CLCD 2XA7S 3M6BA 4UQIS 4IVIA 1K25A 4E6WA 1MPLA 3TSGA 4GB7A 1W7FA 3UMEA 3LI9A 4R23A 4NK3A 4ETZA 4UA7A 2QJ5A 5FEGA 3DWKA 3FG8A 4FH4A 2WGWB 5JYPA 2V0UA 1G6AA 2W3GA 4I3JA 1TF1A 4KZ5A 5DTTA 1VB6A 2WZZA 4M3KA 5CERA 3F1NA 2WAFA 2ZM0A 1BULA 2VK3A 2KOIA 2Q9MA 5A92A 3HUOA 1DJBA 5FQKA 2WKPA 4Y17A 4UEYA 3QHYA 3O88A 3GR2A 5FSRA 4U0TA 2J3TC 3CZDA 4HBUA 4WELA 3SH8A 1K54A 3CITA 2V0WA 4QY5A 3N6IA 4LCLA 3OBFA 4Y0OA 4RQ9A 4WM9A 1I2WA 5TBMB 4KUOA 1IELA 4JPMA 5GLAA 1FSWA 3ZYTA 1ESUA 4BBTA 2ZBBA 3CWFA 2OAQ1 1PWGA 4HY8A 2M1CA 3Q1FA 4EWFA 3GRJA 4ZJ1A 2GZAA 4R4SA 3E4PA 5KZHA 4QJGA 3ITBA 4G3KA 4R3BA 3V67A 4BL3A 4LV1A 3P01A 2PBDP 3UPPA 1IOUA 1PW1A 4Y13A 3D72A 1CF0A 4E6XA 2WKHA 3GDIA 3PBOA 4H8RA 3GECA 1FCNA 1LSVA 5J3WA 4OKPA 1ONHA 1ERQA 1XA1A 4MN6A 4MBKA 4HP9A 3BLSA 3IWIA 1K6RA 2M7UA 4E3IA 3A0SA 4G3VA 3IS2B 1FCMA 2YKFA 4IEDA 5FQIA 2J9OA 4CLCC 2ACGA 1DJAA 4BD0A 5GHZA 4WBGA 1K4FA 5HWTA 5EVIA 5FQJA 2QJ7A 1PW8A 3SOIA 5FDHA 2WADA 4GHIB 4E3NA 4I38A 3EQVA 1IEMA 4LV3A 4L9EA 1DP9A 2Y2LA 4B9OA 3LIDA 4H6JB 1K56D 3S1YA 1AXBA 3VSLA 1MWUA 4IBRA 3G30A 3B47A 4ETXA 4P6ZS 2Z2MB 4GLQA 3IX8A 5HDCA 1J3WA 3T4LA 3LFVA 4UHUA 3NIAA 3VP1A 1ZTUA 1G5UA 2OWHA 1CI9A 3SZTA 1K38A 3O86A 3ZG0A 2KLIA 1W8YA 4HP4A 2Y2OA 3NBLA 4PKYA 1L0EA 3C7UA 3C4OA 1WYCA 2EX2A 2D02A 2XROA 1DJCA 2Y2JA 3RFBA 3CUEA 5HAQA 4B4ZA 2ZM8A 4S2MA 2BTFP 4RVAA 4L9GA 3BFGA 1W5DA 3NC8A 4YWZA 4E3JA 3CAXA 4P6BA 5EV0A 2EX8A 4WMCD 5AVFA 4ESPA 5DJTA 4GN2A 1LI0A 2BLSA 2EWWA 5TGFA 1N9BA 3LO7A 4OOYA 4K0WA 5CECA 4R1GA 2KDKA 4GZBA 5CEBA 1ERMA 1JTDA 1UWPX 3NOPC 3P7NA 5DTSA 1E4DA 4WYYA 3UY6A 4CJNA 3UO9A 3ZG9B 2V8CA 1KDSA 4GOGA 3CHWP 3T4TA 3HLCA 3DWZA 4RA7A 5J8XA 3TRCA 1STZA 1S1YA 2XR0A 2OLUA 2VV7A 2INWA 1L0DA 5GLCA 2DMWA 4X1LA 4MN5A 4AFIA 3RTYA 2XFTA 3RXWA 3Q82A 2B18A 3MS6A 3CPTA 1ES4A 2PYPA 3MF0A 4DF6A 3C4PA 2H5SA 5A90A 1BLPA 2VV6A 3A0RA 3A3DA 2M7VA 3ZNYA 1CI8A 1GCEA 3ZG7B 3UN7A 3C7VA 4BMWA 3SS4A 4N9LA 4E3MA 1VQQA 2EX6A 3JVVA 5M18A 3Q7VA 5F5YA 1WYBA 4HI4A 3ZGAB 2JKRI 4JF4A 2UV0E 5EPHA 2X71A 5DF7A 4KQQA 1JWZA 1BTLA 5L10A 3RH8B 2VZWA 4RYEA 5J4EA 1N9NA 2ZQAA 1IYPA 3GTCA 1MY8A 2J7VA 4OLGA 1PNEA 3WRTA 5GHXA 2VX8A 4ID4A 2ZC5B 3IX4A 1JWPA 4EXOA 4WN5A 5F82A 2P9VA 4NXFA 4O8GA 3WS0A 3ZG8B 3LEQA 3MSHA 4BLMA 3HREA 1A0KA 1MWRA 3T4QA 1M40A 3IQAA 1HVBA 4Q0HA 3L9KA 1K55C 4PM6A 2Y2NA 4P85A 1H8YA 2G7UA 3G2ZA 3UMDA 4PM9A 1NRJA 5AQ7A 2PR6A 2J8YA 3UB9A 2ZMAA 3IBRA 3BJNA 4P0MA 4Y3IA 5HW3A 3LY3A 2I72A 4Z9QA 1CEFA 3D4FA 5EECA 1LHYA 2JKGA 1F9IA 3MZFA 3TOIA 1DY6A 4X56A 2W3EA 1IYSA 2WKIA 3BW6A 3H7WA 2ZC6B 4KZBA 2XH9A 1QMEA 3H9WA 1XXMA 3A3JA 3FV7A 3K3DA 4K91A 3CMZA 5EVEA 2Y59A 2K2NA 4QWOA 1O7EA 3FKVA 1JNUA 4E3KA 4I3IA 4BJPA 3DTKA 5FI2A 4DMZA 4NEED 3PBTA 2PDRA 1H8ZA 3P98A 4DXCA 3ZVTA 1IFQA 2NUTC 3IF6C 3BFEA 1BYWA 2ZQCA 5KMWA 2OOLA 5A91A 2JKTI 4OPZA 3H82A 3MJQA 4Q8IA 1LI9A 3AGFA 3PTEA 3QP4A 3K3CA 1J9MA 4HJ6A 4A5RA 1GSWA 1YAXA 1PFLA 1YPRA 1BZAA 4QHCA 2W1TA 3V3RA 3KSHA 3S4XA 4BBVA 2IWBA 4WEJA 5HDDA 3NHQA 2XGNA 1KE0A 4YNRA 3TE8A 5EM1A 1HZOA 1S4RA 3BFDA 4R38A 1NJ4A 3VP2A 4IUHA 2PYRA 3QNBA 3PBNA 4ZAMA 1VM1A 1N9OA 4BBUA 4KZ3A 1E3UA 4S2LA 5D3OA 4E3LA 4S2IA 5HWVA 3EOIA 4F3LA 1GHIA 2A24B 2PRFA 2W3FA 3D3OA 4Y0TA 1H5XA 3M6HA 3HLWA 3A3IA 2IWCA 3VFFA 2PHYA 2JN7A 1NYMA 4OOMA 3WS4A 3HLGA 1Z09A 3UPOA 1VETB 3WRZA 1FILA 4WZ4A 3IWQA 4KG5A 3HLFA 3OPLA 5F83A 2HP9A 1S0WA 4JF5A 2I9VA 3HUMA 3Q81A 1NYYA 4S2PA 2H0TA 2HGVA 3S22A 2VGLM 3N8RA 4KENB 1ES2A 1NY0A 5GLBA 1TS7A 5KIZA 1MZUA 1L0GA 5E2EA 3CG5A 2DCFA 2P08A 5FAPA 4X6TA 2R78A 4KQDA 5HX9A 2XLNA 1YLYA 1RGYA 4LGWA 3M2KA 2JKRM 2WZXA 4YINA 1YLZA 5CRFA 3LY4A 4NXGA 4BL2A 4N1XA 3PR6A 4EUZA 3F1OA 2O9CA 4DJ2A 1XKZA 1PWCA 3KYQA 5HAPA 4N1HA 4BD1A 1XJ2A 2XK1A 4EQIA 5HPFA 3FPVA 4CLCA 4GDNA 5EVIB 4WLAA 1NWZA 2JKFA 4N9KA 1BT5A 3T4SA 3CI6A 3KSIA 3G4PA 4F94A 2C5WB 4IUKA 3UDXA 4Y2FA 5CHMA 3G2YA 3AGDA 3C38A 3I7JA 5L2FA 3FYZA 4LENA 2EXBA 4X25A 5FI6A 2Z2LB 1M6KA 1OT6A 3UNWA 4HQAA 1NRFA 3IHAA 2JCHA 3S7OA 1KVLA 4XT2B 3ICYA 3QP8A 3HLBA 3KSGA 1FOFA 3OC2A 1PWDA 5JYOA 3LIEA 3MXSA 4GNUA 2JC7A 3G32A 3TJZC 3V50A 1YSPA 4JXWA 3B42A 1W63M 1OPXA 2HDRA 4IJGA 