2KOIA

Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Transferase
total genus 34
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2koiA00
4R70A 3O5YA 5DFXA 4Y5FA 1YSQA 3MF0A 5HSQA 3KSIA 3NOTC 4FOFA 4LRZE 4LRYC 5I5LA 2W3FA 2HGVA 4MMNA 2W3GA 2OOLA 3NHQA 2KOIA 4Y2FA 2ZMFA 4GW9A 3R4KA 2XROA 3RFBA 3OBFA 4IUKA 4E04A 2LB5A 2VEAA 2O0YA 4MDZA 3G6OA 2O9AA 3E98A 3MQ0A 2VKSA 3IBJA 2LB9A 2B18A 2IA2A 3C2WA 4QPRA 1YKDA 4YNRA 3KO6A 3HCYA 2G7UA 3NOPC 4G3KA 4CQHA 2W3DA 1F5MA 1VHMA 1MKMA 4G3VA 5LBRA 5TJJA 1TD5A 4R6LA 3IBRA 4LRXC 5HPIA 4Y3IA 2XSSA 2W3HA 4BWIA 5HL6A 4MCWA 4EUVA 3LFVA 2W1TB 2Y8HA 2W1RA 3DBAA 5L8MA 3VV4A 2KLIA 2Y79A 2VJWA 3ZQ5A 2M7UA 2O99A 3CI6A 2QYBA 4EU0A 4DN0A 3KSGA 3TRCA 2K2NA 4ETZA 4ETXA 3K2NA 1TF1A 3EEAA 3D3OA 3KSFA 3OOVA 4Q0JA 2K31A 1ZTUA 3KSHA 2VZWA 3S7PA 4O01A 5K5BA 4Z1WA 3S7QA 4G3WA 2W1TA 2M7VA 5C5KA 4O8GA 2GX5A 1STZA 3BJNA 1MC0A 4ME4A 4Q0HA 5HPFA 4RQ9A 4YOFA 3NOUC 3S7NA 4Q0IA 4DMZA 4GLQA 3W2ZA 5AJGA 2XRNA 4MN7A 1YSPA 4IUHA 2O9CA 2O9BA 4PAUA 3E0YA 4O0PA 3CITA 3MMHA 3S7OA 2W3EA 4IJGA 4ZRRA 5DFYA
chains in the Genus database with same CATH superfamily
3G2YA 3G31A 5HWWA 1LHYA 2FH5A 2R9WA 4KQDA 4MBHA 1NLYA 1KE3A 4LRZE 2HGVA 2OLVA 3PAEA 3LICA 4BENA 3W8KA 4GW9A 3C7VA 1G68A 4LV3A 2WGWA 1OTIA 3OBFA 4MLLA 2LB5A 4S2MA 4LCMA 5E2HA 1CQAA 1G6OA 3UMEA 2A2LA 4KENB 1DP9A 3ZG7B 3C7UA 2P04A 3CZDA 4JBFA 2PBDP 3T50A 2Y2HA 1GA0A 3MXSA 4KQRA 3UN7A 3UPPA 4K08A 3LFVA 3A3DA 1SKFA 5FI2A 3NIAA 1K55A 3U2AA 4BJPA 4X56A 3BFDA 3P7NA 2ZQDA 4ETXA 1BUEA 2D01A 3T1RA 4NK3A 4DDYA 3GV9A 1BZAA 4KZ3A 4FH2A 3G4PA 2ZLYA 1N9OA 4NXBA 4O8GA 4KG6A 3NI9A 3CJMA 1E4DA 2EXBA 4ESPA 5L2FA 3NOUC 4DMZA 3W2ZA 1TEMA 1D1JA 4IUHA 3VE3A 3UY6A 1MXOA 5MC7A 3E0YA 1XA1A 1W8QA 4BD1A 1SZVA 5DFXA 3CUEC 3SOIA 1EWZA 3EEHA 3G35A 1PW1A 4S2PA 2EWWA 4FSFA 5GHXA 1VETA 4NKPA 2ZOIA 4ARZB 3ZYTA 1KGGA 2XROA 1IOUA 4E3KA 1ACFA 1H8MA 1FSYA 4KZ5A 1E25A 1Y28A 1Q2QA 2ZM2A 5FDHA 3PTEA 5DTKA 2LB9A 5FAOA 2Y59A 5A91A 4DJ2A 5FQQA 4HJ4A 2WZXA 3FWLA 1MKMA 3W4OA 1OMEA 2VK3A 1KVMA 1K56D 1Y54A 4HHDA 4R0QA 2W1TB 2VX8A 3V39A 1KDWA 2Y91A 3IXBA 1D7EA 4ETZA 1TF1A 3PBTA 4N9KA 4LFUA 2OV5A 4X1MA 3FPVA 3IXHA 2B5RA 4EERA 1YAXA 5EM1A 3LIAA 1H8YA 3HLBA 5FATA 1K25A 4XUZA 1STZA 3BJNA 3E4OA 4CLCA 4YFMA 5KZHA 3UE1A 5FAQA 2J8YA 1EW0A 5EECA 3C30A 2X01A 1HZOA 3BM6A 5CXWA 1IELA 1FILA 3V3RA 4KQQA 4WEKA 3VE4A 3LGOA 4ID4A 1KOUA 3BECA 1CJFA 3IX8A 4E6XA 5CECA 4OH0A 4R23A 5FSRA 2ZMAA 3A3IA 5HAPA 4LPZA 2W3FA 1W7FA 4E6WA 3C4PA 4Y2FA 4DKIA 3HUOA 3LR0A 4H6JB 1YLTA 5GLAA 2Y2NA 4U0TA 3BYDA 3LUQA 1T1BA 1S0WA 2O9AA 3DWZA 5HAIA 3ZG9B 4JXVA 5EVIC 2VKSA 2FFFB 1LI0A 4WYYA 1BTLA 1D06A 4OPZA 2Y2PA 1ESIA 3IT9A 4XT2B 4B88A 1GSVA 5A90A 5HPIA 1YT4A 3R7WB 5FASA 3C8CA 2KLIA 2R9XA 2XA7S 3ZG8B 1MWRA 5G4ZA 5EVLA 5TBMA 3HUNA 2E8JA 4GZBA 3BEBA 4JLFA 4I5SA 4BMWA 4JXWA 2INWA 3ZNYA 4E3MA 3IXDA 3S1YA 2NUPC 3BFCA 4JF4A 3HLGA 2RCXA 3OPLA 3BFFA 1VEUA 2HP5A 4X69A 5GLDA 2ZQ8A 3SH7A 2ACGA 4UQIM 1KE0A 2V1AA 1P97A 1OTDA 1DY6A 5FDSA 4OONA 3VOYA 4X53A 3MKEA 3NOTC 4OPRA 1K57C 4PM7A 4MN5A 1DJAA 2OOLA 3SS3A 3T4KA 2J80A 2GNXA 5CHMA 4F3LA 1F2KA 2P7JA 4OOLA 3VP0A 1ES3A 2Y4AA 3W4PA 2JE5A 5TR7A 4S2OA 5IS1A 4YNRA 2B02A 1TD5A 5F1GA 2XR0A 3M6HA 5IT5A 2PBYA 3WRTA 2Y8HA 3Q7VB 3UE0A 1G6AA 4S2JA 3QP5A 4EEPA 1IKIA 3PBOA 4KZBA 2VGJA 3ZCZA 2EFXA 5G18A 3D3OA 3H9WA 2Q0OA 2K31A 3BFEA 3JVUA 1VM1A 2VZWA 3ZNTA 4Z1WA 2Y2KA 5A8BA 1PWGA 3NCKA 1YPRA 2BLSA 3PXPA 3BY9A 1TDLA 3BW6A 4GLQA 1MWTA 4BL2A 5EV0A 5U47A 3BFGA 3S4XA 4BQMA 3S7OA 2W3EA 5HZHA 4N9LA 3WRZA 1Y4OA 4OQGA 1HD8A 1YSQA 5HW3A 2HDSA 4LV1A 2K7SA 5DF8A 3F1PB 1EROA 5I5LA 1P9WA 3T1SA 1AWIA 2QZ6A 2ZMFA 4E04A 4HBTA 2KX6A 4DJ3A 4MDZA 3G6OA 3MZEA 1DRMA 1ONGA 2V8CA 5GL9A 3IF6B 3UPNA 2A49A 4JF5A 2QHKA 3HCYA 3KO6A 4KUOA 2PD7A 3UB5P 3MKFA 4JKTA 4ARZA 1DJBA 4S2IA 3KYEA 4MNRA 4LV0A 2ZQCA 2XEPA 1NWZA 4BWIA 5HL6A 5HDCA 5JYPA 3RTYA 3E4PA 4R3AA 1FIKA 1UWPX 3Q1FA 2H5SA 3T4SA 1K0KA 3MBZA 3LY3A 4OQHA 4Y17A 3H82B 5CX7A 1HTZA 2VV6A 1K6SA 2HJEA 5F69A 3S7PA 3B33A 1QMEA 5J4EA 3GQZA 4G3WA 2NUTC 2W1TA 4ZTKA 3N8SA 5EOEA 3UE6A 2Q9MA 5AQAA 1XX2A 5AQBA 1ERMA 1RGZA 3WS2A 1L0GA 3LEZA 4MN7A 1S66L 3S22A 1OT9A 3CITA 1F98A 1KVLA 2WZZA 5FQIA 5TFQA 2WAFA 5EVID 4UHUA 4R1GA 4GCZA 4QJGA 4LGWA 3AGFA 1EI5A 4Y0UA 1V9ZA 2XGNA 5HFOA 3CAXA 3FKWA 5M19A 4E3IA 3CWFA 3O88A 1OTEA 1XFQA 3GECA 3WWXA 1ZKJA 5J3WA 3E98A 1PWCA 2PR5A 4EXOA 3CPTB 4S2KA 1TS7A 1E3UA 5TGFA 1YKDA 3UB6A 4B4XA 4DXCA 4NEED 2W3DA 4K0WA 1SCWA 1YLYA 3TE8A 4H6JA 3UO9A 4Y3IA 3MQQA 4HI4A 3IF5A 3L9KA 2Y2MA 2DMWA 3EQVA 1XJ4A 4A5RA 4HBUA 4MBFA 2W27A 4QY5A 3FC7A 3JYIA 3P98A 5CGXA 2V20A 3UMDA 5HWTA 4XT2A 2ZC6B 3ZVTA 4FD8A 5F6AA 4O01A 3R7WA 