5EVIC

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
356
structure length
350
Chain Sequence
AALDTLVQTEARKVMQENNITGLSIAITRHGQQFYNYGVASATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFKAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDKQTLYAQGYNTLDEPVRVNPGILAAEAYGVSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVKLAYRILQHAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 101
structure length 350
sequence length 356
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviC00
3PBRA 4KQOA 2Y2OA 2Z2LB 4MLLA 1G6AA 1I2SA 2H0YA 1Q2PA 2P9VB 1DJBA 2J9PA 4P85A 4ZTKA 1BLPA 1YMXA 4X68A 4QHCA 5KSHA 4FH4A 1M6KA 1N4OA 1DJCA 4OPZA 3AGFA 4BJPA 5FA7A 3C7UA 1LLBA 4IVIA 4S2JA 2ZM2A 3IF6B 3SH7A 2DRWA 4Q8IA 1KVMA 5GHZA 5FI2A 3V3RA 4E6XA 2JE5A 1HVBA 2ZC3B 3NY4A 1EI5A 3HLDA 4OP5A 4EBLA 1I2WA 1TVFA 4C3QA 4LV0A 3N8LA 3ZG8B 3Q07A 1L2SA 2FFYA 2WGWA 5DF9A 3UE3A 4JXWA 1SKFA 4OVDA 4LENA 3ZCZA 1GHIA 4BL2A 3I7JA 5EVID 1N9BA 1TDLA 3OPLA 4LV3A 3UO9A 3CG5A 4DKIA 1NY0A 5F82A 3GMWA 1K6SA 1KGEA 2ZQ9A 2R9XA 1K25A 1BLSA 4WEKA 3RXWA 4DRTA 4KZ9A 4EQIA 2P9VA 1RP5A 2ZQ8A 1RCJA 1MPLA 1I5QA 1DJAA 1E3UD 1HTZA 1PI4A 2ZC5B 4BENA 3PBOA 1CI9A 2JC7A 4KZ3A 4QY5A 5FI6A 4PM9A 3M2KA 4MEZA 2WYXA 4MBKA 4BD0A 2ZMAA 4MNRA 4PMAA 1KE3A 5AQBA 4OPQA 5EE8A 3ZG5A 5TFQA 3BM6A 1W5DA 3CZDA 3WS2A 3M2JA 3MXRA 2DCFA 2WK0A 2ZM8A 1SDNA 3LCEA 5DVAA 1KGFA 4OOMA 3GR2A 3VSLA 2XEPA 2XD1A 1HZOA 4NK3A 4KQRA 4GDBA 1ES4A 1NZOA 3BRMA 3Q1FA 1K56A 1YLJA 2WKEA 1ESIA 4OKPA 2IWCA 3UN7A 2XQZA 3G4PA 3QNBA 4X56A 4P0MA 5EOOA 3QNCA 1BZAA 1GA9A 2Y2GA 4N1HA 4PM6A 3WRTA 1FSYA 3W4PA 5DTSA 5CEDA 4BQMA 1RGZA 3A3JA 4PM7A 4B88A 4OLDA 3IQAA 4U0TA 4JF5A 4RX3A 4DXCA 4C6YA 5L2FA 2WUQA 3V50A 2BG1A 5FQIA 5E2HA 4DDYA 3OCNA 1YM1A 3ZVTA 4GZBA 5FATA 3RJUA 3C4OA 2UWXA 1FOFA 4LCLA 4QY6A 3WS5A 3UDXA 2R9WA 4IEDA 3IXBA 4OQIA 2H0TA 1QMFA 3ZGAB 4WM9A 3MXSA 2A3UA 3AGDA 3O3VA 2IWDA 1SHVA 2WKIA 3FKVA 3OPRA 5CHJA 3G32A 1FCOA 5EVIB 1NZUA 2EX6A 5E2FA 1K54A 2ZD8A 3TG9A 4K91A 5EECA 5DTTA 5F1GA 4BLMA 3S1YA 3N7WA 4Y7PA 3WS1A 4DE2A 3HLGA 4U0XA 2EXBA 4P87A 5HAQA 4RYEA 2EX9A 4PM5A 4N1XA 4CPKA 2Y2QA 4HESA 5KZHA 4WMCA 2Y55A 3UPOA 5FAPA 3OC2A 2C6WB 4GB7A 1LI9A 5GHXA 4DE3A 4DXBA 4JF6A 4YFMA 1FR6A 3ITAA 1U60A 4JXGA 1L0FA 1ONGA 4K0WA 1IELA 4R23A 4KZ8A 2ZQ7A 5HL1A 1LL5A 3HUMA 4E3NA 4EV4A 1SCWA 4UA7A 3IH9A 1FCNA 1QMEA 4OPYA 1BULA 3O86A 5GLDA 3UPNA 3VFFA 1XA1A 1XGJA 4KG2A 4EWFA 4ZAMA 2ZM0A 5KMWA 5E2GA 2WGIA 4S2KA 4QJGA 5EPHA 3E2KA 5A91A 2H10A 5A92A 3GVBA 5CRFA 2V1ZA 5EVIA 1BLHA 3UDFA 5M18A 3MZEA 1YLZA 5CEBA 1ES3A 4OQ0A 4YINA 4BD1A 4ZDXA 1MWRA 4KG5A 3HLFA 1NJ4A 1CEGA 1PWGA 2C5WB 2Y2PA 4L0LA 1MWSA 3SS5A 2X02A 4C75A 3MZDA 2EFUA 3BFCA 3CMZA 1E3UA 1PWDA 3GV9A 1NYMA 1FCMA 2G2WA 2XFTA 5FQKA 3MBZA 5BOHA 4FSFA 1YLTA 1L0GA 5G18A 3GRJA 1K54C 4JXVA 2J9OA 2OLVA 4U3TA 4JXSA 1CI8A 2WAEA 3ZVWA 4K0XA 2B5RA 3OZHA 4EBPA 4R4RA 3UY6A 4RA7A 2XR0A 3LO7A 1Y54A 2HP6A 4F94A 2XF3A 3HL9A 2XH9A 3ZG7B 2HDRA 3N8SA 4E3MA 3BLSA 4R1GA 5FI7A 4KZBA 1XGIA 3MKEA 4Z9QA 1XKZA 5CGSA 3C5AA 1W79A 2Z2MB 3VP3A 1ZKJA 2E8IA 3IH8A 2Y2HA 1GHPA 3E2LA 5J8XA 5CHMA 3MZFA 3DW0A 3IF6A 1ES2A 3BFDA 4DE0A 2ZC6B 1W7FA 1KVLA 3UPPA 3V39A 3FWLA 1NYYA 3P98A 3HVFA 2CC1A 5GLBA 4X69A 4WZ5A 4S2OA 1ALQA 3HLBA 3A3DA 4OOYA 1GA0A 3UDIA 4EBNA 2ZLYA 4NETA 2Y2KA 3OPPA 4WZ4A 2Y2NA 2VGKA 4R3BA 3DWZA 1PW8A 3P09A 5AQ9A 1KDSA 4JLFA 3MKFA 1FSWA 3VP1A 3FZCA 1JTDA 3V5MA 4GN2A 5JYPA 1MWUA 3S22A 3PBSA 4UA9A 5CHUA 2PBYA 3G2ZA 3V3SA 4D2OA 3NI9A 3N8RA 5F83A 5CERA 2RCXA 3IXHA 2Y59A 1KDWA 2ZJ9A 3Q7VB 4M3KA 4WEJA 4MBHA 1GCEA 4DE1A 3IWIA 3DWKA 3GQZA 4KQQA 3C7VA 2IWBA 1EWZA 2HDSA 5FASA 1VM1A 5E43A 5CECA 5FQMA 3SH9A 2HPBA 2ZC4B 1XXMA 1ZG4A 1PYYA 1AXBA 1YLWA 2OSUA 2XDMA 3PAEA 4X53A 1LHYA 2Q9NA 5CTNA 2HP5A 4N92A 3W8KA 5FQJA 3PAGA 1MKIA 3IF5A 3PTEA 4E3OA 4UAAA 3MFDA 4XXRA 3ZNYA 3B3XA 2J8YA 5FQQA 3VOZA 4OQHA 5A93A 4N9KA 1K6RA 1ZG6A 3AGEA 1IYSA 1MWTA 3IF6C 1IEMA 4CJNA 4ZBEA 5HARA 1FR1A 1K56D 3A3FA 4OH0A 1KGGA 5CXWA 1IKGA 5JYOA 4RVAA 4Y0TA 3O88A 2WZZA 4MBFA 4WELA 1DY6A 3BEBA 4WZ5C 5EOEA 4B4XA 4QD4A 1NRFA 1NXYA 3M6BA 3Q7VA 1YLYA 4N9LA 1KE4A 3Q82A 4R4SA 1WYBA 2Y2LA 1IYOA 2QZ6A 1H8ZA 1L0DA 1K4FA 3PBNA 3VMAA 3NDGA 4R3JA 3ZNTA 3ZG9B 4EUZA 5GLCA 1IKIA 1PW1A 3HREA 4KZAA 4E3JA 4QU3A 5DF8A 3A3EA 3G35A 5FDHA 3EQUA 3IWQA 3FV7A 3VP2A 3IWOA 2XLNA 3WRZA 3M6HA 5HX9A 3G34A 3Q7ZA 2VGJA 3SS3A 1JWPA 4XUZA 2QMIA 1YQSA 3JYIA 1K55A 2Q9MA 4HBUA 1BUEA 3UE1A 3RXXA 2ZQDA 1LL9A 4OLGA 4KZ5A 2J7VA 3NC8A 5TGFA 2JBFA 3VSKA 1MY8A 1KE0A 3ZG0A 3Q81A 2BLSA 3IHAA 3TOIA 5U47A 1MXOA 1Z6FA 4P6BA 1BSGA 2XD5A 3FKWA 2H5SA 4GOGA 4WMCD 3BYDA 3CJMA 1BT5A 3HLEA 4LV2A 4IBRA 4E3IA 5CGXA 4FCFA 3ITBA 4OQGA 4ZJ1A 3SH8A 3BLMA 4X6TA 5FAOA 1ES5A 1CEFA 1ESUA 3NIAA 5HAPA 5CTMA 2P74A 1CK3A 3VFHA 5D3OA 1RGYA 5GL9A 5HFOA 2RL3A 2WADA 2V2FF 3ZFZA 2HP9A 1BTLA 2XGNA 4ZJ3A 3D4FA 4S2MA 4DDSA 3S4XA 2WZXA 4GNUA 2Y2MA 1PI5A 3QHYA 3NDEA 1M40A 4E3KA 2OLUA 5FQ9A 3WS4A 1J9MA 3PBTA 4GDNA 4OP8A 5E2EA 4LV1A 1G68A 5IHVA 1SDEA 5HAIA 3BFGA 4DF6A 5GLAA 2GDNA 4FH2A 4S2IA 1TDGA 5GHYA 1IYQA 1JTGA 1S0WA 3G2YA 4KENB 5DTKA 5EVIC 1FQGA 3WS0A 4RX2A 3W4OA 1O7EA 1YMSA 4IBXA 3ZHHA 3DTMA 2X01A 3C4PA 4Y0UA 2EFXA 1K57A 2XK1A 3A3IA 1K55C 4S2NA 3HLWA 1LI0A 2JCHA 2PU2A 4JPMA 3GSGA 4WBGA 4ZJ2A 2EX8A 3W4QA 5M19A 1XPBA 2X71A 2QPNA 2A49A 2EX2A 3HUNA 1W8YA 1K38A 5M1AA 1C3BA 2V20A 2Y2IA 1XX2A 2OV5A 3G31A 4WYYA 1E4DA 1MBLA 4A5RA 4OOLA 3HUOA 4KZ6A 1K4EA 2Y2JA 1ZC2A 3PBQA 2G2UA 2EXAA 4S2PA 3ISGA 2Y91A 3SS4A 1Q2QA 5EVLA 4O7DA 2XFSA 1JWVA 2Y4AA 1GHMA 3HBRA 4BL3A 1ERQA 1EROA 4LCMA 1JVJA 4KZ7A 2PU4A 3N4IA 3O87A 4IVKA 5AQAA 1IYPA 3TSGA 4S2LA 3BFEA 3WWXA 3IXGA 4B4ZA 2ZC7A 4ID4A 5A90A 4PPRA 3UE0A 3VP4A 4GD8A 1ERMA 2FFFB 3SOIA 2HDQA 3IXDA 5DF7A 5FSRA 3HLCA 1XP4A 1XA7A 3OCLA 2DNSA 4UA6A 4OONA 1PZOA 4XUXA 1H8YA 4X55A 1PIOA 4JKTA 1WE4A 4JBFA 4HEFA 4KG6A 5CGWA 2I72A 1ONHA 1L0EA 4GKUA 1PZPA 5I94A 5HW3A 4E6WA 3LY4A 3LEZA 3BFFA 5FAQA 1TEMA 4Y0OA 1H5XA 3N6IA 5KSCA 1W8QA 1OMEA 3BECA 1O07A 3OPHA 2ZQAA 4R0QA 5TR7A 1K57C 1PWCA 4S2NC 5AQ7A 3VP0A 5F1FA 2WGVA 4QB8A 1E25A 3FYZA 3NCKA 4UHUA 4JF4A 3G30A 1YLPA 3GTCA 1HD8A 2ZQCA 1S6RA 4GD6A 5EUAA 2WAFA 3VOYA 1JWZA 1WYCA 2WKHA 3LY3A 3NBLA 4FD8A 2WGWB 3EQVA 4PM8A 1BLCA 4E3LA 3UNWA 3IT9A 1YT4A 2HDUA 4H8RA 4HBTA 3IHBA 4KZ4A 3ZDJA 4OPRA 1VQQA
chains in the Genus database with same CATH superfamily