4P87A 4FCFA 4GKUA 4S2KA 1F98A 1YMSA 2ZOHA 3OPRA 3V3SA 1XGJA 5FA7A 2HDQA 2J3WA 4KG2A 1W63Q 4MDZA 3W4PA 2ZL1B 2XA7M 5DFYA 1YT4A 2QYBA 5DJUA 1QMFA 4UQIM 2ZJ9A 3T4OA 2K7SA 4DE0A 2MJ6A 1GSXA 4ZBEA 2V1ZA 2WYXA 2QKPA 5HSQA 4JGPA 4LLOB 5F1FA 1AWIA 1TEMA 2Z6DA 1I2SA 1ALQA 2B95A 4KZ4A 4K0XA 1F2KA 2KX6A 4QU3A 2Y79A 4HESA 5FAQA 4KZAA 3UE1A 5CTMA 5TBMA 2H0YA 5A8BA 5CHUA 1JWVA 2JKTM 3MFXA 5A93A 1XPBA 3BRMA 3OCLA 1MKIA 3C30A 2PBYA 1TVFA 1ZC2A 3VFHA 3VP3A 5CHJA 3ZG5A 2P74A 4FTXA 1KOUA 1S6RA 3T4JA 1EROA 2A2LA 2ZMVA 3PBRA 4FD8A 4Y15A 5IS1A 1RCJA 3MBZA 3ITAA 1XJ6A 5CX7A 2ZM2A 1W79A 4GW9A 5HWWA 5GHYA 1ZG6A 4L9FA 5TR7A 2X02A 2L1MA 4E04A 1KGFA 3HVFA 3PXPA 4LCMA 2RCXA 1K56A 3HJIA 3ZDJA 3WWXA 2Y2HA 4FSFA 1HTZA 5HL6A 4KQOA 3BFCA 1GHPA 3IS2A 5EOEA 1O07A 3S7PA 4QB8A 3NCKA 1SKOA 1XX2A 2QPNA 4C6YA 4EERA 3R7WB 2XRNA 1BLCA 3SH7A 1KGEA 3O87A 3UE0A 1EW0A 4MLLA 4ZJ3A 3BLMA 4GHIA 5AQAA 1PIOA 5EVLA 4EEUA 4ME4A 3QP6A 2EFUA 4Z1WA 1MWSA 2EWVA 2EXAA 5HZHA 3OCNA 4CPKA 1TD5A 4H6JA 3O5YA 2GDNA 2P9VB 4R3AA 3LR0A 1ODVA 3NULA 3G34A 4LRZE 2V20A 3K2NA 3JPUA 1Q2PA 4EBLA 1P0ZA 3LICA 1Z6FA 4S2NC 4WMCA 4BQMA 2K31A 1U60A 3Q7ZA 3A3FA 4GD6A 1XJ4A 1OT9A 2V9AA 2QHKA 5L8MA 1FCOA 4ARZB 2JHEA 1K55A 2WUQA 3PBSA 2ZQDA 3SS3A 5CTNA 3LIFA 3N4IA 4P6ZM 3ZFZA 5E2GA 2W3DA 5HARA 3DTMA 3T1SA 1L2SA 2PT7A 5HAIA 1K57C 1BLHA 4MN7A 1NXYA 4I5SA 1XFNA 4LRXC 3HBRA 4PAUA 3MFDA 5EOOA 3ZNTA 4R70A 1I5QA 4Y7PA 4X55A 5GLDA 5F69A 4DDYA 1KVMA 1V9ZA 5HFOA 4B93A 5LBRA 2ZMFA 5CXWA 4WUJA 4X68A 3S7NA 1Y28A 4HEFA 5FQMA 3MKFA 4Y5FA 3VP4A 2XQZA 3MQ0A 5IT5A 1ZG4A 3LR5A 3VMAA 3VP0A 3TW8A 1VEUA 3EQUA 3QNCA 3IH8A 3NDGA 5F1GA 3F1PA 4PHTA 3HCYA 2QZ6A 3IF6A 1YLJA 3LCEA 2O0YA 1SDNA 4MMNA 4EEPA 1TS6A 1IKGA 1ES3A 2L0WA 1T18A 5GL9A 4LV2A 1JVJA 1CEGA 1LL8A 2W1TB 2GJ3A 3JVUA 2YKHA 4UAAA 3DTEA 3NI9A 2Y2PA 4GD8A 5DF8A 3SW1A 1JTGA 4EQ1A 2DNSA 3WS1A 3ZCZA 2PAVP 3KYEA 3UB6A 3VOYA 3T4KA 2Y8HA 5F68A 4LRYC 1LL9A 3IH9A 4HHDA 4X69A 3KYZA 4F3LB 4RX3A 1MKMA 3ISGA 3LIBA 3E2LA 2LB5A 3BEBA 2JE5A 3MQOA 1TDGA 4WZ5C 1KE4A 4KZ7A 3U4LP 3KO6A 4R6LA 5DKLA 3E2KA 1T1CA 4M4XA 3GQZA 2A49A 2R9WA 2VKSA 3ZQ5A 1G28A 3IF5A 2PD7A 3DW0A 5G4ZA 4MBFA 1C3BA 1ES5A 3MMHA 3E4OA 2PU4A 4X53A 5I94A 4FUWA 3OLOA 3D9YA 4Q0JA 3BYDA 4WF0A 1NZUA 3E0YA 2ZQ8A 3F1NB 1WE4A 4O7DA 4EU0A 4S2JA 1T1AA 5FAOA 5L09A 3LUQA 1HLUP 3GSGA 4FOFA 1MBLA 5AQBA 3PHYA 3BM6A 1CQAA 3NOUC 1P9WA 3C2WA 4PM5A 1Q2QA 2QMIA 4PPRA 1ONGA 3GMWA 1CK3A 3T1RA 4CLCB 2V1AA 5HL1A 2VEAA 1SZVA 4O01A 2XEPA 1D06A 1BSGA 3KSFA 1K6SA 1EWZA 5DTKA 4EUVA 2HDUA 2HP6A 3E4QA 2HPBA 1K4EA 1EI5A 4JKTA 4PM7A 4LPZA 2WGIA 2EFXA 4Q0IA 4R4RA 5E2HA 4DN0A 4KZ8A
chains in the Genus database with same CATH topology
4I3AA 3TRCA 5DFYA 1STZA 2QYBA 5DJUA 3OOVA 4UQIM 3T4OA 5DFXA 2K7SA 4HJ4A 2GNXA 4JGRA 4L0LA 1S1YA 2MJ6A 2VV7A 1GSXA 2INWA 3BQAA 2BASA 2QKPA 1LT0A 5HSQA 4JGPA 4LLOB 2DMWA 2Z6DA 4MN5A 4BWIA 4AFIA 3RTYA 3UE6A 2FH5A 2KX6A 4CQHA 2HF6A 2Y79A 1S66L 1UWNX 2VGLS 3FPWA 2B18A 3C8CA 1OJ5A 2PYPA 3MF0A 3BY9A 1YKDA 3HJKA 5TBMA 2VV6A 4WEKA 1T1BA 3A0RA 5A8BA 1LSWA 2JKTM 3MFXA 2M7VA 2B02A 3OCLA 4GJ4A 3C30A 4HJ3A 4HH3A 1UGUA 5HD3A 4BMWA 1S67L 1TS0A 2J3TD 3BQ8A 4MCWA 2L4RA 3JVVA 1KOUA 3T4JA 4QPRA 5F5YA 2A2LA 2WKQA 2ZMVA 4HI4A 3PBRA 5AJGA 2JKRI 5IS1A 5G4YA 4PKYG 3A0VA 2O99A 2P04A 3EEHA 3RH8B 2VJWA 2VZWA 2IA2A 1F5MA 4EESA 1XJ6A 5CX7A 1OTIA 5F6AA 5J4EA 4GW9A 5HWWA 1N9NA 4L9FA 3KX0X 3PBQA 2A24A 4WL9A 1XFQA 2L1MA 4E04A 3LR3A 3PXPA 2H28A 4O0PA 2VX8A 3MXQA 3LIAA 4EXOA 4WN5A 3HJIA 4GS9A 5DF9A 2FZ0A 4NXFA 3MR0A 3F1OB 4O8GA 3NOTC 2P7JA 4FSFA 4G3WA 5HL6A 4KQOA 2EA9A 2PD8A 1V9YA 2XSSA 3IS2A 3T4QA 3S7PA 4JGQA 4Q0HA 3EEAA 2O9BA 1MC0A 4EERA 4GCZA 3R7WB 4NKPA 2XRNA 1OTEA 4DJ3A 2ZOIA 2G7UA 1LSXA 3UB7A 1EW0A 2HJ9C 3UMDA 3EGDC 3PYPA 4GHIA 1NRJA 1DP6A 2PR6A 3UB9A 4EEUA 4ME4A 4NXEA 4Z1WA 3VE4A 2EWVA 2OWJA 5HZHA 3OCNA 3IBRA 1TD5A 4H6JA 4II7A 3BJNA 1OTDA 3O5YA 4GS9B 4Y3IA 4R3AA 3LR0A 5HD5A 1ODVA 1D7EA 4LRZE 3R4KA 3K2NA 2O9AA 2VV8A 5HDSA 1F9IA 3G6OA 1VHMA 4CLCD 2XA7S 1P0ZA 3LICA 3E98A 2W3EA 2K31A 4UQIS 3BW6A 2Z6CA 3UMEA 3LI9A 3H7WA 4ETZA 1XJ4A 1OT9A 2V9AA 2QHKA 2QJ5A 3H9WA 