2KOIA

Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Transferase
total genus 34
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2koiA00
4EUVA 3LFVA 4YNRA 3VV4A 3MQ0A 2VZWA 4ME4A 2W1TA 1TF1A 4FOFA 3BJNA 3KSFA 2QYBA 3D3OA 4GW9A 1ZTUA 1TD5A 3G6OA 3NHQA 2W1TB 2W3FA 2M7VA 3NOUC 2W3EA 3DBAA 1YSPA 4G3VA 2W3DA 5DFYA 4Q0IA 4IJGA 2XRNA 1VHMA 2O9CA 4R70A 3S7NA 3NOTC 4Y2FA 1MC0A 2LB5A 5C5KA 3E98A 2IA2A 4DN0A 3S7OA 4Y5FA 2W1RA 2W3HA 3OBFA 4MMNA 3EEAA 4GLQA 3W2ZA 3CI6A 5HSQA 5TJJA 3S7PA 3KSGA 3KSHA 3R4KA 2VKSA 2M7UA 5AJGA 5HL6A 2GX5A 3C2WA 4G3WA 4IUHA 5L8MA 2K2NA 4Q0JA 4G3KA 3NOPC 5I5LA 1YSQA 2HGVA 4MCWA 4Z1WA 3KSIA 4RQ9A 2KOIA 4E04A 2XROA 3K2NA 2G7UA 5LBRA 2VEAA 5HPFA 2O0YA 4IUKA 4CQHA 4ETZA 2K31A 1YKDA 4QPRA 5DFXA 3OOVA 3O5YA 4BWIA 4EU0A 4LRZE 2VJWA 4ZRRA 1MKMA 2B18A 1STZA 2Y79A 3KO6A 4LRXC 3IBRA 3MF0A 4LRYC 3IBJA 4R6LA 2Y8HA 4O8GA 4O01A 3MMHA 1F5MA 2XSSA 3ZQ5A 4Y3IA 2LB9A 2O9AA 4YOFA 2ZMFA 4DMZA 4MDZA 2KLIA 5K5BA 4Q0HA 4O0PA 2OOLA 3S7QA 2O99A 3CITA 2W3GA 4PAUA 3HCYA 4ETXA 4MN7A 5HPIA 3RFBA 2O9BA 3TRCA 3E0YA
chains in the Genus database with same CATH superfamily
3LEQA 1K54A 5F5YA 4XUXA 4E3NA 3VV4A 3CLOA 3QP6A 3UDXA 1XJ6A 2V0UA 3KSFA 3P98A 2NUPC 1FOFA 4KG2A 3HLEA 2J3TD 4G3VA 1DY6A 3LIBA 1K25A 1NYYA 5HAQA 5A90A 4Y2FA 5AQ7A 2FH5A 5FAPA 5I94A 4PM6A 3ICYA 4Y5FA 2X71A 4OP5A 1FCNA 1U60A 2V0WA 4GDNA 5CGXA 2ZOIA 3SZTA 2ZQ9A 3R4KA 2GX5A 1IELA 1KE4A 1VEUA 1PWGA 1K57A 4DXBA 2ZQDA 3OLOA 5M18A 3VP4A 2KOIA 4I3AA 1VEUB 2VA0A 3K2NA 5FAQA 2UWXA 4BMWA 4JGRA 1N9LA 4DXCA 2OSUA 4CJNA 3AGDA 2H28A 4B93A 3EOIA 4LRXC 1LI0A 2Y8HA 5F69A 3V3RA 1FIKA 3MFDA 2K7SA 4N1HA 3TSGA 3UN7A 3A3JA 3VOZA 3BFFA 4PAUA 3IF6A 4H8RA 3AGEA 1IKIA 4BQMA 4ME4A 3IF6B 1Z6FA 5CHUA 3H7WA 5A8BA 4GD6A 3V39A 2XA7S 3A3DA 5HAPA 1N9OA 2RCXA 3UB9A 3H7WB 4WF0A 4S2PA 3NOUC 4FTXA 3HUOA 5EUAA 5DKLA 3MXRA 2EFUA 2FZ0A 3SOIA 4E3MA 1LSXA 5EM0A 3S7NA 4CPKA 1K38A 1NZOA 3IXBA 4X55A 5F1FA 4GLQA 4F3LA 1O07A 3HLBA 3KSHA 1NYMA 4EBLA 4F3LB 4X56A 2QHKA 3D9YA 4UQIS 1F2KA 1TS7A 1T19A 4Z1WA 4NKPA 3ITAA 5FDHA 4QY6A 3ZNYA 1NRJA 4PPRA 3NIAA 5GHZA 4CLCA 3O87A 3EGXC 1C3BA 3T4KA 1BLCA 3IBRA 2KDKA 4HESA 1QMFA 4JF6A 1NLZA 1Q2PA 5HFOA 4NXGA 3B33A 4R3AA 3HUMA 4CLCB 4Y3IA 1ES4A 3JVUA 1H8MA 2EX2A 1HTZA 3M2JA 3ZDJA 4GJ4A 4HP9A 3EWKA 4OQ0A 1YT4A 1AXBA 2L1MA 2V1ZA 2M1CA 3MQ0A 2VZWA 5CTNA 1PYYA 1TVFA 1UGUA 4R4RA 4EBPA 1KDSA 4WELA 3BYDA 3D3OA 2Q9MA 3HLCA 2IWBA 3HUNA 5CECA 2W3FA 2ZMVA 4QHCA 2WKHA 1BTLA 4IVKA 4GOGA 3F1OA 4PM8A 2Y2KA 2G2UA 4E6WA 1S1YA 2R9WA 1ESIA 4E3JA 1PI5A 2JCHA 4MMNA 4N9LA 1GSVA 5TJJA 2J7VA 3S7PA 4PMAA 2ZM0A 2VV6A 4UA6A 1FCMA 3W4OA 4WYYA 5HL1A 4M3KA 1G68A 2WGIA 3AGFA 3ISGA 4MBHA 1YQSA 2HJ9C 1EW0A 2PU4A 1OT9A 4G3KA 1YSQA 1YM1A 3LIDA 4B4XA 1YAXA 2ZC5B 2XF3A 3LICA 1W63M 3MQQA 4IHQA 1O7EA 4CQHA 5GHXA 4IVIA 2K31A 2A3UA 3EQVA 4AFIA 1S66L 2EXAA 2GZAA 2JKFA 3ITBA 5EOOA 3CUEA 2EX6A 4FD8A 4P87A 3VP0A 2EWVA 4K0WA 2W0NA 2WZXA 1KVMA 3IX3A 4E3LA 1K6SA 4OOYA 3HLFA 4QY5A 5KZHA 1OJ5A 2ZQ8A 3MFXA 4PKYA 4MN7A 5HPIA 2V1BA 3N7WA 1PFLA 4E6XA 5HWVA 3VP3A 3LFVA 3LI8A 2HV1A 1G6OA 1ZG6A 4BENA 3VFFA 1JTGA 1XGIA 1XJ3A 2ZQ7A 4KZBA 1IYQA 4EEPA 4ID4A 4I3JA 4L9GA 1W8QA 4X68A 3KYQA 2ZC7A 1MWTA 1SKOB 2W3EA 3CZDA 5FQMA 4GHIB 5AVFA 3HVFA 1XFNA 4EXOA 3HLWA 1S4RA 3B3XA 1GHIA 1K4EA 2D01A 4DN0A 3UO9A 1OTIA 2Y2LA 1PIOA 4JXVA 5EVIA 5DF9A 2PBYA 1A0KA 5KSHA 4OOMA 2EX9A 3BFGA 4WMCD 1CEFA 3BQ8A 5HW3A 1GCEA 4KZAA 3KSIA 3EGDC 2EWWA 4P6ZM 3IXDA 4MLLA 5HWWA 1LSVA 4NEED 5TGFA 2PBDP 3UE3A 2XFTA 3SW1A 4EWFA 3NDGA 5EVEA 2JC7A 3QP4A 3MKEA 4EERA 3PBQA 2XK1A 1BZAA 4WM9A 4QB8A 1L0FA 1RGYA 1VQQA 2QZ6A 2EFXA 3MR0A 3CITA 2W3GA 2VV8A 2ZQCA 1BLSA 3DWZA 3FZCA 4XXRA 5F82A 2ZQAA 2VGLM 4EUVA 4DF6A 1G6AA 1M6KA 1PW8A 5CGSA 4FUWA 5J8XA 3GTCA 1W5DA 3LR5A 4BLMA 1L0DA 2FFYA 2L4RA 3VMAA 4JXGA 3PYPA 2WKIA 2QJ7A 3MZFA 5EOEA 2EXBA 1YSPA 1ONGA 2WGWA 1L0GA 3VOLA 4R70A 4L0LA 3LY3A 1MC0A 3ZYTA 4WMCA 2WGWB 5F83A 2PAVP 1T18A 4DRTA 1KVLA 3WRZA 1WE4A 4OKPA 4HQAA 4OLGA 1G5UA 2IWCA 4Q0JA 5I5LA 1MWUA 5CRFA 4OP8A 3ZG0A 4MBFA 5J3WA 4Q8IA 2Z6CA 4OONA 4N1XA 1NLYA 5IT5A 4I3IA 3KYEA 1KOUA 1SHVA 5DFXA 4P6BA 1F98A 1V9ZA 3LYXA 3HJIA 2DNSA 4NXBA 5HDSA 3OZHA 3OCNA 2WAFA 2P04A 3M2KA 3MS6A 4WBGA 4DDYA 4BL3A 1NRFA 1NZUA 4S2MA 5DVAA 3S7QA 1HLUP 4F94A 2A49A 3S4XA 2DMWA 2WAEA 1ERQA 1JNUA 2I9VA 3VE3A 3GMWA 3RFBA 4GZBA 4JLFA 2PD8A 1DJBA 1ACFA 4H6JA 3V67A 4MN6A 4GNUA 3UPPA 1P9WA 1DRMA 5L2FA 5KIZA 1F9IA 4H6JB 3O3VA 1LL9A 3A0SA 4HIAA 5FI7A 5DFYA 4XT2A 1D06A 5EPHA 4Z9QA 5A91A 3CPTA 3W4QA 2Z6DA 2OAQ1 3MBZA 1P9RA 2FFFB 4HEFA 4XT2B 1L3LA 4I5SA 4BBVA 4P0MA 3PXPA 5HSQA 1S4SA 2Y59A 4EESA 3A0RA 5U47A 3JYIA 3CPTB 1OTDA 4IBXA 4BL2A 