1V9ZA 2Z2LB 2IA2A 2P7JA 3QP6A 5HPIA 3QP5A 1T1BA 4FH4A 1N4OA 4OPZA 3ZQ5A 3AGFA 5A8BA 4Q0IA 3CUEA 1LLBA 3IF6B 3UB5P 5F69A 3K3DA 3PXPA 3V3RA 2JE5A 1HVBA 2ZC3B 1EI5A 1PRQA 3HLDA 1I2WA 4C3QA 1TF1A 3JVUA 3ZG8B 4R3AA 1GHIA 3I7JA 4DKIA 1KGEA 5EV0A 2R9XA 3UB8A 4LGWA 1BLSA 4WEKA 4DRTA 2QKPA 4X25A 2P9VA 1RP5A 4I5SA 1RCJA 2FZ0A 2ZC5B 3PBOA 4QY5A 3M2KA 4MBKA 2ZMAA 3CWFA 1P0ZA 1KE3A 5AQBA 5EE8A 2PR6A 2DCFA 3LCEA 2XD1A 2W3FA 4NK3A 4R6LA 4AFIA 3BRMA 4OKPA 1H3QA 3CUEC 4LRYC 4X56A 5G4YA 1BZAA 1GA9A 3WRTA 1FSYA 3OLOA 3B33A 1YAXA 3VV4A 3LYXA 3SW1A 4OLDA 4JF5A 4RX3A 2WUQA 4GW9A 3V50A 2OAP1 4GZBA 3IXBA 1VEUA 3L9KA 3ZGAB 2KDKA 3O3VA 1SHVA 2WKIA 3G32A 2PD8A 1NZUA 2ZD8A 3DAVA 5EECA 5F1GA 3N7WA 3HLGA 1K0KA 2PYRA 2EXBA 5HAQA 4B9OA 4CPKA 2Y2QA 3UPOA 3LR5A 3OOVA 4MDZA 2W3DA 3GDIA 3ITAA 1L0FA 1T1AA 4K0WA 4R23A 4HNBA 2XRNA 1OTAA 4EV4A 3O86A 5GLDA 4EWFA 2V0UA 3E2KA 3HCYA 2H10A 5A92A 2V1ZA 1BLHA 2JKRI 3MZEA 1YLZA 2W3GA 4PKYG 3UB6A 4HH3A 3MZDA 2EFUA 1NYMA 3IX3A 3FPWA 1YLTA 3GRJA 2OLVA 4U3TA 4JXSA 3PR6A 3K2NA 3MR0A 4ESPA 4EBPA 2XR0A 2HP6A 2XF3A 3IBJA 1F98A 4E3MA 3BLSA 1XGIA 3MKEA 4Z9QA 1XKZA 4Y13A 3VP3A 4HIAA 2Y2HA 3E2LA 5J8XA 5CHMA 3MZFA 3IF6A 1W7FA 1NYYA 2ZLYA 2Z6CA 4RQ9A 2Y2NA 2VGKA 3P09A 1KDSA 4JLFA 3MKFA 3FZCA 1JTDA 3V5MA 3E4OA 4Y2FA 4UA9A 3V3SA 3N8RA 2RCXA 3IXHA 2ZJ9A 4WEJA 1GCEA 3GQZA 1VM1A 3OBFA 2HPBA 1D7EA 1XXMA 4HI4A 2OSUA 2XDMA 4CLCE 2Q9NA 2HP5A 1MKIA 3IF5A 4UAAA 3IX4A 1S1ZA 4IHQA 4NKPA 4EESA 5FQQA 4OQHA 5MC7A 4N9KA 5HDDA 2D02A 1KOUA 1ZG6A 3AGEA 1XFQA 3F1NA 1NRJA 1IYSA 1MWTA 3IF6C 1FR1A 1K56D 3A3FA 4OH0A 5HD5A 3O88A 4WELA 3BEBA 5EOEA 3IX8A 1KE4A 3A0VA 1WYBA 2QZ6A 2J3WA 1L0DA 4Y3IA 3S7PA 4ETZA 2K7SA 3VMAA 4MN6A 1PW1A 4KZAA 4QU3A 5DF8A 3EQUA 3IWQA 3VP2A 4JGRA 5HX9A 2V8FA 2W1TA 3RXXA 2ZQDA 1LL9A 4KZ5A 2JBFA 4WMCD 1F9IA 3BYDA 3HLEA 4LV2A 4IBRA 5CGXA 4G3VA 4ZJ1A 1HLUP 2XA7S 3RH8B 2VGLS 1CQAA 5HAPA 1S67L 3BY8A 1TS6A 1T18A 2WADA 2V2FF 3ZYTA 1XJ3A 3D4FA 3C2WA 4DDSA 4EW7A 3WS4A 1YPRA 5E2EA 1G68A 2W0NA 1SDEA 2G7UA 3R7WB 5J4EA 2JHEA 4KENB 3VE3A 3P7NA 3ZHHA 3MQ0A 2P08A 3DTMA 1OJ5A 3C4PA 2L1MA 3PYPA 4ZJ2A 5M1AA 2V20A 2Y2IA 3KO6A 2OV5A 4HY8A 4OOLA 4KZ6A 3PBQA 1UWPX 2A2LA 4S2PA 3ISGA 2Y91A 5EVLA 4O7DA 4BL3A 1GHMA 2OWJA 4HJ6A 4HQAA 5J3WA 3KYEA 3N4IA 3O87A 1IYPA 3H9WA 3LIEA 5I5LA 4B4ZA 2ZC7A 3DTKA 5DKKA 4F3LB 5A90A 3UE0A 2FFFB 2LB5A 3IXDA 1XA7A 2DNSA 3T12B 2A24A 1Z09A 4LRXC 1F2KA 4I39A 1NLZA 2V1AA 2I72A 5I94A 5HW3A 2EWVA 1DP8A 4FTXA 5FAQA 1TEMA 1H5XA 2YKHA 1O07A 5EM1A 5TR7A 4Y15A 4YOFA 1PWCA 5AQ7A 1E25A 4EXOA 4JF4A 2CMNA 3MFXA 1JWZA 2WKPA 2JKRM 3IT9A 2MJ6A 3PHYA 1YT4A 1TS7A 3E98A 3PBRA 5L8MA 5HPFA 2H0YA 2WKRA 2P9VB 1BLPA 4WUJA 2B95A 1DRMA 3V67A 3C7UA 4S2JA 2ZM2A 3SH7A 3T4LA 1KVMA 5GHZA 3B42A 2DMWA 1WA9A 2GJ3A 3N8LA 1L2SA 5DF9A 2L0WA 1T1CA 4OVDA 4LENA 1XFNA 3CG5A 4DMZA 1NY0A 2FH5A 5F82A 3GMWA 1K6SA 2VKSA 2ZQ9A 3B47A 1K25A 2W3HA 4EQIA 5J7EA 2ZQ8A 2OOLA 1MPLA 1I5QA 5FL3A 2PR5A 4BENA 1P97A 5EVEA 4PMAA 1W5DA 3M2JA 3MXRA 2WK0A 4QPRA 1KGFA 4OOMA 3GR2A 3LICA 1G6OA 4KQRA 2JKTI 4GDBA 4YWZA 3IBRA 3Q1FA 1YLJA 2WKEA 1ESIA 3UN7A 3LGOA 2XQZA 3EEHA 3O5YA 3QNCA 3LEQA 5HDCA 2W1RA 4N1HA 4BQMA 3A3JA 4B88A 5L2FA 4DDYA 1YM1A 1OTDA 3NOTC 3RJUA 3WS5A 3C4OA 2UWXA 1FOFA 4QY6A 1YSQA 4PAUA 1NWZA 4OQIA 2PHYA 1N9LA 2IWDA 5KIZA 5E2FA 3HJIA 1GSXA 3WS1A 4DE2A 3S7OA 2O99A 4JGOA 4P87A 5LBRA 4RYEA 5AVEA 2EX9A 4HJ4A 5FAPA 4GB7A 4F3LA 1LI9A 4YFMA 3NJAA 4JXGA 1ONGA 4DJ3A 1TS8A 3HUMA 3T1QB 4E3NA 4Y17A 3VFFA 1XGJA 5KMWA 5E2GA 2WGIA 4NG2A 3GVBA 5CRFA 4P6ZM 5M18A 4ZDXA 4KG5A 1PWGA 2C5WB 2Y2PA 3KSFA 1MWSA 3CMZA 3BFCA 1L3LA 5AVFA 5FQKA 4GHIB 1FCMA 2XFTA 3MBZA 4ZRRA 1H0MA 3ZVWA 4K0XA 5L10A 2B5RA 3OZHA 3UY6A 4D60A 2QYBA 5TBMA 3ZG7B 1BYWA 4R1GA 4KZBA 2ZOIA 2Z2MB 2E8IA 3SZTA 3E0YA 4MN7A 2CC1A 1STZA 4WZ5A 4X69A 2HF6A 5F5YA 1ALQA 4OOYA 3UDIA 1GA0A 3OPPA 2PYPA 1PW8A 3F1NB 1F5MA 1OPXA 4GN2A 3S22A 2PBYA 4KQQA 2IWBA 3C7VA 1EWZA 2HDSA 5E43A 3KX0X 1LHYA 5L07A 1OTEA 4N92A 5FQJA 3PAGA 4BWIA 4E3OA 4XXRA 5A93A 5FEFA 2W1TB 4O01A 3T4TA 2ZL1A 4KUKA 4GJ4A 1KGGA 4RVAA 4Y0TA 4WZ5C 1DY6A 4QD4A 1NRFA 1NXYA 1YLYA 3Q82A 4R4SA 2H28A 2Y2LA 4GLQA 3E4PA 1K4FA 3PBNA 1SZVA 4NXFA 3HREA 4E3JA 3A3EA 3QP8A 4LRZE 3NOPC 5DFYA 2M1CA 3E4QA 3G34A 2M7VA 5G4ZA 3MMHA 4HBUA 1BUEA 4OLGA 2JKGA 2J7VA 3NC8A 3VSKA 1KE0A 2BLSA 3TOIA 1S4RA 1Z6FA 3EWKA 3CI6A 2H5SA 4E3IA 2PD7A 4OQGA 4CLCD 3SH8A 1ES5A 2ZMVA 5CTMA 2P74A 3VFHA 5D3OA 4CQHA 1RGYA 5GL9A 5HFOA 5HZHA 4NEED 2HP9A 4S2MA 3EEAA 1ZTUA 1PI5A 1M40A 1UGUA 2OLUA 5FQ9A 1J9MA 4GDNA 3JPUA 4LV1A 5GLAA 2GDNA 4GHIA 1IYQA 1JTGA 4R70A 1FQGA 2JKTM 3D3OA 4Y0UA 3HLWA 1LSWA 2PU2A 3GSGA 2VZWA 2A24B 4BBVA 1XPBA 2X71A 5HSQA 2ZMFA 2A49A 2EX2A 1K38A 1C3BA 3NOUC 4X1LA 4A5RA 1K4EA 2Y2JA 1ZC2A 2PBDP 2EXAA 4MCWA 3HBRA 4LCMA 2VV6A 4KZ7A 4IVKA 1TD5A 3TSGA 4QWOA 3WWXA 3IXGA 5IU1A 4ID4A 3H82B 1ERMA 3GECA 1XP4A 3OCLA 2J3TD 3H7WA 3LR4A 4UA6A 1XJ2A 4X55A 1PIOA 4JKTA 1WE4A 4JBFA 4HEFA 4KG6A 3C30A 1ONHA 1L0EA 4E6WA 4G3WA 3FPVA 4YNRA 3BFFA 1N9OA 1W8QA 5DFXA 4EETB 1PNEA 2HZ5A 4EEUA 5HWVA 4QB8A 2V1BA 3FYZA 1T19A 1YLPA 3G30A 2ZQCA 1ZHHB 3S7QA 2B02A 3VOYA 4PM8A 3U2AA 1BLCA 4CLCA 2QJ7A 4ETXA 3BWLA 3IHBA 4KZ4A 1VQQA 4KQOA 4B93A 2ZBBA 4MLLA 1G6AA 1I2SA 4P85A 4ZTKA 1YMXA 4QHCA 3QP4A 1M6KA 2QJ5A 1DJCA 3LIBA 4IVIA 2DRWA 5FI2A 3NY4A 4LV0A 5EM0A 2WGWA 3UE3A 4UEYA 4JXWA 3ZCZA 2Y8HA 1N9NA 5EVID 1N9BA 1TDLA 1MC0A 1OT6A 3RXWA 4KUOA 4KZ9A 3MF0A 2HGVA 1DJAA 2V9AA 4EERA 2LB9A 4CLCC 4KZ3A 5FI6A 4PM9A 5HWWA 2WYXA 4BD0A 4ARZB 4NXBA 4ME4A 3BM6A 5DVAA 3VSLA 1Y28A 4IUKA 1ES4A 5DJTA 1K56A 2IWCA 2HV1A 3QNBA 3T4OA 4LFUA 2Y2GA 2PDRA 5CEDA 4P6ZS 4PM7A 3IQAA 4DXCA 2BG1A 5FQIA 3OCNA 3T4SA 4I38A 4LCLA 4E04A 1QMFA 4WM9A 3MXSA 2A3UA 3AGDA 5CHJA 3FKVA 2EX6A 1DP9A 4JGQA 2PT7A 3TG9A 4K91A 5DTTA 4BLMA 4U0XA 4PM5A 4N1XA 4HESA 4WMCA 3LUQA 3OC2A 2C6WB 4M4XA 3H82A 5GHXA 5F68A 4DXBA 1P9WA 1U60A 2O9AA 1LSVA 5DKLA 4KZ8A 2ZQ7A 5HL1A 3DTEA 2NUPC 1SCWA 3IH9A 1FCNA 5TBMB 4OPYA 1BULA 5F6AA 4ZAMA 2D01A 4S2KA 4QJGA 5A91A 3UDFA 5EVIA 4BBUA 3R4KA 1ES3A 4YINA 3FG8A 3HLFA 1CEGA 2VJWA 4L0LA 3QP1A 3SS5A 1W63M 4C75A 4HHDA 1PWDA 3GV9A 2G2WA 5BOHA 1L0GA 5G18A 4JXVA 3F1OB 1CI8A 2WAEA 1P9RA 4LLOB 5IS1A 2OWHA 1UWNX 4R4RA 3MSHA 1Y54A 3HL9A 3P01A 3RFBA 2HDRA 5CGSA 3C5AA 4R38A 1S4SA 3LI9A 1ACFA 2GX5A 3DTIA 1ES2A 3BFDA 4DE0A 2ZC6B 1KVLA 3UPPA 3FWLA 4HOIA 4BMWA 3HVFA 1IFQA 3HLBA 3A3DA 4EBNA 3G6OA 3T4KA 4X1MA 1Y4OA 2ZL1B 5AQ9A 1FSWA 2ACGA 3HJKA 1MWUA 5CHUA 4D2OA 3G2ZA 3D9YA 5F83A 2Y59A 5K5BA 4K08A 4MBHA 3DWKA 4O0PA 5FASA 1FILA 5CECA 5FQMA 2ZC4B 4ARZA 1ZG4A 1AXBA 1YLWA 3PAEA 5CTNA 1CJFA 3UB9A 3T4QA 3MFDA 3B3XA 3VOZA 1LSXA 1K6RA 1MZUA 4ZBEA 3ICYA 3KYQA 3LIFA 3BQAA 1FIKA 2WZZA 5IT5A 4L9EA 2BTFP 3FC7A 3Q7VA 4N9LA 1H8ZA 4L9FA 3ZNTA 3ZG9B 1CF0A 2PRFA 5EFWA 3G35A 3FV7A 4LPZA 1AWIA 2XLNA 2XROA 3CAXA 1D06A 4EUVA 2VGJA 3SS3A 4XUZA 1K55A 2Q9MA 3T1SA 2O9BA 1JNUA 1MY8A 3ZG0A 1VHMA 3IHAA 3CLOA 5U47A 1BSGA 2QWSA 2XD5A 3FKWA 1BT5A 1H8MA 2HJ9C 5FAOA 1CEFA 3NIAA 3EGDC 4GCZA 2RL3A 4H6JA 3ZFZA 1S66L 2VV7A 2XGNA 4UQIM 3S4XA 2Y2MA 4FOFA 4E3KA 1G5UA 3PBTA 5HWTA 5HAIA 4Q0JA 3BJNA 4FH2A 4S2IA 3WS0A 3W4OA 4NXEA 1O7EA 2Z6DA 3F1OA 1W63Q 3H7WB 2X01A 1K57A 3VE4A 2XK1A 4BBTA 1K55C 4S2NA 1LI0A 4WBGA 5M19A 2EX8A 2JN7A 4Q0HA 4HP9A 2QPNA 3HUNA 1W8YA 2ZOHA 1XX2A 3G31A 3T1XA 1MBLA 1PFLA 3T50A 2EWWA 3F1PA 3SS4A 4Z1WA 2Y4AA 1ERQA 1GSWA 2EA9A 