3H7WB 3S7QA 5AQ7A 2RL3A 4P0MA 3EOIA 3PBQA 1MC0A 3BY8A 3MXRA 5L09A 3IWOA 3D72A 2JN7A 4RQ9A 2PHYA 4L0LA 5EOOA 5EFWA 2ZJ9A 4O0PA 1NRJA 2ZC3B 4P6ZS 4LV2A 4HOIA 1JVJA 5DTTA 4BD0A 3QP1A 1GSWA 3IWQA 3ZG0A 5M18A 4ZDXA 3Q81A 3OLOA 5EUAA 1K4FA 2HPBA 2JBFA 4OLDA 1N9NA 1MKIA 1K4EA 4LCLA 4EBPA 2O0YA 4JXGA 4OP5A 1YMXA 2IA2A 4PKYA 3TSGA 3VP3A 2EX8A 2ZC7A 5FAPA 4X25A 3NOPC 3OPPA 3IWIA 4P87A 4RYEA 5HDDA 4HEFA 4HNBA 5CEBA 3SH9A 1SDNA 5EVEA 5J8XA 1SHVA 3NC8A 4X55A 2Y79A 1XXMA 3ULFA 1KGEA 1MWSA 2HF6A 3TRCA 2JHEA 2J7VA 3TG9A 2BASA 3Q7VA 3T4QA 3VSLA 1VB6A 2GX5A 2XFSA 2XQZA 1DP6A 2PAVP 1NY0A 1LLBA 2XRNA 4S2LA 3LIFA 1NYMA 5L07A 1FCNA 3Q07A 4ZRRA 4WM9A 4BL3A 4R70A 3VMAA 1ERQA 3KSIA 4DE0A 1LI9A 4EV4A 1LSVA 1IEMA 1AXBA 1L0DA 1S1ZA 2HDQA 3PBSA 3PAGA 4JXSA 2UWXA 3NHQA 2KOIA 1CEFA 3R4KA 5CGSA 3GR2A 4IUKA 4LLOB 1P0ZA 2CMNA 5GLCA 3UPOA 3CHWP 4KG2A 3E4QA 4GDBA 2PDRA 2EFUA 1WYBA 3F1PA 1L0EA 2OAQ1 2QJ7A 3JVVA 5CTMA 1TS0A 2J9PA 1CK3A 1L0FA 3G34A 3NJAA 2W0NA 1LSXA 3BQ8A 4PMAA 2XSSA 3AGDA 4D2OA 4EUVA 3C5AA 4KG5A 4WZ5C 3SZTA 4IEDA 3IF6A 2VGLS 2O99A 1GHPA 4CLCE 4GD8A 3WS1A 2H28A 3DTIA 5FQKA 4GKUA 4XUXA 5DJUA 2K2NA 1KE4A 3NDGA 5F68A 4Z9QA 3UDIA 4NETA 3VFHA 1JWZA 1U60A 3QNBA 5K5BA 1PZOA 2MJ6A 3B42A 1UWNX 1M40A 3N8LA 3K3DA 3ITAA 2H0YA 3F1OB 5HPFA 1OT6A 1MBLA 1BLSA 5AJGA 3CLOA 1TDGA 2XF3A 3H82A 5EPHA 3O86A 5E2EA 4HP4A 2GJ3A 1IYOA 3FKVA 3E2KA 2Y55A 4EWFA 2XA7M 2HV1A 4JGRA 5F82A 2ZBBA 3VOLA 1PNEA 3SW1A 2QKPA 3HUMA 2W3GA 1T1AA 3OPRA 3HJKA 2HDUA 1SKOB 1XP4A 3FYZA 2ZL1B 2IWDA 4U3TA 2J3TC 1BULA 2XFTA 4GNUA 1FQGA 4GHIB 4N1XA 1CF0A 4C3QA 3RXXA 3V50A 1L3LA 3C2WA 4CPKA 4QPRA 3HBRA 1PRQA 4CQHA 4NXEA 3UDXA 1T1CA 4XXRA 3NBLA 5EE8A 3HJIA 1G5UA 1IYSA 1TS8A 2HJ9C 1H0MA 2E8IA 2WK0A 3QP2A 3GSGA 4KZ8A 3WS0A 3LEQA 1T19A 2QYBA 2H10A 3CPTA 4R38A 4DN0A 4EBNA 4N1HA 3BLMA 4PM6A 1O07A 1FR6A 3K2NA 1O7EA 1K55C 5DF7A 4GDNA 1N4OA 3SS5A 3OCLA 3PBNA 3ZFZA 3FPWA 2PD8A 2HDRA 3WS5A 3VP4A 3QNCA 4L9FA 4NG2A 3UNWA 4E3OA 4YOFA 1MPLA 4BBUA 2YKHA 4MBKA 4Q0IA 4OOMA 2WAEA 3BQAA 3CG5A 1VQQA 5EM0A 5DF9A 2EWVA 3CUEA 5AQ9A 3HLFA 4PAUA 2OWHA 3MSHA 2IWBA 4S2NA 4UA6A 4I38A 3RJUA 1W79A 1GHMA 4OP8A 1ZG6A 4B9OA 3H7WA 1S4RA 3VP2A 4RVAA 5L10A 3KYZA 4EQ1A 3GMWA 2V0UA 3DTKA 2JKTM 4LRYC 5FQJA 1J9MA 4MMNA 3QP6A 4QU3A 3MS6A 1XPBA 2R78A 1K54A 1XJ6A 2JKFA 2OLUA 2J9OA 4PM8A 2WKIA 1PI5A 2KDKA 2EX6A 3W4QA 3I7JA 4RA7A 3IBRA 3LY4A 3IQAA 3A3JA 3HL9A 3VSKA 2W3HA 3G30A 3Q82A 3V3SA 4MCWA 1TS6A 3ICYA 4GD6A 3N8RA 3AGEA 4OPYA 4HH2A 3CI6A 4EEUA 4EU0A 5HWVA 2V0WA 4KZ6A 3QP8A 3HLDA 1KGFA 1ODVA 1L2SA 4X6TA 1NRFA 3KSFA 4KUKA 3MJQA 1YMSA 2Y2IA 5FI6A 2VLGA 3VFFA 1Z09A 4DDSA 3UE3A 1JWVA 2WGVA 3T4TA 2JKRM 4Q0HA 4PKYG 5F5YA 1CEGA 3ZDJA 3S7NA 4JGPA 4BLMA 4CLCC 4WN5A 1PIOA 3IX3A 3LIDA 4WZ4A 2V9AA 2XD5A 2XK1A 4C6YA 2I72A 4Y15A 2VGKA 2JCHA 1X0OA 3P01A 5HAQA 3DAVA 3GRJA 1WYCA 1PYYA 1YLZA 5D3OA 1XFNA 1NLZA 1WA9A 2Z2LB 2V1BA 1PW8A 1RCJA 5EVIA 1LL9A 4FTXA 2XH9A 1ZC2A 4WMCA 1PFLA 4JGQA 1ALQA 3F1NA 3V67A 2A24B 2FZ0A 2V1ZA 4I3AA 4WBGA 1JTDA 4G3VA 4P85A 4HJ3A 5A93A 3NULA 3FV7A 3IHAA 2XDMA 2Z2MB 3GTCA 1XJ2A 5DKLA 3V5MA 3A3FA 2EA9A 2AVXA 4OPQA 2A3UA 2EX9A 2QWSA 4WUJA 4FH4A 2JC7A 4QB8A 3L7HA 5M1AA 3OOVA 4EETB 3MQOA 5HL1A 4B93A 3EGDC 1LT0A 1I2SA 2M7VA 4EQIA 2H0TA 3E2LA 3RH8B 1MY8A 4Y13A 4GOGA 1ES2A 2WYXA 3DWKA 3RXWA 5CEDA 3LR3A 4M3KA 2O9CA 3ISGA 1E3UD 2J3TD 4IVIA 1BLCA 5FA7A 4IJGA 1K57A 5E2GA 5F83A 3O5YA 3ZG5A 4OQIA 3D4FA 3N6IA 3F1OA 4FOFA 1BLPA 2Z6DA 4B4ZA 1OPXA 1S1YA 2QJ5A 4YWZA 2L1MA 2WKQA 3UB8A 1SDEA 3T4LA 3N4IA 1CI8A 4Y7PA 4UA7A 3IXGA 1ZG4A 2BTFP 4QHCA 3HLWA 4C75A 3A0SA 2WKRA 1YLWA 3UB7A 1NYYA 1TVFA 3KYQA 4WF0A 2EX2A 3TOIA 2ZD8A 5DKKA 4G3KA 1IKGA 1KDSA 3OZHA 5LBRA 5TJJA 3BLSA 1K38A 4F94A 1MWUA 1SKOA 2ZL1A 4FCFA 3TW8A 3ZVWA 4WEJA 2M1CA 4P6ZM 4GHIA 5CHJA 2W1RA 2WUQA 4OQ0A 5L8MA 5E2FA 5E43A 2M7UA 2PU4A 3HLEA 2DRWA 4M4XA 4UA9A 3KSGA 3A3EA 3Q7ZA 2Y2OA 2Y2JA 2C5WB 2ZQ7A 2V8FA 4HY8A 1F9IA 4QWOA 3LIBA 3ITBA 2PT7A 1MZUA 4GS9B 2P9VA 5C5KA 1HLUP 4S2NC 4KZ9A 2OSUA 4ME4A 1FR1A 1H3QA 3DW0A 4HJ6A 1M6KA 5KSCA 1K56A 4U0XA 1XGIA 4DXBA 4WELA 2VA0A 4JF6A 4MN6A 3HLCA 2O9BA 3LR5A 4KZ7A 4X1LA 1ESUA 3M2JA 4K0XA 3LI8A 4R3BA 3DTMA 5DFYA 3LR4A 5JYOA 3FG8A 3B3XA 3UB9A 4E3NA 1K54C 5G4YA 5I94A 3VOZA 3NECA 2Y2LA 3M2KA 5EVIB 1GA9A 3SS4A 4LENA 4IVKA 5FL3A 2VEAA 2Y2QA 2ZQ9A 3F1NB 4QD4A 3MQ0A 3OPHA 3QP4A 3MFXA 4H8RA 3A0VA 3IBJA 1ES4A 3G32A 4K91A 2B18A 3T12B 4D60A 4AFIA 3LI9A 1F5MA 2DNSA 3LIEA 4LRXC 4DRTA 1S6RA 4II7A 4IBRA 4L9GA 3DBAA 3IS2B 4EESA 3PBRA 4N92A 4GJ4A 3ZQ5A 3IH9A 4FUWA 3OC2A 4O7DA 1T18A 1K6RA 2Y2GA 1W63Q 4CLCD 1DP8A 3DTEA 4BBVA 1S4SA 1ZTUA 5FEFA 1RP5A 2P74A 3KSHA 1OJGA 4PHTA 4WLAA 1ONHA 2I9VA 