4FH4A 2VKSA 4M4XA 4S2LA 3G35A 5HL6A 3ZGAB 2P9VB 5TR7A 2QJ5A 2Y55A 4WEJA 3TE8A 4I38A 1XJ4A 4BD0A 3G30A 5GHYA 4KUKA 2RL3A 3E4PA 2J9OA 3IWQA 4LLOB 4DE2A 2ZM2A 2WYXA 4HJ4A 1NWZA 2WKRA 5G4ZA 4S2IA 3T4OA 1DJCA 2XSSA 4DMZA 2ZMFA 1K55C 2WZZA 2HJEA 1PNEA 4KQDA 2B02A 2Y2PA 3UE0A 3HCYA 2W27A 3C4PA 1K0KA 4I39A 2Y2MA 3P01A 5GLCA 1I2SA 2XQZA 1NY0A 5BOHA 5FEFA 5KSCA 2PYPA 5E2GA 3C5AA 2VGLS 3G6OA 3DTIA 4ZDXA 3GECA 3R7WB 3NBLA 3G31A 1OPXA 1GA9A 3VP1A 3DBAA 3IXHA 2V1AA 2OAP1 1ZG4A 1E3UD 3NCKA 2XRNA 1K54C 4EETB 1OJGA 5FAOA 2Y2QA 2PR6A 5HZHA 4HP4A 5C5KA 5G18A 3OPPA 1N9NA 1ES5A 1H3QA 5IHVA 2QKPA 4HOIA 4MN5A 4RYEA 1JWPA 5DTTA 1MKIA 3T50A 3UPOA 1DP8A 2GDNA 2M7UA 5AJGA 1Z09A 4EQIA 1KE0A 4Y15A 1PWDA 2CC1A 1E25A 1ODVA 3LUQA 1T1BA 1VM1A 3UDFA 4K08A 3CMZA 2HP5A 4WZ4A 3TOIA 3FC7A 2VEAA 3P09A 1YMSA 2Y4AA 1QMEA 3NJAA 3LY4A 1YLZA 3VSLA 3N8RA 4BWIA 2YKHA 2VJWA 3MZEA 4OLDA 3EEHA 3LEZA 1WYBA 1K57C 4NXFA 4O01A 1GSXA 3F1NB 1T1AA 1LT0A 4K0XA 1NJ4A 2JKRI 3PR6A 4KG6A 4ESPA 1EI5A 1EROA 4R3JA 5FI6A 4YINA 4ETXA 3RH8B 5CXWA 3OPLA 1FR6A 2BG1A 5FQKA 5A92A 1S6RA 2NUTC 4EBNA 1Q2QA 4U3TA 1E3UA 3FPWA 3WWXA 1TS6A 3NY4A 1ZTUA 4JKTA 4GN2A 3QNBA 4NK3A 5FSRA 3HLDA 4FH2A 4BBUA 3OCLA 3DWKA 3GRJA 4Q0IA 4LCMA 2OLVA 4GKUA 4HH3A 3IT9A 2O9CA 4B4ZA 2CMNA 4LV0A 3T1XA 5HD3A 5HAIA 3U4LP 4KQOA 3H9WA 3QNCA 1YLWA 3UE1A 3A3FA 3KSGA 4E3IA 2WKPA 4KZ7A 4PM9A 3QHYA 4HNBA 2X01A 4EEUA 3TW8A 3HL9A 2VLGA 2HGVA 3GV9A 3S1YA 1ALQA 4LGWA 3DW0A 4X6TA 1JVJA 3MQOA 4JPMA 1YKDA 1ES3A 3LR4A 4FSFA 1OT6A 2HDRA 3CG5A 3G2YA 4X69A 1NXYA 3MZDA 3IBJA 4GD8A 5F68A 1Y4OA 3BFDA 3E4OA 3WS1A 2WK0A 4YOFA 2BASA 4JF4A 4LV2A 3Q7ZA 4NXEA 4LV1A 4S2JA 4JBFA 5CERA 2ZC4B 4CLCC 3N8SA 4WL9A 4RVAA 3Q07A 3LIEA 2KX6A 1Y28A 3BJNA 4Y7PA 5JYOA 4RX3A 5AVEA 2H5SA 1XX2A 3BLMA 3GSGA 3NHQA 1JTDA 4GDBA 4QJGA 3BLSA 3ZG8B 1K56D 3E2KA 5KMWA 1WYCA 4OPYA 2EX8A 3DAVA 4DE0A 5FI2A 1RGZA 3TJZC 1PZOA 1SKOA 3IWIA 5EECA 1PW1A 4GHIA 4O7DA 1DJAA 3E2LA 4KENB 3K3CA 4WN5A 5DTKA 3GVBA 4LPZA 2JBFA 4HBUA 4KQRA 4EV4A 4DDSA 5CX7A 3RXWA 5DJTA 1V9YA 3UMDA 3A3IA 3IH8A 2WKQA 2ZL1A 4KZ6A 1KDWA 3B42A 3H82A 2HDQA 3PBSA 2HP9A 3T4LA 5HDDA 2ZL1B 3H82B 3LIFA 1F5MA 5L10A 1ZC2A 2HDSA 2O99A 3WS5A 3IS2A 1WA9A 3T4QA 5DTSA 3ZCZA 2ZBBA 3CUEC 4P85A 3IS2B 1L0EA 2XD1A 1OTEA 4GB7A 3A3EA 2P74A 3E4QA 3UPNA 5M19A 2QYBA 4S2NA 2L0WA 1TD5A 3Q7VA 2HF6A 2JHEA 1PZPA 4DJ3A 1BUEA 2I72A 5FASA 4LFUA 1KGEA 3Q7VB 3ULFA 2PYRA 3T4TA 3NC8A 1KGGA 4R0QA 3BEBA 2ACGA 3FG8A 3E98A 1FSYA 4S2OA 4EUZA 2EA9A 3PBOA 1H8ZA 4B88A 4KZ8A 3MJQA 4X25A 3C38A 3G34A 5CGWA 2XDMA 3CAXA 5M1AA 3LR3A 4E04A 4WZ5C 2XROA 4QWOA 2HPBA 3SH7A 3ZVTA 5J4EA 3A0VA 3M6BA 5HPFA 2O0YA 1W7FA 2JKRM 3V5MA 1J9MA 1CF0A 4JXWA 4EU0A 4QD4A 5EVIC 4HHDA 3EQUA 3ZFZA 4C3QA 4CLCE 2QMIA 4R3BA 5GLBA 2E8IA 2Z2MB 3V50A 3C4OA 2LB9A 2Y91A 3LO7A 4ZJ3A 4Y17A 3L7HA 3NULA 1YLTA 2R9XA 5CEDA 1S67L 3LCEA 4U0TA 5E2EA 2C5WB 3RTYA 2W1TA 3I7JA 1TF1A 1XP4A 5AQ9A 1BULA 3BFEA 3VOYA 5A93A 4OH0A 3FWLA 1BLHA 2W1TB 5GLAA 3C7UA 4K91A 4OQIA 4Y0OA 3PTEA 2A24A 1ONHA 2VK3A 1W8YA 2Y2IA 4UHUA 5EV0A 3SH8A 1VHMA 4JXSA 3OPRA 2HZ5A 2A24B 2XR0A 4D2OA 5FQQA 1MPLA 3VE4A 2VGKA 3ZG7B 3T1QB 3V3SA 1LHYA 4DE1A 1XJ2A 3W2ZA 3CI6A 2D02A 3DTMA 4D60A 3G2ZA 1BSGA 3O86A 2Q9NA 3Q81A 5G4YA 3DTEA 3BM6A 4YWZA 3C2WA 3LR0A 3UNWA 1GA0A 3IHAA 4B9OA 3WS0A 3QP5A 2HP6A 4E3OA 3GR2A 4X1MA 3W4PA 3PBRA 4R4SA 1XPBA 2P9VA 4GS9A 3C30A 4QPRA 3UB8A 1MKMA 2ZLYA 2B18A 1BT5A 4GS9B 4C6YA 4LRYC 1IEMA 2VGJA 4C75A 1M40A 2QPNA 3HJKA 2J9PA 1DP6A 3HLGA 3WRTA 4RA7A 1E4DA 3LI9A 4PHTA 1UWNX 3BECA 3O88A 4L9EA 3TRCA 4E3KA 1FILA 1XA7A 3T1RA 5F1GA 4P6ZS 3JVVA 4UAAA 2PD7A 3BY9A 1S0WA 4FOFA 3T4SA 2Y2NA 1D7EA 2ZC6B 2DRWA 4HBTA 2G2WA 4MNRA 5FL3A 5FQJA 3N8LA 4PKYG 2XEPA 3R7WA 2WKEA 2ZD8A 2IA2A 4EQ1A 5GL9A 3EEAA 2V2FF 3D72A 4ZAMA 5L09A 4OQGA 4JGPA 1CEGA 4R23A 1YMXA 2V8CA 2VV7A 5D3OA 1YLPA 4N9KA 4NETA 4XUZA 4R38A 4ZBEA 1TS8A 1IKGA 1K4FA 4OPRA 4CLCD 1H5XA 2G7UA 4IUKA 3KX0X 4BD1A 1LL8A 3UY6A 2JKTM 5CHMA 1STZA 2Y79A 3KO6A 1GHMA 1SKFA 3MF0A 4ZTKA 1N4OA 4ZJ1A 3UB6A 4R6LA 2ZM8A 3MXQA 1SDEA 3GDIA 5CEBA 3TG9A 4RX2A 4MDZA 1FSWA 1YLJA 2GNXA 1HZOA 2O9BA 1LL5A 3BQAA 3F1NA 2IWDA 1W63Q 4HJ6A 5HDCA 4PM5A 5DF8A 1PRQA 4GCZA 2BTFP 4GW9A 3FYZA 5AQBA 4KZ3A 2PR5A 3WS2A 3VFHA 3ZG5A 4FCFA 3IWOA 4OPZA 2A2LA 4PM7A 3C8CA 3DTKA 2XLNA 1P0ZA 2XH9A 3NOTC 5DJUA 5JYPA 2W1RA 1TDGA 4II7A 3MXSA 2B5RA 3F1PA 4WEKA 3IQAA 4X53A 1OTBA 3ZHHA 3NDEA 3IF6C 4IUHA 2K2NA 2ZJ9A 4BJPA 3SS4A 1SCWA 1IOUA 2J3WA 1D1JA 3F1PB 3G32A 3OC2A 4RQ9A 4UA9A 5FQIA 3G4PA 5LBRA 2J3TC 1L2SA 4HJ3A 3ZNTA 5L07A 4Y13A 1CQAA 5CTMA 4KZ4A 4ZRRA 5HARA 3BWLA 5AQAA 2WADA 4A5RA 4KQQA 2QWSA 3ZQ5A 4BBTA 1HVBA 1EWZA 1ZKJA 2Y2HA 1FQGA 2Y2OA 