2PU4A 3LFVA 5FEGA 1LL8A 4S2LA 3BFEA 4O8GA 3RTYA 4PPRA 3VP4A 4CLCB 2HDQA 4XT2A 5FSRA 1SKOB 3MS6A 4HH2A 4EEPA 4OONA 1H8YA 3U4LP 3CPTA 5CGWA 3LEZA 1OMEA 3OPHA 1K57C 1NLYA 4S2NC 3NCKA 3VOLA 1HD8A 1S6RA 5TJJA 5EUAA 2WAFA 4FD8A 3LY3A 2E8JA 5L09A 2WGWB 3EQVA 4DN0A 4E3LA 2W27A 2HDUA 4H8RA 4HBTA 3ZDJA 4OPRA 2Y2OA 3TW8A 1Q2PA 1DJBA 2J9PA 4X68A 5KSHA 4EU0A 4BJPA 5FA7A 1OTBA 2O0YA 3NECA 4Q8IA 3NHQA 4E6XA 2HJEA 4OP5A 4EBLA 2INWA 1TVFA 4HP4A 4GS9B 3Q07A 2FFYA 1SKFA 4BL2A 3BQ8A 2I9VA 3IS2B 3OPLA 4LV3A 4NXGA 3UO9A 3KSHA 2VV8A 1OT9A 1TS0A 1VETB 3TRCA 5DJUA 4MN5A 1E3UD 2B18A 3S7NA 1HTZA 1PI4A 1XJ4A 3DBAA 1CI9A 2JC7A 2V0WA 1ODVA 4MEZA 3KSIA 4MNRA 4OPQA 3ZG5A 5TFQA 2UV0E 3CZDA 3WS2A 2ZM8A 1SDNA 2JKFA 4DJ2A 3T4JA 2XEPA 1HZOA 1NZOA 3G4PA 4WL9A 4P0MA 5EOOA 1LT0A 4PM6A 3W4PA 5DTSA 1RGZA 4U0TA 4C6YA 1DP6A 5E2HA 3ZVTA 5FATA 3T1RA 4I3AA 3UDXA 2R9WA 4IEDA 1XJ6A 2H0TA 4WLAA 3OPRA 5EVIB 1FCOA 1K54A 3S1YA 4Y7PA 3UE6A 2W3EA 4WF0A 5KZHA 2Y55A 2GNXA 4DE3A 3MQQA 4JF6A 1FR6A 4PHTA 1SKOA 1IELA 1LL5A 2M7UA 2Q0OA 4UA7A 1QMEA 3UPNA 1XA1A 4KG2A 2ZM0A 5EPHA 5HL6A 5CEBA 4OQ0A 4BD1A 3CITA 1MWRA 3A0SA 1NJ4A 2X02A 4I3IA 3EOIA 2KLIA 1E3UA 4FSFA 4WN5A 1K54C 2J9OA 5AJGA 3MXQA 4Y5FA 2VK3A 4RA7A 3LO7A 1OTIA 3BY9A 4F94A 2XH9A 2V8CA 3N8SA 5FI7A 5HD3A 1W79A 5HDSA 1X0OA 1ZKJA 5CX7A 3IH8A 1GHPA 3DW0A 3V39A 3LI8A 2R78A 3P98A 5GLBA 4S2OA 4GS9A 2XSSA 4NETA 2Y2KA 3ULFA 1A0KA 4WZ4A 4R3BA 3L7HA 3DWZA 3IS2A 3JVVA 4IJGA 3VP1A 3W2ZA 5JYPA 3PBSA 1J3WA 1VETA 3NI9A 1G28A 5CERA 4FUWA 1KDWA 3Q7VB 2VA0A 4M3KA 3MJQA 4DE1A 3IWIA 4IUHA 3QP2A 2K2NA 4JGPA 3SH9A 2O9CA 4G3KA 3D72A 1PYYA 1EW0A 4X53A 3W8KA 3TJZC 3PTEA 3ZNYA 2J8YA 4II7A 1D1JA 4CJNA 1IEMA 2GZAA 5HARA 5CXWA 1IKGA 4PKYA 5JYOA 4MBFA 4B4XA 1YSPA 2VX8A 3M6BA 4UQIS 2J3TC 1IYOA 3NDGA 4R3JA 4EUZA 5GLCA 1IKIA 1OJGA 1MKMA 4H6JB 5FDHA 3CHWP 3IWOA 4I3JA 3WRZA 3M6HA 3Q7ZA 1JWPA 2QMIA 1YQSA 3JYIA 3KSGA 3UE1A 5TGFA 2KOIA 3Q81A 3C8CA 1MXOA 4P6BA 4GOGA 3A0RA 3CJMA 4FCFA 3ITBA 3BLMA 2VEAA 4X6TA 1ESUA 2QHKA 3MQOA 1CK3A 1VB6A 1IOUA 2J80A 4EQ1A 1BTLA 4ZJ3A 4KQDA 2KX6A 3F1PB 2WZXA 3KYZA 4GNUA 3C38A 3UMEA 3QHYA 3NDEA 3TE8A 4L9GA 4OP8A 5IHVA 3BFGA 4DF6A 1TDGA 5GHYA 3EGXC 4XT2B 1S0WA 3G2YA 5DTKA 5EVIC 3UMDA 4RX2A 1YMSA 4IBXA 2EFXA 3A3IA 3NULA 2JCHA 4JPMA 3W4QA 2BASA 3UB7A 3CPTB 3LIAA 1S1YA 1VEUB 4WYYA 3LR0A 1E4DA 2OAQ1 2WKQA 2Y79A 3HUOA 2G2UA 1Q2QA 3BW6A 2NUTC 1JWVA 2XA7M 2XFSA 5C5KA 2VGLM 1EROA 1GSVA 2YKFA 1JVJA 4HJ3A 5AQAA 4MMNA 3R7WA 4GD8A 3SOIA 5DF7A 3HLCA 1YKDA 1PZOA 4XUXA 4GKUA 1PZPA 2L4RA 3LY4A 4Y0OA 3N6IA 5FDSA 5KSCA 3BECA 2P04A 2ZQAA 3LR3A 4R0QA 3K3CA 3VP0A 5F1FA 2PAVP 2WGVA 4UHUA 3LIDA 3GTCA 2AVXA 4GD6A 1V9YA 1WYCA 2WKHA 3NBLA 2VLGA 3UNWA 2K31A
chains in the Genus database with same CATH topology
3PBRA 4KQOA 2Y2OA 2Z2LB 4MLLA 1G6AA 1I2SA 2H0YA 1Q2PA 2P9VB 1DJBA 2J9PA 4P85A 4ZTKA 1BLPA 1YMXA 4X68A 4QHCA 5KSHA 4FH4A 1M6KA 1N4OA 1DJCA 4OPZA 3AGFA 4BJPA 5FA7A 3C7UA 1LLBA 4IVIA 4S2JA 2ZM2A 3IF6B 3SH7A 2DRWA 4Q8IA 1KVMA 5GHZA 5FI2A 3V3RA 4E6XA 2JE5A 1HVBA 2ZC3B 3NY4A 1EI5A 3HLDA 4OP5A 4EBLA 1I2WA 1TVFA 4C3QA 4LV0A 3N8LA 3ZG8B 3Q07A 1L2SA 2FFYA 2WGWA 5DF9A 3UE3A 4JXWA 1SKFA 4OVDA 4LENA 3ZCZA 1GHIA 4BL2A 3I7JA 5EVID 1N9BA 1TDLA 3OPLA 4LV3A 3UO9A 3CG5A 4DKIA 1NY0A 5F82A 3GMWA 1K6SA 1KGEA 2ZQ9A 2R9XA 1K25A 1BLSA 4WEKA 3RXWA 4DRTA 4KZ9A 4EQIA 2P9VA 1RP5A 2ZQ8A 1RCJA 1MPLA 1I5QA 1DJAA 1E3UD 1HTZA 1PI4A 2ZC5B 4BENA 3PBOA 1CI9A 2JC7A 4KZ3A 4QY5A 5FI6A 4PM9A 3M2KA 4MEZA 2WYXA 4MBKA 4BD0A 2ZMAA 4MNRA 4PMAA 1KE3A 5AQBA 4OPQA 5EE8A 3ZG5A 5TFQA 3BM6A 1W5DA 3CZDA 3WS2A 3M2JA 3MXRA 2DCFA 2WK0A 2ZM8A 1SDNA 3LCEA 5DVAA 1KGFA 4OOMA 3GR2A 3VSLA 2XEPA 2XD1A 1HZOA 4NK3A 4KQRA 4GDBA 1ES4A 1NZOA 3BRMA 3Q1FA 1K56A 1YLJA 2WKEA 1ESIA 4OKPA 2IWCA 3UN7A 2XQZA 3G4PA 3QNBA 4X56A 4P0MA 5EOOA 3QNCA 1BZAA 1GA9A 2Y2GA 4N1HA 4PM6A 3WRTA 1FSYA 3W4PA 5DTSA 5CEDA 4BQMA 1RGZA 3A3JA 4PM7A 4B88A 4OLDA 3IQAA 4U0TA 4JF5A 4RX3A 4DXCA 4C6YA 5L2FA 2WUQA 3V50A 2BG1A 5FQIA 5E2HA 4DDYA 3OCNA 1YM1A 3ZVTA 4GZBA 5FATA 3RJUA 3C4OA 2UWXA 1FOFA 4LCLA 4QY6A 3WS5A 3UDXA 2R9WA 4IEDA 3IXBA 4OQIA 2H0TA 1QMFA 3ZGAB 4WM9A 3MXSA 2A3UA 3AGDA 3O3VA 2IWDA 1SHVA 2WKIA 3FKVA 3OPRA 5CHJA 3G32A 1FCOA 5EVIB 1NZUA 2EX6A 5E2FA 1K54A 2ZD8A 3TG9A 4K91A 5EECA 5DTTA 5F1GA 4BLMA 3S1YA 3N7WA 4Y7PA 3WS1A 4DE2A 3HLGA 4U0XA 2EXBA 4P87A 5HAQA 4RYEA 2EX9A 4PM5A 4N1XA 4CPKA 2Y2QA 4HESA 5KZHA 4WMCA 2Y55A 3UPOA 5FAPA 3OC2A 2C6WB 4GB7A 1LI9A 5GHXA 4DE3A 4DXBA 4JF6A 4YFMA 1FR6A 3ITAA 1U60A 4JXGA 1L0FA 1ONGA 4K0WA 1IELA 4R23A 4KZ8A 2ZQ7A 5HL1A 1LL5A 3HUMA 4E3NA 4EV4A 1SCWA 4UA7A 3IH9A 1FCNA 1QMEA 4OPYA 1BULA 3O86A 5GLDA 3UPNA 3VFFA 1XA1A 1XGJA 4KG2A 4EWFA 4ZAMA 2ZM0A 5KMWA 5E2GA 2WGIA 4S2KA 4QJGA 5EPHA 3E2KA 5A91A 2H10A 5A92A 3GVBA 5CRFA 2V1ZA 5EVIA 1BLHA 3UDFA 5M18A 3MZEA 1YLZA 5CEBA 1ES3A 4OQ0A 4YINA 4BD1A 4ZDXA 1MWRA 4KG5A 3HLFA 1NJ4A 1CEGA 1PWGA 2C5WB 2Y2PA 4L0LA 1MWSA 3SS5A 2X02A 4C75A 3MZDA 2EFUA 3BFCA 3CMZA 1E3UA 1PWDA 3GV9A 1NYMA 1FCMA 2G2WA 2XFTA 5FQKA 3MBZA 5BOHA 4FSFA 1YLTA 1L0GA 5G18A 3GRJA 1K54C 4JXVA 2J9OA 2OLVA 4U3TA 4JXSA 1CI8A 2WAEA 3ZVWA 4K0XA 2B5RA 3OZHA 4EBPA 4R4RA 3UY6A 4RA7A 2XR0A 3LO7A 1Y54A 2HP6A 4F94A 2XF3A 3HL9A 2XH9A 3ZG7B 2HDRA 3N8SA 4E3MA 3BLSA 4R1GA 5FI7A 4KZBA 1XGIA 3MKEA 4Z9QA 1XKZA 5CGSA 3C5AA 1W79A 2Z2MB 3VP3A 1ZKJA 2E8IA 3IH8A 2Y2HA 1GHPA 3E2LA 5J8XA 5CHMA 3MZFA 3DW0A 3IF6A 1ES2A 3BFDA 4DE0A 2ZC6B 1W7FA 1KVLA 3UPPA 3V39A 3FWLA 1NYYA 3P98A 3HVFA 2CC1A 5GLBA 4X69A 4WZ5A 4S2OA 1ALQA 3HLBA 3A3DA 4OOYA 1GA0A 3UDIA 4EBNA 2ZLYA 4NETA 2Y2KA 3OPPA 4WZ4A 2Y2NA 2VGKA 4R3BA 3DWZA 1PW8A 3P09A 5AQ9A 1KDSA 4JLFA 3MKFA 1FSWA 3VP1A 3FZCA 1JTDA 3V5MA 4GN2A 5JYPA 1MWUA 3S22A 3PBSA 4UA9A 5CHUA 2PBYA 3G2ZA 3V3SA 4D2OA 3NI9A 3N8RA 5F83A 5CERA 2RCXA 3IXHA 2Y59A 1KDWA 2ZJ9A 3Q7VB 4M3KA 4WEJA 4MBHA 1GCEA 4DE1A 3IWIA 3DWKA 3GQZA 4KQQA 3C7VA 2IWBA 1EWZA 2HDSA 5FASA 1VM1A 5E43A 5CECA 5FQMA 3SH9A 2HPBA 2ZC4B 1XXMA 1ZG4A 1PYYA 1AXBA 1YLWA 2OSUA 2XDMA 3PAEA 4X53A 1LHYA 2Q9NA 5CTNA 2HP5A 4N92A 3W8KA 5FQJA 3PAGA 1MKIA 3IF5A 3PTEA 4E3OA 4UAAA 3MFDA 4XXRA 3ZNYA 3B3XA 2J8YA 5FQQA 3VOZA 4OQHA 5A93A 4N9KA 1K6RA 1ZG6A 3AGEA 1IYSA 1MWTA 3IF6C 1IEMA 4CJNA 4ZBEA 5HARA 1FR1A 1K56D 3A3FA 4OH0A 1KGGA 5CXWA 1IKGA 5JYOA 4RVAA 4Y0TA 3O88A 2WZZA 4MBFA 4WELA 1DY6A 3BEBA 4WZ5C 5EOEA 4B4XA 4QD4A 1NRFA 1NXYA 3M6BA 3Q7VA 1YLYA 4N9LA 1KE4A 3Q82A 4R4SA 1WYBA 2Y2LA 1IYOA 2QZ6A 1H8ZA 1L0DA 1K4FA 3PBNA 3VMAA 3NDGA 4R3JA 3ZNTA 3ZG9B 4EUZA 5GLCA 1IKIA 1PW1A 3HREA 4KZAA 4E3JA 4QU3A 5DF8A 3A3EA 3G35A 5FDHA 3EQUA 3IWQA 3FV7A 3VP2A 3IWOA 2XLNA 3WRZA 3M6HA 5HX9A 3G34A 3Q7ZA 2VGJA 3SS3A 1JWPA 4XUZA 2QMIA 1YQSA 3JYIA 1K55A 2Q9MA 4HBUA 1BUEA 3UE1A 3RXXA 2ZQDA 1LL9A 4OLGA 4KZ5A 2J7VA 3NC8A 5TGFA 2JBFA 3VSKA 1MY8A 1KE0A 3ZG0A 3Q81A 2BLSA 3IHAA 3TOIA 5U47A 1MXOA 1Z6FA 4P6BA 1BSGA 2XD5A 3FKWA 2H5SA 4GOGA 4WMCD 3BYDA 3CJMA 