5EVIC

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
356
structure length
350
Chain Sequence
AALDTLVQTEARKVMQENNITGLSIAITRHGQQFYNYGVASATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFKAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDKQTLYAQGYNTLDEPVRVNPGILAAEAYGVSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVKLAYRILQHAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 101
structure length 350
sequence length 356
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviC00
2ZQAA 5FQKA 4P87A 4X56A 4QHCA 2ZLYA 1CEFA 1DJCA 5AQ7A 3ZCZA 4GN2A 4DRTA 1RP5A 5A92A 2E8IA 4OVDA 3UDFA 4Z9QA 1Y54A 2ZM2A 3VP4A 3W4QA 4RA7A 1IYSA 3N8LA 1LHYA 3NC8A 1LI9A 2JE5A 3GR2A 4GKUA 3UPPA 1U60A 1L0FA 1H8ZA 1LLBA 3ZG0A 3VP0A 3JYIA 5HW3A 3UPNA 3HBRA 4GD8A 4R3BA 4XXRA 5EECA 3TG9A 1TDLA 5A91A 4QD4A 4MLLA 3HUOA 4R3JA 2Y2IA 1XP4A 1FR1A 3BFDA 5CECA 4DE2A 4OH0A 1MWSA 4LCLA 1BLPA 4S2IA 1AXBA 2VGKA 3HREA 5FI7A 1FR6A 3W8KA 1JWPA 1YM1A 2EFXA 3DWKA 4PM6A 2RL3A 3N6IA 3S4XA 4CPKA 3ZHHA 1IYQA 5GHZA 4KQQA 1IELA 5CEBA 3HUMA 1HVBA 3I7JA 4ZDXA 3QNBA 2QPNA 4WZ5C 2A3UA 3O88A 4JXGA 4C75A 3IT9A 4PM7A 4IBRA 4ZBEA 3D4FA 3PBTA 2X01A 3WWXA 3BFFA 1L0EA 2BLSA 3OCNA 2H5SA 1K55C 1WYBA 3N8RA 4YFMA 3ZNYA 3BYDA 3BECA 2J9PA 3RXWA 1BULA 1PYYA 4QU3A 1ZKJA 1MWRA 1E25A 4WMCD 4UA9A 4RX3A 3V3RA 1ES2A 2G2UA 2Y91A 3Q7VA 2H0YA 3HL9A 3HVFA 4N92A 1JTGA 5FSRA 3IF6C 3VOYA 2R9XA 3N7WA 4E6WA 2EXAA 4BENA 1ERQA 2XK1A 1MBLA 5CEDA 1PZOA 4DF6A 1K54C 1K4EA 2OLUA 3PBSA 2XFSA 4O7DA 4MBFA 4ZAMA 5FASA 5FDHA 5HX9A 3HLBA 1NRFA 3CG5A 4ZJ3A 2Y2JA 4OP5A 5KMWA 4JKTA 1H5XA 3UDIA 1Z6FA 3HLCA 3UNWA 3SH8A 1Q2QA 2ZQ8A 3P09A 4IVKA 4N9LA 5KSHA 2HPBA 3IWIA 1MPLA 1XA7A 1MKIA 4M3KA 3LY3A 1BTLA 2WAEA 4P85A 1NYYA 3Q07A 1KE4A 3WS2A 4E3NA 3PBQA 4S2NC 1LI0A 2J7VA 3ZDJA 5EVIC 2EX9A 5EVID 5FQ9A 1W8QA 4EV4A 5AQ9A 2Y2OA 1YLTA 3FKVA 4KZ7A 1KE0A 3UE3A 2HP5A 1VQQA 2HP6A 3V50A 4PM5A 5CTNA 1YQSA 3WS5A 2V20A 3N8SA 3G31A 4B88A 1NZUA 1IKIA 3ZG8B 1XGIA 3EQVA 3GRJA 5FQQA 1Q2PA 1C3BA 1PI4A 2ZM0A 1J9MA 4OP8A 5F1FA 3WS4A 4B4ZA 4DXBA 3OZHA 2HDRA 4A5RA 3CZDA 1PWDA 4R23A 5CXWA 2Y2GA 2IWBA 2EFUA 2XR0A 3DTMA 2ZC7A 5FI6A 4S2NA 4BL3A 2XH9A 5D3OA 3UO9A 2P9VA 3GTCA 1KGGA 1ONGA 5EOEA 4DDYA 4BLMA 1YT4A 1ERMA 2WZZA 2XEPA 4C6YA 1K25A 4EQIA 3A3IA 1W79A 3IWOA 4E3JA 5GLAA 1XX2A 2PBYA 3M6HA 2XDMA 3BRMA 1K6RA 1K56A 4DE3A 3ZVTA 1K38A 3C5AA 3IH9A 5E2HA 1SCWA 3BM6A 5BOHA 1BLCA 3VP2A 1ES4A 4Q8IA 3PBRA 3S1YA 4WEJA 2Y59A 1PIOA 2Y2MA 3SS5A 4QY6A 1KGEA 3N4IA 2HP9A 3HLFA 4CJNA 2EX2A 2DRWA 2EX6A 4F94A 5CRFA 1TVFA 3NDEA 3LEZA 1DJAA 1L0GA 4Y0UA 1PW8A 4IBXA 2ZM8A 4R4SA 3Q7VB 3VP3A 1O7EA 2BG1A 1RCJA 4JF6A 3CJMA 4XUXA 1BT5A 2VGJA 3ZVWA 4WBGA 1NJ4A 3A3DA 3C7VA 2JCHA 2ZC3B 3OPPA 2OSUA 2WKHA 2XQZA 3BLMA 3AGFA 5EUAA 3OPHA 4LV3A 3PAGA 4UA7A 3TOIA 5F82A 4HEFA 1I2WA 3OPLA 5G18A 4ZTKA 4GDBA 3DW0A 3ZG7B 4WEKA 4KZ9A 3ZG5A 4EBPA 2QMIA 4R0QA 4FCFA 2XFTA 4S2MA 3G35A 4KG5A 1L2SA 4JXVA 5TGFA 1G6AA 1LL9A 2DCFA 2HDUA 2WAFA 5FA7A 4U0TA 1N4OA 3RJUA 4B4XA 3HUNA 2Q9MA 3BLSA 3NI9A 4UA6A 5GL9A 2R9WA 1E3UA 3WRTA 3OC2A 3IH8A 2ZQCA 4ID4A 3IHBA 3VSKA 2PU2A 4GZBA 4H8RA 1ZG4A 4OPYA 4X6TA 4E3LA 3HLEA 2J9OA 3GVBA 5FQMA 5DTSA 4BL2A 1WE4A 3SS3A 4ZJ2A 4WZ5A 4BD1A 5M1AA 4JXSA 5CHMA 5HAQA 4BD0A 3LCEA 3MXRA 4OQHA 3VFHA 3VOZA 1O07A 4DE1A 4E3OA 1CI9A 4Y0TA 3HLWA 1IYOA 1XXMA 1K55A 5FATA 1JVJA 4GDNA 4WZ4A 5I94A 2QZ6A 4NK3A 2WGWA 1BSGA 4PM8A 3V3SA 1BLHA 3VMAA 4EWFA 1SHVA 1DY6A 4KZ3A 1CI8A 3M2KA 1L0DA 3ITAA 4GD6A 4GOGA 4KQOA 3IF6A 4X69A 2RCXA 4IEDA 5EPHA 1JTDA 5GLBA 3M2JA 3MKEA 1FQGA 2CC1A 1K54A 1H8YA 3PBOA 2XF3A 4E6XA 1TEMA 4FH4A 4KZ5A 3WS0A 4JXWA 4RVAA 2ZQDA 1KVMA 3HLGA 5FQIA 2P74A 1K6SA 1XKZA 1XGJA 2V2FF 1FOFA 3A3FA 3OPRA 1MWUA 1NYMA 2WADA 2WKIA 2ZC5B 4UHUA 4RYEA 2WK0A 1TDGA 3LY4A 1BZAA 3Q81A 4BQMA 1ES3A 1I2SA 3NCKA 5HL1A 1K57C 2Y55A 4WELA 1WYCA 5KZHA 3UY6A 5JYPA 4MEZA 3A3EA 2Z2MB 3OCLA 5F1GA 4PM9A 3ZNTA 1FCNA 5E43A 4HESA 4QY5A 4DXCA 5EVIA 1BLSA 5IHVA 2OV5A 2Y4AA 5GLDA 5HAPA 3AGEA 4EBNA 1K56D 1W5DA 3Q7ZA 4DE0A 1RGZA 1GA9A 4QB8A 5J8XA 5EVLA 2ZMAA 4K0WA 1IYPA 5DTTA 4Y7PA 4S2PA 5CHUA 2PU4A 3G30A 3A3JA 5EE8A 3ZG9B 2FFYA 4MBHA 4FH2A 3QHYA 1SDNA 3O87A 4OPRA 2HDQA 1M6KA 3O3VA 1SKFA 4UAAA 5HFOA 2Y2HA 1HD8A 3NDGA 4OQIA 2IWCA 2Y2QA 1PWGA 1IKGA 1W8YA 2DNSA 1K57A 4LV2A 3IHAA 4U3TA 3SS4A 3LO7A 5M18A 5DF9A 5DVAA 1CK3A 1LL5A 5E2EA 3C4OA 1ZC2A 1M40A 3BFEA 3G2YA 1FSWA 3E2KA 1KDSA 2WZXA 1G68A 1S6RA 4KG6A 3UN7A 4OLDA 3GMWA 5JYOA 2FFFB 1ONHA 1DJBA 1N9BA 1FCMA 4S2LA 3IQAA 4OPZA 4IVIA 4RX2A 2JBFA 4P0MA 3FYZA 5CTMA 5A93A 1ESUA 2EX8A 1ZG6A 4R1GA 3MZDA 5HARA 1EWZA 2Y2LA 4MNRA 2XGNA 4LCMA 1BUEA 3TSGA 1E4DA 4EUZA 1XPBA 2B5RA 1CEGA 4OOMA 3HLDA 1PW1A 4KZAA 3BFCA 4OKPA 3MZEA 3PBNA 1GA0A 1NZOA 4Y0OA 4C3QA 5AQBA 5EOOA 2UWXA 2HDSA 4L0LA 4OPQA 1PI5A 5CGXA 3NIAA 3O86A 3C4PA 3FWLA 1VM1A 4MBKA 2ZQ9A 1XA1A 1S0WA 4FSFA 4KG2A 1JWZA 4OONA 1E3UD 3GSGA 2WGWB 4JF5A 4PPRA 4KZBA 2V1ZA 3G32A 5FAOA 4ZJ1A 2WKEA 3W4PA 3IF6B 2ZC4B 3ZFZA 1NY0A 1W7FA 3E2LA 4HBTA 1GHPA 1FSYA 2XD5A 2Y2KA 3MKFA 4JLFA 4E3MA 1EI5A 3IXHA 5E2FA 4S2JA 1ALQA 3SH9A 1QMFA 3IXGA 3FZCA 5FAQA 3WRZA 1YMSA 3ZGAB 3UPOA 3UDXA 2XLNA 4QJGA 4K0XA 5L2FA 3CMZA 3G34A 5DTKA 2X02A 4KZ6A 4X55A 5F83A 4K91A 2OLVA 3UE0A 3SH7A 3VP1A 4WYYA 2H10A 1FCOA 1MXOA 3NY4A 5U47A 3QNCA 3PAEA 1MY8A 1EROA 3RXXA 3IXDA 1GHMA 3FKWA 4LV0A 4WMCA 3IWQA 1YMXA 3ITBA 5EVIB 4S2KA 1K4FA 1SDEA 4DKIA 2WGIA 1YLPA 4P6BA 4E3KA 2P9VB 4D2OA 5HAIA 1YLYA 5AQAA 3GQZA 3BFGA 2WUQA 2C6WB 3ISGA 5FQJA 4DDSA 2Y2PA 5CGWA 1ES5A 5FI2A 3V39A 2H0TA 4KENB 3C7UA 3VSLA 4N1HA 1NXYA 5CGSA 4OOYA 5DF8A 4JBFA 2ZD8A 3G2ZA 4BJPA 3FV7A 1OMEA 1YLZA 3PTEA 5GHYA 4X68A 4YINA 3VFFA 4OLGA 1JWVA 5FAPA 1GCEA 5CERA 4NETA 3UE1A 3V5MA 3IF5A 5E2GA 3SOIA 2ZC6B 5GLCA 4JPMA 3W4OA 5M19A 4OQ0A 3Q1FA 3EQUA 3IXBA 4S2OA 4U0XA 1YLJA 4E3IA 5GHXA 3M6BA 2C5WB 5DF7A 1PZPA 4FD8A 1IEMA 3MZFA 2ZQ7A 4N9KA 3GV9A 4LV1A 4PMAA 4EBLA 4KZ8A 1I5QA 3NBLA 2A49A 1KE3A 2GDNA 3B3XA 1GHIA 1YLWA 4LENA 2XD1A 1ESIA 5KSCA 3BEBA 1HZOA 5A90A 2G2WA 3G4PA 2WYXA 3MFDA 4JF4A 4XUZA 2Y2NA 4R4RA 3S22A 4KZ4A 1PWCA 3WS1A 5TR7A 2J8YA 2ZJ9A 3MXSA 2JC7A 1KGFA 1KVLA 2X71A 4GNUA 1RGYA 2Z2LB 5TFQA 3DWZA 1QMEA 4X53A 2IWDA 3MBZA 2Q9NA 1KDWA 4HBUA 4KQRA 5CHJA 3Q82A 4OQGA 4N1XA 1MWTA 3AGDA 2I72A 4OOLA 2EXBA 3P98A 4GB7A 2WGVA 1HTZA 4WM9A
chains in the Genus database with same CATH superfamily
