5EVIC

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
356
structure length
350
Chain Sequence
b'AALDTLVQTEARKVMQENNITGLSIAITRHGQQFYNYGVASATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFKAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDKQTLYAQGYNTLDEPVRVNPGILAAEAYGVSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVKLAYRILQHAEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
molecule tags Hydrolase
source organism Pseudomonas syringae pv. tomato
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
total genus 101
structure length 350
sequence length 356
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviC00
4H8RA 4KG6A 4GB7A 2EX8A 2E8IA 4JF5A 5DVAA 1XP4A 1W79A 1WE4A 2BG1A 2ZD8A 3WRZA 4UA6A 4BENA 5A91A 1IKIA 3PAGA 3I7JA 4MLLA 4OPQA 3S1YA 3IF6C 1YLTA 5F1GA 4KQQA 4Q8IA 1E3UA 4LV0A 2JCHA 2UWXA 2G2WA 4KZ5A 4O7DA 1DY6A 2ZC4B 3HLWA 5FSRA 1YM1A 2Y2OA 4U0XA 3SS4A 4YFMA 5CXWA 4PM9A 2Y2QA 1IEMA 4X68A 4XXRA 1XX2A 1IYQA 1I5QA 1Q2PA 1FSYA 2EXAA 5DTSA 3FZCA 4GN2A 3IWOA 1BSGA 3IWIA 3GMWA 1G6AA 5E2FA 3PBQA 3A3JA 3DW0A 4WZ5C 4EV4A 4WELA 3GQZA 2V1ZA 4HBUA 4JXWA 3QHYA 4R0QA 4WYYA 3ZCZA 3M2KA 3PBTA 1DJCA 4MNRA 4CPKA 2GDNA 3WWXA 1LL9A 3OPLA 5EOEA 5HAQA 1IELA 2ZM2A 4RVAA 2EFUA 4C6YA 1YLJA 4GDBA 2Y2PA 5KSCA 3G4PA 4Z9QA 2EX6A 3OPRA 3BFEA 4X56A 2XF3A 4Y0OA 1C3BA 3BM6A 3G35A 3ISGA 3G32A 1E25A 1QMFA 1MXOA 1BT5A 1PZPA 1MPLA 2OLVA 3HBRA 5E2EA 3E2LA 1DJBA 5AQAA 2R9WA 3SH7A 2WYXA 3SS3A 2C5WB 4OH0A 2X02A 5FQKA 1KDSA 3NBLA 2WGIA 4OONA 4GNUA 1FCOA 1PZOA 3CJMA 2CC1A 1ZC2A 3BLMA 3MXSA 3P98A 4R3BA 2HDRA 3UNWA 2RCXA 4LENA 4E6XA 4HEFA 4EUZA 2Q9NA 3ZG9B 3IT9A 3NCKA 3B3XA 5E2GA 3IHAA 4KG2A 2WZZA 2H10A 1H8YA 1SDNA 2ZQ7A 4L0LA 5AQBA 2VGKA 5DTKA 2J9OA 5E43A 3PBNA 4BJPA 2EFXA 2ZC6B 4OPYA 4OPZA 5BOHA 3O87A 3MKFA 1ES5A 2WKIA 1EROA 3BYDA 1PWDA 5TR7A 4DE2A 1QMEA 4X55A 5A93A 1CI8A 3A3EA 5GHXA 3O3VA 1CEGA 1H5XA 5EUAA 2XD5A 3LY4A 4KZ9A 4KG5A 5CRFA 1JWPA 2ZLYA 4R3JA 3A3IA 3G31A 2XFTA 3BECA 1YLWA 2Y4AA 4KZ6A 3ZNYA 3C5AA 4LCMA 5AQ9A 2Y2JA 1I2SA 3HUOA 1EWZA 3Q1FA 4PM6A 1LHYA 1N4OA 3UPPA 2Y2IA 4GDNA 1KVLA 1K54A 2PU2A 3UPNA 4BL3A 4E3KA 1SDEA 2DNSA 1K6SA 2WKHA 2XK1A 4WZ4A 2ZQCA 1WYBA 4OOMA 4F94A 1GHIA 5KMWA 1ES2A 5FQJA 2X71A 2XR0A 5EVID 4LV2A 3TOIA 1L0FA 3ZG8B 2XGNA 4HBTA 4EBPA 5CGSA 1K25A 3EQVA 5EVIB 2HP6A 3MFDA 5FASA 2XEPA 1ESIA 2DRWA 4ZDXA 1BTLA 5CTMA 2HDUA 3MZEA 4IVKA 3VOYA 1NY0A 1K57C 3BFDA 4WMCA 4JXGA 1FOFA 1MWUA 3V3SA 4DKIA 1BZAA 5GLDA 4BLMA 3AGEA 3S4XA 2XD1A 1IYSA 4JXVA 1VM1A 5FQMA 4E3NA 3SH9A 5CGXA 1CK3A 1YQSA 4R4SA 4DE3A 2JBFA 4ZJ2A 2H0TA 3M6HA 1L0GA 5M19A 3EQUA 1PW1A 1ZG6A 4WEJA 1AXBA 1J9MA 2ZC7A 3ZG0A 4IBXA 2WKEA 3VP3A 5FI6A 1GA9A 3IF6B 4P0MA 5GLBA 3W4QA 3VMAA 1TDLA 3VFFA 5HAIA 3UY6A 3PBRA 3RXXA 4KZ7A 4IEDA 3HUNA 3E2KA 3HVFA 3UDIA 3ZNTA 3C7UA 4DRTA 5CEDA 3WS5A 1M6KA 3VSLA 3Q7VA 1K38A 4RX2A 3BFCA 3A3FA 1TEMA 1K4EA 3BLSA 2Z2MB 2J8YA 3UDFA 5F83A 1KGFA 3IHBA 4E3JA 3ITAA 4GD8A 4JKTA 3MBZA 4LCLA 2IWBA 3W8KA 2Y2HA 1H8ZA 2ZQAA 3P09A 1E4DA 1XXMA 4OOLA 5FQIA 3IQAA 2A49A 3Q81A 1HTZA 2Y2NA 1U60A 1GCEA 1PYYA 3WRTA 3M2JA 4DDSA 1ONHA 3G2YA 4EWFA 5GHZA 2EX2A 1S6RA 3RXWA 3AGDA 1XPBA 4EBLA 4X53A 3V3RA 5FAQA 4DF6A 3BFFA 3N8LA 4N92A 1E3UD 2QPNA 2Y91A 4MEZA 3QNCA 1MKIA 3OZHA 3PAEA 3Q07A 3ZHHA 5EVIC 1ES4A 3W4OA 1KVMA 4X6TA 1GHMA 1FR1A 5DTTA 3BEBA 3VP2A 3S22A 4OQHA 3VOZA 3OPHA 3GVBA 2WAEA 5IHVA 1S0WA 3W4PA 5I94A 4RX3A 2H0YA 3TG9A 1K55A 4UA9A 4JLFA 3G34A 4C75A 3IWQA 4EBNA 4KZ8A 1YMSA 4U0TA 5HW3A 4N9LA 5EOOA 2Y59A 3DWZA 4KENB 3PBSA 4OQIA 1ZKJA 1NJ4A 3IXDA 3ITBA 5CGWA 2WUQA 4UA7A 5A90A 3SS5A 1O7EA 1PIOA 4OLDA 1W8QA 3VSKA 4PM5A 3ZVWA 3ZG7B 1CI9A 2A3UA 2RL3A 4IBRA 2XH9A 3G2ZA 2Y2LA 4S2LA 3HLDA 5CHJA 3GR2A 2WGWB 5FQ9A 5M18A 3ZVTA 3GV9A 3DWKA 4GZBA 1FR6A 3RJUA 1EI5A 1L0EA 4GD6A 3OCLA 2Y2GA 2HDQA 5FDHA 4P87A 4KQOA 5FQQA 5GLAA 5A92A 3QNBA 4S2OA 3SH8A 3HUMA 1ZG4A 4S2JA 4DXBA 3NDGA 4Y7PA 5CHMA 2XLNA 4MBKA 2Y55A 4NK3A 3ZFZA 1GA0A 1HVBA 1KGGA 1XA7A 1YMXA 4WM9A 2B5RA 4S2PA 4Y0UA 1K56A 3V50A 4WMCD 5U47A 4JPMA 3N7WA 4BQMA 4ZJ3A 4LV1A 5D3OA 4K0WA 4R23A 3HLFA 4S2KA 4GOGA 4E3LA 4ID4A 4B4XA 3MKEA 4PPRA 1ALQA 1BUEA 4FH2A 4OP8A 4EQIA 2EX9A 2FFYA 1FQGA 4MBHA 1ESUA 1FCNA 4UHUA 2ZM8A 5CEBA 4S2MA 2V2FF 3IXGA 3UN7A 1SCWA 1FSWA 4P6BA 1XA1A 3MXRA 4ZBEA 3HL9A 1PW8A 2ZC5B 5L2FA 4ZTKA 5M1AA 4QJGA 1JTGA 4S2NA 2OSUA 1BULA 4GKUA 4KZBA 5CTNA 3LEZA 1SKFA 5HL1A 3D4FA 1MWTA 4FSFA 3G30A 4QU3A 4QB8A 1N9BA 1RGZA 1JWZA 4JXSA 2WAFA 4KZ3A 2OLUA 4K91A 4OVDA 3WS1A 4DXCA 3N8RA 2EXBA 1I2WA 3CZDA 4S2IA 3O86A 2HPBA 2XFSA 4S2NC 1CEFA 2J9PA 5G18A 3V5MA 3OC2A 1HD8A 3UO9A 4E6WA 4QD4A 4XUZA 4HESA 5J8XA 1JTDA 4KZ4A 1K54C 4E3IA 2C6WB 3BRMA 5TFQA 1K55C 1HZOA 3PTEA 4JF6A 3C7VA 1Q2QA 1YLPA 1NZOA 1K56D 2G2UA 3NY4A 4OKPA 2HP5A 3AGFA 3JYIA 2BLSA 2OV5A 1K4FA 2P9VB 1TVFA 1MWRA 3WS0A 2DCFA 5DF9A 3V39A 4N9KA 3PBOA 3GSGA 1WYCA 1NXYA 5GLCA 1M40A 5KSHA 4P85A 1RCJA 2IWCA 1NRFA 2XQZA 1NZUA 1W7FA 1KGEA 3N6IA 5HX9A 3FKWA 1RGYA 4FCFA 5GHYA 5EE8A 5EVIA 1XGIA 3VP1A 2ZQ9A 4QY6A 3OPPA 1FCMA 1LI0A 3N8SA 3TSGA 4CJNA 1BLHA 5FAPA 3CG5A 3OCNA 2WGWA 3IXHA 2WADA 1IYOA 4RA7A 3VFHA 3C4OA 4JBFA 2ZJ9A 1OMEA 2P9VA 1NYYA 3LY3A 4PM8A 2J7VA 5CERA 4E3MA 3FYZA 4K0XA 1BLPA 4ZJ1A 4DDYA 5DF7A 2FFFB 2PBYA 4BL2A 1JWVA 4FH4A 2ZQ8A 4PMAA 3HLCA 1ERMA 1BLCA 4MBFA 1L2SA 1W5DA 2QMIA 3IF6A 4U3TA 3VP4A 1PWGA 4QHCA 3WS4A 1LL5A 1YLYA 5KZHA 3NDEA 1TDGA 2WGVA 3HLGA 1MWSA 5DF8A 1SHVA 4WEKA 1K6RA 4N1HA 4DE1A 3HREA 3IH9A 2IWDA 3O88A 3N4IA 1KE4A 2H5SA 3BFGA 1RP5A 3WS2A 4DE0A 3HLEA 4D2OA 5TGFA 4N1XA 1XKZA 1ERQA 2JE5A 1Z6FA 2ZM0A 5FA7A 4ZAMA 4OPRA 4R4RA 3NI9A 5FI2A 3SOIA 3HLBA 4NETA 5HARA 1G68A 3VP0A 5EECA 1JVJA 1PWCA 2ZQDA 2ZMAA 4KQRA 3C4PA 4M3KA 4XUXA 4OOYA 1KE0A 5EVLA 2P74A 3LO7A 5E2HA 3MZFA 1IYPA 2V20A 4E3OA 3NC8A 1PI4A 2HDSA 1KDWA 1O07A 3IF5A 2Z2LB 1ES3A 2JC7A 3M6BA 2ZC3B 4IVIA 3UDXA 3IXBA 3IH8A 4B88A 1YT4A 1VQQA 4RYEA 1MY8A 5EPHA 4JF4A 2Y2KA 3MZDA 5FATA 4OP5A 3ZGAB 1LLBA 1KE3A 5F82A 1MBLA 2VGJA 4UAAA 3LCEA 3Q7VB 1W8YA 5CECA 4OLGA 5JYPA 3ZDJA 4BD0A 3Q7ZA 1L0DA 1BLSA 4BD1A 2R9XA 2WZXA 4X69A 4LV3A 3UE1A 3GTCA 2XDMA 1NYMA 5FI7A 4PM7A 3CMZA 5FAOA 4B4ZA 5AQ7A 4KZAA 4YINA 2X01A 3GRJA 3NIAA 5HFOA 4OQGA 3FWLA 4QY5A 1PI5A 4FD8A 3FKVA 4OQ0A 5HAPA 3ZG5A 4C3QA 1GHPA 1DJAA 4WBGA 5GL9A 3UE0A 4Y0TA 2I72A 3UE3A 3UPOA 5JYOA 2QZ6A 1XGJA 3DTMA 2Y2MA 1YLZA 3FV7A 1K57A 1ONGA 1IKGA 2HP9A 4A5RA 5CHUA 2PU4A 2WK0A 5F1FA 4WZ5A 1LI9A 4R1GA 1Y54A 2Q9MA 3Q82A 3A3DA
chains in the Genus database with same CATH superfamily
