5EVIC

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
356
structure length
350
Chain Sequence
AALDTLVQTEARKVMQENNITGLSIAITRHGQQFYNYGVASATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFKAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDKQTLYAQGYNTLDEPVRVNPGILAAEAYGVSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVKLAYRILQHAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 101
structure length 350
sequence length 356
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviC00
4JF5A 4DE2A 3S4XA 2HP5A 4JF6A 4E6WA 3Q7VA 1QMFA 4S2LA 4OQHA 5JYOA 3IXBA 3IQAA 1MPLA 4OLDA 1YLYA 4MLLA 3FWLA 4RA7A 1SDEA 3MKEA 1NJ4A 2BG1A 3ZDJA 1W8QA 1YLJA 2Y4AA 1JTDA 5AQAA 3Q1FA 3OPPA 1NRFA 3AGDA 1ALQA 4OKPA 4JXVA 4BQMA 3E2KA 3IH8A 4X68A 4ZJ2A 3BFCA 2EX9A 3A3JA 3MFDA 3GV9A 1LLBA 4S2NA 3OPHA 4LV2A 2ZM2A 4DE1A 5KSCA 3WWXA 3Q81A 3GQZA 2EX6A 3DTMA 3GMWA 4R23A 1ERQA 3PBOA 3A3DA 3QNCA 4RYEA 2FFFB 5DTKA 5GLAA 1GA0A 1S0WA 5CTMA 3WS4A 3PAEA 1O7EA 3ZG7B 3IXHA 1BLCA 5EPHA 3O3VA 4EBLA 4EUZA 2H0YA 2Y59A 4IBRA 3NY4A 1YM1A 2EXAA 3HBRA 4DXCA 1K57A 4OOMA 4XUZA 2HDQA 2WAFA 2XEPA 4BD1A 3NDGA 1ZG6A 1LL9A 4DRTA 3BFGA 4Z9QA 3AGFA 5F82A 3BLMA 4WBGA 1DJBA 1LI9A 3ZVTA 2QPNA 4P85A 1PW8A 1IYPA 5FI6A 1CI9A 1TVFA 3HUMA 2OLUA 3ZG9B 5CGWA 1ES4A 4QY6A 1ES5A 2OSUA 4OVDA 2H10A 4S2IA 5E2EA 2ZQCA 4K91A 1I2SA 4R4RA 4LCLA 3HUNA 1WYCA 3SS5A 1L0EA 1K54C 4NK3A 2DCFA 2Y2KA 4PM8A 3W4OA 1FQGA 1ERMA 3UDXA 4KQRA 2E8IA 3SS4A 5CGSA 1BLSA 2IWDA 5HL1A 4GD6A 3G35A 4KZ7A 3HVFA 2XR0A 1MWSA 3FZCA 4D2OA 1VQQA 4WEKA 1K56A 2H5SA 3CZDA 3HUOA 3NC8A 3VFHA 2XDMA 1YMXA 3UDFA 2PU4A 4S2MA 3BFDA 4WEJA 2Y2GA 3A3IA 4JKTA 4HEFA 1E4DA 5BOHA 4KQOA 4ZDXA 2Y2PA 1K6RA 5EECA 1CK3A 4OP8A 1VM1A 2ZQAA 4FD8A 4P87A 3O87A 1KDSA 2Y91A 3LCEA 1KE3A 4KZ5A 1MWRA 3PBSA 2JCHA 1FCMA 3IXDA 4PM7A 1YLWA 4LV0A 3IWQA 2X71A 5EVIA 4PPRA 5EVID 5FDHA 2XFSA 1YLZA 4Y0OA 2ZM8A 3FV7A 2OV5A 3TSGA 2ZLYA 3N6IA 1KE0A 4QU3A 3MXRA 4DXBA 4HESA 1K4EA 1HZOA 2VGJA 3IF5A 1KVLA 1PI5A 4S2KA 4Y7PA 5EUAA 4E3KA 5JYPA 5DTTA 3B3XA 4E6XA 5E2GA 1IKIA 5I94A 1M40A 4BLMA 1ZC2A 1XA7A 3D4FA 4R0QA 2OLVA 3G34A 5E2FA 3CMZA 3IF6B 4KZBA 4FCFA 4S2NC 3W8KA 1K55A 4MBKA 3IXGA 4IEDA 5DF7A 3WS1A 4GZBA 4IVIA 5A90A 4XUXA 5FI7A 3PBNA 1FCOA 3G30A 1WE4A 1KE4A 2P74A 1ONGA 3O86A 3VP1A 4B4XA 1DJCA 4MBHA 5DTSA 2HPBA 2V2FF 2IWCA 5GLBA 2UWXA 3QNBA 3C4PA 3SS3A 2A3UA 3NBLA 4GOGA 2PU2A 1W79A 3HLWA 2WADA 2ZQ8A 2CC1A 4EWFA 1FSWA 1EROA 2HDUA 5KMWA 5KSHA 4FH2A 3IWIA 5M1AA 3VFFA 1K57C 1LHYA 5DF9A 4K0WA 1K25A 4X53A 3P98A 4RX2A 1LI0A 4WELA 1BLHA 2HP6A 1IYQA 4OPYA 1H8ZA 3HREA 4DF6A 2WGIA 2WGWB 4C3QA 1ESIA 2C5WB 3JYIA 5AQ9A 2Y2NA 3VP4A 4JF4A 1ZKJA 2XFTA 1MXOA 2I72A 1OMEA 1H5XA 1PZPA 2JE5A 2ZC7A 5GL9A 4KQQA 4B4ZA 3N8LA 2XK1A 2WZXA 2ZQ7A 4R3BA 3SH9A 1N9BA 3MXSA 4WZ4A 3FKWA 5U47A 2WGVA 2WUQA 3TOIA 4CPKA 5CHMA 4CJNA 3G2YA 3NDEA 2G2UA 3DW0A 4NETA 4E3JA 1TEMA 3A3FA 1IYSA 5CERA 4Y0TA 4EBPA 1NZOA 3OC2A 4O7DA 4HBTA 1E3UA 3ZFZA 1G6AA 1W5DA 3QHYA 3BECA 4E3MA 1ES3A 1MWTA 2EFXA 1CEFA 3RXWA 1NY0A 1XA1A 3PBQA 3UPNA 3ZVWA 3BM6A 3G31A 2FFYA 4N1XA 4DDSA 5FATA 3CG5A 2WYXA 3M6BA 3HLBA 3SH8A 1PYYA 3A3EA 5A92A 3MZEA 2J8YA 1NXYA 3UO9A 4GKUA 3UN7A 3IHAA 2WAEA 4ID4A 3UE0A 4BENA 5GLDA 4WYYA 1FR6A 1PWCA 1Q2PA 4GB7A 3HLGA 1E25A 4KZ3A 5FA7A 5FQIA 4GDBA 3G2ZA 5FQJA 4FSFA 4S2JA 3EQVA 3M2JA 2ZJ9A 4OP5A 3S22A 3S1YA 1K56D 4KG2A 2H0TA 2EFUA 3UY6A 2Y2LA 4S2PA 3RXXA 2P9VB 3WS2A 2Y2JA 3MZDA 3C5AA 5DVAA 5EVIC 4BL3A 5M19A 1YLTA 4JBFA 4KENB 5E2HA 2ZQDA 2RCXA 2XD1A 1GCEA 1L0FA 4BL2A 2XD5A 4UA6A 5F1FA 5CRFA 5HAPA 1W7FA 4KZAA 3AGEA 5HAIA 4C6YA 1K6SA 4K0XA 2V1ZA 1C3BA 4FH4A 1G68A 1XGIA 5KZHA 4L0LA 5CEBA 4JLFA 1FR1A 1KDWA 2RL3A 1JWZA 3PBRA 4WZ5A 5FQQA 3WRTA 4KZ6A 1K4FA 1AXBA 2EXBA 4OQIA 4OOLA 4MBFA 5GHYA 4GNUA 5AQBA 3UPPA 4OH0A 4EBNA 1K55C 3G4PA 5EVIB 4U0XA 1L2SA 3C7UA 3PAGA 3ZG8B 1WYBA 4DE0A 3V5MA 1PWGA 3LY3A 1MBLA 4A5RA 5E43A 2R9XA 3OPLA 1GA9A 3EQUA 1Q2QA 3VOZA 5CXWA 1BZAA 2EX8A 4KZ4A 4RVAA 1PW1A 4QD4A 3IT9A 1YQSA 1RP5A 4XXRA 2IWBA 2X01A 4F94A 4X69A 3I7JA 1HD8A 1NYMA 1BULA 1GHIA 1RGZA 1BSGA 1CEGA 2DNSA 3OCLA 5DF8A 4EQIA 3MBZA 5EOOA 1S6RA 4QJGA 3OCNA 4JPMA 3Q7VB 4DDYA 4X55A 1IEMA 3LY4A 2V20A 5TR7A 3WRZA 1IKGA 5GHXA 1ONHA 5CTNA 1PIOA 2QMIA 3SH7A 1PI4A 1N4OA 4N92A 1O07A 1HVBA 3VSLA 1EI5A 4JXWA 5FQMA 3VMAA 4PMAA 4U0TA 2WKHA 5CGXA 3V39A 5FASA 3UDIA 4JXGA 2WKEA 3IF6A 3ZHHA 3WS5A 2WK0A 2J7VA 4E3NA 2JC7A 4UA9A 1GHPA 5FAQA 5TFQA 3BEBA 1L0GA 3P09A 1PZOA 3ITBA 3Q82A 3V3RA 5EOEA 4U3TA 1XKZA 4DKIA 4JXSA 3N8RA 4E3LA 5GHZA 1EWZA 3TG9A 1JWPA 4N9KA 1M6KA 4OPZA 3PBTA 4LENA 3ZGAB 2X02A 3HLCA 3E2LA 4IBXA 5EVLA 1BUEA 4OLGA 1U60A 3HLDA 3VP3A 1YLPA 2Z2LB 1HTZA 5TGFA 2ZC3B 2XH9A 4RX3A 3GSGA 1SKFA 3Q7ZA 4S2OA 1KGEA 1NZUA 5FQKA 1FCNA 2Y2QA 4LCMA 1XXMA 2XGNA 3M6HA 3ZNTA 4OONA 1PWDA 4OPRA 1TDGA 5HX9A 1ES2A 1SDNA 2ZM0A 3VSKA 2ZMAA 4H8RA 2WGWA 4Y0UA 3OZHA 4PM6A 5AQ7A 5M18A 3ZCZA 4OQGA 5CHUA 3VP0A 3ZG5A 5CECA 3PTEA 1XGJA 1E3UD 3N7WA 3NIAA 1LL5A 2PBYA 2ZC6B 5CHJA 2ZD8A 3DWZA 3NCKA 4PM9A 5L2FA 4QB8A 3CJMA 1XPBA 3IWOA 1MWUA 5D3OA 3ISGA 4B88A 3V50A 1XP4A 3N8SA 3MZFA 2HDSA 4DE3A 3C4OA 1DJAA 4ZBEA 5G18A 3V3SA 1JTGA 1I2WA 1FOFA 1H8YA 3LEZA 1KGFA 2XLNA 2QZ6A 4ZTKA 4N1HA 4IVKA 4GN2A 4OQ0A 3ITAA 4X56A 3G32A 2Q9MA 4KG6A 5A93A 3IHBA 5CEDA 4UAAA 4KZ8A 4OOYA 5EE8A 4HBUA 2HP9A 2J9OA 2ZC4B 1BLPA 1J9MA 1RCJA 4ZAMA 5FAPA 4E3OA 1K38A 5HW3A 2Y2OA 5FSRA 1I5QA 4ZJ1A 4UHUA 1Y54A 4QY5A 4KG5A 4WZ5C 5J8XA 3GVBA 2DRWA 3DWKA 1IELA 4UA7A 3BLSA 4X6TA 4YINA 3W4PA 3IH9A 2XF3A 1JWVA 5IHVA 4WM9A 3Q07A 3SOIA 5A91A 1YMSA 4R3JA 1GHMA 3LO7A 3FKVA 1YT4A 2JBFA 3UNWA 2Y2IA 2BLSA 5HFOA 3GR2A 3ZNYA 2EX2A 2Y2MA 5HAQA 4PM5A 2R9WA 2G2WA 1XX2A 2P9VA 3GTCA 3OPRA 2Y2HA 3VOYA 3BYDA 2ZQ9A 1IYOA 3NI9A 1KGGA 4BD0A 5FI2A 1QMEA 2Y55A 1BT5A 3N4IA 4P6BA 1K54A 4N9LA 2GDNA 3MKFA 1L0DA 3VP2A 5HARA 2VGKA 3ZG0A 4C75A 2B5RA 3BFFA 3BRMA 4OPQA 1Z6FA 2Q9NA 4GD8A 4YFMA 3UPOA 4R4SA 2ZC5B 3HL9A 4LV1A 5FQ9A 5GLCA 3UE1A 1MY8A 1W8YA 1NYYA 1ZG4A 4WMCA 1BTLA 4WMCD 2J9PA 3HLEA 2XQZA 3IF6C 4EV4A 1TDLA 3M2KA 4P0MA 4BJPA 3C7VA 4M3KA 3WS0A 1SHVA 3O88A 4QHCA 3W4QA 2WZZA 5F83A 1DY6A 5FAOA 3BFEA 4MNRA 1SCWA 4MEZA 4LV3A 2Z2MB 3GRJA 1ESUA 3UE3A 2A49A 1RGYA 1JVJA 3FYZA 4GDNA 2C6WB 3HLFA 4E3IA 3RJUA 1FSYA 5F1GA 4Q8IA 2WKIA 4R1GA 2HDRA 1MKIA 4ZJ3A 1CI8A 4KZ9A 1KVMA
chains in the Genus database with same CATH superfamily