2VV7A 4P87A 2HF6A 3LUQA 5A92A 1V9YA 2A24B 3UDFA 3C8CA 3L9KA 3VP4A 1W63Q 2W3HA 3LR5A 3N8LA 4I39A 2JE5A 1CJFA 1YKDA 3U2AA 5DJUA 1H8ZA 2W3EA 3EGDC 3UPNA 3HBRA 4GD8A 3KYQA 2EA9A 4XXRA 5EECA 1TDLA 3T12B 3TG9A 3T1SA 1ODVA 1UGUA 2VEAA 1BLPA 2VGKA 2JKGA 3HREA 1JWPA 4HP9A 2RL3A 2K2NA 3S4XA 1IYQA 3I7JA 1S67L 2QPNA 4JGQA 1OPXA 4UQIS 3BECA 3RXWA 1E25A 2GJ3A 4WMCD 3K3CA 5AVEA 4RX3A 1ES2A 2G2UA 2Y91A 2H0YA 3HVFA 3UB9A 2R9XA 3N7WA 5L09A 1PZOA 3PBSA 4IUKA 3UMEA 4ZAMA 5FDHA 2V8CA 5TJJA 2Y2JA 1Z6FA 3UNWA 3SH8A 1Q2QA 3P09A 4IVKA 2HPBA 3EGXC 4MN7A 1XA7A 1MKIA 3FG8A 4P85A 2Y79A 4S2NC 3T4LA 1V9ZA 4ETXA 4CLCA 5EVID 5FL3A 2Y2OA 1S1YA 3T1RA 3ZG8B 3EQVA 4HOIA 5HWVA 2ZM0A 4OP8A 5F1FA 2KX6A 2PD7A 4MMNA 4DXBA 2HDRA 4G3KA 4R23A 2WKRA 2PBDP 4L9FA 2V8FA 3UO9A 3GTCA 3V67A 1MZUA 3A3IA 2Z6CA 3H82B 4E3JA 1K56A 3IH9A 3MQQA 2PYRA 5DJTA 1ES4A 3H7WA 1G6OA 2Y59A 1NLYA 5L8MA 1OTBA 3N4IA 2DRWA 1Y4OA 4IUHA 1Y28A 1PW8A 2ZM8A 3Q7VB 2BG1A 4LGWA 1BT5A 4HIAA 3ZVWA 2HZ5A 3QP1A 4WBGA 1NJ4A 4Q0JA 2WKHA 3LEQA 5TBMA 2VGLS 3AGFA 4LV3A 3KSIA 1I2WA 3OPLA 2OAP1 3EOIA 5AVFA 4FCFA 1SKOA 1OTIA 1VEUA 4JXVA 2HDUA 2WAFA 1E3UA 4GCZA 3WRTA 3IH8A 3D9YA 5FQMA 3VE3A 3UE6A 1WE4A 4WZ5A 4OQHA 3VOLA 1O07A 3E4PA 4Y0TA 1IYOA 1H8MA 1XXMA 1VB6A 5C5KA 5FATA 2G7UA 4RQ9A 3V3SA 1H3QA 3C30A 3VMAA 3FPVA 3E0YA 3M2KA 4KQOA 2V1BA 1JTDA 3M2JA 1H8YA 4HI4A 4KZ5A 3WS0A 4JXWA 2ZQDA 1KVMA 3HLGA 5FQIA 1XKZA 4EU0A 2PT7A 1TD5A 4BQMA 1K57C 3KO6A 4B9OA 2Z2MB 3OCLA 4Y13A 2V0WA 5E43A 1W63M 5IHVA 1NLZA 5HAPA 3AGEA 2A2LA 5FDSA 1VETA 4DE0A 4QB8A 5J8XA 4LPZA 3F1OB 4R38A 4HQAA 3E4OA 3QHYA 1S4SA 2HDQA 5HFOA 2Y2HA 3SS4A 5M18A 3NECA 1CK3A 5E2EA 1M40A 5L07A 3BFEA 2WZXA 3GMWA 2FFFB 1FCMA 4RX2A 2JBFA 1N9OA 4P0MA 5CTMA 3UB5P 4LCMA 3KSFA 3TSGA 2B5RA 4OOMA 5F69A 3BFCA 4OKPA 5AQBA 3KSHA 3LR4A 3NIAA 4WL9A 4GJ4A 2ZQ9A 1XA1A 4FSFA 3IS2B 4JF5A 2WGWB 4KZBA 2PRFA 4ARZA 4GS9B 2VA0A 4NG2A 3IF6B 4I3AA 3ZFZA 1NY0A 4R6LA 1FSYA 1T1CA 2XD5A 4HY8A 4E3MA 5E2FA 2KLIA 2OWJA 3FZCA 1YMSA 2XLNA 3LIAA 2JKFA 2OOLA 3CMZA 3OOVA 4CLCC 5L2FA 2X02A 2VKSA 4X55A 1FCOA 1MY8A 1EROA 3A0VA 1P9WA 1STZA 4S2KA 4DKIA 4E3KA 2P9VB 1D1JA 5AQAA 5HAIA 3UB7A 2FH5A 2C6WB 4DDSA 2Y2PA 1ES5A 5FI2A 3V39A 1NXYA 5CGSA 4OOYA 2O9CA 4EXOA 1OMEA 4NXBA 1JWVA 1GCEA 4NETA 2V9AA 3UE1A 3V5MA 1LSXA 2ZC6B 4JPMA 3W4OA 3Q1FA 1Z09A 4S2OA 1YLJA 2C5WB 2XA7M 1CF0A 1IFQA 4PMAA 5HZHA 3NBLA 3LIDA 2A49A 2PD8A 1GHIA 3BEBA 2QJ5A 3MFDA 4JF4A 4XUZA 1PWCA 2JC7A 1RGYA 3ZYTA 4F3LB 4EUVA 2IWDA 3MBZA 1KDWA 2PR6A 1X0OA 1YSQA 2EXBA 4GB7A 2PYPA 5FQKA 3MQ0A 2YKFA 1OJ5A 1DJCA 5AQ7A 4GN2A 3HJIA 2E8IA 4OVDA 3PYPA 4YWZA 2ZM2A 4PAUA 3OBFA 3UPPA 3ZG0A 5HW3A 1JNUA 5F68A 4R3BA 3LR3A 4QD4A 4MLLA 2P08A 3MS6A 3CUEA 2O0YA 5L10A 3BFDA 5CECA 4OH0A 4Q0IA 4LCLA 1AXBA 4EEUA 1YM1A 2EFXA 3ZHHA 4KQQA 1HVBA 4ZDXA 3QNBA 1PFLA 4WZ5C 2A3UA 3IT9A 3D4FA 3BFFA 3BY9A 3OCNA 5HL6A 2H5SA 3N8RA 2J9PA 1BULA 1PYYA 4QU3A 1ZKJA 1MWRA 4NEED 4LRXC 3HL9A 1OJGA 2L0WA 5IT5A 1MBLA 1K4EA 1GSXA 2XFSA 4O7DA 5HX9A 1LL8A 4OP5A 1DRMA 3HLCA 4PKYG 1HLUP 1T1BA 5KSHA 5FEGA 3LY3A 1BTLA 3ZQ5A 3WS2A 3PBQA 1LI0A 2J7VA 3ZDJA 5FQ9A 1F98A 4KZ7A 3UE3A 2J3WA 2HP5A 4PM5A 3ICYA 1YQSA 2O9BA 2V20A 3N8SA 3MSHA 4Z1WA 2W1RA 1IKIA 5FQQA 2K7SA 3WS4A 4PHTA 1NRJA 5CXWA 4X25A 2XR0A 4R70A 3HCYA 4JGPA 4NKPA 2P9VA 1KGGA 1ONGA 4Y2FA 4BLMA 4C6YA 3DBAA 1K25A 2W3GA 3IWOA 3BRMA 4DE3A 3ZVTA 2PHYA 3C5AA 3CHWP 3K2NA 3BM6A 3IBRA 4BMWA 4Q8IA 3PBRA 2ZBBA 3S1YA 4QWOA 1PIOA 3T4SA 2Y2MA 4QY6A 2VV8A 2HP9A 2EX2A 5FEFA 1TVFA 3VP3A 1O7EA 3B47A 4XUXA 2VGJA 5HD5A 5EFWA 3C7VA 2JCHA 1AWIA 5G4YA 3OPHA 3PAGA 5A8BA 5F82A 2E8JA 5G18A 1F2KA 3DW0A 4O8GA 4EETB 3ZG5A 4EBPA 2QMIA 5HDDA 1ACFA 1L2SA 1G28A 5FA7A 3HUNA 2Q9MA 5GL9A 3T1XA 2ZQCA 3EEHA 3IHBA 4GZBA 4H8RA 4OPYA 4X6TA 4E3LA 3HLEA 5DTSA 2HJ9C 3F1NA 4BD1A 1XFNA 4JXSA 5CHMA 4BD0A 4CLCD 3LCEA 4DE1A 2QYBA 3HLWA 3IX8A 4GDNA 5I94A 4Y5FA 4EWFA 4KZ3A 1DY6A 3U4LP 1TF1A 1CI8A 4X69A 5EPHA 2W27A 4R3AA 1K54A 2LB9A 3UB8A 1TEMA 2P74A 1XGJA 3A3FA 4BBVA 1FOFA 1MWUA 2WADA 4JGOA 1TDGA 3LY4A 2OWHA 3Q81A 1ES3A 1I2SA 3CLOA 5J7EA 4WELA 1WYCA 5KZHA 3UY6A 5JYPA 4MEZA 3A3EA 4PM9A 3F1PB 5EVIA 2EWWA 2HGVA 1WA9A 1K56D 3GECA 1W5DA 3SW1A 1GA9A 2ZMAA 5DTTA 4Y7PA 4S2PA 5CHUA 1KOUA 3ZG9B 5CX7A 4FH2A 1SDNA 3K3DA 1SKFA 4UAAA 2KDKA 3NDGA 2IWCA 2Y2QA 1IKGA 1W8YA 3LI8A 4U3TA 3IHAA 3CUEC 5DF9A 4HJ4A 5EVEA 3VV4A 3T4TA 3UN7A 4OPZA 4EQ1A 3FYZA 1ESUA 3MZDA 1EWZA 2Y2LA 5EV0A 4EUZA 1E4DA 1XPBA 1CEGA 3C38A 4KZAA 2K31A 3PBNA 2CMNA 4Y0OA 4C3QA 2HDSA 3O86A 3C4PA 3FWLA 1VM1A 1S0WA 2M1CA 5DFXA 1E3UD 4Y3IA 3IX3A 2A24A 4ZJ1A 4QPRA 2WKEA 3BQAA 1G5UA 1W7FA 2ZOIA 3MKFA 1ALQA 1QMFA 3WRZA 4B93A 3UDXA 3QP4A 4KZ6A 5F83A 3UE0A 3SH7A 3NY4A 4M4XA 3NJAA 3IXDA 1GHMA 3IWQA 1K4FA 2V0UA 2WGIA 4D2OA 5FQJA 5CGWA 2VJWA 2VLGA 3C7UA 1UWNX 4JBFA 3QP5A 1YLZA 4YINA 2B18A 5K5BA 4X1MA 3DTIA 2BASA 4OQ0A 3T4JA 4I38A 3T4OA 2JKRM 4U0XA 4E3IA 1PZPA 4HJ3A 4EEPA 4LV1A 1DP6A 1KE3A 2GDNA 2P7JA 5HWWA 1ESIA 3LFVA 5DKLA 3G4PA 4R4RA 5TR7A 2UV0E 3Q82A 1MWTA 3AGDA 1YAXA 3T4QA 3P98A 3E4QA 3S7PA 4QHCA 2IA2A 1RP5A 2JHEA 4Z9QA 5F5YA 4RA7A 1IYSA 4HHDA 1DP8A 4HH2A 1LI9A 3GR2A 3EWKA 1LLBA 1ZHHB 3VP0A 3JYIA 5EM0A 2I9VA 2ZOHA 5A91A 2BTFP 4D60A 3HUOA 2Y2IA 1XP4A 1FR1A 3H82A 3PR6A 1YSPA 1FR6A 3W8KA 3DWKA 3N6IA 4Y15A 2Y8HA 1IELA 4WLAA 5CEBA 3HUMA 3NULA 3QP8A 1F5MA 4IJGA 3O88A 4JXGA 4K08A 4PM7A 4IBRA 3WWXA 2B95A 4XT2B 5MC7A 1L0EA 2BLSA 1WYBA 2D02A 5F6AA 4YFMA 2NUPC 2PDRA 4UA9A 1CQAA 5FSRA 3Q7VA 4N92A 1JTGA 3LI9A 4JGRA 4BENA 2XK1A 2GNXA 5CEDA 1K54C 1OTDA 2J3TC 1T19A 3HLBA 5IS1A 1NRFA 4ZJ3A 5KMWA 4JKTA 2ZQ8A 3IWIA 3TW8A 1NYYA 3Q07A 1KE4A 4E3NA 5EVIC 2EX9A 3CPTB 5HPFA 4EV4A 3ULFA 1LSWA 3FKVA 2ZL1B 3S7NA 1KE0A 3V50A 5CTNA 3T4KA 3WS5A 1XJ4A 3NHQA 5HDSA 2QKPA 1MC0A 2R78A 4IHQA 1NZUA 2L4RA 2J80A 4MDZA 2GZAA 3CZDA 3UMDA 1PWDA 1FIKA 1K0KA 2Y2GA 2IWBA 1L3LA 2EFUA 3DTMA 4S2NA 3G6OA 3IX4A 5D3OA 4MCWA 3D72A 4DN0A 5EOEA 4DDYA 1YT4A 2XEPA 2WZZA 1W79A 1GSWA 1K6RA 3TE8A 5E2HA 5BOHA 1BLCA 3VP2A 2B02A 2VK3A 4DMZA 1KGEA 2H28A 1VHMA 2JKTI 2EX6A 4F94A 2PAVP 3NDEA 1L0GA 5I5LA 1OTEA 3CI6A 1RCJA 2HV1A 3CJMA 4JF6A 3F1OA 3A3DA 3BY8A 4O0PA 3OPPA 2OSUA 5EUAA 4HEFA 4ZTKA 4L9GA 4R0QA 4G3WA 3L7HA 4KG5A 3KSGA 3NOTC 1G6AA 1LL9A 2DCFA 4HP4A 4CLCB 4U0TA 3BLSA 3NI9A 4GHIB 4UA6A 2R9WA 5LBRA 3RTYA 1H0MA 3OC2A 3VSKA 3R7WB 3GVBA 2W3FA 2NUTC 3CAXA 1NWZA 3VFHA 1DP9A 1OT9A 3VOZA 4E3OA 2JKRI 1K55A 3IS2A 1GSVA 1JVJA 4NK3A 2WGWA 1BSGA 3A0SA 1BLHA 4HJ6A 4GS9A 2W1TB 1L0DA 3ITAA 4GOGA 3IF6A 5IU1A 4IEDA 2VX8A 4XT2A 2CC1A 3PBOA 4FH4A 4BBTA 1K6SA 3OPRA 4UHUA 1PRQA 4RYEA 2WK0A 3JVUA 5HL1A 2Y55A 3H7WB 3MR0A 2QJ7A 4KUKA 3H9WA 4P6ZM 4QY5A 4DXCA 5GLDA 2M7UA 4EBNA 1OT6A 1RGZA 4WF0A 2D01A 5EVLA 4K0WA 1IYPA 1MKMA 2PU4A 3G30A 4Q0HA 5EE8A 5TBMB 3T50A 4OPRA 3S7QA 5DFYA 3JPUA 1M6KA 1HD8A 4OQIA 3MF0A 1K57A 4LV2A 1S1ZA 3LO7A 1EW0A 5DVAA 3UB6A 1SKOB 3DAVA 1ZC2A 1VEUB 1S6RA 1ZTUA 4H6JB 1ONHA 1DJBA 1N9BA 4S2LA 3IQAA 5A93A 3P7NA 4LLOB 2EX8A 1ZG6A 1FILA 4R1GA 5HARA 2XGNA 1BUEA 3W2ZA 2MJ6A 2P04A 1PW1A 2M7VA 4F3LA 3MZEA 1XFQA 3FC7A 1GA0A 2INWA 2YKHA 1PI5A 5CGXA 4MBKA 4X1LA 3MFXA 4KUOA 4PPRA 5HSQA 3G32A 2W0NA 2XRNA 4MN5A 5FAOA 1IOUA 4E04A 3OLOA 2ZC4B 4HBTA 1GHPA 2Y2KA 4KQDA 4LRZE 1EI5A 4NXFA 4S2JA 5FAQA 3ZGAB 3S7OA 1J3WA 2H10A 5U47A 3QNCA 2XA7S 4WMCA 4LV0A 2J3TD 4O01A 4P6BA 1VETB 5J4EA 3GQZA 2WUQA 3ISGA 4LFUA 2H0TA 2ZD8A 4BJPA 3FV7A 4CLCE 