1YLPA 5CERA 4OOYA 1W5DA 1JWPA 2OAP1 1N9BA 3MR0A 4L9EA 1FOFA 3HVFA 1BLHA 1YSPA 5KIZA 3MXQA 2PR6A 3TJZC 1NZUA 2WGWB 5DJTA 3U4LP 5IU1A 4KZ4A 1CI9A 4ZJ2A 5KSHA 4OVDA 3ZGAB 3EWKA 3PR6A 4Y5FA 2PYRA 2VGLM 1PZPA 3IX4A 1LL5A 1G28A 4KQOA 2C6WB 4ZJ1A 5AVEA 2G2UA 5CTNA 4I39A 1P9RA 4DF6A 4KZAA 1OJ5A 1GCEA 3T1XA 3PYPA 1YQSA 4I3JA 2J3WA 4Q8IA 5FI7A 3QHYA 2B95A 5CGWA 3EQUA 4R6LA 4X68A 4NXFA 2G2WA 4R4SA 1PWDA 4NXGA 4UQIS 2XD1A 4OKPA 1XA7A 1NJ4A 3KX0X 1FCMA 2L0WA 1NZOA 5GHYA 2EXAA 4Y0TA 1Q2PA 4IHQA 1PI4A 4HESA 2A24A 2ZM0A 2DCFA 3BWLA 1W8YA 2ZC4B 1UGUA 1FCOA 4UAAA 3O3VA 4YINA 2X02A 3JPUA 1HVBA 2P9VB 3WS4A 2WGIA 4R4RA 2XLNA 2ZMVA 3B47A 1J3WA 2Z6CA 3HREA 1XJ3A 1VETB 2Q9NA 4PPRA 3NY4A 3BRMA 4E3LA 1OTBA 1GSXA 2CC1A 1ES5A 3ZHHA 2WADA 2QMIA 3VP1A 1GHIA 2JKTI 1H5XA 1XKZA 5CHUA 1W63M 3RFBA 5KMWA 1V9YA 3IH8A 2PRFA 1BT5A 2OWJA 3CMZA 2VV7A 5DVAA 5FQ9A 3P09A 5J7EA 4EUZA 5CRFA 2BG1A 5HD3A 1FSWA 1IYQA 1YLJA 2VV8A 5HD5A 4IBXA 4DE1A 2PU2A 3LYXA 5HX9A 3VV4A 3K3CA 4CLCB 1OTAA 2UV0E 4HH3A 4RX2A 4OLGA 2D02A 3M6BA 1JNUA 1JTGA 4Q0JA 1WE4A 4EW7A 1A0KA 3C38A 1DJCA 4PM5A 2WKEA 5HARA 2GDNA 5GHZA 4UEYA 1BSGA 1N9LA 3LCEA 2ZQAA 1LSWA 2JKRI 2HP6A 2X71A 1BYWA 1IFQA 1C3BA 1S67L 3MZDA 2ZC5B 1ZHHB 3MFDA 2WKHA 5BOHA 2ZOHA 4PM9A 3MMHA 2QPNA 2JKGA 4GS9A 3C4OA 3N7WA 4Y0OA 3MF0A 4JGOA 4JPMA 5HDSA 3OCNA 5HSQA 4P6BA 4MEZA 1RGYA 4ZJ3A 2V2FF 2FFYA 1IYPA 5GLBA 3SH8A 4WL9A 1YM1A 2PYPA 3T1QB 2HP9A 1H8ZA 5FQMA 3O87A 4GN2A 3T4OA 4DE3A 3D9YA 3LO7A 1Z6FA 3G2ZA 1QMFA 2G7UA 4ZAMA 3UDFA 4DE2A 5TBMB 4WZ5A 4QY6A 1VHMA 4I3IA 3T4JA 4RX3A 2GZAA 1I2WA 3A0RA 1NXYA 3NDEA 5IHVA 5A92A 4BBTA 2VJWA 2IWCA 5DTSA 4R3JA 4HQAA 2L4RA 2HZ5A 2WKPA 1VEUB 3EEAA 3IF6C 2P08A 4GB7A 5F1FA 2ZM8A 4E3JA 4HP9A 1LL8A 3GVBA 4ZBEA 4EBLA 3IS2A 3FZCA 3EGXC 3PHYA 4WMCD 4CJNA 5AVFA 1I5QA 3MZFA 5FEGA 3GDIA 3IHBA 4F3LB 2YKFA 1XGJA 4HIAA
chains in the Genus database with same CATH topology
3FG8A 5HWWA 1YSQA 3UB9A 2XA7M 2HV1A 4JGRA 2FH5A 2ZBBA 2K7SA 5G4YA 4KQDA 3VOLA 1NLYA 3F1PB 3SW1A 4LRZE 5I5LA 2QKPA 2HGVA 2W3GA 1P9WA 1T1AA 3HJKA 3LICA 2ZMFA 4GW9A 2J3TC 3OBFA 1OTIA 4E04A 2KX6A 2LB5A 5FL3A 4DJ3A 2VEAA 4MDZA 3G6OA 4GHIB 1DRMA 3F1NB 3MQ0A 1G6OA 3MFXA 3UMEA 3A0VA 3IBJA 2A2LA 2B18A 3C2WA 4QPRA 2QHKA 3HCYA 3KO6A 4KUOA 4AFIA 3LI9A 2PD7A 4CQHA 4NXEA 1DP9A 1F5MA 1T1CA 2P04A 4ARZA 3LIEA 3T50A 3HJIA 4LRXC 1NWZA 1TS8A 2HJ9C 4BWIA 5HL6A 4K08A 5HDCA 3LFVA 4II7A 4L9GA 3DBAA 3IS2B 3RTYA 4EESA 3E4PA 3PBRA 4GJ4A 4R3AA 3U2AA 3ZQ5A 1T19A 2QYBA 1UWPX 4R38A 3T4SA 4BJPA 4DN0A 3OC2A 1T18A 3P7NA 4ETXA 3K2NA 1W63Q 4CLCD 1DP8A 2D01A 3H82B 4BBVA 5CX7A 1S4SA 2VV6A 1ZTUA 2HJEA 3KSHA 5F69A 3S7PA 3B33A 1OJGA 5J4EA 4PHTA 4WLAA 2I9VA 3OCLA 4G3WA 3PBNA 2NUTC 2W1TA 3FPWA 1N9OA 4NXBA 2PD8A 4O8GA 3UE6A 4L9FA 2OAP1 4YOFA 3NOUC 4BBUA 2YKHA 4Q0IA 3MR0A 4L9EA 4DMZA 4OOMA 3BQAA 3W2ZA 5DF9A 2EWVA 3CUEA 4MN7A 1S66L 1YSPA 1OT9A 4IUHA 3VE3A 3MXQA 2PR6A 5KIZA 4PAUA 3TJZC 2OWHA 5MC7A 3E0YA 4I38A 3CITA 1F98A 5DJTA 5IU1A 5KSHA 4B9OA 3H7WA 3EWKA 3PR6A 5DFXA 3CUEC 1S4RA 4Y5FA 2PYRA 4GCZA 3EEHA 2VGLM 3KYZA 1V9ZA 4EQ1A 2V0UA 2EWWA 2JKTM 4FSFA 4LRYC 4NKPA 4MMNA 3CAXA 1G28A 2ZOIA 4KQOA 4ARZB 3CWFA 3ZYTA 1OTEA 2R78A 2XROA 1IOUA 5AVEA 1XFQA 1XJ6A 3GECA 1H8MA 4I39A 1P9RA 1OJ5A 5J3WA 1Y28A 3E98A 2PR5A 4EXOA 3PYPA 2KDKA 4I3JA 2J3WA 1TS7A 2LB9A 1YKDA 3UB6A 4NEED 4DJ2A 2W3DA 4HJ4A 1MKMA 3EQUA 4R6LA 3IBRA 4NXFA 3TE8A 4H6JA 4NXGA 3MQQA 4HHDA 4UQIS 4Y3IA 2W3HA 4HI4A 4MCWA 1TS6A 2W1TB 3ICYA 3KX0X 2DMWA 3EQVA 2VX8A 2L0WA 1XJ4A 4HH2A 3CI6A 4EEUA 4EU0A 5HWVA 4IHQA 2W27A 2V0WA 2A24A 1D7EA 3FC7A 3BWLA 1ODVA 4ETZA 3UMDA 1TF1A 3PBTA 5HWTA 3KSFA 3FPVA 4KUKA 4XT2A 1UGUA 3MJQA 4EERA 5F6AA 2VLGA 4O01A 1YAXA 3LIAA 3R7WA 3UE3A 3H7WB 3S7QA 3EOIA 1STZA 3BJNA 3E4OA 4CLCA 3PBQA 3T4TA 1MC0A 3BY8A 2JKRM 4Q0HA 4PKYG 3D72A 5F5YA 2ZMVA 2JN7A 3B47A 2PHYA 1EW0A 4RQ9A 3S7NA 2Z6CA 3C30A 4L0LA 1XJ3A 4JGPA 5EFWA 4CLCC 4WN5A 4O0PA 3LIDA 1NRJA 2V9AA 1OTBA 1GSXA 4P6ZS 4WEKA 3VE4A 4HOIA 1KOUA 1GSWA 1X0OA 3P01A 3OLOA 4LPZA 2W3FA 1XFNA 1NLZA 1WA9A 2JKTI 2V1BA 4Y2FA 3LR0A 4H6JB 1N9NA 1W63M 3RFBA 1V9YA 2O0YA 3LUQA 4JGQA 1T1BA 2O9AA 3F1NA 2VKSA 2OWJA 3V67A 2A24B 2FZ0A 2IA2A 4PKYA 1D06A 4I3AA 2VV7A 5J7EA 3NOPC 5HDDA 4G3VA 4HNBA 4XT2B 5HD3A 4HJ3A 1GSVA 2VV8A 5HPIA 5HD5A 3R7WB 3LYXA 3VV4A 3K3CA 3C8CA 2KLIA 2XA7S 2Y79A 1XJ2A 1OTAA 5DKLA 4CLCB 4HH3A 2EA9A 3ULFA 2HF6A 3TRCA 5G4ZA 2D02A 2QWSA 4WUJA 5TBMA 1JNUA 2JHEA 4EETB 3OOVA 4Q0JA 3MQOA 4EW7A 4I5SA 4BMWA 3C38A 2INWA 4B93A 3EGDC 1LT0A 2M7VA 2BASA 3T4QA 1VB6A 2GX5A 4UEYA 2NUPC 3RH8B 1N9LA 1DP6A 1LSWA 2JKRI 1BYWA 1IFQA 1S67L 2XRNA 1ZHHB 3LR3A 2O9CA 2J3TD 3LIFA 2ZOHA 3MMHA 4UQIM 4IJGA 2V1AA 1P97A 1OTDA 