4I39A 3S4XA 2HP5A 2P08A 5JYOA 4B93A 1YLYA 4RA7A 1SDEA 1NJ4A 3GDIA 3ZDJA 1NRFA 5AVEA 1IFQA 2INWA 4BQMA 2EX9A 2QKPA 3KYZA 2PR5A 3WWXA 3CHWP 4HJ4A 4R23A 5DTKA 2FFFB 1GA0A 2XROA 4EBLA 3LR0A 1YM1A 3HBRA 4BD1A 2A24B 4LRXC 4DRTA 4Z9QA 2L4RA 2QPNA 2WKQA 1T1BA 2PRFA 1IYPA 1NLZA 1SKOA 3HUMA 3EEHA 2OSUA 4G3KA 4OVDA 4WF0A 1WYCA 1PRQA 1L0EA 4NK3A 3W4OA 3UDXA 2E8IA 1BLSA 2IWDA 1VQQA 2OWHA 3VFHA 3MXQA 1YMXA 5DJTA 3NOUC 4WEJA 5F6AA 2Y2PA 1CK3A 3V67A 1LL8A 3O87A 1KDSA 2Y91A 2JKFA 4LV0A 3JVVA 4ZRRA 2OV5A 3KO6A 3BY9A 4QU3A 3MXRA 4DXBA 1K4EA 4E3KA 1DP8A 4Y13A 2OOLA 1D06A 1M40A 1XA7A 3G34A 2W3GA 1K55A 4IEDA 5DF7A 1PFLA 1FCOA 2O0YA 2P74A 3VP1A 2V2FF 2UWXA 3C4PA 5EVEA 1MKMA 5KSHA 1K57C 4K0WA 1K25A 1X0OA 2IA2A 1ESIA 3VP4A 5DKKA 1OMEA 1H5XA 3NULA 1OJGA 1OTIA 4IHQA 2ZQ7A 1GSVA 1EW0A 5U47A 3ZYTA 3TOIA 3CWFA 4NETA 4ETZA 1IYSA 5CERA 4Y0TA 1OT6A 3BECA 1ES3A 1MWTA 3RXWA 1WA9A 2FFYA 4N1XA 4DDSA 2A24A 3CG5A 3E0YA 3PXPA 2HZ5A 4GKUA 3IHAA 4ID4A 4BENA 4HP4A 4KZ3A 5FQJA 4GDBA 3G2ZA 3EQVA 3S22A 1Y4OA 2OWJA 3EWKA 3UY6A 3LI8A 4S2PA 3JVUA 1DRMA 2Y2JA 5EVIC 3EEAA 2RCXA 1L0FA 4BL2A 1W7FA 4C6YA 4K0XA 2ZMFA 1G68A 1XGIA 2FZ0A 1FR1A 2BASA 1N9OA 4R38A 5FQQA 4WLAA 4KZ6A 1K4FA 2E8JA 3G4PA 4Y17A 1L2SA 3C7UA 3HCYA 3PAGA 3ZG8B 4QWOA 1PWGA 4LRYC 5E43A 1DP9A 1SZVA 2ZBBA 4GW9A 3QP4A 2EX8A 4RVAA 4QD4A 3IT9A 4O01A 3I7JA 1HD8A 1GHIA 1RGZA 5DF8A 5GHXA 2QMIA 2AVXA 5DKLA 1ZTUA 3F1OB 3VSLA 2QJ7A 4N92A 4U0TA 2WKHA 3Q82A 3V3RA 4U3TA 1XKZA 4KUKA 5GHZA 1EWZA 1JWPA 1M6KA 2QWSA 2L0WA 2QHKA 3E2LA 5EVLA 3HLDA 1YLPA 5FDSA 5FQKA 2PD8A 1XXMA 5HX9A 4H8RA 4Y0UA 1FILA 3OZHA 4I3JA 1BYWA 2K2NA 5CHUA 3PTEA 1E3UD 3NIAA 4E04A 3MFXA 4GLQA 1XPBA 4R6LA 1XP4A 3N8SA 4DE3A 4ZBEA 2YKFA 3LEZA 1I2WA 1FOFA 4ZTKA 2QZ6A 4N1HA 3MSHA 3ITAA 3P01A 5A93A 4HJ6A 5IT5A 2PYRA 2ZL1B 3BJNA 2Y2OA 1I5QA 1Y54A 4KG5A 5J8XA 2NUPC 5G4YA 1S4SA 3IH9A 1F98A 2G7UA 2JBFA 2PR6A 3UNWA 5HFOA 3ZNYA 3T1XA 2V1BA 3SW1A 3OPRA 3VOYA 2ZQ9A 3P7NA 1L3LA 4X1MA 5FI2A 1K54A 2GDNA 2VGLS 5HARA 3T1SA 3BRMA 2JHEA 1NWZA 4R4SA 2ZC5B 4WMCA 3M2KA 3T4JA 3O88A 5F83A 4MEZA 3H7WA 2A49A 1JVJA 2C6WB 1LSVA 2KX6A 4MMNA 4ARZA 1KVMA 4JF5A 4E6WA 4YWZA 4NEED 3CUEA 4OQHA 1H3QA 4OLDA 4MLLA 3F1OA 3QP5A 1W8QA 2Y4AA 1JTDA 3OPPA 5K5BA 4CLCC 3E2KA 4ZJ2A 3GV9A 4S2NA 2ZM2A 4DE1A 1ERQA 3PBOA 4RYEA 3QNCA 5GLAA 1S0WA 5CTMA 3WS4A 1O7EA 3IXHA 4ETXA 4Q0JA 5EPHA 3O3VA 4EUZA 4IBRA 2B02A 2O9AA 2XEPA 3BFGA 1F5MA 3DTKA 3ULFA 3G6OA 4UQIS 2XA7S 5TBMB 3FC7A 1TVFA 2OLUA 3ZG9B 4QY6A 1ES5A 1I2SA 3SS5A 2ZL1A 4PM8A 5HL1A 4GD6A 3HVFA 1MWSA 4WEKA 4BBUA 2H5SA 3HUOA 4EEUA 3LR5A 1DP6A 2PU4A 4BMWA 5IU1A 4KQOA 5EECA 2L1MA 3DTIA 4OP8A 2ZQAA 4FD8A 5F68A 2XRNA 3S7PA 2JCHA 4PPRA 5EVID 5FDHA 2XFSA 2PDRA 4EERA 3FV7A 4HOIA 4H6JA 3W2ZA 2JKRM 4Y7PA 2I9VA 1KVLA 1PI5A 4S2KA 4BBVA 5DTTA 1YPRA 3B3XA 4K08A 5L10A 4NKPA 2OLVA 3CMZA 3IF6B 4KZBA 4XT2B 2V8CA 4Q0HA 3IXGA 4HNBA 4IVIA 1P97A 3PBNA 1FIKA 1WE4A 1KE4A 3O86A 1ONGA 5HDDA 4MBHA 2HPBA 2IWCA 2V8FA 2VV8A 2FH5A 3RTYA 3HLWA 2NUTC 2WADA 2CC1A 1A0KA 1Z09A 2HDUA 3LIEA 4ME4A 5M1AA 2PHYA 5DF9A 3P98A 4RX2A 3KSGA 4WELA 1IYQA 4OPYA 3LIFA 3HREA 2WGWB 3JYIA 4WL9A 4JF4A 2R78A 5FL3A 1MXOA 2HGVA 4B4ZA 1TS8A 4KQQA 3N8LA 5L8MA 4R3BA 4EEPA 2WUQA 3LYXA 4CJNA 3G2YA 1VHMA 2G2UA 3UMEA 4E3JA 2K7SA 4DMZA 3OC2A 4O7DA 1E3UA 1W5DA 4E3MA 3BM6A 3LIBA 4DN0A 1XJ4A 2WYXA 1PYYA 4EXOA 2J8YA 3UO9A 3UN7A 3OLOA 5HWTA 3UE0A 2H28A 1PWCA 4GB7A 1E25A 5FA7A 5TBMA 1MC0A 2ZJ9A 4EW7A 2XSSA 5HPIA 2JN7A 1K56D 2H0TA 2Y2LA 3QP1A 1ACFA 2P9VB 2CMNA 4FOFA 4KENB 2ZQDA 1GCEA 5F1FA 4UA6A 4CLCE 4MN5A 5CRFA 3AGEA 2V1ZA 1TF1A 4FH4A 5KZHA 5CEBA 3QP6A 4JLFA 3WRTA 2W3EA 4OQIA 5HDSA 4GNUA 3UPPA 4OH0A 1K55C 5EVIB 2JKGA 4DE0A 1F2KA 1S1YA 4L9GA 4A5RA 1Q2QA 3VOZA 5CXWA 2ZOHA 1CJFA 4HHDA 1TS0A 4XXRA 2VV7A 1BSGA 2DNSA 4EESA 3OCNA 4I3IA 3Q7VB 4X55A 3WRZA 3T1QB 4NXFA 1IKGA 1ONHA 5HZHA 1PIOA 1IOUA 3SH7A 4UEYA 1N4OA 4BWIA 1HVBA 1S4RA 1EI5A 1TD5A 5FQMA 4PAUA 2VEAA 2W1TA 4KUOA 3PHYA 2WKEA 3IF6A 3T12B 3WS5A 4XT2A 2WK0A 2J7VA 3P09A 5EOEA 4JXSA 1LT0A 4E3LA 3TG9A 3ZGAB 2Z6CA 3HLCA 2VA0A 3VP3A 2Z2LB 1HTZA 4RX3A 4HH3A 1NZUA 2Y2QA 4LCMA 3IX8A 3M6HA 2QJ5A 4OONA 1PWDA 4Q0IA 1ES2A 3VSKA 2WGWA 5AQ7A 5M18A 4OQGA 5CECA 3VP0A 3T4OA 2J80A 3N7WA 2PBYA 2ZC6B 5CHJA 3DWZA 3IWOA 3LEQA 2P7JA 4P6ZM 2HDSA 2K31A 3PR6A 3EOIA 1KGFA 4GN2A 4X56A 2O99A 4KZ8A 4OOYA 5MC7A 2HJEA 4JGQA 2W3FA 2ZC4B 4ZAMA 1J9MA 1RCJA 4X1LA 5HWVA 3TRCA 5FSRA 4I3AA 4QY5A 3HJIA 3H82B 4X6TA 3W4PA 5IHVA 1N9LA 3Q07A 5A91A 4R3JA 3FKVA 1YT4A 5HD5A 2BLSA 4MN7A 3E4PA 3MQQA 4HY8A 3VE4A 2JKRI 5F5YA 3DAVA 4PM5A 2WKRA 2P9VA 1V9ZA 1KGGA 1QMEA 2Y55A 4P6BA 1L0DA 4C75A 3L9KA 4LV1A 5FQ9A 3UE1A 1NYYA 3MS6A 1BTLA 3MJQA 4EV4A 1TDLA 4P0MA 4DJ3A 2KOIA 4BJPA 4M3KA 3WS0A 1SHVA 5G4ZA 3B47A 1DY6A 1UWPX 4LV3A 1RGYA 5J3WA 3HLFA 3RJUA 3F1PB 4R1GA 2HDRA 3A0SA 4MDZA 1MKIA 1CI8A 4KZ9A 2JKTM 4DE2A 3T4QA 4JF6A 4HIAA 2EA9A 3Q7VA 4S2LA 1MPLA 4GCZA 3MKEA 2DMWA 2BG1A 4I5SA 5AJGA 3Q1FA 5DJUA 3F1NB 1ALQA 2J3TC 4OKPA 4JXVA 3IH8A 4X68A 4G3WA 4L9EA 2J3WA 4CQHA 3MFDA 1LLBA 4FTXA 5DFYA 3Q81A 3DTMA 3A3DA 3PAEA 1XJ3A 1BLCA 3TE8A 2H0YA 2Y59A 3NY4A 2HDQA 2WAFA 3K3DA 1STZA 3NDGA 1ZG6A 1XFQA 1LL9A 3BLMA 4WBGA 2V0UA 2M7UA 4P85A 1PW8A 5EV0A 4NXGA 5FI6A 4YNRA 1G6OA 5CGWA 2PBDP 4S2IA 2ZQCA 4LCLA 1K54C 1VEUB 2Y2KA 4KQRA 2PYPA 3OOVA 3G35A 3L7HA 2W1RA 2XR0A 3IBJA 3H82A 1K56A 1S67L 4PHTA 3UDFA 4S2MA 2Y2GA 1E4DA 4M4XA 4D60A 4DJ2A 3IBRA 2ZMVA 1VM1A 2M1CA 2D02A 2GJ3A 4KZ5A 1MWRA 4O0PA 4PM7A 3R7WB 3E4OA 3IWQA 1CF0A 1GSXA 1AWIA 1YLZA 1VETB 3CUEC 3TSGA 2ZLYA 3H9WA 3LIAA 3CITA 3LUQA 3C30A 4HESA 4EQ1A 1HZOA 2VGJA 3IF5A 5EM0A 3KX0X 5E2GA 1IKIA 1T19A 2D01A 1ZC2A 4BLMA 4R0QA 5E2FA 2V0WA 4HI4A 4S2NC 3W8KA 4MBKA 3WS1A 1UWNX 5FI7A 3E4QA 3F1PA 4GS9B 5GLBA 3SS3A 3NBLA 3D9YA 3LR4A 3CI6A 3T1RA 3VFFA 4NG2A 3U2AA 4X53A 2HP6A 1H8ZA 4DF6A 2WGIA 5AQ9A 2Y2NA 3F1NA 2JE5A 1PZPA 4HQAA 4JGRA 2WZXA 3SH9A 3MMHA 3MXSA 4WZ4A 3T4KA 1T1AA 2WGVA 2EWWA 5TJJA 4CPKA 1XJ2A 4LFUA 1HLUP 1TEMA 5J7EA 3ZFZA 1G6AA 3QHYA 2O9CA 1NY0A 3G31A 2QYBA 3M6BA 2O9BA 3HLBA 3SH8A 5A92A 1NXYA 3BQ8A 5GLDA 4WYYA 3HLGA 4FSFA 3M2JA 1XFNA 4OP5A 2ZOIA 3S1YA 4NXEA 1OTEA 3MR0A 3WS2A 5DVAA 3MZDA 5M19A 1PNEA 3RFBA 1VEUA 4X25A 2XD1A 3FPVA 4QPRA 1P9RA 5HAIA 1K6SA 1C3BA 3KYEA 4L0LA 2M7VA 1JWZA 3PBRA 4WZ5A 2EXBA 1AXBA 2Z6DA 4OOLA 5GHYA 4LPZA 5HPFA 4JGPA 2JKTI 2BTFP 4U0XA 1WYBA 3OPLA 1GA9A 3R7WA 2IWBA 2X01A 4F94A 1VETA 4X69A 4JGOA 1BULA 3OCLA 4Z1WA 5EOOA 4QJGA 4JPMA 4DDYA 2VV6A 5TR7A 4RQ9A 5CTNA 5L09A 2OAQ1 3KSFA 4II7A 1G5UA 3NJAA 4JXGA 3ZHHA 4UA9A 5FAQA 1GHPA 1D7EA 3BEBA 4AFIA 1L0GA 3ITBA 3DBAA 4DKIA 4GS9A 5DFXA 2VKSA 4WUJA 4N9KA 3PBTA 2HF6A 4OLGA 5TGFA 2ZC3B 2XH9A 4Y5FA 4S2OA 1KGEA 1FCNA 3MF0A 3NOPC 3NOTC 4MN6A 4B9OA 2XGNA 4LRZE 3HJKA 1SDNA 2W3HA 2ZMAA 1V9YA 5IS1A 4PM6A 2VLGA 2J3TD 1XGJA 1LL5A 3EGDC 2ZD8A 3NCKA 1YAXA 5A8BA 4GHIB 3CJMA 1MWUA 3ISGA 4B88A 5G18A 3G32A 2Q9MA 3IHBA 4UAAA 5EE8A 5KIZA 2J9OA 5FAPA 3UE6A 2HV1A 5HW3A 3S7NA 3VV4A 3NECA 3DWKA 1IELA 3BLSA 2W0NA 1G28A 4WM9A 1OTBA 1GHMA 2VZWA 2Y2IA 3QP8A 3GR2A 3LICA 2V9AA 1LSXA 3RH8B 3GTCA 3BYDA 1Y28A 3T4LA 4BD0A 5L07A 3MKFA 2VGKA 3ZG0A 2B5RA 2YKHA 1Z6FA 4GD8A 4YFMA 3UPOA 4BBTA 4R70A 1MY8A 1ZG4A 4WMCD 2XQZA 3IF6C 4IUKA 3T4TA 1OJ5A 4QHCA 1UGUA 1CQAA 5FAOA 3BFEA 1SCWA 1KOUA 3GRJA 1ESUA 4GDNA 5HL6A 5F1GA 4Q8IA 3IS2B 2KDKA 3ZG7B 5HD3A 1QMFA 3IXBA 3IQAA 3FWLA 3UB8A 1YLJA 