2KOIA

Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form
pubmed doi rcsb
source organism Synechococcus sp.
total genus 34
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2koiA00
3ZQ5A 3RFBA 4Q0HA 4ZRRA 5DFYA 5I5LA 4Y3IA 4Q0IA 4O01A 4ME4A 2XRNA 4R70A 3S7NA 2K31A 3IBJA 4G3KA 4DMZA 4LRZE 1VHMA 2G7UA 4IUHA 1TF1A 4YOFA 2O99A 5HPFA 2B18A 3O5YA 2M7VA 2O0YA 5DFXA 3C2WA 4MDZA 4O0PA 2KLIA 1F5MA 4EUVA 3TRCA 4IUKA 5C5KA 2VEAA 4G3VA 4YNRA 2QYBA 3E0YA 4PAUA 4ETXA 3DBAA 3NHQA 3G6OA 2XROA 3D3OA 3MMHA 4LRXC 3W2ZA 2Y79A 3KSHA 2HGVA 2W3HA 5L8MA 5K5BA 4MMNA 3CITA 2VJWA 4Z1WA 5HL6A 2GX5A 3S7PA 4RQ9A 1YSPA 4R6LA 5AJGA 4G3WA 2VKSA 4CQHA 2W3EA 3E98A 4E04A 3NOUC 2XSSA 4MCWA 2LB5A 3S7QA 2O9BA 1MKMA 1TD5A 3KSGA 4ETZA 1MC0A 4LRYC 3VV4A 2W1TB 2W1TA 3S7OA 4IJGA 2W3FA 3IBRA 2IA2A 3KSFA 2M7UA 3OOVA 1YSQA 5HSQA 4DN0A 1ZTUA 4GLQA 1YKDA 4O8GA 2KOIA 5TJJA 1STZA 2O9CA 3CI6A 3KO6A 3MF0A 3BJNA 2LB9A 2O9AA 2VZWA 2W3GA 4MN7A 3HCYA 3NOTC 4Y5FA 2ZMFA 4Y2FA 4BWIA 5LBRA 3OBFA 2OOLA 3LFVA 3KSIA 2W1RA 2K2NA 3NOPC 4QPRA 2Y8HA 3MQ0A 2W3DA 4EU0A 4Q0JA 5HPIA 3K2NA 3EEAA 4FOFA 4GW9A 3R4KA
chains in the Genus database with same CATH superfamily
1H8ZA 4JBFA 2EX9A 3IF6B 4BL2A 3NCKA 4HOIA 5FQ9A 1OJGA 4GDNA 5FDHA 2XQZA 3S7NA 4LV3A 3SZTA 2A2LA 4A5RA 2YKHA 2PD8A 4QB8A 4LCMA 1GHMA 3DW0A 3W4OA 4S2KA 2Y2NA 1F9IA 3DTKA 1XFQA 3V3SA 3T4QA 5HDCA 2WKHA 4BBTA 3IH9A 3ZNTA 2QWSA 3CWFA 3EOIA 5HL6A 1K57C 3B3XA 3QNBA 4FCFA 5AJGA 2A24A 4KZ4A 3NOUC 3R7WB 4IVKA 1JWVA 5DJTA 2G2UA 1MWRA 3KSGA 4X55A 2WYXA 3CZDA 5I94A 3VP1A 1NRJA 1S0WA 3UB6A 2M7UA 3B47A 1W8YA 3MKEA 4X6TA 2VLGA 2JBFA 2L1MA 4X1MA 2H10A 1PNEA 2WADA 3IXDA 3DWKA 3RXXA 3B33A 4HI4A 5HW3A 3HLBA 4S2OA 1H5XA 3Q07A 2W1RA 1L3LA 1FCOA 3FKWA 2Q9NA 4HBUA 4BBUA 5EVEA 1S1ZA 3G31A 1XJ4A 4FOFA 3IWQA 4JXVA 4WELA 1PW1A 3KYEA 2XA7M 1HLUP 1IYQA 1K0KA 4N9KA 4QJGA 5GLAA 2ACGA 3F1PB 2PYPA 3ITAA 3IBJA 4OOLA 4DMZA 5DF7A 1TF1A 2P08A 1IYOA 4E6XA 3NJAA 5HPFA 1KGFA 1T1CA 5FATA 2IWBA 5EECA 1XA1A 3NHQA 3JYIA 4CLCE 4GD8A 4RX2A 1PYYA 3G2YA 1KVLA 1ZG4A 4S2PA 1K55C 1VM1A 3H9WA 5F68A 4WYYA 3BQAA 1Y54A 3V39A 2ZQ7A 3FZCA 1Q2QA 3QP5A 5EVIA 2HP5A 2XR0A 1WE4A 3AGEA 4GB7A 3PYPA 3A0RA 4JGPA 5EM1A 4KZ6A 2Y4AA 2C6WB 2ZC6B 3E4QA 5FA7A 5M18A 3UNWA 5EOOA 4EESA 2KDKA 2KOIA 1NZOA 3LIFA 3NBLA 1UWPX 3N6IA 1CI9A 3HCYA 2IWDA 5G4ZA 1N9LA 3C5AA 3F1NB 1OTEA 2Y8HA 4HY8A 5BOHA 4OOYA 5HPIA 4LV0A 2PHYA 3VFHA 4HH2A 1LSVA 3D9YA 4E6WA 1BLPA 2Q9MA 3G34A 3IF6A 3AGDA 4O01A 1G28A 4GCZA 3ZVTA 4KUKA 4H6JB 1KGEA 5EVID 2JCHA 3PBOA 4WN5A 4II7A 3PBNA 3T1XA 3VFFA 4M4XA 4OKPA 4I3AA 4WF0A 1LI9A 2FFYA 5IU1A 1YT4A 4RVAA 4HQAA 4NKPA 2ZQ9A 4E3NA 2EFXA 3EQUA 1F2KA 3CMZA 3ZFZA 1SZVA 4WEJA 1PI5A 5CRFA 2VK3A 2INWA 1G68A 3R7WA 4CLCD 5JYPA 2C5WB 5IT5A 5GLDA 3MZDA 4UHUA 4NETA 2QMIA 3BQ8A 4XUZA 4JGRA 1WYBA 3HJKA 4NK3A 1YPRA 1MXOA 3IBRA 1SDEA 4OOMA 5CTMA 4U3TA 4DN0A 4KQRA 1TDGA 2V0UA 4GLQA 4ARZB 1ALQA 3N4IA 1NYMA 3MF0A 3Q7ZA 3ULFA 2V1ZA 4KUOA 1LSXA 4HH3A 3VP3A 5HDDA 4BWIA 5FI2A 3T4JA 2K2NA 2XD5A 3HREA 1T1BA 3CPTB 2L4RA 3W4PA 3ZQ5A 2RCXA 3E2LA 4IBRA 5IHVA 5DFYA 3E4OA 3UN7A 1XGIA 3DTIA 2HPBA 3F1PA 1IYSA 1PWCA 2G7UA 