4ZRRA 4GS9A 4R70A 3O5YA 3MF0A 4JGOA 5HDSA 5HSQA 3OCNA 3KSIA 3NOTC 3F1OA 4FOFA 2Z6DA 1LSVA 4MN5A 1OPXA 1S1YA 1S1ZA 2QJ5A 2OOLA 4YWZA 3PBSA 2L1MA 2WKQA 3UB8A 3NHQA 2KOIA 3T4LA 3T4KA 2J80A 2GNXA 3R4KA 4IUKA 4LLOB 4WL9A 1P0ZA 2CMNA 4F3LA 2PYPA 3A0SA 2P7JA 4OOLA 2WKRA 3T4OA 3E4QA 3UB7A 2PDRA 3KYQA 4WF0A 3F1PA 5IS1A 4YNRA 5DKKA 2OAQ1 2G7UA 2QJ7A 2B02A 5TBMB 4G3KA 3JVVA 1VHMA 5LBRA 4I3IA 1TS0A 5TJJA 3T4JA 1TD5A 3NJAA 2GZAA 2W0NA 1LSXA 3BQ8A 2XSSA 3A0RA 3TW8A 4EUVA 4HIAA 2M1CA 4P6ZM 4WEJA 5IT5A 4GHIA 2Y8HA 4BBTA 2W1RA 5L8MA 2VJWA 2VGLS 2M7UA 2O99A 4EEPA 4CLCE 4HQAA 4M4XA 2L4RA 2H28A 3KSGA 3PBOA 5DJUA 2K2NA 2WKPA 3D3OA 3EEAA 3H9WA 5F68A 2P08A 2K31A 3JVUA 4HY8A 1F9IA 2VZWA 3LIBA 4HP9A 5K5BA 1LL8A 1MZUA 2PT7A 4GS9B 4Z1WA 2MJ6A 3B42A 5C5KA 1UWNX 3IS2A 3K3DA 3EGXC 3PHYA 5A8BA 3F1OB 4ME4A 5HPFA 1OT6A 1H3QA 3PXPA 4HJ6A 3BY9A 5AVFA 3BW6A 4GLQA 4WELA 5AJGA 2VA0A 3CLOA 4MN6A 3H82A 2O9BA 3LR5A 3GDIA 3LI8A 3S7OA 2W3EA 2GJ3A 4HP4A 4F3LB 5HZHA 2YKFA 5DFYA 3LR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R70 A;  3O5Y A;  5DFX A;  4Y5F A;  1YSQ A;  3MF0 A;  5HSQ A;  3KSI A;  3NOT C;  4FOF A;  4LRZ E;  4LRY C;  5I5L A;  2W3F A;  2HGV A;  4MMN A;  2W3G A;  2OOL A;  3NHQ A;  2KOI A;  4Y2F A;  2ZMF A;  4GW9 A;  3R4K A;  2XRO A;  3RFB A;  3OBF A;  4IUK A;  4E04 A;  2LB5 A;  2VEA A;  2O0Y A;  4MDZ A;  3G6O A;  2O9A A;  3E98 A;  3MQ0 A;  2VKS A;  3IBJ A;  2LB9 A;  2B18 A;  2IA2 A;  3C2W A;  4QPR A;  1YKD A;  4YNR A;  3KO6 A;  3HCY A;  2G7U A;  3NOP C;  4G3K A;  4CQH A;  2W3D A;  1F5M A;  1VHM A;  1MKM A;  4G3V A;  5LBR A;  5TJJ A;  1TD5 A;  4R6L A;  3IBR A;  4LRX C;  5HPI A;  4Y3I A;  2XSS A;  2W3H A;  4BWI A;  5HL6 A;  4MCW A;  4EUV A;  3LFV A;  2W1T B;  2Y8H A;  2W1R A;  3DBA A;  5L8M A;  3VV4 A;  2KLI A;  2Y79 A;  2VJW A;  3ZQ5 A;  2M7U A;  2O99 A;  3CI6 A;  2QYB A;  4EU0 A;  4DN0 A;  3KSG A;  3TRC A;  2K2N A;  4ETZ A;  4ETX A;  3K2N A;  1TF1 A;  3EEA A;  3D3O A;  3KSF A;  3OOV A;  4Q0J A;  2K31 A;  1ZTU A;  3KSH A;  2VZW A;  3S7P A;  4O01 A;  5K5B A;  4Z1W A;  3S7Q A;  4G3W A;  2W1T A;  2M7V A;  5C5K A;  4O8G A;  2GX5 A;  1STZ A;  3BJN A;  1MC0 A;  4ME4 A;  4Q0H A;  5HPF A;  4RQ9 A;  4YOF A;  3NOU C;  3S7N A;  4Q0I A;  4DMZ A;  4GLQ A;  3W2Z A;  5AJG A;  2XRN A;  4MN7 A;  1YSP A;  4IUH A;  2O9C A;  2O9B A;  4PAU A;  3E0Y A;  4O0P A;  3CIT A;  3MMH A;  3S7O A;  2W3E A;  4IJG A;  4ZRR A;  5DFY A; 
#chains in the Genus database with same CATH topology
 3G2Y A;  3G31 A;  5HWW A;  1LHY A;  2FH5 A;  2R9W A;  4KQD A;  4MBH A;  1NLY A;  1KE3 A;  4LRZ E;  2HGV A;  2OLV A;  3PAE A;  3LIC A;  4BEN A;  3W8K A;  4GW9 A;  3C7V A;  1G68 A;  4LV3 A;  2WGW A;  1OTI A;  3OBF A;  4MLL A;  2LB5 A;  4S2M A;  4LCM A;  5E2H A;  1CQA A;  1G6O A;  3UME A;  2A2L A;  4KEN B;  1DP9 A;  3ZG7 B;  3C7U A;  2P04 A;  3CZD A;  4JBF A;  2PBD P;  3T50 A;  2Y2H A;  1GA0 A;  3MXS A;  4KQR A;  3UN7 A;  3UPP A;  4K08 A;  3LFV A;  3A3D A;  1SKF A;  5FI2 A;  3NIA A;  1K55 A;  3U2A A;  4BJP A;  4X56 A;  3BFD A;  3P7N A;  2ZQD A;  4ETX A;  1BUE A;  2D01 A;  3T1R A;  4NK3 A;  4DDY A;  3GV9 A;  1BZA A;  4KZ3 A;  4FH2 A;  3G4P A;  2ZLY A;  1N9O A;  4NXB A;  4O8G A;  4KG6 A;  3NI9 A;  3CJM A;  1E4D A;  2EXB A;  4ESP A;  5L2F A;  3NOU C;  4DMZ A;  3W2Z A;  1TEM A;  1D1J A;  4IUH A;  3VE3 A;  3UY6 A;  1MXO A;  5MC7 A;  3E0Y A;  1XA1 A;  1W8Q A;  4BD1 A;  1SZV A;  5DFX A;  3CUE C;  3SOI A;  1EWZ A;  3EEH A;  3G35 A;  1PW1 A;  4S2P A;  2EWW A;  4FSF A;  5GHX A;  1VET A;  4NKP A;  2ZOI A;  4ARZ B;  3ZYT A;  1KGG A;  2XRO A;  1IOU A;  4E3K A;  1ACF A;  1H8M A;  1FSY A;  4KZ5 A;  1E25 A;  1Y28 A;  1Q2Q A;  2ZM2 A;  5FDH A;  3PTE A;  5DTK A;  2LB9 A;  5FAO A;  2Y59 A;  5A91 A;  4DJ2 A;  5FQQ A;  4HJ4 A;  2WZX A;  3FWL A;  1MKM A;  3W4O A;  1OME A;  2VK3 A;  1KVM A;  1K56 D;  1Y54 A;  4HHD A;  4R0Q A;  2W1T B;  2VX8 A;  3V39 A;  1KDW A;  2Y91 A;  3IXB A;  1D7E A;  4ETZ A;  1TF1 A;  3PBT A;  4N9K A;  4LFU A;  2OV5 A;  4X1M A;  3FPV A;  3IXH A;  2B5R A;  4EER A;  1YAX A;  5EM1 A;  3LIA A;  1H8Y A;  3HLB A;  5FAT A;  1K25 A;  4XUZ A;  1STZ A;  3BJN A;  3E4O A;  4CLC A;  4YFM A;  5KZH A;  3UE1 A;  5FAQ A;  2J8Y A;  1EW0 A;  5EEC A;  3C30 A;  2X01 A;  1HZO A;  3BM6 A;  5CXW A;  1IEL A;  1FIL A;  3V3R A;  4KQQ A;  4WEK A;  3VE4 A;  3LGO A;  4ID4 A;  1KOU A;  3BEC A;  1CJF A;  3IX8 A;  4E6X A;  5CEC A;  4OH0 A;  4R23 A;  5FSR A;  2ZMA A;  3A3I A;  5HAP A;  4LPZ A;  2W3F A;  1W7F A;  4E6W A;  3C4P A;  4Y2F A;  4DKI A;  3HUO A;  3LR0 A;  4H6J B;  1YLT A;  5GLA A;  2Y2N A;  4U0T A;  3BYD A;  3LUQ A;  1T1B A;  1S0W A;  