1W63M 5AQAA 3AGDA 3BFCA 3A3JA 1D1JA 3OPHA 4LV2A 1OTAA 1T1CA 5KSCA 3NHQA 4EETB 3GQZA 2PAVP 2EX6A 3GMWA 1S66L 3C38A 4CLCD 2EXAA 4DXCA 3IX3A 1K57A 4OOMA 3UB9A 4XUZA 2EWVA 3AGFA 5F82A 3ZQ5A 1DJBA 1LI9A 3ZVTA 2W27A 4GHIA 1CI9A 4ESPA 4HH2A 5HWWA 1ES4A 3C2WA 3TJZC 2H10A 4FUWA 5E2EA 3CPTB 4K91A 4R4RA 4L9FA 3HUNA 2V1AA 2DCFA 1FQGA 1ERMA 3SS4A 5CGSA 3VE3A 4LLOB 4KZ7A 3FZCA 4D2OA 3CZDA 1H8MA 3NC8A 1YKDA 2XDMA 3FPWA 2KLIA 3BFDA 3A3IA 4JKTA 4HEFA 5BOHA 1F9IA 4ZDXA 1K6RA 2VGLM 3OBFA 4P87A 3S7OA 3LCEA 1KE3A 3PBSA 3IXDA 1FCMA 1YLWA 2X71A 5EVIA 1J3WA 4Y0OA 2ZM8A 2HJ9C 2OAP1 3N6IA 1KE0A 2UV0E 5EUAA 5JYPA 3H7WB 2LB5A 4E6XA 3EGXC 5I94A 3D4FA 4PKYG 4KQDA 1YSPA 4FCFA 4GZBA 5A90A 4XUXA 3G30A 3T50A 2VK3A 1ZHHB 4B4XA 1DJCA 3R4KA 5DTSA 5AVFA 3D72A 3IS2A 4HP9A 3QNBA 2A3UA 2GNXA 4GOGA 2PU2A 1W79A 2Y8HA 2ZQ8A 3KSHA 3S7QA 4IUHA 4EWFA 1FSWA 1EROA 5KMWA 2PD7A 4FH2A 3IWIA 1LHYA 5J4EA 1LI0A 1BLHA 4C3QA 2P04A 5HSQA 2GX5A 2C5WB 3VOLA 3MQOA 1ZKJA 2XFTA 2I72A 2ZC7A 4LGWA 5GL9A 4G3VA 4CLCB 2XK1A 3BWLA 3KSIA 4R3AA 1N9BA 2VX8A 3FKWA 1NRJA 2WKPA 5CHMA 3NDEA 3DW0A 2Y79A 3A3FA 3BY8A 3CLOA 3B33A 4EBPA 1NZOA 4HBTA 3BW6A 4P6ZS 2EFXA 1CEFA 1MZUA 1JNUA 1XA1A 3PBQA 3UPNA 3ZVWA 4UQIM 2XA7M 4PKYA 5FATA 4F3LB 3K3CA 3A3EA 3MZEA 3GECA 2WAEA 4I38A 1FR6A 1Q2PA 5FQIA 4S2JA 4Y3IA 4KG2A 2EFUA 3CPTA 3RXXA 3C5AA 4BL3A 3UB5P 1YLTA 2LB9A 4JBFA 5E2HA 3UB7A 1NLYA 1VB6A 5HAPA 2XD5A 3K2NA 4WN5A 4KZAA 5LBRA 3T4SA 3E98A 1K0KA 1KDWA 1W63Q 2RL3A 3D3OA 3UMDA 3ICYA 3KYQA 5CX7A 4MBFA 2B95A 5AQBA 5C5KA 1TS7A 4EBNA 5FEGA 5F69A 3V5MA 3LY3A 1MBLA 2R9XA 4H6JB 3EQUA 1TS6A 4NXBA 1BZAA 3QP2A 4KZ4A 3JPUA 1PW1A 3DTEA 1YQSA 1RP5A 3TW8A 4HJ3A 4MCWA 1NYMA 3B42A 1CEGA 4ARZB 4EQIA 3MBZA 1S6RA 1IEMA 3LY4A 2V20A 1GSWA 1PI4A 3LFVA 1O07A 4JXWA 3VMAA 4PMAA 4YOFA 3LIDA 5I5LA 2GZAA 5CGXA 4Y2FA 3V39A 4EU0A 5FASA 3UDIA 3O5YA 4E3NA 2JC7A 5TFQA 1PZOA 3IX4A 3U4LP 3N8RA 4OPZA 4LENA 2X02A 4IBXA 1ODVA 1BUEA 1U60A 3GSGA 1SKFA 3Q7ZA 2VJWA 3ZNTA 4OPRA 1TDGA 2ZM0A 2Q0OA 2B18A 3ZCZA 3ZG5A 1OPXA 4CLCA 2A2LA 3SZTA 4O8GA 3LGOA 4PM9A 3MQ0A 2PT7A 1OT9A 5L2FA 4QB8A 3FG8A 3PYPA 1SKOB 5D3OA 3V50A 5FEFA 3MZFA 3C4OA 1DJAA 1S1ZA 3V3SA 1JTGA 1H8YA 2XLNA 4IVKA 4OQ0A 1P0ZA 4KG6A 4IJGA 5CEDA 4HBUA 2MJ6A 2HP9A 1BLPA 4E3OA 1K38A 1P9WA 1XJ6A 4ZJ1A 4UHUA 3UB6A 4F3LA 4Y15A 4WZ5C 3GVBA 1T18A 2DRWA 3CAXA 4UA7A 4YINA 1N9NA 2XF3A 1JWVA 3SOIA 1YMSA 5EM1A 3LO7A 3LI9A 3A0RA 3LR3A 2EX2A 2Y2MA 5HAQA 2R9WA 2G2WA 1XX2A 4EUVA 2Y2HA 1IYOA 1OTDA 3NI9A 5HDCA 1BT5A 3C8CA 3N4IA 4N9LA 3VP2A 3BFFA 4OPQA 2Q9NA 3HL9A 2W3DA 5GLCA 1W8YA 2J9PA 3HLEA 3C7VA 3BQAA 3A0VA 1YSQA 3W4QA 2WZZA 2ACGA 4MNRA 2Z2MB 3UE3A 1LSWA 3FYZA 4E3IA 1FSYA 1H0MA 2WKIA 5EFWA 4GJ4A 2W1TB 4ZJ3A
chains in the Genus database with same CATH topology
4JF5A 4DE2A 3S4XA 2HP5A 4JF6A 4E6WA 3Q7VA 1QMFA 4S2LA 4OQHA 5JYOA 3IXBA 3IQAA 1MPLA 4OLDA 1YLYA 4MLLA 3FWLA 4RA7A 1SDEA 3MKEA 1NJ4A 2BG1A 3ZDJA 1W8QA 1YLJA 2Y4AA 1JTDA 5AQAA 3Q1FA 3OPPA 1NRFA 3AGDA 1ALQA 4OKPA 4JXVA 4BQMA 3E2KA 3IH8A 4X68A 4ZJ2A 3BFCA 2EX9A 3A3JA 3MFDA 3GV9A 1LLBA 4S2NA 3OPHA 4LV2A 2ZM2A 4DE1A 5KSCA 3WWXA 3Q81A 3GQZA 2EX6A 3DTMA 3GMWA 4R23A 1ERQA 3PBOA 3A3DA 3QNCA 4RYEA 2FFFB 5DTKA 5GLAA 1GA0A 1S0WA 5CTMA 3WS4A 3PAEA 1O7EA 3ZG7B 3IXHA 1BLCA 5EPHA 3O3VA 4EBLA 4EUZA 2H0YA 2Y59A 4IBRA 3NY4A 1YM1A 2EXAA 3HBRA 4DXCA 1K57A 4OOMA 4XUZA 2HDQA 2WAFA 2XEPA 4BD1A 3NDGA 1ZG6A 1LL9A 4DRTA 3BFGA 4Z9QA 3AGFA 5F82A 3BLMA 4WBGA 1DJBA 1LI9A 3ZVTA 2QPNA 4P85A 1PW8A 1IYPA 5FI6A 1CI9A 1TVFA 3HUMA 2OLUA 3ZG9B 5CGWA 1ES4A 4QY6A 1ES5A 2OSUA 4OVDA 2H10A 4S2IA 5E2EA 2ZQCA 4K91A 1I2SA 4R4RA 4LCLA 3HUNA 1WYCA 3SS5A 1L0EA 1K54C 4NK3A 2DCFA 2Y2KA 4PM8A 3W4OA 1FQGA 1ERMA 3UDXA 4KQRA 2E8IA 3SS4A 5CGSA 1BLSA 2IWDA 5HL1A 4GD6A 3G35A 4KZ7A 3HVFA 2XR0A 1MWSA 3FZCA 4D2OA 1VQQA 4WEKA 1K56A 2H5SA 3CZDA 3HUOA 3NC8A 3VFHA 2XDMA 1YMXA 3UDFA 2PU4A 4S2MA 3BFDA 4WEJA 2Y2GA 3A3IA 4JKTA 4HEFA 1E4DA 5BOHA 4KQOA 4ZDXA 2Y2PA 1K6RA 5EECA 1CK3A 4OP8A 1VM1A 2ZQAA 4FD8A 4P87A 3O87A 1KDSA 2Y91A 3LCEA 1KE3A 4KZ5A 1MWRA 3PBSA 2JCHA 1FCMA 3IXDA 4PM7A 1YLWA 4LV0A 3IWQA 2X71A 5EVIA 4PPRA 5EVID 5FDHA 2XFSA 1YLZA 4Y0OA 2ZM8A 3FV7A 2OV5A 3TSGA 2ZLYA 3N6IA 1KE0A 4QU3A 3MXRA 4DXBA 4HESA 1K4EA 1HZOA 2VGJA 3IF5A 1KVLA 1PI5A 4S2KA 4Y7PA 5EUAA 4E3KA 5JYPA 5DTTA 3B3XA 4E6XA 5E2GA 1IKIA 5I94A 1M40A 4BLMA 1ZC2A 1XA7A 3D4FA 4R0QA 2OLVA 3G34A 5E2FA 3CMZA 3IF6B 4KZBA 4FCFA 4S2NC 3W8KA 1K55A 4MBKA 3IXGA 4IEDA 5DF7A 3WS1A 4GZBA 4IVIA 5A90A 4XUXA 5FI7A 3PBNA 1FCOA 3G30A 1WE4A 1KE4A 2P74A 1ONGA 3O86A 3VP1A 4B4XA 1DJCA 4MBHA 5DTSA 2HPBA 2V2FF 2IWCA 5GLBA 2UWXA 3QNBA 3C4PA 3SS3A 2A3UA 3NBLA 4GOGA 2PU2A 1W79A 3HLWA 2WADA 2ZQ8A 2CC1A 4EWFA 1FSWA 1EROA 2HDUA 5KMWA 5KSHA 4FH2A 3IWIA 5M1AA 3VFFA 1K57C 1LHYA 5DF9A 4K0WA 1K25A 4X53A 3P98A 4RX2A 1LI0A 4WELA 1BLHA 2HP6A 1IYQA 4OPYA 1H8ZA 3HREA 4DF6A 2WGIA 2WGWB 4C3QA 1ESIA 2C5WB 3JYIA 5AQ9A 2Y2NA 3VP4A 4JF4A 1ZKJA 2XFTA 1MXOA 2I72A 1OMEA 1H5XA 1PZPA 2JE5A 2ZC7A 5GL9A 4KQQA 4B4ZA 3N8LA 2XK1A 2WZXA 2ZQ7A 4R3BA 3SH9A 1N9BA 3MXSA 4WZ4A 3FKWA 5U47A 2WGVA 2WUQA 3TOIA 4CPKA 5CHMA 4CJNA 3G2YA 3NDEA 2G2UA 3DW0A 4NETA 4E3JA 1TEMA 3A3FA 1IYSA 5CERA 4Y0TA 4EBPA 1NZOA 3OC2A 4O7DA 4HBTA 1E3UA 3ZFZA 1G6AA 1W5DA 3QHYA 3BECA 4E3MA 1ES3A 1MWTA 2EFXA 1CEFA 3RXWA 1NY0A 1XA1A 3PBQA 3UPNA 3ZVWA 3BM6A 3G31A 2FFYA 4N1XA 4DDSA 5FATA 3CG5A 2WYXA 3M6BA 3HLBA 3SH8A 1PYYA 3A3EA 5A92A 3MZEA 2J8YA 1NXYA 3UO9A 4GKUA 3UN7A 3IHAA 2WAEA 4ID4A 3UE0A 4BENA 5GLDA 4WYYA 1FR6A 1PWCA 1Q2PA 4GB7A 3HLGA 1E25A 4KZ3A 5FA7A 5FQIA 4GDBA 3G2ZA 5FQJA 4FSFA 4S2JA 3EQVA 3M2JA 2ZJ9A 4OP5A 3S22A 3S1YA 1K56D 4KG2A 2H0TA 2EFUA 3UY6A 2Y2LA 4S2PA 3RXXA 2P9VB 3WS2A 2Y2JA 3MZDA 3C5AA 5DVAA 5EVIC 4BL3A 5M19A 1YLTA 4JBFA 4KENB 5E2HA 2ZQDA 2RCXA 2XD1A 1GCEA 1L0FA 4BL2A 2XD5A 4UA6A 5F1FA 5CRFA 5HAPA 1W7FA 4KZAA 3AGEA 5HAIA 4C6YA 1K6SA 4K0XA 2V1ZA 1C3BA 4FH4A 1G68A 1XGIA 5KZHA 4L0LA 5CEBA 4JLFA 1FR1A 1KDWA 2RL3A 1JWZA 3PBRA 4WZ5A 5FQQA 3WRTA 4KZ6A 1K4FA 1AXBA 2EXBA 4OQIA 4OOLA 4MBFA 5GHYA 4GNUA 5AQBA 3UPPA 4OH0A 4EBNA 1K55C 3G4PA 5EVIB 4U0XA 1L2SA 3C7UA 3PAGA 3ZG8B 1WYBA 4DE0A 3V5MA 1PWGA 3LY3A 1MBLA 4A5RA 5E43A 2R9XA 3OPLA 1GA9A 3EQUA 1Q2QA 3VOZA 5CXWA 1BZAA 2EX8A 4KZ4A 4RVAA 1PW1A 4QD4A 3IT9A 1YQSA 1RP5A 4XXRA 2IWBA 2X01A 4F94A 4X69A 3I7JA 1HD8A 1NYMA 1BULA 1GHIA 1RGZA 1BSGA 1CEGA 2DNSA 3OCLA 5DF8A 4EQIA 3MBZA 5EOOA 1S6RA 4QJGA 3OCNA 4JPMA 3Q7VB 4DDYA 4X55A 1IEMA 3LY4A 2V20A 5TR7A 3WRZA 1IKGA 5GHXA 1ONHA 5CTNA 1PIOA 2QMIA 3SH7A 1PI4A 1N4OA 4N92A 1O07A 1HVBA 3VSLA 1EI5A 4JXWA 5FQMA 3VMAA 4PMAA 4U0TA 2WKHA 5CGXA 3V39A 5FASA 3UDIA 4JXGA 2WKEA 3IF6A 3ZHHA 3WS5A 2WK0A 2J7VA 4E3NA 2JC7A 4UA9A 1GHPA 5FAQA 5TFQA 3BEBA 1L0GA 3P09A 1PZOA 3ITBA 3Q82A 3V3RA 5EOEA 4U3TA 1XKZA 4DKIA 4JXSA 3N8RA 4E3LA 5GHZA 1EWZA 3TG9A 1JWPA 4N9KA 1M6KA 4OPZA 3PBTA 4LENA 3ZGAB 2X02A 3HLCA 3E2LA 4IBXA 5EVLA 1BUEA 