2Z2LB 2OLUA 4LCLA 3IH9A 4OOLA 1JWVA 4LENA 3IX8A 4NG2A 4YNRA 3B47A 2XFSA 5FEGA 1KGFA 3BW6A 3VSKA 4DE3A 4EW7A 3F1OB 2DCFA 3IF5A 2VX8A 1PWCA 4OVDA 2X02A 1X0OA 4Y0TA 5EE8A 2PU2A 1LI9A 5HWTA 2W3DA 4IJGA 4OQHA 4Y0UA 2Y2GA 5EVID 3MKFA 3S7OA 1AWIA 3PAEA 2W3HA 3OBFA 4X1LA 2AVXA 4MBKA 3UDIA 5F6AA 3PBNA 3S22A 1S1ZA 4N92A 1XXMA 3HREA 5TBMA 3P7NA 3LIAA 5L8MA 1CI9A 3NOPC 5MC7A 1BLPA 5TFQA 1MY8A 5TBMB 1TEMA 3UMEA 1JWZA 2WGVA 1ESUA 2PDRA 1T1CA 1YPRA 3CJMA 3HBRA 4UEYA 4LRZE 3QP1A 4HH2A 5E2HA 1OMEA 1H8YA 2H0YA 3FKWA 2ZC3B 1KE3A 2XD5A 2PT7A 4QU3A 1XFQA 2P7JA 3VP2A 3T12B 4JGQA 4Q0HA 5K5BA 4O0PA 2OOLA 1LSWA 3NI9A 3OPHA 1LLBA 1FCOA 2HDUA 3ZVWA 3U2AA 1FR1A 4HI4A 4MEZA 3KYZA 1YLYA 3K3DA 4WZ5A 1DP9A 3W8KA 5FDSA 3MSHA 5FQ9A 3IX4A 2OWHA 3QP2A 2JKTI 3PAGA 4JF5A 2M7VA 1MXOA 4L9FA 1GHPA 1XKZA 3Q1FA 4LV3A 5EFWA 3WS4A 5EVIB 1IYSA 4R1GA 1GSWA 5IU1A 4IEDA 2LB5A 2YKFA 2PRFA 1MZUA 2JKGA 4KUOA 2V9AA 1K56A 4KZ5A 1ES2A 3CHWP 3M6HA 3IXGA 2JN7A 4KZ9A 2WUQA 3BRMA 1MWRA 4MCWA 3SS5A 5HD5A 1VETA 2Q0OA 2R78A 1XA1A 1CI8A 3T4JA 2JE5A 4ETZA 3JPUA 1VETB 1Y54A 3OOVA 5EM1A 1IYPA 4JGOA 1G28A 2OV5A 2ZMAA 1IFQA 2BLSA 1CK3A 2XGNA 4O8GA 4U0XA 4KG5A 1OTAA 1I5QA 2KLIA 1N9BA 3NECA 2ZOHA 5HX9A 1I2WA 3Q82A 5IS1A 2PHYA 5GLDA 2V20A 2XA7M 3FPVA 5E43A 1P97A 3E0YA 3SS3A 4DJ2A 3PHYA 5FATA 3N6IA 1J3WA 4WUJA 2H10A 4HY8A 1IYOA 3GQZA 5FA7A 1UWPX 3SH9A 1H0MA 3D4FA 1MBLA 3UE6A 5DF7A 1SZVA 2OWJA 5E2FA 3BFCA 3PBTA 2C6WB 3RJUA 2INWA 1HD8A 3UB5P 3C7VA 2H0TA 4UQIM 4S2NC 4S2KA 2MJ6A 3ZG9B 1VB6A 3T1SA 4ARZA 3CWFA 3QP8A 4G3WA 1BYWA 3LGOA 3L9KA 1MWSA 1TDLA 4YFMA 3FKVA 4OPQA 2V8FA 1K55A 1SDNA 4ARZB 1ERMA 3BY8A 2J80A 2GJ3A 1RP5A 4IBRA 1RCJA 3IHBA 2P08A 3O5YA 2E8JA 4DKIA 5J7EA 3FV7A 3N4IA 1XGJA 1K6RA 1PI4A 4UA7A 3MMHA 3UB7A 2J8YA 4ZJ2A 2UV0E 2O9AA 4WLAA 5DKKA 5CHJA 2Y2JA 1ZHHB 1W79A 2B95A 5EVLA 1TS0A 3RXXA 1CJFA
chains in the Genus database with same CATH topology
2VGLM 3BQAA 3F1NA 4EUVA 1W63Q 5F5YA 4HJ6A 3VV4A 4CLCC 3CLOA 4WL9A 5HDCA 3LIEA 2KX6A 1Y28A 3BJNA 3LR5A 1XJ6A 2V0UA 3KSFA 4GCZA 5AVEA 4GW9A 2NUPC 2L4RA 3NHQA 2PR5A 3PYPA 2J3TD 2QJ7A 1YSPA 4G3VA 2A2LA 3LIBA 3VOLA 3C8CA 4R70A 1P0ZA 4L0LA 3NOTC 4Y2FA 5DJUA 2FH5A 1MC0A 3ZYTA 3TJZC 3ICYA 4Y5FA 2W1RA 4II7A 2V0WA 4GHIA 1T18A 2ZOIA 3R4KA 3F1PA 4WEKA 2GX5A 1OTBA 4HQAA 3K3CA 4IUHA 4LPZA 2K2NA 4WN5A 4BJPA 4Q0JA 5I5LA 1IOUA 2J3WA 3OLOA 3F1PB 5J3WA 5CX7A 3OC2A 2Z6CA 4RQ9A 2KOIA 4I3AA 2VA0A 5DJTA 3K2NA 5LBRA 2J3TC 1NLYA 4HJ3A 5IT5A 1V9YA 4BMWA 4I3IA 3UMDA 1KOUA 4JGRA 1N9LA 5DFXA 2WKQA 1F98A 3B42A 1V9ZA 3H82A 3LYXA 4ZRRA 3PBSA 3HJIA 2H28A 4B93A 3T4LA 3EOIA 4NXBA 4LRXC 5HDSA 3BWLA 5HDDA 2Y8HA 3OCNA 2P04A 5F69A 3H82B 3LIFA 2QWSA 1F5MA 3ZQ5A 4BBTA 2K7SA 3S7QA 2O99A 3IS2A 2DMWA 4PAUA 4OOLA 1WA9A 1JNUA 2I9VA 3VE3A 3RFBA 3T4QA 2ZBBA 4YNRA 3B47A 3CUEC 3IS2B 4ME4A 1OTEA 3H7WA 3BW6A 3E4QA 2PD8A 5A8BA 4EW7A 2XA7S 2QYBA 3F1OB 2L0WA 4H6JA 1N9OA 3V67A 3UB9A 4MN6A 1TD5A 2VX8A 2HF6A 3H7WB 2JHEA 1P9WA 1X0OA 1DRMA 4WF0A 4DJ3A 3NOUC 5KIZA 1F9IA 4H6JB 5DKLA 5HWTA 2W3DA 3A0SA 2FZ0A 3ULFA 4HIAA 5DFYA 4XT2A 1D06A 2PYRA 4IJGA 1LSXA 3T4TA 3S7NA 3FG8A 2Z6DA 3E98A 2OAQ1 3S7OA 1P9RA 2EA9A 3PBOA 4XT2B 4I5SA 4BBVA 2W3HA 3OBFA 3PXPA 4GLQA 4F3LA 5HSQA 1S4SA 4EESA 3A0RA 1OTDA 5F6AA 3PBNA 3KSHA 1S1ZA 2VKSA 4M4XA 5HL6A 5TBMA 3MJQA 4F3LB 3P7NA 2QJ5A 3LIAA 5L8MA 3C38A 2QHKA 3NOPC 5MC7A 4WEJA 4UQIS 3CAXA 3TE8A 1TS7A 1T19A 4Z1WA 3LR3A 4NKPA 5TBMB 4E04A 2XROA 4I38A 3UMEA 1XJ4A 5J4EA 3A0VA 5HPFA 2O0YA 4KUKA 2PDRA 1T1CA 2JKRM 1NRJA 3E4PA 4UEYA 4EU0A 4LRZE 4HH2A 4LLOB 4CLCA 3EGXC 4HHDA 3EQUA 4HJ4A 3T4KA 4CLCE 3IBRA 2KDKA 1NWZA 1NLZA 2WKRA 4NXGA 5G4ZA 3B33A 4R3AA 3T4OA 2PT7A 4CLCB 1XFQA 2P7JA 2XSSA 4Y3IA 2LB9A 4DMZA 2ZMFA 3JVUA 1H8MA 2HJEA 4JGQA 4Q0HA 4O0PA 2OOLA 5K5BA 1LSWA 1S67L 4GJ4A 4KQDA 2B02A 4HP9A 3HCYA 3EWKA 2W27A 3U2AA 4HI4A 4I39A 3P01A 2L1MA 3RTYA 3KYZA 2M1CA 3K3DA 2VZWA 3MQ0A 1DP9A 1UGUA 2W1TA 1TF1A 4WELA 2PYPA 2OWHA 3D3OA 2VGLS 3G6OA 2W1TB 3GECA 3R7WB 2JKTI 2W3FA 2M7VA 2ZMVA 1OPXA 2A24A 4L9FA 3DBAA 2V1AA 2OAP1 5EFWA 3F1OA 2XRNA 1VHMA 1GSWA 4EETB 1OJGA 1S1YA 5IU1A 2A24B 2PR6A 5HZHA 4HP4A 2LB5A 2YKFA 5C5KA 1MZUA 3VE4A 1N9NA 1H3QA 2QKPA 4KUOA 2V9AA 4MMNA 1XJ2A 3W2ZA 3CI6A 1GSVA 4HOIA 4MN5A 5TJJA 2D02A 3S7PA 2VV6A 3T50A 1DP8A 5G4YA 2M7UA 5AJGA 2JN7A 4YWZA 3C2WA 3LR0A 2HJ9C 1EW0A 4G3KA 1OT9A 4B9OA 1ODVA 1YSQA 4MCWA 3LUQA 5HD5A 1T1BA 3LIDA 4K08A 1YAXA 3LICA 1W63M 3MQQA 2R78A 4IHQA 3PBRA 3FC7A 2VEAA 3T4JA 4GS9A 4CQHA 3NJAA 3C30A 2K31A 4ETZA 4QPRA 3UB8A 3EQVA 4AFIA 3OOVA 1S66L 4BWIA 2YKHA 2GZAA 2VJWA 4JGOA 3CUEA 1MKMA 1G28A 2B18A 4GS9B 1IFQA 4LRYC 3EEHA 4O8GA 4NXFA 4O01A 2EWVA 1GSXA 2W0NA 3F1NB 1OTAA 1T1AA 1LT0A 