1BT5A 3HLEA 4LV2A 4IBRA 4E3IA 5CGXA 4FCFA 3ITBA 4OQGA 4ZJ1A 3SH8A 3BLMA 4X6TA 5FAOA 1ES5A 1CEFA 1ESUA 3NIAA 5HAPA 5CTMA 2P74A 1CK3A 3VFHA 5D3OA 1RGYA 5GL9A 5HFOA 2RL3A 2WADA 2V2FF 3ZFZA 2HP9A 1BTLA 2XGNA 4ZJ3A 3D4FA 4S2MA 4DDSA 3S4XA 2WZXA 4GNUA 2Y2MA 1PI5A 3QHYA 3NDEA 1M40A 4E3KA 2OLUA 5FQ9A 3WS4A 1J9MA 3PBTA 4GDNA 4OP8A 5E2EA 4LV1A 1G68A 5IHVA 1SDEA 5HAIA 3BFGA 4DF6A 5GLAA 2GDNA 4FH2A 4S2IA 1TDGA 5GHYA 1IYQA 1JTGA 1S0WA 3G2YA 4KENB 5DTKA 5EVIC 1FQGA 3WS0A 4RX2A 3W4OA 1O7EA 1YMSA 4IBXA 3ZHHA 3DTMA 2X01A 3C4PA 4Y0UA 2EFXA 1K57A 2XK1A 3A3IA 1K55C 4S2NA 3HLWA 1LI0A 2JCHA 2PU2A 4JPMA 3GSGA 4WBGA 4ZJ2A 2EX8A 3W4QA 5M19A 1XPBA 2X71A 2QPNA 2A49A 2EX2A 3HUNA 1W8YA 1K38A 5M1AA 1C3BA 2V20A 2Y2IA 1XX2A 2OV5A 3G31A 4WYYA 1E4DA 1MBLA 4A5RA 4OOLA 3HUOA 4KZ6A 1K4EA 2Y2JA 1ZC2A 3PBQA 2G2UA 2EXAA 4S2PA 3ISGA 2Y91A 3SS4A 1Q2QA 5EVLA 4O7DA 2XFSA 1JWVA 2Y4AA 1GHMA 3HBRA 4BL3A 1ERQA 1EROA 4LCMA 1JVJA 4KZ7A 2PU4A 3N4IA 3O87A 4IVKA 5AQAA 1IYPA 3TSGA 4S2LA 3BFEA 3WWXA 3IXGA 4B4ZA 2ZC7A 4ID4A 5A90A 4PPRA 3UE0A 3VP4A 4GD8A 1ERMA 2FFFB 3SOIA 2HDQA 3IXDA 5DF7A 5FSRA 3HLCA 1XP4A 1XA7A 3OCLA 2DNSA 4UA6A 4OONA 1PZOA 4XUXA 1H8YA 4X55A 1PIOA 4JKTA 1WE4A 4JBFA 4HEFA 4KG6A 5CGWA 2I72A 1ONHA 1L0EA 4GKUA 1PZPA 5I94A 5HW3A 4E6WA 3LY4A 3LEZA 3BFFA 5FAQA 1TEMA 4Y0OA 1H5XA 3N6IA 5KSCA 1W8QA 1OMEA 3BECA 1O07A 3OPHA 2ZQAA 4R0QA 5TR7A 1K57C 1PWCA 4S2NC 5AQ7A 3VP0A 5F1FA 2WGVA 4QB8A 1E25A 3FYZA 3NCKA 4UHUA 4JF4A 3G30A 1YLPA 3GTCA 1HD8A 2ZQCA 1S6RA 4GD6A 5EUAA 2WAFA 3VOYA 1JWZA 1WYCA 2WKHA 3LY3A 3NBLA 4FD8A 2WGWB 3EQVA 4PM8A 1BLCA 4E3LA 3UNWA 3IT9A 1YT4A 2HDUA 4H8RA 4HBTA 3IHBA 4KZ4A 3ZDJA 4OPRA 1VQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBR A;  4KQO A;  2Y2O A;  2Z2L B;  4MLL A;  1G6A A;  1I2S A;  2H0Y A;  1Q2P A;  2P9V B;  1DJB A;  2J9P A;  4P85 A;  4ZTK A;  1BLP A;  1YMX A;  4X68 A;  4QHC A;  5KSH A;  4FH4 A;  1M6K A;  1N4O A;  1DJC A;  4OPZ A;  3AGF A;  4BJP A;  5FA7 A;  3C7U A;  1LLB A;  4IVI A;  4S2J A;  2ZM2 A;  3IF6 B;  3SH7 A;  2DRW A;  4Q8I A;  1KVM A;  5GHZ A;  5FI2 A;  3V3R A;  4E6X A;  2JE5 A;  1HVB A;  2ZC3 B;  3NY4 A;  1EI5 A;  3HLD A;  4OP5 A;  4EBL A;  1I2W A;  1TVF A;  4C3Q A;  4LV0 A;  3N8L A;  3ZG8 B;  3Q07 A;  1L2S A;  2FFY A;  2WGW A;  5DF9 A;  3UE3 A;  4JXW A;  1SKF A;  4OVD A;  4LEN A;  3ZCZ A;  1GHI A;  4BL2 A;  3I7J A;  5EVI D;  1N9B A;  1TDL A;  3OPL A;  4LV3 A;  3UO9 A;  3CG5 A;  4DKI A;  1NY0 A;  5F82 A;  3GMW A;  1K6S A;  1KGE A;  2ZQ9 A;  2R9X A;  1K25 A;  1BLS A;  4WEK A;  3RXW A;  4DRT A;  4KZ9 A;  4EQI A;  2P9V A;  1RP5 A;  2ZQ8 A;  1RCJ A;  1MPL A;  1I5Q A;  1DJA A;  1E3U D;  1HTZ A;  1PI4 A;  2ZC5 B;  4BEN A;  3PBO A;  1CI9 A;  2JC7 A;  4KZ3 A;  4QY5 A;  5FI6 A;  4PM9 A;  3M2K A;  4MEZ A;  2WYX A;  4MBK A;  4BD0 A;  2ZMA A;  4MNR A;  4PMA A;  1KE3 A;  5AQB A;  4OPQ A;  5EE8 A;  3ZG5 A;  5TFQ A;  3BM6 A;  1W5D A;  3CZD A;  3WS2 A;  3M2J A;  3MXR A;  2DCF A;  2WK0 A;  2ZM8 A;  1SDN A;  3LCE A;  5DVA A;  1KGF A;  4OOM A;  3GR2 A;  3VSL A;  2XEP A;  2XD1 A;  1HZO A;  4NK3 A;  4KQR A;  4GDB A;  1ES4 A;  1NZO A;  3BRM A;  3Q1F A;  1K56 A;  1YLJ A;  2WKE A;  1ESI A;  4OKP A;  2IWC A;  3UN7 A;  2XQZ A;  3G4P A;  3QNB A;  4X56 A;  4P0M A;  5EOO A;  3QNC A;  1BZA A;  1GA9 A;  2Y2G A;  4N1H A;  4PM6 A;  3WRT A;  1FSY A;  3W4P A;  5DTS A;  5CED A;  4BQM A;  1RGZ A;  3A3J A;  4PM7 A;  4B88 A;  4OLD A;  3IQA A;  4U0T A;  4JF5 A;  4RX3 A;  4DXC A;  4C6Y A;  5L2F A;  2WUQ A;  3V50 A;  2BG1 A;  5FQI A;  5E2H A;  4DDY A;  3OCN A;  1YM1 A;  3ZVT A;  4GZB A;  5FAT A;  3RJU A;  3C4O A;  2UWX A;  1FOF A;  4LCL A;  4QY6 A;  3WS5 A;  3UDX A;  2R9W A;  4IED A;  3IXB A;  4OQI A;  2H0T A;  1QMF A;  3ZGA B;  4WM9 A;  3MXS A;  2A3U A;  3AGD A;  3O3V A;  2IWD A;  1SHV A;  2WKI A;  3FKV A;  3OPR A;  5CHJ A;  3G32 A;  1FCO A;  5EVI B;  1NZU A;  2EX6 A;  5E2F A;  1K54 A;  2ZD8 A;  3TG9 A;  4K91 A;  5EEC A;  5DTT A;  5F1G A;  4BLM A;  3S1Y A;  3N7W A;  4Y7P A;  3WS1 A;  4DE2 A;  3HLG A;  4U0X A;  2EXB A;  4P87 A;  5HAQ A;  4RYE A;  2EX9 A;  4PM5 A;  4N1X A;  4CPK A;  2Y2Q A;  4HES A;  5KZH A;  4WMC A;  2Y55 A;  3UPO A;  5FAP A;  3OC2 A;  2C6W B;  4GB7 A;  1LI9 A;  5GHX A;  4DE3 A;  4DXB A;  4JF6 A;  4YFM A;  1FR6 A;  3ITA A;  1U60 A;  4JXG A;  1L0F A;  1ONG A;  4K0W A;  1IEL A;  4R23 A;  4KZ8 A;  2ZQ7 A;  5HL1 A;  1LL5 A;  3HUM A;  4E3N A;  4EV4 A;  1SCW A;  4UA7 A;  3IH9 A;  1FCN A;  1QME A;  4OPY A;  1BUL A;  3O86 A;  5GLD A;  3UPN A;  3VFF A;  1XA1 A;  1XGJ A;  4KG2 A;  4EWF A;  4ZAM A;  2ZM0 A;  5KMW A;  5E2G A;  2WGI A;  4S2K A;  4QJG A;  5EPH A;  3E2K A;  5A91 A;  2H10 A;  5A92 A;  3GVB A;  5CRF A;  2V1Z A;  5EVI A;  1BLH A;  3UDF A;  5M18 A;  3MZE A;  1YLZ A;  5CEB A;  1ES3 A;  4OQ0 A;  4YIN A;  4BD1 A;  4ZDX A;  1MWR A;  4KG5 A;  3HLF A;  1NJ4 A;  1CEG A;  1PWG A;  2C5W B;  2Y2P A;  4L0L A;  1MWS A;  3SS5 A;  2X02 A;  4C75 A;  3MZD A;  2EFU A;  3BFC A;  3CMZ A;  1E3U A;  1PWD A;  3GV9 A;  1NYM A;  1FCM A;  2G2W A;  2XFT A;  5FQK A;  3MBZ A;  5BOH A;  4FSF A;  1YLT A;  1L0G A;  5G18 A;  3GRJ A;  1K54 C;  4JXV A;  2J9O A;  2OLV A;  4U3T A;  4JXS A;  1CI8 A;  2WAE A;  3ZVW A;  4K0X A;  2B5R A;  3OZH A;  4EBP A;  4R4R A;  3UY6 A;  4RA7 A;  2XR0 A;  3LO7 A;  1Y54 A;  2HP6 A;  4F94 A;  2XF3 A;  3HL9 A;  2XH9 A;  3ZG7 B;  2HDR A;  3N8S A;  4E3M A;  3BLS A;  4R1G A;  5FI7 A;  4KZB A;  1XGI A;  3MKE A;  4Z9Q A;  1XKZ A;  5CGS A;  3C5A A;  1W79 A;  2Z2M B;  3VP3 A;  1ZKJ A;  2E8I A;  3IH8 A;  2Y2H A;  1GHP A;  3E2L A;  5J8X A;  5CHM A;  3MZF A;  3DW0 A;  3IF6 A;  1ES2 A;  3BFD A;  4DE0 A;  2ZC6 B;  1W7F A;  1KVL A;  3UPP A;  3V39 A;  3FWL A;  1NYY A;  3P98 A;  3HVF A;  2CC1 A;  5GLB A;  4X69 A;  4WZ5 A;  4S2O A;  1ALQ A;  3HLB A;  3A3D A;  4OOY A;  1GA0 A;  3UDI A;  4EBN A;  2ZLY A;  4NET A;  2Y2K A;  3OPP A;  4WZ4 A;  2Y2N A;  2VGK A;  4R3B A;  3DWZ A;  1PW8 A;  3P09 A;  5AQ9 A;  1KDS A;  4JLF A;  3MKF A;  1FSW A;  3VP1 A;  3FZC A;  1JTD A;  3V5M A;  4GN2 A;  5JYP A;  1MWU A;  3S22 A;  3PBS A;  4UA9 A;  5CHU A;  2PBY A;  3G2Z A;  3V3S A;  4D2O A;  3NI9 A;  3N8R A;  5F83 A;  5CER A;  2RCX A;  3IXH A;  2Y59 A;  1KDW A;  2ZJ9 A;  3Q7V B;  4M3K A;  4WEJ A;  4MBH A;  1GCE A;  4DE1 A;  3IWI A;  3DWK A;  3GQZ A;  4KQQ A;  3C7V A;  2IWB A;  1EWZ A;  2HDS A;  5FAS A;  1VM1 A;  5E43 A;  5CEC A;  5FQM A;  3SH9 A;  2HPB A;  2ZC4 B;  1XXM A;  1ZG4 A;  1PYY A;  1AXB A;  1YLW A;  2OSU A;  2XDM A;  3PAE A;  4X53 A;  1LHY A;  2Q9N A;  5CTN A;  2HP5 A;  4N92 A;  3W8K A;  5FQJ A;  3PAG A;  1MKI A;  3IF5 A;  3PTE A;  4E3O A;  4UAA A;  3MFD A;  4XXR A;  3ZNY A;  3B3X A;  2J8Y A;  5FQQ A;  3VOZ A;  4OQH A;  5A93 A;  4N9K A;  1K6R A;  1ZG6 A;  3AGE A;  1IYS A;  1MWT A;  3IF6 C;  1IEM A;  4CJN A;  4ZBE A;  5HAR A;  