4OLGA 1U60A 3HLDA 3VP3A 1YLPA 2Z2LB 1HTZA 5TGFA 2ZC3B 2XH9A 4RX3A 3GSGA 1SKFA 3Q7ZA 4S2OA 1KGEA 1NZUA 5FQKA 1FCNA 2Y2QA 4LCMA 1XXMA 2XGNA 3M6HA 3ZNTA 4OONA 1PWDA 4OPRA 1TDGA 5HX9A 1ES2A 1SDNA 2ZM0A 3VSKA 2ZMAA 4H8RA 2WGWA 4Y0UA 3OZHA 4PM6A 5AQ7A 5M18A 3ZCZA 4OQGA 5CHUA 3VP0A 3ZG5A 5CECA 3PTEA 1XGJA 1E3UD 3N7WA 3NIAA 1LL5A 2PBYA 2ZC6B 5CHJA 2ZD8A 3DWZA 3NCKA 4PM9A 5L2FA 4QB8A 3CJMA 1XPBA 3IWOA 1MWUA 5D3OA 3ISGA 4B88A 3V50A 1XP4A 3N8SA 3MZFA 2HDSA 4DE3A 3C4OA 1DJAA 4ZBEA 5G18A 3V3SA 1JTGA 1I2WA 1FOFA 1H8YA 3LEZA 1KGFA 2XLNA 2QZ6A 4ZTKA 4N1HA 4IVKA 4GN2A 4OQ0A 3ITAA 4X56A 3G32A 2Q9MA 4KG6A 5A93A 3IHBA 5CEDA 4UAAA 4KZ8A 4OOYA 5EE8A 4HBUA 2HP9A 2J9OA 2ZC4B 1BLPA 1J9MA 1RCJA 4ZAMA 5FAPA 4E3OA 1K38A 5HW3A 2Y2OA 5FSRA 1I5QA 4ZJ1A 4UHUA 1Y54A 4QY5A 4KG5A 4WZ5C 5J8XA 3GVBA 2DRWA 3DWKA 1IELA 4UA7A 3BLSA 4X6TA 4YINA 3W4PA 3IH9A 2XF3A 1JWVA 5IHVA 4WM9A 3Q07A 3SOIA 5A91A 1YMSA 4R3JA 1GHMA 3LO7A 3FKVA 1YT4A 2JBFA 3UNWA 2Y2IA 2BLSA 5HFOA 3GR2A 3ZNYA 2EX2A 2Y2MA 5HAQA 4PM5A 2R9WA 2G2WA 1XX2A 2P9VA 3GTCA 3OPRA 2Y2HA 3VOYA 3BYDA 2ZQ9A 1IYOA 3NI9A 1KGGA 4BD0A 5FI2A 1QMEA 2Y55A 1BT5A 3N4IA 4P6BA 1K54A 4N9LA 2GDNA 3MKFA 1L0DA 3VP2A 5HARA 2VGKA 3ZG0A 4C75A 2B5RA 3BFFA 3BRMA 4OPQA 1Z6FA 2Q9NA 4GD8A 4YFMA 3UPOA 4R4SA 2ZC5B 3HL9A 4LV1A 5FQ9A 5GLCA 3UE1A 1MY8A 1W8YA 1NYYA 1ZG4A 4WMCA 1BTLA 4WMCD 2J9PA 3HLEA 2XQZA 3IF6C 4EV4A 1TDLA 3M2KA 4P0MA 4BJPA 3C7VA 4M3KA 3WS0A 1SHVA 3O88A 4QHCA 3W4QA 2WZZA 5F83A 1DY6A 5FAOA 3BFEA 4MNRA 1SCWA 4MEZA 4LV3A 2Z2MB 3GRJA 1ESUA 3UE3A 2A49A 1RGYA 1JVJA 3FYZA 4GDNA 2C6WB 3HLFA 4E3IA 3RJUA 1FSYA 5F1GA 4Q8IA 2WKIA 4R1GA 2HDRA 1MKIA 4ZJ3A 1CI8A 4KZ9A 1KVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF5 A;  4DE2 A;  3S4X A;  2HP5 A;  4JF6 A;  4E6W A;  3Q7V A;  1QMF A;  4S2L A;  4OQH A;  5JYO A;  3IXB A;  3IQA A;  1MPL A;  4OLD A;  1YLY A;  4MLL A;  3FWL A;  4RA7 A;  1SDE A;  3MKE A;  1NJ4 A;  2BG1 A;  3ZDJ A;  1W8Q A;  1YLJ A;  2Y4A A;  1JTD A;  5AQA A;  3Q1F A;  3OPP A;  1NRF A;  3AGD A;  1ALQ A;  4OKP A;  4JXV A;  4BQM A;  3E2K A;  3IH8 A;  4X68 A;  4ZJ2 A;  3BFC A;  2EX9 A;  3A3J A;  3MFD A;  3GV9 A;  1LLB A;  4S2N A;  3OPH A;  4LV2 A;  2ZM2 A;  4DE1 A;  5KSC A;  3WWX A;  3Q81 A;  3GQZ A;  2EX6 A;  3DTM A;  3GMW A;  4R23 A;  1ERQ A;  3PBO A;  3A3D A;  3QNC A;  4RYE A;  2FFF B;  5DTK A;  5GLA A;  1GA0 A;  1S0W A;  5CTM A;  3WS4 A;  3PAE A;  1O7E A;  3ZG7 B;  3IXH A;  1BLC A;  5EPH A;  3O3V A;  4EBL A;  4EUZ A;  2H0Y A;  2Y59 A;  4IBR A;  3NY4 A;  1YM1 A;  2EXA A;  3HBR A;  4DXC A;  1K57 A;  4OOM A;  4XUZ A;  2HDQ A;  2WAF A;  2XEP A;  4BD1 A;  3NDG A;  1ZG6 A;  1LL9 A;  4DRT A;  3BFG A;  4Z9Q A;  3AGF A;  5F82 A;  3BLM A;  4WBG A;  1DJB A;  1LI9 A;  3ZVT A;  2QPN A;  4P85 A;  1PW8 A;  1IYP A;  5FI6 A;  1CI9 A;  1TVF A;  3HUM A;  2OLU A;  3ZG9 B;  5CGW A;  1ES4 A;  4QY6 A;  1ES5 A;  2OSU A;  4OVD A;  2H10 A;  4S2I A;  5E2E A;  2ZQC A;  4K91 A;  1I2S A;  4R4R A;  4LCL A;  3HUN A;  1WYC A;  3SS5 A;  1L0E A;  1K54 C;  4NK3 A;  2DCF A;  2Y2K A;  4PM8 A;  3W4O A;  1FQG A;  1ERM A;  3UDX A;  4KQR A;  2E8I A;  3SS4 A;  5CGS A;  1BLS A;  2IWD A;  5HL1 A;  4GD6 A;  3G35 A;  4KZ7 A;  3HVF A;  2XR0 A;  1MWS A;  3FZC A;  4D2O A;  1VQQ A;  4WEK A;  1K56 A;  2H5S A;  3CZD A;  3HUO A;  3NC8 A;  3VFH A;  2XDM A;  1YMX A;  3UDF A;  2PU4 A;  4S2M A;  3BFD A;  4WEJ A;  2Y2G A;  3A3I A;  4JKT A;  4HEF A;  1E4D A;  5BOH A;  4KQO A;  4ZDX A;  2Y2P A;  1K6R A;  5EEC A;  1CK3 A;  4OP8 A;  1VM1 A;  2ZQA A;  4FD8 A;  4P87 A;  3O87 A;  1KDS A;  2Y91 A;  3LCE A;  1KE3 A;  4KZ5 A;  1MWR A;  3PBS A;  2JCH A;  1FCM A;  3IXD A;  4PM7 A;  1YLW A;  4LV0 A;  3IWQ A;  2X71 A;  5EVI A;  4PPR A;  5EVI D;  5FDH A;  2XFS A;  1YLZ A;  4Y0O A;  2ZM8 A;  3FV7 A;  2OV5 A;  3TSG A;  2ZLY A;  3N6I A;  1KE0 A;  4QU3 A;  3MXR A;  4DXB A;  4HES A;  1K4E A;  1HZO A;  2VGJ A;  3IF5 A;  1KVL A;  1PI5 A;  4S2K A;  4Y7P A;  5EUA A;  4E3K A;  5JYP A;  5DTT A;  3B3X A;  4E6X A;  5E2G A;  1IKI A;  5I94 A;  1M40 A;  4BLM A;  1ZC2 A;  1XA7 A;  3D4F A;  4R0Q A;  2OLV A;  3G34 A;  5E2F A;  3CMZ A;  3IF6 B;  4KZB A;  4FCF A;  4S2N C;  3W8K A;  1K55 A;  4MBK A;  3IXG A;  4IED A;  5DF7 A;  3WS1 A;  4GZB A;  4IVI A;  5A90 A;  4XUX A;  5FI7 A;  3PBN A;  1FCO A;  3G30 A;  1WE4 A;  1KE4 A;  2P74 A;  1ONG A;  3O86 A;  3VP1 A;  4B4X A;  1DJC A;  4MBH A;  5DTS A;  2HPB A;  2V2F F;  2IWC A;  5GLB A;  2UWX A;  3QNB A;  3C4P A;  3SS3 A;  2A3U A;  3NBL A;  4GOG A;  2PU2 A;  1W79 A;  3HLW A;  2WAD A;  2ZQ8 A;  2CC1 A;  4EWF A;  1FSW A;  1ERO A;  2HDU A;  5KMW A;  5KSH A;  4FH2 A;  3IWI A;  5M1A A;  3VFF A;  1K57 C;  1LHY A;  5DF9 A;  4K0W A;  1K25 A;  4X53 A;  3P98 A;  4RX2 A;  1LI0 A;  4WEL A;  1BLH A;  2HP6 A;  1IYQ A;  4OPY A;  1H8Z A;  3HRE A;  4DF6 A;  2WGI A;  2WGW B;  4C3Q A;  1ESI A;  2C5W B;  3JYI A;  5AQ9 A;  2Y2N A;  3VP4 A;  4JF4 A;  1ZKJ A;  2XFT A;  1MXO A;  2I72 A;  1OME A;  1H5X A;  1PZP A;  2JE5 A;  2ZC7 A;  5GL9 A;  4KQQ A;  4B4Z A;  3N8L A;  2XK1 A;  2WZX A;  2ZQ7 A;  4R3B A;  3SH9 A;  1N9B A;  3MXS A;  4WZ4 A;  3FKW A;  5U47 A;  2WGV A;  2WUQ A;  3TOI A;  4CPK A;  5CHM A;  4CJN A;  3G2Y A;  3NDE A;  2G2U A;  3DW0 A;  4NET A;  4E3J A;  1TEM A;  3A3F A;  1IYS A;  5CER A;  4Y0T A;  4EBP A;  1NZO A;  3OC2 A;  4O7D A;  4HBT A;  1E3U A;  3ZFZ A;  1G6A A;  1W5D A;  3QHY A;  3BEC A;  4E3M A;  1ES3 A;  1MWT A;  2EFX A;  1CEF A;  3RXW A;  1NY0 A;  1XA1 A;  3PBQ A;  3UPN A;  3ZVW A;  3BM6 A;  3G31 A;  2FFY A;  4N1X A;  4DDS A;  5FAT A;  3CG5 A;  2WYX A;  3M6B A;  3HLB A;  3SH8 A;  1PYY A;  3A3E A;  5A92 A;  3MZE A;  2J8Y A;  1NXY A;  3UO9 A;  4GKU A;  3UN7 A;  3IHA A;  2WAE A;  4ID4 A;  3UE0 A;  4BEN A;  5GLD A;  4WYY A;  1FR6 A;  1PWC A;  1Q2P A;  4GB7 A;  3HLG A;  1E25 A;  4KZ3 A;  5FA7 A;  5FQI A;  4GDB A;  3G2Z A;  5FQJ A;  4FSF A;  4S2J A;  3EQV A;  3M2J A;  2ZJ9 A;  4OP5 A;  3S22 A;  3S1Y A;  1K56 D;  4KG2 A;  2H0T A;  2EFU A;  3UY6 A;  2Y2L A;  4S2P A;  3RXX A;  2P9V B;  3WS2 A;  2Y2J A;  3MZD A;  3C5A A;  5DVA A;  5EVI C;  4BL3 A;  5M19 A;  1YLT A;  4JBF A;  4KEN B;  5E2H A;  2ZQD A;  2RCX A;  2XD1 A;  1GCE A;  1L0F A;  4BL2 A;  2XD5 A;  4UA6 A;  5F1F A;  5CRF A;  5HAP A;  1W7F A;  4KZA A;  3AGE A;  5HAI A;  4C6Y A;  1K6S A;  4K0X A;  2V1Z A;  1C3B A;  4FH4 A;  1G68 A;  1XGI A;  5KZH A;  4L0L A;  5CEB A;  4JLF A;  1FR1 A;  1KDW A;  2RL3 A;  1JWZ A;  3PBR A;  4WZ5 A;  5FQQ A;  3WRT A;  4KZ6 A;  1K4F A;  1AXB A;  2EXB A;  4OQI A;  4OOL A;  4MBF A;  5GHY A;  4GNU A;  5AQB A;  3UPP A;  4OH0 A;  4EBN A;  1K55 C;  3G4P A;  5EVI B;  4U0X A;  1L2S A;  3C7U A;  3PAG A;  3ZG8 B;  1WYB A;  4DE0 A;  3V5M A;  1PWG A;  3LY3 A;  1MBL A;  4A5R A;  5E43 A;  2R9X A;  3OPL A;  1GA9 A;  3EQU A;  1Q2Q A;  3VOZ A;  5CXW A;  1BZA A;  