5FAPA 5CERA 3IF5A 5E2GA 5HDCA 5GLCA 3PXPA 2LB5A 4GHIA 3EQUA 3M6BA 3R7WA 5DF7A 3NOPC 3GV9A 4KZ8A 1I5QA 3QP2A 5KSCA 5A90A 2G2WA 2Y2NA 4KZ4A 2ZJ9A 3MXSA 3LIEA 1KVLA 4GNUA 2Z2LB 4HBUA 5HWTA 4OQGA 4CQHA 4G3VA 2W1TA 2I72A 4BWIA 3BWLA 3LIFA 1P9RA 5FI7A 2ZQAA 4L9EA 4X56A 2ZLYA 1CEFA 5KIZA 3ZCZA 4DRTA 3NOUC 4ARZB 3W4QA 1Y54A 1LHYA 3NC8A 4GKUA 1U60A 2KOIA 3LR0A 1L0FA 1XJ3A 2OAQ1 3KX0X 4GLQA 2L1MA 4R3JA 4DE2A 1MWSA 4S2IA 3TJZC 2VV6A 4PM6A 4DJ2A 4CPKA 5GHZA 2JKTM 3PHYA 3DTEA 3GDIA 3B42A 4ESPA 4C75A 2X01A 4ZBEA 3PBTA 1N9NA 3KYEA 4HNBA 4I3IA 4WUJA 1K55C 3ZNYA 3BYDA 3BQ8A 1P97A 3EEAA 4H6JA 3V3RA 3IF6C 3VOYA 4E6WA 2EXAA 1ERQA 4DF6A 2OLUA 4MBFA 5FASA 3DTKA 2XROA 3CG5A 2XSSA 4EW7A 1H5XA 3UDIA 4N9LA 1MPLA 1D06A 3QP6A 4M3KA 2WAEA 1TS6A 3JVVA 4AFIA 4P6ZS 1TS8A 1W8QA 3MJQA 4NXEA 5AQ9A 1YLTA 3VE4A 4FOFA 2V1AA 1VQQA 2HP6A 4BBUA 3G31A 4B88A 1XGIA 3GRJA 1Q2PA 1C3BA 1PI4A 1YPRA 1J9MA 1UWPX 4B4ZA 1A0KA 3OZHA 4A5RA 3D3OA 2AVXA 3HJKA 5FI6A 2ZC7A 1TS7A 3KYZA 2XH9A 4BL3A 2Z6DA 1XJ2A 2GX5A 1ERMA 2ZMVA 4FUWA 4EQIA 4ME4A 5GLAA 1TS0A 1XX2A 1S66L 2PBYA 3M6HA 2XDMA 1K38A 1SCWA 2HJEA 3SZTA 1XJ6A 4WN5A 4LRYC 4WEJA 3F1PA 3SS5A 3O5YA 3HLFA 4CJNA 1SZVA 3IBJA 3LGOA 5CRFA 3LEZA 1DJAA 4Y0UA 4IBXA 4R4SA 2QHKA 4HH3A 3LICA 4Y17A 2ZC3B 2XQZA 4EERA 3BLMA 4UA7A 3TOIA 4GDBA 3ZG7B 4WEKA 4KZ9A 2XFTA 4S2MA 3G35A 5TGFA 1N4OA 2WKQA 3RJUA 4B4XA 4I5SA 3CITA 2EWVA 4ID4A 5G4ZA 2PU2A 1ZG4A 1N9LA 2J9OA 2FZ0A 4BL2A 3SS3A 4ZJ2A 5M1AA 5HAQA 3MXRA 1CI9A 1P0ZA 4WZ4A 2QZ6A 4PM8A 4UQIM 5DKKA 3TRCA 1SHVA 4ZRRA 5AJGA 4GD6A 2RCXA 5GLBA 3MKEA 1FQGA 4E6XA 2XF3A 4RVAA 1F9IA 2V2FF 1NYMA 2WKIA 2ZC5B 2ZMFA 2DMWA 4YNRA 1BZAA 3NCKA 3BJNA 3ZNTA 5F1GA 1FCNA 4HESA 1BLSA 2OV5A 2Y4AA 4UEYA 3Q7ZA 5HD3A 3LIBA 4GW9A 3A3JA 2FFYA 4MBHA 4PKYA 3O87A 3O3VA 2QWSA 1PWGA 2DNSA 3MMHA 2W3DA 1LL5A 3C4OA 3G2YA 1FSWA 3E2KA 1KDSA 1G68A 4KG6A 1S4RA 5JYOA 4OLDA 5HPIA 2O9AA 4IVIA 1D7EA 3P01A 4MNRA 3HLDA 3R4KA 3F1NB 1NZOA 5EOOA 2UWXA 4L0LA 4OPQA 3T1QB 5EM1A 4KG2A 1JWZA 4OONA 3GSGA 2V1ZA 2JN7A 4FTXA 3W4PA 1T1AA 3E2LA 4EESA 4JLFA 3IXHA 2ACGA 3SH9A 1PNEA 3IXGA 3MXQA 3LYXA 4ETZA 2VGLM 3UPOA 4QJGA 4K0XA 3G34A 5DTKA 4K91A 2OLVA 3VP1A 4WYYA 3A0RA 1MXOA 3PAEA 3RXXA 3FKWA 1YMXA 3ITBA 5EVIB 3BW6A 1SDEA 1YLPA 2WKPA 1YLYA 1OTAA 3BFGA 4NXGA 4KENB 3RFBA 3VSLA 3E98A 4N1HA 5DF8A 4YOFA 2O99A 3G2ZA 3PTEA 5GHYA 1LT0A 4X68A 3VFFA 3MQOA 4OLGA 1BYWA 3SOIA 5M19A 3IXBA 4DJ3A 5GHXA 3CWFA 2PR5A 4FD8A 1IEMA 3MZFA 2ZQ7A 5J3WA 4I3JA 4N9KA 4II7A 4EBLA 3FPWA 3B3XA 4LENA 1YLWA 2XD1A 1HZOA 2Q0OA 2WYXA 1LSVA 3S22A 4MN6A 3WS1A 2J8YA 3C2WA 2X71A 1KGFA 5TFQA 1T18A 3DWZA 1QMEA 4X53A 3CPTA 4KQRA 2Q9NA 5CHJA 4N1XA 3B33A 4OOLA 2VZWA 2WGVA 2ZL1A 1HTZA 3RH8B 4WM9A
chains in the Genus database with same CATH topology
2ZQAA 5FQKA 4P87A 4X56A 4QHCA 2ZLYA 1CEFA 1DJCA 5AQ7A 3ZCZA 4GN2A 4DRTA 1RP5A 5A92A 2E8IA 4OVDA 3UDFA 4Z9QA 1Y54A 2ZM2A 3VP4A 3W4QA 4RA7A 1IYSA 3N8LA 1LHYA 3NC8A 1LI9A 2JE5A 3GR2A 4GKUA 3UPPA 1U60A 1L0FA 1H8ZA 1LLBA 3ZG0A 3VP0A 3JYIA 5HW3A 3UPNA 3HBRA 4GD8A 4R3BA 4XXRA 5EECA 3TG9A 1TDLA 5A91A 4QD4A 4MLLA 3HUOA 4R3JA 2Y2IA 1XP4A 1FR1A 3BFDA 5CECA 4DE2A 4OH0A 1MWSA 4LCLA 1BLPA 4S2IA 1AXBA 2VGKA 3HREA 5FI7A 1FR6A 3W8KA 1JWPA 1YM1A 2EFXA 3DWKA 4PM6A 2RL3A 3N6IA 3S4XA 4CPKA 3ZHHA 1IYQA 5GHZA 4KQQA 1IELA 5CEBA 3HUMA 1HVBA 3I7JA 4ZDXA 3QNBA 2QPNA 4WZ5C 2A3UA 3O88A 4JXGA 4C75A 3IT9A 4PM7A 4IBRA 4ZBEA 3D4FA 3PBTA 2X01A 3WWXA 3BFFA 1L0EA 2BLSA 3OCNA 2H5SA 1K55C 1WYBA 3N8RA 4YFMA 3ZNYA 3BYDA 3BECA 2J9PA 3RXWA 1BULA 1PYYA 4QU3A 1ZKJA 1MWRA 1E25A 4WMCD 4UA9A 4RX3A 3V3RA 1ES2A 2G2UA 2Y91A 3Q7VA 2H0YA 3HL9A 3HVFA 4N92A 1JTGA 5FSRA 3IF6C 3VOYA 2R9XA 3N7WA 4E6WA 2EXAA 4BENA 1ERQA 2XK1A 1MBLA 5CEDA 1PZOA 4DF6A 1K54C 1K4EA 2OLUA 3PBSA 2XFSA 4O7DA 4MBFA 4ZAMA 5FASA 5FDHA 5HX9A 3HLBA 1NRFA 3CG5A 4ZJ3A 2Y2JA 4OP5A 5KMWA 4JKTA 1H5XA 3UDIA 1Z6FA 3HLCA 3UNWA 3SH8A 1Q2QA 2ZQ8A 3P09A 4IVKA 4N9LA 5KSHA 2HPBA 3IWIA 1MPLA 1XA7A 1MKIA 4M3KA 3LY3A 1BTLA 2WAEA 4P85A 1NYYA 3Q07A 1KE4A 3WS2A 4E3NA 3PBQA 4S2NC 1LI0A 2J7VA 3ZDJA 5EVIC 2EX9A 5EVID 5FQ9A 1W8QA 4EV4A 5AQ9A 2Y2OA 1YLTA 3FKVA 4KZ7A 1KE0A 3UE3A 2HP5A 1VQQA 2HP6A 3V50A 4PM5A 5CTNA 1YQSA 3WS5A 2V20A 3N8SA 3G31A 4B88A 1NZUA 1IKIA 3ZG8B 1XGIA 3EQVA 3GRJA 5FQQA 1Q2PA 1C3BA 1PI4A 2ZM0A 1J9MA 4OP8A 5F1FA 3WS4A 4B4ZA 4DXBA 3OZHA 2HDRA 4A5RA 3CZDA 1PWDA 4R23A 5CXWA 2Y2GA 2IWBA 2EFUA 2XR0A 3DTMA 2ZC7A 5FI6A 4S2NA 4BL3A 2XH9A 5D3OA 3UO9A 2P9VA 3GTCA 1KGGA 1ONGA 5EOEA 4DDYA 4BLMA 1YT4A 1ERMA 2WZZA 2XEPA 4C6YA 1K25A 4EQIA 3A3IA 1W79A 3IWOA 4E3JA 5GLAA 1XX2A 2PBYA 3M6HA 2XDMA 3BRMA 1K6RA 1K56A 4DE3A 3ZVTA 1K38A 3C5AA 3IH9A 5E2HA 1SCWA 3BM6A 5BOHA 1BLCA 3VP2A 1ES4A 4Q8IA 3PBRA 3S1YA 4WEJA 2Y59A 1PIOA 2Y2MA 3SS5A 4QY6A 1KGEA 3N4IA 2HP9A 3HLFA 4CJNA 2EX2A 2DRWA 2EX6A 4F94A 5CRFA 1TVFA 3NDEA 3LEZA 1DJAA 1L0GA 4Y0UA 1PW8A 4IBXA 2ZM8A 4R4SA 3Q7VB 3VP3A 1O7EA 2BG1A 1RCJA 4JF6A 3CJMA 4XUXA 1BT5A 2VGJA 3ZVWA 4WBGA 1NJ4A 3A3DA 3C7VA 2JCHA 2ZC3B 3OPPA 2OSUA 2WKHA 2XQZA 3BLMA 3AGFA 5EUAA 3OPHA 4LV3A 3PAGA 4UA7A 3TOIA 5F82A 4HEFA 1I2WA 3OPLA 5G18A 4ZTKA 4GDBA 3DW0A 3ZG7B 4WEKA 4KZ9A 3ZG5A 4EBPA 2QMIA 4R0QA 4FCFA 2XFTA 4S2MA 3G35A 4KG5A 1L2SA 4JXVA 5TGFA 1G6AA 1LL9A 2DCFA 2HDUA 2WAFA 5FA7A 4U0TA 1N4OA 3RJUA 4B4XA 3HUNA 2Q9MA 3BLSA 3NI9A 4UA6A 5GL9A 2R9WA 1E3UA 3WRTA 3OC2A 3IH8A 2ZQCA 4ID4A 3IHBA 3VSKA 2PU2A 4GZBA 4H8RA 1ZG4A 4OPYA 4X6TA 4E3LA 3HLEA 2J9OA 3GVBA 5FQMA 5DTSA 4BL2A 1WE4A 3SS3A 4ZJ2A 4WZ5A 4BD1A 5M1AA 4JXSA 5CHMA 5HAQA 4BD0A 3LCEA 3MXRA 4OQHA 3VFHA 3VOZA 1O07A 4DE1A 4E3OA 1CI9A 4Y0TA 3HLWA 1IYOA 1XXMA 1K55A 5FATA 1JVJA 4GDNA 4WZ4A 5I94A 2QZ6A 4NK3A 2WGWA 1BSGA 4PM8A 3V3SA 1BLHA 3VMAA 4EWFA 1SHVA 1DY6A 4KZ3A 1CI8A 3M2KA 1L0DA 3ITAA 4GD6A 4GOGA 4KQOA 3IF6A 4X69A 2RCXA 4IEDA 5EPHA 1JTDA 5GLBA 3M2JA 3MKEA 1FQGA 2CC1A 1K54A 1H8YA 3PBOA 2XF3A 4E6XA 1TEMA 4FH4A 4KZ5A 3WS0A 4JXWA 4RVAA 2ZQDA 1KVMA 3HLGA 5FQIA 2P74A 1K6SA 1XKZA 1XGJA 2V2FF 1FOFA 3A3FA 3OPRA 1MWUA 1NYMA 2WADA 2WKIA 2ZC5B 4UHUA 4RYEA 2WK0A 1TDGA 3LY4A 1BZAA 3Q81A 4BQMA 1ES3A 1I2SA 3NCKA 5HL1A 1K57C 2Y55A 4WELA 1WYCA 5KZHA 3UY6A 5JYPA 4MEZA 3A3EA 2Z2MB 3OCLA 5F1GA 4PM9A 3ZNTA 1FCNA 5E43A 4HESA 4QY5A 4DXCA 5EVIA 1BLSA 5IHVA 2OV5A 2Y4AA 5GLDA 5HAPA 3AGEA 4EBNA 1K56D 1W5DA 3Q7ZA 4DE0A 1RGZA 1GA9A 4QB8A 5J8XA 5EVLA 2ZMAA 4K0WA 1IYPA 5DTTA 4Y7PA 4S2PA 5CHUA 2PU4A 3G30A 3A3JA 5EE8A 3ZG9B 2FFYA 4MBHA 4FH2A 3QHYA 1SDNA 3O87A 4OPRA 2HDQA 1M6KA 3O3VA 1SKFA 4UAAA 5HFOA 2Y2HA 1HD8A 3NDGA 4OQIA 2IWCA 2Y2QA 1PWGA 1IKGA 1W8YA 2DNSA 1K57A 4LV2A 3IHAA 4U3TA 3SS4A 3LO7A 5M18A 5DF9A 5DVAA 1CK3A 1LL5A 5E2EA 3C4OA 1ZC2A 1M40A 3BFEA 3G2YA 1FSWA 3E2KA 1KDSA 2WZXA 1G68A 1S6RA 4KG6A 3UN7A 4OLDA 3GMWA 5JYOA 2FFFB 1ONHA 1DJBA 1N9BA 1FCMA 4S2LA 3IQAA 4OPZA 4IVIA 4RX2A 2JBFA 4P0MA 3FYZA 5CTMA 5A93A 1ESUA 2EX8A 1ZG6A 4R1GA 3MZDA 5HARA 1EWZA 2Y2LA 4MNRA 2XGNA 4LCMA 