4IUHA 1RCJA 5L07A 2KX6A 2ZQAA 3HLCA 3A0VA 5FDSA 2ZQCA 4D2OA 2ZQDA 3C2WA 1AWIA 1PWDA 2Y2LA 2ZQ8A 3DTEA 3MXRA 3VSKA 4ETXA 3DBAA 1W63Q 3LIDA 1L0EA 3MFDA 4S2MA 3OCNA 5A8BA 1EI5A 3E2KA 1FR1A 5CECA 2J3WA 5K5BA 4WLAA 2Q0OA 1JWPA 3PBRA 2ZL1B 5EE8A 3HLGA 3QP1A 4HJ6A 3GRJA 4RQ9A 1G6AA 1ACFA 1TS0A 4GKUA 4MBFA 1KVMA 1XA7A 3IT9A 2B02A 2GJ3A 4AFIA 2QJ5A 1K57A 3BFDA 3PAGA 4EQ1A 4JXGA 3G32A 4U0XA 2A3UA 3O88A 4PPRA 1SHVA 4KQDA 4JXWA 1PZPA 3BFCA 5F1FA 1DP6A 3FYZA 1OMEA 2E8IA 2HDQA 4EV4A 2VZWA 1Y28A 3Q82A 1F98A 4KZ3A 4I38A 4YFMA 3F1NA 2OLVA 2ZBBA 2WK0A 1W5DA 2PYRA 3TE8A 4BL3A 1S6RA 1NZUA 3LICA 1DP8A 4JF4A 1XGJA 3UY6A 5FASA 2XRNA 4H6JA 4G3KA 3T4TA 4E3OA 2J3TC 3ISGA 5HAPA 1K56A 5E43A 2RL3A 3TOIA 4OPQA 3A3IA 1GSVA 3NIAA 2VEAA 4G3VA 3UB5P 1TS7A 2QJ7A 1YMSA 1VEUB 2W3HA 5L8MA 4QU3A 4MN6A 3GECA 3A3JA 3KYZA 1GHPA 4G3WA 5DVAA 5HAIA 2ZJ9A 5AQ9A 4M3KA 2LB5A 1BLHA 1K55A 2E8JA 5CGSA 5L10A 4O7DA 4CPKA 4OQGA 5FSRA 2EFUA 4C75A 4KG2A 4ARZA 2VGLS 1ESUA 4JXSA 3WS4A 3BRMA 1MWSA 3LR4A 3SH7A 4LV2A 5AQ7A 3HLWA 1K4EA 2YKFA 1Z09A 2Y59A 3MKFA 1M40A 1MKIA 1V9ZA 3CPTA 1FQGA 4HHDA 1L0DA 4PM6A 3UB9A 1XJ3A 5I5LA 2EX8A 4L9EA 4Q8IA 4CLCB 3RH8B 4IBXA 2M7VA 2GNXA 2HJ9C 2XEPA 4O0PA 5DKLA 3UE0A 1DP9A 2D01A 1LSWA 1YLPA 2ZC7A 4HESA 1T1AA 2ZD8A 3WRZA 5A90A 1V9YA 1ONHA 1JWZA 4WZ4A 3NI9A 2ZL1A 4C3QA 3OPPA 1LI0A 2W3EA 3HUOA 3SS3A 4EWFA 1K38A 3W4QA 2O9BA 3RXWA 1DY6A 1OJ5A 2QKPA 4OP5A 3UMDA 4DE2A 5DKKA 2J80A 2IA2A 4S2NC 4OQ0A 3O3VA 4LENA 4X68A 4KG6A 4C6YA 2GDNA 5HSQA 4OQHA 4IVIA 4QD4A 1MWTA 4O8GA 1W79A 5FQJA 1IYPA 4S2IA 4GZBA 3FC7A 2WGIA 2WKQA 5CXWA 2XDMA 2W3DA 4DKIA 1XJ6A 3EEAA 2HJEA 4Y13A 3T4SA 1OPXA 1BZAA 3JPUA 3R4KA 4ZDXA 3ZNYA 2Z6DA 3HUMA 3LY4A 4I5SA 3CJMA 4WUJA 4N92A 3ZG7B 3UB8A 5HD5A 4Y0TA 5EM0A 4E3MA 5HARA 5J8XA 4ZBEA 3PHYA 4R3AA 2Z2MB 4PM9A 2EXBA 3IS2B 3UDXA 1VEUA 3CG5A 2HGVA 1GA0A 2W27A 3WS0A 3M6HA 4X25A 2J9OA 3ZG9B 1YM1A 3VOYA 1N4OA 4EEUA 3H82B 3S7OA 2XFSA 1JTGA 5KMWA 1PIOA 1KE3A 3GDIA 1BTLA 4UQIS 1E3UD 3WRTA 1CEGA 2EWVA 2XF3A 2OLUA 2EXAA 5E2HA 3LEQA 3D72A 2PR6A 1VETB 3K3DA 2OWHA 3CI6A 5DTKA 5AVFA 2WAEA 3HBRA 1FCMA 1BYWA 5D3OA 4DXBA 4UAAA 2ZMFA 1GCEA 3LY3A 4ZJ1A 1GA9A 4R3BA 1OTBA 4EU0A 4KZ7A 4Q0JA 3MZFA 5TR7A 2OSUA 1ERQA 4UEYA 1UGUA 3N8RA 4EQIA 3OC2A 5EFWA 4MNRA 4XXRA 1SCWA 1FIKA 2L0WA 4ME4A 1EROA 4CLCA 3O87A 4UA6A 3ZYTA 1JVJA 1OT6A 2VGLM 2O99A 1RGZA 2O0YA 3LUQA 2KLIA 4MEZA 4IUKA 3OPHA 3G2ZA 5FI7A 5KZHA 5HAQA 4H8RA 3QP2A 1JTDA 3WS5A 3W2ZA 2IWCA 3GVBA 2HDUA 5FQMA 4OLGA 4MMNA 3Q81A 1KDSA 3T1SA 3M2KA 1DJCA 1ODVA 3JVUA 5AQBA 1YSPA 2PBYA 3AGFA 2VKSA 3W8KA 2PDRA 4LRYC 2H28A 1KOUA 2HP6A 1BLSA 2W1TB 2OWJA 4KENB 2JE5A 4IJGA 5TGFA 2ZMAA 3NDEA 3PBTA 1H0MA 4HNBA 2WGVA 5CGWA 2K7SA 5FI6A 1YSQA 5HDSA 3C7VA 1YQSA 4KZ9A 2V0WA 3BECA 5TJJA 3T4LA 4JLFA 3IQAA 4QY5A 1O7EA 2UV0E 4BLMA 2JN7A 3KX0X 4GS9B 5FEGA 5FL3A 4NXFA 2EX6A 3KSIA 2PU2A 3MQ0A 5GHZA 3LO7A 2WKPA 4K0WA 3MXSA 3MQOA 3UMEA 2J3TD 1NLZA 1ZG6A 3MSHA 3S4XA 4P6ZS 3M6BA 4Q0HA 3WWXA 4ZRRA 5EOEA 5EPHA 3MR0A 1ES2A 4WBGA 5HFOA 5J7EA 2FZ0A 2Y2GA 3D4FA 5CEBA 4GOGA 1YLWA 5E2GA 5IS1A 3G4PA 4DJ2A 1OTDA 1I5QA 3GTCA 4WMCD 4KZAA 2DMWA 4PAUA 1CJFA 4I3JA 1PZOA 