3K3DA 5L8MA 4ARZB 2JHEA 2K2NA 3FG8A 3PBSA 1NLYA 1H8MA 1JNUA 2V0UA 2W3GA 4I3IA 4I3JA 3LIFA 4BJPA 1TF1A 1OJGA 3LI8A 5IU1A 4P6ZM 1VB6A 4EETB 2PR5A 2W3DA 3F1NA 4NEED 3PBTA 4DMZA 2KOIA 2PDRA 2PT7A 1YSQA 2WKPA 4UEYA 4MN7A 3VOLA 3CLOA 4I5SA 1P9RA 1XFNA 1IFQA 4LRXC 2J3TC 2V1BA 4KUKA 4PAUA 2NUTC 1T19A 1BYWA 4WELA 3CITA 2WKRA 2LB9A 2OOLA 2V0WA 3W2ZA 4R70A 2JKTI 2HJEA 4XT2A 3VV4A 2OAP1 3H82A 3MJQA 5F69A 1V9ZA 1OTBA 3OBFA 5MC7A 4RQ9A 3UB8A 2W1RA 3K3CA 4HJ6A 4B93A 1GSWA 1YAXA 5TBMB 1S4SA 4KUOA 4YOFA 4BBTA 5LBRA 3ZYTA 2ZMFA 4WUJA 1N9LA 2ZBBA 3UE3A 3CWFA 3S7NA 1H3QA 1Y28A 2OAQ1 4Y5FA 3MQ0A 2W1TA 2M1CA 4HY8A 4ZRRA 3KSHA 4BBVA 5IT5A 5K5BA 2W27A 4NXBA 2HV1A 4WEJA 5HDDA 5FL3A 3NHQA 4JGOA 4HIAA 2GZAA 3LR5A 3E4PA 3TW8A 3TE8A 4YNRA 5DKKA 3EQUA 4G3KA 3EWKA 1S4RA 3V67A 3BY8A 4EW7A 4R38A 3F1PA 3P01A 4PHTA 2QWSA 4IUHA 3HCYA 2PYRA 1IOUA 3PBNA 4BBUA 1N9OA 1XJ3A 1G6OA 3LYXA 2O0YA 3D72A 4MMNA 5HWVA 3EOIA 3GDIA 3PBOA 4F3LA 4K08A 4EEPA 3GECA 1TS6A 5AVEA 2A24B 2W3FA 2GX5A 1LSVA 3D3OA 5J3WA 4HH2A 2L0WA 1T18A 2PHYA 4MN6A 1LL8A 2W1TB 2GJ3A 2JN7A 4OOMA 3JVUA 2YKHA 4IHQA 4HP9A 2M7UA 3ULFA 3A0SA 3DBAA 4G3VA 3SW1A 4EQ1A 1X0OA 3IS2B 2YKFA 3UB6A 5EFWA 3F1PB 3T4KA 2Y8HA 5F68A 4LRYC 4CLCC 4CLCE 2I9VA 4HHDA 2HGVA 2VGLM 3T50A 5HWTA 1NLZA 4HOIA 2QJ7A 3KYZA 4F3LB 1TS7A 3CUEC 1MZUA 5KIZA 4GHIB 2VA0A 1GSVA 1MKMA 4I38A 3EQVA 3LIBA 2P08A 4L9EA 2LB5A 5C5KA 1DP9A 3MQOA 3LIDA 2R78A 4B9OA 4KQDA 4H6JB 3B33A 3KO6A 2J80A 2JKRM 4R6LA 5DKLA 1T1CA 4M4XA 3IBJA 5I5LA 2CMNA 3B47A 4GLQA 4P6ZS 4ETXA 1OTAA 4NXGA 5HDCA 3T4LA 2VKSA 3LFVA 3ZQ5A 3S7QA 3PR6A 1ZTUA 5J7EA 1G28A 2PD7A 2OWHA 1TS8A 3F1OA 2O9CA 3H7WB 1P97A 4DJ2A 3FC7A 5G4ZA 3KYQA 3MMHA 3E4OA 1XJ2A 5HPFA 2KLIA 2W0NA 3FPVA 4HP4A 4CLCA 3OLOA 4WLAA 1NWZA 4Q0JA 5KSHA 4PKYA 3NJAA 4WF0A 2D02A 1DP8A 3E0YA 3MQQA 2XROA 3RFBA 3T4SA 3CI6A 3KSIA 3BWLA 3CUEA 3F1NB 3R7WA 4IUKA 4Y2FA 1DRMA 4EU0A 1T1AA 3C38A 2VLGA 3LUQA 4L9GA 3U2AA 4FOFA 4YWZA 4HNBA 1S1ZA 3VE3A 3CAXA 3PHYA 1OT6A 4HQAA 5AVFA 4I39A 5DJTA 3S7OA 4XT2B 3ICYA 1P9WA 3NOUC 1ZHHB 2D01A 2EWWA 3C2WA 3H82B 3KSGA 5TJJA 3OC2A 2NUPC 3EGXC 2KDKA 4CLCB 2V1AA 3LIEA 2VEAA 4O01A 1D06A 1UWPX 3LR4A 3TJZC 3KSFA 3NOPC 3P7NA 1YSPA 3B42A 4EUVA 1W63M 1OPXA 4IJGA 3E4QA 4OOLA 5HPIA 2W3HA 1F98A 2ZOHA 1WA9A 4ARZA 4LPZA 4Q0IA 4DN0A 2J3WA 3T4TA 1W63Q 4MDZA 2XA7M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ9 A;  3TRC A;  2XSS A;  5DFY A;  1STZ A;  2W1R A;  2QYB A;  3OOV A;  3S7P A;  5DFX A;  3KO6 A;  4YOF A;  4Q0H A;  5LBR A;  4R6L A;  2ZMF A;  3EEA A;  2O9B A;  1MC0 A;  3S7N A;  3IBJ A;  5I5L A;  2XRN A;  4ETX A;  4GLQ A;  4Y5F A;  3MQ0 A;  2W1T A;  4ZRR A;  3KSH A;  2G7U A;  3LFV A;  2VKS A;  3ZQ5 A;  5K5B A;  3S7Q A;  5HSQ A;  1ZTU A;  3NHQ A;  2O9C A;  4BWI A;  4YNR A;  4CQH A;  2Y79 A;  3MMH A;  4ME4 A;  4Z1W A;  4G3K A;  2B18 A;  5HPF A;  2KLI A;  3IBR A;  1TD5 A;  3BJN A;  3MF0 A;  3O5Y A;  4Q0J A;  4Y3I A;  1YKD A;  4IUH A;  3HCY A;  3E0Y A;  2XRO A;  4LRZ E;  3R4K A;  2M7V A;  3CI6 A;  3K2N A;  3KSI A;  2O9A A;  3RFB A;  3G6O A;  1VHM A;  2O0Y A;  4IUK A;  4Y2F A;  3E98 A;  4MMN A;  4EU0 A;  2W3E A;  2K31 A;  2W3F A;  3D3O A;  2GX5 A;  4FOF A;  4MCW A;  4ETZ A;  2W1T B;  4QPR A;  5L8M A;  5AJG A;  2K2N A;  3S7O A;  2M7U A;  3NOU C;  3C2W A;  3KSG A;  2W3G A;  5TJJ A;  1TF1 A;  3DBA A;  4G3V A;  2O99 A;  2VJW A;  2VZW A;  2W3D A;  4DMZ A;  2IA2 A;  1F5M A;  2VEA A;  4O01 A;  4GW9 A;  2Y8H A;  2KOI A;  4LRY C;  3KSF A;  3NOP C;  1YSQ A;  1YSP A;  4MN7 A;  4E04 A;  4EUV A;  4IJG A;  2HGV A;  4LRX C;  4O0P A;  4PAU A;  5HPI A;  2W3H A;  3CIT A;  2LB9 A;  4O8G A;  2OOL A;  1MKM A;  3W2Z A;  3NOT C;  4R70 A;  4Q0I A;  3VV4 A;  4DN0 A;  2LB5 A;  5C5K A;  4G3W A;  5HL6 A;  4MDZ A;  3OBF A; 
#chains in the Genus database with same CATH topology