3HJKA 2JKRI 2KLIA 2ZOHA 3PR6A 5IS1A 1OJ5A 3MFXA 1DP6A 2PHYA 4ETXA 3LI9A 4PKYA 4PHTA 1UWNX 2XA7M 3FPVA 2V1BA 4MN7A 3RH8B 5HPIA 3TRCA 4L9EA 1P97A 3E0YA 5HWVA 3LFVA 4DJ2A 3LI8A 2HV1A 1G6OA 3PHYA 4P6ZS 3JVVA 2PD7A 1XJ3A 2NUTC 3BY9A 4FOFA 3T4SA 4WUJA 4EEPA 3FPWA 4HY8A 1D7EA 1TS6A 4I3JA 4L9GA 1ZTUA 3KYQA 1UWPX 5FL3A 2W3EA 4BBUA 3OCLA 4GHIB 3UE6A 4PKYG 5AVFA 4Q0IA 1XFNA 4EXOA 1S4RA 4HH3A 2O9CA 2OWJA 2CMNA 2D01A 3R7WA 3PBTA 5HD3A 2IA2A 4DN0A 4EQ1A 1OTIA 2INWA 4KQOA 3H9WA 3EEAA 4UQIM 3D72A 2MJ6A 5DF9A 1VB6A 3KSGA 2WKPA 4JGPA 5KSHA 4OOMA 4ARZA 3CWFA 4HNBA 4EEUA 3TW8A 4G3WA 3BQ8A 2VV7A 1BYWA 2VLGA 2HGVA 4R38A 4ARZB 3KSIA 1TS8A 3EGDC 3BY8A 2EWWA 4CLCD 2G7UA 2J80A 2GJ3A 4P6ZM 4IUKA 3MQOA 3KX0X 5HWWA 1LL8A 1YKDA 1LSVA 3LR4A 4NEED 2P08A 3O5YA 4FSFA 2JKTM 3UE3A 1OT6A 5J7EA 1STZA 2Y79A 3KO6A 3MF0A 3UB6A 4R6LA 3IBJA 3SW1A 3MXQA 5F68A 3GDIA 3MMHA 3E4OA 4EERA 3UB7A 3PBQA 2O9AA 4WLAA 4YOFA 2BASA 4MDZA 5DKKA 3MR0A 1ZHHB 4NXEA 3CITA 2W3GA 2GNXA 1TS0A 2VV8A 2O9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUV A;  3LFV A;  4YNR A;  3VV4 A;  3MQ0 A;  2VZW A;  4ME4 A;  2W1T A;  1TF1 A;  4FOF A;  3BJN A;  3KSF A;  2QYB A;  3D3O A;  4GW9 A;  1ZTU A;  1TD5 A;  3G6O A;  3NHQ A;  2W1T B;  2W3F A;  2M7V A;  3NOU C;  2W3E A;  3DBA A;  1YSP A;  4G3V A;  2W3D A;  5DFY A;  4Q0I A;  4IJG A;  2XRN A;  1VHM A;  2O9C A;  4R70 A;  3S7N A;  3NOT C;  4Y2F A;  1MC0 A;  2LB5 A;  5C5K A;  3E98 A;  2IA2 A;  4DN0 A;  3S7O A;  4Y5F A;  2W1R A;  2W3H A;  3OBF A;  4MMN A;  3EEA A;  4GLQ A;  3W2Z A;  3CI6 A;  5HSQ A;  5TJJ A;  3S7P A;  3KSG A;  3KSH A;  3R4K A;  2VKS A;  2M7U A;  5AJG A;  5HL6 A;  2GX5 A;  3C2W A;  4G3W A;  4IUH A;  5L8M A;  2K2N A;  4Q0J A;  4G3K A;  3NOP C;  5I5L A;  1YSQ A;  2HGV A;  4MCW A;  4Z1W A;  3KSI A;  4RQ9 A;  2KOI A;  4E04 A;  2XRO A;  3K2N A;  2G7U A;  5LBR A;  2VEA A;  5HPF A;  2O0Y A;  4IUK A;  4CQH A;  4ETZ A;  2K31 A;  1YKD A;  4QPR A;  5DFX A;  3OOV A;  3O5Y A;  4BWI A;  4EU0 A;  4LRZ E;  2VJW A;  4ZRR A;  1MKM A;  2B18 A;  1STZ A;  2Y79 A;  3KO6 A;  4LRX C;  3IBR A;  3MF0 A;  4LRY C;  3IBJ A;  4R6L A;  2Y8H A;  4O8G A;  4O01 A;  3MMH A;  1F5M A;  2XSS A;  3ZQ5 A;  4Y3I A;  2LB9 A;  2O9A A;  4YOF A;  2ZMF A;  4DMZ A;  4MDZ A;  2KLI A;  5K5B A;  4Q0H A;  4O0P A;  2OOL A;  3S7Q A;  2O99 A;  3CIT A;  2W3G A;  4PAU A;  3HCY A;  4ETX A;  4MN7 A;  5HPI A;  3RFB A;  2O9B A;  3TRC A;  3E0Y A; 
#chains in the Genus database with same CATH topology
 3LEQ A;  1K54 A;  5F5Y A;  4XUX A;  4E3N A;  3VV4 A;  3CLO A;  3QP6 A;  3UDX A;  1XJ6 A;  2V0U A;  3KSF A;  3P98 A;  2NUP C;  1FOF A;  4KG2 A;  3HLE A;  2J3T D;  4G3V A;  1DY6 A;  3LIB A;  1K25 A;  1NYY A;  5HAQ A;  5A90 A;  4Y2F A;  5AQ7 A;  2FH5 A;  5FAP A;  5I94 A;  4PM6 A;  3ICY A;  4Y5F A;  2X71 A;  4OP5 A;  1FCN A;  1U60 A;  2V0W A;  4GDN A;  5CGX A;  2ZOI A;  3SZT A;  2ZQ9 A;  3R4K A;  2GX5 A;  1IEL A;  1KE4 A;  1VEU A;  1PWG A;  1K57 A;  4DXB A;  2ZQD A;  3OLO A;  5M18 A;  3VP4 A;  2KOI A;  4I3A A;  1VEU B;  2VA0 A;  3K2N A;  5FAQ A;  2UWX A;  4BMW A;  4JGR A;  1N9L A;  4DXC A;  2OSU A;  4CJN A;  3AGD A;  2H28 A;  4B93 A;  3EOI A;  4LRX C;  1LI0 A;  2Y8H A;  5F69 A;  3V3R A;  1FIK A;  3MFD A;  2K7S A;  4N1H A;  3TSG A;  3UN7 A;  3A3J A;  3VOZ A;  3BFF A;  4PAU A;  3IF6 A;  4H8R A;  3AGE A;  1IKI A;  4BQM A;  4ME4 A;  3IF6 B;  1Z6F A;  5CHU A;  3H7W A;  5A8B A;  4GD6 A;  3V39 A;  2XA7 S;  3A3D A;  5HAP A;  1N9O A;  2RCX A;  3UB9 A;  3H7W B;  4WF0 A;  4S2P A;  3NOU C;  4FTX A;  3HUO A;  5EUA A;  5DKL A;  3MXR A;  2EFU A;  2FZ0 A;  3SOI A;  4E3M A;  1LSX A;  5EM0 A;  3S7N A;  4CPK A;  1K38 A;  1NZO A;  3IXB A;  4X55 A;  5F1F A;  4GLQ A;  4F3L A;  1O07 A;  3HLB A;  3KSH A;  1NYM A;  4EBL A;  4F3L B;  4X56 A;  2QHK A;  3D9Y A;  4UQI S;  1F2K A;  1TS7 A;  1T19 A;  4Z1W A;  4NKP A;  3ITA A;  5FDH A;  4QY6 A;  3ZNY A;  1NRJ A;  4PPR A;  3NIA A;  5GHZ A;  4CLC A;  3O87 A;  3EGX C;  1C3B A;  3T4K A;  1BLC A;  3IBR A;  2KDK A;  4HES A;  1QMF A;  4JF6 A;  1NLZ A;  1Q2P A;  5HFO A;  4NXG A;  3B33 A;  4R3A A;  3HUM A;  4CLC B;  4Y3I A;  1ES4 A;  3JVU A;  1H8M A;  2EX2 A;  1HTZ A;  3M2J A;  3ZDJ A;  4GJ4 A;  4HP9 A;  3EWK A;  4OQ0 A;  1YT4 A;  1AXB A;  2L1M A;  2V1Z A;  2M1C A;  3MQ0 A;  2VZW A;  5CTN A;  1PYY A;  1TVF A;  1UGU A;  4R4R A;  4EBP A;  1KDS A;  4WEL A;  3BYD A;  3D3O A;  2Q9M A;  3HLC A;  2IWB A;  3HUN A;  5CEC A;  2W3F A;  2ZMV A;  4QHC A;  2WKH A;  1BTL A;  4IVK A;  4GOG A;  3F1O A;  4PM8 A;  2Y2K A;  2G2U A;  4E6W A;  1S1Y A;  2R9W A;  1ESI A;  4E3J A;  1PI5 A;  2JCH A;  4MMN A;  4N9L A;  1GSV A;  