4PKYA 3IS2A 2ZC4B 2Y79A 4U0TA 1M6KA 3VE3A 5F5YA 1ES3A 2GX5A 2QHKA 4FTXA 2D02A 4DE3A 3S7PA 5EUAA 2ZC5B 2WUQA 3VP2A 3E98A 2XSSA 5FAOA 3TSGA 2PU4A 2XH9A 3H82A 3VOZA 2PT7A 3OPLA 1RP5A 2BLSA 2HDRA 1BLCA 3RTYA 3F1OB 1A0KA 4EW7A 5FEFA 2VV6A 3I7JA 2UWXA 1K4FA 1NYYA 1YKDA 1CEFA 4NEED 1STZA 1VETA 4X53A 3P7NA 2XFTA 3V3RA 3UO9A 4ZJ3A 3LIBA 3GQZA 1UWNX 3H7WB 3K3CA 4X69A 3P98A 3S1YA 2Y2PA 4GHIB 1CF0A 1PW8A 4UQIM 3QP8A 4LGWA 4R70A 3HVFA 5FQKA 1J3WA 1SDNA 4OH0A 4OPRA 1IOUA 5TBMB 3NC8A 1K54C 1N9OA 4BQMA 1DRMA 1XFNA 2EWWA 1NWZA 2XLNA 3C7UA 3WS1A 4N9LA 5HX9A 4QWOA 4R4RA 5DF8A 2J7VA 3MZEA 4CJNA 4KQQA 1XP4A 4K91A 4DE0A 1L2SA 3B42A 4R6LA 4B4ZA 4HP9A 2Z2LB 3BEBA 4D60A 4HJ3A 2Y2MA 1S67L 1TEMA 4HBTA 1TVFA 3HL9A 2W1TA 3UE1A 3VMAA 5G18A 3HLEA 2WZXA 3T4KA 1D1JA 3C4OA 5CX7A 2JKRI 2OAQ1 4YWZA 3HJIA 1RGYA 4FH4A 3ZCZA 2DCFA 2DNSA 5KSCA 1K6RA 1HTZA 3NOTC 4GS9A 4HEFA 2JKRM 4I3IA 4BD0A 1H3QA 3BFEA 3DTMA 5CEDA 3CAXA 3N7WA 3IXHA 2V1AA 4KZ8A 5FQQA 2JC7A 2MJ6A 1OTIA 1L0GA 1OTAA 2HV1A 5HWVA 3Q7VB 3V67A 3VE4A 5CHMA 1XX2A 1SKFA 2PBDP 1JNUA 4NXBA 4Z9QA 5U47A 3CLOA 3ZG5A 1CK3A 4KZ5A 4S2LA 4DXCA 3O86A 5GHYA 2GZAA 3T1QB 4JKTA 1KE0A 4B88A 2CC1A 3MBZA 3PBQA 2VJWA 1IFQA 5L09A 4IHQA 4P6ZM 1XJ2A 1LL5A 2P9VB 4KZBA 5A93A 4LLOB 4F94A 4LPZA 3IHAA 4RA7A 2W3FA 3F1OA 1H8YA 4FH2A 3LR0A 1Q2PA 4MBKA 2ZM2A 1BUEA 2XGNA 3A3EA 3MS6A 4B9OA 4PM8A 3PBSA 3PXPA 5GL9A 4HJ4A 1T18A 2XK1A 1ES5A 4HP4A 2J8YA 3BLSA 1W8QA 1FR6A 1FOFA 4L9GA 4FSFA 2O9AA 1MBLA 2A49A 1P97A 2HDSA 2W3GA 5FAQA 3A3DA 4BBVA 3LIEA 4Y7PA 3H7WA 1TS6A 2WKIA 1PI4A 4QPRA 2Y2KA 5DTSA 1YMXA 2X71A 1KGGA 4EEPA 3M2JA 3L7HA 4GHIA 1J9MA 4GW9A 3MQQA 4RX3A 1CI8A 4JPMA 4B4XA 3RFBA 4DRTA 2BTFP 3SS4A 3TG9A 1LL8A 3OCLA 2P74A 1P9WA 1BT5A 2QPNA 1YLTA 3VP0A 3MJQA 1HVBA 3NDGA 3TW8A 3FV7A 3BW6A 4JGQA 3IXBA 3CUEC 3HUNA 3UE6A 4R1GA 5TBMA 4GNUA 1W7FA 2PD7A 1C3BA 1FSWA 1E3UA 3UB7A 5EV0A 2XROA 2I72A 1L0FA 4EBNA 2W0NA 1WA9A 4ZTKA 3FPVA 3LI8A 1K25A 1N9NA 3IH8A 5FAPA 2H0YA 4CQHA 3P09A 5DTTA 1IKGA 1VB6A 3BLMA 1MC0A 2V2FF 3U2AA 1U60A 5GLCA 3VSLA 3LEZA 1YAXA 3C8CA 4B93A 1ESIA 4OVDA 1ZTUA 2EX2A 1XPBA 2V8FA 2Y2QA 3UPPA 3BWLA 2O9CA 4N1XA 5AVEA 5EVLA 2JKFA 1MY8A 2VGKA 1G5UA 4OPZA 2OOLA 3G30A 2VX8A 4E3KA 2P7JA 3K2NA 3UE3A 2NUPC 2Y2OA 3ZVWA 4DDYA 2G2WA 5F6AA 3ZG0A 3NULA 3PTEA 4JF6A 3ZHHA 4Q0IA 4EETB 2BG1A 4NG2A 4GDBA 1S66L 3Q7VA 3NY4A 4BD1A 1EWZA 1IKIA 4YINA 3P01A 5J4EA 3O5YA 1KDWA 4I39A 4QHCA 1D7EA 5M1AA 4MDZA 4EUVA 3LYXA 5HD3A 5F1GA 2OV5A 4EUZA 4KQOA 3E0YA 2BASA 2ZMVA 1K6SA 2ZOHA 1VQQA 5E2FA 2HF6A 3GMWA 4XT2B 4JGOA 3JVVA 1K54A 3BYDA 2PAVP 3T50A 4Y0UA 2JHEA 3ZDJA 4PM5A 4MCWA 2P9VA 2DRWA 4ETZA 1HZOA 2WGWB 3VV4A 4K08A 3LR5A 3ZGAB 3BY9A 2R9XA 5KIZA 4R4SA 1W63M 1HD8A 2ZC3B 4ID4A 4R3JA 3WS2A 5DF9A 4WZ5C 4WM9A 4WMCA 2Y55A 1LL9A 3IX3A 1I2WA 4Y5FA 1FILA 2J9PA 3G35A 4GN2A 4Y0OA 5LBRA 3GV9A 4KG5A 5GHXA 4PMAA 1PFLA 4FD8A 2HZ5A 2WKRA 3IX8A 1NLYA 3PR6A 4FUWA 4OONA 2WZZA 3BY8A 1ZHHB 4GJ4A 4X56A 3QP4A 4PM7A 4LCLA 1OT9A 3OZHA 1MPLA 4P6BA 4F3LB 4LRZE 4R0QA 4UA9A 2P04A 1N9BA 4EXOA 4E3JA 1AXBA 4EBPA 3FPWA 5KSHA 2H5SA 1P0ZA 4PKYG 5C5KA 1EW0A 4YNRA 4MBHA 3U4LP 3UDFA 3EEHA 2ZLYA 3KSHA 3IWIA 