2EX8 A;  4KZ4 A;  4RVA A;  1PW1 A;  4QD4 A;  3IT9 A;  1YQS A;  1RP5 A;  4XXR A;  2IWB A;  2X01 A;  4F94 A;  4X69 A;  3I7J A;  1HD8 A;  1NYM A;  1BUL A;  1GHI A;  1RGZ A;  1BSG A;  1CEG A;  2DNS A;  3OCL A;  5DF8 A;  4EQI A;  3MBZ A;  5EOO A;  1S6R A;  4QJG A;  3OCN A;  4JPM A;  3Q7V B;  4DDY A;  4X55 A;  1IEM A;  3LY4 A;  2V20 A;  5TR7 A;  3WRZ A;  1IKG A;  5GHX A;  1ONH A;  5CTN A;  1PIO A;  2QMI A;  3SH7 A;  1PI4 A;  1N4O A;  4N92 A;  1O07 A;  1HVB A;  3VSL A;  1EI5 A;  4JXW A;  5FQM A;  3VMA A;  4PMA A;  4U0T A;  2WKH A;  5CGX A;  3V39 A;  5FAS A;  3UDI A;  4JXG A;  2WKE A;  3IF6 A;  3ZHH A;  3WS5 A;  2WK0 A;  2J7V A;  4E3N A;  2JC7 A;  4UA9 A;  1GHP A;  5FAQ A;  5TFQ A;  3BEB A;  1L0G A;  3P09 A;  1PZO A;  3ITB A;  3Q82 A;  3V3R A;  5EOE A;  4U3T A;  1XKZ A;  4DKI A;  4JXS A;  3N8R A;  4E3L A;  5GHZ A;  1EWZ A;  3TG9 A;  1JWP A;  4N9K A;  1M6K A;  4OPZ A;  3PBT A;  4LEN A;  3ZGA B;  2X02 A;  3HLC A;  3E2L A;  4IBX A;  5EVL A;  1BUE A;  4OLG A;  1U60 A;  3HLD A;  3VP3 A;  1YLP A;  2Z2L B;  1HTZ A;  5TGF A;  2ZC3 B;  2XH9 A;  4RX3 A;  3GSG A;  1SKF A;  3Q7Z A;  4S2O A;  1KGE A;  1NZU A;  5FQK A;  1FCN A;  2Y2Q A;  4LCM A;  1XXM A;  2XGN A;  3M6H A;  3ZNT A;  4OON A;  1PWD A;  4OPR A;  1TDG A;  5HX9 A;  1ES2 A;  1SDN A;  2ZM0 A;  3VSK A;  2ZMA A;  4H8R A;  2WGW A;  4Y0U A;  3OZH A;  4PM6 A;  5AQ7 A;  5M18 A;  3ZCZ A;  4OQG A;  5CHU A;  3VP0 A;  3ZG5 A;  5CEC A;  3PTE A;  1XGJ A;  1E3U D;  3N7W A;  3NIA A;  1LL5 A;  2PBY A;  2ZC6 B;  5CHJ A;  2ZD8 A;  3DWZ A;  3NCK A;  4PM9 A;  5L2F A;  4QB8 A;  3CJM A;  1XPB A;  3IWO A;  1MWU A;  5D3O A;  3ISG A;  4B88 A;  3V50 A;  1XP4 A;  3N8S A;  3MZF A;  2HDS A;  4DE3 A;  3C4O A;  1DJA A;  4ZBE A;  5G18 A;  3V3S A;  1JTG A;  1I2W A;  1FOF A;  1H8Y A;  3LEZ A;  1KGF A;  2XLN A;  2QZ6 A;  4ZTK A;  4N1H A;  4IVK A;  4GN2 A;  4OQ0 A;  3ITA A;  4X56 A;  3G32 A;  2Q9M A;  4KG6 A;  5A93 A;  3IHB A;  5CED A;  4UAA A;  4KZ8 A;  4OOY A;  5EE8 A;  4HBU A;  2HP9 A;  2J9O A;  2ZC4 B;  1BLP A;  1J9M A;  1RCJ A;  4ZAM A;  5FAP A;  4E3O A;  1K38 A;  5HW3 A;  2Y2O A;  5FSR A;  1I5Q A;  4ZJ1 A;  4UHU A;  1Y54 A;  4QY5 A;  4KG5 A;  4WZ5 C;  5J8X A;  3GVB A;  2DRW A;  3DWK A;  1IEL A;  4UA7 A;  3BLS A;  4X6T A;  4YIN A;  3W4P A;  3IH9 A;  2XF3 A;  1JWV A;  5IHV A;  4WM9 A;  3Q07 A;  3SOI A;  5A91 A;  1YMS A;  4R3J A;  1GHM A;  3LO7 A;  3FKV A;  1YT4 A;  2JBF A;  3UNW A;  2Y2I A;  2BLS A;  5HFO A;  3GR2 A;  3ZNY A;  2EX2 A;  2Y2M A;  5HAQ A;  4PM5 A;  2R9W A;  2G2W A;  1XX2 A;  2P9V A;  3GTC A;  3OPR A;  2Y2H A;  3VOY A;  3BYD A;  2ZQ9 A;  1IYO A;  3NI9 A;  1KGG A;  4BD0 A;  5FI2 A;  1QME A;  2Y55 A;  1BT5 A;  3N4I A;  4P6B A;  1K54 A;  4N9L A;  2GDN A;  3MKF A;  1L0D A;  3VP2 A;  5HAR A;  2VGK A;  3ZG0 A;  4C75 A;  2B5R A;  3BFF A;  3BRM A;  4OPQ A;  1Z6F A;  2Q9N A;  4GD8 A;  4YFM A;  3UPO A;  4R4S A;  2ZC5 B;  3HL9 A;  4LV1 A;  5FQ9 A;  5GLC A;  3UE1 A;  1MY8 A;  1W8Y A;  1NYY A;  1ZG4 A;  4WMC A;  1BTL A;  4WMC D;  2J9P A;  3HLE A;  2XQZ A;  3IF6 C;  4EV4 A;  1TDL A;  3M2K A;  4P0M A;  4BJP A;  3C7V A;  4M3K A;  3WS0 A;  1SHV A;  3O88 A;  4QHC A;  3W4Q A;  2WZZ A;  5F83 A;  1DY6 A;  5FAO A;  3BFE A;  4MNR A;  1SCW A;  4MEZ A;  4LV3 A;  2Z2M B;  3GRJ A;  1ESU A;  3UE3 A;  2A49 A;  1RGY A;  1JVJ A;  3FYZ A;  4GDN A;  2C6W B;  3HLF A;  4E3I A;  3RJU A;  1FSY A;  5F1G A;  4Q8I A;  2WKI A;  4R1G A;  2HDR A;  1MKI A;  4ZJ3 A;  1CI8 A;  4KZ9 A;  1KVM A; 
#chains in the Genus database with same CATH topology
 4I39 A;  3S4X A;  2HP5 A;  2P08 A;  5JYO A;  4B93 A;  1YLY A;  4RA7 A;  1SDE A;  1NJ4 A;  3GDI A;  3ZDJ A;  1NRF A;  5AVE A;  1IFQ A;  2INW A;  4BQM A;  2EX9 A;  2QKP A;  3KYZ A;  2PR5 A;  3WWX A;  3CHW P;  4HJ4 A;  4R23 A;  5DTK A;  2FFF B;  1GA0 A;  2XRO A;  4EBL A;  3LR0 A;  1YM1 A;  3HBR A;  4BD1 A;  2A24 B;  4LRX C;  4DRT A;  4Z9Q A;  2L4R A;  2QPN A;  2WKQ A;  1T1B A;  2PRF A;  1IYP A;  1NLZ A;  1SKO A;  3HUM A;  3EEH A;  2OSU A;  4G3K A;  4OVD A;  4WF0 A;  1WYC A;  1PRQ A;  1L0E A;  4NK3 A;  3W4O A;  3UDX A;  2E8I A;  1BLS A;  2IWD A;  1VQQ A;  2OWH A;  3VFH A;  3MXQ A;  1YMX A;  5DJT A;  3NOU C;  4WEJ A;  5F6A A;  2Y2P A;  1CK3 A;  3V67 A;  1LL8 A;  3O87 A;  1KDS A;  2Y91 A;  2JKF A;  4LV0 A;  3JVV A;  4ZRR A;  2OV5 A;  3KO6 A;  3BY9 A;  4QU3 A;  3MXR A;  4DXB A;  1K4E A;  4E3K A;  1DP8 A;  4Y13 A;  2OOL A;  1D06 A;  1M40 A;  1XA7 A;  3G34 A;  2W3G A;  1K55 A;  4IED A;  5DF7 A;  1PFL A;  1FCO A;  2O0Y A;  2P74 A;  3VP1 A;  2V2F F;  2UWX A;  3C4P A;  5EVE A;  1MKM A;  5KSH A;  1K57 C;  4K0W A;  1K25 A;  1X0O A;  2IA2 A;  1ESI A;  3VP4 A;  5DKK A;  1OME A;  1H5X A;  3NUL A;  1OJG A;  1OTI A;  4IHQ A;  2ZQ7 A;  1GSV A;  1EW0 A;  5U47 A;  3ZYT A;  3TOI A;  3CWF A;  4NET A;  4ETZ A;  1IYS A;  5CER A;  4Y0T A;  1OT6 A;  3BEC A;  1ES3 A;  1MWT A;  3RXW A;  1WA9 A;  2FFY A;  4N1X A;  4DDS A;  2A24 A;  3CG5 A;  3E0Y A;  3PXP A;  2HZ5 A;  4GKU A;  3IHA A;  4ID4 A;  4BEN A;  4HP4 A;  4KZ3 A;  5FQJ A;  4GDB A;  3G2Z A;  3EQV A;  3S22 A;  1Y4O A;  2OWJ A;  3EWK A;  3UY6 A;  3LI8 A;  4S2P A;  3JVU A;  1DRM A;  2Y2J A;  5EVI C;  3EEA A;  2RCX A;  1L0F A;  4BL2 A;  1W7F A;  4C6Y A;  4K0X A;  2ZMF A;  1G68 A;  1XGI A;  2FZ0 A;  1FR1 A;  2BAS A;  1N9O A;  4R38 A;  5FQQ A;  4WLA A;  4KZ6 A;  1K4F A;  2E8J A;  3G4P A;  4Y17 A;  1L2S A;  3C7U A;  3HCY A;  3PAG A;  3ZG8 B;  4QWO A;  1PWG A;  4LRY C;  5E43 A;  1DP9 A;  1SZV A;  2ZBB A;  4GW9 A;  3QP4 A;  2EX8 A;  4RVA A;  4QD4 A;  3IT9 A;  4O01 A;  3I7J A;  1HD8 A;  1GHI A;  1RGZ A;  5DF8 A;  5GHX A;  2QMI A;  2AVX A;  5DKL A;  1ZTU A;  3F1O B;  3VSL A;  2QJ7 A;  4N92 A;  4U0T A;  2WKH A;  3Q82 A;  3V3R A;  4U3T A;  1XKZ A;  4KUK A;  5GHZ A;  1EWZ A;  1JWP A;  1M6K A;  2QWS A;  2L0W A;  2QHK A;  3E2L A;  5EVL A;  3HLD A;  1YLP A;  5FDS A;  5FQK A;  2PD8 A;  1XXM A;  5HX9 A;  4H8R A;  4Y0U A;  1FIL A;  3OZH A;  4I3J A;  1BYW A;  2K2N A;  5CHU A;  3PTE A;  1E3U D;  3NIA A;  4E04 A;  3MFX A;  4GLQ A;  1XPB A;  4R6L A;  1XP4 A;  3N8S A;  4DE3 A;  4ZBE A;  2YKF A;  3LEZ A;  1I2W A;  1FOF A;  4ZTK A;  2QZ6 A;  4N1H A;  3MSH A;  3ITA A;  3P01 A;  5A93 A;  4HJ6 A;  5IT5 A;  2PYR A;  2ZL1 B;  3BJN A;  2Y2O A;  1I5Q A;  1Y54 A;  4KG5 A;  5J8X A;  2NUP C;  5G4Y A;  1S4S A;  3IH9 A;  1F98 A;  2G7U A;  2JBF A;  2PR6 A;  3UNW A;  5HFO A;  3ZNY A;  3T1X A;  2V1B A;  3SW1 A;  3OPR A;  3VOY A;  2ZQ9 A;  3P7N A;  1L3L A;  4X1M A;  5FI2 A;  1K54 A;  2GDN A;  2VGL S;  5HAR A;  3T1S A;  3BRM A;  2JHE A;  1NWZ A;  4R4S A;  2ZC5 B;  4WMC A;  3M2K A;  3T4J A;  3O88 A;  5F83 A;  4MEZ A;  3H7W A;  2A49 A;  1JVJ A;  2C6W B;  1LSV A;  2KX6 A;  4MMN A;  4ARZ A;  1KVM A;  4JF5 A;  4E6W A;  4YWZ A;  4NEE D;  3CUE A;  4OQH A;  1H3Q A;  4OLD