2O9A A;  3DWZ A;  5HAI A;  3ZG9 B;  4JXV A;  5EVI C;  2VKS A;  2FFF B;  1LI0 A;  4WYY A;  1BTL A;  1D06 A;  4OPZ A;  2Y2P A;  1ESI A;  3IT9 A;  4XT2 B;  4B88 A;  1GSV A;  5A90 A;  5HPI A;  1YT4 A;  3R7W B;  5FAS A;  3C8C A;  2KLI A;  2R9X A;  2XA7 S;  3ZG8 B;  1MWR A;  5G4Z A;  5EVL A;  5TBM A;  3HUN A;  2E8J A;  4GZB A;  3BEB A;  4JLF A;  4I5S A;  4BMW A;  4JXW A;  2INW A;  3ZNY A;  4E3M A;  3IXD A;  3S1Y A;  2NUP C;  3BFC A;  4JF4 A;  3HLG A;  2RCX A;  3OPL A;  3BFF A;  1VEU A;  2HP5 A;  4X69 A;  5GLD A;  2ZQ8 A;  3SH7 A;  2ACG A;  4UQI M;  1KE0 A;  2V1A A;  1P97 A;  1OTD A;  1DY6 A;  5FDS A;  4OON A;  3VOY A;  4X53 A;  3MKE A;  3NOT C;  4OPR A;  1K57 C;  4PM7 A;  4MN5 A;  1DJA A;  2OOL A;  3SS3 A;  3T4K A;  2J80 A;  2GNX A;  5CHM A;  4F3L A;  1F2K A;  2P7J A;  4OOL A;  3VP0 A;  1ES3 A;  2Y4A A;  3W4P A;  2JE5 A;  5TR7 A;  4S2O A;  5IS1 A;  4YNR A;  2B02 A;  1TD5 A;  5F1G A;  2XR0 A;  3M6H A;  5IT5 A;  2PBY A;  3WRT A;  2Y8H A;  3Q7V B;  3UE0 A;  1G6A A;  4S2J A;  3QP5 A;  4EEP A;  1IKI A;  3PBO A;  4KZB A;  2VGJ A;  3ZCZ A;  2EFX A;  5G18 A;  3D3O A;  3H9W A;  2Q0O A;  2K31 A;  3BFE A;  3JVU A;  1VM1 A;  2VZW A;  3ZNT A;  4Z1W A;  2Y2K A;  5A8B A;  1PWG A;  3NCK A;  1YPR A;  2BLS A;  3PXP A;  3BY9 A;  1TDL A;  3BW6 A;  4GLQ A;  1MWT A;  4BL2 A;  5EV0 A;  5U47 A;  3BFG A;  3S4X A;  4BQM A;  3S7O A;  2W3E A;  5HZH A;  4N9L A;  3WRZ A;  1Y4O A;  4OQG A;  1HD8 A;  1YSQ A;  5HW3 A;  2HDS A;  4LV1 A;  2K7S A;  5DF8 A;  3F1P B;  1ERO A;  5I5L A;  1P9W A;  3T1S A;  1AWI A;  2QZ6 A;  2ZMF A;  4E04 A;  4HBT A;  2KX6 A;  4DJ3 A;  4MDZ A;  3G6O A;  3MZE A;  1DRM A;  1ONG A;  2V8C A;  5GL9 A;  3IF6 B;  3UPN A;  2A49 A;  4JF5 A;  2QHK A;  3HCY A;  3KO6 A;  4KUO A;  2PD7 A;  3UB5 P;  3MKF A;  4JKT A;  4ARZ A;  1DJB A;  4S2I A;  3KYE A;  4MNR A;  4LV0 A;  2ZQC A;  2XEP A;  1NWZ A;  4BWI A;  5HL6 A;  5HDC A;  5JYP A;  3RTY A;  3E4P A;  4R3A A;  1FIK A;  1UWP X;  3Q1F A;  2H5S A;  3T4S A;  1K0K A;  3MBZ A;  3LY3 A;  4OQH A;  4Y17 A;  3H82 B;  5CX7 A;  1HTZ A;  2VV6 A;  1K6S A;  2HJE A;  5F69 A;  3S7P A;  3B33 A;  1QME A;  5J4E A;  3GQZ A;  4G3W A;  2NUT C;  2W1T A;  4ZTK A;  3N8S A;  5EOE A;  3UE6 A;  2Q9M A;  5AQA A;  1XX2 A;  5AQB A;  1ERM A;  1RGZ A;  3WS2 A;  1L0G A;  3LEZ A;  4MN7 A;  1S66 L;  3S22 A;  1OT9 A;  3CIT A;  1F98 A;  1KVL A;  2WZZ A;  5FQI A;  5TFQ A;  2WAF A;  5EVI D;  4UHU A;  4R1G A;  4GCZ A;  4QJG A;  4LGW A;  3AGF A;  1EI5 A;  4Y0U A;  1V9Z A;  2XGN A;  5HFO A;  3CAX A;  3FKW A;  5M19 A;  4E3I A;  3CWF A;  3O88 A;  1OTE A;  1XFQ A;  3GEC A;  3WWX A;  1ZKJ A;  5J3W A;  3E98 A;  1PWC A;  2PR5 A;  4EXO A;  3CPT B;  4S2K A;  1TS7 A;  1E3U A;  5TGF A;  1YKD A;  3UB6 A;  4B4X A;  4DXC A;  4NEE D;  2W3D A;  4K0W A;  1SCW A;  1YLY A;  3TE8 A;  4H6J A;  3UO9 A;  4Y3I A;  3MQQ A;  4HI4 A;  3IF5 A;  3L9K A;  2Y2M A;  2DMW A;  3EQV A;  1XJ4 A;  4A5R A;  4HBU A;  4MBF A;  2W27 A;  4QY5 A;  3FC7 A;  3JYI A;  3P98 A;  5CGX A;  2V20 A;  3UMD A;  5HWT A;  4XT2 A;  2ZC6 B;  3ZVT A;  4FD8 A;  5F6A A;  4O01 A;  3R7W A;  3H7W B;  3S7Q A;  5AQ7 A;  2RL3 A;  4P0M A;  3EOI A;  3PBQ A;  1MC0 A;  3BY8 A;  3MXR A;  5L09 A;  3IWO A;  3D72 A;  2JN7 A;  4RQ9 A;  2PHY A;  4L0L A;  5EOO A;  5EFW A;  2ZJ9 A;  4O0P A;  1NRJ A;  2ZC3 B;  4P6Z S;  4LV2 A;  4HOI A;  1JVJ A;  5DTT A;  4BD0 A;  3QP1 A;  1GSW A;  3IWQ A;  3ZG0 A;  5M18 A;  4ZDX A;  3Q81 A;  3OLO A;  5EUA A;  1K4F A;  2HPB A;  2JBF A;  4OLD A;  1N9N A;  1MKI A;  1K4E A;  4LCL A;  4EBP A;  2O0Y A;  4JXG A;  4OP5 A;  1YMX A;  2IA2 A;  4PKY A;  3TSG A;  3VP3 A;  2EX8 A;  2ZC7 A;  5FAP A;  4X25 A;  3NOP C;  3OPP A;  3IWI A;  4P87 A;  4RYE A;  5HDD A;  4HEF A;  4HNB A;  5CEB A;  3SH9 A;  1SDN A;  5EVE A;  5J8X A;  1SHV A;  3NC8 A;  4X55 A;  2Y79 A;  1XXM A;  3ULF A;  1KGE A;  1MWS A;  2HF6 A;  3TRC A;  2JHE A;  2J7V A;  3TG9 A;  2BAS A;  3Q7V A;  3T4Q A;  3VSL A;  1VB6 A;  2GX5 A;  2XFS A;  2XQZ A;  1DP6 A;  2PAV P;  1NY0 A;  1LLB A;  2XRN A;  4S2L A;  3LIF A;  1NYM A;  5L07 A;  1FCN A;  3Q07 A;  4ZRR A;  4WM9 A;  4BL3 A;  4R70 A;  3VMA A;  1ERQ A;  3KSI A;  4DE0 A;  1LI9 A;  4EV4 A;  1LSV A;  1IEM A;  1AXB A;  1L0D A;  1S1Z A;  2HDQ A;  3PBS A;  3PAG A;  4JXS A;  2UWX A;  3NHQ A;  2KOI A;  1CEF A;  3R4K A;  5CGS A;  3GR2 A;  4IUK A;  4LLO B;  1P0Z A;  2CMN A;  5GLC A;  3UPO A;  3CHW P;  4KG2 A;  3E4Q A;  4GDB A;  2PDR A;  2EFU A;  1WYB A;  3F1P A;  1L0E A;  2OAQ 1;  2QJ7 A;  3JVV A;  5CTM A;  1TS0 A;  2J9P A;  1CK3 A;  1L0F A;  3G34 A;  3NJA A;  2W0N A;  1LSX A;  3BQ8 A;  4PMA A;  2XSS A;  3AGD A;  4D2O