4JF5A 3OPRA 5J3WA 3CITA 1QMFA 1H8MA 3UPOA 2XD1A 5F69A 1QMEA 3L9KA 4E04A 3C4PA 1IEMA 1TD5A 3IHBA 3IF5A 5CTNA 2X01A 2PRFA 2CMNA 3GSGA 3EQVA 3T1RA 3HLDA 4BENA 4P87A 4OQIA 1TS8A 2VA0A 3EWKA 2V9AA 4L9FA 2ZM0A 3S22A 3IWOA 4MN7A 5HWWA 4NXEA 4EERA 1SKOB 4WL9A 5L2FA 4DDSA 2VGJA 3VP4A 1S4SA 3GR2A 3NOPC 5M19A 5HL1A 3KYQA 3BFFA 1GSWA 1CQAA 1ZKJA 5FQIA 3T12B 3MXQA 3UPNA 3V5MA 1BSGA 2EA9A 1DJBA 2R78A 1XKZA 4Y3IA 3LR3A 4S2NA 4LFUA 3UDIA 2WKEA 4HIAA 3IXGA 4EBLA 3E4PA 1LHYA 3EGDC 4YOFA 1NXYA 4E3LA 3A0SA 4UA7A 3FKVA 2B18A 3SH9A 1O07A 3DWZA 1MWUA 1ONGA 1YLJA 4MN5A 5TFQA 2ZOIA 2QYBA 1ES4A 5EVIC 2FFFB 3SS5A 3C30A 1GHIA 3MMHA 5G4YA 3CUEA 4XT2A 4P85A 5CHJA 2R9WA 3LCEA 4BJPA 4Y15A 1XXMA 2A24B 4ZAMA 3LIAA 5F82A 5A92A 1MKMA 1NY0A 4OP8A 1DJAA 2HP9A 3MFXA 2WGWA 5E2EA 3RJUA 1ERMA 2ZM8A 4OPYA 4R38A 2B5RA 4LV1A 2XA7S 3ZG8B 3LGOA 2I9VA 2Y91A 2VV7A 4CLCC 3HLFA 2X02A 3SH8A 3QNCA 2V8CA 3V50A 4ZJ2A 5CERA 1GSXA 2Y2IA 1IELA 3ICYA 2JKGA 4E3IA 5JYOA 2V20A 3N8SA 3PAEA 3IF6C 3FWLA 3LFVA 1E4DA 2PR5A 5AQAA 2Y2JA 1YLZA 1NJ4A 1G6OA 3QP6A 2VV8A 1I2SA 3C38A 4P0MA 4DJ3A 2M1CA 3DAVA 1WYCA 2K31A 5DJUA 4F3LA 5HZHA 1VHMA 1Z6FA 3LI9A 1KE4A 4R23A 2QZ6A 4DE1A 3SW1A 3BM6A 5DFXA 2AVXA 1F5MA 1PRQA 3TRCA 2B95A 3ITBA 3Q1FA 1NRFA 3G6OA 3SOIA 3D3OA 4K0XA 4XUXA 2Z6CA 4LRXC 2JKTI 4GD6A 1YLYA 3VOLA 4PHTA 4Z1WA 3N8LA 5A91A 4BMWA 1PWGA 1P9RA 4IEDA 4N1HA 3QHYA 4Y17A 5EVIB 3BFGA 4NXGA 3S7QA 5MC7A 5GLBA 2OAP1 4OLDA 1FSYA 5CHUA 1T19A 2JKTM 5HWTA 1K56D 3FG8A 1X0OA 4WEKA 5F83A 3CHWP 2Y2HA 3KSFA 3OOVA 3A3FA 2FH5A 4S2JA 3EGXC 1D06A 4L0LA 3TJZC 1LT0A 1FCNA 2WAFA 3OLOA 1BULA 4MLLA 1TDLA 3KO6A 3BJNA 2LB9A 1ZC2A 5CGXA 1SKOA 4DF6A 1LLBA 1E25A 4Y2FA 1Y4OA 2V1BA 3OBFA 4QY6A 4ESPA 2NUTC 1S4RA 3T4OA 1S1YA 4X1LA 3IX4A 2H0TA 4WZ5A 4RYEA 1MZUA 3NECA
chains in the Genus database with same CATH topology
2J3TD 1NLZA 4P6ZS 4Q0HA 4ZRRA 4HOIA 3MR0A 1OJGA 4Q0IA 5J7EA 2FZ0A 2XRNA 4EETB 3S7NA 2A2LA 4H6JA 1S66L 4G3KA 2YKHA 2PD8A 3T4TA 2J3TC 5IS1A 3P01A 5J4EA 3O5YA 4DJ2A 4I39A 1OTDA 1D7EA 4MDZA 4EUVA 3LYXA 1GSVA 1F9IA 2DMWA 5HD3A 1XFQA 2VEAA 4G3VA 4KQOA 3E0YA 2BASA 2ZMVA 2ZOHA 1TS7A 4PAUA 4I3JA 2QJ7A 4PKYA 3IS2A 3T4QA 5HDCA 2Y79A 4BBTA 2HF6A 2W3HA 4XT2B 4JGOA 2QWSA 3JVVA 5L8MA 3VE3A 3CWFA 3EOIA 5HL6A 4MN6A 5F5YA 3GECA 2GX5A 2QHKA 3KYZA 2D02A 3T50A 3S7PA 5AJGA 2A24A 4G3WA 2JHEA 3E98A 3NOUC 3R7WB 2XSSA 4MCWA 5DJTA 2LB5A 3KSGA 4ETZA 3VV4A 4K08A 3H82A 2PT7A 3LR5A 3BY9A 3RTYA 3F1OB 4EW7A 1NRJA 5KIZA 3UB6A 2M7UA 2VV6A 1W63M 3B47A 1YKDA 4ARZA 5DF9A 2VGLS 4NEED 2VLGA 1STZA 2L1MA 3P7NA 3B33A 3LR4A 4HI4A 3LIBA 4Y5FA 1UWNX 3H7WB 5LBRA 3K3CA 2YKFA 2W1RA 1V9ZA 4BBUA 4HHDA 4GHIB 1S1ZA 2WKRA 1XJ4A 4FOFA 4WELA 1NLYA 3PR6A 2XA7M 3BY8A 1ZHHB 4GJ4A 3UB9A 1XJ3A 5I5LA 4L9EA 4UQIM 1OT9A 4CLCB 3RH8B 3F1PB 4R70A 2PYPA 4F3LB 3IBJA 4OOLA 4DMZA 4LRZE 1TF1A 2P08A 2P04A 1IOUA 5TBMB 4EXOA 3NJAA 5HPFA 1T1CA 3UMEA 2M7VA 1N9OA 2GNXA 2HJ9C 3FPWA 5KSHA 4O0PA 5DKLA 1DRMA 1P0ZA 4PKYG 1DP9A 1XFNA 2EWWA 5C5KA 1EW0A 2D01A 1NWZA 4YNRA 3NHQA 3EEHA 1LSWA 1T1AA 4CLCE 3KSHA 1V9YA 5J3WA 3CITA 1H8MA 3H9WA 5F68A 3BQAA 3B42A 4R6LA 4HP9A 5F69A 2W3EA 4E04A 4HJ3A 2O9BA 