 4DXB A;  3VSK A;  1MWT A;  3HLE A;  5DFX A;  4JGR A;  1FIK A;  3BQA A;  2BAS A;  5KSC A;  1LT0 A;  3OPH A;  4YFM A;  2VGK A;  2DRW A;  1FR6 A;  4BWI A;  1FSY A;  3GVB A;  1BLS A;  5TFQ A;  3RJU A;  4X1M A;  4CQH A;  3UDI A;  4HBT A;  1UWN X;  3FPW A;  4DRT A;  2Y4A A;  4BEN A;  4ZTK A;  1YKD A;  4OP8 A;  3HJK A;  4WEK A;  1LSW A;  4RX2 A;  2B02 A;  4GJ4 A;  4HJ3 A;  4HH3 A;  5HD3 A;  3T1Q B;  1TS0 A;  3BQ8 A;  4OH0 A;  1G68 A;  2L4R A;  3IXH A;  2WKQ A;  3IX3 A;  4OQI A;  5DVA A;  4KQR A;  2OLV A;  3A0V A;  4B88 A;  2O99 A;  2XF3 A;  1NZO A;  3HUN A;  1MXO A;  1F5M A;  2E8J A;  3OZH A;  3KX0 X;  3PBQ A;  2A24 A;  4WL9 A;  4OON A;  1XFQ A;  1BUE A;  3MXR A;  2H28 A;  5FEF A;  4JF6 A;  3LIA A;  3M2J A;  1YM1 A;  4GS9 A;  2FZ0 A;  1PI5 A;  3NOT C;  4OQ0 A;  3LGO A;  1VET A;  5FAS A;  1V9Y A;  5EVI D;  2ZC7 A;  2XSS A;  1N4O A;  3EEA A;  3LEZ A;  4KZ6 A;  2O9B A;  4MNR A;  4PM8 A;  1MC0 A;  3W8K A;  4NKP A;  4DE2 A;  1OTE A;  5FQ9 A;  2ZOI A;  1IYQ A;  3QP2 A;  2OV5 A;  3JYI A;  2FFY A;  2HJ9 C;  2WGW A;  3PYP A;  4N92 A;  1ZKJ A;  3N8S A;  2IWD A;  1SDE A;  2OWJ A;  1H0M A;  4IBX A;  4ZJ2 A;  4OPQ A;  2CC1 A;  2G2W A;  2R9X A;  1D7E A;  1K54 C;  1SHV A;  3R4K A;  2O9A A;  5HDS A;  3G6O A;  1SCW A;  3RXX A;  4EV4 A;  2XDM A;  3E98 A;  1SKO B;  4DE3 A;  4GDB A;  2Z6C A;  4XUZ A;  1GHM A;  1PI4 A;  4QY6 A;  4EBP A;  3P09 A;  1NLY A;  1PYY A;  1H8M A;  1OJG A;  3LI8 A;  5IU1 A;  2Y2G A;  4NET A;  4EET B;  2PR5 A;  3PAE A;  1SKF A;  1Y54 A;  5EM0 A;  2Y55 A;  4B4X A;  1YSQ A;  3ZVW A;  1ACF A;  2PU2 A;  4JBF A;  3CLO A;  3VOL A;  1P9R A;  1KDW A;  2ZC4 B;  4C75 A;  2V1B A;  2XD1 A;  4KUK A;  4JLF A;  2A3U A;  3FKW A;  1T19 A;  1GA9 A;  2WKR A;  2LB9 A;  3W2Z A;  4OLD A;  5FQQ A;  2C6W B;  2HJE A;  3C5A A;  4XT2 A;  3VV4 A;  2OAP 1;  1RP5 A;  1L0F A;  4S2N A;  5FDS A;  1OTB A;  3CPT B;  5MC7 A;  3UB8 A;  1OME A;  1PZP A;  2W1R A;  3IHB A;  4UA9 A;  3MZD A;  1YLW A;  1S4S A;  2E8I A;  4C3Q A;  4Y0U A;  4YOF A;  1N9L A;  3UE3 A;  1H3Q A;  2UWX A;  4ZRR A;  5K5B A;  2W27 A;  4NXB A;  2HV1 A;  2OSU A;  3T12 B;  5FL3 A;  1YLP A;  4JGO A;  4HIA A;  3HLD A;  3IWO A;  5DKK A;  3Q7V B;  5IHV A;  3EWK A;  2ZL1 A;  3BY8 A;  4EW7 A;  2WKE A;  4IVK A;  4DKI A;  1K57 A;  4DDS A;  2QWS A;  5EVI C;  3FZC A;  3CJM A;  1LL5 A;  1XP4 A;  1XJ3 A;  1G6O A;  3LYX A;  5U47 A;  3N7W A;  2ZQ7 A;  4K08 A;  2HP5 A;  5AVE A;  2GX5 A;  4HH2 A;  2RL3 A;  4JXG A;  4IHQ A;  2AVX A;  4R0Q A;  1YLT A;  3ULF A;  1VEU B;  3IXB A;  3DBA A;  2Q9N A;  1X0O A;  3T1X A;  5EFW A;  3F1P B;  4CLC E;  1KE3 A;  2HDS A;  3IF6 B;  1FQG A;  3T50 A;  1Y4O A;  1NLZ A;  4HOI A;  1LLB A;  5E43 A;  1GA0 A;  3CUE C;  2VA0 A;  1GSV A;  3MKE A;  2ZQ9 A;  5C5K A;  2HZ5 A;  3Q07 A;  3DAV A;  1PZO A;  2V2F F;  5BOH A;  3B3X A;  2WGV A;  3B33 A;  2J80 A;  3DTI A;  2FFF B;  3IBJ A;  3NEC A;  1YQS A;  5I5L A;  2CMN A;  1RGZ A;  1OTA A;  5EUA A;  3L7H A;  3S7Q A;  2G2U A;  5FI7 A;  5J7E A;  1TS8 A;  4U3T A;  3BEC A;  3H7W B;  1P97 A;  3FC7 A;  4PMA A;  4OP5 A;  1HD8 A;  3W4Q A;  2WK0 A;  4UA6 A;  3A3E A;  4LFU A;  2W0N A;  5KSH A;  3AGE A;  3N8L A;  4S2O A;  5G18 A;  4QD4 A;  4FH2 A;  5FAT A;  2ZD8 A;  4XUX A;  3NJA A;  1DP8 A;  3MQQ A;  3BWL A;  1D1J A;  1YMX A;  3NDE A;  3R7W A;  1DRM A;  1IYO A;  2VLG A;  2Y2M A;  3WS2 A;  4WZ5 A;  3U2A A;  2V8F A;  4HNB A;  1S1Z A;  2ZC3 B;  3VE3 A;  3G35 A;  2J9P A;  2XD5 A;  2WAE A;  4I39 A;  1XGI A;  1ZHH B;  2D01 A;  3H82 B;  5TJJ A;  5AQ9 A;  5M19 A;  2NUP C;  4KZ9 A;  3EGX C;  5CGS A;  1E25 A;  4D2O A;  4XXR A;  5CGX A;  3LR4 A;  2VGJ A;  1ESI A;  4OOL A;  5HPI A;  2W3H A;  1WA9 A;  4ARZ A;  1IKI A;  3IT9 A;  1TDL A;  4KG6 A;  4OVD A;  4R3J A;  3WS5 A;  3V39 A;  3HL9 A;  4U0X A;  2JBF A;  4I3A A;  3OOV A;  4HJ4 A;  2GNX A;  4L0L A;  3NY4 A;  3W4O A;  1KGG A;  3UB5 P;  3UPN A;  1CJF A;  3UE6 A;  2Y91 A;  2FH5 A;  2HF6 A;  1S66 L;  2VGL S;  3C8C A;  3QP5 A;  1OJ5 A;  3BY9 A;  4MBH A;  1T1B A;  2EX9 A;  5E2F A;  3FWL A;  3O3V A;  1UGU A;  3G31 A;  4JXV A;  1S67 L;  4D60 A;  2J3T D;  1W8Q A;  4JXS A;  4MCW A;  2Y2I A;  1E3U D;  4NG2 A;  3MZE A;  3SH9 A;  4QPR A;  2Y2Q A;  5AJG A;  2Y2K A;  3QP1 A;  3UDF A;  5G4Y A;  3TG9 A;  3PAG A;  4PKY G;  3GV9 A;  1XA7 A;  2P04 A;  3EEH A;  2VJW A;  2IA2 A;  5L07 A;  