1FR1 A;  1K56 D;  3A3F A;  4OH0 A;  1KGG A;  5CXW A;  1IKG A;  5JYO A;  4RVA A;  4Y0T A;  3O88 A;  2WZZ A;  4MBF A;  4WEL A;  1DY6 A;  3BEB A;  4WZ5 C;  5EOE A;  4B4X A;  4QD4 A;  1NRF A;  1NXY A;  3M6B A;  3Q7V A;  1YLY A;  4N9L A;  1KE4 A;  3Q82 A;  4R4S A;  1WYB A;  2Y2L A;  1IYO A;  2QZ6 A;  1H8Z A;  1L0D A;  1K4F A;  3PBN A;  3VMA A;  3NDG A;  4R3J A;  3ZNT A;  3ZG9 B;  4EUZ A;  5GLC A;  1IKI A;  1PW1 A;  3HRE A;  4KZA A;  4E3J A;  4QU3 A;  5DF8 A;  3A3E A;  3G35 A;  5FDH A;  3EQU A;  3IWQ A;  3FV7 A;  3VP2 A;  3IWO A;  2XLN A;  3WRZ A;  3M6H A;  5HX9 A;  3G34 A;  3Q7Z A;  2VGJ A;  3SS3 A;  1JWP A;  4XUZ A;  2QMI A;  1YQS A;  3JYI A;  1K55 A;  2Q9M A;  4HBU A;  1BUE A;  3UE1 A;  3RXX A;  2ZQD A;  1LL9 A;  4OLG A;  4KZ5 A;  2J7V A;  3NC8 A;  5TGF A;  2JBF A;  3VSK A;  1MY8 A;  1KE0 A;  3ZG0 A;  3Q81 A;  2BLS A;  3IHA A;  3TOI A;  5U47 A;  1MXO A;  1Z6F A;  4P6B A;  1BSG A;  2XD5 A;  3FKW A;  2H5S A;  4GOG A;  4WMC D;  3BYD A;  3CJM A;  1BT5 A;  3HLE A;  4LV2 A;  4IBR A;  4E3I A;  5CGX A;  4FCF A;  3ITB A;  4OQG A;  4ZJ1 A;  3SH8 A;  3BLM A;  4X6T A;  5FAO A;  1ES5 A;  1CEF A;  1ESU A;  3NIA A;  5HAP A;  5CTM A;  2P74 A;  1CK3 A;  3VFH A;  5D3O A;  1RGY A;  5GL9 A;  5HFO A;  2RL3 A;  2WAD A;  2V2F F;  3ZFZ A;  2HP9 A;  1BTL A;  2XGN A;  4ZJ3 A;  3D4F A;  4S2M A;  4DDS A;  3S4X A;  2WZX A;  4GNU A;  2Y2M A;  1PI5 A;  3QHY A;  3NDE A;  1M40 A;  4E3K A;  2OLU A;  5FQ9 A;  3WS4 A;  1J9M A;  3PBT A;  4GDN A;  4OP8 A;  5E2E A;  4LV1 A;  1G68 A;  5IHV A;  1SDE A;  5HAI A;  3BFG A;  4DF6 A;  5GLA A;  2GDN A;  4FH2 A;  4S2I A;  1TDG A;  5GHY A;  1IYQ A;  1JTG A;  1S0W A;  3G2Y A;  4KEN B;  5DTK A;  5EVI C;  1FQG A;  3WS0 A;  4RX2 A;  3W4O A;  1O7E A;  1YMS A;  4IBX A;  3ZHH A;  3DTM A;  2X01 A;  3C4P A;  4Y0U A;  2EFX A;  1K57 A;  2XK1 A;  3A3I A;  1K55 C;  4S2N A;  3HLW A;  1LI0 A;  2JCH A;  2PU2 A;  4JPM A;  3GSG A;  4WBG A;  4ZJ2 A;  2EX8 A;  3W4Q A;  5M19 A;  1XPB A;  2X71 A;  2QPN A;  2A49 A;  2EX2 A;  3HUN A;  1W8Y A;  1K38 A;  5M1A A;  1C3B A;  2V20 A;  2Y2I A;  1XX2 A;  2OV5 A;  3G31 A;  4WYY A;  1E4D A;  1MBL A;  4A5R A;  4OOL A;  3HUO A;  4KZ6 A;  1K4E A;  2Y2J A;  1ZC2 A;  3PBQ A;  2G2U A;  2EXA A;  4S2P A;  3ISG A;  2Y91 A;  3SS4 A;  1Q2Q A;  5EVL A;  4O7D A;  2XFS A;  1JWV A;  2Y4A A;  1GHM A;  3HBR A;  4BL3 A;  1ERQ A;  1ERO A;  4LCM A;  1JVJ A;  4KZ7 A;  2PU4 A;  3N4I A;  3O87 A;  4IVK A;  5AQA A;  1IYP A;  3TSG A;  4S2L A;  3BFE A;  3WWX A;  3IXG A;  4B4Z A;  2ZC7 A;  4ID4 A;  5A90 A;  4PPR A;  3UE0 A;  3VP4 A;  4GD8 A;  1ERM A;  2FFF B;  3SOI A;  2HDQ A;  3IXD A;  5DF7 A;  5FSR A;  3HLC A;  1XP4 A;  1XA7 A;  3OCL A;  2DNS A;  4UA6 A;  4OON A;  1PZO A;  4XUX A;  1H8Y A;  4X55 A;  1PIO A;  4JKT A;  1WE4 A;  4JBF A;  4HEF A;  4KG6 A;  5CGW A;  2I72 A;  1ONH A;  1L0E A;  4GKU A;  1PZP A;  5I94 A;  5HW3 A;  4E6W A;  3LY4 A;  3LEZ A;  3BFF A;  5FAQ A;  1TEM A;  4Y0O A;  1H5X A;  3N6I A;  5KSC A;  1W8Q A;  1OME A;  3BEC A;  1O07 A;  3OPH A;  2ZQA A;  4R0Q A;  5TR7 A;  1K57 C;  1PWC A;  4S2N C;  5AQ7 A;  3VP0 A;  5F1F A;  2WGV A;  4QB8 A;  1E25 A;  3FYZ A;  3NCK A;  4UHU A;  4JF4 A;  3G30 A;  1YLP A;  3GTC A;  1HD8 A;  2ZQC A;  1S6R A;  4GD6 A;  5EUA A;  2WAF A;  3VOY A;  1JWZ A;  1WYC A;  2WKH A;  3LY3 A;  3NBL A;  4FD8 A;  2WGW B;  3EQV A;  4PM8 A;  1BLC A;  4E3L A;  3UNW A;  3IT9 A;  1YT4 A;  2HDU A;  4H8R A;  4HBT A;  3IHB A;  4KZ4 A;  3ZDJ A;  4OPR A;  1VQQ A; 
#chains in the Genus database with same CATH topology
 1V9Z A;  2Z2L B;  2IA2 A;  2P7J A;  3QP6 A;  5HPI A;  3QP5 A;  1T1B A;  4FH4 A;  1N4O A;  4OPZ A;  3ZQ5 A;  3AGF A;  5A8B A;  4Q0I A;  3CUE A;  1LLB A;  3IF6 B;  3UB5 P;  5F69 A;  3K3D A;  3PXP A;  3V3R A;  2JE5 A;  1HVB A;  2ZC3 B;  1EI5 A;  1PRQ A;  3HLD A;  1I2W A;  4C3Q A;  1TF1 A;  3JVU A;  3ZG8 B;  4R3A A;  1GHI A;  3I7J A;  4DKI A;  1KGE A;  5EV0 A;  2R9X A;  3UB8 A;  4LGW A;  1BLS A;  4WEK A;  4DRT A;  2QKP A;  4X25 A;  2P9V A;  1RP5 A;  4I5S A;  1RCJ A;  2FZ0 A;  2ZC5 B;  3PBO A;  4QY5 A;  3M2K A;  4MBK A;  2ZMA A;  3CWF A;  1P0Z A;  1KE3 A;  5AQB A;  5EE8 A;  2PR6 A;  2DCF A;  3LCE A;  2XD1 A;  2W3F A;  4NK3 A;  4R6L A;  4AFI A;  3BRM A;  4OKP A;  1H3Q A;  3CUE C;  4LRY C;  4X56 A;  5G4Y A;  1BZA A;  1GA9 A;  3WRT A;  1FSY A;  3OLO A;  3B33 A;  1YAX A;  3VV4 A;  3LYX A;  3SW1 A;  4OLD A;  4JF5 A;  4RX3 A;  2WUQ A;  4GW9 A;  3V50 A;  2OAP 1;  4GZB A;  3IXB A;  1VEU A;  3L9K A;  3ZGA B;  2KDK A;  3O3V A;  1SHV A;  2WKI A;  3G32 A;  2PD8 A;  1NZU A;  2ZD8 A;  3DAV A;  5EEC A;  5F1G A;  3N7W A;  3HLG A;  1K0K A;  2PYR A;  2EXB A;  5HAQ A;  4B9O A;  4CPK A;  2Y2Q A;  3UPO A;  3LR5 A;  3OOV A;  4MDZ A;  2W3D A;  3GDI A;  3ITA A;  1L0F A;  1T1A A;  4K0W A;  4R23 A;  4HNB A;  2XRN A;  1OTA A;  4EV4 A;  3O86 A;  5GLD A;  4EWF A;  2V0U A;  3E2K A;  3HCY A;  2H10 A;  5A92 A;  2V1Z A;  1BLH A;  2JKR I;  3MZE A;  1YLZ A;  2W3G A;  4PKY G;  3UB6 A;  4HH3 A;  3MZD A;  2EFU A;  1NYM A;  3IX3 A;  3FPW A;  1YLT A;  3GRJ A;  2OLV A;  4U3T A;  4JXS A;  3PR6 A;  3K2N A;  3MR0 A;  4ESP A;  4EBP A;  2XR0 A;  2HP6 A;  2XF3 A;  3IBJ A;  1F98 A;  4E3M A;  3BLS A;  1XGI A;  3MKE A;  4Z9Q A;  1XKZ A;  4Y13 A;  3VP3 A;  4HIA A;  2Y2H A;  3E2L A;  5J8X A;  5CHM A;  3MZF A;  3IF6 A;  1W7F A;  1NYY A;  2ZLY A;  2Z6C A;  4RQ9 A;  2Y2N A;  2VGK A;  3P09 A;  1KDS A;  4JLF A;  3MKF A;  3FZC A;  1JTD A;  3V5M A;  3E4O A;  4Y2F A;  4UA9 A;  3V3S A;  3N8R A;  2RCX A;  3IXH A;  2ZJ9 A;  4WEJ A;  1GCE A;  3GQZ A;  1VM1 A;  3OBF A;  2HPB A;  1D7E A;  1XXM A;  4HI4 A;  2OSU A;  2XDM A;  4CLC E;  2Q9N A;  2HP5 A;  1MKI A;  3IF5 A;  4UAA A;  3IX4 A;  1S1Z A;  4IHQ A;  4NKP A;  4EES A;  5FQQ A;  4OQH A;  5MC7 A;  4N9K A;  5HDD A;  2D02 A;  1KOU A;  1ZG6 A;  3AGE A;  1XFQ A;  3F1N A;  1NRJ A;  1IYS A;  1MWT A;  3IF6 C;  1FR1 A;  1K56 D;  3A3F A;  4OH0 A;  5HD5 A;  3O88 A;  4WEL A;  3BEB A;  5EOE A;  3IX8 A;  1KE4 A;  3A0V A;  1WYB A;  2QZ6 A;  2J3W A;  1L0D A;  4Y3I A;  3S7P A;  4ETZ A;  2K7S A;  3VMA A;  4MN6 A;  1PW1 A;  4KZA A;  4QU3 A;  5DF8 A;  3EQU A;  3IWQ A;  3VP2 A;  4JGR A;  5HX9 A;  2V8F A;  2W1T A;  3RXX A;  2ZQD A;  1LL9 A;  4KZ5 A;  2JBF A;  4WMC D;  1F9I A;  3BYD A;  3HLE A;  4LV2 A;  4IBR A;  5CGX A;  4G3V A;  4ZJ1 A;  1HLU P;  2XA7 S;  3RH8 B;  2VGL S;  1CQA A;  5HAP A;  1S67 L;  3BY8 A;  1TS6 A;  1T18 A;  2WAD A;  2V2F F;  3ZYT A;  1XJ3 A;  3D4F A;  3C2W A;  4DDS A;  4EW7 A;  3WS4 A;  1YPR A;  5E2E A;  1G68 A;  2W0N A;  1SDE A;  2G7U A;  3R7W B;  5J4E A;  2JHE A;  4KEN B;  3VE3 A;  3P7N A;  3ZHH A;  3MQ0 A;  2P08 A;  3DTM A;  1OJ5 A;  3C4P A;  2L1M A;  3PYP A;  4ZJ2 A;  5M1A A;  2V20 A;  2Y2I A;  3KO6 A;  2OV5 A;  4HY8 A;  4OOL A;  4KZ6 A;  3PBQ A;  1UWP X;  2A2L