1TD5A 1OJ5A 1S67L 3PYPA 2QKPA 2W1TA 3A0RA 4JGPA 3UMDA 5DKKA 2J80A 3T4KA 2IA2A 2CMNA 3EQVA 5CX7A 2JKRI 2OAQ1 4YWZA 3E4QA 3HJIA 5HSQA 1TS8A 4EESA 2KDKA 4O8GA 2KOIA 2VA0A 3EWKA 2V9AA 4L9FA 3LIFA 1UWPX 3FC7A 2WKQA 4MN7A 5HWWA 3HCYA 4NXEA 4EERA 5G4ZA 3NOTC 4GS9A 1N9LA 4WL9A 3F1NB 1S4SA 1OTEA 2JKRM 4I3IA 3NOPC 1H3QA 2Y8HA 2W3DA 4HY8A 3CAXA 3KYQA 5HPIA 1XJ6A 2PHYA 1GSWA 2V1AA 3EEAA 2HJEA 4HH2A 3T4SA 1LSVA 1OPXA 3R4KA 3MXQA 2Z6DA 2EA9A 4I5SA 2R78A 2MJ6A 4Y3IA 1OTIA 3LR3A 1G28A 4GCZA 4O01A 1OTAA 2HV1A 4WUJA 5HWVA 4KUKA 4HIAA 4H6JB 3V67A 3VE4A 3E4PA 3EGDC 3PBOA 4WN5A 4YOFA 3UB8A 4II7A 3PBNA 5HD5A 4M4XA 1JNUA 3A0SA 2B18A 4I3AA 4NXBA 4WF0A 3PHYA 3CLOA 5IU1A 4MN5A 4R3AA 2ZOIA 2QYBA 3C30A 3IS2B 4HQAA 2GZAA 3MMHA 4NKPA 3EQUA 5G4YA 2HGVA 3CUEA 2W27A 4WEJA 4XT2A 3PBQA 2VJWA 1IFQA 4BJPA 2INWA 4IHQA 2A24B 4P6ZM 3LIAA 1XJ2A 3R7WA 4CLCD 5IT5A 1MKMA 4LLOB 3MFXA 4EEUA 3BQ8A 4LPZA 3H82B 3S7OA 4JGRA 3HJKA 4R38A 2W3FA 3F1OA 3IBRA 2XA7S 2I9VA 3GDIA 2VV7A 4OOMA 4CLCC 3LR0A 4UQIS 4B9OA 4DN0A 2EWVA 3PBSA 2V0UA 3PXPA 4GLQA 4HJ4A 4ARZB 1T18A 3D72A 1GSXA 2PR6A 3ICYA 3K3DA 4HP4A 2OWHA 3CI6A 3MF0A 5AVFA 4L9GA 4FSFA 3ULFA 2O9AA 1P97A 2W3GA 4BBVA 1BYWA 3LIEA 2ZMFA 4KUOA 1LSXA 4HH3A 3H7WA 5HDDA 4BWIA 3LFVA 1TS6A 3T4JA 2K2NA 4QPRA 1T1BA 1OTBA 4EU0A 4Q0JA 2L4RA 2PR5A 4UEYA 1UGUA 4EEPA 4GHIA 3OC2A 5EFWA 4GW9A 3MQQA 1G6OA 3ZQ5A 3RFBA 2VV8A 3C38A 5DFYA 2L0WA 1LL8A 3E4OA 3OCLA 4DJ3A 1P9WA 2M1CA 4ME4A 4CLCA 3F1PA 2K31A 3MJQA 5DJUA 3ZYTA 4F3LA 5HZHA 3TW8A 3BW6A 1VHMA 2G7UA 4IUHA 1OT6A 4JGQA 3CUEC 2VGLM 3LI9A 3UE6A 2KX6A 5TBMA 2O99A 3A0VA 3SW1A 2O0YA 5DFXA 3C2WA 3LUQA 2PD7A 2KLIA 1F5MA 3TRCA 4IUKA 4ETXA 3UB7A 3DBAA 3G6OA 2XROA 3D3OA 1W63Q 3LIDA 2Z6CA 4LRXC 2JKTI 3W2ZA 3OCNA 5A8BA 2J3WA 3VOLA 2W0NA 5K5BA 4MMNA 4WLAA 4PHTA 4Z1WA 1WA9A 3PBRA 4BMWA 3FPVA 3LI8A 1ODVA 3JVUA 1P9RA 1N9NA 4HJ6A 1YSPA 4RQ9A 1TS0A 2VKSA 4CQHA 1VB6A 2PDRA 4NXGA 3S7QA 5MC7A 1MC0A 2OAP1 4LRYC 3U2AA 2H28A 1KOUA 2W1TB 2OWJA 4IJGA 2B02A 2GJ3A 4AFIA 1T19A 2QJ5A 2JKTM 5HWTA 3PBTA 4EQ1A 3FG8A 4HNBA 1X0OA 4WEKA 1YAXA 3C8CA 3KSFA 2K7SA 3OOVA 5HDSA 1YSQA 4KQDA 4B93A 2FH5A 3EGXC 1ZTUA 1D06A 4L0LA 3TJZC 1LT0A 2V0WA 3OLOA 5TJJA 3T4LA 3BWLA 1DP6A 2O9CA 3KO6A 5AVEA 3BJNA 2LB9A 2VZWA 1Y28A 1F98A 2JN7A 3KX0X 4GS9B 4I38A 5FL3A 3F1NA 4NXFA 4Y2FA 2V1BA 2ZBBA 3OBFA 2OOLA 3KSIA 2NUTC 3MQ0A 1S4RA 2VX8A 3T4OA 1S1YA 2P7JA 3K2NA 2PYRA 2WKPA 3TE8A 3UE3A 2NUPC 1MZUA 3MQOA 3LICA 1DP8A 5F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  3RFB A;  4Q0H A;  4ZRR A;  5DFY A;  5I5L A;  4Y3I A;  4Q0I A;  4O01 A;  4ME4 A;  2XRN A;  4R70 A;  3S7N A;  2K31 A;  3IBJ A;  4G3K A;  4DMZ A;  4LRZ E;  1VHM A;  2G7U A;  4IUH A;  1TF1 A;  4YOF A;  2O99 A;  5HPF A;  2B18 A;  3O5Y A;  2M7V A;  2O0Y A;  5DFX A;  3C2W A;  4MDZ A;  4O0P A;  2KLI A;  1F5M A;  4EUV A;  3TRC A;  4IUK A;  5C5K A;  2VEA A;  4G3V A;  4YNR A;  2QYB A;  3E0Y A;  4PAU A;  4ETX A;  3DBA A;  3NHQ A;  3G6O A;  2XRO A;  3D3O A;  3MMH A;  4LRX C;  3W2Z A;  2Y79 A;  3KSH A;  2HGV A;  2W3H A;  5L8M A;  5K5B A;  4MMN A;  3CIT A;  2VJW A;  4Z1W A;  5HL6 A;  2GX5 A;  3S7P A;  4RQ9 A;  