4GB7A 2EX8A 2E8IA 4JF5A 2BG1A 4HP4A 4ZRRA 3IBRA 3SZTA 3BWLA 4KQQA 1E3UA 3MQ0A 5EM0A 3D72A 3HLWA 3CAXA 1YM1A 2Y2OA 4PM9A 2Y2QA 3PXPA 4EU0A 3P7NA 1XX2A 4GN2A 1G6AA 4WZ5C 3UB6A 3E4PA 4WELA 3VE4A 4JXWA 3QHYA 4R0QA 3M2KA 4L9EA 1LL9A 4C6YA 2GZAA 1YLJA 5HDDA 2Y2PA 3BFEA 2M1CA 1C3BA 3BM6A 3G35A 3G32A 1E25A 1PZPA 1MPLA 3HBRA 3SH7A 3E2LA 4X25A 2WYXA 5J3WA 3T12B 2WGIA 4GNUA 4R3BA 2HDRA 3UNWA 4HEFA 4E04A 5E2GA 3F1PA 2WZZA 2P08A 1H8YA 1XJ2A 2JKFA 5KIZA 3VOLA 1EROA 3BYDA 2M7UA 1H3QA 4GHIA 4X55A 1LSXA 1IFQA 5GHXA 1G5UA 1CEGA 2XD5A 1YPRA 3G31A 2XFTA 3CUEC 3C5AA 3Q1FA 1LHYA 4YNRA 3R7WB 3UPPA 4IUKA 3UPNA 4E3KA 2NUTC 2J3TD 2XK1A 2KX6A 3H7WB 4WZ4A 4OOMA 3GDIA 4F94A 3A0SA 2X71A 5HWTA 2V8FA 4EBPA 5EVIB 2XEPA 3C2WA 4MN7A 2J3TC 2L1MA 4JXGA 1FOFA 3V3SA 1BZAA 3AGEA 4E3NA 4JXVA 3CITA 3SH9A 3M6HA 3D3OA 1G6OA 1N9OA 1PW1A 4WEJA 2ZC7A 3D9YA 3W4QA 1TDLA 3PBRA 4PAUA 5DJUA 4BMWA 4KZ7A 3HUNA 3UDIA 1FILA 1HLUP 1M6KA 3BW6A 3A3FA 1TEMA 3BLSA 4BBVA 5F83A 4GD8A 5IT5A 1E4DA 1XXMA 3Q81A 1HTZA 1U60A 4LGWA 1ONHA 3G2YA 2W3FA 1S6RA 2W1RA 3RXWA 3AGDA 1XPBA 1OJ5A 2BASA 4ETXA 2W3DA 4X53A 5FAQA 3BFFA 2PR6A 2QPNA 2Y91A 4MEZA 1S66L 3TW8A 3PAEA 3ZHHA 5EVIC 5DTTA 1GHMA 3BEBA 3LIFA 1S4SA 4OQHA 3VOZA 3W4PA 4RX3A 4UA9A 4JLFA 4EBNA 4U0TA 5HW3A 2Y59A 4FOFA 3UE6A 2O9CA 4PKYA 5CGWA 5L07A 1PIOA 3VSKA 3EOIA 3ZG7B 4IBRA 2KOIA 4S2LA 4CLCB 3GR2A 2WGWB 5FQ9A 3ZVTA 3KYQA 5C5KA 1L0EA 4GD6A 2Y2GA 5FQQA 1N9LA 4KQOA 4S2OA 3SH8A 4KUKA 1KGGA 2WKQA 1YMXA 3T4TA 5LBRA 3N7WA 4K0WA 4EQ1A 3HLFA 4S2KA 1FQGA 5CEBA 3MQQA 4KUOA 1SCWA 3F1PB 3V67A 4P6BA 3MXRA 4QJGA 1JTGA 4KZBA 3LEZA 3D4FA 3A0VA 4JXSA 3NOTC 2OLUA 4K91A 3WS1A 2EXBA 3F1NA 2XFSA 1CEFA 3UO9A 4QD4A 5J8XA 1PRQA 4G3VA 2DMWA 1HZOA 3PTEA 4JF6A 3RH8B 1YLPA 1NZOA 4OKPA 2G2UA 3JYIA 1MWRA 1NLZA 5DF9A 3V39A 1NXYA 3IX4A 1M40A 5GLCA 4HJ6A 2VJWA 2ZL1B 2K2NA 1RGYA 5GHYA 3QP8A 4XT2B 2WKRA 3SW1A 3CG5A 3OCNA 2WADA 1STZA 2ZJ9A 3UMEA 1N9NA 2J7VA 4X1LA 1XFNA 4K0XA 4ZJ1A 3QP6A 4BL2A 4FH4A 1ERMA 4H6JB 3B42A 3NECA 1TDGA 3IH9A 4I3IA 3N4IA 2H5SA 1OPXA 1GSXA 3P01A 2ZOIA 5AVFA 1LT0A 2PRFA 1BYWA 3CUEA 5FI2A 2B95A 2L0WA 2ZOHA 1G68A 4K08A 1JVJA 2ZMAA 4M3KA 4XUXA 1CJFA 1MC0A 2PT7A 5E2HA 2V20A 4E3OA 1KDWA 1O07A 5K5BA 4IHQA 2EWWA 2O99A 1YT4A 4RYEA 5EPHA 2Y2KA 3MZDA 5FATA 1LLBA 2VGJA 3LCEA 3Q7VB 1W8YA 4CLCE 3BY8A 4BD1A 5F6AA 3E4QA 4Q0JA 4LV3A 3UE1A 2XDMA 1NYMA 2W27A 4PM7A 5FAOA 1D06A 3VE3A 4KZAA 4YINA 5HFOA 4OQGA 1PI5A 4FD8A 3H9WA 4ARZB 2A24A 4C3QA 3H7WA 1TS8A 4GCZA 2QZ6A 1XGJA 3DTMA 2K31A 3F1OA 5CHUA 2PU4A 1S67L 2EWVA 4WZ5A 1K0KA 4R1GA 1VEUB 4CQHA 2V0WA 5DVAA 2VV8A 1WE4A 1IKIA 4OPQA 3I7JA 2GNXA 3ZQ5A 1YLTA 5F1GA 2JKRM 3NHQA 2G2WA 5MC7A 4O7DA 5J4EA 4O8GA 5FSRA 2CMNA 4MDZA 2K7SA 4JGQA 5CXWA 2OAQ1 3HJIA 1F5MA 1ZTUA 4XXRA 5DTSA 1OT6A 3IWIA 3A3JA 3DW0A 2JKRI 4CLCA 4EV4A 5HPIA 4AFIA 4WYYA 1DJCA 5HDCA 4MNRA 2PD7A 2ZM2A 2EFUA 5KSCA 3LIAA 2YKFA 3G4PA 4X56A 3OPRA 1QMFA 4LLOB 2HV1A 1BT5A 5EM1A 4OH0A 2X02A 1KDSA 3NBLA 2HGVA 2UV0E 1FCOA 3CJMA 1LL8A 2RCXA 3FC7A 1T1CA 4EUZA 3IT9A 3IHAA 2H10A 1S1YA 1ODVA 2ZQ7A 1SDNA 4DJ3A 2VGKA 2EFXA 4P6ZS 2ZC6B 2WKIA 3GECA 4EETB 1PWDA 5TR7A 1YSPA 1QMEA 5A93A 1F2KA 3A3EA 3RFBA 3IBJA 1JWPA 3A3IA 1YLWA 3OOVA 4KZ6A 2V9AA 3EGXC 4LCMA 2Y2JA 2W3GA 4PM6A 3RTYA 1N4OA 3KX0X 1K54A 3T1QB 4BL3A 2W3EA 2DNSA 5FQJA 3K3CA 3EQVA 4LRXC 2HP6A 3LEQA 4B93A 3S7PA 4ZDXA 1BTLA 4WF0A 3VOYA 3BFDA 3S4XA 1IYSA 1TS0A 1CK3A 1YQSA 4IUHA 2JBFA 3E4OA 3EEAA 1Z09A 4DN0A 1L0GA 2W3HA 1ZG6A 1J9MA 5FI6A 3ZYTA 2AVXA 3LYXA 4Y15A 4NXBA 3UB7A 5DFXA 3F1NB 3BY9A 3ZNTA 3C7UA 4DRTA 2Q0OA 4MMNA 4DMZA 3VSLA 5TBMA 3Q7VA 1K38A 3BFCA 4GS9B 3LIDA 2QYBA 1K4EA 2Z2MB 4ME4A 2J8YA 3UDFA 1KGFA 3IHBA 4E3JA 4JKTA 4Y17A 2ZMFA 4RQ9A 3P09A 5J7EA 4D60A 1IOUA 2Y2NA 4EXOA 3WRTA 3M2JA 2PBDP 4DDSA 2EX2A 4UEYA 4WUJA 1ZHHB 1E3UD 4HY8A 3Q07A 3LR0A 5HL6A 1T19A 2W0NA 4YOFA 3GVBA 2WAEA 1S0WA 4C75A 1K55A 3G34A 4QWOA 1YMSA 3B47A 4N9LA 3UB5P 3DWZA 4EEPA 3IXDA 3ITBA 4HH2A 4UA7A 5A90A 2J3WA 3ZVWA 1CI9A 3G2ZA 3QP2A 2Y2LA 5M18A 5HD3A 1DRMA 2XROA 3C38A 4R70A 4X1MA 2HDQA 5FDHA 5A92A 3QNBA 1MZUA 4S2JA 3NDGA 4Y7PA 2XLNA 2Y55A 4NK3A 1GA0A 4LRZE 1XA7A 2B5RA 4S2PA 3V50A 4WMCD 5U47A 4ZJ3A 5D3OA 3S7OA 4E3LA 4PPRA 4FH2A 1ESUA 4BWIA 1TD5A 3CWFA 4NXEA 4WN5A 1XA1A 3HJKA 3HL9A 2ZC5B 1F9IA 4S2NA 3DTEA 4GKUA 5CTNA 5HL1A 4FSFA 1XFQA 4QU3A 1JWZA 2WAFA 2JKGA 2JKTI 1W63Q 2HPBA 4E6WA 5G18A 3V5MA 1JTDA 4EEUA 4JGOA 3BRMA 5HSQA 3C7VA 1Q2QA 5HWVA 3NY4A 2HP5A 2JHEA 2P9VB 4M4XA 4N9KA 3GSGA 3E0YA 3IX8A 4P85A 1RCJA 1OTBA 1W7FA 1GSWA 4L9FA 5EVIA 4QY6A 4WL9A 3OPPA 1VHMA 1FCMA 3N8SA 4CJNA 4BBTA 1IYOA 4RA7A 4UQIM 1BLPA 5DF7A 1JWVA 2ZQ8A 2KLIA 3O5YA 1D1JA 1W5DA 3CI6A 4HIAA 4QHCA 3WS4A 2WKPA 2HJEA 5DF8A 1SHVA 4WEKA 1K6RA 2HF6A 2QJ5A 2NUPC 1A0KA 3HLEA 4PHTA 3EWKA 3BQ8A 4Y5FA 1XKZA 1ERQA 4ZAMA 4R4RA 3VP0A 5EECA 2ZQDA 1Y4OA 4OOYA 1JNUA 3KSGA 2JKTM 2P74A 3MZFA 2ACGA 1PI4A 3DBAA 2Z2LB 2OWJA 3IH8A 2Y79A 1VQQA 4F3LB 1MY8A 4Q0IA 2QKPA 5F82A 1MBLA 2OAP1 5JYPA 5CX7A 1BLSA 3BJNA 5FI7A 4B4ZA 5F69A 1FIKA 3GRJA 5HZHA 5HAPA 3ZG5A 1GHPA 5G4ZA 1YKDA 4FTXA 2Y2MA 3PHYA 4GLQA 1K57A 2HP9A 4A5RA 1LI9A 1MKMA 3Q82A 2VKSA 3A3DA 4KG6A 3DTIA 1XP4A 3LI8A 1W79A 4BENA 1OTIA 4NXFA 4UA6A 5A91A 4Q8IA 1NWZA 4LV0A 2JCHA 3KSIA 4KZ5A 2Y8HA 2PR5A 2A2LA 2B18A 1LSVA 4X68A 1IYQA 1Q2PA 2VX8A 2EXAA 1D7EA 3FZCA 4O0PA 1BSGA 5E2FA 3TE8A 4HBUA 4GS9A 3ULFA 2GDNA 3WWXA 3OPLA 4UQIS 5EOEA 5HAQA 1IELA 4RVAA 4GDBA 4HHDA 3T4KA 4Y0OA 3ISGA 1MXOA 3BQAA 3NULA 5E2EA 1DJBA 4ARZA 2MJ6A 2R9WA 3LFVA 3SS3A 5FQKA 4OONA 4NG2A 3LUQA 3P98A 4LENA 3T1SA 3ZG9B 3NCKA 3B3XA 3L7HA 1J3WA 5AQBA 5L8MA 1OJGA 3PBNA 1AWIA 3KYEA 4OPYA 3MKFA 2XA7S 4DE2A 3PYPA 3EEHA 1CI8A 4PKYG 3MF0A 5EUAA 3LY4A 4I3JA 5IS1A 4R3JA 3ZNYA 2Y4AA 3UMDA 1I2SA 2O9AA 1EWZA 2R78A 3JVUA 4GDNA 1KVLA 1SDEA 1GHIA 4LV2A 2EA9A 3TOIA 3ZG8B 2XGNA 1T18A 4HBTA 5CGSA 3MFDA 5FASA 2PHYA 5CTMA 3CHWP 4IVKA 1K57C 2VV6A 4HOIA 4GW9A 1UWPX 2FZ0A 3A0RA 4DKIA 2XD1A 5FQMA 2XA7M 4R4SA 2H0TA 1PFLA 3T4SA 5M19A 2INWA 3FPVA 3IS2B 2VK3A 1GA9A 3IF6B 4P0MA 3L9KA 3FPWA 3VMAA 3VFFA 3KO6A 5TJJA 2P7JA 2HJ9C 4IEDA 3HVFA 5CEDA 3T50A 3ITAA 4I3AA 2J80A 4LCLA 2IWBA 1H8ZA 1SKOB 1TS7A 4OOLA 2V1AA 2PDRA 1GCEA 1PYYA 4LFUA 4HP9A 3MQOA 4QPRA 3V3RA 3N8LA 1SZVA 1MKIA 3OZHA 3R7WA 2BTFP 3W4OA 1FR1A 4H6JA 3VP2A 3S22A 3T4LA 3OPHA 5DFYA 3PBSA 4OQIA 1ZKJA 1NJ4A 1WA9A 1O7EA 3W2ZA 4OLDA 5FL3A 2A3UA 2XH9A 5G4YA 1ACFA 4O01A 5EFWA 3T4JA 3GV9A 4GZBA 1FR6A 1EI5A 3LIBA 1T1BA 4I38A 3HUMA 1SKOA 4DXBA 4MBKA 3ZFZA 1HVBA 3LICA 4WM9A 3QP1A 1K56A 5F68A 4R23A 4B4XA 3MKEA 1ALQA 1BUEA 1VETA 4EQIA 2EX9A 3F1OB 1FCNA 4S2MA 2V2FF 3IXGA 3UN7A 1FSWA 4FUWA 1S4RA 5L2FA 4ZTKA 4DJ2A 2OSUA 1SKFA 4Y2FA 1MWTA 4QB8A 4Y13A 4KZ3A 4HJ3A 4OVDA 4CLCD 4B9OA 2O0YA 1I2WA 4S2IA 4WLAA 4S2NC 3OC2A 1HD8A 2O9BA 4XUZA 4HESA 5L09A 4KZ4A 1K54C 3S7QA 2C6WB 4P6ZM 1UWNX 1K55C 4EUVA 3QP5A 1XJ3A 1P9WA 2OV5A 1K4FA 1TVFA 2H28A 4BBUA 3WS0A 2DCFA 1T1AA 3PBOA 1WYCA 5KSHA 5DKLA 3LR4A 1NRFA 1NZUA 3UB8A 5HWWA 1F98A 5HX9A 3N6IA 4JGPA 4FCFA 5EE8A 1XGIA 4IJGA 2ZQ9A 3T1RA 3VP1A 1LI0A 1BLHA 5FAPA 4HI4A 3IXHA 3C4OA 1NYYA 5CERA 1H0MA 4DDYA 2PBYA 4L9GA 3HLCA 1BLCA 4U3TA 3IF6A 3NDEA 3HLGA 1MWSA 5EVEA 3HREA 2IWDA 3MMHA 2ZMVA 1RP5A 4DE0A 4D2OA 4N1XA 2JE5A 3NI9A 4NETA 1OTEA 1KE0A 1P0ZA 5A8BA 1GSVA 