4EES A;  1OTI A;  5F6A A;  3V5M A;  4DE1 A;  4E3O A;  4OQG A;  3IXG A;  3LR3 A;  2X01 A;  3VOZ A;  4EBN A;  4O0P A;  3MXQ A;  5CED A;  5DF9 A;  3SS5 A;  3MR0 A;  3F1O B;  1PRQ A;  3ZHH A;  2P7J A;  3IXD A;  2Q0O A;  1K0K A;  4G3W A;  2EA9 A;  2PD8 A;  3BFF A;  4MEZ A;  2ZLY A;  4JGQ A;  2B5R A;  2XFS A;  1FR1 A;  4OPR A;  4GCZ A;  4ZDX A;  4DJ3 A;  1LSX A;  3UB7 A;  4LV0 A;  5CGW A;  3EGD C;  1DP6 A;  2BG1 A;  4NXE A;  3VE4 A;  3OPP A;  4II7 A;  1OTD A;  4GS9 B;  4OPY A;  5EE8 A;  5HD5 A;  1L3L A;  5M1A A;  4OQH A;  2VV8 A;  1VHM A;  2H10 A;  4CLC D;  2XA7 S;  3M6B A;  4UQI S;  4IVI A;  1K25 A;  4E6W A;  1MPL A;  3TSG A;  4GB7 A;  1W7F A;  3UME A;  3LI9 A;  4R23 A;  4NK3 A;  4ETZ A;  4UA7 A;  2QJ5 A;  5FEG A;  3DWK A;  3FG8 A;  4FH4 A;  2WGW B;  5JYP A;  2V0U A;  1G6A A;  2W3G A;  4I3J A;  1TF1 A;  4KZ5 A;  5DTT A;  1VB6 A;  2WZZ A;  4M3K A;  5CER A;  3F1N A;  2WAF A;  2ZM0 A;  1BUL A;  2VK3 A;  2KOI A;  2Q9M A;  5A92 A;  3HUO A;  1DJB A;  5FQK A;  2WKP A;  4Y17 A;  4UEY A;  3QHY A;  3O88 A;  3GR2 A;  5FSR A;  4U0T A;  2J3T C;  3CZD A;  4HBU A;  4WEL A;  3SH8 A;  1K54 A;  3CIT A;  2V0W A;  4QY5 A;  3N6I A;  4LCL A;  3OBF A;  4Y0O A;  4RQ9 A;  4WM9 A;  1I2W A;  5TBM B;  4KUO A;  1IEL A;  4JPM A;  5GLA A;  1FSW A;  3ZYT A;  1ESU A;  4BBT A;  2ZBB A;  3CWF A;  2OAQ 1;  1PWG A;  4HY8 A;  2M1C A;  3Q1F A;  4EWF A;  3GRJ A;  4ZJ1 A;  2GZA A;  4R4S A;  3E4P A;  5KZH A;  4QJG A;  3ITB A;  4G3K A;  4R3B A;  3V67 A;  4BL3 A;  4LV1 A;  3P01 A;  2PBD P;  3UPP A;  1IOU A;  1PW1 A;  4Y13 A;  3D72 A;  1CF0 A;  4E6X A;  2WKH A;  3GDI A;  3PBO A;  4H8R A;  3GEC A;  1FCN A;  1LSV A;  5J3W A;  4OKP A;  1ONH A;  1ERQ A;  1XA1 A;  4MN6 A;  4MBK A;  4HP9 A;  3BLS A;  3IWI A;  1K6R A;  2M7U A;  4E3I A;  3A0S A;  4G3V A;  3IS2 B;  1FCM A;  2YKF A;  4IED A;  5FQI A;  2J9O A;  4CLC C;  2ACG A;  1DJA A;  4BD0 A;  5GHZ A;  4WBG A;  1K4F A;  5HWT A;  5EVI A;  5FQJ A;  2QJ7 A;  1PW8 A;  3SOI A;  5FDH A;  2WAD A;  4GHI B;  4E3N A;  4I38 A;  3EQV A;  1IEM A;  4LV3 A;  4L9E A;  1DP9 A;  2Y2L A;  4B9O A;  3LID A;  4H6J B;  1K56 D;  3S1Y A;  1AXB A;  3VSL A;  1MWU A;  4IBR A;  3G30 A;  3B47 A;  4ETX A;  4P6Z S;  2Z2M B;  4GLQ A;  3IX8 A;  5HDC A;  1J3W A;  3T4L A;  3LFV A;  4UHU A;  3NIA A;  3VP1 A;  1ZTU A;  1G5U A;  2OWH A;  1CI9 A;  3SZT A;  1K38 A;  3O86 A;  3ZG0 A;  2KLI A;  1W8Y A;  4HP4 A;  2Y2O A;  3NBL A;  4PKY A;  1L0E A;  3C7U A;  3C4O A;  1WYC A;  2EX2 A;  2D02 A;  2XRO A;  1DJC A;  2Y2J A;  3RFB A;  3CUE A;  5HAQ A;  4B4Z A;  2ZM8 A;  4S2M A;  2BTF P;  4RVA A;  4L9G A;  3BFG A;  1W5D A;  3NC8 A;  4YWZ A;  4E3J A;  3CAX A;  4P6B A;  5EV0 A;  2EX8 A;  4WMC D;  5AVF A;  4ESP A;  5DJT A;  4GN2 A;  1LI0 A;  2BLS A;  2EWW A;  5TGF A;  1N9B A;  3LO7 A;  4OOY A;  4K0W A;  5CEC A;  4R1G A;  2KDK A;  4GZB A;  5CEB A;  1ERM A;  1JTD A;  1UWP X;  3NOP C;  3P7N A;  5DTS A;  1E4D A;  4WYY A;  3UY6 A;  4CJN A;  3UO9 A;  3ZG9 B;  2V8C A;  1KDS A;  4GOG A;  3CHW P;  3T4T A;  3HLC A;  3DWZ A;  4RA7 A;  5J8X A;  3TRC A;  1STZ A;  1S1Y A;  2XR0 A;  2OLU A;  2VV7 A;  2INW A;  1L0D A;  5GLC A;  2DMW A;  4X1L A;  4MN5 A;  4AFI A;  3RTY A;  2XFT A;  3RXW A;  3Q82 A;  2B18 A;  3MS6 A;  3CPT A;  1ES4 A;  2PYP A;  3MF0 A;  4DF6 A;  3C4P A;  2H5S A;  5A90 A;  1BLP A;  2VV6 A;  3A0R A;  3A3D A;  2M7V A;  3ZNY A;  1CI8 A;  1GCE A;  3ZG7 B;  3UN7 A;  3C7V A;  4BMW A;  3SS4 A;  4N9L A;  4E3M A;  1VQQ A;  2EX6 A;  3JVV A;  5M18 A;  3Q7V A;  5F5Y A;  1WYB A;  4HI4 A;  3ZGA B;  2JKR I;  4JF4 A;  2UV0 E;  5EPH A;  2X71 A;  5DF7 A;  4KQQ A;  1JWZ A;  1BTL A;  5L10 A;  3RH8 B;  2VZW A;  4RYE A;  5J4E A;  1N9N A;  2ZQA A;  1IYP A;  3GTC A;  1MY8 A;  2J7V A;  4OLG A;  1PNE A;  3WRT A;  5GHX A;  2VX8 A;  4ID4 A;  2ZC5 B;  3IX4 A;  1JWP A;  4EXO A;  4WN5 A;  5F82 A;  2P9V A;  4NXF A;  4O8G A;  3WS0 A;  3ZG8 B;  3LEQ A;  3MSH A;  4BLM A;  3HRE A;  1A0K A;  1MWR A;  3T4Q A;  1M40 A;  3IQA A;  1HVB A;  4Q0H A;  3L9K A;  1K55 C;  4PM6 A;  2Y2N A;  4P85 A;  1H8Y A;  2G7U A;  3G2Z A;  3UMD