1YSP A;  4R6L A;  5AJG A;  4G3W A;  2VKS A;  4CQH A;  2W3E A;  3E98 A;  4E04 A;  3NOU C;  2XSS A;  4MCW A;  2LB5 A;  3S7Q A;  2O9B A;  1MKM A;  1TD5 A;  3KSG A;  4ETZ A;  1MC0 A;  4LRY C;  3VV4 A;  2W1T B;  2W1T A;  3S7O A;  4IJG A;  2W3F A;  3IBR A;  2IA2 A;  3KSF A;  2M7U A;  3OOV A;  1YSQ A;  5HSQ A;  4DN0 A;  1ZTU A;  4GLQ A;  1YKD A;  4O8G A;  2KOI A;  5TJJ A;  1STZ A;  2O9C A;  3CI6 A;  3KO6 A;  3MF0 A;  3BJN A;  2LB9 A;  2O9A A;  2VZW A;  2W3G A;  4MN7 A;  3HCY A;  3NOT C;  4Y5F A;  2ZMF A;  4Y2F A;  4BWI A;  5LBR A;  3OBF A;  2OOL A;  3LFV A;  3KSI A;  2W1R A;  2K2N A;  3NOP C;  4QPR A;  2Y8H A;  3MQ0 A;  2W3D A;  4EU0 A;  4Q0J A;  5HPI A;  3K2N A;  3EEA A;  4FOF A;  4GW9 A;  3R4K A; 
#chains in the Genus database with same CATH topology
 1H8Z A;  4JBF A;  2EX9 A;  3IF6 B;  4BL2 A;  3NCK A;  4HOI A;  5FQ9 A;  1OJG A;  4GDN A;  5FDH A;  2XQZ A;  3S7N A;  4LV3 A;  3SZT A;  2A2L A;  4A5R A;  2YKH A;  2PD8 A;  4QB8 A;  4LCM A;  1GHM A;  3DW0 A;  3W4O A;  4S2K A;  2Y2N A;  1F9I A;  3DTK A;  1XFQ A;  3V3S A;  3T4Q A;  5HDC A;  2WKH A;  4BBT A;  3IH9 A;  3ZNT A;  2QWS A;  3CWF A;  3EOI A;  5HL6 A;  1K57 C;  3B3X A;  3QNB A;  4FCF A;  5AJG A;  2A24 A;  4KZ4 A;  3NOU C;  3R7W B;  4IVK A;  1JWV A;  5DJT A;  2G2U A;  1MWR A;  3KSG A;  4X55 A;  2WYX A;  3CZD A;  5I94 A;  3VP1 A;  1NRJ A;  1S0W A;  3UB6 A;  2M7U A;  3B47 A;  1W8Y A;  3MKE A;  4X6T A;  2VLG A;  2JBF A;  2L1M A;  4X1M A;  2H10 A;  1PNE A;  2WAD A;  3IXD A;  3DWK A;  3RXX A;  3B33 A;  4HI4 A;  5HW3 A;  3HLB A;  4S2O A;  1H5X A;  3Q07 A;  2W1R A;  1L3L A;  1FCO A;  3FKW A;  2Q9N A;  4HBU A;  4BBU A;  5EVE A;  1S1Z A;  3G31 A;  1XJ4 A;  4FOF A;  3IWQ A;  4JXV A;  4WEL A;  1PW1 A;  3KYE A;  2XA7 M;  1HLU P;  1IYQ A;  1K0K A;  4N9K A;  4QJG A;  5GLA A;  2ACG A;  3F1P B;  2PYP A;  3ITA A;  3IBJ A;  4OOL A;  4DMZ A;  5DF7 A;  1TF1 A;  2P08 A;  1IYO A;  4E6X A;  3NJA A;  5HPF A;  1KGF A;  1T1C A;  5FAT A;  2IWB A;  5EEC A;  1XA1 A;  3NHQ A;  3JYI A;  4CLC E;  4GD8 A;  4RX2 A;  1PYY A;  3G2Y A;  1KVL A;  1ZG4 A;  4S2P A;  1K55 C;  1VM1 A;  3H9W A;  5F68 A;  4WYY A;  3BQA A;  1Y54 A;  3V39 A;  2ZQ7 A;  3FZC A;  1Q2Q A;  3QP5 A;  5EVI A;  2HP5 A;  2XR0 A;  1WE4 A;  3AGE A;  4GB7 A;  3PYP A;  3A0R A;  4JGP A;  5EM1 A;  4KZ6 A;  2Y4A A;  2C6W B;  2ZC6 B;  3E4Q A;  5FA7 A;  5M18 A;  3UNW A;  5EOO A;  4EES A;  2KDK A;  2KOI A;  1NZO A;  3LIF A;  3NBL A;  1UWP X;  3N6I A;  1CI9 A;  3HCY A;  2IWD A;  5G4Z A;  1N9L A;  3C5A A;  3F1N B;  1OTE A;  2Y8H A;  4HY8 A;  5BOH A;  4OOY A;  5HPI A;  4LV0 A;  2PHY A;  3VFH A;  4HH2 A;  1LSV A;  3D9Y A;  4E6W A;  1BLP A;  2Q9M A;  3G34 A;  3IF6 A;  3AGD A;  4O01 A;  1G28 A;  4GCZ A;  3ZVT A;  4KUK A;  4H6J B;  1KGE A;  5EVI D;  2JCH A;  3PBO A;  4WN5 A;  4II7 A;  3PBN A;  3T1X A;  3VFF A;  4M4X A;  4OKP A;  4I3A A;  4WF0 A;  1LI9 A;  2FFY A;  5IU1 A;  1YT4 A;  4RVA A;  4HQA A;  4NKP A;  2ZQ9 A;  4E3N A;  2EFX A;  3EQU A;  1F2K A;  3CMZ A;  3ZFZ A;  1SZV A;  4WEJ A;  1PI5 A;  5CRF A;  2VK3 A;  2INW A;  1G68 A;  3R7W A;  4CLC D;  5JYP A;  2C5W B;  