1BUEA 3TSGA 1E4DA 4EUZA 1XPBA 2B5RA 1CEGA 4OOMA 3HLDA 1PW1A 4KZAA 3BFCA 4OKPA 3MZEA 3PBNA 1GA0A 1NZOA 4Y0OA 4C3QA 5AQBA 5EOOA 2UWXA 2HDSA 4L0LA 4OPQA 1PI5A 5CGXA 3NIAA 3O86A 3C4PA 3FWLA 1VM1A 4MBKA 2ZQ9A 1XA1A 1S0WA 4FSFA 4KG2A 1JWZA 4OONA 1E3UD 3GSGA 2WGWB 4JF5A 4PPRA 4KZBA 2V1ZA 3G32A 5FAOA 4ZJ1A 2WKEA 3W4PA 3IF6B 2ZC4B 3ZFZA 1NY0A 1W7FA 3E2LA 4HBTA 1GHPA 1FSYA 2XD5A 2Y2KA 3MKFA 4JLFA 4E3MA 1EI5A 3IXHA 5E2FA 4S2JA 1ALQA 3SH9A 1QMFA 3IXGA 3FZCA 5FAQA 3WRZA 1YMSA 3ZGAB 3UPOA 3UDXA 2XLNA 4QJGA 4K0XA 5L2FA 3CMZA 3G34A 5DTKA 2X02A 4KZ6A 4X55A 5F83A 4K91A 2OLVA 3UE0A 3SH7A 3VP1A 4WYYA 2H10A 1FCOA 1MXOA 3NY4A 5U47A 3QNCA 3PAEA 1MY8A 1EROA 3RXXA 3IXDA 1GHMA 3FKWA 4LV0A 4WMCA 3IWQA 1YMXA 3ITBA 5EVIB 4S2KA 1K4FA 1SDEA 4DKIA 2WGIA 1YLPA 4P6BA 4E3KA 2P9VB 4D2OA 5HAIA 1YLYA 5AQAA 3GQZA 3BFGA 2WUQA 2C6WB 3ISGA 5FQJA 4DDSA 2Y2PA 5CGWA 1ES5A 5FI2A 3V39A 2H0TA 4KENB 3C7UA 3VSLA 4N1HA 1NXYA 5CGSA 4OOYA 5DF8A 4JBFA 2ZD8A 3G2ZA 4BJPA 3FV7A 1OMEA 1YLZA 3PTEA 5GHYA 4X68A 4YINA 3VFFA 4OLGA 1JWVA 5FAPA 1GCEA 5CERA 4NETA 3UE1A 3V5MA 3IF5A 5E2GA 3SOIA 2ZC6B 5GLCA 4JPMA 3W4OA 5M19A 4OQ0A 3Q1FA 3EQUA 3IXBA 4S2OA 4U0XA 1YLJA 4E3IA 5GHXA 3M6BA 2C5WB 5DF7A 1PZPA 4FD8A 1IEMA 3MZFA 2ZQ7A 4N9KA 3GV9A 4LV1A 4PMAA 4EBLA 4KZ8A 1I5QA 3NBLA 2A49A 1KE3A 2GDNA 3B3XA 1GHIA 1YLWA 4LENA 2XD1A 1ESIA 5KSCA 3BEBA 1HZOA 5A90A 2G2WA 3G4PA 2WYXA 3MFDA 4JF4A 4XUZA 2Y2NA 4R4RA 3S22A 4KZ4A 1PWCA 3WS1A 5TR7A 2J8YA 2ZJ9A 3MXSA 2JC7A 1KGFA 1KVLA 2X71A 4GNUA 1RGYA 2Z2LB 5TFQA 3DWZA 1QMEA 4X53A 2IWDA 3MBZA 2Q9NA 1KDWA 4HBUA 4KQRA 5CHJA 3Q82A 4OQGA 4N1XA 1MWTA 3AGDA 2I72A 4OOLA 2EXBA 3P98A 4GB7A 2WGVA 1HTZA 4WM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQA A;  5FQK A;  4P87 A;  4X56 A;  4QHC A;  2ZLY A;  1CEF A;  1DJC A;  5AQ7 A;  3ZCZ A;  4GN2 A;  4DRT A;  1RP5 A;  5A92 A;  2E8I A;  4OVD A;  3UDF A;  4Z9Q A;  1Y54 A;  2ZM2 A;  3VP4 A;  3W4Q A;  4RA7 A;  1IYS A;  3N8L A;  1LHY A;  3NC8 A;  1LI9 A;  2JE5 A;  3GR2 A;  4GKU A;  3UPP A;  1U60 A;  1L0F A;  1H8Z A;  1LLB A;  3ZG0 A;  3VP0 A;  3JYI A;  5HW3 A;  3UPN A;  3HBR A;  4GD8 A;  4R3B A;  4XXR A;  5EEC A;  3TG9 A;  1TDL A;  5A91 A;  4QD4 A;  4MLL A;  3HUO A;  4R3J A;  2Y2I A;  1XP4 A;  1FR1 A;  3BFD A;  5CEC A;  4DE2 A;  4OH0 A;  1MWS A;  4LCL A;  1BLP A;  4S2I A;  1AXB A;  2VGK A;  3HRE A;  5FI7 A;  1FR6 A;  3W8K A;  1JWP A;  1YM1 A;  2EFX A;  3DWK A;  4PM6 A;  2RL3 A;  3N6I A;  3S4X A;  4CPK A;  3ZHH A;  1IYQ A;  5GHZ A;  4KQQ A;  1IEL A;  5CEB A;  3HUM A;  1HVB A;  3I7J A;  4ZDX A;  3QNB A;  2QPN A;  4WZ5 C;  2A3U A;  3O88 A;  4JXG A;  4C75 A;  3IT9 A;  4PM7 A;  4IBR A;  4ZBE A;  3D4F A;  3PBT A;  2X01 A;  3WWX A;  3BFF A;  1L0E A;  2BLS A;  3OCN A;  2H5S A;  1K55 C;  1WYB A;  3N8R A;  4YFM A;  3ZNY A;  3BYD A;  3BEC A;  2J9P A;  3RXW A;  1BUL A;  1PYY A;  4QU3 A;  1ZKJ A;  1MWR A;  1E25 A;  4WMC D;  4UA9 A;  4RX3 A;  3V3R A;  1ES2 A;  2G2U A;  2Y91 A;  3Q7V A;  2H0Y A;  3HL9 A;  3HVF A;  4N92 A;  1JTG A;  5FSR A;  3IF6 C;  3VOY A;  2R9X A;  3N7W A;  4E6W A;  2EXA A;  4BEN A;  1ERQ A;  2XK1 A;  1MBL A;  5CED A;  1PZO A;  4DF6 A;  1K54 C;  1K4E A;  2OLU A;  3PBS A;  2XFS A;  4O7D A;  4MBF A;  4ZAM A;  5FAS A;  5FDH A;  5HX9 A;  3HLB A;  1NRF A;  3CG5 A;  4ZJ3 A;  2Y2J A;  4OP5 A;  5KMW A;  4JKT A;  1H5X A;  3UDI A;  1Z6F A;  3HLC A;  3UNW A;  3SH8 A;  1Q2Q A;  2ZQ8 A;  3P09 A;  4IVK A;  4N9L A;  5KSH A;  2HPB A;  3IWI A;  1MPL A;  1XA7 A;  1MKI A;  4M3K A;  3LY3 A;  1BTL A;  2WAE A;  4P85 A;  1NYY A;  3Q07 A;  1KE4 A;  3WS2 A;  4E3N A;  3PBQ A;  4S2N C;  1LI0 A;  2J7V A;  3ZDJ A;  5EVI C;  2EX9 A;  5EVI D;  5FQ9 A;  1W8Q A;  4EV4 A;  5AQ9 A;  2Y2O A;  1YLT A;  3FKV A;  4KZ7 A;  1KE0 A;  3UE3 A;  2HP5 A;  1VQQ A;  2HP6 A;  3V50 A;  4PM5 A;  5CTN A;  1YQS A;  3WS5 A;  2V20 A;  3N8S A;  3G31 A;  4B88 A;  1NZU A;  1IKI A;  3ZG8 B;  1XGI A;  3EQV A;  3GRJ A;  5FQQ A;  1Q2P A;  1C3B A;  1PI4 A;  2ZM0 A;  1J9M A;  4OP8 A;  5F1F A;  3WS4 A;  4B4Z A;  4DXB A;  3OZH A;  2HDR A;  4A5R A;  3CZD A;  1PWD A;  4R23 A;  5CXW A;  2Y2G A;  2IWB A;  2EFU A;  2XR0 A;  3DTM A;  2ZC7 A;  5FI6 A;  4S2N A;  4BL3 A;  2XH9 A;  5D3O A;  3UO9 A;  2P9V A;  3GTC A;  1KGG A;  1ONG A;  5EOE A;  4DDY A;  4BLM A;  1YT4 A;  1ERM A;  2WZZ A;  2XEP A;  4C6Y A;  1K25 A;  4EQI A;  3A3I A;  1W79 A;  3IWO A;  4E3J A;  5GLA A;  1XX2 A;  2PBY A;  3M6H A;  2XDM A;  3BRM A;  1K6R A;  1K56 A;  4DE3 A;  3ZVT A;  1K38 A;  3C5A A;  3IH9 A;  5E2H A;  1SCW A;  3BM6 A;  5BOH A;  1BLC A;  3VP2 A;  1ES4 A;  4Q8I A;  3PBR A;  3S1Y A;  4WEJ A;  2Y59 A;  1PIO A;  2Y2M A;  3SS5 A;  4QY6 A;  1KGE A;  3N4I A;  2HP9 A;  3HLF A;  4CJN A;  2EX2 A;  2DRW A;  2EX6 A;  4F94 A;  5CRF A;  1TVF A;  3NDE A;  3LEZ A;  1DJA A;  1L0G A;  4Y0U A;  1PW8 A;  4IBX A;  2ZM8 A;  4R4S A;  3Q7V B;  3VP3 A;  1O7E A;  2BG1 A;  1RCJ A;  4JF6 A;  3CJM A;  4XUX A;  1BT5 A;  2VGJ A;  3ZVW A;  4WBG A;  1NJ4 A;  3A3D A;  3C7V A;  2JCH A;  2ZC3 B;  3OPP A;  2OSU A;  2WKH A;  2XQZ A;  3BLM A;  3AGF A;  5EUA A;  3OPH A;  4LV3 A;  3PAG A;  4UA7 A;  3TOI A;  5F82 A;  4HEF A;  1I2W A;  3OPL A;  5G18 A;  4ZTK A;  4GDB A;  3DW0 A;  3ZG7 B;  4WEK A;  4KZ9 A;  3ZG5 A;  4EBP A;  2QMI A;  4R0Q A;  4FCF A;  2XFT A;  4S2M A;  3G35 A;  4KG5 A;  1L2S A;  4JXV A;  5TGF A;  1G6A A;  1LL9 A;  2DCF A;  2HDU A;  2WAF A;  5FA7 A;  4U0T A;  1N4O A;  3RJU A;  4B4X A;  3HUN A;  2Q9M A;  3BLS A;  3NI9 A;  4UA6 A;  5GL9 A;  2R9W A;  1E3U A;  3WRT A;  3OC2 A;  3IH8 A;  2ZQC A;  4ID4 A;  3IHB A;  3VSK A;  2PU2 A;  4GZB A;  4H8R A;  1ZG4 A;  4OPY A;  4X6T A;  4E3L A;  3HLE A;  2J9O A;  3GVB A;  5FQM A;  5DTS A;  4BL2 A;  1WE4 A;  3SS3 A;  4ZJ2 A;  4WZ5 A;  4BD1 A;  5M1A A;  4JXS A;  5CHM A;  5HAQ A;  4BD0 A;  3LCE A;  3MXR A;  4OQH A;  3VFH A;  3VOZ A;  1O07 A;  4DE1 A;  4E3O A;  1CI9 A;  4Y0T A;  3HLW A;  1IYO A;  1XXM A;  1K55 A;  5FAT A;  1JVJ A;  4GDN A;  4WZ4 A;  5I94 A;  2QZ6 A;  4NK3 A;  2WGW A;  1BSG A;  4PM8 A;  3V3S A;  1BLH A;  3VMA A;  4EWF A;  1SHV A;  1DY6 A;  4KZ3 A;  1CI8 A;  3M2K A;  1L0D A;  3ITA A;  4GD6 A;  4GOG A;  4KQO A;  3IF6 A;  4X69 A;  2RCX A;  4IED A;  5EPH A;  1JTD A;  5GLB A;  3M2J A;  3MKE A;  1FQG A;  2CC1 A;  1K54 A;  1H8Y A;  3PBO A;  2XF3 A;  4E6X A;  1TEM A;  4FH4 A;  4KZ5 A;  3WS0 A;  4JXW A;  4RVA A;  2ZQD A;  1KVM A;  3HLG A;  5FQI A;  2P74 A;  1K6S A;  1XKZ A;  1XGJ A;  2V2F F;  1FOF A;  3A3F A;  3OPR A;  1MWU A;  1NYM A;  2WAD A;  2WKI A;  2ZC5 B;  4UHU A;  4RYE A;  2WK0 A;  1TDG A;  3LY4 A;  1BZA A;  3Q81 A;  4BQM A;  1ES3 A;  1I2S A;  3NCK A;  5HL1 A;  1K57 C;  2Y55 A;  4WEL A;  1WYC A;  5KZH A;  3UY6 A;  5JYP A;  4MEZ A;  3A3E A;  2Z2M B;  3OCL A;  5F1G A;  4PM9 A;  3ZNT A;  1FCN A;  5E43 A;  4HES A;  4QY5 A;  4DXC A;  5EVI A;  