A;  4PM9 A;  1NRJ A;  5AQ7 A;  2PR6 A;  2J8Y A;  3UB9 A;  2ZMA A;  3IBR A;  3BJN A;  4P0M A;  4Y3I A;  5HW3 A;  3LY3 A;  2I72 A;  4Z9Q A;  1CEF A;  3D4F A;  5EEC A;  1LHY A;  2JKG A;  1F9I A;  3MZF A;  3TOI A;  1DY6 A;  4X56 A;  2W3E A;  1IYS A;  2WKI A;  3BW6 A;  3H7W A;  2ZC6 B;  4KZB A;  2XH9 A;  1QME A;  3H9W A;  1XXM A;  3A3J A;  3FV7 A;  3K3D A;  4K91 A;  3CMZ A;  5EVE A;  2Y59 A;  2K2N A;  4QWO A;  1O7E A;  3FKV A;  1JNU A;  4E3K A;  4I3I A;  4BJP A;  3DTK A;  5FI2 A;  4DMZ A;  4NEE D;  3PBT A;  2PDR A;  1H8Z A;  3P98 A;  4DXC A;  3ZVT A;  1IFQ A;  2NUT C;  3IF6 C;  3BFE A;  1BYW A;  2ZQC A;  5KMW A;  2OOL A;  5A91 A;  2JKT I;  4OPZ A;  3H82 A;  3MJQ A;  4Q8I A;  1LI9 A;  3AGF A;  3PTE A;  3QP4 A;  3K3C A;  1J9M A;  4HJ6 A;  4A5R A;  1GSW A;  1YAX A;  1PFL A;  1YPR A;  1BZA A;  4QHC A;  2W1T A;  3V3R A;  3KSH A;  3S4X A;  4BBV A;  2IWB A;  4WEJ A;  5HDD A;  3NHQ A;  2XGN A;  1KE0 A;  4YNR A;  3TE8 A;  5EM1 A;  1HZO A;  1S4R A;  3BFD A;  4R38 A;  1NJ4 A;  3VP2 A;  4IUH A;  2PYR A;  3QNB A;  3PBN A;  4ZAM A;  1VM1 A;  1N9O A;  4BBU A;  4KZ3 A;  1E3U A;  4S2L A;  5D3O A;  4E3L A;  4S2I A;  5HWV A;  3EOI A;  4F3L A;  1GHI A;  2A24 B;  2PRF A;  2W3F A;  3D3O A;  4Y0T A;  1H5X A;  3M6H A;  3HLW A;  3A3I A;  2IWC A;  3VFF A;  2PHY A;  2JN7 A;  1NYM A;  4OOM A;  3WS4 A;  3HLG A;  1Z09 A;  3UPO A;  1VET B;  3WRZ A;  1FIL A;  4WZ4 A;  3IWQ A;  4KG5 A;  3HLF A;  3OPL A;  5F83 A;  2HP9 A;  1S0W A;  4JF5 A;  2I9V A;  3HUM A;  3Q81 A;  1NYY A;  4S2P A;  2H0T A;  2HGV A;  3S22 A;  2VGL M;  3N8R A;  4KEN B;  1ES2 A;  1NY0 A;  5GLB A;  1TS7 A;  5KIZ A;  1MZU A;  1L0G A;  5E2E A;  3CG5 A;  2DCF A;  2P08 A;  5FAP A;  4X6T A;  2R78 A;  4KQD A;  5HX9 A;  2XLN A;  1YLY A;  1RGY A;  4LGW A;  3M2K A;  2JKR M;  2WZX A;  4YIN A;  1YLZ A;  5CRF A;  3LY4 A;  4NXG A;  4BL2 A;  4N1X A;  3PR6 A;  4EUZ A;  3F1O A;  2O9C A;  4DJ2 A;  1XKZ A;  1PWC A;  3KYQ A;  5HAP A;  4N1H A;  4BD1 A;  1XJ2 A;  2XK1 A;  4EQI A;  5HPF A;  3FPV A;  4CLC A;  4GDN A;  5EVI B;  4WLA A;  1NWZ A;  2JKF A;  4N9K A;  1BT5 A;  3T4S A;  3CI6 A;  3KSI A;  3G4P A;  4F94 A;  2C5W B;  4IUK A;  3UDX A;  4Y2F A;  5CHM A;  3G2Y A;  3AGD A;  3C38 A;  3I7J A;  5L2F A;  3FYZ A;  4LEN A;  2EXB A;  4X25 A;  5FI6 A;  2Z2L B;  1M6K A;  1OT6 A;  3UNW A;  4HQA A;  1NRF A;  3IHA A;  2JCH A;  3S7O A;  1KVL A;  4XT2 B;  3ICY A;  3QP8 A;  3HLB A;  3KSG A;  1FOF A;  3OC2 A;  1PWD A;  5JYO A;  3LIE A;  3MXS A;  4GNU A;  2JC7 A;  3G32 A;  3TJZ C;  3V50 A;  1YSP A;  4JXW A;  3B42 A;  1W63 M;  1OPX A;  2HDR A;  4IJG A;  4P87 A;  4FCF A;  4GKU A;  4S2K A;  1F98 A;  1YMS A;  2ZOH A;  3OPR A;  3V3S A;  1XGJ A;  5FA7 A;  2HDQ A;  2J3W A;  4KG2 A;  1W63 Q;  4MDZ A;  3W4P A;  2ZL1 B;  2XA7 M;  5DFY A;  1YT4 A;  2QYB A;  5DJU A;  1QMF A;  4UQI M;  2ZJ9 A;  3T4O A;  2K7S A;  4DE0 A;  2MJ6 A;  1GSX A;  4ZBE A;  2V1Z A;  2WYX A;  2QKP A;  5HSQ A;  4JGP A;  4LLO B;  5F1F A;  1AWI A;  1TEM A;  2Z6D A;  1I2S A;  1ALQ A;  2B95 A;  4KZ4 A;  4K0X A;  1F2K A;  2KX6 A;  4QU3 A;  2Y79 A;  4HES A;  5FAQ A;  4KZA A;  3UE1 A;  5CTM A;  5TBM A;  2H0Y A;  5A8B A;  5CHU A;  1JWV A;  2JKT M;  3MFX A;  5A93 A;  1XPB A;  3BRM A;  3OCL A;  1MKI A;  3C30 A;  2PBY A;  1TVF A;  1ZC2 A;  3VFH A;  3VP3 A;  5CHJ A;  3ZG5 A;  2P74 A;  4FTX A;  1KOU A;  1S6R A;  3T4J A;  1ERO A;  2A2L A;  2ZMV A;  3PBR A;  4FD8 A;  4Y15 A;  5IS1 A;  1RCJ A;  3MBZ A;  3ITA A;  1XJ6 A;  5CX7 A;  2ZM2 A;  1W79 A;  4GW9 A;  5HWW A;  5GHY A;  1ZG6 A;  4L9F A;  5TR7 A;  2X02 A;  2L1M A;  4E04 A;  1KGF A;  3HVF A;  3PXP A;  4LCM A;  2RCX A;  1K56 A;  3HJI A;  3ZDJ A;  3WWX A;  2Y2H A;  4FSF A;  1HTZ A;  5HL6 A;  4KQO A;  3BFC A;  1GHP A;  3IS2 A;  5EOE A;  1O07 A;  3S7P A;  4QB8 A;  3NCK A;  1SKO A;  1XX2 A;  2QPN A;  4C6Y A;  4EER A;  3R7W B;  2XRN A;  1BLC A;  3SH7 A;  1KGE A;  3O87 A;  3UE0 A;  1EW0 A;  4MLL A;  4ZJ3 A;  3BLM A;  4GHI A;  5AQA A;  1PIO A;  5EVL A;  4EEU A;  4ME4 A;  3QP6 A;  2EFU A;  4Z1W A;  1MWS A;  2EWV A;  2EXA A;  5HZH A;  3OCN