5IT5 A;  5GLD A;  3MZD A;  4UHU A;  4NET A;  2QMI A;  3BQ8 A;  4XUZ A;  4JGR A;  1WYB A;  3HJK A;  4NK3 A;  1YPR A;  1MXO A;  3IBR A;  1SDE A;  4OOM A;  5CTM A;  4U3T A;  4DN0 A;  4KQR A;  1TDG A;  2V0U A;  4GLQ A;  4ARZ B;  1ALQ A;  3N4I A;  1NYM A;  3MF0 A;  3Q7Z A;  3ULF A;  2V1Z A;  4KUO A;  1LSX A;  4HH3 A;  3VP3 A;  5HDD A;  4BWI A;  5FI2 A;  3T4J A;  2K2N A;  2XD5 A;  3HRE A;  1T1B A;  3CPT B;  2L4R A;  3W4P A;  3ZQ5 A;  2RCX A;  3E2L A;  4IBR A;  5IHV A;  5DFY A;  3E4O A;  3UN7 A;  1XGI A;  3DTI A;  2HPB A;  3F1P A;  1IYS A;  1PWC A;  2G7U A;  4IUH A;  1RCJ A;  5L07 A;  2KX6 A;  2ZQA A;  3HLC A;  3A0V A;  5FDS A;  2ZQC A;  4D2O A;  2ZQD A;  3C2W A;  1AWI A;  1PWD A;  2Y2L A;  2ZQ8 A;  3DTE A;  3MXR A;  3VSK A;  4ETX A;  3DBA A;  1W63 Q;  3LID A;  1L0E A;  3MFD A;  4S2M A;  3OCN A;  5A8B A;  1EI5 A;  3E2K A;  1FR1 A;  5CEC A;  2J3W A;  5K5B A;  4WLA A;  2Q0O A;  1JWP A;  3PBR A;  2ZL1 B;  5EE8 A;  3HLG A;  3QP1 A;  4HJ6 A;  3GRJ A;  4RQ9 A;  1G6A A;  1ACF A;  1TS0 A;  4GKU A;  4MBF A;  1KVM A;  1XA7 A;  3IT9 A;  2B02 A;  2GJ3 A;  4AFI A;  2QJ5 A;  1K57 A;  3BFD A;  3PAG A;  4EQ1 A;  4JXG A;  3G32 A;  4U0X A;  2A3U A;  3O88 A;  4PPR A;  1SHV A;  4KQD A;  4JXW A;  1PZP A;  3BFC A;  5F1F A;  1DP6 A;  3FYZ A;  1OME A;  2E8I A;  2HDQ A;  4EV4 A;  2VZW A;  1Y28 A;  3Q82 A;  1F98 A;  4KZ3 A;  4I38 A;  4YFM A;  3F1N A;  2OLV A;  2ZBB A;  2WK0 A;  1W5D A;  2PYR A;  3TE8 A;  4BL3 A;  1S6R A;  1NZU A;  3LIC A;  1DP8 A;  4JF4 A;  1XGJ A;  3UY6 A;  5FAS A;  2XRN A;  4H6J A;  4G3K A;  3T4T A;  4E3O A;  2J3T C;  3ISG A;  5HAP A;  1K56 A;  5E43 A;  2RL3 A;  3TOI A;  4OPQ A;  3A3I A;  1GSV A;  3NIA A;  2VEA A;  4G3V A;  3UB5 P;  1TS7 A;  2QJ7 A;  1YMS A;  1VEU B;  2W3H A;  5L8M A;  4QU3 A;  4MN6 A;  3GEC A;  3A3J A;  3KYZ A;  1GHP A;  4G3W A;  5DVA A;  5HAI A;  2ZJ9 A;  5AQ9 A;  4M3K A;  2LB5 A;  1BLH A;  1K55 A;  2E8J A;  5CGS A;  5L10 A;  4O7D A;  4CPK A;  4OQG A;  5FSR A;  2EFU A;  4C75 A;  4KG2 A;  4ARZ A;  2VGL S;  1ESU A;  4JXS A;  3WS4 A;  3BRM A;  1MWS A;  3LR4 A;  3SH7 A;  4LV2 A;  5AQ7 A;  3HLW A;  1K4E A;  2YKF A;  1Z09 A;  2Y59 A;  3MKF A;  1M40 A;  1MKI A;  1V9Z A;  3CPT A;  1FQG A;  4HHD A;  1L0D A;  4PM6 A;  3UB9 A;  1XJ3 A;  5I5L A;  2EX8 A;  4L9E A;  4Q8I A;  4CLC B;  3RH8 B;  4IBX A;  2M7V A;  2GNX A;  2HJ9 C;  2XEP A;  4O0P A;  5DKL A;  3UE0 A;  1DP9 A;  2D01 A;  1LSW A;  1YLP A;  2ZC7 A;  4HES A;  1T1A A;  2ZD8 A;  3WRZ A;  5A90 A;  1V9Y A;  1ONH A;  1JWZ A;  4WZ4 A;  3NI9 A;  2ZL1 A;  4C3Q A;  3OPP A;  1LI0 A;  2W3E A;  3HUO A;  3SS3 A;  4EWF A;  1K38 A;  3W4Q A;  2O9B A;  3RXW A;  1DY6 A;  1OJ5 A;  2QKP A;  4OP5 A;  3UMD A;  4DE2 A;  5DKK A;  2J80 A;  2IA2 A;  4S2N C;  4OQ0 A;  3O3V A;  4LEN A;  4X68 A;  4KG6 A;  4C6Y A;  2GDN A;  5HSQ A;  4OQH A;  4IVI A;  4QD4 A;  1MWT A;  4O8G A;  1W79 A;  5FQJ A;  1IYP A;  4S2I A;  4GZB A;  3FC7 A;  2WGI A;  2WKQ A;  5CXW A;  2XDM A;  2W3D A;  4DKI A;  1XJ6 A;  3EEA A;  2HJE A;  4Y13 A;  3T4S A;  1OPX A;  1BZA A;  3JPU A;  3R4K A;  4ZDX A;  3ZNY A;  2Z6D A;  3HUM A;  3LY4 A;  