5TJJ A;  2J7V A;  3S7P A;  4PMA A;  2ZM0 A;  2VV6 A;  4UA6 A;  1FCM A;  3W4O A;  4WYY A;  5HL1 A;  4M3K A;  1G68 A;  2WGI A;  3AGF A;  3ISG A;  4MBH A;  1YQS A;  2HJ9 C;  1EW0 A;  2PU4 A;  1OT9 A;  4G3K A;  1YSQ A;  1YM1 A;  3LID A;  4B4X A;  1YAX A;  2ZC5 B;  2XF3 A;  3LIC A;  1W63 M;  3MQQ A;  4IHQ A;  1O7E A;  4CQH A;  5GHX A;  4IVI A;  2K31 A;  2A3U A;  3EQV A;  4AFI A;  1S66 L;  2EXA A;  2GZA A;  2JKF A;  3ITB A;  5EOO A;  3CUE A;  2EX6 A;  4FD8 A;  4P87 A;  3VP0 A;  2EWV A;  4K0W A;  2W0N A;  2WZX A;  1KVM A;  3IX3 A;  4E3L A;  1K6S A;  4OOY A;  3HLF A;  4QY5 A;  5KZH A;  1OJ5 A;  2ZQ8 A;  3MFX A;  4PKY A;  4MN7 A;  5HPI A;  2V1B A;  3N7W A;  1PFL A;  4E6X A;  5HWV A;  3VP3 A;  3LFV A;  3LI8 A;  2HV1 A;  1G6O A;  1ZG6 A;  4BEN A;  3VFF A;  1JTG A;  1XGI A;  1XJ3 A;  2ZQ7 A;  4KZB A;  1IYQ A;  4EEP A;  4ID4 A;  4I3J A;  4L9G A;  1W8Q A;  4X68 A;  3KYQ A;  2ZC7 A;  1MWT A;  1SKO B;  2W3E A;  3CZD A;  5FQM A;  4GHI B;  5AVF A;  3HVF A;  1XFN A;  4EXO A;  3HLW A;  1S4R A;  3B3X A;  1GHI A;  1K4E A;  2D01 A;  4DN0 A;  3UO9 A;  1OTI A;  2Y2L A;  1PIO A;  4JXV A;  5EVI A;  5DF9 A;  2PBY A;  1A0K A;  5KSH A;  4OOM A;  2EX9 A;  3BFG A;  4WMC D;  1CEF A;  3BQ8 A;  5HW3 A;  1GCE A;  4KZA A;  3KSI A;  3EGD C;  2EWW A;  4P6Z M;  3IXD A;  4MLL A;  5HWW A;  1LSV A;  4NEE D;  5TGF A;  2PBD P;  3UE3 A;  2XFT A;  3SW1 A;  4EWF A;  3NDG A;  5EVE A;  2JC7 A;  3QP4 A;  3MKE A;  4EER A;  3PBQ A;  2XK1 A;  1BZA A;  4WM9 A;  4QB8 A;  1L0F A;  1RGY A;  1VQQ A;  2QZ6 A;  2EFX A;  3MR0 A;  3CIT A;  2W3G A;  2VV8 A;  2ZQC A;  1BLS A;  3DWZ A;  3FZC A;  4XXR A;  5F82 A;  2ZQA A;  2VGL M;  4EUV A;  4DF6 A;  1G6A A;  1M6K A;  1PW8 A;  5CGS A;  4FUW A;  5J8X A;  3GTC A;  1W5D A;  3LR5 A;  4BLM A;  1L0D A;  2FFY A;  2L4R A;  3VMA A;  4JXG A;  3PYP A;  2WKI A;  2QJ7 A;  3MZF A;  5EOE A;  2EXB A;  1YSP A;  1ONG A;  2WGW A;  1L0G A;  3VOL A;  4R70 A;  4L0L A;  3LY3 A;  1MC0 A;  3ZYT A;  4WMC A;  2WGW B;  5F83 A;  2PAV P;  1T18 A;  4DRT A;  1KVL A;  3WRZ A;  1WE4 A;  4OKP A;  4HQA A;  4OLG A;  1G5U A;  2IWC A;  4Q0J A;  5I5L A;  1MWU A;  5CRF A;  4OP8 A;  3ZG0 A;  4MBF A;  5J3W A;  4Q8I A;  2Z6C A;  4OON A;  4N1X A;  1NLY A;  5IT5 A;  4I3I A;  3KYE A;  1KOU A;  1SHV A;  5DFX A;  4P6B A;  1F98 A;  1V9Z A;  3LYX A;  3HJI A;  2DNS A;  4NXB A;  5HDS A;  3OZH A;  3OCN A;  2WAF A;  2P04 A;  3M2K A;  3MS6 A;  4WBG A;  4DDY A;  4BL3 A;  1NRF A;  1NZU A;  4S2M A;  5DVA A;  3S7Q A;  1HLU P;  4F94 A;  2A49 A;  3S4X A;  2DMW A;  2WAE A;  1ERQ A;  1JNU A;  2I9V A;  3VE3 A;  3GMW A;  3RFB A;  4GZB A;  4JLF A;  2PD8 A;  1DJB A;  1ACF A;  4H6J A;  3V67 A;  4MN6 A;  4GNU A;  3UPP A;  1P9W A;  1DRM A;  5L2F A;  5KIZ A;  1F9I A;  4H6J B;  3O3V A;  1LL9 A;  3A0S A;  4HIA A;  5FI7 A;  5DFY A;  4XT2 A;  1D06 A;  5EPH A;  4Z9Q A;  5A91 A;  3CPT A;  3W4Q A;  2Z6D A;  2OAQ 1;  3MBZ A;  1P9R A;  2FFF B;  4HEF A;  4XT2 B;  1L3L A;  4I5S A;  4BBV A;  4P0M A;  3PXP A;  5HSQ A;  1S4S A;  2Y59 A;  4EES A;  3A0R A;  5U47 A;  3JYI A;  3CPT B;  1OTD A;  4IBX A;  4BL2 A;  4FH4 A;  2VKS A;  4M4X A;  4S2L A;  3G35 A;  5HL6 A;  3ZGA B;  2P9V B;  5TR7 A;  2QJ5 A;  2Y55 A;  4WEJ A;  3TE8 A;  4I38 A;  1XJ4 A;  4BD0 A;  3G30 A;  5GHY A;  4KUK A;  2RL3 A;  3E4P A;  2J9O A;  3IWQ A;  4LLO B;  4DE2 A;  2ZM2 A;  2WYX A;  4HJ4 A;  1NWZ A;  2WKR A;  5G4Z A;  4S2I A;  3T4O A;  1DJC A;  2XSS A;  4DMZ A;  2ZMF A;  1K55 C;  2WZZ A;  2HJE A;  1PNE A;  4KQD A;  2B02 A;  2Y2P A;  3UE0 A;  3HCY A;  2W27 A;  3C4P A;  1K0K A;  4I39 A;  2Y2M A;  3P01 A;  5GLC A;  1I2S A;  2XQZ A;  1NY0 A;  5BOH A;  5FEF A;  5KSC A;  2PYP A;  5E2G A;  3C5A A;  2VGL S;  3G6O A;  3DTI A;  4ZDX A;  3GEC A;  3R7W B;  3NBL A;  3G31 A;  1OPX A;  1GA9 A;  3VP1 A;  3DBA A;  3IXH A;  2V1A A;  2OAP 1;  1ZG4 A;  1E3U D;  3NCK A;  2XRN A;  1K54 C;  4EET B;  1OJG A;  5FAO A;  2Y2Q A;  2PR6 A;  5HZH A;  4HP4 A;  5C5K A;  5G18 A;  3OPP A;  1N9N A;  1ES5 A;  1H3Q A;  5IHV A;  2QKP A;  4HOI A;  4MN5 A;  4RYE A;  1JWP A;  5DTT A;  1MKI A;  3T50 A;  3UPO A;  1DP8 A;  2GDN A;  2M7U A;  5AJG A;  1Z09 A;  4EQI A;  1KE0 A;  4Y15 A;  1PWD A;  2CC1 A;  1E25 A;  1ODV A;  3LUQ A;  1T1B A;  1VM1 A;  3UDF A;  4K08 A;  3CMZ A;  2HP5 A;  4WZ4 A;  3TOI A;  3FC7 A;  2VEA A;  3P09 A;  1YMS A;  2Y4A A;  1QME A;  3NJA A;  3LY4 A;  1YLZ A;  3VSL A;  3N8R A;  4BWI A;  2YKH A;  2VJW A;  3MZE A;  4OLD A;  3EEH A;  3LEZ A;  1WYB A;  1K57 C;  4NXF A;  4O01 A;  1GSX A;  3F1N B;  1T1A A;  1LT0 A;  4K0X A;  1NJ4 A;  2JKR I;  3PR6 A;  4KG6 A;  4ESP A;  1EI5 A;  1ERO A;  4R3J A;  5FI6 A;  