A;  4MLL A;  3F1O A;  3QP5 A;  1W8Q A;  2Y4A A;  1JTD A;  3OPP A;  5K5B A;  4CLC C;  3E2K A;  4ZJ2 A;  3GV9 A;  4S2N A;  2ZM2 A;  4DE1 A;  1ERQ A;  3PBO A;  4RYE A;  3QNC A;  5GLA A;  1S0W A;  5CTM A;  3WS4 A;  1O7E A;  3IXH A;  4ETX A;  4Q0J A;  5EPH A;  3O3V A;  4EUZ A;  4IBR A;  2B02 A;  2O9A A;  2XEP A;  3BFG A;  1F5M A;  3DTK A;  3ULF A;  3G6O A;  4UQI S;  2XA7 S;  5TBM B;  3FC7 A;  1TVF A;  2OLU A;  3ZG9 B;  4QY6 A;  1ES5 A;  1I2S A;  3SS5 A;  2ZL1 A;  4PM8 A;  5HL1 A;  4GD6 A;  3HVF A;  1MWS A;  4WEK A;  4BBU A;  2H5S A;  3HUO A;  4EEU A;  3LR5 A;  1DP6 A;  2PU4 A;  4BMW A;  5IU1 A;  4KQO A;  5EEC A;  2L1M A;  3DTI A;  4OP8 A;  2ZQA A;  4FD8 A;  5F68 A;  2XRN A;  3S7P A;  2JCH A;  4PPR A;  5EVI D;  5FDH A;  2XFS A;  2PDR A;  4EER A;  3FV7 A;  4HOI A;  4H6J A;  3W2Z A;  2JKR M;  4Y7P A;  2I9V A;  1KVL A;  1PI5 A;  4S2K A;  4BBV A;  5DTT A;  1YPR A;  3B3X A;  4K08 A;  5L10 A;  4NKP A;  2OLV A;  3CMZ A;  3IF6 B;  4KZB A;  4XT2 B;  2V8C A;  4Q0H A;  3IXG A;  4HNB A;  4IVI A;  1P97 A;  3PBN A;  1FIK A;  1WE4 A;  1KE4 A;  3O86 A;  1ONG A;  5HDD A;  4MBH A;  2HPB A;  2IWC A;  2V8F A;  2VV8 A;  2FH5 A;  3RTY A;  3HLW A;  2NUT C;  2WAD A;  2CC1 A;  1A0K A;  1Z09 A;  2HDU A;  3LIE A;  4ME4 A;  5M1A A;  2PHY A;  5DF9 A;  3P98 A;  4RX2 A;  3KSG A;  4WEL A;  1IYQ A;  4OPY A;  3LIF A;  3HRE A;  2WGW B;  3JYI A;  4WL9 A;  4JF4 A;  2R78 A;  5FL3 A;  1MXO A;  2HGV A;  4B4Z A;  1TS8 A;  4KQQ A;  3N8L A;  5L8M A;  4R3B A;  4EEP A;  2WUQ A;  3LYX A;  4CJN A;  3G2Y A;  1VHM A;  2G2U A;  3UME A;  4E3J A;  2K7S A;  4DMZ A;  3OC2 A;  4O7D A;  1E3U A;  1W5D A;  4E3M A;  3BM6 A;  3LIB A;  4DN0 A;  1XJ4 A;  2WYX A;  1PYY A;  4EXO A;  2J8Y A;  3UO9 A;  3UN7 A;  3OLO A;  5HWT A;  3UE0 A;  2H28 A;  1PWC A;  4GB7 A;  1E25 A;  5FA7 A;  5TBM A;  1MC0 A;  2ZJ9 A;  4EW7 A;  2XSS A;  5HPI A;  2JN7 A;  1K56 D;  2H0T A;  2Y2L A;  3QP1 A;  1ACF A;  2P9V B;  2CMN A;  4FOF A;  4KEN B;  2ZQD A;  1GCE A;  5F1F A;  4UA6 A;  4CLC E;  4MN5 A;  5CRF A;  3AGE A;  2V1Z A;  1TF1 A;  4FH4 A;  5KZH A;  5CEB A;  3QP6 A;  4JLF A;  3WRT A;  2W3E A;  4OQI A;  5HDS A;  4GNU A;  3UPP A;  4OH0 A;  1K55 C;  5EVI B;  2JKG A;  4DE0 A;  1F2K A;  1S1Y A;  4L9G A;  4A5R A;  1Q2Q A;  3VOZ A;  5CXW A;  2ZOH A;  1CJF A;  4HHD A;  1TS0 A;  4XXR A;  2VV7 A;  1BSG A;  2DNS A;  4EES A;  3OCN A;  4I3I A;  3Q7V B;  4X55 A;  3WRZ A;  3T1Q B;  4NXF A;  1IKG A;  1ONH A;  5HZH A;  1PIO A;  1IOU A;  3SH7 A;  4UEY A;  1N4O A;  4BWI A;  1HVB A;  1S4R A;  1EI5 A;  1TD5 A;  5FQM A;  4PAU A;  2VEA A;  2W1T A;  4KUO A;  3PHY A;  2WKE A;  3IF6 A;  3T12 B;  3WS5 A;  4XT2 A;  2WK0 A;  2J7V A;  3P09 A;  5EOE A;  4JXS A;  1LT0 A;  4E3L A;  3TG9 A;  3ZGA B;  2Z6C A;  3HLC A;  2VA0 A;  3VP3 A;  2Z2L B;  1HTZ A;  4RX3 A;  4HH3 A;  1NZU A;  2Y2Q A;  4LCM A;  3IX8 A;  3M6H A;  2QJ5 A;  4OON A;  1PWD A;  4Q0I A;  1ES2 A;  3VSK A;  2WGW A;  5AQ7 A;  5M18 A;  4OQG A;  5CEC A;  3VP0 A;  3T4O A;  2J80 A;  3N7W A;  2PBY A;  2ZC6 B;  5CHJ A;  3DWZ A;  3IWO A;  3LEQ A;  2P7J A;  4P6Z M;  2HDS A;  2K31 A;  3PR6 A;  3EOI A;  1KGF A;  4GN2 A;  4X56 A;  2O99 A;  4KZ8 A;  4OOY A;  5MC7 A;  2HJE A;  4JGQ A;  2W3F A;  2ZC4 B;  4ZAM A;  1J9M A;  1RCJ A;  4X1L A;  5HWV A;  3TRC A;  5FSR A;  4I3A A;  4QY5 A;  3HJI A;  3H82 B;  4X6T A;  3W4P A;  5IHV A;  1N9L A;  3Q07 A;  5A91 A;  4R3J A;  3FKV A;  1YT4 A;  5HD5 A;  2BLS A;  4MN7 A;  3E4P A;  3MQQ A;  4HY8 A;  3VE4 A;  2JKR I;  5F5Y A;  3DAV A;  4PM5 A;  2WKR A;  2P9V A;  1V9Z A;  1KGG A;  1QME A;  2Y55 A;  4P6B A;  1L0D A;  4C75 A;  3L9K A;  4LV1 A;  5FQ9 A;  3UE1 A;  1NYY A;  3MS6 A;  1BTL A;  3MJQ A;  4EV4 A;  1TDL A;  4P0M A;  4DJ3 A;  2KOI A;  4BJP A;  4M3K A;  3WS0 A;  1SHV A;  5G4Z A;  3B47 A;  1DY6 A;  1UWP X;  4LV3 A;  1RGY A;  5J3W A;  3HLF A;  3RJU A;  3F1P B;  4R1G A;  2HDR A;  3A0S A;  4MDZ A;  1MKI A;  1CI8 A;  4KZ9 A;  2JKT M;  4DE2 A;  3T4Q A;  4JF6 A;  4HIA A;  2EA9 A;  3Q7V A;  4S2L A;  1MPL A;  4GCZ A;  3MKE A;  2DMW A;  2BG1 A;  4I5S A;  5AJG A;  3Q1F A;  5DJU A;  3F1N B;  1ALQ A;  2J3T C;  4OKP A;  4JXV A;  3IH8 A;  4X68 A;  4G3W A;  4L9E A;  2J3W A;  4CQH A;  3MFD A;  1LLB A;  4FTX A;  5DFY A;  3Q81 A;  3DTM A;  3A3D A;  3PAE A;  1XJ3 A;  1BLC A;  3TE8 A;  2H0Y A;  2Y59 A;  3NY4 A;  2HDQ A;  2WAF A;  3K3D A;  1STZ A;  3NDG A;  1ZG6 A;  1XFQ A;  1LL9 A;  3BLM A;  4WBG A;  2V0U A;  2M7U A;  4P85 A;  1PW8 A;  5EV0 A;  4NXG A;  5FI6 A;  4YNR A;  1G6O A;  5CGW A;  2PBD P;  4S2I A;  2ZQC A;  4LCL A;  1K54 C;  1VEU B;  2Y2K A;  4KQR A;  2PYP A;  3OOV A;  3G35 A;  3L7H A;  2W1R A;  2XR0 A;  3IBJ A;  3H82 A;  1K56 A;  1S67 L;  4PHT A;  3UDF A;  4S2M A;  2Y2G A;  1E4D A;  4M4X A;  4D60 A;  4DJ2 A;  3IBR A;  2ZMV A;  1VM1 A;  2M1C A;  2D02 A;  2GJ3 A;  4KZ5 A;  1MWR A;  4O0P A;  4PM7 A;  3R7W B;  3E4O A;  3IWQ A;  1CF0 A;  1GSX A;  1AWI A;  1YLZ A;  1VET B;  3CUE C;  3TSG A;  2ZLY A;  3H9W A;  3LIA A;  3CIT A;  3LUQ A;  3C30 A;  4HES A;  4EQ1 A;  1HZO A;  2VGJ A;  3IF5 A;  5EM0 A;  3KX0 X;  5E2G A;  1IKI A;  1T19 A;  2D01 A;  1ZC2 A;  4BLM A;  4R0Q A;  5E2F A;  2V0W A;  4HI4 A;  4S2N C;  3W8K A;  4MBK A;  3WS1 A;  1UWN X;  5FI7 A;  3E4Q A;  3F1P A;  4GS9 B;  5GLB A;  3SS3 A;  3NBL A;  3D9Y A;  3LR4 A;  3CI6 A;  3T1R A;  3VFF A;  4NG2 A;  3U2A A;  4X53 A;  2HP6 A;  1H8Z A;  4DF6 A;  2WGI A;  5AQ9 A;  2Y2N A;  3F1N A;  2JE5 A;  1PZP A;  4HQA A;  4JGR A;  2WZX A;  3SH9 A;  3MMH A;  3MXS A;  4WZ4 A;  3T4K A;  1T1A A;  2WGV A;  2EWW A;  5TJJ A;  4CPK A;  1XJ2 A;  4LFU A;  1HLU P;  1TEM A;  5J7E A;  3ZFZ A;  1G6A A;  3QHY A;  2O9C A;  1NY0 A;  3G31 A;  2QYB A;  3M6B A;  2O9B A;  3HLB A;  3SH8 A;  5A92 A;  1NXY A;  3BQ8 A;  5GLD A;  4WYY A;  3HLG A;  4FSF A;  3M2J A;  1XFN A;  4OP5 A;  2ZOI A;  3S1Y A;  4NXE A;  1OTE A;  3MR0 A;  3WS2 A;  5DVA A;  3MZD A;  5M19 A;  1PNE A;  3RFB A;  1VEU A;  4X25 A;  2XD1 A;  3FPV A;  4QPR A;  1P9R A;  5HAI A;  1K6S A;  1C3B A;  3KYE A;  4L0L A;  2M7V A;  1JWZ A;  3PBR A;  4WZ5 A;  2EXB A;  1AXB A;  2Z6D A;  4OOL A;  5GHY A;  4LPZ A;  5HPF A;  4JGP A;  2JKT I;  2BTF P;  4U0X A;  1WYB A;  3OPL A;  1GA9 A;  3R7W A;  2IWB A;  2X01 A;  4F94 A;  1VET A;  4X69 A;  4JGO A;  1BUL A;  3OCL A;  4Z1W A;  5EOO A;  4QJG A;  4JPM A;  4DDY A;  2VV6 A;  5TR7 A;  4RQ9 A;  5CTN A;  5L09 A;  2OAQ 1;  3KSF A;  4II7 A;  1G5U A;  3NJA A;  4JXG A;  3ZHH A;  4UA9 A;  5FAQ A;  1GHP A;  1D7E A;  3BEB A;  4AFI A;  1L0G A;  3ITB A;  3DBA A;  4DKI A;  4GS9 A;  5DFX A;  2VKS A;  4WUJ A;  4N9K A;  3PBT A;  2HF6 A;  4OLG A;  5TGF A;  2ZC3 B;  2XH9 A;  4Y5F A;  4S2O A;  1KGE A;  1FCN A;  3MF0 A;  3NOP C;  3NOT C;  4MN6 A;  4B9O A;  2XGN A;  4LRZ E;  3HJK A;  1SDN A;  2W3H A;  2ZMA A;  1V9Y A;  5IS1 A;  4PM6 A;  