1BLS A;  5IHV A;  2OV5 A;  2Y4A A;  5GLD A;  5HAP A;  3AGE A;  4EBN A;  1K56 D;  1W5D A;  3Q7Z A;  4DE0 A;  1RGZ A;  1GA9 A;  4QB8 A;  5J8X A;  5EVL A;  2ZMA A;  4K0W A;  1IYP A;  5DTT A;  4Y7P A;  4S2P A;  5CHU A;  2PU4 A;  3G30 A;  3A3J A;  5EE8 A;  3ZG9 B;  2FFY A;  4MBH A;  4FH2 A;  3QHY A;  1SDN A;  3O87 A;  4OPR A;  2HDQ A;  1M6K A;  3O3V A;  1SKF A;  4UAA A;  5HFO A;  2Y2H A;  1HD8 A;  3NDG A;  4OQI A;  2IWC A;  2Y2Q A;  1PWG A;  1IKG A;  1W8Y A;  2DNS A;  1K57 A;  4LV2 A;  3IHA A;  4U3T A;  3SS4 A;  3LO7 A;  5M18 A;  5DF9 A;  5DVA A;  1CK3 A;  1LL5 A;  5E2E A;  3C4O A;  1ZC2 A;  1M40 A;  3BFE A;  3G2Y A;  1FSW A;  3E2K A;  1KDS A;  2WZX A;  1G68 A;  1S6R A;  4KG6 A;  3UN7 A;  4OLD A;  3GMW A;  5JYO A;  2FFF B;  1ONH A;  1DJB A;  1N9B A;  1FCM A;  4S2L A;  3IQA A;  4OPZ A;  4IVI A;  4RX2 A;  2JBF A;  4P0M A;  3FYZ A;  5CTM A;  5A93 A;  1ESU A;  2EX8 A;  1ZG6 A;  4R1G A;  3MZD A;  5HAR A;  1EWZ A;  2Y2L A;  4MNR A;  2XGN A;  4LCM A;  1BUE A;  3TSG A;  1E4D A;  4EUZ A;  1XPB A;  2B5R A;  1CEG A;  4OOM A;  3HLD A;  1PW1 A;  4KZA A;  3BFC A;  4OKP A;  3MZE A;  3PBN A;  1GA0 A;  1NZO A;  4Y0O A;  4C3Q A;  5AQB A;  5EOO A;  2UWX A;  2HDS A;  4L0L A;  4OPQ A;  1PI5 A;  5CGX A;  3NIA A;  3O86 A;  3C4P A;  3FWL A;  1VM1 A;  4MBK A;  2ZQ9 A;  1XA1 A;  1S0W A;  4FSF A;  4KG2 A;  1JWZ A;  4OON A;  1E3U D;  3GSG A;  2WGW B;  4JF5 A;  4PPR A;  4KZB A;  2V1Z A;  3G32 A;  5FAO A;  4ZJ1 A;  2WKE A;  3W4P A;  3IF6 B;  2ZC4 B;  3ZFZ A;  1NY0 A;  1W7F A;  3E2L A;  4HBT A;  1GHP A;  1FSY A;  2XD5 A;  2Y2K A;  3MKF A;  4JLF A;  4E3M A;  1EI5 A;  3IXH A;  5E2F A;  4S2J A;  1ALQ A;  3SH9 A;  1QMF A;  3IXG A;  3FZC A;  5FAQ A;  3WRZ A;  1YMS A;  3ZGA B;  3UPO A;  3UDX A;  2XLN A;  4QJG A;  4K0X A;  5L2F A;  3CMZ A;  3G34 A;  5DTK A;  2X02 A;  4KZ6 A;  4X55 A;  5F83 A;  4K91 A;  2OLV A;  3UE0 A;  3SH7 A;  3VP1 A;  4WYY A;  2H10 A;  1FCO A;  1MXO A;  3NY4 A;  5U47 A;  3QNC A;  3PAE A;  1MY8 A;  1ERO A;  3RXX A;  3IXD A;  1GHM A;  3FKW A;  4LV0 A;  4WMC A;  3IWQ A;  1YMX A;  3ITB A;  5EVI B;  4S2K A;  1K4F A;  1SDE A;  4DKI A;  2WGI A;  1YLP A;  4P6B A;  4E3K A;  2P9V B;  4D2O A;  5HAI A;  1YLY A;  5AQA A;  3GQZ A;  3BFG A;  2WUQ A;  2C6W B;  3ISG A;  5FQJ A;  4DDS A;  2Y2P A;  5CGW A;  1ES5 A;  5FI2 A;  3V39 A;  2H0T A;  4KEN B;  3C7U A;  3VSL A;  4N1H A;  1NXY A;  5CGS A;  4OOY A;  5DF8 A;  4JBF A;  2ZD8 A;  3G2Z A;  4BJP A;  3FV7 A;  1OME A;  1YLZ A;  3PTE A;  5GHY A;  4X68 A;  4YIN A;  3VFF A;  4OLG A;  1JWV A;  5FAP A;  1GCE A;  5CER A;  4NET A;  3UE1 A;  3V5M A;  3IF5 A;  5E2G A;  3SOI A;  2ZC6 B;  5GLC A;  4JPM A;  3W4O A;  5M19 A;  4OQ0 A;  3Q1F A;  3EQU A;  3IXB A;  4S2O A;  4U0X A;  1YLJ A;  4E3I A;  5GHX A;  3M6B A;  2C5W B;  5DF7 A;  1PZP A;  4FD8 A;  1IEM A;  3MZF A;  2ZQ7 A;  4N9K A;  3GV9 A;  4LV1 A;  4PMA A;  4EBL A;  4KZ8 A;  1I5Q A;  3NBL A;  2A49 A;  1KE3 A;  2GDN A;  3B3X A;  1GHI A;  1YLW A;  4LEN A;  2XD1 A;  1ESI A;  5KSC A;  3BEB A;  1HZO A;  5A90 A;  2G2W A;  3G4P A;  2WYX A;  3MFD A;  4JF4 A;  4XUZ A;  2Y2N A;  4R4R A;  3S22 A;  4KZ4 A;  1PWC A;  3WS1 A;  5TR7 A;  2J8Y A;  2ZJ9 A;  3MXS A;  2JC7 A;  1KGF A;  1KVL A;  2X71 A;  4GNU A;  1RGY A;  2Z2L B;  5TFQ A;  3DWZ A;  1QME A;  4X53 A;  2IWD A;  3MBZ A;  2Q9N A;  1KDW A;  4HBU A;  4KQR A;  5CHJ A;  3Q82 A;  4OQG A;  4N1X A;  1MWT A;  3AGD A;  2I72 A;  4OOL A;  2EXB A;  3P98 A;  4GB7 A;  2WGV A;  1HTZ A;  4WM9 A; 
#chains in the Genus database with same CATH topology
 2VV7 A;  4P87 A;  2HF6 A;  3LUQ A;  5A92 A;  1V9Y A;  2A24 B;  3UDF A;  3C8C A;  3L9K A;  3VP4 A;  1W63 Q;  2W3H A;  3LR5 A;  3N8L A;  4I39 A;  2JE5 A;  1CJF A;  1YKD A;  3U2A A;  5DJU A;  1H8Z A;  2W3E A;  3EGD C;  3UPN A;  3HBR A;  4GD8 A;  3KYQ A;  2EA9 A;  4XXR A;  5EEC A;  1TDL A;  3T12 B;  3TG9 A;  3T1S A;  1ODV A;  1UGU A;  2VEA A;  1BLP A;  2VGK A;  2JKG A;  3HRE A;  1JWP A;  4HP9 A;  2RL3 A;  2K2N A;  3S4X A;  1IYQ A;  3I7J A;  1S67 L;  2QPN A;  4JGQ A;  1OPX A;  4UQI S;  3BEC A;  3RXW A;  1E25 A;  2GJ3 A;  4WMC D;  3K3C A;  5AVE A;  4RX3 A;  1ES2 A;  2G2U A;  2Y91 A;  2H0Y A;  3HVF A;  3UB9 A;  2R9X A;  3N7W A;  5L09 A;  1PZO A;  3PBS A;  4IUK A;  3UME A;  4ZAM A;  5FDH A;  2V8C A;  5TJJ A;  2Y2J A;  1Z6F A;  3UNW A;  3SH8 A;  1Q2Q A;  3P09 A;  4IVK A;  2HPB A;  3EGX C;  4MN7 A;  1XA7 A;  1MKI A;  3FG8 A;  4P85 A;  2Y79 A;  4S2N C;  3T4L A;  1V9Z A;  4ETX A;  4CLC A;  5EVI D;  5FL3 A;  2Y2O A;  1S1Y A;  3T1R A;  3ZG8 B;  3EQV A;  4HOI A;  5HWV A;  2ZM0 A;  4OP8 A;  5F1F A;  2KX6 A;  2PD7 A;  4MMN A;  4DXB A;  2HDR A;  4G3K A;  4R23 A;  2WKR A;  2PBD P;  4L9F A;  2V8F A;  3UO9 A;  3GTC A;  3V67 A;  1MZU A;  3A3I A;  2Z6C A;  3H82 B;  4E3J A;  1K56 A;  3IH9 A;  3MQQ A;  2PYR A;  5DJT A;  1ES4 A;  3H7W A;  1G6O A;  2Y59 A;  1NLY A;  5L8M A;  1OTB A;  3N4I A;  2DRW A;  1Y4O A;  4IUH A;  1Y28 A;  1PW8 A;  2ZM8 A;  3Q7V B;  2BG1 A;  4LGW A;  1BT5 A;  4HIA A;  3ZVW A;  2HZ5 A;  3QP1 A;  4WBG A;  1NJ4 A;  4Q0J A;  2WKH A;  3LEQ A;  5TBM A;  2VGL S;  3AGF A;  4LV3 A;  3KSI A;  1I2W A;  3OPL A;  2OAP 1;  3EOI A;  5AVF A;  4FCF A;  1SKO A;  1OTI A;  1VEU A;  4JXV A;  2HDU A;  2WAF A;  1E3U A;  4GCZ A;  3WRT A;  3IH8 A;  3D9Y A;  5FQM A;  3VE3 A;  3UE6 A;  1WE4 A;  4WZ5 A;  4OQH A;  3VOL A;  1O07 A;  3E4P A;  4Y0T A;  1IYO A;  1H8M A;  1XXM A;  1VB6 A;  5C5K A;  5FAT A;  2G7U A;  4RQ9 A;  3V3S A;  1H3Q A;  3C30 A;  3VMA A;  3FPV A;  3E0Y A;  3M2K A;  4KQO A;  2V1B A;  1JTD A;  3M2J A;  1H8Y A;  4HI4 A;  4KZ5 A;  3WS0 A;  4JXW A;  2ZQD A;  1KVM A;  3HLG A;  5FQI A;  1XKZ A;  4EU0 A;  2PT7 A;  1TD5 A;  4BQM A;  1K57 C;  3KO6 A;  4B9O A;  2Z2M B;  3OCL A;  4Y13 A;  2V0W A;  5E43 A;  1W63 M;  5IHV A;  1NLZ A;  5HAP A;  3AGE A;  2A2L A;  5FDS A;  1VET A;  4DE0 A;  4QB8 A;  5J8X A;  4LPZ A;  3F1O B;  4R38 A;  4HQA A;  3E4O A;  3QHY A;  1S4S A;  2HDQ A;  5HFO A;  2Y2H A;  3SS4 A;  5M18 A;  3NEC A;  1CK3 A;  5E2E A;  1M40 A;  5L07 A;  3BFE A;  2WZX A;  3GMW A;  2FFF B;  1FCM A;  4RX2 A;  2JBF A;  1N9O A;  4P0M A;  5CTM A;  3UB5 P;  4LCM A;  3KSF A;  3TSG A;  2B5R A;  4OOM A;  5F69 A;  3BFC A;  4OKP A;  5AQB A;  3KSH A;  3LR4 A;  3NIA A;  4WL9 A;  4GJ4 A;  2ZQ9 A;  1XA1 A;  4FSF A;  3IS2 B;  4JF5 A;  2WGW B;  4KZB A;  2PRF A;  4ARZ A;  4GS9 B;  2VA0 A;  4NG2 A;  3IF6 B;  4I3A A;  3ZFZ A;  1NY0 A;  4R6L A;  1FSY A;  1T1C A;  2XD5 A;  4HY8 A;  4E3M A;  5E2F A;  2KLI A;  2OWJ A;  3FZC A;  1YMS A;  2XLN A;  3LIA A;  2JKF A;  2OOL A;  3CMZ A;  3OOV A;  4CLC C;  5L2F A;  2X02 A;  2VKS A;  4X55 A;  1FCO A;  1MY8 A;  1ERO A;  3A0V A;  1P9W A;  1STZ A;  4S2K A;  4DKI A;  4E3K A;  2P9V B;  1D1J A;  5AQA A;  5HAI A;  3UB7 A;  2FH5 A;  2C6W B;  4DDS A;  2Y2P A;  1ES5 