1KOUA 1IYPA 3NC8A 4GHIB 2XRNA 3MFXA 2VA0A 1VB6A 3UDXA 3IXBA 5FDSA 2LB9A 3ZGAB 4UAAA 5CECA 4EERA 4OLGA 5I5LA 1L0DA 1OTAA 3KYZA 4GJ4A 3ICYA 2YKHA 3KSFA 2GX5A 3MR0A 3GTCA 2VGLS 3NIAA 4QY5A 3FKVA 3NOUC 4HH3A 3JPUA 5GL9A 4Y0TA 2KDKA 2QWSA 2PYPA 3UE3A 2HZ5A 5JYOA 3UPOA 4R3AA 1YLZA 3H82A 4HQAA 1IKGA 2WK0A 1Y54A 2Q9MA 5HDSA 4H8RA 3WRZA 2ZD8A 3PAGA 4MLLA 3S1YA 3IF6C 1PNEA 2LB5A 1L3LA 2UWXA 2Z6CA 1DY6A 2ZC4B 4NXGA 3MS6A 1CF0A 3OLOA 4U0XA 4YFMA 3SS4A 1IEMA 1I5QA 1FSYA 3IWOA 3GMWA 3PBQA 4II7A 3GQZA 2V1ZA 3ZCZA 3PBTA 4LRYC 4CPKA 3G6OA 2E8JA 1P97A 2EX6A 4Z9QA 4R38A 2XF3A 5IU1A 2OLVA 5AQAA 5HD5A 2C5WB 2QHKA 3K2NA 3LGOA 1P9RA 3FG8A 3K3DA 1PZOA 5TBMB 4I39A 2CC1A 1ZC2A 3BLMA 3MXSA 3H82B 4NEED 4E6XA 2V0UA 2Q9NA 4G3WA 5DKKA 4KG2A 1V9ZA 3DAVA 4L0LA 5DTKA 2J9OA 5E43A 4BJPA 3LIEA 4OPZA 3UB9A 3O87A 5BOHA 2VZWA 1ES5A 1YAXA 3O3VA 1H5XA 1DP9A 4KZ9A 4KG5A 5CRFA 1TS6A 1XJ6A 2ZLYA 4EW7A 3BECA 3KSHA 5AQ9A 3HUOA 2Y2IA 2PU2A 2QJ7A 1K6SA 2A24B 2WKHA 2ZQCA 1WYBA 2JN7A 1NRJA 5KMWA 1ES2A 2V8CA 5EVID 2XR0A 1L0FA 1K25A 4MCWA 1ESIA 2DRWA 2HDUA 2D02A 3CPTB 3MZEA 1NY0A 4WMCA 3HCYA 1MWUA 4HNBA 5GLDA 4BLMA 1VM1A 3MSHA 5CGXA 3S7NA 4DE3A 1VEUA 4ZJ2A 3B33A 3EQUA 1AXBA 3TJZC 3ZG0A 2GJ3A 4IBXA 2WKEA 3VP3A 5GLBA 4ESPA 4XT2A 5HAIA 3UY6A 3RXXA 3E2KA 3WS5A 4RX2A 1W63M 4KQDA 3MBZA 3W8KA 2Y2HA 3NJAA 2ZQAA 5DJTA 5FQIA 3IQAA 2A49A 1YSQA 4G3KA 3U4LP 2Z6DA 2P04A 2PD8A 4EWFA 5GHZA 1S1ZA 4EBLA 4MN6A 4DF6A 3T4QA 4N92A 3MXQA 3JVVA 3QNCA 1ES4A 4Y3IA 1KVMA 4X6TA 1XJ4A 2VV7A 5AVEA 2V1BA 3LR3A 1EW0A 3MJQA 5F5YA 1DP6A 5IHVA 5I94A 2H0YA 2OOLA 2VEAA 3TG9A 4LPZA 3IWQA 4KZ8A 5EOOA 4KENB 3C8CA 2WUQA 3SS5A 1W8QA 4PM5A 2RL3A 3OBFA 3HLDA 5L10A 5CHJA 3LI9A 3DWKA 3EGDC 3RJUA 3T1XA 1OTDA 3PR6A 3OCLA 5GLAA 4P87A 2ZL1A 5HPFA 1ZG4A 5CHMA 2OWHA 4Y0UA 4JPMA 4BQMA 4LV1A 4GOGA 4ID4A 2D01A 4OP8A 2FFYA 4MBHA 4Q0HA 4ETZA 4UHUA 2ZM8A 3CLOA 3IX3A 1LSWA 4ZBEA 1PW8A 5M1AA 2G7UA 1BULA 5FEFA 3G30A 1N9BA 1RGZA 1TF1A 4DXCA 2M7VA 3N8RA 4YWZA 3CZDA 3O86A 2J9PA 4E3IA 5TFQA 3U2AA 1K56D 3AGFA 2BLSA 3TRCA 2PYRA 2VGLM 3R4KA 4R6LA 3T4OA 2IWCA 2B02A 2XQZA 1OT9A 1KGEA 1V9YA 3FKWA 2W1TA 1CQAA 3CPTA 2I9VA 3TSGA 2WGWA 2L4RA 3VFHA 2VLGA 4JBFA 1OMEA 2P9VA 4JGRA 3LY3A 3QP4A 4PM8A 1UGUA 1H8MA 2IA2A 4E3MA 3FYZA 2FFFB 4HJ4A 4PMAA 4MBFA 3E98A 1L2SA 2QMIA 3VP4A 1PWGA 1LL5A 1YLYA 5KZHA 2WGVA 4N1HA 4DE1A 3O88A 2PAVP 1KE4A 3BFGA 5AJGA 3WS2A 2XSSA 4F3LA 5TGFA 5FA7A 1Z6FA 2ZM0A 2FH5A 1NLYA 4EESA 4OPRA 3DTKA 4CLCC 3SOIA 5HARA 3HLBA 1PWCA 4KQRA 3C4PA 5EVLA 3LR5A 3LO7A 5FEGA 3C30A 4MN5A 1Y28A 2HDSA 3IF5A 1ES3A 2JC7A 3M6BA 2ZC3B 4IVIA 4B88A 4JF4A 2W1TB 4OP5A 1G28A 1KE3A 1VETB 2ZBBA 1DP8A 3ZDJA 4I5SA 4BD0A 3Q7ZA 5EV0A 2R9XA 2WZXA 4X69A 4Z1WA 3CMZA 5AQ7A 3IS2A 1X0OA 2X01A 3FWLA 4OQ0A 3NOPC 4NKPA 1DJAA 4WBGA 3UE0A 3VV4A 2I72A 3FV7A 1ONGA 5F1FA
chains in the Genus database with same CATH topology
4H8RA 4KG6A 4GB7A 2EX8A 2E8IA 4JF5A 5DVAA 1XP4A 1W79A 1WE4A 2BG1A 2ZD8A 3WRZA 4UA6A 4BENA 5A91A 1IKIA 3PAGA 3I7JA 4MLLA 4OPQA 3S1YA 3IF6C 1YLTA 5F1GA 4KQQA 4Q8IA 1E3UA 4LV0A 2JCHA 2UWXA 2G2WA 4KZ5A 4O7DA 1DY6A 2ZC4B 3HLWA 5FSRA 1YM1A 2Y2OA 4U0XA 3SS4A 4YFMA 5CXWA 4PM9A 2Y2QA 1IEMA 4X68A 4XXRA 1XX2A 1IYQA 1I5QA 1Q2PA 1FSYA 2EXAA 5DTSA 3FZCA 4GN2A 3IWOA 1BSGA 3IWIA 3GMWA 1G6AA 5E2FA 3PBQA 3A3JA 3DW0A 4WZ5C 4EV4A 4WELA 3GQZA 2V1ZA 4HBUA 4JXWA 3QHYA 4R0QA 4WYYA 3ZCZA 3M2KA 3PBTA 1DJCA 4MNRA 4CPKA 2GDNA 3WWXA 1LL9A 3OPLA 5EOEA 5HAQA 1IELA 2ZM2A 4RVAA 2EFUA 4C6YA 1YLJA 4GDBA 2Y2PA 5KSCA 3G4PA 4Z9QA 2EX6A 3OPRA 3BFEA 4X56A 2XF3A 4Y0OA 1C3BA 3BM6A 3G35A 3ISGA 3G32A 1E25A 1QMFA 1MXOA 1BT5A 1PZPA 1MPLA 2OLVA 3HBRA 5E2EA 3E2LA 1DJBA 5AQAA 2R9WA 3SH7A 2WYXA 3SS3A 2C5WB 4OH0A 2X02A 5FQKA 1KDSA 3NBLA 2WGIA 4OONA 4GNUA 1FCOA 1PZOA 3CJMA 2CC1A 1ZC2A 3BLMA 3MXSA 3P98A 4R3BA 2HDRA 3UNWA 2RCXA 4LENA 4E6XA 4HEFA 4EUZA 2Q9NA 3ZG9B 3IT9A 3NCKA 3B3XA 5E2GA 3IHAA 4KG2A 2WZZA 2H10A 1H8YA 1SDNA 2ZQ7A 4L0LA 5AQBA 2VGKA 5DTKA 2J9OA 5E43A 3PBNA 4BJPA 2EFXA 2ZC6B 4OPYA 4OPZA 5BOHA 3O87A 3MKFA 1ES5A 2WKIA 1EROA 3BYDA 1PWDA 5TR7A 4DE2A 1QMEA 4X55A 5A93A 1CI8A 3A3EA 5GHXA 3O3VA 1CEGA 1H5XA 5EUAA 2XD5A 3LY4A 4KZ9A 4KG5A 5CRFA 1JWPA 2ZLYA 4R3JA 3A3IA 3G31A 2XFTA 3BECA 1YLWA 2Y4AA 4KZ6A 3ZNYA 3C5AA 4LCMA 5AQ9A 2Y2JA 1I2SA 3HUOA 1EWZA 3Q1FA 4PM6A 1LHYA 1N4OA 3UPPA 2Y2IA 4GDNA 1KVLA 1K54A 2PU2A 3UPNA 4BL3A 4E3KA 1SDEA 2DNSA 1K6SA 2WKHA 2XK1A 4WZ4A 2ZQCA 1WYBA 4OOMA 4F94A 1GHIA 5KMWA 1ES2A 5FQJA 2X71A 2XR0A 5EVID 4LV2A 3TOIA 1L0FA 3ZG8B 2XGNA 4HBTA 4EBPA 5CGSA 1K25A 3EQVA 5EVIB 2HP6A 3MFDA 5FASA 2XEPA 1ESIA 2DRWA 4ZDXA 1BTLA 5CTMA 2HDUA 3MZEA 4IVKA 3VOYA 1NY0A 1K57C 3BFDA 4WMCA 4JXGA 1FOFA 1MWUA 3V3SA 4DKIA 1BZAA 5GLDA 4BLMA 3AGEA 3S4XA 2XD1A 1IYSA 4JXVA 1VM1A 5FQMA 4E3NA 3SH9A 5CGXA 1CK3A 1YQSA 4R4SA 4DE3A 2JBFA 4ZJ2A 2H0TA 3M6HA 1L0GA 5M19A 3EQUA 1PW1A 1ZG6A 4WEJA 1AXBA 1J9MA 2ZC7A 3ZG0A 4IBXA 2WKEA 3VP3A 5FI6A 1GA9A 3IF6B 4P0MA 5GLBA 3W4QA 3VMAA 1TDLA 3VFFA 5HAIA 3UY6A 3PBRA 3RXXA 4KZ7A 4IEDA 3HUNA 3E2KA 3HVFA 3UDIA 3ZNTA 3C7UA 4DRTA 5CEDA 3WS5A 1M6KA 3VSLA 3Q7VA 1K38A 4RX2A 3BFCA 3A3FA 1TEMA 1K4EA 3BLSA 2Z2MB 2J8YA 3UDFA 5F83A 1KGFA 3IHBA 4E3JA 3ITAA 4GD8A 4JKTA 3MBZA 4LCLA 2IWBA 3W8KA 2Y2HA 1H8ZA 2ZQAA 3P09A 1E4DA 1XXMA 4OOLA 5FQIA 3IQAA 2A49A 3Q81A 1HTZA 2Y2NA 1U60A 1GCEA 1PYYA 3WRTA 3M2JA 4DDSA 1ONHA 3G2YA 4EWFA 5GHZA 2EX2A 1S6RA 3RXWA 3AGDA 1XPBA 4EBLA 4X53A 3V3RA 5FAQA 4DF6A 3BFFA 3N8LA 4N92A 1E3UD 2QPNA 2Y91A 4MEZA 3QNCA 1MKIA 3OZHA 3PAEA 3Q07A 3ZHHA 5EVIC 1ES4A 3W4OA 1KVMA 4X6TA 1GHMA 1FR1A 5DTTA 3BEBA 3VP2A 3S22A 4OQHA 3VOZA 3OPHA 3GVBA 2WAEA 5IHVA 1S0WA 3W4PA 5I94A 4RX3A 2H0YA 3TG9A 1K55A 4UA9A 4JLFA 3G34A 4C75A 3IWQA 4EBNA 4KZ8A 1YMSA 4U0TA 5HW3A 4N9LA 5EOOA 2Y59A 3DWZA 4KENB 3PBSA 4OQIA 1ZKJA 1NJ4A 3IXDA 3ITBA 5CGWA 2WUQA 4UA7A 5A90A 3SS5A 1O7EA 1PIOA 4OLDA 1W8QA 3VSKA 4PM5A 3ZVWA 3ZG7B 1CI9A 2A3UA 2RL3A 4IBRA 2XH9A 3G2ZA 2Y2LA 4S2LA 3HLDA 5CHJA 3GR2A 2WGWB 5FQ9A 5M18A 3ZVTA 3GV9A 3DWKA 4GZBA 1FR6A 3RJUA 1EI5A 1L0EA 4GD6A 3OCLA 2Y2GA 2HDQA 5FDHA 4P87A 4KQOA 5FQQA 5GLAA 5A92A 3QNBA 4S2OA 3SH8A 3HUMA 1ZG4A 4S2JA 4DXBA 3NDGA 4Y7PA 5CHMA 2XLNA 4MBKA 2Y55A 4NK3A 3ZFZA 1GA0A 1HVBA 1KGGA 1XA7A 1YMXA 4WM9A 2B5RA 4S2PA 4Y0UA 1K56A 3V50A 4WMCD 5U47A 4JPMA 3N7WA 4BQMA 4ZJ3A 4LV1A 5D3OA 4K0WA 4R23A 3HLFA 4S2KA 4GOGA 4E3LA 4ID4A 4B4XA 3MKEA 4PPRA 1ALQA 1BUEA 4FH2A 4OP8A 4EQIA 2EX9A 2FFYA 1FQGA 4MBHA 1ESUA 1FCNA 4UHUA 2ZM8A 5CEBA 4S2MA 2V2FF 3IXGA 3UN7A 1SCWA 1FSWA 4P6BA 1XA1A 3MXRA 4ZBEA 3HL9A 1PW8A 2ZC5B 5L2FA 4ZTKA 5M1AA 4QJGA 1JTGA 4S2NA 2OSUA 1BULA 4GKUA 4KZBA 5CTNA 3LEZA 1SKFA 5HL1A 3D4FA 1MWTA 4FSFA 3G30A 4QU3A 4QB8A 1N9BA 1RGZA 1JWZA 4JXSA 2WAFA 4KZ3A 2OLUA 4K91A 4OVDA 3WS1A 4DXCA 3N8RA 2EXBA 1I2WA 3CZDA 4S2IA 3O86A 2HPBA 2XFSA 4S2NC 1CEFA 2J9PA 5G18A 3V5MA 3OC2A 1HD8A 3UO9A 4E6WA 4QD4A 4XUZA 4HESA 5J8XA 1JTDA 4KZ4A 1K54C 4E3IA 2C6WB 3BRMA 5TFQA 