A;  4EUV A;  3C5A A;  4KG5 A;  4WZ5 C;  3SZT A;  4IED A;  3IF6 A;  2VGL S;  2O99 A;  1GHP A;  4CLC E;  4GD8 A;  3WS1 A;  2H28 A;  3DTI A;  5FQK A;  4GKU A;  4XUX A;  5DJU A;  2K2N A;  1KE4 A;  3NDG A;  5F68 A;  4Z9Q A;  3UDI A;  4NET A;  3VFH A;  1JWZ A;  1U60 A;  3QNB A;  5K5B A;  1PZO A;  2MJ6 A;  3B42 A;  1UWN X;  1M40 A;  3N8L A;  3K3D A;  3ITA A;  2H0Y A;  3F1O B;  5HPF A;  1OT6 A;  1MBL A;  1BLS A;  5AJG A;  3CLO A;  1TDG A;  2XF3 A;  3H82 A;  5EPH A;  3O86 A;  5E2E A;  4HP4 A;  2GJ3 A;  1IYO A;  3FKV A;  3E2K A;  2Y55 A;  4EWF A;  2XA7 M;  2HV1 A;  4JGR A;  5F82 A;  2ZBB A;  3VOL A;  1PNE A;  3SW1 A;  2QKP A;  3HUM A;  2W3G A;  1T1A A;  3OPR A;  3HJK A;  2HDU A;  1SKO B;  1XP4 A;  3FYZ A;  2ZL1 B;  2IWD A;  4U3T A;  2J3T C;  1BUL A;  2XFT A;  4GNU A;  1FQG A;  4GHI B;  4N1X A;  1CF0 A;  4C3Q A;  3RXX A;  3V50 A;  1L3L A;  3C2W A;  4CPK A;  4QPR A;  3HBR A;  1PRQ A;  4CQH A;  4NXE A;  3UDX A;  1T1C A;  4XXR A;  3NBL A;  5EE8 A;  3HJI A;  1G5U A;  1IYS A;  1TS8 A;  2HJ9 C;  1H0M A;  2E8I A;  2WK0 A;  3QP2 A;  3GSG A;  4KZ8 A;  3WS0 A;  3LEQ A;  1T19 A;  2QYB A;  2H10 A;  3CPT A;  4R38 A;  4DN0 A;  4EBN A;  4N1H A;  3BLM A;  4PM6 A;  1O07 A;  1FR6 A;  3K2N A;  1O7E A;  1K55 C;  5DF7 A;  4GDN A;  1N4O A;  3SS5 A;  3OCL A;  3PBN A;  3ZFZ A;  3FPW A;  2PD8 A;  2HDR A;  3WS5 A;  3VP4 A;  3QNC A;  4L9F A;  4NG2 A;  3UNW A;  4E3O A;  4YOF A;  1MPL A;  4BBU A;  2YKH A;  4MBK A;  4Q0I A;  4OOM A;  2WAE A;  3BQA A;  3CG5 A;  1VQQ A;  5EM0 A;  5DF9 A;  2EWV A;  3CUE A;  5AQ9 A;  3HLF A;  4PAU A;  2OWH A;  3MSH A;  2IWB A;  4S2N A;  4UA6 A;  4I38 A;  3RJU A;  1W79 A;  1GHM A;  4OP8 A;  1ZG6 A;  4B9O A;  3H7W A;  1S4R A;  3VP2 A;  4RVA A;  5L10 A;  3KYZ A;  4EQ1 A;  3GMW A;  2V0U A;  3DTK A;  2JKT M;  4LRY C;  5FQJ A;  1J9M A;  4MMN A;  3QP6 A;  4QU3 A;  3MS6 A;  1XPB A;  2R78 A;  1K54 A;  1XJ6 A;  2JKF A;  2OLU A;  2J9O A;  4PM8 A;  2WKI A;  1PI5 A;  2KDK A;  2EX6 A;  3W4Q A;  3I7J A;  4RA7 A;  3IBR A;  3LY4 A;  3IQA A;  3A3J A;  3HL9 A;  3VSK A;  2W3H A;  3G30 A;  3Q82 A;  3V3S A;  4MCW A;  1TS6 A;  3ICY A;  4GD6 A;  3N8R A;  3AGE A;  4OPY A;  4HH2 A;  3CI6 A;  4EEU A;  4EU0 A;  5HWV A;  2V0W A;  4KZ6 A;  3QP8 A;  3HLD A;  1KGF A;  1ODV A;  1L2S A;  4X6T A;  1NRF A;  3KSF A;  4KUK A;  3MJQ A;  1YMS A;  2Y2I A;  5FI6 A;  2VLG A;  3VFF A;  1Z09 A;  4DDS A;  3UE3 A;  1JWV A;  2WGV A;  3T4T A;  2JKR M;  4Q0H A;  4PKY G;  5F5Y A;  1CEG A;  3ZDJ A;  3S7N A;  4JGP A;  4BLM A;  4CLC C;  4WN5 A;  1PIO A;  3IX3 A;  3LID A;  4WZ4 A;  2V9A A;  2XD5 A;  2XK1 A;  4C6Y A;  2I72 A;  4Y15 A;  2VGK A;  2JCH A;  1X0O A;  3P01 A;  5HAQ A;  3DAV A;  3GRJ A;  1WYC A;  1PYY A;  1YLZ A;  5D3O A;  1XFN A;  1NLZ A;  1WA9 A;  2Z2L B;  2V1B A;  1PW8 A;  1RCJ A;  5EVI A;  1LL9 A;  4FTX A;  2XH9 A;  1ZC2 A;  4WMC A;  1PFL A;  4JGQ A;  1ALQ A;  3F1N A;  3V67 A;  2A24 B;  2FZ0 A;  2V1Z A;  4I3A A;  4WBG A;  1JTD A;  4G3V A;  4P85 A;  4HJ3 A;  5A93 A;  3NUL A;  3FV7 A;  3IHA A;  2XDM A;  2Z2M B;  3GTC A;  1XJ2 A;  5DKL A;  3V5M A;  3A3F A;  2EA9 A;  2AVX A;  4OPQ A;  2A3U A;  2EX9 A;  2QWS A;  4WUJ A;  4FH4 A;  2JC7 A;  4QB8 A;  3L7H A;  5M1A A;  3OOV A;  4EET B;  3MQO A;  5HL1 A;  4B93 A;  3EGD C;  1LT0 A;  1I2S A;  2M7V A;  4EQI A;  2H0T A;  3E2L A;  3RH8 B;  1MY8 A;  4Y13 A;  4GOG A;  1ES2 A;  2WYX A;  3DWK A;  3RXW A;  5CED A;  3LR3 A;  4M3K A;  2O9C A;  3ISG A;  1E3U D;  2J3T D;  4IVI A;  1BLC A;  5FA7 A;  4IJG A;  1K57 A;  5E2G A;  5F83 A;  3O5Y A;  3ZG5 A;  4OQI A;  3D4F A;  3N6I A;  3F1O A;  4FOF A;  1BLP A;  2Z6D A;  4B4Z A;  1OPX A;  1S1Y A;  2QJ5 A;  4YWZ A;  2L1M A;  2WKQ A;  3UB8 A;  1SDE A;  3T4L A;  3N4I A;  1CI8 A;  4Y7P A;  4UA7 A;  3IXG A;  1ZG4 A;  2BTF P;  4QHC A;  3HLW A;  4C75 A;  3A0S A;  2WKR A;  1YLW A;  3UB7 A;  1NYY A;  1TVF A;  3KYQ A;  4WF0 A;  2EX2 A;  3TOI A;  2ZD8 A;  5DKK A;  4G3K A;  1IKG A;  1KDS A;  3OZH A;  5LBR A;  5TJJ A;  3BLS A;  1K38 A;  4F94 A;  1MWU A;  1SKO A;  2ZL1 A;  4FCF A;  3TW8 A;  3ZVW A;  4WEJ A;  2M1C A;  4P6Z M;  4GHI A;  5CHJ A;  2W1R A;  2WUQ A;  4OQ0 A;  5L8M A;  5E2F A;  5E43 A;  2M7U A;  2PU4 A;  3HLE A;  2DRW A;  4M4X A;  4UA9 A;  3KSG A;  3A3E A;  3Q7Z A;  2Y2O A;  2Y2J A;  2C5W B;  2ZQ7 A;  2V8F A;  4HY8 A;  1F9I A;  4QWO A;  3LIB A;  3ITB A;  2PT7 A;  1MZU A;  4GS9 B;  2P9V A;  5C5K A;  1HLU P;  4S2N C;  4KZ9 A;  2OSU A;  4ME4 A;  1FR1 A;  1H3Q A;  3DW0 A;  4HJ6 A;  1M6K A;  5KSC A;  1K56 A;  4U0X A;  1XGI A;  4DXB A;  4WEL A;  2VA0 A;  4JF6 A;  4MN6 A;  3HLC A;  2O9B A;  3LR5 A;  4KZ7 A;  4X1L A;  1ESU A;  3M2J