4YIN A;  4ETX A;  3RH8 B;  5CXW A;  3OPL A;  1FR6 A;  2BG1 A;  5FQK A;  5A92 A;  1S6R A;  2NUT C;  4EBN A;  1Q2Q A;  4U3T A;  1E3U A;  3FPW A;  3WWX A;  1TS6 A;  3NY4 A;  1ZTU A;  4JKT A;  4GN2 A;  3QNB A;  4NK3 A;  5FSR A;  3HLD A;  4FH2 A;  4BBU A;  3OCL A;  3DWK A;  3GRJ A;  4Q0I A;  4LCM A;  2OLV A;  4GKU A;  4HH3 A;  3IT9 A;  2O9C A;  4B4Z A;  2CMN A;  4LV0 A;  3T1X A;  5HD3 A;  5HAI A;  3U4L P;  4KQO A;  3H9W A;  3QNC A;  1YLW A;  3UE1 A;  3A3F A;  3KSG A;  4E3I A;  2WKP A;  4KZ7 A;  4PM9 A;  3QHY A;  4HNB A;  2X01 A;  4EEU A;  3TW8 A;  3HL9 A;  2VLG A;  2HGV A;  3GV9 A;  3S1Y A;  1ALQ A;  4LGW A;  3DW0 A;  4X6T A;  1JVJ A;  3MQO A;  4JPM A;  1YKD A;  1ES3 A;  3LR4 A;  4FSF A;  1OT6 A;  2HDR A;  3CG5 A;  3G2Y A;  4X69 A;  1NXY A;  3MZD A;  3IBJ A;  4GD8 A;  5F68 A;  1Y4O A;  3BFD A;  3E4O A;  3WS1 A;  2WK0 A;  4YOF A;  2BAS A;  4JF4 A;  4LV2 A;  3Q7Z A;  4NXE A;  4LV1 A;  4S2J A;  4JBF A;  5CER A;  2ZC4 B;  4CLC C;  3N8S A;  4WL9 A;  4RVA A;  3Q07 A;  3LIE A;  2KX6 A;  1Y28 A;  3BJN A;  4Y7P A;  5JYO A;  4RX3 A;  5AVE A;  2H5S A;  1XX2 A;  3BLM A;  3GSG A;  3NHQ A;  1JTD A;  4GDB A;  4QJG A;  3BLS A;  3ZG8 B;  1K56 D;  3E2K A;  5KMW A;  1WYC A;  4OPY A;  2EX8 A;  3DAV A;  4DE0 A;  5FI2 A;  1RGZ A;  3TJZ C;  1PZO A;  1SKO A;  3IWI A;  5EEC A;  1PW1 A;  4GHI A;  4O7D A;  1DJA A;  3E2L A;  4KEN B;  3K3C A;  4WN5 A;  5DTK A;  3GVB A;  4LPZ A;  2JBF A;  4HBU A;  4KQR A;  4EV4 A;  4DDS A;  5CX7 A;  3RXW A;  5DJT A;  1V9Y A;  3UMD A;  3A3I A;  3IH8 A;  2WKQ A;  2ZL1 A;  4KZ6 A;  1KDW A;  3B42 A;  3H82 A;  2HDQ A;  3PBS A;  2HP9 A;  3T4L A;  5HDD A;  2ZL1 B;  3H82 B;  3LIF A;  1F5M A;  5L10 A;  1ZC2 A;  2HDS A;  2O99 A;  3WS5 A;  3IS2 A;  1WA9 A;  3T4Q A;  5DTS A;  3ZCZ A;  2ZBB A;  3CUE C;  4P85 A;  3IS2 B;  1L0E A;  2XD1 A;  1OTE A;  4GB7 A;  3A3E A;  2P74 A;  3E4Q A;  3UPN A;  5M19 A;  2QYB A;  4S2N A;  2L0W A;  1TD5 A;  3Q7V A;  2HF6 A;  2JHE A;  1PZP A;  4DJ3 A;  1BUE A;  2I72 A;  5FAS A;  4LFU A;  1KGE A;  3Q7V B;  3ULF A;  2PYR A;  3T4T A;  3NC8 A;  1KGG A;  4R0Q A;  3BEB A;  2ACG A;  3FG8 A;  3E98 A;  1FSY A;  4S2O A;  4EUZ A;  2EA9 A;  3PBO A;  1H8Z A;  4B88 A;  4KZ8 A;  3MJQ A;  4X25 A;  3C38 A;  3G34 A;  5CGW A;  2XDM A;  3CAX A;  5M1A A;  3LR3 A;  4E04 A;  4WZ5 C;  2XRO A;  4QWO A;  2HPB A;  3SH7 A;  3ZVT A;  5J4E A;  3A0V A;  3M6B A;  5HPF A;  2O0Y A;  1W7F A;  2JKR M;  3V5M A;  1J9M A;  1CF0 A;  4JXW A;  4EU0 A;  4QD4 A;  5EVI C;  4HHD A;  3EQU A;  3ZFZ A;  4C3Q A;  4CLC E;  2QMI A;  4R3B A;  5GLB A;  2E8I A;  2Z2M B;  3V50 A;  3C4O A;  2LB9 A;  2Y91 A;  3LO7 A;  4ZJ3 A;  4Y17 A;  3L7H A;  3NUL A;  1YLT A;  2R9X A;  5CED A;  1S67 L;  3LCE A;  4U0T A;  5E2E A;  2C5W B;  3RTY A;  2W1T A;  3I7J A;  1TF1 A;  1XP4 A;  5AQ9 A;  1BUL A;  3BFE A;  3VOY A;  5A93 A;  4OH0 A;  3FWL A;  1BLH A;  2W1T B;  5GLA A;  3C7U A;  4K91 A;  4OQI A;  4Y0O A;  3PTE A;  2A24 A;  1ONH A;  2VK3 A;  1W8Y A;  2Y2I A;  4UHU A;  5EV0 A;  3SH8 A;  1VHM A;  4JXS A;  3OPR A;  2HZ5 A;  2A24 B;  2XR0 A;  4D2O A;  5FQQ A;  1MPL A;  3VE4 A;  2VGK A;  3ZG7 B;  3T1Q B;  3V3S A;  1LHY A;  4DE1 A;  1XJ2 A;  3W2Z A;  3CI6 A;  2D02 A;  3DTM A;  4D60 A;  3G2Z A;  1BSG A;  3O86 A;  2Q9N A;  3Q81 A;  5G4Y A;  3DTE A;  3BM6 A;  4YWZ A;  3C2W A;  3LR0 A;  3UNW A;  1GA0 A;  3IHA A;  4B9O A;  3WS0 A;  3QP5 A;  2HP6 A;  4E3O A;  3GR2 A;  4X1M A;  3W4P A;  3PBR A;  4R4S A;  1XPB A;  2P9V A;  4GS9 A;  3C30 A;  4QPR A;  3UB8 A;  1MKM A;  2ZLY A;  2B18 A;  1BT5 A;  4GS9 B;  4C6Y A;  4LRY C;  1IEM A;  2VGJ A;  4C75 A;  1M40 A;  2QPN A;  3HJK A;  2J9P A;  1DP6 A;  3HLG A;  3WRT A;  4RA7 A;  1E4D A;  3LI9 A;  4PHT A;  1UWN X;  3BEC A;  3O88 A;  4L9E A;  3TRC A;  4E3K A;  1FIL A;  1XA7 A;  3T1R A;  5F1G A;  4P6Z S;  3JVV A;  4UAA A;  2PD7 A;  3BY9 A;  1S0W A;  4FOF A;  3T4S A;  2Y2N A;  1D7E A;  2ZC6 B;  2DRW A;  4HBT A;  2G2W A;  4MNR A;  5FL3 A;  5FQJ A;  3N8L A;  4PKY G;  2XEP A;  3R7W A;  2WKE A;  2ZD8 A;  2IA2 A;  4EQ1 A;  5GL9 A;  3EEA A;  2V2F F;  3D72 A;  4ZAM A;  5L09 A;  4OQG A;  4JGP A;  1CEG A;  4R23 A;  1YMX A;  2V8C A;  2VV7 A;  5D3O A;  1YLP A;  4N9K A;  4NET A;  4XUZ A;  4R38 A;  4ZBE A;  1TS8 A;  1IKG A;  1K4F A;  4OPR A;  4CLC D;  1H5X A;  2G7U A;  4IUK A;  3KX0 X;  4BD1 A;  1LL8 A;  3UY6 A;  2JKT M;  5CHM A;  1STZ A;  2Y79 A;  3KO6 A;  1GHM A;  1SKF A;  3MF0 A;  4ZTK A;  1N4O A;  4ZJ1 A;  3UB6 A;  4R6L A;  2ZM8 A;  3MXQ A;  1SDE A;  3GDI A;  5CEB A;  3TG9 A;  4RX2 A;  4MDZ A;  1FSW A;  1YLJ A;  2GNX A;  1HZO A;  2O9B A;  1LL5 A;  3BQA A;  3F1N A;  2IWD A;  1W63 