1K55C 1HZOA 3PTEA 4JF6A 3C7VA 1Q2QA 1YLPA 1NZOA 1K56D 2G2UA 3NY4A 4OKPA 2HP5A 3AGFA 3JYIA 2BLSA 2OV5A 1K4FA 2P9VB 1TVFA 1MWRA 3WS0A 2DCFA 5DF9A 3V39A 4N9KA 3PBOA 3GSGA 1WYCA 1NXYA 5GLCA 1M40A 5KSHA 4P85A 1RCJA 2IWCA 1NRFA 2XQZA 1NZUA 1W7FA 1KGEA 3N6IA 5HX9A 3FKWA 1RGYA 4FCFA 5GHYA 5EE8A 5EVIA 1XGIA 3VP1A 2ZQ9A 4QY6A 3OPPA 1FCMA 1LI0A 3N8SA 3TSGA 4CJNA 1BLHA 5FAPA 3CG5A 3OCNA 2WGWA 3IXHA 2WADA 1IYOA 4RA7A 3VFHA 3C4OA 4JBFA 2ZJ9A 1OMEA 2P9VA 1NYYA 3LY3A 4PM8A 2J7VA 5CERA 4E3MA 3FYZA 4K0XA 1BLPA 4ZJ1A 4DDYA 5DF7A 2FFFB 2PBYA 4BL2A 1JWVA 4FH4A 2ZQ8A 4PMAA 3HLCA 1ERMA 1BLCA 4MBFA 1L2SA 1W5DA 2QMIA 3IF6A 4U3TA 3VP4A 1PWGA 4QHCA 3WS4A 1LL5A 1YLYA 5KZHA 3NDEA 1TDGA 2WGVA 3HLGA 1MWSA 5DF8A 1SHVA 4WEKA 1K6RA 4N1HA 4DE1A 3HREA 3IH9A 2IWDA 3O88A 3N4IA 1KE4A 2H5SA 3BFGA 1RP5A 3WS2A 4DE0A 3HLEA 4D2OA 5TGFA 4N1XA 1XKZA 1ERQA 2JE5A 1Z6FA 2ZM0A 5FA7A 4ZAMA 4OPRA 4R4RA 3NI9A 5FI2A 3SOIA 3HLBA 4NETA 5HARA 1G68A 3VP0A 5EECA 1JVJA 1PWCA 2ZQDA 2ZMAA 4KQRA 3C4PA 4M3KA 4XUXA 4OOYA 1KE0A 5EVLA 2P74A 3LO7A 5E2HA 3MZFA 1IYPA 2V20A 4E3OA 3NC8A 1PI4A 2HDSA 1KDWA 1O07A 3IF5A 2Z2LB 1ES3A 2JC7A 3M6BA 2ZC3B 4IVIA 3UDXA 3IXBA 3IH8A 4B88A 1YT4A 1VQQA 4RYEA 1MY8A 5EPHA 4JF4A 2Y2KA 3MZDA 5FATA 4OP5A 3ZGAB 1LLBA 1KE3A 5F82A 1MBLA 2VGJA 4UAAA 3LCEA 3Q7VB 1W8YA 5CECA 4OLGA 5JYPA 3ZDJA 4BD0A 3Q7ZA 1L0DA 1BLSA 4BD1A 2R9XA 2WZXA 4X69A 4LV3A 3UE1A 3GTCA 2XDMA 1NYMA 5FI7A 4PM7A 3CMZA 5FAOA 4B4ZA 5AQ7A 4KZAA 4YINA 2X01A 3GRJA 3NIAA 5HFOA 4OQGA 3FWLA 4QY5A 1PI5A 4FD8A 3FKVA 4OQ0A 5HAPA 3ZG5A 4C3QA 1GHPA 1DJAA 4WBGA 5GL9A 3UE0A 4Y0TA 2I72A 3UE3A 3UPOA 5JYOA 2QZ6A 1XGJA 3DTMA 2Y2MA 1YLZA 3FV7A 1K57A 1ONGA 1IKGA 2HP9A 4A5RA 5CHUA 2PU4A 2WK0A 5F1FA 4WZ5A 1LI9A 4R1GA 1Y54A 2Q9MA 3Q82A 3A3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H8R A;  4KG6 A;  4GB7 A;  2EX8 A;  2E8I A;  4JF5 A;  5DVA A;  1XP4 A;  1W79 A;  1WE4 A;  2BG1 A;  2ZD8 A;  3WRZ A;  4UA6 A;  4BEN A;  5A91 A;  1IKI A;  3PAG A;  3I7J A;  4MLL A;  4OPQ A;  3S1Y A;  3IF6 C;  1YLT A;  5F1G A;  4KQQ A;  4Q8I A;  1E3U A;  4LV0 A;  2JCH A;  2UWX A;  2G2W A;  4KZ5 A;  4O7D A;  1DY6 A;  2ZC4 B;  3HLW A;  5FSR A;  1YM1 A;  2Y2O A;  4U0X A;  3SS4 A;  4YFM A;  5CXW A;  4PM9 A;  2Y2Q A;  1IEM A;  4X68 A;  4XXR A;  1XX2 A;  1IYQ A;  1I5Q A;  1Q2P A;  1FSY A;  2EXA A;  5DTS A;  3FZC A;  4GN2 A;  3IWO A;  1BSG A;  3IWI A;  3GMW A;  1G6A A;  5E2F A;  3PBQ A;  3A3J A;  3DW0 A;  4WZ5 C;  4EV4 A;  4WEL A;  3GQZ A;  2V1Z A;  4HBU A;  4JXW A;  3QHY A;  4R0Q A;  4WYY A;  3ZCZ A;  3M2K A;  3PBT A;  1DJC A;  4MNR A;  4CPK A;  2GDN A;  3WWX A;  1LL9 A;  3OPL A;  5EOE A;  5HAQ A;  1IEL A;  2ZM2 A;  4RVA A;  2EFU A;  4C6Y A;  1YLJ A;  4GDB A;  2Y2P A;  5KSC A;  3G4P A;  4Z9Q A;  2EX6 A;  3OPR A;  3BFE A;  4X56 A;  2XF3 A;  4Y0O A;  1C3B A;  3BM6 A;  3G35 A;  3ISG A;  3G32 A;  1E25 A;  1QMF A;  1MXO A;  1BT5 A;  1PZP A;  1MPL A;  2OLV A;  3HBR A;  5E2E A;  3E2L A;  1DJB A;  5AQA A;  2R9W A;  3SH7 A;  2WYX A;  3SS3 A;  2C5W B;  4OH0 A;  2X02 A;  5FQK A;  1KDS A;  3NBL A;  2WGI A;  4OON A;  4GNU A;  1FCO A;  1PZO A;  3CJM A;  2CC1 A;  1ZC2 A;  3BLM A;  3MXS A;  3P98 A;  4R3B A;  2HDR A;  3UNW A;  2RCX A;  4LEN A;  4E6X A;  4HEF A;  4EUZ A;  2Q9N A;  3ZG9 B;  3IT9 A;  3NCK A;  3B3X A;  5E2G A;  3IHA A;  4KG2 A;  2WZZ A;  2H10 A;  1H8Y A;  1SDN A;  2ZQ7 A;  4L0L A;  5AQB A;  2VGK A;  5DTK A;  2J9O A;  5E43 A;  3PBN A;  4BJP A;  2EFX A;  2ZC6 B;  4OPY A;  4OPZ A;  5BOH A;  3O87 A;  3MKF A;  1ES5 A;  2WKI A;  1ERO A;  3BYD A;  1PWD A;  5TR7 A;  4DE2 A;  1QME A;  4X55 A;  5A93 A;  1CI8 A;  3A3E A;  5GHX A;  3O3V A;  1CEG A;  1H5X A;  5EUA A;  2XD5 A;  3LY4 A;  4KZ9 A;  4KG5 A;  5CRF A;  1JWP A;  2ZLY A;  4R3J A;  3A3I A;  3G31 A;  2XFT A;  3BEC A;  1YLW A;  2Y4A A;  4KZ6 A;  3ZNY A;  3C5A A;  4LCM A;  5AQ9 A;  2Y2J A;  1I2S A;  3HUO A;  1EWZ A;  3Q1F A;  4PM6 A;  1LHY A;  1N4O A;  3UPP A;  2Y2I A;  4GDN A;  1KVL A;  1K54 A;  2PU2 A;  3UPN A;  4BL3 A;  4E3K A;  1SDE A;  2DNS A;  1K6S A;  2WKH A;  2XK1 A;  4WZ4 A;  2ZQC A;  1WYB A;  4OOM A;  4F94 A;  1GHI A;  5KMW A;  1ES2 A;  5FQJ A;  2X71 A;  2XR0 A;  5EVI D;  4LV2 A;  3TOI A;  1L0F A;  3ZG8 B;  2XGN A;  4HBT A;  4EBP A;  5CGS A;  1K25 A;  3EQV A;  5EVI B;  2HP6 A;  3MFD A;  5FAS A;  2XEP A;  1ESI A;  2DRW A;  4ZDX A;  1BTL A;  5CTM A;  2HDU A;  3MZE A;  4IVK A;  3VOY A;  1NY0 A;  1K57 C;  3BFD A;  4WMC A;  4JXG A;  1FOF A;  1MWU A;  3V3S A;  4DKI A;  1BZA A;  5GLD A;  4BLM A;  3AGE A;  3S4X A;  2XD1 A;  1IYS A;  4JXV A;  1VM1 A;  5FQM A;  4E3N A;  3SH9 A;  5CGX A;  1CK3 A;  1YQS A;  4R4S A;  4DE3 A;  2JBF A;  4ZJ2 A;  2H0T A;  3M6H A;  1L0G A;  5M19 A;  3EQU A;  1PW1 A;  1ZG6 A;  4WEJ A;  1AXB A;  1J9M A;  2ZC7 A;  3ZG0 A;  4IBX A;  2WKE A;  3VP3 A;  5FI6 A;  1GA9 A;  3IF6 B;  4P0M A;  5GLB A;  3W4Q A;  3VMA A;  1TDL A;  3VFF A;  5HAI A;  3UY6 A;  3PBR A;  3RXX A;  4KZ7 A;  4IED A;  3HUN A;  3E2K A;  3HVF A;  3UDI A;  3ZNT A;  3C7U A;  4DRT A;  5CED A;  3WS5 A;  1M6K A;  3VSL A;  3Q7V A;  1K38 A;  4RX2 A;  3BFC A;  3A3F A;  1TEM A;  1K4E A;  3BLS A;  2Z2M B;  2J8Y A;  3UDF A;  5F83 A;  1KGF A;  3IHB A;  4E3J A;  3ITA A;  4GD8 A;  4JKT A;  3MBZ A;  4LCL A;  2IWB A;  3W8K A;  2Y2H A;  1H8Z A;  2ZQA A;  3P09 A;  1E4D A;  1XXM A;  4OOL A;  5FQI A;  3IQA A;  2A49 A;  3Q81 A;  1HTZ A;  2Y2N A;  1U60 A;  1GCE A;  1PYY A;  3WRT A;  3M2J A;  4DDS A;  1ONH A;  3G2Y A;  4EWF A;  5GHZ A;  2EX2 A;  1S6R A;  3RXW A;  3AGD A;  1XPB A;  4EBL A;  4X53 A;  3V3R A;  5FAQ A;  4DF6 A;  3BFF A;  3N8L A;  4N92 A;  1E3U D;  2QPN A;  2Y91 A;  4MEZ A;  3QNC A;  1MKI A;  3OZH A;  3PAE A;  3Q07 A;  3ZHH A;  5EVI C;  1ES4 A;  3W4O A;  1KVM A;  4X6T A;  1GHM A;  1FR1 A;  5DTT A;  3BEB A;  3VP2 A;  3S22 A;  4OQH A;  3VOZ A;  3OPH A;  3GVB A;  2WAE A;  5IHV A;  1S0W A;  3W4P A;  5I94 A;  4RX3 A;  2H0Y A;  3TG9 A;  1K55 A;  4UA9 A;  4JLF A;  3G34 A;  4C75 A;  3IWQ A;  4EBN A;  4KZ8 A;  1YMS A;  4U0T A;  5HW3 A;  4N9L A;  5EOO A;  2Y59 A;  3DWZ A;  4KEN B;  3PBS A;  4OQI A;  1ZKJ A;  1NJ4 A;  3IXD A;  3ITB A;  5CGW A;  2WUQ A;  4UA7 A;  5A90 A;  3SS5 A;  1O7E A;  1PIO A;  4OLD A;  1W8Q A;  3VSK A;  4PM5 A;  3ZVW A;  3ZG7 B;  1CI9 A;  2A3U A;  2RL3 A;  4IBR A;  2XH9 A;  3G2Z A;  2Y2L A;  4S2L A;  3HLD A;  5CHJ A;  3GR2 A;  2WGW B;  5FQ9 A;  5M18 A;  3ZVT A;  3GV9 A;  3DWK A;  4GZB A;  1FR6 A;  3RJU A;  1EI5 A;  1L0E A;  4GD6 A;  3OCL A;  2Y2G A;  2HDQ A;  5FDH A;  4P87 A;  4KQO A;  5FQQ A;  5GLA A;  5A92 A;  3QNB A;  4S2O A;  3SH8 A;  3HUM A;  1ZG4 A;  4S2J A;  4DXB A;  3NDG A;  4Y7P A;  5CHM A;  2XLN A;  4MBK A;  2Y55 A;  4NK3 A;  3ZFZ A;  1GA0 A;  1HVB A;  1KGG A;  1XA7 A;  1YMX A;  4WM9 A;  2B5R A;  4S2P A;  4Y0U A;  1K56 A;  3V50 A;  4WMC D;  5U47 A;  4JPM A;  3N7W A;  