2VLG A;  2J3T D;  1XGJ A;  1LL5 A;  3EGD C;  2ZD8 A;  3NCK A;  1YAX A;  5A8B A;  4GHI B;  3CJM A;  1MWU A;  3ISG A;  4B88 A;  5G18 A;  3G32 A;  2Q9M A;  3IHB A;  4UAA A;  5EE8 A;  5KIZ A;  2J9O A;  5FAP A;  3UE6 A;  2HV1 A;  5HW3 A;  3S7N A;  3VV4 A;  3NEC A;  3DWK A;  1IEL A;  3BLS A;  2W0N A;  1G28 A;  4WM9 A;  1OTB A;  1GHM A;  2VZW A;  2Y2I A;  3QP8 A;  3GR2 A;  3LIC A;  2V9A A;  1LSX A;  3RH8 B;  3GTC A;  3BYD A;  1Y28 A;  3T4L A;  4BD0 A;  5L07 A;  3MKF A;  2VGK A;  3ZG0 A;  2B5R A;  2YKH A;  1Z6F A;  4GD8 A;  4YFM A;  3UPO A;  4BBT A;  4R70 A;  1MY8 A;  1ZG4 A;  4WMC D;  2XQZ A;  3IF6 C;  4IUK A;  3T4T A;  1OJ5 A;  4QHC A;  1UGU A;  1CQA A;  5FAO A;  3BFE A;  1SCW A;  1KOU A;  3GRJ A;  1ESU A;  4GDN A;  5HL6 A;  5F1G A;  4Q8I A;  3IS2 B;  2KDK A;  3ZG7 B;  5HD3 A;  1QMF A;  3IXB A;  3IQA A;  3FWL A;  3UB8 A;  1YLJ A;  1W63 M;  5AQA A;  3AGD A;  3BFC A;  3A3J A;  1D1J A;  3OPH A;  4LV2 A;  1OTA A;  1T1C A;  5KSC A;  3NHQ A;  4EET B;  3GQZ A;  2PAV P;  2EX6 A;  3GMW A;  1S66 L;  3C38 A;  4CLC D;  2EXA A;  4DXC A;  3IX3 A;  1K57 A;  4OOM A;  3UB9 A;  4XUZ A;  2EWV A;  3AGF A;  5F82 A;  3ZQ5 A;  1DJB A;  1LI9 A;  3ZVT A;  2W27 A;  4GHI A;  1CI9 A;  4ESP A;  4HH2 A;  5HWW A;  1ES4 A;  3C2W A;  3TJZ C;  2H10 A;  4FUW A;  5E2E A;  3CPT B;  4K91 A;  4R4R A;  4L9F A;  3HUN A;  2V1A A;  2DCF A;  1FQG A;  1ERM A;  3SS4 A;  5CGS A;  3VE3 A;  4LLO B;  4KZ7 A;  3FZC A;  4D2O A;  3CZD A;  1H8M A;  3NC8 A;  1YKD A;  2XDM A;  3FPW A;  2KLI A;  3BFD A;  3A3I A;  4JKT A;  4HEF A;  5BOH A;  1F9I A;  4ZDX A;  1K6R A;  2VGL M;  3OBF A;  4P87 A;  3S7O A;  3LCE A;  1KE3 A;  3PBS A;  3IXD A;  1FCM A;  1YLW A;  2X71 A;  5EVI A;  1J3W A;  4Y0O A;  2ZM8 A;  2HJ9 C;  2OAP 1;  3N6I A;  1KE0 A;  2UV0 E;  5EUA A;  5JYP A;  3H7W B;  2LB5 A;  4E6X A;  3EGX C;  5I94 A;  3D4F A;  4PKY G;  4KQD A;  1YSP A;  4FCF A;  4GZB A;  5A90 A;  4XUX A;  3G30 A;  3T50 A;  2VK3 A;  1ZHH B;  4B4X A;  1DJC A;  3R4K A;  5DTS A;  5AVF A;  3D72 A;  3IS2 A;  4HP9 A;  3QNB A;  2A3U A;  2GNX A;  4GOG A;  2PU2 A;  1W79 A;  2Y8H A;  2ZQ8 A;  3KSH A;  3S7Q A;  4IUH A;  4EWF A;  1FSW A;  1ERO A;  5KMW A;  2PD7 A;  4FH2 A;  3IWI A;  1LHY A;  5J4E A;  1LI0 A;  1BLH A;  4C3Q A;  2P04 A;  5HSQ A;  2GX5 A;  2C5W B;  3VOL A;  3MQO A;  1ZKJ A;  2XFT A;  2I72 A;  2ZC7 A;  4LGW A;  5GL9 A;  4G3V A;  4CLC B;  2XK1 A;  3BWL A;  3KSI A;  4R3A A;  1N9B A;  2VX8 A;  3FKW A;  1NRJ A;  2WKP A;  5CHM A;  3NDE A;  3DW0 A;  2Y79 A;  3A3F A;  3BY8 A;  3CLO A;  3B33 A;  4EBP A;  1NZO A;  4HBT A;  3BW6 A;  4P6Z S;  2EFX A;  1CEF A;  1MZU A;  1JNU A;  1XA1 A;  3PBQ A;  3UPN A;  3ZVW A;  4UQI M;  2XA7 M;  4PKY A;  5FAT A;  4F3L B;  3K3C A;  3A3E A;  3MZE A;  3GEC A;  2WAE A;  4I38 A;  1FR6 A;  1Q2P A;  5FQI A;  4S2J A;  4Y3I A;  4KG2 A;  2EFU A;  3CPT A;  3RXX A;  3C5A A;  4BL3 A;  3UB5 P;  1YLT A;  2LB9 A;  4JBF A;  5E2H A;  3UB7 A;  1NLY A;  1VB6 A;  5HAP A;  2XD5 A;  3K2N A;  4WN5 A;  4KZA A;  5LBR A;  3T4S A;  3E98 A;  1K0K A;  1KDW A;  1W63 Q;  2RL3 A;  3D3O A;  3UMD A;  3ICY A;  3KYQ A;  5CX7 A;  4MBF A;  2B95 A;  5AQB A;  5C5K A;  1TS7 A;  4EBN A;  5FEG A;  5F69 A;  3V5M A;  3LY3 A;  1MBL A;  2R9X A;  4H6J B;  3EQU A;  1TS6 A;  4NXB A;  1BZA A;  3QP2 A;  4KZ4 A;  3JPU A;  1PW1 A;  3DTE A;  1YQS A;  1RP5 A;  3TW8 A;  4HJ3 A;  4MCW A;  1NYM A;  3B42 A;  1CEG A;  4ARZ B;  4EQI A;  3MBZ A;  1S6R A;  1IEM A;  3LY4 A;  2V20 A;  1GSW A;  1PI4 A;  3LFV A;  1O07 A;  4JXW A;  3VMA A;  4PMA A;  4YOF A;  3LID A;  5I5L A;  2GZA A;  5CGX A;  4Y2F A;  3V39 A;  4EU0 A;  5FAS A;  3UDI A;  3O5Y A;  4E3N A;  2JC7 A;  5TFQ A;  1PZO A;  3IX4 A;  3U4L P;  3N8R A;  4OPZ A;  4LEN A;  2X02 A;  4IBX A;  1ODV A;  1BUE A;  1U60 A;  3GSG A;  1SKF A;  3Q7Z A;  2VJW A;  3ZNT A;  4OPR A;  1TDG A;  2ZM0 A;  2Q0O A;  2B18 A;  3ZCZ A;  3ZG5 A;  1OPX A;  4CLC A;  2A2L A;  3SZT A;  4O8G A;  3LGO A;  4PM9 A;  3MQ0 A;  2PT7 A;  1OT9 A;  5L2F A;  4QB8 A;  3FG8 A;  3PYP A;  1SKO B;  5D3O A;  3V50 A;  5FEF A;  3MZF A;  3C4O A;  1DJA A;  1S1Z A;  3V3S A;  1JTG A;  1H8Y A;  2XLN A;  4IVK A;  4OQ0 A;  1P0Z A;  4KG6 A;  4IJG A;  5CED A;  4HBU A;  2MJ6 A;  2HP9 A;  1BLP A;  4E3O A;  1K38 A;  1P9W A;  1XJ6 A;  4ZJ1 A;  4UHU A;  3UB6 A;  4F3L A;  4Y15 A;  4WZ5 C;  3GVB A;  1T18 A;  2DRW A;  3CAX A;  4UA7 A;  4YIN A;  1N9N A;  2XF3 A;  1JWV A;  3SOI A;  1YMS A;  5EM1 A;  3LO7 A;  3LI9 A;  3A0R A;  3LR3 A;  2EX2 A;  2Y2M A;  5HAQ A;  2R9W A;  2G2W A;  1XX2 A;  4EUV A;  2Y2H A;  1IYO A;  1OTD A;  3NI9 A;  5HDC A;  1BT5 A;  3C8C A;  3N4I A;  4N9L A;  3VP2 A;  3BFF A;  4OPQ A;  2Q9N A;  3HL9 A;  2W3D A;  5GLC A;  1W8Y A;  2J9P A;  3HLE A;  3C7V A;  3BQA A;  3A0V A;  1YSQ A;  3W4Q A;  2WZZ A;  2ACG A;  4MNR A;  2Z2M B;  3UE3 A;  1LSW A;  3FYZ A;  4E3I A;  1FSY A;  1H0M A;  2WKI A;  5EFW A;  4GJ4 A;  2W1T B;  4ZJ3 A; 
#chains in the Genus database with same CATH homology
 4JF5 A;  4DE2 A;  3S4X A;  2HP5 A;  4JF6 A;  4E6W A;  3Q7V A;  1QMF A;  4S2L A;  4OQH A;  5JYO A;  3IXB A;  3IQA A;  1MPL A;  4OLD A;  1YLY A;  4MLL A;  3FWL A;  4RA7 A;  1SDE A;  3MKE A;  1NJ4 A;  2BG1 A;  3ZDJ A;  1W8Q A;  1YLJ A;  2Y4A A;  1JTD A;  5AQA A;  3Q1F A;  3OPP A;  1NRF A;  3AGD A;  1ALQ A;  4OKP A;  4JXV A;  4BQM A;  3E2K A;  3IH8 A;  4X68 A;  4ZJ2 A;  3BFC A;  2EX9 A;  3A3J A;  3MFD A;  3GV9 A;  1LLB A;  4S2N A;  3OPH A;  4LV2 A;  2ZM2 A;  4DE1 A;  5KSC A;  3WWX A;  3Q81 A;  3GQZ A;  2EX6 A;  3DTM A;  3GMW A;  4R23 A;  1ERQ A;  3PBO A;  3A3D A;  3QNC A;  4RYE A;  2FFF B;  5DTK A;  5GLA A;  1GA0 A;  1S0W A;  5CTM A;  3WS4 A;  3PAE A;  1O7E A;  3ZG7 B;  3IXH A;  1BLC A;  5EPH A;  3O3V A;  4EBL A;  4EUZ A;  2H0Y A;  2Y59 A;  4IBR A;  3NY4 A;  1YM1 A;  2EXA A;  3HBR A;  4DXC A;  1K57 A;  4OOM A;  4XUZ A;  2HDQ A;  2WAF A;  2XEP A;  4BD1 A;  3NDG A;  1ZG6 A;  1LL9 A;  4DRT A;  3BFG A;  4Z9Q A;  3AGF A;  5F82 A;  3BLM A;  4WBG A;  1DJB A;  1LI9 A;  3ZVT A;  2QPN A;  4P85 A;  1PW8 A;  1IYP A;  5FI6 A;  1CI9 A;  1TVF A;  3HUM A;  2OLU A;  3ZG9 B;  5CGW A;  1ES4 A;  4QY6 A;  1ES5 A;  2OSU A;  4OVD A;  2H10 A;  4S2I A;  5E2E A;  2ZQC A;  4K91 A;  1I2S A;  4R4R A;  4LCL A;  3HUN A;  1WYC A;  3SS5 A;  1L0E A;  1K54 C;  4NK3 A;  2DCF A;  2Y2K A;  4PM8 A;  3W4O A;  1FQG A;  1ERM A;  3UDX A;  4KQR A;  2E8I A;  3SS4 A;  5CGS A;  1BLS A;  2IWD A;  5HL1 A;  4GD6 A;  3G35 A;  4KZ7 A;  3HVF A;  2XR0 A;  1MWS A;  3FZC A;  4D2O A;  1VQQ A;  4WEK A;  1K56 A;  2H5S A;  3CZD A;  3HUO A;  3NC8 A;  3VFH A;  2XDM A;  1YMX A;  3UDF A;  2PU4 A;  4S2M A;  3BFD A;  4WEJ A;  2Y2G A;  3A3I A;  4JKT A;  4HEF A;  1E4D A;  5BOH A;  4KQO A;  4ZDX A;  2Y2P A;  1K6R A;  5EEC A;  1CK3 A;  4OP8 A;  1VM1 A;  2ZQA A;  4FD8 A;  4P87 A;  3O87 A;  