Q;  4HJ6 A;  5HDC A;  4PM5 A;  5DF8 A;  1PRQ A;  4GCZ A;  2BTF P;  4GW9 A;  3FYZ A;  5AQB A;  4KZ3 A;  2PR5 A;  3WS2 A;  3VFH A;  3ZG5 A;  4FCF A;  3IWO A;  4OPZ A;  2A2L A;  4PM7 A;  3C8C A;  3DTK A;  2XLN A;  1P0Z A;  2XH9 A;  3NOT C;  5DJU A;  5JYP A;  2W1R A;  1TDG A;  4II7 A;  3MXS A;  2B5R A;  3F1P A;  4WEK A;  3IQA A;  4X53 A;  1OTB A;  3ZHH A;  3NDE A;  3IF6 C;  4IUH A;  2K2N A;  2ZJ9 A;  4BJP A;  3SS4 A;  1SCW A;  1IOU A;  2J3W A;  1D1J A;  3F1P B;  3G32 A;  3OC2 A;  4RQ9 A;  4UA9 A;  5FQI A;  3G4P A;  5LBR A;  2J3T C;  1L2S A;  4HJ3 A;  3ZNT A;  5L07 A;  4Y13 A;  1CQA A;  5CTM A;  4KZ4 A;  4ZRR A;  5HAR A;  3BWL A;  5AQA A;  2WAD A;  4A5R A;  4KQQ A;  2QWS A;  3ZQ5 A;  4BBT A;  1HVB A;  1EWZ A;  1ZKJ A;  2Y2H A;  1FQG A;  2Y2O A;  2Z2L B;  2OLU A;  4LCL A;  3IH9 A;  4OOL A;  1JWV A;  4LEN A;  3IX8 A;  4NG2 A;  4YNR A;  3B47 A;  2XFS A;  5FEG A;  1KGF A;  3BW6 A;  3VSK A;  4DE3 A;  4EW7 A;  3F1O B;  2DCF A;  3IF5 A;  2VX8 A;  1PWC A;  4OVD A;  2X02 A;  1X0O A;  4Y0T A;  5EE8 A;  2PU2 A;  1LI9 A;  5HWT A;  2W3D A;  4IJG A;  4OQH A;  4Y0U A;  2Y2G A;  5EVI D;  3MKF A;  3S7O A;  1AWI A;  3PAE A;  2W3H A;  3OBF A;  4X1L A;  2AVX A;  4MBK A;  3UDI A;  5F6A A;  3PBN A;  3S22 A;  1S1Z A;  4N92 A;  1XXM A;  3HRE A;  5TBM A;  3P7N A;  3LIA A;  5L8M A;  1CI9 A;  3NOP C;  5MC7 A;  1BLP A;  5TFQ A;  1MY8 A;  5TBM B;  1TEM A;  3UME A;  1JWZ A;  2WGV A;  1ESU A;  2PDR A;  1T1C A;  1YPR A;  3CJM A;  3HBR A;  4UEY A;  4LRZ E;  3QP1 A;  4HH2 A;  5E2H A;  1OME A;  1H8Y A;  2H0Y A;  3FKW A;  2ZC3 B;  1KE3 A;  2XD5 A;  2PT7 A;  4QU3 A;  1XFQ A;  2P7J A;  3VP2 A;  3T12 B;  4JGQ A;  4Q0H A;  5K5B A;  4O0P A;  2OOL A;  1LSW A;  3NI9 A;  3OPH A;  1LLB A;  1FCO A;  2HDU A;  3ZVW A;  3U2A A;  1FR1 A;  4HI4 A;  4MEZ A;  3KYZ A;  1YLY A;  3K3D A;  4WZ5 A;  1DP9 A;  3W8K A;  5FDS A;  3MSH A;  5FQ9 A;  3IX4 A;  2OWH A;  3QP2 A;  2JKT I;  3PAG A;  4JF5 A;  2M7V A;  1MXO A;  4L9F A;  1GHP A;  1XKZ A;  3Q1F A;  4LV3 A;  5EFW A;  3WS4 A;  5EVI B;  1IYS A;  4R1G A;  1GSW A;  5IU1 A;  4IED A;  2LB5 A;  2YKF A;  2PRF A;  1MZU A;  2JKG A;  4KUO A;  2V9A A;  1K56 A;  4KZ5 A;  1ES2 A;  3CHW P;  3M6H A;  3IXG A;  2JN7 A;  4KZ9 A;  2WUQ A;  3BRM A;  1MWR A;  4MCW A;  3SS5 A;  5HD5 A;  1VET A;  2Q0O A;  2R78 A;  1XA1 A;  1CI8 A;  3T4J A;  2JE5 A;  4ETZ A;  3JPU A;  1VET B;  1Y54 A;  3OOV A;  5EM1 A;  1IYP A;  4JGO A;  1G28 A;  2OV5 A;  2ZMA A;  1IFQ A;  2BLS A;  1CK3 A;  2XGN A;  4O8G A;  4U0X A;  4KG5 A;  1OTA A;  1I5Q A;  2KLI A;  1N9B A;  3NEC A;  2ZOH A;  5HX9 A;  1I2W A;  3Q82 A;  5IS1 A;  2PHY A;  5GLD A;  2V20 A;  2XA7 M;  3FPV A;  5E43 A;  1P97 A;  3E0Y A;  3SS3 A;  4DJ2 A;  3PHY A;  5FAT A;  3N6I A;  1J3W A;  4WUJ A;  2H10 A;  4HY8 A;  1IYO A;  3GQZ A;  5FA7 A;  1UWP X;  3SH9 A;  1H0M A;  3D4F A;  1MBL A;  3UE6 A;  5DF7 A;  1SZV A;  2OWJ A;  5E2F A;  3BFC A;  3PBT A;  2C6W B;  3RJU A;  2INW A;  1HD8 A;  3UB5 P;  3C7V A;  2H0T A;  4UQI M;  4S2N C;  4S2K A;  2MJ6 A;  3ZG9 B;  1VB6 A;  3T1S A;  4ARZ A;  3CWF A;  3QP8 A;  4G3W A;  1BYW A;  3LGO A;  3L9K A;  1MWS A;  1TDL A;  4YFM A;  3FKV A;  4OPQ A;  2V8F A;  1K55 A;  1SDN A;  4ARZ B;  1ERM A;  3BY8 A;  2J80 A;  2GJ3 A;  1RP5 A;  4IBR A;  1RCJ A;  3IHB A;  2P08 A;  3O5Y A;  2E8J A;  4DKI A;  5J7E A;  3FV7 A;  3N4I A;  1XGJ A;  1K6R A;  1PI4 A;  4UA7 A;  3MMH A;  3UB7 A;  2J8Y A;  4ZJ2 A;  2UV0 E;  2O9A A;  4WLA A;  5DKK A;  5CHJ A;  2Y2J A;  1ZHH B;  1W79 A;  2B95 A;  5EVL A;  1TS0 A;  3RXX A;  1CJF A; 
#chains in the Genus database with same CATH homology
 2VGL M;  3BQA A;  3F1N A;  4EUV A;  1W63 Q;  5F5Y A;  4HJ6 A;  3VV4 A;  4CLC C;  3CLO A;  4WL9 A;  5HDC A;  3LIE A;  2KX6 A;  1Y28 A;  3BJN A;  3LR5 A;  1XJ6 A;  2V0U A;  3KSF A;  4GCZ A;  5AVE A;  4GW9 A;  2NUP C;  2L4R A;  3NHQ A;  2PR5 A;  3PYP A;  2J3T D;  2QJ7 A;  1YSP A;  4G3V A;  2A2L A;  3LIB A;  3VOL A;  3C8C A;  4R70 A;  1P0Z A;  4L0L A;  3NOT C;  4Y2F A;  5DJU A;  2FH5 A;  1MC0 A;  3ZYT A;  3TJZ C;  3ICY A;  4Y5F A;  2W1R A;  4II7 A;  2V0W A;  4GHI A;  1T18 A;  2ZOI A;  3R4K A;  3F1P A;  4WEK A;  2GX5 A;  1OTB A;  4HQA A;  3K3C A;  4IUH A;  4LPZ A;  2K2N A;  4WN5 A;  4BJP A;  4Q0J A;  5I5L A;  1IOU A;  2J3W A;  3OLO A;  3F1P B;  5J3W A;  5CX7 A;  3OC2 A;  2Z6C A;  4RQ9 A;  2KOI A;  4I3A A;  2VA0 A;  5DJT A;  3K2N A;  5LBR A;  2J3T C;  1NLY A;  4HJ3 A;  5IT5 A;  1V9Y A;  4BMW A;  4I3I A;  3UMD A;  1KOU A;  4JGR A;  1N9L A;  5DFX A;  2WKQ A;  1F98 A;  3B42 A;  1V9Z A;  3H82 A;  3LYX A;  4ZRR A;  3PBS A;  3HJI A;  2H28 A;  4B93 A;  3T4L A;  3EOI A;  