4BQM A;  4ZJ3 A;  4LV1 A;  5D3O A;  4K0W A;  4R23 A;  3HLF A;  4S2K A;  4GOG A;  4E3L A;  4ID4 A;  4B4X A;  3MKE A;  4PPR A;  1ALQ A;  1BUE A;  4FH2 A;  4OP8 A;  4EQI A;  2EX9 A;  2FFY A;  1FQG A;  4MBH A;  1ESU A;  1FCN A;  4UHU A;  2ZM8 A;  5CEB A;  4S2M A;  2V2F F;  3IXG A;  3UN7 A;  1SCW A;  1FSW A;  4P6B A;  1XA1 A;  3MXR A;  4ZBE A;  3HL9 A;  1PW8 A;  2ZC5 B;  5L2F A;  4ZTK A;  5M1A A;  4QJG A;  1JTG A;  4S2N A;  2OSU A;  1BUL A;  4GKU A;  4KZB A;  5CTN A;  3LEZ A;  1SKF A;  5HL1 A;  3D4F A;  1MWT A;  4FSF A;  3G30 A;  4QU3 A;  4QB8 A;  1N9B A;  1RGZ A;  1JWZ A;  4JXS A;  2WAF A;  4KZ3 A;  2OLU A;  4K91 A;  4OVD A;  3WS1 A;  4DXC A;  3N8R A;  2EXB A;  1I2W A;  3CZD A;  4S2I A;  3O86 A;  2HPB A;  2XFS A;  4S2N C;  1CEF A;  2J9P A;  5G18 A;  3V5M A;  3OC2 A;  1HD8 A;  3UO9 A;  4E6W A;  4QD4 A;  4XUZ A;  4HES A;  5J8X A;  1JTD A;  4KZ4 A;  1K54 C;  4E3I A;  2C6W B;  3BRM A;  5TFQ A;  1K55 C;  1HZO A;  3PTE A;  4JF6 A;  3C7V A;  1Q2Q A;  1YLP A;  1NZO A;  1K56 D;  2G2U A;  3NY4 A;  4OKP A;  2HP5 A;  3AGF A;  3JYI A;  2BLS A;  2OV5 A;  1K4F A;  2P9V B;  1TVF A;  1MWR A;  3WS0 A;  2DCF A;  5DF9 A;  3V39 A;  4N9K A;  3PBO A;  3GSG A;  1WYC A;  1NXY A;  5GLC A;  1M40 A;  5KSH A;  4P85 A;  1RCJ A;  2IWC A;  1NRF A;  2XQZ A;  1NZU A;  1W7F A;  1KGE A;  3N6I A;  5HX9 A;  3FKW A;  1RGY A;  4FCF A;  5GHY A;  5EE8 A;  5EVI A;  1XGI A;  3VP1 A;  2ZQ9 A;  4QY6 A;  3OPP A;  1FCM A;  1LI0 A;  3N8S A;  3TSG A;  4CJN A;  1BLH A;  5FAP A;  3CG5 A;  3OCN A;  2WGW A;  3IXH A;  2WAD A;  1IYO A;  4RA7 A;  3VFH A;  3C4O A;  4JBF A;  2ZJ9 A;  1OME A;  2P9V A;  1NYY A;  3LY3 A;  4PM8 A;  2J7V A;  5CER A;  4E3M A;  3FYZ A;  4K0X A;  1BLP A;  4ZJ1 A;  4DDY A;  5DF7 A;  2FFF B;  2PBY A;  4BL2 A;  1JWV A;  4FH4 A;  2ZQ8 A;  4PMA A;  3HLC A;  1ERM A;  1BLC A;  4MBF A;  1L2S A;  1W5D A;  2QMI A;  3IF6 A;  4U3T A;  3VP4 A;  1PWG A;  4QHC A;  3WS4 A;  1LL5 A;  1YLY A;  5KZH A;  3NDE A;  1TDG A;  2WGV A;  3HLG A;  1MWS A;  5DF8 A;  1SHV A;  4WEK A;  1K6R A;  4N1H A;  4DE1 A;  3HRE A;  3IH9 A;  2IWD A;  3O88 A;  3N4I A;  1KE4 A;  2H5S A;  3BFG A;  1RP5 A;  3WS2 A;  4DE0 A;  3HLE A;  4D2O A;  5TGF A;  4N1X A;  1XKZ A;  1ERQ A;  2JE5 A;  1Z6F A;  2ZM0 A;  5FA7 A;  4ZAM A;  4OPR A;  4R4R A;  3NI9 A;  5FI2 A;  3SOI A;  3HLB A;  4NET A;  5HAR A;  1G68 A;  3VP0 A;  5EEC A;  1JVJ A;  1PWC A;  2ZQD A;  2ZMA A;  4KQR A;  3C4P A;  4M3K A;  4XUX A;  4OOY A;  1KE0 A;  5EVL A;  2P74 A;  3LO7 A;  5E2H A;  3MZF A;  1IYP A;  2V20 A;  4E3O A;  3NC8 A;  1PI4 A;  2HDS A;  1KDW A;  1O07 A;  3IF5 A;  2Z2L B;  1ES3 A;  2JC7 A;  3M6B A;  2ZC3 B;  4IVI A;  3UDX A;  3IXB A;  3IH8 A;  4B88 A;  1YT4 A;  1VQQ A;  4RYE A;  1MY8 A;  5EPH A;  4JF4 A;  2Y2K A;  3MZD A;  5FAT A;  4OP5 A;  3ZGA B;  1LLB A;  1KE3 A;  5F82 A;  1MBL A;  2VGJ A;  4UAA A;  3LCE A;  3Q7V B;  1W8Y A;  5CEC A;  4OLG A;  5JYP A;  3ZDJ A;  4BD0 A;  3Q7Z A;  1L0D A;  1BLS A;  4BD1 A;  2R9X A;  2WZX A;  4X69 A;  4LV3 A;  3UE1 A;  3GTC A;  2XDM A;  1NYM A;  5FI7 A;  4PM7 A;  3CMZ A;  5FAO A;  4B4Z A;  5AQ7 A;  4KZA A;  4YIN A;  2X01 A;  3GRJ A;  3NIA A;  5HFO A;  4OQG A;  3FWL A;  4QY5 A;  1PI5 A;  4FD8 A;  3FKV A;  4OQ0 A;  5HAP A;  3ZG5 A;  4C3Q A;  1GHP A;  1DJA A;  4WBG A;  5GL9 A;  3UE0 A;  4Y0T A;  2I72 A;  3UE3 A;  3UPO A;  5JYO A;  2QZ6 A;  1XGJ A;  3DTM A;  2Y2M A;  1YLZ A;  3FV7 A;  1K57 A;  1ONG A;  1IKG A;  2HP9 A;  4A5R A;  5CHU A;  2PU4 A;  2WK0 A;  5F1F A;  4WZ5 A;  1LI9 A;  4R1G A;  1Y54 A;  2Q9M A;  3Q82 A;  3A3D A; 
#chains in the Genus database with same CATH topology
 4GB7 A;  2EX8 A;  2E8I A;  4JF5 A;  2BG1 A;  4HP4 A;  4ZRR A;  3IBR A;  3SZT A;  3BWL A;  4KQQ A;  1E3U A;  3MQ0 A;  5EM0 A;  3D72 A;  3HLW A;  3CAX A;  1YM1 A;  2Y2O A;  4PM9 A;  2Y2Q A;  3PXP A;  4EU0 A;  3P7N A;  1XX2 A;  4GN2 A;  1G6A A;  4WZ5 C;  3UB6 A;  3E4P A;  4WEL A;  3VE4 A;  4JXW A;  3QHY A;  4R0Q A;  3M2K A;  4L9E A;  1LL9 A;  4C6Y A;  2GZA A;  1YLJ A;  5HDD A;  2Y2P A;  3BFE A;  2M1C A;  1C3B A;  3BM6 A;  3G35 A;  3G32 A;  1E25 A;  1PZP A;  1MPL A;  3HBR A;  3SH7 A;  3E2L A;  4X25 A;  2WYX A;  5J3W A;  3T12 B;  2WGI A;  4GNU A;  4R3B A;  2HDR A;  3UNW A;  4HEF A;  4E04 A;  5E2G A;  3F1P A;  2WZZ A;  2P08 A;  1H8Y A;  1XJ2 A;  2JKF A;  5KIZ A;  3VOL A;  1ERO A;  3BYD A;  2M7U A;  1H3Q A;  4GHI A;  4X55 A;  1LSX A;  1IFQ A;  5GHX A;  1G5U A;  1CEG A;  2XD5 A;  1YPR A;  3G31 A;  2XFT A;  3CUE C;  3C5A A;  3Q1F A;  1LHY A;  4YNR A;  3R7W B;  3UPP A;  4IUK A;  3UPN A;  4E3K A;  2NUT C;  2J3T D;  2XK1 A;  2KX6 A;  3H7W B;  4WZ4 A;  4OOM A;  3GDI A;  4F94 A;  3A0S A;  2X71 A;  5HWT A;  2V8F A;  4EBP A;  5EVI B;  2XEP A;  3C2W A;  4MN7 A;  2J3T C;  2L1M A;  4JXG A;  1FOF A;  3V3S A;  1BZA A;  3AGE A;  4E3N A;  4JXV A;  3CIT A;  3SH9 A;  3M6H A;  3D3O A;  1G6O A;  1N9O A;  1PW1 A;  4WEJ A;  2ZC7 A;  3D9Y A;  3W4Q A;  1TDL A;  3PBR A;  4PAU A;  5DJU A;  4BMW A;  4KZ7 A;  3HUN A;  3UDI A;  1FIL A;  1HLU P;  1M6K A;  3BW6 A;  3A3F A;  1TEM A;  3BLS A;  4BBV A;  5F83 A;  4GD8 A;  5IT5 A;  1E4D A;  1XXM A;  3Q81 A;  1HTZ A;  1U60 A;  4LGW A;  1ONH A;  3G2Y A;  2W3F A;  1S6R A;  2W1R A;  3RXW A;  3AGD A;  1XPB A;  1OJ5 A;  2BAS A;  4ETX A;  2W3D A;  4X53 A;  5FAQ A;  3BFF A;  2PR6 A;  2QPN A;  2Y91 A;  4MEZ A;  1S66 L;  3TW8 A;  3PAE A;  3ZHH A;  5EVI C;  5DTT A;  1GHM A;  3BEB A;  3LIF A;  1S4S A;  4OQH A;  3VOZ A;  3W4P A;  4RX3 A;  4UA9 A;  4JLF A;  4EBN A;  4U0T A;  5HW3 A;  2Y59 A;  4FOF A;  3UE6 A;  2O9C A;  4PKY A;  5CGW A;  5L07 A;  1PIO A;  3VSK A;  3EOI A;  3ZG7 B;  4IBR A;  2KOI A;  4S2L A;  4CLC B;  3GR2 A;  2WGW B;  5FQ9 A;  3ZVT A;  3KYQ A;  5C5K A;  1L0E A;  4GD6 A;  2Y2G A;  5FQQ A;  1N9L A;  4KQO A;  4S2O A;  3SH8 A;  4KUK A;  1KGG A;  2WKQ A;  1YMX A;  3T4T A;  5LBR A;  3N7W A;  4K0W A;  4EQ1 A;  3HLF A;  4S2K A;  1FQG A;  5CEB A;  3MQQ A;  4KUO A;  1SCW A;  3F1P B;  3V67 A;  4P6B A;  3MXR A;  4QJG A;  1JTG A;  4KZB A;  3LEZ A;  3D4F A;  3A0V A;  4JXS A;  3NOT C;  2OLU A;  4K91 A;  3WS1 A;  2EXB A;  3F1N A;  2XFS A;  1CEF A;  3UO9 A;  4QD4 A;  5J8X A;  1PRQ A;  4G3V A;  2DMW A;  1HZO A;  3PTE A;  4JF6 A;  3RH8 B;  1YLP A;  1NZO A;  4OKP A;  2G2U A;  3JYI A;  1MWR A;  1NLZ A;  5DF9 A;  3V39 A;  1NXY A;  3IX4 A;  1M40 A;  5GLC A;  4HJ6 A;  2VJW A;  2ZL1 B;  2K2N A;  1RGY A;  5GHY A;  3QP8 A;  4XT2 B;  2WKR A;  3SW1 A;  3CG5 A;  3OCN A;  2WAD A;  1STZ A;  2ZJ9 A;  3UME A;  1N9N A;  2J7V A;  4X1L A;  1XFN A;  4K0X A;  4ZJ1 A;  3QP6 A;  4BL2 A;  4FH4 A;  1ERM A;  4H6J B;  3B42 A;  3NEC A;  1TDG A;  3IH9 A;  4I3I A;  3N4I A;  2H5S A;  1OPX A;  1GSX A;  3P01 A;  2ZOI A;  5AVF A;  1LT0 A;  2PRF A;  1BYW A;  3CUE A;  5FI2 A;  2B95 A;  2L0W A;  2ZOH A;  1G68 A;  4K08 A;  1JVJ A;  2ZMA