A;  4CPK A;  1TD5 A;  4H6J A;  3O5Y A;  2GDN A;  2P9V B;  4R3A A;  3LR0 A;  1ODV A;  3NUL A;  3G34 A;  4LRZ E;  2V20 A;  3K2N A;  3JPU A;  1Q2P A;  4EBL A;  1P0Z A;  3LIC A;  1Z6F A;  4S2N C;  4WMC A;  4BQM A;  2K31 A;  1U60 A;  3Q7Z A;  3A3F A;  4GD6 A;  1XJ4 A;  1OT9 A;  2V9A A;  2QHK A;  5L8M A;  1FCO A;  4ARZ B;  2JHE A;  1K55 A;  2WUQ A;  3PBS A;  2ZQD A;  3SS3 A;  5CTN A;  3LIF A;  3N4I A;  4P6Z M;  3ZFZ A;  5E2G A;  2W3D A;  5HAR A;  3DTM A;  3T1S A;  1L2S A;  2PT7 A;  5HAI A;  1K57 C;  1BLH A;  4MN7 A;  1NXY A;  4I5S A;  1XFN A;  4LRX C;  3HBR A;  4PAU A;  3MFD A;  5EOO A;  3ZNT A;  4R70 A;  1I5Q A;  4Y7P A;  4X55 A;  5GLD A;  5F69 A;  4DDY A;  1KVM A;  1V9Z A;  5HFO A;  4B93 A;  5LBR A;  2ZMF A;  5CXW A;  4WUJ A;  4X68 A;  3S7N A;  1Y28 A;  4HEF A;  5FQM A;  3MKF A;  4Y5F A;  3VP4 A;  2XQZ A;  3MQ0 A;  5IT5 A;  1ZG4 A;  3LR5 A;  3VMA A;  3VP0 A;  3TW8 A;  1VEU A;  3EQU A;  3QNC A;  3IH8 A;  3NDG A;  5F1G A;  3F1P A;  4PHT A;  3HCY A;  2QZ6 A;  3IF6 A;  1YLJ A;  3LCE A;  2O0Y A;  1SDN A;  4MMN A;  4EEP A;  1TS6 A;  1IKG A;  1ES3 A;  2L0W A;  1T18 A;  5GL9 A;  4LV2 A;  1JVJ A;  1CEG A;  1LL8 A;  2W1T B;  2GJ3 A;  3JVU A;  2YKH A;  4UAA A;  3DTE A;  3NI9 A;  2Y2P A;  4GD8 A;  5DF8 A;  3SW1 A;  1JTG A;  4EQ1 A;  2DNS A;  3WS1 A;  3ZCZ A;  2PAV P;  3KYE A;  3UB6 A;  3VOY A;  3T4K A;  2Y8H A;  5F68 A;  4LRY C;  1LL9 A;  3IH9 A;  4HHD A;  4X69 A;  3KYZ A;  4F3L B;  4RX3 A;  1MKM A;  3ISG A;  3LIB A;  3E2L A;  2LB5 A;  3BEB A;  2JE5 A;  3MQO A;  1TDG A;  4WZ5 C;  1KE4 A;  4KZ7 A;  3U4L P;  3KO6 A;  4R6L A;  5DKL A;  3E2K A;  1T1C A;  4M4X A;  3GQZ A;  2A49 A;  2R9W A;  2VKS A;  3ZQ5 A;  1G28 A;  3IF5 A;  2PD7 A;  3DW0 A;  5G4Z A;  4MBF A;  1C3B A;  1ES5 A;  3MMH A;  3E4O A;  2PU4 A;  4X53 A;  5I94 A;  4FUW A;  3OLO A;  3D9Y A;  4Q0J A;  3BYD A;  4WF0 A;  1NZU A;  3E0Y A;  2ZQ8 A;  3F1N B;  1WE4 A;  4O7D A;  4EU0 A;  4S2J A;  1T1A A;  5FAO A;  5L09 A;  3LUQ A;  1HLU P;  3GSG A;  4FOF A;  1MBL A;  5AQB A;  3PHY A;  3BM6 A;  1CQA A;  3NOU C;  1P9W A;  3C2W A;  4PM5 A;  1Q2Q A;  2QMI A;  4PPR A;  1ONG A;  3GMW A;  1CK3 A;  3T1R A;  4CLC B;  2V1A A;  5HL1 A;  2VEA A;  1SZV A;  4O01 A;  2XEP A;  1D06 A;  1BSG A;  3KSF A;  1K6S A;  1EWZ A;  5DTK A;  4EUV A;  2HDU A;  2HP6 A;  3E4Q A;  2HPB A;  1K4E A;  1EI5 A;  4JKT A;  4PM7 A;  4LPZ A;  2WGI A;  2EFX A;  4Q0I A;  4R4R A;  5E2H A;  4DN0 A;  4KZ8 A; 
#chains in the Genus database with same CATH homology
 4I3A A;  3TRC A;  5DFY A;  1STZ A;  2QYB A;  5DJU A;  3OOV A;  4UQI M;  3T4O A;  5DFX A;  2K7S A;  4HJ4 A;  2GNX A;  4JGR A;  4L0L A;  1S1Y A;  2MJ6 A;  2VV7 A;  1GSX A;  2INW A;  3BQA A;  2BAS A;  2QKP A;  1LT0 A;  5HSQ A;  4JGP A;  4LLO B;  2DMW A;  2Z6D A;  4MN5 A;  4BWI A;  4AFI A;  3RTY A;  3UE6 A;  2FH5 A;  2KX6 A;  4CQH A;  2HF6 A;  2Y79 A;  1S66 L;  1UWN X;  2VGL S;  3FPW A;  2B18 A;  3C8C A;  1OJ5 A;  2PYP A;  3MF0 A;  3BY9 A;  1YKD A;  3HJK A;  5TBM A;  2VV6 A;  4WEK A;  1T1B A;  3A0R A;  5A8B A;  1LSW A;  2JKT M;  3MFX A;  2M7V A;  2B02 A;  3OCL A;  4GJ4 A;  3C30 A;  4HJ3 A;  4HH3 A;  1UGU A;  5HD3 A;  4BMW A;  1S67 L;  1TS0 A;  2J3T D;  3BQ8 A;  4MCW A;  2L4R A;  3JVV A;  1KOU A;  3T4J A;  4QPR A;  5F5Y A;  2A2L A;  2WKQ A;  2ZMV A;  4HI4 A;  3PBR A;  5AJG A;  2JKR I;  5IS1 A;  5G4Y A;  4PKY G;  3A0V A;  2O99 A;  2P04 A;  3EEH A;  3RH8 B;  2VJW A;  2VZW A;  2IA2 A;  1F5M A;  4EES A;  1XJ6 A;  5CX7 A;  1OTI A;  5F6A A;  5J4E A;  4GW9 A;  5HWW A;  1N9N A;  4L9F A;  3KX0 X;  3PBQ A;  2A24 A;  4WL9 A;  1XFQ A;  2L1M A;  4E04 A;  3LR3 A;  3PXP A;  2H28 A;  4O0P A;  2VX8 A;  3MXQ A;  3LIA A;  4EXO A;  4WN5 A;  3HJI A;  4GS9 A;  5DF9 A;  2FZ0 A;  4NXF A;  3MR0 A;  3F1O B;  4O8G A;  3NOT C;  2P7J A;  4FSF A;  4G3W A;  5HL6 A;  4KQO A;  2EA9 A;  2PD8 A;  1V9Y A;  2XSS A;  3IS2 A;  3T4Q A;  3S7P A;  4JGQ A;  4Q0H A;  3EEA A;  2O9B A;  1MC0 A;  4EER A;  4GCZ A;  3R7W B;  4NKP A;  2XRN A;  1OTE A;  4DJ3 A;  2ZOI A;  2G7U A;  1LSX A;  3UB7 A;  1EW0 A;  2HJ9 C;  3UMD A;  3EGD