A;  5FI2 A;  3V39 A;  1NXY A;  5CGS A;  4OOY A;  2O9C A;  4EXO A;  1OME A;  4NXB A;  1JWV A;  1GCE A;  4NET A;  2V9A A;  3UE1 A;  3V5M A;  1LSX A;  2ZC6 B;  4JPM A;  3W4O A;  3Q1F A;  1Z09 A;  4S2O A;  1YLJ A;  2C5W B;  2XA7 M;  1CF0 A;  1IFQ A;  4PMA A;  5HZH A;  3NBL A;  3LID A;  2A49 A;  2PD8 A;  1GHI A;  3BEB A;  2QJ5 A;  3MFD A;  4JF4 A;  4XUZ A;  1PWC A;  2JC7 A;  1RGY A;  3ZYT A;  4F3L B;  4EUV A;  2IWD A;  3MBZ A;  1KDW A;  2PR6 A;  1X0O A;  1YSQ A;  2EXB A;  4GB7 A;  2PYP A;  5FQK A;  3MQ0 A;  2YKF A;  1OJ5 A;  1DJC A;  5AQ7 A;  4GN2 A;  3HJI A;  2E8I A;  4OVD A;  3PYP A;  4YWZ A;  2ZM2 A;  4PAU A;  3OBF A;  3UPP A;  3ZG0 A;  5HW3 A;  1JNU A;  5F68 A;  4R3B A;  3LR3 A;  4QD4 A;  4MLL A;  2P08 A;  3MS6 A;  3CUE A;  2O0Y A;  5L10 A;  3BFD A;  5CEC A;  4OH0 A;  4Q0I A;  4LCL A;  1AXB A;  4EEU A;  1YM1 A;  2EFX A;  3ZHH A;  4KQQ A;  1HVB A;  4ZDX A;  3QNB A;  1PFL A;  4WZ5 C;  2A3U A;  3IT9 A;  3D4F A;  3BFF A;  3BY9 A;  3OCN A;  5HL6 A;  2H5S A;  3N8R A;  2J9P A;  1BUL A;  1PYY A;  4QU3 A;  1ZKJ A;  1MWR A;  4NEE D;  4LRX C;  3HL9 A;  1OJG A;  2L0W A;  5IT5 A;  1MBL A;  1K4E A;  1GSX A;  2XFS A;  4O7D A;  5HX9 A;  1LL8 A;  4OP5 A;  1DRM A;  3HLC A;  4PKY G;  1HLU P;  1T1B A;  5KSH A;  5FEG A;  3LY3 A;  1BTL A;  3ZQ5 A;  3WS2 A;  3PBQ A;  1LI0 A;  2J7V A;  3ZDJ A;  5FQ9 A;  1F98 A;  4KZ7 A;  3UE3 A;  2J3W A;  2HP5 A;  4PM5 A;  3ICY A;  1YQS A;  2O9B A;  2V20 A;  3N8S A;  3MSH A;  4Z1W A;  2W1R A;  1IKI A;  5FQQ A;  2K7S A;  3WS4 A;  4PHT A;  1NRJ A;  5CXW A;  4X25 A;  2XR0 A;  4R70 A;  3HCY A;  4JGP A;  4NKP A;  2P9V A;  1KGG A;  1ONG A;  4Y2F A;  4BLM A;  4C6Y A;  3DBA A;  1K25 A;  2W3G A;  3IWO A;  3BRM A;  4DE3 A;  3ZVT A;  2PHY A;  3C5A A;  3CHW P;  3K2N A;  3BM6 A;  3IBR A;  4BMW A;  4Q8I A;  3PBR A;  2ZBB A;  3S1Y A;  4QWO A;  1PIO A;  3T4S A;  2Y2M A;  4QY6 A;  2VV8 A;  2HP9 A;  2EX2 A;  5FEF A;  1TVF A;  3VP3 A;  1O7E A;  3B47 A;  4XUX A;  2VGJ A;  5HD5 A;  5EFW A;  3C7V A;  2JCH A;  1AWI A;  5G4Y A;  3OPH A;  3PAG A;  5A8B A;  5F82 A;  2E8J A;  5G18 A;  1F2K A;  3DW0 A;  4O8G A;  4EET B;  3ZG5 A;  4EBP A;  2QMI A;  5HDD A;  1ACF A;  1L2S A;  1G28 A;  5FA7 A;  3HUN A;  2Q9M A;  5GL9 A;  3T1X A;  2ZQC A;  3EEH A;  3IHB A;  4GZB A;  4H8R A;  4OPY A;  4X6T A;  4E3L A;  3HLE A;  5DTS A;  2HJ9 C;  3F1N A;  4BD1 A;  1XFN A;  4JXS A;  5CHM A;  4BD0 A;  4CLC D;  3LCE A;  4DE1 A;  2QYB A;  3HLW A;  3IX8 A;  4GDN A;  5I94 A;  4Y5F A;  4EWF A;  4KZ3 A;  1DY6 A;  3U4L P;  1TF1 A;  1CI8 A;  4X69 A;  5EPH A;  2W27 A;  4R3A A;  1K54 A;  2LB9 A;  3UB8 A;  1TEM A;  2P74 A;  1XGJ A;  3A3F A;  4BBV A;  1FOF A;  1MWU A;  2WAD A;  4JGO A;  1TDG A;  3LY4 A;  2OWH A;  3Q81 A;  1ES3 A;  1I2S A;  3CLO A;  5J7E A;  4WEL A;  1WYC A;  5KZH A;  3UY6 A;  5JYP A;  4MEZ A;  3A3E A;  4PM9 A;  3F1P B;  5EVI A;  2EWW A;  2HGV A;  1WA9 A;  1K56 D;  3GEC A;  1W5D A;  3SW1 A;  1GA9 A;  2ZMA A;  5DTT A;  4Y7P A;  4S2P A;  5CHU A;  1KOU A;  3ZG9 B;  5CX7 A;  4FH2 A;  1SDN A;  3K3D A;  1SKF A;  4UAA A;  2KDK A;  3NDG A;  2IWC A;  2Y2Q A;  1IKG A;  1W8Y A;  3LI8 A;  4U3T A;  3IHA A;  3CUE C;  5DF9 A;  4HJ4 A;  5EVE A;  3VV4 A;  3T4T A;  3UN7 A;  4OPZ A;  4EQ1 A;  3FYZ A;  1ESU A;  3MZD A;  1EWZ A;  2Y2L A;  5EV0 A;  4EUZ A;  1E4D A;  1XPB A;  1CEG A;  3C38 A;  4KZA A;  2K31 A;  3PBN A;  2CMN A;  4Y0O A;  4C3Q A;  2HDS A;  3O86 A;  3C4P A;  3FWL A;  1VM1 A;  1S0W A;  2M1C A;  5DFX A;  1E3U D;  4Y3I A;  3IX3 A;  2A24 A;  4ZJ1 A;  4QPR A;  2WKE A;  3BQA A;  1G5U A;  1W7F A;  2ZOI A;  3MKF A;  1ALQ A;  1QMF A;  3WRZ A;  4B93 A;  3UDX A;  3QP4 A;  4KZ6 A;  5F83 A;  3UE0 A;  3SH7 A;  3NY4 A;  4M4X A;  3NJA A;  3IXD A;  1GHM A;  3IWQ A;  1K4F A;  2V0U A;  2WGI A;  4D2O A;  5FQJ A;  5CGW A;  2VJW A;  2VLG A;  3C7U A;  1UWN X;  4JBF A;  3QP5 A;  1YLZ A;  4YIN A;  2B18 A;  5K5B A;  4X1M A;  3DTI A;  2BAS A;  4OQ0 A;  3T4J A;  4I38 A;  3T4O A;  2JKR M;  4U0X A;  4E3I A;  1PZP A;  4HJ3 A;  4EEP A;  4LV1 A;  1DP6 A;  1KE3 A;  2GDN A;  2P7J A;  5HWW A;  1ESI A;  3LFV A;  5DKL A;  3G4P A;  4R4R A;  5TR7 A;  2UV0 E;  3Q82 A;  1MWT A;  3AGD A;  1YAX A;  3T4Q A;  3P98 A;  3E4Q A;  3S7P A;  4QHC A;  2IA2 A;  1RP5 A;  2JHE A;  4Z9Q A;  5F5Y A;  4RA7 A;  1IYS A;  4HHD A;  1DP8 A;  4HH2 A;  1LI9 A;  3GR2 A;  3EWK A;  1LLB A;  1ZHH B;  3VP0 A;  3JYI A;  5EM0 A;  2I9V A;  2ZOH A;  5A91 A;  2BTF P;  4D60 A;  3HUO A;  2Y2I A;  1XP4 A;  1FR1 A;  3H82 A;  3PR6 A;  1YSP A;  1FR6 A;  3W8K A;  3DWK A;  3N6I A;  4Y15 A;  2Y8H A;  1IEL A;  4WLA A;  5CEB A;  3HUM A;  3NUL A;  3QP8 A;  1F5M A;  4IJG A;  3O88 A;  4JXG A;  4K08 A;  4PM7 A;  4IBR A;  3WWX A;  2B95 A;  4XT2 B;  5MC7 A;  1L0E A;  2BLS A;  1WYB A;  2D02 A;  5F6A A;  4YFM A;  2NUP C;  2PDR A;  4UA9 A;  1CQA A;  5FSR A;  3Q7V A;  4N92 A;  1JTG A;  3LI9 A;  4JGR A;  4BEN A;  2XK1 A;  2GNX A;  5CED A;  1K54 C;  1OTD A;  2J3T C;  1T19 A;  3HLB A;  5IS1 A;  1NRF A;  4ZJ3 A;  5KMW A;  4JKT A;  2ZQ8 A;  3IWI A;  3TW8 A;  1NYY A;  3Q07 A;  1KE4 A;  4E3N A;  5EVI C;  2EX9 A;  3CPT B;  5HPF A;  4EV4 A;  3ULF A;  1LSW A;  3FKV A;  2ZL1 B;  3S7N A;  1KE0 A;  3V50 A;  5CTN A;  3T4K A;  3WS5 A;  1XJ4 A;  3NHQ A;  5HDS A;  2QKP A;  1MC0 A;  2R78 A;  4IHQ A;  1NZU A;  2L4R A;  2J80 A;  4MDZ A;  2GZA A;  3CZD A;  3UMD A;  1PWD A;  1FIK A;  1K0K A;  2Y2G A;  2IWB A;  1L3L A;  2EFU A;  3DTM A;  4S2N A;  3G6O A;  3IX4 A;  5D3O A;  4MCW A;  3D72 A;  4DN0 A;  5EOE A;  4DDY A;  1YT4 A;  2XEP A;  2WZZ A;  1W79 A;  1GSW A;  1K6R A;  3TE8 A;  5E2H A;  5BOH A;  1BLC A;  3VP2 A;  2B02 A;  2VK3 A;  4DMZ A;  1KGE A;  2H28 A;  1VHM A;  2JKT I;  2EX6 A;  4F94 A;  2PAV P;  3NDE A;  1L0G A;  5I5L A;  1OTE A;  3CI6 A;  1RCJ A;  2HV1 A;  3CJM A;  4JF6 A;  3F1O A;  3A3D A;  3BY8 A;  4O0P A;  3OPP A;  2OSU A;  5EUA A;  4HEF A;  4ZTK A;  4L9G A;  4R0Q A;  4G3W A;  3L7H A;  4KG5 A;  3KSG A;  3NOT C;  1G6A A;  1LL9 A;  2DCF A;  4HP4 A;  4CLC B;  4U0T A;  3BLS A;  3NI9 A;  4GHI B;  4UA6 A;  2R9W A;  5LBR A;  3RTY A;  1H0M A;  3OC2 A;  3VSK A;  3R7W B;  3GVB A;  2W3F A;  2NUT C;  3CAX A;  1NWZ A;  3VFH A;  1DP9 A;  1OT9 A;  3VOZ A;  4E3O A;  2JKR I;  1K55 A;  3IS2 A;  1GSV A;  1JVJ A;  4NK3 A;  2WGW A;  1BSG A;  3A0S A;  1BLH A;  4HJ6 A;  4GS9 A;  2W1T B;  1L0D A;  3ITA A;  4GOG A;  3IF6 A;  5IU1 A;  4IED A;  2VX8 A;  4XT2 A;  2CC1 A;  3PBO A;  4FH4 A;  4BBT A;  1K6S A;  3OPR A;  4UHU A;  1PRQ A;  4RYE A;  2WK0 A;  3JVU A;  5HL1 A;  2Y55 A;  3H7W B;  3MR0 A;  2QJ7 A;  4KUK A;  3H9W A;  4P6Z M;  4QY5 A;  4DXC A;  5GLD A;  2M7U A;  4EBN A;  1OT6 A;  1RGZ A;  4WF0 A;  2D01 A;  5EVL A;  4K0W A;  1IYP A;  1MKM A;  2PU4 A;  3G30 A;  4Q0H A;  5EE8 A;  5TBM B;  3T50 A;  4OPR A;  3S7Q A;  5DFY A;  3JPU A;  1M6K A;  