A;  4M3K A;  4XUX A;  1CJF A;  1MC0 A;  2PT7 A;  5E2H A;  2V20 A;  4E3O A;  1KDW A;  1O07 A;  5K5B A;  4IHQ A;  2EWW A;  2O99 A;  1YT4 A;  4RYE A;  5EPH A;  2Y2K A;  3MZD A;  5FAT A;  1LLB A;  2VGJ A;  3LCE A;  3Q7V B;  1W8Y A;  4CLC E;  3BY8 A;  4BD1 A;  5F6A A;  3E4Q A;  4Q0J A;  4LV3 A;  3UE1 A;  2XDM A;  1NYM A;  2W27 A;  4PM7 A;  5FAO A;  1D06 A;  3VE3 A;  4KZA A;  4YIN A;  5HFO A;  4OQG A;  1PI5 A;  4FD8 A;  3H9W A;  4ARZ B;  2A24 A;  4C3Q A;  3H7W A;  1TS8 A;  4GCZ A;  2QZ6 A;  1XGJ A;  3DTM A;  2K31 A;  3F1O A;  5CHU A;  2PU4 A;  1S67 L;  2EWV A;  4WZ5 A;  1K0K A;  4R1G A;  1VEU B;  4CQH A;  2V0W A;  5DVA A;  2VV8 A;  1WE4 A;  1IKI A;  4OPQ A;  3I7J A;  2GNX A;  3ZQ5 A;  1YLT A;  5F1G A;  2JKR M;  3NHQ A;  2G2W A;  5MC7 A;  4O7D A;  5J4E A;  4O8G A;  5FSR A;  2CMN A;  4MDZ A;  2K7S A;  4JGQ A;  5CXW A;  2OAQ 1;  3HJI A;  1F5M A;  1ZTU A;  4XXR A;  5DTS A;  1OT6 A;  3IWI A;  3A3J A;  3DW0 A;  2JKR I;  4CLC A;  4EV4 A;  5HPI A;  4AFI A;  4WYY A;  1DJC A;  5HDC A;  4MNR A;  2PD7 A;  2ZM2 A;  2EFU A;  5KSC A;  3LIA A;  2YKF A;  3G4P A;  4X56 A;  3OPR A;  1QMF A;  4LLO B;  2HV1 A;  1BT5 A;  5EM1 A;  4OH0 A;  2X02 A;  1KDS A;  3NBL A;  2HGV A;  2UV0 E;  1FCO A;  3CJM A;  1LL8 A;  2RCX A;  3FC7 A;  1T1C A;  4EUZ A;  3IT9 A;  3IHA A;  2H10 A;  1S1Y A;  1ODV A;  2ZQ7 A;  1SDN A;  4DJ3 A;  2VGK A;  2EFX A;  4P6Z S;  2ZC6 B;  2WKI A;  3GEC A;  4EET B;  1PWD A;  5TR7 A;  1YSP A;  1QME A;  5A93 A;  1F2K A;  3A3E A;  3RFB A;  3IBJ A;  1JWP A;  3A3I A;  1YLW A;  3OOV A;  4KZ6 A;  2V9A A;  3EGX C;  4LCM A;  2Y2J A;  2W3G A;  4PM6 A;  3RTY A;  1N4O A;  3KX0 X;  1K54 A;  3T1Q B;  4BL3 A;  2W3E A;  2DNS A;  5FQJ A;  3K3C A;  3EQV A;  4LRX C;  2HP6 A;  3LEQ A;  4B93 A;  3S7P A;  4ZDX A;  1BTL A;  4WF0 A;  3VOY A;  3BFD A;  3S4X A;  1IYS A;  1TS0 A;  1CK3 A;  1YQS A;  4IUH A;  2JBF A;  3E4O A;  3EEA A;  1Z09 A;  4DN0 A;  1L0G A;  2W3H A;  1ZG6 A;  1J9M A;  5FI6 A;  3ZYT A;  2AVX A;  3LYX A;  4Y15 A;  4NXB A;  3UB7 A;  5DFX A;  3F1N B;  3BY9 A;  3ZNT A;  3C7U A;  4DRT A;  2Q0O A;  4MMN A;  4DMZ A;  3VSL A;  5TBM A;  3Q7V A;  1K38 A;  3BFC A;  4GS9 B;  3LID A;  2QYB A;  1K4E A;  2Z2M B;  4ME4 A;  2J8Y A;  3UDF A;  1KGF A;  3IHB A;  4E3J A;  4JKT A;  4Y17 A;  2ZMF A;  4RQ9 A;  3P09 A;  5J7E A;  4D60 A;  1IOU A;  2Y2N A;  4EXO A;  3WRT A;  3M2J A;  2PBD P;  4DDS A;  2EX2 A;  4UEY A;  4WUJ A;  1ZHH B;  1E3U D;  4HY8 A;  3Q07 A;  3LR0 A;  5HL6 A;  1T19 A;  2W0N A;  4YOF A;  3GVB A;  2WAE A;  1S0W A;  4C75 A;  1K55 A;  3G34 A;  4QWO A;  1YMS A;  3B47 A;  4N9L A;  3UB5 P;  3DWZ A;  4EEP A;  3IXD A;  3ITB A;  4HH2 A;  4UA7 A;  5A90 A;  2J3W A;  3ZVW A;  1CI9 A;  3G2Z A;  3QP2 A;  2Y2L A;  5M18 A;  5HD3 A;  1DRM A;  2XRO A;  3C38 A;  4R70 A;  4X1M A;  2HDQ A;  5FDH A;  5A92 A;  3QNB A;  1MZU A;  4S2J A;  3NDG A;  4Y7P A;  2XLN A;  2Y55 A;  4NK3 A;  1GA0 A;  4LRZ E;  1XA7 A;  2B5R A;  4S2P A;  3V50 A;  4WMC D;  5U47 A;  4ZJ3 A;  5D3O A;  3S7O A;  4E3L A;  4PPR A;  4FH2 A;  1ESU A;  4BWI A;  1TD5 A;  3CWF A;  4NXE A;  4WN5 A;  1XA1 A;  3HJK A;  3HL9 A;  2ZC5 B;  1F9I A;  4S2N A;  3DTE A;  4GKU A;  5CTN A;  5HL1 A;  4FSF A;  1XFQ A;  4QU3 A;  1JWZ A;  2WAF A;  2JKG A;  2JKT I;  1W63 Q;  2HPB A;  4E6W A;  5G18 A;  3V5M A;  1JTD A;  4EEU A;  4JGO A;  3BRM A;  5HSQ A;  3C7V A;  1Q2Q A;  5HWV A;  3NY4 A;  2HP5 A;  2JHE A;  2P9V B;  4M4X A;  4N9K A;  3GSG A;  3E0Y A;  3IX8 A;  4P85 A;  1RCJ A;  1OTB A;  1W7F A;  1GSW A;  4L9F A;  5EVI A;  4QY6 A;  4WL9 A;  3OPP A;  1VHM A;  1FCM A;  3N8S A;  4CJN A;  4BBT A;  1IYO A;  4RA7 A;  4UQI M;  1BLP A;  5DF7 A;  1JWV A;  2ZQ8 A;  2KLI A;  3O5Y A;  1D1J A;  1W5D A;  3CI6 A;  4HIA A;  4QHC A;  3WS4 A;  2WKP A;  2HJE A;  5DF8 A;  1SHV A;  4WEK A;  1K6R A;  2HF6 A;  2QJ5 A;  2NUP C;  1A0K A;  3HLE A;  4PHT A;  3EWK A;  3BQ8 A;  4Y5F A;  1XKZ A;  1ERQ A;  4ZAM A;  4R4R A;  3VP0 A;  5EEC A;  2ZQD A;  1Y4O A;  4OOY A;  1JNU A;  3KSG A;  2JKT M;  2P74 A;  3MZF A;  2ACG A;  1PI4 A;  3DBA A;  2Z2L B;  2OWJ A;  3IH8 A;  2Y79 A;  1VQQ A;  4F3L B;  1MY8 A;  4Q0I A;  2QKP A;  5F82 A;  1MBL A;  2OAP 1;  5JYP A;  5CX7 A;  1BLS A;  3BJN A;  5FI7 A;  4B4Z A;  5F69 A;  1FIK A;  3GRJ A;  5HZH A;  5HAP A;  3ZG5 A;  1GHP A;  5G4Z A;  1YKD A;  4FTX A;  2Y2M A;  3PHY A;  4GLQ A;  1K57 A;  2HP9 A;  4A5R A;  1LI9 A;  1MKM A;  3Q82 A;  2VKS A;  3A3D A;  4KG6 A;  3DTI A;  1XP4 A;  3LI8 A;  1W79 A;  4BEN A;  1OTI A;  4NXF A;  4UA6 A;  5A91 A;  4Q8I A;  1NWZ A;  4LV0 A;  2JCH A;  3KSI A;  4KZ5 A;  2Y8H A;  2PR5 A;  2A2L A;  2B18 A;  1LSV A;  4X68 A;  1IYQ A;  1Q2P A;  2VX8 A;  2EXA A;  1D7E A;  3FZC A;  4O0P A;  1BSG A;  5E2F A;  3TE8 A;  4HBU A;  4GS9 A;  3ULF A;  2GDN A;  3WWX A;  3OPL A;  4UQI S;  5EOE A;  5HAQ A;  1IEL A;  4RVA A;  4GDB A;  4HHD A;  3T4K A;  4Y0O A;  3ISG A;  1MXO A;  3BQA A;  3NUL A;  5E2E A;  1DJB A;  4ARZ A;  2MJ6 A;  2R9W A;  3LFV A;  3SS3 A;  5FQK A;  4OON A;  4NG2 A;  3LUQ A;  3P98 A;  4LEN A;  3T1S A;  3ZG9 B;  3NCK A;  3B3X A;  3L7H A;  1J3W A;  5AQB A;  5L8M A;  1OJG A;  3PBN A;  1AWI A;  3KYE A;  4OPY A;  3MKF A;  2XA7 S;  4DE2 A;  3PYP A;  3EEH A;  1CI8 A;  4PKY G;  3MF0 A;  5EUA A;  3LY4 A;  4I3J A;  5IS1 A;  4R3J A;  3ZNY A;  2Y4A A;  3UMD A;  1I2S A;  2O9A A;  1EWZ A;  2R78 A;  3JVU A;  4GDN A;  1KVL A;  1SDE A;  1GHI A;  4LV2 A;  2EA9 A;  3TOI A;  3ZG8 B;  2XGN A;  1T18 A;  4HBT A;  5CGS A;  3MFD A;  5FAS A;  2PHY A;  5CTM A;  3CHW P;  4IVK A;  1K57 C;  2VV6 A;  4HOI A;  4GW9 A;  1UWP X;  2FZ0 A;  3A0R A;  4DKI A;  2XD1 A;  5FQM A;  2XA7 M;  4R4S A;  2H0T A;  1PFL A;  3T4S A;  5M19 A;  2INW A;  3FPV A;  3IS2 B;  2VK3 A;  1GA9 A;  3IF6 B;  4P0M A;  3L9K A;  3FPW A;  3VMA A;  3VFF A;  3KO6 A;  5TJJ A;  2P7J A;  2HJ9 C;  4IED A;  3HVF A;  5CED A;  3T50 A;  3ITA A;  4I3A A;  2J80 A;  4LCL A;  2IWB A;  1H8Z A;  1SKO B;  1TS7 A;  4OOL A;  2V1A A;  2PDR A;  1GCE A;  1PYY A;  4LFU A;  4HP9 A;  3MQO A;  4QPR A;  3V3R A;  3N8L A;  1SZV A;  1MKI A;  3OZH A;  3R7W A;  2BTF P;  3W4O A;  1FR1 A;  4H6J A;  3VP2 A;  3S22 A;  3T4L A;  3OPH A;  5DFY A;  3PBS A;  4OQI A;  1ZKJ A;  1NJ4 A;  1WA9 A;  1O7E A;  3W2Z A;  4OLD A;  5FL3 A;  2A3U A;  2XH9 A;  5G4Y A;  1ACF A;  4O01 A;  5EFW A;  3T4J A;  3GV9 A;  4GZB A;  1FR6 A;  1EI5 A;  3LIB A;  1T1B A;  4I38 A;  3HUM A;  1SKO A;  4DXB A;  4MBK A;  3ZFZ A;  1HVB A;  3LIC A;  4WM9 A;  3QP1 A;  1K56 A;  5F68 A;  4R23 A;  4B4X A;  3MKE A;  1ALQ A;  1BUE A;  1VET A;  4EQI A;  2EX9 A;  3F1O B;  1FCN A;  4S2M A;  2V2F F;  3IXG A;  3UN7 A;  1FSW A;  4FUW A;  1S4R A;  5L2F A;  4ZTK A;  4DJ2 A;  2OSU A;  1SKF A;  4Y2F A;  1MWT A;  4QB8 A;  4Y13 A;  4KZ3 A;  4HJ3 A;  4OVD A;  4CLC D;  4B9O A;  2O0Y A;  1I2W A;  4S2I A;  4WLA A;  4S2N C;  3OC2 A;  