A;  4S2P A;  3ISG A;  2Y91 A;  5EVL A;  4O7D A;  4BL3 A;  1GHM A;  2OWJ A;  4HJ6 A;  4HQA A;  5J3W A;  3KYE A;  3N4I A;  3O87 A;  1IYP A;  3H9W A;  3LIE A;  5I5L A;  4B4Z A;  2ZC7 A;  3DTK A;  5DKK A;  4F3L B;  5A90 A;  3UE0 A;  2FFF B;  2LB5 A;  3IXD A;  1XA7 A;  2DNS A;  3T12 B;  2A24 A;  1Z09 A;  4LRX C;  1F2K A;  4I39 A;  1NLZ A;  2V1A A;  2I72 A;  5I94 A;  5HW3 A;  2EWV A;  1DP8 A;  4FTX A;  5FAQ A;  1TEM A;  1H5X A;  2YKH A;  1O07 A;  5EM1 A;  5TR7 A;  4Y15 A;  4YOF A;  1PWC A;  5AQ7 A;  1E25 A;  4EXO A;  4JF4 A;  2CMN A;  3MFX A;  1JWZ A;  2WKP A;  2JKR M;  3IT9 A;  2MJ6 A;  3PHY A;  1YT4 A;  1TS7 A;  3E98 A;  3PBR A;  5L8M A;  5HPF A;  2H0Y A;  2WKR A;  2P9V B;  1BLP A;  4WUJ A;  2B95 A;  1DRM A;  3V67 A;  3C7U A;  4S2J A;  2ZM2 A;  3SH7 A;  3T4L A;  1KVM A;  5GHZ A;  3B42 A;  2DMW A;  1WA9 A;  2GJ3 A;  3N8L A;  1L2S A;  5DF9 A;  2L0W A;  1T1C A;  4OVD A;  4LEN A;  1XFN A;  3CG5 A;  4DMZ A;  1NY0 A;  2FH5 A;  5F82 A;  3GMW A;  1K6S A;  2VKS A;  2ZQ9 A;  3B47 A;  1K25 A;  2W3H A;  4EQI A;  5J7E A;  2ZQ8 A;  2OOL A;  1MPL A;  1I5Q A;  5FL3 A;  2PR5 A;  4BEN A;  1P97 A;  5EVE A;  4PMA A;  1W5D A;  3M2J A;  3MXR A;  2WK0 A;  4QPR A;  1KGF A;  4OOM A;  3GR2 A;  3LIC A;  1G6O A;  4KQR A;  2JKT I;  4GDB A;  4YWZ A;  3IBR A;  3Q1F A;  1YLJ A;  2WKE A;  1ESI A;  3UN7 A;  3LGO A;  2XQZ A;  3EEH A;  3O5Y A;  3QNC A;  3LEQ A;  5HDC A;  2W1R A;  4N1H A;  4BQM A;  3A3J A;  4B88 A;  5L2F A;  4DDY A;  1YM1 A;  1OTD A;  3NOT C;  3RJU A;  3WS5 A;  3C4O A;  2UWX A;  1FOF A;  4QY6 A;  1YSQ A;  4PAU A;  1NWZ A;  4OQI A;  2PHY A;  1N9L A;  2IWD A;  5KIZ A;  5E2F A;  3HJI A;  1GSX A;  3WS1 A;  4DE2 A;  3S7O A;  2O99 A;  4JGO A;  4P87 A;  5LBR A;  4RYE A;  5AVE A;  2EX9 A;  4HJ4 A;  5FAP A;  4GB7 A;  4F3L A;  1LI9 A;  4YFM A;  3NJA A;  4JXG A;  1ONG A;  4DJ3 A;  1TS8 A;  3HUM A;  3T1Q B;  4E3N A;  4Y17 A;  3VFF A;  1XGJ A;  5KMW A;  5E2G A;  2WGI A;  4NG2 A;  3GVB A;  5CRF A;  4P6Z M;  5M18 A;  4ZDX A;  4KG5 A;  1PWG A;  2C5W B;  2Y2P A;  3KSF A;  1MWS A;  3CMZ A;  3BFC A;  1L3L A;  5AVF A;  5FQK A;  4GHI B;  1FCM A;  2XFT A;  3MBZ A;  4ZRR A;  1H0M A;  3ZVW A;  4K0X A;  5L10 A;  2B5R A;  3OZH A;  3UY6 A;  4D60 A;  2QYB A;  5TBM A;  3ZG7 B;  1BYW A;  4R1G A;  4KZB A;  2ZOI A;  2Z2M B;  2E8I A;  3SZT A;  3E0Y A;  4MN7 A;  2CC1 A;  1STZ A;  4WZ5 A;  4X69 A;  2HF6 A;  5F5Y A;  1ALQ A;  4OOY A;  3UDI A;  1GA0 A;  3OPP A;  2PYP A;  1PW8 A;  3F1N B;  1F5M A;  1OPX A;  4GN2 A;  3S22 A;  2PBY A;  4KQQ A;  2IWB A;  3C7V A;  1EWZ A;  2HDS A;  5E43 A;  3KX0 X;  1LHY A;  5L07 A;  1OTE A;  4N92 A;  5FQJ A;  3PAG A;  4BWI A;  4E3O A;  4XXR A;  5A93 A;  5FEF A;  2W1T B;  4O01 A;  3T4T A;  2ZL1 A;  4KUK A;  4GJ4 A;  1KGG A;  4RVA A;  4Y0T A;  4WZ5 C;  1DY6 A;  4QD4 A;  1NRF A;  1NXY A;  1YLY A;  3Q82 A;  4R4S A;  2H28 A;  2Y2L A;  4GLQ A;  3E4P A;  1K4F A;  3PBN A;  1SZV A;  4NXF A;  3HRE A;  4E3J A;  3A3E A;  3QP8 A;  4LRZ E;  3NOP C;  5DFY A;  2M1C A;  3E4Q A;  3G34 A;  2M7V A;  5G4Z A;  3MMH A;  4HBU A;  1BUE A;  4OLG A;  2JKG A;  2J7V A;  3NC8 A;  3VSK A;  1KE0 A;  2BLS A;  3TOI A;  1S4R A;  1Z6F A;  3EWK A;  3CI6 A;  2H5S A;  4E3I A;  2PD7 A;  4OQG A;  4CLC D;  3SH8 A;  1ES5 A;  2ZMV A;  5CTM A;  2P74 A;  3VFH A;  5D3O A;  4CQH A;  1RGY A;  5GL9 A;  5HFO A;  5HZH A;  4NEE D;  2HP9 A;  4S2M A;  3EEA A;  1ZTU A;  1PI5 A;  1M40 A;  1UGU A;  2OLU A;  5FQ9 A;  1J9M A;  4GDN A;  3JPU A;  4LV1 A;  5GLA A;  2GDN A;  4GHI A;  1IYQ A;  1JTG A;  4R70 A;  1FQG A;  2JKT M;  3D3O A;  4Y0U A;  3HLW A;  1LSW A;  2PU2 A;  3GSG A;  2VZW A;  2A24 B;  4BBV A;  1XPB A;  2X71 A;  5HSQ A;  2ZMF A;  2A49 A;  2EX2 A;  1K38 A;  1C3B A;  3NOU C;  4X1L A;  4A5R A;  1K4E A;  2Y2J A;  1ZC2 A;  2PBD P;  2EXA A;  4MCW A;  3HBR A;  4LCM A;  2VV6 A;  4KZ7 A;  4IVK A;  1TD5 A;  3TSG A;  4QWO A;  3WWX A;  3IXG A;  5IU1 A;  4ID4 A;  3H82 B;  1ERM A;  3GEC A;  1XP4 A;  3OCL A;  2J3T D;  3H7W A;  3LR4 A;  4UA6 A;  1XJ2 A;  4X55 A;  1PIO A;  4JKT A;  1WE4 A;  4JBF A;  4HEF A;  4KG6 A;  3C30 A;  1ONH A;  1L0E A;  4E6W A;  4G3W A;  3FPV A;  4YNR A;  3BFF A;  1N9O A;  1W8Q A;  5DFX A;  4EET B;  1PNE A;  2HZ5 A;  4EEU A;  5HWV A;  4QB8 A;  2V1B A;  3FYZ A;  1T19 A;  1YLP A;  3G30 A;  2ZQC A;  1ZHH B;  3S7Q A;  2B02 A;  3VOY A;  4PM8 A;  3U2A A;  1BLC A;  4CLC A;  2QJ7 A;  4ETX A;  3BWL A;  3IHB A;  4KZ4 A;  1VQQ A;  4KQO A;  4B93 A;  2ZBB A;  4MLL A;  1G6A A;  1I2S A;  4P85 A;  4ZTK A;  1YMX A;  4QHC A;  3QP4 A;  1M6K A;  2QJ5 A;  1DJC A;  3LIB A;  4IVI A;  2DRW A;  5FI2 A;  3NY4 A;  4LV0 A;  5EM0 A;  2WGW A;  3UE3 A;  4UEY A;  4JXW A;  3ZCZ A;  2Y8H A;  1N9N A;  5EVI D;  1N9B A;  1TDL A;  1MC0 A;  1OT6 A;  3RXW A;  4KUO A;  4KZ9 A;  3MF0 A;  2HGV A;  1DJA A;  2V9A A;  4EER A;  2LB9 A;  4CLC C;  4KZ3 A;  5FI6 A;  4PM9 A;  5HWW A;  2WYX A;  4BD0 A;  4ARZ B;  4NXB A;  4ME4 A;  3BM6 A;  5DVA A;  3VSL A;  1Y28 A;  4IUK A;  1ES4 A;  5DJT A;  1K56 A;  2IWC A;  2HV1 A;  3QNB A;  3T4O A;  4LFU A;  2Y2G A;  2PDR A;  5CED A;  4P6Z S;  4PM7 A;  3IQA A;  4DXC A;  2BG1 A;  5FQI A;  3OCN A;  3T4S A;  4I38 A;  4LCL A;  4E04 A;  1QMF A;  4WM9 A;  3MXS A;  2A3U A;  3AGD A;  5CHJ A;  3FKV A;  2EX6 A;  1DP9 A;  4JGQ A;  2PT7 A;  3TG9 A;  4K91 A;  5DTT A;  4BLM A;  4U0X A;  4PM5 A;  4N1X A;  4HES A;  4WMC A;  3LUQ A;  3OC2 A;  2C6W B;  4M4X A;  3H82 A;  5GHX A;  5F68 A;  4DXB A;  1P9W A;  1U60 A;  2O9A A;  1LSV A;  5DKL A;  4KZ8 A;  2ZQ7 A;  5HL1 A;  3DTE A;  2NUP C;  1SCW A;  3IH9 A;  1FCN A;  5TBM B;  4OPY A;  1BUL A;  5F6A A;  4ZAM A;  2D01 A;  4S2K A;  4QJG A;  5A91 A;  3UDF A;  5EVI A;  4BBU A;  3R4K A;  1ES3 A;  4YIN A;  3FG8 A;  3HLF A;  1CEG A;  2VJW A;  4L0L A;  3QP1 A;  3SS5 A;  1W63 M;  4C75 A;  4HHD A;  1PWD A;  3GV9 A;  2G2W A;  5BOH A;  1L0G A;  5G18 A;  4JXV A;  3F1O B;  1CI8 A;  2WAE A;  1P9R A;  4LLO B;  5IS1 A;  2OWH A;  1UWN X;  4R4R A;  3MSH A;  1Y54 A;  3HL9 A;  3P01 A;  3RFB A;  2HDR A;  5CGS A;  3C5A A;  4R38 A;  1S4S A;  3LI9 A;  1ACF A;  2GX5 A;  3DTI A;  1ES2 A;  3BFD A;  4DE0 A;  2ZC6 B;  1KVL A;  3UPP A;  3FWL A;  4HOI A;  4BMW A;  3HVF A;  1IFQ A;  3HLB A;  3A3D A;  4EBN A;  3G6O A;  3T4K A;  4X1M A;  1Y4O A;  2ZL1 B;  5AQ9 A;  1FSW A;  2ACG A;  3HJK A;  1MWU A;  5CHU A;  4D2O A;  3G2Z A;  3D9Y A;  5F83 A;  2Y59 A;  5K5B A;  4K08 A;  4MBH A;  3DWK A;  4O0P A;  5FAS A;  1FIL A;  5CEC A;  5FQM A;  2ZC4 B;  4ARZ A;  1ZG4 A;  1AXB A;  1YLW A;  3PAE A;  5CTN A;  1CJF A;  3UB9 A;  3T4Q A;  3MFD A;  3B3X A;  3VOZ A;  1LSX A;  1K6R A;  1MZU A;  4ZBE A;  3ICY A;  3KYQ A;  3LIF A;  3BQA A;  1FIK A;  2WZZ A;  5IT5 A;  4L9E A;  2BTF P;  3FC7 A;  3Q7V A;  4N9L A;  1H8Z A;  4L9F A;  3ZNT A;  3ZG9 B;  1CF0 A;  2PRF A;  5EFW A;  3G35 A;  