1HD8 A;  4OQI A;  3MF0 A;  1K57 A;  4LV2 A;  1S1Z A;  3LO7 A;  1EW0 A;  5DVA A;  3UB6 A;  1SKO B;  3DAV A;  1ZC2 A;  1VEU B;  1S6R A;  1ZTU A;  4H6J B;  1ONH A;  1DJB A;  1N9B A;  4S2L A;  3IQA A;  5A93 A;  3P7N A;  4LLO B;  2EX8 A;  1ZG6 A;  1FIL A;  4R1G A;  5HAR A;  2XGN A;  1BUE A;  3W2Z A;  2MJ6 A;  2P04 A;  1PW1 A;  2M7V A;  4F3L A;  3MZE A;  1XFQ A;  3FC7 A;  1GA0 A;  2INW A;  2YKH A;  1PI5 A;  5CGX A;  4MBK A;  4X1L A;  3MFX A;  4KUO A;  4PPR A;  5HSQ A;  3G32 A;  2W0N A;  2XRN A;  4MN5 A;  5FAO A;  1IOU A;  4E04 A;  3OLO A;  2ZC4 B;  4HBT A;  1GHP A;  2Y2K A;  4KQD A;  4LRZ E;  1EI5 A;  4NXF A;  4S2J A;  5FAQ A;  3ZGA B;  3S7O A;  1J3W A;  2H10 A;  5U47 A;  3QNC A;  2XA7 S;  4WMC A;  4LV0 A;  2J3T D;  4O01 A;  4P6B A;  1VET B;  5J4E A;  3GQZ A;  2WUQ A;  3ISG A;  4LFU A;  2H0T A;  2ZD8 A;  4BJP A;  3FV7 A;  4CLC E;  5FAP A;  5CER A;  3IF5 A;  5E2G A;  5HDC A;  5GLC A;  3PXP A;  2LB5 A;  4GHI A;  3EQU A;  3M6B A;  3R7W A;  5DF7 A;  3NOP C;  3GV9 A;  4KZ8 A;  1I5Q A;  3QP2 A;  5KSC A;  5A90 A;  2G2W A;  2Y2N A;  4KZ4 A;  2ZJ9 A;  3MXS A;  3LIE A;  1KVL A;  4GNU A;  2Z2L B;  4HBU A;  5HWT A;  4OQG A;  4CQH A;  4G3V A;  2W1T A;  2I72 A;  4BWI A;  3BWL A;  3LIF A;  1P9R A;  5FI7 A;  2ZQA A;  4L9E A;  4X56 A;  2ZLY A;  1CEF A;  5KIZ A;  3ZCZ A;  4DRT A;  3NOU C;  4ARZ B;  3W4Q A;  1Y54 A;  1LHY A;  3NC8 A;  4GKU A;  1U60 A;  2KOI A;  3LR0 A;  1L0F A;  1XJ3 A;  2OAQ 1;  3KX0 X;  4GLQ A;  2L1M A;  4R3J A;  4DE2 A;  1MWS A;  4S2I A;  3TJZ C;  2VV6 A;  4PM6 A;  4DJ2 A;  4CPK A;  5GHZ A;  2JKT M;  3PHY A;  3DTE A;  3GDI A;  3B42 A;  4ESP A;  4C75 A;  2X01 A;  4ZBE A;  3PBT A;  1N9N A;  3KYE A;  4HNB A;  4I3I A;  4WUJ A;  1K55 C;  3ZNY A;  3BYD A;  3BQ8 A;  1P97 A;  3EEA A;  4H6J A;  3V3R A;  3IF6 C;  3VOY A;  4E6W A;  2EXA A;  1ERQ A;  4DF6 A;  2OLU A;  4MBF A;  5FAS A;  3DTK A;  2XRO A;  3CG5 A;  2XSS A;  4EW7 A;  1H5X A;  3UDI A;  4N9L A;  1MPL A;  1D06 A;  3QP6 A;  4M3K A;  2WAE A;  1TS6 A;  3JVV A;  4AFI A;  4P6Z S;  1TS8 A;  1W8Q A;  3MJQ A;  4NXE A;  5AQ9 A;  1YLT A;  3VE4 A;  4FOF A;  2V1A A;  1VQQ A;  2HP6 A;  4BBU A;  3G31 A;  4B88 A;  1XGI A;  3GRJ A;  1Q2P A;  1C3B A;  1PI4 A;  1YPR A;  1J9M A;  1UWP X;  4B4Z A;  1A0K A;  3OZH A;  4A5R A;  3D3O A;  2AVX A;  3HJK A;  5FI6 A;  2ZC7 A;  1TS7 A;  3KYZ A;  2XH9 A;  4BL3 A;  2Z6D A;  1XJ2 A;  2GX5 A;  1ERM A;  2ZMV A;  4FUW A;  4EQI A;  4ME4 A;  5GLA A;  1TS0 A;  1XX2 A;  1S66 L;  2PBY A;  3M6H A;  2XDM A;  1K38 A;  1SCW A;  2HJE A;  3SZT A;  1XJ6 A;  4WN5 A;  4LRY C;  4WEJ A;  3F1P A;  3SS5 A;  3O5Y A;  3HLF A;  4CJN A;  1SZV A;  3IBJ A;  3LGO A;  5CRF A;  3LEZ A;  1DJA A;  4Y0U A;  4IBX A;  4R4S A;  2QHK A;  4HH3 A;  3LIC A;  4Y17 A;  2ZC3 B;  2XQZ A;  4EER A;  3BLM A;  4UA7 A;  3TOI A;  4GDB A;  3ZG7 B;  4WEK A;  4KZ9 A;  2XFT A;  4S2M A;  3G35 A;  5TGF A;  1N4O A;  2WKQ A;  3RJU A;  4B4X A;  4I5S A;  3CIT A;  2EWV A;  4ID4 A;  5G4Z A;  2PU2 A;  1ZG4 A;  1N9L A;  2J9O A;  2FZ0 A;  4BL2 A;  3SS3 A;  4ZJ2 A;  5M1A A;  5HAQ A;  3MXR A;  1CI9 A;  1P0Z A;  4WZ4 A;  2QZ6 A;  4PM8 A;  4UQI M;  5DKK A;  3TRC A;  1SHV A;  4ZRR A;  5AJG A;  4GD6 A;  2RCX A;  5GLB A;  3MKE A;  1FQG A;  4E6X A;  2XF3 A;  4RVA A;  1F9I A;  2V2F F;  1NYM A;  2WKI A;  2ZC5 B;  2ZMF A;  2DMW A;  4YNR A;  1BZA A;  3NCK A;  3BJN A;  3ZNT A;  5F1G A;  1FCN A;  4HES A;  1BLS A;  2OV5 A;  2Y4A A;  4UEY A;  3Q7Z A;  5HD3 A;  3LIB A;  4GW9 A;  3A3J A;  2FFY A;  4MBH A;  4PKY A;  3O87 A;  3O3V A;  2QWS A;  1PWG A;  2DNS A;  3MMH A;  2W3D A;  1LL5 A;  3C4O A;  3G2Y A;  1FSW A;  3E2K A;  1KDS A;  1G68 A;  4KG6 A;  1S4R A;  5JYO A;  4OLD A;  5HPI A;  2O9A A;  4IVI A;  1D7E A;  3P01 A;  4MNR A;  3HLD A;  3R4K A;  3F1N B;  1NZO A;  5EOO A;  2UWX A;  4L0L A;  4OPQ A;  3T1Q B;  5EM1 A;  4KG2 A;  1JWZ A;  4OON A;  3GSG A;  2V1Z A;  2JN7 A;  4FTX A;  3W4P A;  1T1A A;  3E2L A;  4EES A;  4JLF A;  3IXH A;  2ACG A;  3SH9 A;  1PNE A;  3IXG A;  3MXQ A;  3LYX A;  4ETZ A;  2VGL M;  3UPO A;  4QJG A;  4K0X A;  3G34 A;  5DTK A;  4K91 A;  2OLV A;  3VP1 A;  4WYY A;  3A0R A;  1MXO A;  3PAE A;  3RXX A;  3FKW A;  1YMX A;  3ITB A;  5EVI B;  3BW6 A;  1SDE A;  1YLP A;  2WKP A;  1YLY A;  1OTA A;  3BFG A;  4NXG A;  4KEN B;  3RFB A;  3VSL A;  3E98 A;  4N1H A;  5DF8 A;  4YOF A;  2O99 A;  3G2Z A;  3PTE A;  5GHY A;  1LT0 A;  4X68 A;  3VFF A;  3MQO A;  4OLG A;  1BYW A;  3SOI A;  5M19 A;  3IXB A;  4DJ3 A;  5GHX A;  3CWF A;  2PR5 A;  4FD8 A;  1IEM A;  3MZF A;  2ZQ7 A;  5J3W A;  4I3J A;  4N9K A;  4II7 A;  4EBL A;  3FPW A;  3B3X A;  4LEN A;  1YLW A;  2XD1 A;  1HZO A;  2Q0O A;  2WYX A;  1LSV A;  3S22 A;  4MN6 A;  3WS1 A;  2J8Y A;  3C2W A;  2X71 A;  1KGF A;  5TFQ A;  1T18 A;  3DWZ A;  1QME A;  4X53 A;  3CPT A;  4KQR A;  2Q9N A;  5CHJ A;  4N1X A;  3B33 A;  4OOL A;  2VZW A;  2WGV A;  2ZL1 A;  1HTZ A;  3RH8 B;  4WM9 A; 
#chains in the Genus database with same CATH homology
 2ZQA A;  5FQK A;  4P87 A;  4X56 A;  4QHC A;  2ZLY A;  1CEF A;  1DJC A;  5AQ7 A;  3ZCZ A;  4GN2 A;  4DRT A;  1RP5 A;  5A92 A;  2E8I A;  4OVD A;  3UDF A;  4Z9Q A;  1Y54 A;  2ZM2 A;  3VP4 A;  3W4Q A;  4RA7 A;  1IYS A;  3N8L A;  1LHY A;  3NC8 A;  1LI9 A;  2JE5 A;  3GR2 A;  4GKU A;  3UPP A;  1U60 A;  1L0F A;  1H8Z A;  1LLB A;  3ZG0 A;  3VP0 A;  3JYI A;  5HW3 A;  3UPN A;  3HBR A;  4GD8 A;  4R3B A;  4XXR A;  5EEC A;  3TG9 A;  1TDL A;  5A91 A;  4QD4 A;  4MLL A;  3HUO A;  4R3J A;  2Y2I A;  1XP4 A;  1FR1 A;  3BFD A;  5CEC A;  4DE2 A;  4OH0 A;  1MWS A;  4LCL A;  1BLP A;  4S2I A;  1AXB A;  2VGK A;  3HRE A;  5FI7 A;  1FR6 A;  3W8K A;  1JWP A;  1YM1 A;  2EFX A;  3DWK A;  4PM6 A;  2RL3 A;  3N6I A;  3S4X A;  4CPK A;  3ZHH A;  1IYQ A;  5GHZ A;  4KQQ A;  1IEL A;  5CEB A;  3HUM A;  1HVB A;  3I7J A;  4ZDX A;  3QNB A;  2QPN A;  4WZ5 C;  2A3U A;  3O88 A;  4JXG A;  4C75 A;  3IT9 A;  4PM7 A;  4IBR A;  4ZBE A;  3D4F A;  3PBT A;  2X01 A;  3WWX A;  3BFF A;  1L0E A;  2BLS A;  3OCN A;  2H5S A;  1K55 C;  1WYB A;  3N8R A;  4YFM A;  3ZNY A;  3BYD A;  3BEC A;  2J9P A;  3RXW A;  1BUL A;  1PYY A;  4QU3 A;  1ZKJ A;  1MWR A;  1E25 A;  4WMC D;  4UA9 A;  4RX3 A;  3V3R A;  1ES2 A;  2G2U A;  2Y91 A;  3Q7V A;  2H0Y A;  3HL9 A;  3HVF A;  4N92 A;  1JTG A;  5FSR A;  3IF6 C;  3VOY A;  2R9X A;  3N7W A;  4E6W A;  2EXA A;  4BEN A;  1ERQ A;  2XK1 A;  1MBL A;  5CED A;  1PZO A;  4DF6 A;  1K54 C;  1K4E A;  2OLU A;  3PBS A;  2XFS A;  4O7D A;  4MBF A;  4ZAM A;  5FAS A;  5FDH A;  5HX9 A;  3HLB A;  1NRF A;  3CG5 A;  4ZJ3 A;  2Y2J A;  4OP5 A;  5KMW A;  4JKT A;  1H5X A;  3UDI A;  1Z6F A;  3HLC A;  3UNW A;  3SH8 A;  1Q2Q A;  2ZQ8 A;  3P09 A;  4IVK A;  4N9L A;  5KSH A;  2HPB A;  3IWI A;  1MPL A;  1XA7 A;  1MKI A;  4M3K A;  3LY3 A;  1BTL A;  2WAE A;  4P85 A;  1NYY A;  3Q07 A;  