1HD8 A;  2O9B A;  4XUZ A;  4HES A;  5L09 A;  4KZ4 A;  1K54 C;  3S7Q A;  2C6W B;  4P6Z M;  1UWN X;  1K55 C;  4EUV A;  3QP5 A;  1XJ3 A;  1P9W A;  2OV5 A;  1K4F A;  1TVF A;  2H28 A;  4BBU A;  3WS0 A;  2DCF A;  1T1A A;  3PBO A;  1WYC A;  5KSH A;  5DKL A;  3LR4 A;  1NRF A;  1NZU A;  3UB8 A;  5HWW A;  1F98 A;  5HX9 A;  3N6I A;  4JGP A;  4FCF A;  5EE8 A;  1XGI A;  4IJG A;  2ZQ9 A;  3T1R A;  3VP1 A;  1LI0 A;  1BLH A;  5FAP A;  4HI4 A;  3IXH A;  3C4O A;  1NYY A;  5CER A;  1H0M A;  4DDY A;  2PBY A;  4L9G A;  3HLC A;  1BLC A;  4U3T A;  3IF6 A;  3NDE A;  3HLG A;  1MWS A;  5EVE A;  3HRE A;  2IWD A;  3MMH A;  2ZMV A;  1RP5 A;  4DE0 A;  4D2O A;  4N1X A;  2JE5 A;  3NI9 A;  4NET A;  1OTE A;  1KE0 A;  1P0Z A;  5A8B A;  1GSV A;  1KOU A;  1IYP A;  3NC8 A;  4GHI B;  2XRN A;  3MFX A;  2VA0 A;  1VB6 A;  3UDX A;  3IXB A;  5FDS A;  2LB9 A;  3ZGA B;  4UAA A;  5CEC A;  4EER A;  4OLG A;  5I5L A;  1L0D A;  1OTA A;  3KYZ A;  4GJ4 A;  3ICY A;  2YKH A;  3KSF A;  2GX5 A;  3MR0 A;  3GTC A;  2VGL S;  3NIA A;  4QY5 A;  3FKV A;  3NOU C;  4HH3 A;  3JPU A;  5GL9 A;  4Y0T A;  2KDK A;  2QWS A;  2PYP A;  3UE3 A;  2HZ5 A;  5JYO A;  3UPO A;  4R3A A;  1YLZ A;  3H82 A;  4HQA A;  1IKG A;  2WK0 A;  1Y54 A;  2Q9M A;  5HDS A;  4H8R A;  3WRZ A;  2ZD8 A;  3PAG A;  4MLL A;  3S1Y A;  3IF6 C;  1PNE A;  2LB5 A;  1L3L A;  2UWX A;  2Z6C A;  1DY6 A;  2ZC4 B;  4NXG A;  3MS6 A;  1CF0 A;  3OLO A;  4U0X A;  4YFM A;  3SS4 A;  1IEM A;  1I5Q A;  1FSY A;  3IWO A;  3GMW A;  3PBQ A;  4II7 A;  3GQZ A;  2V1Z A;  3ZCZ A;  3PBT A;  4LRY C;  4CPK A;  3G6O A;  2E8J A;  1P97 A;  2EX6 A;  4Z9Q A;  4R38 A;  2XF3 A;  5IU1 A;  2OLV A;  5AQA A;  5HD5 A;  2C5W B;  2QHK A;  3K2N A;  3LGO A;  1P9R A;  3FG8 A;  3K3D A;  1PZO A;  5TBM B;  4I39 A;  2CC1 A;  1ZC2 A;  3BLM A;  3MXS A;  3H82 B;  4NEE D;  4E6X A;  2V0U A;  2Q9N A;  4G3W A;  5DKK A;  4KG2 A;  1V9Z A;  3DAV A;  4L0L A;  5DTK A;  2J9O A;  5E43 A;  4BJP A;  3LIE A;  4OPZ A;  3UB9 A;  3O87 A;  5BOH A;  2VZW A;  1ES5 A;  1YAX A;  3O3V A;  1H5X A;  1DP9 A;  4KZ9 A;  4KG5 A;  5CRF A;  1TS6 A;  1XJ6 A;  2ZLY A;  4EW7 A;  3BEC A;  3KSH A;  5AQ9 A;  3HUO A;  2Y2I A;  2PU2 A;  2QJ7 A;  1K6S A;  2A24 B;  2WKH A;  2ZQC A;  1WYB A;  2JN7 A;  1NRJ A;  5KMW A;  1ES2 A;  2V8C A;  5EVI D;  2XR0 A;  1L0F A;  1K25 A;  4MCW A;  1ESI A;  2DRW A;  2HDU A;  2D02 A;  3CPT B;  3MZE A;  1NY0 A;  4WMC A;  3HCY A;  1MWU A;  4HNB A;  5GLD A;  4BLM A;  1VM1 A;  3MSH A;  5CGX A;  3S7N A;  4DE3 A;  1VEU A;  4ZJ2 A;  3B33 A;  3EQU A;  1AXB A;  3TJZ C;  3ZG0 A;  2GJ3 A;  4IBX A;  2WKE A;  3VP3 A;  5GLB A;  4ESP A;  4XT2 A;  5HAI A;  3UY6 A;  3RXX A;  3E2K A;  3WS5 A;  4RX2 A;  1W63 M;  4KQD A;  3MBZ A;  3W8K A;  2Y2H A;  3NJA A;  2ZQA A;  5DJT A;  5FQI A;  3IQA A;  2A49 A;  1YSQ A;  4G3K A;  3U4L P;  2Z6D A;  2P04 A;  2PD8 A;  4EWF A;  5GHZ A;  1S1Z A;  4EBL A;  4MN6 A;  4DF6 A;  3T4Q A;  4N92 A;  3MXQ A;  3JVV A;  3QNC A;  1ES4 A;  4Y3I A;  1KVM A;  4X6T A;  1XJ4 A;  2VV7 A;  5AVE A;  2V1B A;  3LR3 A;  1EW0 A;  3MJQ A;  5F5Y A;  1DP6 A;  5IHV A;  5I94 A;  2H0Y A;  2OOL A;  2VEA A;  3TG9 A;  4LPZ A;  3IWQ A;  4KZ8 A;  5EOO A;  4KEN B;  3C8C A;  2WUQ A;  3SS5 A;  1W8Q A;  4PM5 A;  2RL3 A;  3OBF A;  3HLD A;  5L10 A;  5CHJ A;  3LI9 A;  3DWK A;  3EGD C;  3RJU A;  3T1X A;  1OTD A;  3PR6 A;  3OCL A;  5GLA A;  4P87 A;  2ZL1 A;  5HPF A;  1ZG4 A;  5CHM A;  2OWH A;  4Y0U A;  4JPM A;  4BQM A;  4LV1 A;  4GOG A;  4ID4 A;  2D01 A;  4OP8 A;  2FFY A;  4MBH A;  4Q0H A;  4ETZ A;  4UHU A;  2ZM8 A;  3CLO A;  3IX3 A;  1LSW A;  4ZBE A;  1PW8 A;  5M1A A;  2G7U A;  1BUL A;  5FEF A;  3G30 A;  1N9B A;  1RGZ A;  1TF1 A;  4DXC A;  2M7V A;  3N8R A;  4YWZ A;  3CZD A;  3O86 A;  2J9P A;  4E3I A;  5TFQ A;  3U2A A;  1K56 D;  3AGF A;  2BLS A;  3TRC A;  2PYR A;  2VGL M;  3R4K A;  4R6L A;  3T4O A;  2IWC A;  2B02 A;  2XQZ A;  1OT9 A;  1KGE A;  1V9Y A;  3FKW A;  2W1T A;  1CQA A;  3CPT A;  2I9V A;  3TSG A;  2WGW A;  2L4R A;  3VFH A;  2VLG A;  4JBF A;  1OME A;  2P9V A;  4JGR A;  3LY3 A;  3QP4 A;  4PM8 A;  1UGU A;  1H8M A;  2IA2 A;  4E3M A;  3FYZ A;  2FFF B;  4HJ4 A;  4PMA A;  4MBF A;  3E98 A;  1L2S A;  2QMI A;  3VP4 A;  1PWG A;  1LL5 A;  1YLY A;  5KZH A;  2WGV A;  4N1H A;  4DE1 A;  3O88 A;  2PAV P;  1KE4 A;  3BFG A;  5AJG A;  3WS2 A;  2XSS A;  4F3L A;  5TGF A;  5FA7 A;  1Z6F A;  2ZM0 A;  2FH5 A;  1NLY A;  4EES A;  4OPR A;  3DTK A;  4CLC C;  3SOI A;  5HAR A;  3HLB A;  1PWC A;  4KQR A;  3C4P A;  5EVL A;  3LR5 A;  3LO7 A;  5FEG A;  3C30 A;  4MN5 A;  1Y28 A;  2HDS A;  3IF5 A;  1ES3 A;  2JC7 A;  3M6B A;  2ZC3 B;  4IVI A;  4B88 A;  4JF4 A;  2W1T B;  4OP5 A;  1G28 A;  1KE3 A;  1VET B;  2ZBB A;  1DP8 A;  3ZDJ A;  4I5S A;  4BD0 A;  3Q7Z A;  5EV0 A;  2R9X A;  2WZX A;  4X69 A;  4Z1W A;  3CMZ A;  5AQ7 A;  3IS2 A;  1X0O A;  2X01 A;  3FWL A;  4OQ0 A;  3NOP C;  4NKP A;  1DJA A;  4WBG A;  3UE0 A;  3VV4 A;  2I72 A;  3FV7 A;  1ONG A;  5F1F A; 
#chains in the Genus database with same CATH homology
 4H8R A;  4KG6 A;  4GB7 A;  2EX8 A;  2E8I A;  4JF5 A;  5DVA A;  1XP4 A;  1W79 A;  1WE4 A;  2BG1 A;  2ZD8 A;  3WRZ A;  4UA6 A;  4BEN A;  5A91 A;  1IKI A;  3PAG A;  3I7J A;  4MLL A;  4OPQ A;  3S1Y A;  3IF6 C;  1YLT A;  5F1G A;  4KQQ A;  4Q8I A;  1E3U A;  4LV0 A;  2JCH A;  2UWX A;  2G2W A;  4KZ5 A;  4O7D A;  1DY6 A;  2ZC4 B;  3HLW A;  5FSR A;  1YM1 A;  2Y2O A;  4U0X A;  3SS4 A;  4YFM A;  5CXW A;  4PM9 A;  2Y2Q A;  1IEM A;  4X68 A;  4XXR A;  1XX2 A;  1IYQ A;  1I5Q A;  1Q2P A;  1FSY A;  2EXA A;  5DTS A;  3FZC A;  4GN2 A;  3IWO A;  1BSG A;  3IWI A;  3GMW A;  1G6A A;  5E2F A;  3PBQ A;  3A3J A;  3DW0 A;  4WZ5 C;  4EV4 A;  4WEL A;  3GQZ A;  2V1Z A;  4HBU A;  4JXW A;  3QHY A;  4R0Q A;  4WYY A;  3ZCZ A;  3M2K A;  3PBT A;  1DJC A;  4MNR A;  4CPK A;  2GDN A;  3WWX A;  1LL9 A;  3OPL A;  5EOE A;  5HAQ A;  1IEL A;  2ZM2 A;  4RVA A;  2EFU A;  4C6Y A;  1YLJ A;  4GDB A;  2Y2P A;  5KSC A;  3G4P A;  4Z9Q A;  2EX6 A;  3OPR A;  3BFE A;  4X56 A;  2XF3 A;  4Y0O A;  1C3B A;  3BM6 A;  3G35 A;  3ISG A;  3G32 A;  1E25 A;  1QMF A;  1MXO A;  1BT5 A;  1PZP A;  1MPL A;  2OLV A;  3HBR A;  5E2E A;  3E2L A;  1DJB A;  5AQA A;  2R9W A;  3SH7 A;  2WYX A;  3SS3 A;  2C5W B;  4OH0 A;  2X02 A;  5FQK A;  1KDS A;  3NBL A;  2WGI A;  4OON A;  4GNU A;  1FCO A;  1PZO A;  3CJM A;  2CC1 A;  1ZC2 A;  3BLM A;  3MXS A;  3P98 A;  4R3B A;  2HDR A;  3UNW A;  2RCX A;  4LEN A;  4E6X A;  4HEF A;  4EUZ A;  2Q9N A;  3ZG9 B;  3IT9 A;  3NCK A;  3B3X A;  5E2G A;  3IHA A;  4KG2 A;  2WZZ A;  2H10 A;  1H8Y A;  1SDN A;  2ZQ7 A;  4L0L A;  5AQB A;  2VGK A;  5DTK A;  2J9O A;  5E43 A;  3PBN A;  4BJP A;  2EFX A;  2ZC6 B;  4OPY A;  4OPZ A;  5BOH A;  3O87 A;  3MKF A;  1ES5 A;  2WKI A;  1ERO A;  3BYD A;  1PWD A;  5TR7 A;  4DE2 A;  1QME A;  4X55 A;  5A93 A;  1CI8 A;  3A3E A;  