A;  4K0X A;  3LI8 A;  4R3B A;  3DTM A;  5DFY A;  3LR4 A;  5JYO A;  3FG8 A;  3B3X A;  3UB9 A;  4E3N A;  1K54 C;  5G4Y A;  5I94 A;  3VOZ A;  3NEC A;  2Y2L A;  3M2K A;  5EVI B;  1GA9 A;  3SS4 A;  4LEN A;  4IVK A;  5FL3 A;  2VEA A;  2Y2Q A;  2ZQ9 A;  3F1N B;  4QD4 A;  3MQ0 A;  3OPH A;  3QP4 A;  3MFX A;  4H8R A;  3A0V A;  3IBJ A;  1ES4 A;  3G32 A;  4K91 A;  2B18 A;  3T12 B;  4D60 A;  4AFI A;  3LI9 A;  1F5M A;  2DNS A;  3LIE A;  4LRX C;  4DRT A;  1S6R A;  4II7 A;  4IBR A;  4L9G A;  3DBA A;  3IS2 B;  4EES A;  3PBR A;  4N92 A;  4GJ4 A;  3ZQ5 A;  3IH9 A;  4FUW A;  3OC2 A;  4O7D A;  1T18 A;  1K6R A;  2Y2G A;  1W63 Q;  4CLC D;  1DP8 A;  3DTE A;  4BBV A;  1S4S A;  1ZTU A;  5FEF A;  1RP5 A;  2P74 A;  3KSH A;  1OJG A;  4PHT A;  4WLA A;  1ONH A;  2I9V A;  1YLP A;  5CER A;  4OOY A;  1W5D A;  1JWP A;  2OAP 1;  1N9B A;  3MR0 A;  4L9E A;  1FOF A;  3HVF A;  1BLH A;  1YSP A;  5KIZ A;  3MXQ A;  2PR6 A;  3TJZ C;  1NZU A;  2WGW B;  5DJT A;  3U4L P;  5IU1 A;  4KZ4 A;  1CI9 A;  4ZJ2 A;  5KSH A;  4OVD A;  3ZGA B;  3EWK A;  3PR6 A;  4Y5F A;  2PYR A;  2VGL M;  1PZP A;  3IX4 A;  1LL5 A;  1G28 A;  4KQO A;  2C6W B;  4ZJ1 A;  5AVE A;  2G2U A;  5CTN A;  4I39 A;  1P9R A;  4DF6 A;  4KZA A;  1OJ5 A;  1GCE A;  3T1X A;  3PYP A;  1YQS A;  4I3J A;  2J3W A;  4Q8I A;  5FI7 A;  3QHY A;  2B95 A;  5CGW A;  3EQU A;  4R6L A;  4X68 A;  4NXF A;  2G2W A;  4R4S A;  1PWD A;  4NXG A;  4UQI S;  2XD1 A;  4OKP A;  1XA7 A;  1NJ4 A;  3KX0 X;  1FCM A;  2L0W A;  1NZO A;  5GHY A;  2EXA A;  4Y0T A;  1Q2P A;  4IHQ A;  1PI4 A;  4HES A;  2A24 A;  2ZM0 A;  2DCF A;  3BWL A;  1W8Y A;  2ZC4 B;  1UGU A;  1FCO A;  4UAA A;  3O3V A;  4YIN A;  2X02 A;  3JPU A;  1HVB A;  2P9V B;  3WS4 A;  2WGI A;  4R4R A;  2XLN A;  2ZMV A;  3B47 A;  1J3W A;  2Z6C A;  3HRE A;  1XJ3 A;  1VET B;  2Q9N A;  4PPR A;  3NY4 A;  3BRM A;  4E3L A;  1OTB A;  1GSX A;  2CC1 A;  1ES5 A;  3ZHH A;  2WAD A;  2QMI A;  3VP1 A;  1GHI A;  2JKT I;  1H5X A;  1XKZ A;  5CHU A;  1W63 M;  3RFB A;  5KMW A;  1V9Y A;  3IH8 A;  2PRF A;  1BT5 A;  2OWJ A;  3CMZ A;  2VV7 A;  5DVA A;  5FQ9 A;  3P09 A;  5J7E A;  4EUZ A;  5CRF A;  2BG1 A;  5HD3 A;  1FSW A;  1IYQ A;  1YLJ A;  2VV8 A;  5HD5 A;  4IBX A;  4DE1 A;  2PU2 A;  3LYX A;  5HX9 A;  3VV4 A;  3K3C A;  4CLC B;  1OTA A;  2UV0 E;  4HH3 A;  4RX2 A;  4OLG A;  2D02 A;  3M6B A;  1JNU A;  1JTG A;  4Q0J A;  1WE4 A;  4EW7 A;  1A0K A;  3C38 A;  1DJC A;  4PM5 A;  2WKE A;  5HAR A;  2GDN A;  5GHZ A;  4UEY A;  1BSG A;  1N9L A;  3LCE A;  2ZQA A;  1LSW A;  2JKR I;  2HP6 A;  2X71 A;  1BYW A;  1IFQ A;  1C3B A;  1S67 L;  3MZD A;  2ZC5 B;  1ZHH B;  3MFD A;  2WKH A;  5BOH A;  2ZOH A;  4PM9 A;  3MMH A;  2QPN A;  2JKG A;  4GS9 A;  3C4O A;  3N7W A;  4Y0O A;  3MF0 A;  4JGO A;  4JPM A;  5HDS A;  3OCN A;  5HSQ A;  4P6B A;  4MEZ A;  1RGY A;  4ZJ3 A;  2V2F F;  2FFY A;  1IYP A;  5GLB A;  3SH8 A;  4WL9 A;  1YM1 A;  2PYP A;  3T1Q B;  2HP9 A;  1H8Z A;  5FQM A;  3O87 A;  4GN2 A;  3T4O A;  4DE3 A;  3D9Y A;  3LO7 A;  1Z6F A;  3G2Z A;  1QMF A;  2G7U A;  4ZAM A;  3UDF A;  4DE2 A;  5TBM B;  4WZ5 A;  4QY6 A;  1VHM A;  4I3I A;  3T4J A;  4RX3 A;  2GZA A;  1I2W A;  3A0R A;  1NXY A;  3NDE A;  5IHV A;  5A92 A;  4BBT A;  2VJW A;  2IWC A;  5DTS A;  4R3J A;  4HQA A;  2L4R A;  2HZ5 A;  2WKP A;  1VEU B;  3EEA A;  3IF6 C;  2P08 A;  4GB7 A;  5F1F A;  2ZM8 A;  4E3J A;  4HP9 A;  1LL8 A;  3GVB A;  4ZBE A;  4EBL A;  3IS2 A;  3FZC A;  3EGX C;  3PHY A;  4WMC D;  4CJN A;  5AVF A;  1I5Q A;  3MZF A;  5FEG A;  3GDI A;  3IHB A;  4F3L B;  2YKF A;  1XGJ A;  4HIA A; 
#chains in the Genus database with same CATH homology
 3FG8 A;  5HWW A;  1YSQ A;  3UB9 A;  2XA7 M;  2HV1 A;  4JGR A;  2FH5 A;  2ZBB A;  2K7S A;  5G4Y A;  4KQD A;  3VOL A;  1NLY A;  3F1P B;  3SW1 A;  4LRZ E;  5I5L A;  2QKP A;  2HGV A;  2W3G A;  1P9W A;  1T1A A;  3HJK A;  3LIC A;  2ZMF A;  4GW9 A;  2J3T C;  3OBF A;  1OTI A;  4E04 A;  2KX6 A;  2LB5 A;  5FL3 A;  4DJ3 A;  2VEA A;  4MDZ A;  3G6O A;  4GHI B;  1DRM A;  3F1N B;  3MQ0 A;  1G6O A;  3MFX A;  3UME A;  3A0V A;  3IBJ A;  2A2L A;  2B18 A;  3C2W A;  4QPR A;  2QHK A;  3HCY A;  3KO6 A;  4KUO A;  4AFI A;  3LI9 A;  2PD7 A;  4CQH A;  4NXE A;  1DP9 A;  1F5M A;  1T1C A;  2P04 A;  4ARZ A;  3LIE A;  3T50 A;  3HJI A;  4LRX C;  1NWZ A;  1TS8 A;  2HJ9 C;  4BWI A;  5HL6 A;  4K08 A;  5HDC A;  3LFV A;  4II7 A;  4L9G A;  3DBA A;  3IS2 B;  3RTY A;  4EES A;  3E4P A;  3PBR A;  4GJ4 A;  4R3A A;  3U2A A;  3ZQ5 A;  1T19 A;  2QYB A;  1UWP X;  4R38 A;  3T4S A;  4BJP A;  4DN0 A;  3OC2 A;  1T18 A;  3P7N A;  4ETX A;  3K2N A;  1W63 Q;  4CLC D;  1DP8 A;  2D01 A;  3H82 B;  4BBV A;  5CX7 A;  