4NXB A;  4LRX C;  5HDS A;  3BWL A;  5HDD A;  2Y8H A;  3OCN A;  2P04 A;  5F69 A;  3H82 B;  3LIF A;  2QWS A;  1F5M A;  3ZQ5 A;  4BBT A;  2K7S A;  3S7Q A;  2O99 A;  3IS2 A;  2DMW A;  4PAU A;  4OOL A;  1WA9 A;  1JNU A;  2I9V A;  3VE3 A;  3RFB A;  3T4Q A;  2ZBB A;  4YNR A;  3B47 A;  3CUE C;  3IS2 B;  4ME4 A;  1OTE A;  3H7W A;  3BW6 A;  3E4Q A;  2PD8 A;  5A8B A;  4EW7 A;  2XA7 S;  2QYB A;  3F1O B;  2L0W A;  4H6J A;  1N9O A;  3V67 A;  3UB9 A;  4MN6 A;  1TD5 A;  2VX8 A;  2HF6 A;  3H7W B;  2JHE A;  1P9W A;  1X0O A;  1DRM A;  4WF0 A;  4DJ3 A;  3NOU C;  5KIZ A;  1F9I A;  4H6J B;  5DKL A;  5HWT A;  2W3D A;  3A0S A;  2FZ0 A;  3ULF A;  4HIA A;  5DFY A;  4XT2 A;  1D06 A;  2PYR A;  4IJG A;  1LSX A;  3T4T A;  3S7N A;  3FG8 A;  2Z6D A;  3E98 A;  2OAQ 1;  3S7O A;  1P9R A;  2EA9 A;  3PBO A;  4XT2 B;  4I5S A;  4BBV A;  2W3H A;  3OBF A;  3PXP A;  4GLQ A;  4F3L A;  5HSQ A;  1S4S A;  4EES A;  3A0R A;  1OTD A;  5F6A A;  3PBN A;  3KSH A;  1S1Z A;  2VKS A;  4M4X A;  5HL6 A;  5TBM A;  3MJQ A;  4F3L B;  3P7N A;  2QJ5 A;  3LIA A;  5L8M A;  3C38 A;  2QHK A;  3NOP C;  5MC7 A;  4WEJ A;  4UQI S;  3CAX A;  3TE8 A;  1TS7 A;  1T19 A;  4Z1W A;  3LR3 A;  4NKP A;  5TBM B;  4E04 A;  2XRO A;  4I38 A;  3UME A;  1XJ4 A;  5J4E A;  3A0V A;  5HPF A;  2O0Y A;  4KUK A;  2PDR A;  1T1C A;  2JKR M;  1NRJ A;  3E4P A;  4UEY A;  4EU0 A;  4LRZ E;  4HH2 A;  4LLO B;  4CLC A;  3EGX C;  4HHD A;  3EQU A;  4HJ4 A;  3T4K A;  4CLC E;  3IBR A;  2KDK A;  1NWZ A;  1NLZ A;  2WKR A;  4NXG A;  5G4Z A;  3B33 A;  4R3A A;  3T4O A;  2PT7 A;  4CLC B;  1XFQ A;  2P7J A;  2XSS A;  4Y3I A;  2LB9 A;  4DMZ A;  2ZMF A;  3JVU A;  1H8M A;  2HJE A;  4JGQ A;  4Q0H A;  4O0P A;  2OOL A;  5K5B A;  1LSW A;  1S67 L;  4GJ4 A;  4KQD A;  2B02 A;  4HP9 A;  3HCY A;  3EWK A;  2W27 A;  3U2A A;  4HI4 A;  4I39 A;  3P01 A;  2L1M A;  3RTY A;  3KYZ A;  2M1C A;  3K3D A;  2VZW A;  3MQ0 A;  1DP9 A;  1UGU A;  2W1T A;  1TF1 A;  4WEL A;  2PYP A;  2OWH A;  3D3O A;  2VGL S;  3G6O A;  2W1T B;  3GEC A;  3R7W B;  2JKT I;  2W3F A;  2M7V A;  2ZMV A;  1OPX A;  2A24 A;  4L9F A;  3DBA A;  2V1A A;  2OAP 1;  5EFW A;  3F1O A;  2XRN A;  1VHM A;  1GSW A;  4EET B;  1OJG A;  1S1Y A;  5IU1 A;  2A24 B;  2PR6 A;  5HZH A;  4HP4 A;  2LB5 A;  2YKF A;  5C5K A;  1MZU A;  3VE4 A;  1N9N A;  1H3Q A;  2QKP A;  4KUO A;  2V9A A;  4MMN A;  1XJ2 A;  3W2Z A;  3CI6 A;  1GSV A;  4HOI A;  4MN5 A;  5TJJ A;  2D02 A;  3S7P A;  2VV6 A;  3T50 A;  1DP8 A;  5G4Y A;  2M7U A;  5AJG A;  2JN7 A;  4YWZ A;  3C2W A;  3LR0 A;  2HJ9 C;  1EW0 A;  4G3K A;  1OT9 A;  4B9O A;  1ODV A;  1YSQ A;  4MCW A;  3LUQ A;  5HD5 A;  1T1B A;  3LID A;  4K08 A;  1YAX A;  3LIC A;  1W63 M;  3MQQ A;  2R78 A;  4IHQ A;  3PBR A;  3FC7 A;  2VEA A;  3T4J A;  4GS9 A;  4CQH A;  3NJA A;  3C30 A;  2K31 A;  4ETZ A;  4QPR A;  3UB8 A;  3EQV A;  4AFI A;  3OOV A;  1S66 L;  4BWI A;  2YKH A;  2GZA A;  2VJW A;  4JGO A;  3CUE A;  1MKM A;  1G28 A;  2B18 A;  4GS9 B;  1IFQ A;  4LRY C;  3EEH A;  4O8G A;  4NXF A;  4O01 A;  2EWV A;  1GSX A;  2W0N A;  3F1N B;  1OTA A;  1T1A A;  1LT0 A;  3HJK A;  2JKR I;  2KLI A;  2ZOH A;  3PR6 A;  5IS1 A;  1OJ5 A;  3MFX A;  1DP6 A;  2PHY A;  4ETX A;  3LI9 A;  4PKY A;  4PHT A;  1UWN X;  2XA7 M;  3FPV A;  2V1B A;  4MN7 A;  3RH8 B;  5HPI A;  3TRC A;  4L9E A;  1P97 A;  3E0Y A;  5HWV A;  3LFV A;  4DJ2 A;  3LI8 A;  2HV1 A;  1G6O A;  3PHY A;  4P6Z S;  3JVV A;  2PD7 A;  1XJ3 A;  2NUT C;  3BY9 A;  4FOF A;  3T4S A;  4WUJ A;  4EEP A;  3FPW A;  4HY8 A;  1D7E A;  1TS6 A;  4I3J A;  4L9G A;  1ZTU A;  3KYQ A;  1UWP X;  5FL3 A;  2W3E A;  4BBU A;  3OCL A;  4GHI B;  3UE6 A;  4PKY G;  5AVF A;  4Q0I A;  1XFN A;  4EXO A;  1S4R A;  4HH3 A;  2O9C A;  2OWJ A;  2CMN A;  2D01 A;  3R7W A;  3PBT A;  5HD3 A;  2IA2 A;  4DN0 A;  4EQ1 A;  1OTI A;  2INW A;  4KQO A;  3H9W A;  3EEA A;  4UQI M;  3D72 A;  2MJ6 A;  5DF9 A;  1VB6 A;  3KSG A;  2WKP A;  4JGP A;  5KSH A;  4OOM A;  4ARZ A;  3CWF A;  4HNB A;  4EEU A;  3TW8 A;  4G3W A;  3BQ8 A;  2VV7 A;  1BYW A;  2VLG A;  2HGV A;  4R38 A;  4ARZ B;  3KSI A;  1TS8 A;  3EGD C;  3BY8 A;  2EWW A;  4CLC D;  2G7U A;  2J80 A;  2GJ3 A;  4P6Z M;  4IUK A;  3MQO A;  3KX0 X;  5HWW A;  1LL8 A;  1YKD A;  1LSV A;  3LR4 A;  4NEE D;  2P08 A;  3O5Y A;  4FSF A;  2JKT M;  3UE3 A;  1OT6 A;  5J7E A;  1STZ A;  2Y79 A;  3KO6 A;  3MF0 A;  3UB6 A;  4R6L A;  3IBJ A;  3SW1 A;  3MXQ A;  5F68 A;  3GDI A;  3MMH A;  3E4O A;  4EER A;  3UB7 A;  3PBQ A;  2O9A A;  4WLA A;  4YOF A;  2BAS A;  4MDZ A;  5DKK A;  3MR0 A;  1ZHH B;  4NXE A;  3CIT A;  2W3G A;  2GNX A;  1TS0 A;  2VV8 A;  2O9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...