5GHX A;  3O3V A;  1CEG A;  1H5X A;  5EUA A;  2XD5 A;  3LY4 A;  4KZ9 A;  4KG5 A;  5CRF A;  1JWP A;  2ZLY A;  4R3J A;  3A3I A;  3G31 A;  2XFT A;  3BEC A;  1YLW A;  2Y4A A;  4KZ6 A;  3ZNY A;  3C5A A;  4LCM A;  5AQ9 A;  2Y2J A;  1I2S A;  3HUO A;  1EWZ A;  3Q1F A;  4PM6 A;  1LHY A;  1N4O A;  3UPP A;  2Y2I A;  4GDN A;  1KVL A;  1K54 A;  2PU2 A;  3UPN A;  4BL3 A;  4E3K A;  1SDE A;  2DNS A;  1K6S A;  2WKH A;  2XK1 A;  4WZ4 A;  2ZQC A;  1WYB A;  4OOM A;  4F94 A;  1GHI A;  5KMW A;  1ES2 A;  5FQJ A;  2X71 A;  2XR0 A;  5EVI D;  4LV2 A;  3TOI A;  1L0F A;  3ZG8 B;  2XGN A;  4HBT A;  4EBP A;  5CGS A;  1K25 A;  3EQV A;  5EVI B;  2HP6 A;  3MFD A;  5FAS A;  2XEP A;  1ESI A;  2DRW A;  4ZDX A;  1BTL A;  5CTM A;  2HDU A;  3MZE A;  4IVK A;  3VOY A;  1NY0 A;  1K57 C;  3BFD A;  4WMC A;  4JXG A;  1FOF A;  1MWU A;  3V3S A;  4DKI A;  1BZA A;  5GLD A;  4BLM A;  3AGE A;  3S4X A;  2XD1 A;  1IYS A;  4JXV A;  1VM1 A;  5FQM A;  4E3N A;  3SH9 A;  5CGX A;  1CK3 A;  1YQS A;  4R4S A;  4DE3 A;  2JBF A;  4ZJ2 A;  2H0T A;  3M6H A;  1L0G A;  5M19 A;  3EQU A;  1PW1 A;  1ZG6 A;  4WEJ A;  1AXB A;  1J9M A;  2ZC7 A;  3ZG0 A;  4IBX A;  2WKE A;  3VP3 A;  5FI6 A;  1GA9 A;  3IF6 B;  4P0M A;  5GLB A;  3W4Q A;  3VMA A;  1TDL A;  3VFF A;  5HAI A;  3UY6 A;  3PBR A;  3RXX A;  4KZ7 A;  4IED A;  3HUN A;  3E2K A;  3HVF A;  3UDI A;  3ZNT A;  3C7U A;  4DRT A;  5CED A;  3WS5 A;  1M6K A;  3VSL A;  3Q7V A;  1K38 A;  4RX2 A;  3BFC A;  3A3F A;  1TEM A;  1K4E A;  3BLS A;  2Z2M B;  2J8Y A;  3UDF A;  5F83 A;  1KGF A;  3IHB A;  4E3J A;  3ITA A;  4GD8 A;  4JKT A;  3MBZ A;  4LCL A;  2IWB A;  3W8K A;  2Y2H A;  1H8Z A;  2ZQA A;  3P09 A;  1E4D A;  1XXM A;  4OOL A;  5FQI A;  3IQA A;  2A49 A;  3Q81 A;  1HTZ A;  2Y2N A;  1U60 A;  1GCE A;  1PYY A;  3WRT A;  3M2J A;  4DDS A;  1ONH A;  3G2Y A;  4EWF A;  5GHZ A;  2EX2 A;  1S6R A;  3RXW A;  3AGD A;  1XPB A;  4EBL A;  4X53 A;  3V3R A;  5FAQ A;  4DF6 A;  3BFF A;  3N8L A;  4N92 A;  1E3U D;  2QPN A;  2Y91 A;  4MEZ A;  3QNC A;  1MKI A;  3OZH A;  3PAE A;  3Q07 A;  3ZHH A;  5EVI C;  1ES4 A;  3W4O A;  1KVM A;  4X6T A;  1GHM A;  1FR1 A;  5DTT A;  3BEB A;  3VP2 A;  3S22 A;  4OQH A;  3VOZ A;  3OPH A;  3GVB A;  2WAE A;  5IHV A;  1S0W A;  3W4P A;  5I94 A;  4RX3 A;  2H0Y A;  3TG9 A;  1K55 A;  4UA9 A;  4JLF A;  3G34 A;  4C75 A;  3IWQ A;  4EBN A;  4KZ8 A;  1YMS A;  4U0T A;  5HW3 A;  4N9L A;  5EOO A;  2Y59 A;  3DWZ A;  4KEN B;  3PBS A;  4OQI A;  1ZKJ A;  1NJ4 A;  3IXD A;  3ITB A;  5CGW A;  2WUQ A;  4UA7 A;  5A90 A;  3SS5 A;  1O7E A;  1PIO A;  4OLD A;  1W8Q A;  3VSK A;  4PM5 A;  3ZVW A;  3ZG7 B;  1CI9 A;  2A3U A;  2RL3 A;  4IBR A;  2XH9 A;  3G2Z A;  2Y2L A;  4S2L A;  3HLD A;  5CHJ A;  3GR2 A;  2WGW B;  5FQ9 A;  5M18 A;  3ZVT A;  3GV9 A;  3DWK A;  4GZB A;  1FR6 A;  3RJU A;  1EI5 A;  1L0E A;  4GD6 A;  3OCL A;  2Y2G A;  2HDQ A;  5FDH A;  4P87 A;  4KQO A;  5FQQ A;  5GLA A;  5A92 A;  3QNB A;  4S2O A;  3SH8 A;  3HUM A;  1ZG4 A;  4S2J A;  4DXB A;  3NDG A;  4Y7P A;  5CHM A;  2XLN A;  4MBK A;  2Y55 A;  4NK3 A;  3ZFZ A;  1GA0 A;  1HVB A;  1KGG A;  1XA7 A;  1YMX A;  4WM9 A;  2B5R A;  4S2P A;  4Y0U A;  1K56 A;  3V50 A;  4WMC D;  5U47 A;  4JPM A;  3N7W A;  4BQM A;  4ZJ3 A;  4LV1 A;  5D3O A;  4K0W A;  4R23 A;  3HLF A;  4S2K A;  4GOG A;  4E3L A;  4ID4 A;  4B4X A;  3MKE A;  4PPR A;  1ALQ A;  1BUE A;  4FH2 A;  4OP8 A;  4EQI A;  2EX9 A;  2FFY A;  1FQG A;  4MBH A;  1ESU A;  1FCN A;  4UHU A;  2ZM8 A;  5CEB A;  4S2M A;  2V2F F;  3IXG A;  3UN7 A;  1SCW A;  1FSW A;  4P6B A;  1XA1 A;  3MXR A;  4ZBE A;  3HL9 A;  1PW8 A;  2ZC5 B;  5L2F A;  4ZTK A;  5M1A A;  4QJG A;  1JTG A;  4S2N A;  2OSU A;  1BUL A;  4GKU A;  4KZB A;  5CTN A;  3LEZ A;  1SKF A;  5HL1 A;  3D4F A;  1MWT A;  4FSF A;  3G30 A;  4QU3 A;  4QB8 A;  1N9B A;  1RGZ A;  1JWZ A;  4JXS A;  2WAF A;  4KZ3 A;  2OLU A;  4K91 A;  4OVD A;  3WS1 A;  4DXC A;  3N8R A;  2EXB A;  1I2W A;  3CZD A;  4S2I A;  3O86 A;  2HPB A;  2XFS A;  4S2N C;  1CEF A;  2J9P A;  5G18 A;  3V5M A;  3OC2 A;  1HD8 A;  3UO9 A;  4E6W A;  4QD4 A;  4XUZ A;  4HES A;  5J8X A;  1JTD A;  4KZ4 A;  1K54 C;  4E3I A;  2C6W B;  3BRM A;  5TFQ A;  1K55 C;  1HZO A;  3PTE A;  4JF6 A;  3C7V A;  1Q2Q A;  1YLP A;  1NZO A;  1K56 D;  2G2U A;  3NY4 A;  4OKP A;  2HP5 A;  3AGF A;  3JYI A;  2BLS A;  2OV5 A;  1K4F A;  2P9V B;  1TVF A;  1MWR A;  3WS0 A;  2DCF A;  5DF9 A;  3V39 A;  4N9K A;  3PBO A;  3GSG A;  1WYC A;  1NXY A;  5GLC A;  1M40 A;  5KSH A;  4P85 A;  1RCJ A;  2IWC A;  1NRF A;  2XQZ A;  1NZU A;  1W7F A;  1KGE A;  3N6I A;  5HX9 A;  3FKW A;  1RGY A;  4FCF A;  5GHY A;  5EE8 A;  5EVI A;  1XGI A;  3VP1 A;  2ZQ9 A;  4QY6 A;  3OPP A;  1FCM A;  1LI0 A;  3N8S A;  3TSG A;  4CJN A;  1BLH A;  5FAP A;  3CG5 A;  3OCN A;  2WGW A;  3IXH A;  2WAD A;  1IYO A;  4RA7 A;  3VFH A;  3C4O A;  4JBF A;  2ZJ9 A;  1OME A;  2P9V A;  1NYY A;  3LY3 A;  4PM8 A;  2J7V A;  5CER A;  4E3M A;  3FYZ A;  4K0X A;  1BLP A;  4ZJ1 A;  4DDY A;  5DF7 A;  2FFF B;  2PBY A;  4BL2 A;  1JWV A;  4FH4 A;  2ZQ8 A;  4PMA A;  3HLC A;  1ERM A;  1BLC A;  4MBF A;  1L2S A;  1W5D A;  2QMI A;  3IF6 A;  4U3T A;  3VP4 A;  1PWG A;  4QHC A;  3WS4 A;  1LL5 A;  1YLY A;  5KZH A;  3NDE A;  1TDG A;  2WGV A;  3HLG A;  1MWS A;  5DF8 A;  1SHV A;  4WEK A;  1K6R A;  4N1H A;  4DE1 A;  3HRE A;  3IH9 A;  2IWD A;  3O88 A;  3N4I A;  1KE4 A;  2H5S A;  3BFG A;  1RP5 A;  3WS2 A;  4DE0 A;  3HLE A;  4D2O A;  5TGF A;  4N1X A;  1XKZ A;  1ERQ A;  2JE5 A;  1Z6F A;  2ZM0 A;  5FA7 A;  4ZAM A;  4OPR A;  4R4R A;  3NI9 A;  5FI2 A;  3SOI A;  3HLB A;  4NET A;  5HAR A;  1G68 A;  3VP0 A;  5EEC A;  1JVJ A;  1PWC A;  2ZQD A;  2ZMA A;  4KQR A;  3C4P A;  4M3K A;  4XUX A;  4OOY A;  1KE0 A;  5EVL A;  2P74 A;  3LO7 A;  5E2H A;  3MZF A;  1IYP A;  2V20 A;  4E3O A;  3NC8 A;  1PI4 A;  2HDS A;  1KDW A;  1O07 A;  3IF5 A;  2Z2L B;  1ES3 A;  2JC7 A;  3M6B A;  2ZC3 B;  4IVI A;  3UDX A;  3IXB A;  3IH8 A;  4B88 A;  1YT4 A;  1VQQ A;  4RYE A;  1MY8 A;  5EPH A;  4JF4 A;  2Y2K A;  3MZD A;  5FAT A;  4OP5 A;  3ZGA B;  1LLB A;  1KE3 A;  5F82 A;  1MBL A;  2VGJ A;  4UAA A;  3LCE A;  3Q7V B;  1W8Y A;  5CEC A;  4OLG A;  5JYP A;  3ZDJ A;  4BD0 A;  3Q7Z A;  1L0D A;  1BLS A;  4BD1 A;  2R9X A;  2WZX A;  4X69 A;  4LV3 A;  3UE1 A;  3GTC A;  2XDM A;  1NYM A;  5FI7 A;  4PM7 A;  3CMZ A;  5FAO A;  4B4Z A;  5AQ7 A;  4KZA A;  4YIN A;  2X01 A;  3GRJ A;  3NIA A;  5HFO A;  4OQG A;  3FWL A;  4QY5 A;  1PI5 A;  4FD8 A;  3FKV A;  4OQ0 A;  5HAP A;  3ZG5 A;  4C3Q A;  1GHP A;  1DJA A;  4WBG A;  5GL9 A;  3UE0 A;  4Y0T A;  2I72 A;  3UE3 A;  3UPO A;  5JYO A;  2QZ6 A;  1XGJ A;  3DTM A;  2Y2M A;  1YLZ A;  3FV7 A;  1K57 A;  1ONG A;  1IKG A;  2HP9 A;  4A5R A;  5CHU A;  2PU4 A;  2WK0 A;  5F1F A;  4WZ5 A;  1LI9 A;  4R1G A;  1Y54 A;  2Q9M A;  3Q82 A;  3A3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...