3FV7 A;  4LPZ A;  1AWI A;  2XLN A;  2XRO A;  3CAX A;  1D06 A;  4EUV A;  2VGJ A;  3SS3 A;  4XUZ A;  1K55 A;  2Q9M A;  3T1S A;  2O9B A;  1JNU A;  1MY8 A;  3ZG0 A;  1VHM A;  3IHA A;  3CLO A;  5U47 A;  1BSG A;  2QWS A;  2XD5 A;  3FKW A;  1BT5 A;  1H8M A;  2HJ9 C;  5FAO A;  1CEF A;  3NIA A;  3EGD C;  4GCZ A;  2RL3 A;  4H6J A;  3ZFZ A;  1S66 L;  2VV7 A;  2XGN A;  4UQI M;  3S4X A;  2Y2M A;  4FOF A;  4E3K A;  1G5U A;  3PBT A;  5HWT A;  5HAI A;  4Q0J A;  3BJN A;  4FH2 A;  4S2I A;  3WS0 A;  3W4O A;  4NXE A;  1O7E A;  2Z6D A;  3F1O A;  1W63 Q;  3H7W B;  2X01 A;  1K57 A;  3VE4 A;  2XK1 A;  4BBT A;  1K55 C;  4S2N A;  1LI0 A;  4WBG A;  5M19 A;  2EX8 A;  2JN7 A;  4Q0H A;  4HP9 A;  2QPN A;  3HUN A;  1W8Y A;  2ZOH A;  1XX2 A;  3G31 A;  3T1X A;  1MBL A;  1PFL A;  3T50 A;  2EWW A;  3F1P A;  3SS4 A;  4Z1W A;  2Y4A A;  1ERQ A;  1GSW A;  2EA9 A;  2PU4 A;  3LFV A;  5FEG A;  1LL8 A;  4S2L A;  3BFE A;  4O8G A;  3RTY A;  4PPR A;  3VP4 A;  4CLC B;  2HDQ A;  4XT2 A;  5FSR A;  1SKO B;  3MS6 A;  4HH2 A;  4EEP A;  4OON A;  1H8Y A;  3U4L P;  3CPT A;  5CGW A;  3LEZ A;  1OME A;  3OPH A;  1K57 C;  1NLY A;  4S2N C;  3NCK A;  3VOL A;  1HD8 A;  1S6R A;  5TJJ A;  5EUA A;  2WAF A;  4FD8 A;  3LY3 A;  2E8J A;  5L09 A;  2WGW B;  3EQV A;  4DN0 A;  4E3L A;  2W27 A;  2HDU A;  4H8R A;  4HBT A;  3ZDJ A;  4OPR A;  2Y2O A;  3TW8 A;  1Q2P A;  1DJB A;  2J9P A;  4X68 A;  5KSH A;  4EU0 A;  4BJP A;  5FA7 A;  1OTB A;  2O0Y A;  3NEC A;  4Q8I A;  3NHQ A;  4E6X A;  2HJE A;  4OP5 A;  4EBL A;  2INW A;  1TVF A;  4HP4 A;  4GS9 B;  3Q07 A;  2FFY A;  1SKF A;  4BL2 A;  3BQ8 A;  2I9V A;  3IS2 B;  3OPL A;  4LV3 A;  4NXG A;  3UO9 A;  3KSH A;  2VV8 A;  1OT9 A;  1TS0 A;  1VET B;  3TRC A;  5DJU A;  4MN5 A;  1E3U D;  2B18 A;  3S7N A;  1HTZ A;  1PI4 A;  1XJ4 A;  3DBA A;  1CI9 A;  2JC7 A;  2V0W A;  1ODV A;  4MEZ A;  3KSI A;  4MNR A;  4OPQ A;  3ZG5 A;  5TFQ A;  2UV0 E;  3CZD A;  3WS2 A;  2ZM8 A;  1SDN A;  2JKF A;  4DJ2 A;  3T4J A;  2XEP A;  1HZO A;  1NZO A;  3G4P A;  4WL9 A;  4P0M A;  5EOO A;  1LT0 A;  4PM6 A;  3W4P A;  5DTS A;  1RGZ A;  4U0T A;  4C6Y A;  1DP6 A;  5E2H A;  3ZVT A;  5FAT A;  3T1R A;  4I3A A;  3UDX A;  2R9W A;  4IED A;  1XJ6 A;  2H0T A;  4WLA A;  3OPR A;  5EVI B;  1FCO A;  1K54 A;  3S1Y A;  4Y7P A;  3UE6 A;  2W3E A;  4WF0 A;  5KZH A;  2Y55 A;  2GNX A;  4DE3 A;  3MQQ A;  4JF6 A;  1FR6 A;  4PHT A;  1SKO A;  1IEL A;  1LL5 A;  2M7U A;  2Q0O A;  4UA7 A;  1QME A;  3UPN A;  1XA1 A;  4KG2 A;  2ZM0 A;  5EPH A;  5HL6 A;  5CEB A;  4OQ0 A;  4BD1 A;  3CIT A;  1MWR A;  3A0S A;  1NJ4 A;  2X02 A;  4I3I A;  3EOI A;  2KLI A;  1E3U A;  4FSF A;  4WN5 A;  1K54 C;  2J9O A;  5AJG A;  3MXQ A;  4Y5F A;  2VK3 A;  4RA7 A;  3LO7 A;  1OTI A;  3BY9 A;  4F94 A;  2XH9 A;  2V8C A;  3N8S A;  5FI7 A;  5HD3 A;  1W79 A;  5HDS A;  1X0O A;  1ZKJ A;  5CX7 A;  3IH8 A;  1GHP A;  3DW0 A;  3V39 A;  3LI8 A;  2R78 A;  3P98 A;  5GLB A;  4S2O A;  4GS9 A;  2XSS A;  4NET A;  2Y2K A;  3ULF A;  1A0K A;  4WZ4 A;  4R3B A;  3L7H A;  3DWZ A;  3IS2 A;  3JVV A;  4IJG A;  3VP1 A;  3W2Z A;  5JYP A;  3PBS A;  1J3W A;  1VET A;  3NI9 A;  1G28 A;  5CER A;  4FUW A;  1KDW A;  3Q7V B;  2VA0 A;  4M3K A;  3MJQ A;  4DE1 A;  3IWI A;  4IUH A;  3QP2 A;  2K2N A;  4JGP A;  3SH9 A;  2O9C A;  4G3K A;  3D72 A;  1PYY A;  1EW0 A;  4X53 A;  3W8K A;  3TJZ C;  3PTE A;  3ZNY A;  2J8Y A;  4II7 A;  1D1J A;  4CJN A;  1IEM A;  2GZA A;  5HAR A;  5CXW A;  1IKG A;  4PKY A;  5JYO A;  4MBF A;  4B4X A;  1YSP A;  2VX8 A;  3M6B A;  4UQI S;  2J3T C;  1IYO A;  3NDG A;  4R3J A;  4EUZ A;  5GLC A;  1IKI A;  1OJG A;  1MKM A;  4H6J B;  5FDH A;  3CHW P;  3IWO A;  4I3J A;  3WRZ A;  3M6H A;  3Q7Z A;  1JWP A;  2QMI A;  1YQS A;  3JYI A;  3KSG A;  3UE1 A;  5TGF A;  2KOI A;  3Q81 A;  3C8C A;  1MXO A;  4P6B A;  4GOG A;  3A0R A;  3CJM A;  4FCF A;  3ITB A;  3BLM A;  2VEA A;  4X6T A;  1ESU A;  2QHK A;  3MQO A;  1CK3 A;  1VB6 A;  1IOU A;  2J80 A;  4EQ1 A;  1BTL A;  4ZJ3 A;  4KQD A;  2KX6 A;  3F1P B;  2WZX A;  3KYZ A;  4GNU A;  3C38 A;  3UME A;  3QHY A;  3NDE A;  3TE8 A;  4L9G A;  4OP8 A;  5IHV A;  3BFG A;  4DF6 A;  1TDG A;  5GHY A;  3EGX C;  4XT2 B;  1S0W A;  3G2Y A;  5DTK A;  5EVI C;  3UMD A;  4RX2 A;  1YMS A;  4IBX A;  2EFX A;  3A3I A;  3NUL A;  2JCH A;  4JPM A;  3W4Q A;  2BAS A;  3UB7 A;  3CPT B;  3LIA A;  1S1Y A;  1VEU B;  4WYY A;  3LR0 A;  1E4D A;  2OAQ 1;  2WKQ A;  2Y79 A;  3HUO A;  2G2U A;  1Q2Q A;  3BW6 A;  2NUT C;  1JWV A;  2XA7 M;  2XFS A;  5C5K A;  2VGL M;  1ERO A;  1GSV A;  2YKF A;  1JVJ A;  4HJ3 A;  5AQA A;  4MMN A;  3R7W A;  4GD8 A;  3SOI A;  5DF7 A;  3HLC A;  1YKD A;  1PZO A;  4XUX A;  4GKU A;  1PZP A;  2L4R A;  3LY4 A;  4Y0O A;  3N6I A;  5FDS A;  5KSC A;  3BEC A;  2P04 A;  2ZQA A;  3LR3 A;  4R0Q A;  3K3C A;  3VP0 A;  5F1F A;  2PAV P;  2WGV A;  4UHU A;  3LID A;  3GTC A;  2AVX A;  4GD6 A;  1V9Y A;  1WYC A;  2WKH A;  3NBL A;  2VLG A;  3UNW A;  2K31 A; 
#chains in the Genus database with same CATH homology
 3PBR A;  4KQO A;  2Y2O A;  2Z2L B;  4MLL A;  1G6A A;  1I2S A;  2H0Y A;  1Q2P A;  2P9V B;  1DJB A;  2J9P A;  4P85 A;  4ZTK A;  1BLP A;  1YMX A;  4X68 A;  4QHC A;  5KSH A;  4FH4 A;  1M6K A;  1N4O A;  1DJC A;  4OPZ A;  3AGF A;  4BJP A;  5FA7 A;  3C7U A;  1LLB A;  4IVI A;  4S2J A;  2ZM2 A;  3IF6 B;  3SH7 A;  2DRW A;  4Q8I A;  1KVM A;  5GHZ A;  5FI2 A;  3V3R A;  4E6X A;  2JE5 A;  1HVB A;  2ZC3 B;  3NY4 A;  1EI5 A;  3HLD A;  4OP5 A;  4EBL A;  1I2W A;  1TVF A;  4C3Q A;  4LV0 A;  3N8L A;  3ZG8 B;  3Q07 A;  1L2S A;  2FFY A;  2WGW A;  5DF9 A;  3UE3 A;  4JXW A;  1SKF A;  4OVD A;  4LEN A;  3ZCZ A;  1GHI A;  4BL2 A;  3I7J A;  5EVI D;  1N9B A;  1TDL A;  3OPL A;  4LV3 A;  3UO9 A;  3CG5 A;  4DKI A;  1NY0 A;  5F82 A;  3GMW A;  1K6S A;  1KGE A;  2ZQ9 A;  2R9X A;  1K25 A;  1BLS A;  4WEK A;  3RXW A;  4DRT A;  4KZ9 A;  4EQI A;  2P9V A;  1RP5 A;  2ZQ8 A;  1RCJ A;  1MPL A;  1I5Q A;  1DJA A;  1E3U D;  1HTZ A;  1PI4 A;  2ZC5 B;  4BEN A;  3PBO A;  1CI9 A;  2JC7 A;  4KZ3 A;  4QY5 A;  5FI6 A;  4PM9 A;  3M2K A;  4MEZ A;  2WYX A;  4MBK A;  4BD0 A;  2ZMA A;  4MNR A;  4PMA A;  1KE3 A;  5AQB A;  4OPQ A;  5EE8 A;  3ZG5 A;  5TFQ A;  3BM6 A;  1W5D A;  3CZD A;  3WS2 A;  3M2J A;  3MXR A;  2DCF A;  2WK0 A;  2ZM8 A;  1SDN A;  3LCE A;  5DVA A;  1KGF A;  4OOM A;  3GR2 A;  3VSL A;  2XEP A;  2XD1 A;  1HZO A;  4NK3 A;  4KQR A;  4GDB A;  1ES4 A;  1NZO A;  3BRM A;  3Q1F A;  1K56 A;  1YLJ A;  2WKE A;  1ESI A;  4OKP A;  2IWC A;  3UN7 A;  2XQZ A;  3G4P A;  3QNB A;  4X56 A;  4P0M A;  5EOO A;  3QNC A;  1BZA A;  1GA9 A;  2Y2G A;  4N1H A;  4PM6 A;  3WRT A;  1FSY A;  3W4P A;  5DTS A;  5CED A;  4BQM A;  1RGZ A;  3A3J A;  4PM7 A;  4B88 A;  4OLD A;  3IQA A;  4U0T A;  4JF5 A;  4RX3 A;  4DXC A;  4C6Y A;  5L2F A;  2WUQ A;  3V50 A;  2BG1 A;  5FQI A;  5E2H A;  4DDY A;  3OCN A;  