C;  3PYP A;  4GHI A;  1NRJ A;  1DP6 A;  2PR6 A;  3UB9 A;  4EEU A;  4ME4 A;  4NXE A;  4Z1W A;  3VE4 A;  2EWV A;  2OWJ A;  5HZH A;  3OCN A;  3IBR A;  1TD5 A;  4H6J A;  4II7 A;  3BJN A;  1OTD A;  3O5Y A;  4GS9 B;  4Y3I A;  4R3A A;  3LR0 A;  5HD5 A;  1ODV A;  1D7E A;  4LRZ E;  3R4K A;  3K2N A;  2O9A A;  2VV8 A;  5HDS A;  1F9I A;  3G6O A;  1VHM A;  4CLC D;  2XA7 S;  1P0Z A;  3LIC A;  3E98 A;  2W3E A;  2K31 A;  4UQI S;  3BW6 A;  2Z6C A;  3UME A;  3LI9 A;  3H7W A;  4ETZ A;  1XJ4 A;  1OT9 A;  2V9A A;  2QHK A;  2QJ5 A;  3H9W A;  3K3D A;  5L8M A;  4ARZ B;  2JHE A;  2K2N A;  3FG8 A;  3PBS A;  1NLY A;  1H8M A;  1JNU A;  2V0U A;  2W3G A;  4I3I A;  4I3J A;  3LIF A;  4BJP A;  1TF1 A;  1OJG A;  3LI8 A;  5IU1 A;  4P6Z M;  1VB6 A;  4EET B;  2PR5 A;  2W3D A;  3F1N A;  4NEE D;  3PBT A;  4DMZ A;  2KOI A;  2PDR A;  2PT7 A;  1YSQ A;  2WKP A;  4UEY A;  4MN7 A;  3VOL A;  3CLO A;  4I5S A;  1P9R A;  1XFN A;  1IFQ A;  4LRX C;  2J3T C;  2V1B A;  4KUK A;  4PAU A;  2NUT C;  1T19 A;  1BYW A;  4WEL A;  3CIT A;  2WKR A;  2LB9 A;  2OOL A;  2V0W A;  3W2Z A;  4R70 A;  2JKT I;  2HJE A;  4XT2 A;  3VV4 A;  2OAP 1;  3H82 A;  3MJQ A;  5F69 A;  1V9Z A;  1OTB A;  3OBF A;  5MC7 A;  4RQ9 A;  3UB8 A;  2W1R A;  3K3C A;  4HJ6 A;  4B93 A;  1GSW A;  1YAX A;  5TBM B;  1S4S A;  4KUO A;  4YOF A;  4BBT A;  5LBR A;  3ZYT A;  2ZMF A;  4WUJ A;  1N9L A;  2ZBB A;  3UE3 A;  3CWF A;  3S7N A;  1H3Q A;  1Y28 A;  2OAQ 1;  4Y5F A;  3MQ0 A;  2W1T A;  2M1C A;  4HY8 A;  4ZRR A;  3KSH A;  4BBV A;  5IT5 A;  5K5B A;  2W27 A;  4NXB A;  2HV1 A;  4WEJ A;  5HDD A;  5FL3 A;  3NHQ A;  4JGO A;  4HIA A;  2GZA A;  3LR5 A;  3E4P A;  3TW8 A;  3TE8 A;  4YNR A;  5DKK A;  3EQU A;  4G3K A;  3EWK A;  1S4R A;  3V67 A;  3BY8 A;  4EW7 A;  4R38 A;  3F1P A;  3P01 A;  4PHT A;  2QWS A;  4IUH A;  3HCY A;  2PYR A;  1IOU A;  3PBN A;  4BBU A;  1N9O A;  1XJ3 A;  1G6O A;  3LYX A;  2O0Y A;  3D72 A;  4MMN A;  5HWV A;  3EOI A;  3GDI A;  3PBO A;  4F3L A;  4K08 A;  4EEP A;  3GEC A;  1TS6 A;  5AVE A;  2A24 B;  2W3F A;  2GX5 A;  1LSV A;  3D3O A;  5J3W A;  4HH2 A;  2L0W A;  1T18 A;  2PHY A;  4MN6 A;  1LL8 A;  2W1T B;  2GJ3 A;  2JN7 A;  4OOM A;  3JVU A;  2YKH A;  4IHQ A;  4HP9 A;  2M7U A;  3ULF A;  3A0S A;  3DBA A;  4G3V A;  3SW1 A;  4EQ1 A;  1X0O A;  3IS2 B;  2YKF A;  3UB6 A;  5EFW A;  3F1P B;  3T4K A;  2Y8H A;  5F68 A;  4LRY C;  4CLC C;  4CLC E;  2I9V A;  4HHD A;  2HGV A;  2VGL M;  3T50 A;  5HWT A;  1NLZ A;  4HOI A;  2QJ7 A;  3KYZ A;  4F3L B;  1TS7 A;  3CUE C;  1MZU A;  5KIZ A;  4GHI B;  2VA0 A;  1GSV A;  1MKM A;  4I38 A;  3EQV A;  3LIB A;  2P08 A;  4L9E A;  2LB5 A;  5C5K A;  1DP9 A;  3MQO A;  3LID A;  2R78 A;  4B9O A;  4KQD A;  4H6J B;  3B33 A;  3KO6 A;  2J80 A;  2JKR M;  4R6L A;  5DKL A;  1T1C A;  4M4X A;  3IBJ A;  5I5L A;  2CMN A;  3B47 A;  4GLQ A;  4P6Z S;  4ETX A;  1OTA A;  4NXG A;  5HDC A;  3T4L A;  2VKS A;  3LFV A;  3ZQ5 A;  3S7Q A;  3PR6 A;  1ZTU A;  5J7E A;  1G28 A;  2PD7 A;  2OWH A;  1TS8 A;  3F1O A;  2O9C A;  3H7W B;  1P97 A;  4DJ2 A;  3FC7 A;  5G4Z A;  3KYQ A;  3MMH A;  3E4O A;  1XJ2 A;  5HPF A;  2KLI A;  2W0N A;  3FPV A;  4HP4 A;  4CLC A;  3OLO A;  4WLA A;  1NWZ A;  4Q0J A;  5KSH A;  4PKY A;  3NJA A;  4WF0 A;  2D02 A;  1DP8 A;  3E0Y A;  3MQQ A;  2XRO A;  3RFB A;  3T4S A;  3CI6 A;  3KSI A;  3BWL A;  3CUE A;  3F1N B;  3R7W A;  4IUK A;  4Y2F A;  1DRM A;  4EU0 A;  1T1A A;  3C38 A;  2VLG A;  3LUQ A;  4L9G A;  3U2A A;  4FOF A;  4YWZ A;  4HNB A;  1S1Z A;  3VE3 A;  3CAX A;  3PHY A;  1OT6 A;  4HQA A;  5AVF A;  4I39 A;  5DJT A;  3S7O A;  4XT2 B;  3ICY A;  1P9W A;  3NOU C;  1ZHH B;  2D01 A;  2EWW A;  3C2W A;  3H82 B;  3KSG A;  5TJJ A;  3OC2 A;  2NUP C;  3EGX C;  2KDK A;  4CLC B;  2V1A A;  3LIE A;  2VEA A;  4O01 A;  1D06 A;  1UWP X;  3LR4 A;  3TJZ C;  3KSF A;  3NOP C;  3P7N A;  1YSP A;  3B42 A;  4EUV A;  1W63 M;  1OPX A;  4IJG A;  3E4Q A;  4OOL A;  5HPI A;  2W3H A;  1F98 A;  2ZOH A;  1WA9 A;  4ARZ A;  4LPZ A;  4Q0I A;  4DN0 A;  2J3W A;  3T4T A;  1W63 Q;  4MDZ A;  2XA7 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...