1S4S A;  2VV6 A;  1ZTU A;  2HJE A;  3KSH A;  5F69 A;  3S7P A;  3B33 A;  1OJG A;  5J4E A;  4PHT A;  4WLA A;  2I9V A;  3OCL A;  4G3W A;  3PBN A;  2NUT C;  2W1T A;  3FPW A;  1N9O A;  4NXB A;  2PD8 A;  4O8G A;  3UE6 A;  4L9F A;  2OAP 1;  4YOF A;  3NOU C;  4BBU A;  2YKH A;  4Q0I A;  3MR0 A;  4L9E A;  4DMZ A;  4OOM A;  3BQA A;  3W2Z A;  5DF9 A;  2EWV A;  3CUE A;  4MN7 A;  1S66 L;  1YSP A;  1OT9 A;  4IUH A;  3VE3 A;  3MXQ A;  2PR6 A;  5KIZ A;  4PAU A;  3TJZ C;  2OWH A;  5MC7 A;  3E0Y A;  4I38 A;  3CIT A;  1F98 A;  5DJT A;  5IU1 A;  5KSH A;  4B9O A;  3H7W A;  3EWK A;  3PR6 A;  5DFX A;  3CUE C;  1S4R A;  4Y5F A;  2PYR A;  4GCZ A;  3EEH A;  2VGL M;  3KYZ A;  1V9Z A;  4EQ1 A;  2V0U A;  2EWW A;  2JKT M;  4FSF A;  4LRY C;  4NKP A;  4MMN A;  3CAX A;  1G28 A;  2ZOI A;  4KQO A;  4ARZ B;  3CWF A;  3ZYT A;  1OTE A;  2R78 A;  2XRO A;  1IOU A;  5AVE A;  1XFQ A;  1XJ6 A;  3GEC A;  1H8M A;  4I39 A;  1P9R A;  1OJ5 A;  5J3W A;  1Y28 A;  3E98 A;  2PR5 A;  4EXO A;  3PYP A;  2KDK A;  4I3J A;  2J3W A;  1TS7 A;  2LB9 A;  1YKD A;  3UB6 A;  4NEE D;  4DJ2 A;  2W3D A;  4HJ4 A;  1MKM A;  3EQU A;  4R6L A;  3IBR A;  4NXF A;  3TE8 A;  4H6J A;  4NXG A;  3MQQ A;  4HHD A;  4UQI S;  4Y3I A;  2W3H A;  4HI4 A;  4MCW A;  1TS6 A;  2W1T B;  3ICY A;  3KX0 X;  2DMW A;  3EQV A;  2VX8 A;  2L0W A;  1XJ4 A;  4HH2 A;  3CI6 A;  4EEU A;  4EU0 A;  5HWV A;  4IHQ A;  2W27 A;  2V0W A;  2A24 A;  1D7E A;  3FC7 A;  3BWL A;  1ODV A;  4ETZ A;  3UMD A;  1TF1 A;  3PBT A;  5HWT A;  3KSF A;  3FPV A;  4KUK A;  4XT2 A;  1UGU A;  3MJQ A;  4EER A;  5F6A A;  2VLG A;  4O01 A;  1YAX A;  3LIA A;  3R7W A;  3UE3 A;  3H7W B;  3S7Q A;  3EOI A;  1STZ A;  3BJN A;  3E4O A;  4CLC A;  3PBQ A;  3T4T A;  1MC0 A;  3BY8 A;  2JKR M;  4Q0H A;  4PKY G;  3D72 A;  5F5Y A;  2ZMV A;  2JN7 A;  3B47 A;  2PHY A;  1EW0 A;  4RQ9 A;  3S7N A;  2Z6C A;  3C30 A;  4L0L A;  1XJ3 A;  4JGP A;  5EFW A;  4CLC C;  4WN5 A;  4O0P A;  3LID A;  1NRJ A;  2V9A A;  1OTB A;  1GSX A;  4P6Z S;  4WEK A;  3VE4 A;  4HOI A;  1KOU A;  1GSW A;  1X0O A;  3P01 A;  3OLO A;  4LPZ A;  2W3F A;  1XFN A;  1NLZ A;  1WA9 A;  2JKT I;  2V1B A;  4Y2F A;  3LR0 A;  4H6J B;  1N9N A;  1W63 M;  3RFB A;  1V9Y A;  2O0Y A;  3LUQ A;  4JGQ A;  1T1B A;  2O9A A;  3F1N A;  2VKS A;  2OWJ A;  3V67 A;  2A24 B;  2FZ0 A;  2IA2 A;  4PKY A;  1D06 A;  4I3A A;  2VV7 A;  5J7E A;  3NOP C;  5HDD A;  4G3V A;  4HNB A;  4XT2 B;  5HD3 A;  4HJ3 A;  1GSV A;  2VV8 A;  5HPI A;  5HD5 A;  3R7W B;  3LYX A;  3VV4 A;  3K3C A;  3C8C A;  2KLI A;  2XA7 S;  2Y79 A;  1XJ2 A;  1OTA A;  5DKL A;  4CLC B;  4HH3 A;  2EA9 A;  3ULF A;  2HF6 A;  3TRC A;  5G4Z A;  2D02 A;  2QWS A;  4WUJ A;  5TBM A;  1JNU A;  2JHE A;  4EET B;  3OOV A;  4Q0J A;  3MQO A;  4EW7 A;  4I5S A;  4BMW A;  3C38 A;  2INW A;  4B93 A;  3EGD C;  1LT0 A;  2M7V A;  2BAS A;  3T4Q A;  1VB6 A;  2GX5 A;  4UEY A;  2NUP C;  3RH8 B;  1N9L A;  1DP6 A;  1LSW A;  2JKR I;  1BYW A;  1IFQ A;  1S67 L;  2XRN A;  1ZHH B;  3LR3 A;  2O9C A;  2J3T D;  3LIF A;  2ZOH A;  3MMH A;  4UQI M;  4IJG A;  2V1A A;  1P97 A;  1OTD A;  4ZRR A;  4GS9 A;  4R70 A;  3O5Y A;  3MF0 A;  4JGO A;  5HDS A;  5HSQ A;  3OCN A;  3KSI A;  3NOT C;  3F1O A;  4FOF A;  2Z6D A;  1LSV A;  4MN5 A;  1OPX A;  1S1Y A;  1S1Z A;  2QJ5 A;  2OOL A;  4YWZ A;  3PBS A;  2L1M A;  2WKQ A;  3UB8 A;  3NHQ A;  2KOI A;  3T4L A;  3T4K A;  2J80 A;  2GNX A;  3R4K A;  4IUK A;  4LLO B;  4WL9 A;  1P0Z A;  2CMN A;  4F3L A;  2PYP A;  3A0S A;  2P7J A;  4OOL A;  2WKR A;  3T4O A;  3E4Q A;  3UB7 A;  2PDR A;  3KYQ A;  4WF0 A;  3F1P A;  5IS1 A;  4YNR A;  5DKK A;  2OAQ 1;  2G7U A;  2QJ7 A;  2B02 A;  5TBM B;  4G3K A;  3JVV A;  1VHM A;  5LBR A;  4I3I A;  1TS0 A;  5TJJ A;  3T4J A;  1TD5 A;  3NJA A;  2GZA A;  2W0N A;  1LSX A;  3BQ8 A;  2XSS A;  3A0R A;  3TW8 A;  4EUV A;  4HIA A;  2M1C A;  4P6Z M;  4WEJ A;  5IT5 A;  4GHI A;  2Y8H A;  4BBT A;  2W1R A;  5L8M A;  2VJW A;  2VGL S;  2M7U A;  2O99 A;  4EEP A;  4CLC E;  4HQA A;  4M4X A;  2L4R A;  2H28 A;  3KSG A;  3PBO A;  5DJU A;  2K2N A;  2WKP A;  3D3O A;  3EEA A;  3H9W A;  5F68 A;  2P08 A;  2K31 A;  3JVU A;  4HY8 A;  1F9I A;  2VZW A;  3LIB A;  4HP9 A;  5K5B A;  1LL8 A;  1MZU A;  2PT7 A;  4GS9 B;  4Z1W A;  2MJ6 A;  3B42 A;  5C5K A;  1UWN X;  3IS2 A;  3K3D A;  3EGX C;  3PHY A;  5A8B A;  3F1O B;  4ME4 A;  5HPF A;  1OT6 A;  1H3Q A;  3PXP A;  4HJ6 A;  3BY9 A;  5AVF A;  3BW6 A;  4GLQ A;  4WEL A;  5AJG A;  2VA0 A;  3CLO A;  4MN6 A;  3H82 A;  2O9B A;  3LR5 A;  3GDI A;  3LI8 A;  3S7O A;  2W3E A;  2GJ3 A;  4HP4 A;  4F3L B;  5HZH A;  2YKF A;  5DFY A;  3LR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...