1YM1 A;  3ZVT A;  4GZB A;  5FAT A;  3RJU A;  3C4O A;  2UWX A;  1FOF A;  4LCL A;  4QY6 A;  3WS5 A;  3UDX A;  2R9W A;  4IED A;  3IXB A;  4OQI A;  2H0T A;  1QMF A;  3ZGA B;  4WM9 A;  3MXS A;  2A3U A;  3AGD A;  3O3V A;  2IWD A;  1SHV A;  2WKI A;  3FKV A;  3OPR A;  5CHJ A;  3G32 A;  1FCO A;  5EVI B;  1NZU A;  2EX6 A;  5E2F A;  1K54 A;  2ZD8 A;  3TG9 A;  4K91 A;  5EEC A;  5DTT A;  5F1G A;  4BLM A;  3S1Y A;  3N7W A;  4Y7P A;  3WS1 A;  4DE2 A;  3HLG A;  4U0X A;  2EXB A;  4P87 A;  5HAQ A;  4RYE A;  2EX9 A;  4PM5 A;  4N1X A;  4CPK A;  2Y2Q A;  4HES A;  5KZH A;  4WMC A;  2Y55 A;  3UPO A;  5FAP A;  3OC2 A;  2C6W B;  4GB7 A;  1LI9 A;  5GHX A;  4DE3 A;  4DXB A;  4JF6 A;  4YFM A;  1FR6 A;  3ITA A;  1U60 A;  4JXG A;  1L0F A;  1ONG A;  4K0W A;  1IEL A;  4R23 A;  4KZ8 A;  2ZQ7 A;  5HL1 A;  1LL5 A;  3HUM A;  4E3N A;  4EV4 A;  1SCW A;  4UA7 A;  3IH9 A;  1FCN A;  1QME A;  4OPY A;  1BUL A;  3O86 A;  5GLD A;  3UPN A;  3VFF A;  1XA1 A;  1XGJ A;  4KG2 A;  4EWF A;  4ZAM A;  2ZM0 A;  5KMW A;  5E2G A;  2WGI A;  4S2K A;  4QJG A;  5EPH A;  3E2K A;  5A91 A;  2H10 A;  5A92 A;  3GVB A;  5CRF A;  2V1Z A;  5EVI A;  1BLH A;  3UDF A;  5M18 A;  3MZE A;  1YLZ A;  5CEB A;  1ES3 A;  4OQ0 A;  4YIN A;  4BD1 A;  4ZDX A;  1MWR A;  4KG5 A;  3HLF A;  1NJ4 A;  1CEG A;  1PWG A;  2C5W B;  2Y2P A;  4L0L A;  1MWS A;  3SS5 A;  2X02 A;  4C75 A;  3MZD A;  2EFU A;  3BFC A;  3CMZ A;  1E3U A;  1PWD A;  3GV9 A;  1NYM A;  1FCM A;  2G2W A;  2XFT A;  5FQK A;  3MBZ A;  5BOH A;  4FSF A;  1YLT A;  1L0G A;  5G18 A;  3GRJ A;  1K54 C;  4JXV A;  2J9O A;  2OLV A;  4U3T A;  4JXS A;  1CI8 A;  2WAE A;  3ZVW A;  4K0X A;  2B5R A;  3OZH A;  4EBP A;  4R4R A;  3UY6 A;  4RA7 A;  2XR0 A;  3LO7 A;  1Y54 A;  2HP6 A;  4F94 A;  2XF3 A;  3HL9 A;  2XH9 A;  3ZG7 B;  2HDR A;  3N8S A;  4E3M A;  3BLS A;  4R1G A;  5FI7 A;  4KZB A;  1XGI A;  3MKE A;  4Z9Q A;  1XKZ A;  5CGS A;  3C5A A;  1W79 A;  2Z2M B;  3VP3 A;  1ZKJ A;  2E8I A;  3IH8 A;  2Y2H A;  1GHP A;  3E2L A;  5J8X A;  5CHM A;  3MZF A;  3DW0 A;  3IF6 A;  1ES2 A;  3BFD A;  4DE0 A;  2ZC6 B;  1W7F A;  1KVL A;  3UPP A;  3V39 A;  3FWL A;  1NYY A;  3P98 A;  3HVF A;  2CC1 A;  5GLB A;  4X69 A;  4WZ5 A;  4S2O A;  1ALQ A;  3HLB A;  3A3D A;  4OOY A;  1GA0 A;  3UDI A;  4EBN A;  2ZLY A;  4NET A;  2Y2K A;  3OPP A;  4WZ4 A;  2Y2N A;  2VGK A;  4R3B A;  3DWZ A;  1PW8 A;  3P09 A;  5AQ9 A;  1KDS A;  4JLF A;  3MKF A;  1FSW A;  3VP1 A;  3FZC A;  1JTD A;  3V5M A;  4GN2 A;  5JYP A;  1MWU A;  3S22 A;  3PBS A;  4UA9 A;  5CHU A;  2PBY A;  3G2Z A;  3V3S A;  4D2O A;  3NI9 A;  3N8R A;  5F83 A;  5CER A;  2RCX A;  3IXH A;  2Y59 A;  1KDW A;  2ZJ9 A;  3Q7V B;  4M3K A;  4WEJ A;  4MBH A;  1GCE A;  4DE1 A;  3IWI A;  3DWK A;  3GQZ A;  4KQQ A;  3C7V A;  2IWB A;  1EWZ A;  2HDS A;  5FAS A;  1VM1 A;  5E43 A;  5CEC A;  5FQM A;  3SH9 A;  2HPB A;  2ZC4 B;  1XXM A;  1ZG4 A;  1PYY A;  1AXB A;  1YLW A;  2OSU A;  2XDM A;  3PAE A;  4X53 A;  1LHY A;  2Q9N A;  5CTN A;  2HP5 A;  4N92 A;  3W8K A;  5FQJ A;  3PAG A;  1MKI A;  3IF5 A;  3PTE A;  4E3O A;  4UAA A;  3MFD A;  4XXR A;  3ZNY A;  3B3X A;  2J8Y A;  5FQQ A;  3VOZ A;  4OQH A;  5A93 A;  4N9K A;  1K6R A;  1ZG6 A;  3AGE A;  1IYS A;  1MWT A;  3IF6 C;  1IEM A;  4CJN A;  4ZBE A;  5HAR A;  1FR1 A;  1K56 D;  3A3F A;  4OH0 A;  1KGG A;  5CXW A;  1IKG A;  5JYO A;  4RVA A;  4Y0T A;  3O88 A;  2WZZ A;  4MBF A;  4WEL A;  1DY6 A;  3BEB A;  4WZ5 C;  5EOE A;  4B4X A;  4QD4 A;  1NRF A;  1NXY A;  3M6B A;  3Q7V A;  1YLY A;  4N9L A;  1KE4 A;  3Q82 A;  4R4S A;  1WYB A;  2Y2L A;  1IYO A;  2QZ6 A;  1H8Z A;  1L0D A;  1K4F A;  3PBN A;  3VMA A;  3NDG A;  4R3J A;  3ZNT A;  3ZG9 B;  4EUZ A;  5GLC A;  1IKI A;  1PW1 A;  3HRE A;  4KZA A;  4E3J A;  4QU3 A;  5DF8 A;  3A3E A;  3G35 A;  5FDH A;  3EQU A;  3IWQ A;  3FV7 A;  3VP2 A;  3IWO A;  2XLN A;  3WRZ A;  3M6H A;  5HX9 A;  3G34 A;  3Q7Z A;  2VGJ A;  3SS3 A;  1JWP A;  4XUZ A;  2QMI A;  1YQS A;  3JYI A;  1K55 A;  2Q9M A;  4HBU A;  1BUE A;  3UE1 A;  3RXX A;  2ZQD A;  1LL9 A;  4OLG A;  4KZ5 A;  2J7V A;  3NC8 A;  5TGF A;  2JBF A;  3VSK A;  1MY8 A;  1KE0 A;  3ZG0 A;  3Q81 A;  2BLS A;  3IHA A;  3TOI A;  5U47 A;  1MXO A;  1Z6F A;  4P6B A;  1BSG A;  2XD5 A;  3FKW A;  2H5S A;  4GOG A;  4WMC D;  3BYD A;  3CJM A;  1BT5 A;  3HLE A;  4LV2 A;  4IBR A;  4E3I A;  5CGX A;  4FCF A;  3ITB A;  4OQG A;  4ZJ1 A;  3SH8 A;  3BLM A;  4X6T A;  5FAO A;  1ES5 A;  1CEF A;  1ESU A;  3NIA A;  5HAP A;  5CTM A;  2P74 A;  1CK3 A;  3VFH A;  5D3O A;  1RGY A;  5GL9 A;  5HFO A;  2RL3 A;  2WAD A;  2V2F F;  3ZFZ A;  2HP9 A;  1BTL A;  2XGN A;  4ZJ3 A;  3D4F A;  4S2M A;  4DDS A;  3S4X A;  2WZX A;  4GNU A;  2Y2M A;  1PI5 A;  3QHY A;  3NDE A;  1M40 A;  4E3K A;  2OLU A;  5FQ9 A;  3WS4 A;  1J9M A;  3PBT A;  4GDN A;  4OP8 A;  5E2E A;  4LV1 A;  1G68 A;  5IHV A;  1SDE A;  5HAI A;  3BFG A;  4DF6 A;  5GLA A;  2GDN A;  4FH2 A;  4S2I A;  1TDG A;  5GHY A;  1IYQ A;  1JTG A;  1S0W A;  3G2Y A;  4KEN B;  5DTK A;  5EVI C;  1FQG A;  3WS0 A;  4RX2 A;  3W4O A;  1O7E A;  1YMS A;  4IBX A;  3ZHH A;  3DTM A;  2X01 A;  3C4P A;  4Y0U A;  2EFX A;  1K57 A;  2XK1 A;  3A3I A;  1K55 C;  4S2N A;  3HLW A;  1LI0 A;  2JCH A;  2PU2 A;  4JPM A;  3GSG A;  4WBG A;  4ZJ2 A;  2EX8 A;  3W4Q A;  5M19 A;  1XPB A;  2X71 A;  2QPN A;  2A49 A;  2EX2 A;  3HUN A;  1W8Y A;  1K38 A;  5M1A A;  1C3B A;  2V20 A;  2Y2I A;  1XX2 A;  2OV5 A;  3G31 A;  4WYY A;  1E4D A;  1MBL A;  4A5R A;  4OOL A;  3HUO A;  4KZ6 A;  1K4E A;  2Y2J A;  1ZC2 A;  3PBQ A;  2G2U A;  2EXA A;  4S2P A;  3ISG A;  2Y91 A;  3SS4 A;  1Q2Q A;  5EVL A;  4O7D A;  2XFS A;  1JWV A;  2Y4A A;  1GHM A;  3HBR A;  4BL3 A;  1ERQ A;  1ERO A;  4LCM A;  1JVJ A;  4KZ7 A;  2PU4 A;  3N4I A;  3O87 A;  4IVK A;  5AQA A;  1IYP A;  3TSG A;  4S2L A;  3BFE A;  3WWX A;  3IXG A;  4B4Z A;  2ZC7 A;  4ID4 A;  5A90 A;  4PPR A;  3UE0 A;  3VP4 A;  4GD8 A;  1ERM A;  2FFF B;  3SOI A;  2HDQ A;  3IXD A;  5DF7 A;  5FSR A;  3HLC A;  1XP4 A;  1XA7 A;  3OCL A;  2DNS A;  4UA6 A;  4OON A;  1PZO A;  4XUX A;  1H8Y A;  4X55 A;  1PIO A;  4JKT A;  1WE4 A;  4JBF A;  4HEF A;  4KG6 A;  5CGW A;  2I72 A;  1ONH A;  1L0E A;  4GKU A;  1PZP A;  5I94 A;  5HW3 A;  4E6W A;  3LY4 A;  3LEZ A;  3BFF A;  5FAQ A;  1TEM A;  4Y0O A;  1H5X A;  3N6I A;  5KSC A;  1W8Q A;  1OME A;  3BEC A;  1O07 A;  3OPH A;  2ZQA A;  4R0Q A;  5TR7 A;  1K57 C;  1PWC A;  4S2N C;  5AQ7 A;  3VP0 A;  5F1F A;  2WGV A;  4QB8 A;  1E25 A;  3FYZ A;  3NCK A;  4UHU A;  4JF4 A;  3G30 A;  1YLP A;  3GTC A;  1HD8 A;  2ZQC A;  1S6R A;  4GD6 A;  5EUA A;  2WAF A;  3VOY A;  1JWZ A;  1WYC A;  2WKH A;  3LY3 A;  3NBL A;  4FD8 A;  2WGW B;  3EQV A;  4PM8 A;  1BLC A;  4E3L A;  3UNW A;  3IT9 A;  1YT4 A;  2HDU A;  4H8R A;  4HBT A;  3IHB A;  4KZ4 A;  3ZDJ A;  4OPR A;  1VQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...