1KDS A;  2Y91 A;  3LCE A;  1KE3 A;  4KZ5 A;  1MWR A;  3PBS A;  2JCH A;  1FCM A;  3IXD A;  4PM7 A;  1YLW A;  4LV0 A;  3IWQ A;  2X71 A;  5EVI A;  4PPR A;  5EVI D;  5FDH A;  2XFS A;  1YLZ A;  4Y0O A;  2ZM8 A;  3FV7 A;  2OV5 A;  3TSG A;  2ZLY A;  3N6I A;  1KE0 A;  4QU3 A;  3MXR A;  4DXB A;  4HES A;  1K4E A;  1HZO A;  2VGJ A;  3IF5 A;  1KVL A;  1PI5 A;  4S2K A;  4Y7P A;  5EUA A;  4E3K A;  5JYP A;  5DTT A;  3B3X A;  4E6X A;  5E2G A;  1IKI A;  5I94 A;  1M40 A;  4BLM A;  1ZC2 A;  1XA7 A;  3D4F A;  4R0Q A;  2OLV A;  3G34 A;  5E2F A;  3CMZ A;  3IF6 B;  4KZB A;  4FCF A;  4S2N C;  3W8K A;  1K55 A;  4MBK A;  3IXG A;  4IED A;  5DF7 A;  3WS1 A;  4GZB A;  4IVI A;  5A90 A;  4XUX A;  5FI7 A;  3PBN A;  1FCO A;  3G30 A;  1WE4 A;  1KE4 A;  2P74 A;  1ONG A;  3O86 A;  3VP1 A;  4B4X A;  1DJC A;  4MBH A;  5DTS A;  2HPB A;  2V2F F;  2IWC A;  5GLB A;  2UWX A;  3QNB A;  3C4P A;  3SS3 A;  2A3U A;  3NBL A;  4GOG A;  2PU2 A;  1W79 A;  3HLW A;  2WAD A;  2ZQ8 A;  2CC1 A;  4EWF A;  1FSW A;  1ERO A;  2HDU A;  5KMW A;  5KSH A;  4FH2 A;  3IWI A;  5M1A A;  3VFF A;  1K57 C;  1LHY A;  5DF9 A;  4K0W A;  1K25 A;  4X53 A;  3P98 A;  4RX2 A;  1LI0 A;  4WEL A;  1BLH A;  2HP6 A;  1IYQ A;  4OPY A;  1H8Z A;  3HRE A;  4DF6 A;  2WGI A;  2WGW B;  4C3Q A;  1ESI A;  2C5W B;  3JYI A;  5AQ9 A;  2Y2N A;  3VP4 A;  4JF4 A;  1ZKJ A;  2XFT A;  1MXO A;  2I72 A;  1OME A;  1H5X A;  1PZP A;  2JE5 A;  2ZC7 A;  5GL9 A;  4KQQ A;  4B4Z A;  3N8L A;  2XK1 A;  2WZX A;  2ZQ7 A;  4R3B A;  3SH9 A;  1N9B A;  3MXS A;  4WZ4 A;  3FKW A;  5U47 A;  2WGV A;  2WUQ A;  3TOI A;  4CPK A;  5CHM A;  4CJN A;  3G2Y A;  3NDE A;  2G2U A;  3DW0 A;  4NET A;  4E3J A;  1TEM A;  3A3F A;  1IYS A;  5CER A;  4Y0T A;  4EBP A;  1NZO A;  3OC2 A;  4O7D A;  4HBT A;  1E3U A;  3ZFZ A;  1G6A A;  1W5D A;  3QHY A;  3BEC A;  4E3M A;  1ES3 A;  1MWT A;  2EFX A;  1CEF A;  3RXW A;  1NY0 A;  1XA1 A;  3PBQ A;  3UPN A;  3ZVW A;  3BM6 A;  3G31 A;  2FFY A;  4N1X A;  4DDS A;  5FAT A;  3CG5 A;  2WYX A;  3M6B A;  3HLB A;  3SH8 A;  1PYY A;  3A3E A;  5A92 A;  3MZE A;  2J8Y A;  1NXY A;  3UO9 A;  4GKU A;  3UN7 A;  3IHA A;  2WAE A;  4ID4 A;  3UE0 A;  4BEN A;  5GLD A;  4WYY A;  1FR6 A;  1PWC A;  1Q2P A;  4GB7 A;  3HLG A;  1E25 A;  4KZ3 A;  5FA7 A;  5FQI A;  4GDB A;  3G2Z A;  5FQJ A;  4FSF A;  4S2J A;  3EQV A;  3M2J A;  2ZJ9 A;  4OP5 A;  3S22 A;  3S1Y A;  1K56 D;  4KG2 A;  2H0T A;  2EFU A;  3UY6 A;  2Y2L A;  4S2P A;  3RXX A;  2P9V B;  3WS2 A;  2Y2J A;  3MZD A;  3C5A A;  5DVA A;  5EVI C;  4BL3 A;  5M19 A;  1YLT A;  4JBF A;  4KEN B;  5E2H A;  2ZQD A;  2RCX A;  2XD1 A;  1GCE A;  1L0F A;  4BL2 A;  2XD5 A;  4UA6 A;  5F1F A;  5CRF A;  5HAP A;  1W7F A;  4KZA A;  3AGE A;  5HAI A;  4C6Y A;  1K6S A;  4K0X A;  2V1Z A;  1C3B A;  4FH4 A;  1G68 A;  1XGI A;  5KZH A;  4L0L A;  5CEB A;  4JLF A;  1FR1 A;  1KDW A;  2RL3 A;  1JWZ A;  3PBR A;  4WZ5 A;  5FQQ A;  3WRT A;  4KZ6 A;  1K4F A;  1AXB A;  2EXB A;  4OQI A;  4OOL A;  4MBF A;  5GHY A;  4GNU A;  5AQB A;  3UPP A;  4OH0 A;  4EBN A;  1K55 C;  3G4P A;  5EVI B;  4U0X A;  1L2S A;  3C7U A;  3PAG A;  3ZG8 B;  1WYB A;  4DE0 A;  3V5M A;  1PWG A;  3LY3 A;  1MBL A;  4A5R A;  5E43 A;  2R9X A;  3OPL A;  1GA9 A;  3EQU A;  1Q2Q A;  3VOZ A;  5CXW A;  1BZA A;  2EX8 A;  4KZ4 A;  4RVA A;  1PW1 A;  4QD4 A;  3IT9 A;  1YQS A;  1RP5 A;  4XXR A;  2IWB A;  2X01 A;  4F94 A;  4X69 A;  3I7J A;  1HD8 A;  1NYM A;  1BUL A;  1GHI A;  1RGZ A;  1BSG A;  1CEG A;  2DNS A;  3OCL A;  5DF8 A;  4EQI A;  3MBZ A;  5EOO A;  1S6R A;  4QJG A;  3OCN A;  4JPM A;  3Q7V B;  4DDY A;  4X55 A;  1IEM A;  3LY4 A;  2V20 A;  5TR7 A;  3WRZ A;  1IKG A;  5GHX A;  1ONH A;  5CTN A;  1PIO A;  2QMI A;  3SH7 A;  1PI4 A;  1N4O A;  4N92 A;  1O07 A;  1HVB A;  3VSL A;  1EI5 A;  4JXW A;  5FQM A;  3VMA A;  4PMA A;  4U0T A;  2WKH A;  5CGX A;  3V39 A;  5FAS A;  3UDI A;  4JXG A;  2WKE A;  3IF6 A;  3ZHH A;  3WS5 A;  2WK0 A;  2J7V A;  4E3N A;  2JC7 A;  4UA9 A;  1GHP A;  5FAQ A;  5TFQ A;  3BEB A;  1L0G A;  3P09 A;  1PZO A;  3ITB A;  3Q82 A;  3V3R A;  5EOE A;  4U3T A;  1XKZ A;  4DKI A;  4JXS A;  3N8R A;  4E3L A;  5GHZ A;  1EWZ A;  3TG9 A;  1JWP A;  4N9K A;  1M6K A;  4OPZ A;  3PBT A;  4LEN A;  3ZGA B;  2X02 A;  3HLC A;  3E2L A;  4IBX A;  5EVL A;  1BUE A;  4OLG A;  1U60 A;  3HLD A;  3VP3 A;  1YLP A;  2Z2L B;  1HTZ A;  5TGF A;  2ZC3 B;  2XH9 A;  4RX3 A;  3GSG A;  1SKF A;  3Q7Z A;  4S2O A;  1KGE A;  1NZU A;  5FQK A;  1FCN A;  2Y2Q A;  4LCM A;  1XXM A;  2XGN A;  3M6H A;  3ZNT A;  4OON A;  1PWD A;  4OPR A;  1TDG A;  5HX9 A;  1ES2 A;  1SDN A;  2ZM0 A;  3VSK A;  2ZMA A;  4H8R A;  2WGW A;  4Y0U A;  3OZH A;  4PM6 A;  5AQ7 A;  5M18 A;  3ZCZ A;  4OQG A;  5CHU A;  3VP0 A;  3ZG5 A;  5CEC A;  3PTE A;  1XGJ A;  1E3U D;  3N7W A;  3NIA A;  1LL5 A;  2PBY A;  2ZC6 B;  5CHJ A;  2ZD8 A;  3DWZ A;  3NCK A;  4PM9 A;  5L2F A;  4QB8 A;  3CJM A;  1XPB A;  3IWO A;  1MWU A;  5D3O A;  3ISG A;  4B88 A;  3V50 A;  1XP4 A;  3N8S A;  3MZF A;  2HDS A;  4DE3 A;  3C4O A;  1DJA A;  4ZBE A;  5G18 A;  3V3S A;  1JTG A;  1I2W A;  1FOF A;  1H8Y A;  3LEZ A;  1KGF A;  2XLN A;  2QZ6 A;  4ZTK A;  4N1H A;  4IVK A;  4GN2 A;  4OQ0 A;  3ITA A;  4X56 A;  3G32 A;  2Q9M A;  4KG6 A;  5A93 A;  3IHB A;  5CED A;  4UAA A;  4KZ8 A;  4OOY A;  5EE8 A;  4HBU A;  2HP9 A;  2J9O A;  2ZC4 B;  1BLP A;  1J9M A;  1RCJ A;  4ZAM A;  5FAP A;  4E3O A;  1K38 A;  5HW3 A;  2Y2O A;  5FSR A;  1I5Q A;  4ZJ1 A;  4UHU A;  1Y54 A;  4QY5 A;  4KG5 A;  4WZ5 C;  5J8X A;  3GVB A;  2DRW A;  3DWK A;  1IEL A;  4UA7 A;  3BLS A;  4X6T A;  4YIN A;  3W4P A;  3IH9 A;  2XF3 A;  1JWV A;  5IHV A;  4WM9 A;  3Q07 A;  3SOI A;  5A91 A;  1YMS A;  4R3J A;  1GHM A;  3LO7 A;  3FKV A;  1YT4 A;  2JBF A;  3UNW A;  2Y2I A;  2BLS A;  5HFO A;  3GR2 A;  3ZNY A;  2EX2 A;  2Y2M A;  5HAQ A;  4PM5 A;  2R9W A;  2G2W A;  1XX2 A;  2P9V A;  3GTC A;  3OPR A;  2Y2H A;  3VOY A;  3BYD A;  2ZQ9 A;  1IYO A;  3NI9 A;  1KGG A;  4BD0 A;  5FI2 A;  1QME A;  2Y55 A;  1BT5 A;  3N4I A;  4P6B A;  1K54 A;  4N9L A;  2GDN A;  3MKF A;  1L0D A;  3VP2 A;  5HAR A;  2VGK A;  3ZG0 A;  4C75 A;  2B5R A;  3BFF A;  3BRM A;  4OPQ A;  1Z6F A;  2Q9N A;  4GD8 A;  4YFM A;  3UPO A;  4R4S A;  2ZC5 B;  3HL9 A;  4LV1 A;  5FQ9 A;  5GLC A;  3UE1 A;  1MY8 A;  1W8Y A;  1NYY A;  1ZG4 A;  4WMC A;  1BTL A;  4WMC D;  2J9P A;  3HLE A;  2XQZ A;  3IF6 C;  4EV4 A;  1TDL A;  3M2K A;  4P0M A;  4BJP A;  3C7V A;  4M3K A;  3WS0 A;  1SHV A;  3O88 A;  4QHC A;  3W4Q A;  2WZZ A;  5F83 A;  1DY6 A;  5FAO A;  3BFE A;  4MNR A;  1SCW A;  4MEZ A;  4LV3 A;  2Z2M B;  3GRJ A;  1ESU A;  3UE3 A;  2A49 A;  1RGY A;  1JVJ A;  3FYZ A;  4GDN A;  2C6W B;  3HLF A;  4E3I A;  3RJU A;  1FSY A;  5F1G A;  4Q8I A;  2WKI A;  4R1G A;  2HDR A;  1MKI A;  4ZJ3 A;  1CI8 A;  4KZ9 A;  1KVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...