1KE4 A;  3WS2 A;  4E3N A;  3PBQ A;  4S2N C;  1LI0 A;  2J7V A;  3ZDJ A;  5EVI C;  2EX9 A;  5EVI D;  5FQ9 A;  1W8Q A;  4EV4 A;  5AQ9 A;  2Y2O A;  1YLT A;  3FKV A;  4KZ7 A;  1KE0 A;  3UE3 A;  2HP5 A;  1VQQ A;  2HP6 A;  3V50 A;  4PM5 A;  5CTN A;  1YQS A;  3WS5 A;  2V20 A;  3N8S A;  3G31 A;  4B88 A;  1NZU A;  1IKI A;  3ZG8 B;  1XGI A;  3EQV A;  3GRJ A;  5FQQ A;  1Q2P A;  1C3B A;  1PI4 A;  2ZM0 A;  1J9M A;  4OP8 A;  5F1F A;  3WS4 A;  4B4Z A;  4DXB A;  3OZH A;  2HDR A;  4A5R A;  3CZD A;  1PWD A;  4R23 A;  5CXW A;  2Y2G A;  2IWB A;  2EFU A;  2XR0 A;  3DTM A;  2ZC7 A;  5FI6 A;  4S2N A;  4BL3 A;  2XH9 A;  5D3O A;  3UO9 A;  2P9V A;  3GTC A;  1KGG A;  1ONG A;  5EOE A;  4DDY A;  4BLM A;  1YT4 A;  1ERM A;  2WZZ A;  2XEP A;  4C6Y A;  1K25 A;  4EQI A;  3A3I A;  1W79 A;  3IWO A;  4E3J A;  5GLA A;  1XX2 A;  2PBY A;  3M6H A;  2XDM A;  3BRM A;  1K6R A;  1K56 A;  4DE3 A;  3ZVT A;  1K38 A;  3C5A A;  3IH9 A;  5E2H A;  1SCW A;  3BM6 A;  5BOH A;  1BLC A;  3VP2 A;  1ES4 A;  4Q8I A;  3PBR A;  3S1Y A;  4WEJ A;  2Y59 A;  1PIO A;  2Y2M A;  3SS5 A;  4QY6 A;  1KGE A;  3N4I A;  2HP9 A;  3HLF A;  4CJN A;  2EX2 A;  2DRW A;  2EX6 A;  4F94 A;  5CRF A;  1TVF A;  3NDE A;  3LEZ A;  1DJA A;  1L0G A;  4Y0U A;  1PW8 A;  4IBX A;  2ZM8 A;  4R4S A;  3Q7V B;  3VP3 A;  1O7E A;  2BG1 A;  1RCJ A;  4JF6 A;  3CJM A;  4XUX A;  1BT5 A;  2VGJ A;  3ZVW A;  4WBG A;  1NJ4 A;  3A3D A;  3C7V A;  2JCH A;  2ZC3 B;  3OPP A;  2OSU A;  2WKH A;  2XQZ A;  3BLM A;  3AGF A;  5EUA A;  3OPH A;  4LV3 A;  3PAG A;  4UA7 A;  3TOI A;  5F82 A;  4HEF A;  1I2W A;  3OPL A;  5G18 A;  4ZTK A;  4GDB A;  3DW0 A;  3ZG7 B;  4WEK A;  4KZ9 A;  3ZG5 A;  4EBP A;  2QMI A;  4R0Q A;  4FCF A;  2XFT A;  4S2M A;  3G35 A;  4KG5 A;  1L2S A;  4JXV A;  5TGF A;  1G6A A;  1LL9 A;  2DCF A;  2HDU A;  2WAF A;  5FA7 A;  4U0T A;  1N4O A;  3RJU A;  4B4X A;  3HUN A;  2Q9M A;  3BLS A;  3NI9 A;  4UA6 A;  5GL9 A;  2R9W A;  1E3U A;  3WRT A;  3OC2 A;  3IH8 A;  2ZQC A;  4ID4 A;  3IHB A;  3VSK A;  2PU2 A;  4GZB A;  4H8R A;  1ZG4 A;  4OPY A;  4X6T A;  4E3L A;  3HLE A;  2J9O A;  3GVB A;  5FQM A;  5DTS A;  4BL2 A;  1WE4 A;  3SS3 A;  4ZJ2 A;  4WZ5 A;  4BD1 A;  5M1A A;  4JXS A;  5CHM A;  5HAQ A;  4BD0 A;  3LCE A;  3MXR A;  4OQH A;  3VFH A;  3VOZ A;  1O07 A;  4DE1 A;  4E3O A;  1CI9 A;  4Y0T A;  3HLW A;  1IYO A;  1XXM A;  1K55 A;  5FAT A;  1JVJ A;  4GDN A;  4WZ4 A;  5I94 A;  2QZ6 A;  4NK3 A;  2WGW A;  1BSG A;  4PM8 A;  3V3S A;  1BLH A;  3VMA A;  4EWF A;  1SHV A;  1DY6 A;  4KZ3 A;  1CI8 A;  3M2K A;  1L0D A;  3ITA A;  4GD6 A;  4GOG A;  4KQO A;  3IF6 A;  4X69 A;  2RCX A;  4IED A;  5EPH A;  1JTD A;  5GLB A;  3M2J A;  3MKE A;  1FQG A;  2CC1 A;  1K54 A;  1H8Y A;  3PBO A;  2XF3 A;  4E6X A;  1TEM A;  4FH4 A;  4KZ5 A;  3WS0 A;  4JXW A;  4RVA A;  2ZQD A;  1KVM A;  3HLG A;  5FQI A;  2P74 A;  1K6S A;  1XKZ A;  1XGJ A;  2V2F F;  1FOF A;  3A3F A;  3OPR A;  1MWU A;  1NYM A;  2WAD A;  2WKI A;  2ZC5 B;  4UHU A;  4RYE A;  2WK0 A;  1TDG A;  3LY4 A;  1BZA A;  3Q81 A;  4BQM A;  1ES3 A;  1I2S A;  3NCK A;  5HL1 A;  1K57 C;  2Y55 A;  4WEL A;  1WYC A;  5KZH A;  3UY6 A;  5JYP A;  4MEZ A;  3A3E A;  2Z2M B;  3OCL A;  5F1G A;  4PM9 A;  3ZNT A;  1FCN A;  5E43 A;  4HES A;  4QY5 A;  4DXC A;  5EVI A;  1BLS A;  5IHV A;  2OV5 A;  2Y4A A;  5GLD A;  5HAP A;  3AGE A;  4EBN A;  1K56 D;  1W5D A;  3Q7Z A;  4DE0 A;  1RGZ A;  1GA9 A;  4QB8 A;  5J8X A;  5EVL A;  2ZMA A;  4K0W A;  1IYP A;  5DTT A;  4Y7P A;  4S2P A;  5CHU A;  2PU4 A;  3G30 A;  3A3J A;  5EE8 A;  3ZG9 B;  2FFY A;  4MBH A;  4FH2 A;  3QHY A;  1SDN A;  3O87 A;  4OPR A;  2HDQ A;  1M6K A;  3O3V A;  1SKF A;  4UAA A;  5HFO A;  2Y2H A;  1HD8 A;  3NDG A;  4OQI A;  2IWC A;  2Y2Q A;  1PWG A;  1IKG A;  1W8Y A;  2DNS A;  1K57 A;  4LV2 A;  3IHA A;  4U3T A;  3SS4 A;  3LO7 A;  5M18 A;  5DF9 A;  5DVA A;  1CK3 A;  1LL5 A;  5E2E A;  3C4O A;  1ZC2 A;  1M40 A;  3BFE A;  3G2Y A;  1FSW A;  3E2K A;  1KDS A;  2WZX A;  1G68 A;  1S6R A;  4KG6 A;  3UN7 A;  4OLD A;  3GMW A;  5JYO A;  2FFF B;  1ONH A;  1DJB A;  1N9B A;  1FCM A;  4S2L A;  3IQA A;  4OPZ A;  4IVI A;  4RX2 A;  2JBF A;  4P0M A;  3FYZ A;  5CTM A;  5A93 A;  1ESU A;  2EX8 A;  1ZG6 A;  4R1G A;  3MZD A;  5HAR A;  1EWZ A;  2Y2L A;  4MNR A;  2XGN A;  4LCM A;  1BUE A;  3TSG A;  1E4D A;  4EUZ A;  1XPB A;  2B5R A;  1CEG A;  4OOM A;  3HLD A;  1PW1 A;  4KZA A;  3BFC A;  4OKP A;  3MZE A;  3PBN A;  1GA0 A;  1NZO A;  4Y0O A;  4C3Q A;  5AQB A;  5EOO A;  2UWX A;  2HDS A;  4L0L A;  4OPQ A;  1PI5 A;  5CGX A;  3NIA A;  3O86 A;  3C4P A;  3FWL A;  1VM1 A;  4MBK A;  2ZQ9 A;  1XA1 A;  1S0W A;  4FSF A;  4KG2 A;  1JWZ A;  4OON A;  1E3U D;  3GSG A;  2WGW B;  4JF5 A;  4PPR A;  4KZB A;  2V1Z A;  3G32 A;  5FAO A;  4ZJ1 A;  2WKE A;  3W4P A;  3IF6 B;  2ZC4 B;  3ZFZ A;  1NY0 A;  1W7F A;  3E2L A;  4HBT A;  1GHP A;  1FSY A;  2XD5 A;  2Y2K A;  3MKF A;  4JLF A;  4E3M A;  1EI5 A;  3IXH A;  5E2F A;  4S2J A;  1ALQ A;  3SH9 A;  1QMF A;  3IXG A;  3FZC A;  5FAQ A;  3WRZ A;  1YMS A;  3ZGA B;  3UPO A;  3UDX A;  2XLN A;  4QJG A;  4K0X A;  5L2F A;  3CMZ A;  3G34 A;  5DTK A;  2X02 A;  4KZ6 A;  4X55 A;  5F83 A;  4K91 A;  2OLV A;  3UE0 A;  3SH7 A;  3VP1 A;  4WYY A;  2H10 A;  1FCO A;  1MXO A;  3NY4 A;  5U47 A;  3QNC A;  3PAE A;  1MY8 A;  1ERO A;  3RXX A;  3IXD A;  1GHM A;  3FKW A;  4LV0 A;  4WMC A;  3IWQ A;  1YMX A;  3ITB A;  5EVI B;  4S2K A;  1K4F A;  1SDE A;  4DKI A;  2WGI A;  1YLP A;  4P6B A;  4E3K A;  2P9V B;  4D2O A;  5HAI A;  1YLY A;  5AQA A;  3GQZ A;  3BFG A;  2WUQ A;  2C6W B;  3ISG A;  5FQJ A;  4DDS A;  2Y2P A;  5CGW A;  1ES5 A;  5FI2 A;  3V39 A;  2H0T A;  4KEN B;  3C7U A;  3VSL A;  4N1H A;  1NXY A;  5CGS A;  4OOY A;  5DF8 A;  4JBF A;  2ZD8 A;  3G2Z A;  4BJP A;  3FV7 A;  1OME A;  1YLZ A;  3PTE A;  5GHY A;  4X68 A;  4YIN A;  3VFF A;  4OLG A;  1JWV A;  5FAP A;  1GCE A;  5CER A;  4NET A;  3UE1 A;  3V5M A;  3IF5 A;  5E2G A;  3SOI A;  2ZC6 B;  5GLC A;  4JPM A;  3W4O A;  5M19 A;  4OQ0 A;  3Q1F A;  3EQU A;  3IXB A;  4S2O A;  4U0X A;  1YLJ A;  4E3I A;  5GHX A;  3M6B A;  2C5W B;  5DF7 A;  1PZP A;  4FD8 A;  1IEM A;  3MZF A;  2ZQ7 A;  4N9K A;  3GV9 A;  4LV1 A;  4PMA A;  4EBL A;  4KZ8 A;  1I5Q A;  3NBL A;  2A49 A;  1KE3 A;  2GDN A;  3B3X A;  1GHI A;  1YLW A;  4LEN A;  2XD1 A;  1ESI A;  5KSC A;  3BEB A;  1HZO A;  5A90 A;  2G2W A;  3G4P A;  2WYX A;  3MFD A;  4JF4 A;  4XUZ A;  2Y2N A;  4R4R A;  3S22 A;  4KZ4 A;  1PWC A;  3WS1 A;  5TR7 A;  2J8Y A;  2ZJ9 A;  3MXS A;  2JC7 A;  1KGF A;  1KVL A;  2X71 A;  4GNU A;  1RGY A;  2Z2L B;  5TFQ A;  3DWZ A;  1QME A;  4X53 A;  2IWD A;  3MBZ A;  2Q9N A;  1KDW A;  4HBU A;  4KQR A;  5CHJ A;  3Q82 A;  4OQG A;  4N1X A;  1MWT A;  3AGD A;  2I72 A;  4OOL A;  2EXB A;  3P98 A;  4GB7 A;  2WGV A;  1HTZ A;  4WM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...