4I5S A;  3CJM A;  4WUJ A;  4N92 A;  3ZG7 B;  3UB8 A;  5HD5 A;  4Y0T A;  5EM0 A;  4E3M A;  5HAR A;  5J8X A;  4ZBE A;  3PHY A;  4R3A A;  2Z2M B;  4PM9 A;  2EXB A;  3IS2 B;  3UDX A;  1VEU A;  3CG5 A;  2HGV A;  1GA0 A;  2W27 A;  3WS0 A;  3M6H A;  4X25 A;  2J9O A;  3ZG9 B;  1YM1 A;  3VOY A;  1N4O A;  4EEU A;  3H82 B;  3S7O A;  2XFS A;  1JTG A;  5KMW A;  1PIO A;  1KE3 A;  3GDI A;  1BTL A;  4UQI S;  1E3U D;  3WRT A;  1CEG A;  2EWV A;  2XF3 A;  2OLU A;  2EXA A;  5E2H A;  3LEQ A;  3D72 A;  2PR6 A;  1VET B;  3K3D A;  2OWH A;  3CI6 A;  5DTK A;  5AVF A;  2WAE A;  3HBR A;  1FCM A;  1BYW A;  5D3O A;  4DXB A;  4UAA A;  2ZMF A;  1GCE A;  3LY3 A;  4ZJ1 A;  1GA9 A;  4R3B A;  1OTB A;  4EU0 A;  4KZ7 A;  4Q0J A;  3MZF A;  5TR7 A;  2OSU A;  1ERQ A;  4UEY A;  1UGU A;  3N8R A;  4EQI A;  3OC2 A;  5EFW A;  4MNR A;  4XXR A;  1SCW A;  1FIK A;  2L0W A;  4ME4 A;  1ERO A;  4CLC A;  3O87 A;  4UA6 A;  3ZYT A;  1JVJ A;  1OT6 A;  2VGL M;  2O99 A;  1RGZ A;  2O0Y A;  3LUQ A;  2KLI A;  4MEZ A;  4IUK A;  3OPH A;  3G2Z A;  5FI7 A;  5KZH A;  5HAQ A;  4H8R A;  3QP2 A;  1JTD A;  3WS5 A;  3W2Z A;  2IWC A;  3GVB A;  2HDU A;  5FQM A;  4OLG A;  4MMN A;  3Q81 A;  1KDS A;  3T1S A;  3M2K A;  1DJC A;  1ODV A;  3JVU A;  5AQB A;  1YSP A;  2PBY A;  3AGF A;  2VKS A;  3W8K A;  2PDR A;  4LRY C;  2H28 A;  1KOU A;  2HP6 A;  1BLS A;  2W1T B;  2OWJ A;  4KEN B;  2JE5 A;  4IJG A;  5TGF A;  2ZMA A;  3NDE A;  3PBT A;  1H0M A;  4HNB A;  2WGV A;  5CGW A;  2K7S A;  5FI6 A;  1YSQ A;  5HDS A;  3C7V A;  1YQS A;  4KZ9 A;  2V0W A;  3BEC A;  5TJJ A;  3T4L A;  4JLF A;  3IQA A;  4QY5 A;  1O7E A;  2UV0 E;  4BLM A;  2JN7 A;  3KX0 X;  4GS9 B;  5FEG A;  5FL3 A;  4NXF A;  2EX6 A;  3KSI A;  2PU2 A;  3MQ0 A;  5GHZ A;  3LO7 A;  2WKP A;  4K0W A;  3MXS A;  3MQO A;  3UME A;  2J3T D;  1NLZ A;  1ZG6 A;  3MSH A;  3S4X A;  4P6Z S;  3M6B A;  4Q0H A;  3WWX A;  4ZRR A;  5EOE A;  5EPH A;  3MR0 A;  1ES2 A;  4WBG A;  5HFO A;  5J7E A;  2FZ0 A;  2Y2G A;  3D4F A;  5CEB A;  4GOG A;  1YLW A;  5E2G A;  5IS1 A;  3G4P A;  4DJ2 A;  1OTD A;  1I5Q A;  3GTC A;  4WMC D;  4KZA A;  2DMW A;  4PAU A;  1CJF A;  4I3J A;  1PZO A;  4PKY A;  3IS2 A;  2ZC4 B;  2Y79 A;  4U0T A;  1M6K A;  3VE3 A;  5F5Y A;  1ES3 A;  2GX5 A;  2QHK A;  4FTX A;  2D02 A;  4DE3 A;  3S7P A;  5EUA A;  2ZC5 B;  2WUQ A;  3VP2 A;  3E98 A;  2XSS A;  5FAO A;  3TSG A;  2PU4 A;  2XH9 A;  3H82 A;  3VOZ A;  2PT7 A;  3OPL A;  1RP5 A;  2BLS A;  2HDR A;  1BLC A;  3RTY A;  3F1O B;  1A0K A;  4EW7 A;  5FEF A;  2VV6 A;  3I7J A;  2UWX A;  1K4F A;  1NYY A;  1YKD A;  1CEF A;  4NEE D;  1STZ A;  1VET A;  4X53 A;  3P7N A;  2XFT A;  3V3R A;  3UO9 A;  4ZJ3 A;  3LIB A;  3GQZ A;  1UWN X;  3H7W B;  3K3C A;  4X69 A;  3P98 A;  3S1Y A;  2Y2P A;  4GHI B;  1CF0 A;  1PW8 A;  4UQI M;  3QP8 A;  4LGW A;  4R70 A;  3HVF A;  5FQK A;  1J3W A;  1SDN A;  4OH0 A;  4OPR A;  1IOU A;  5TBM B;  3NC8 A;  1K54 C;  1N9O A;  4BQM A;  1DRM A;  1XFN A;  2EWW A;  1NWZ A;  2XLN A;  3C7U A;  3WS1 A;  4N9L A;  5HX9 A;  4QWO A;  4R4R A;  5DF8 A;  2J7V A;  3MZE A;  4CJN A;  4KQQ A;  1XP4 A;  4K91 A;  4DE0 A;  1L2S A;  3B42 A;  4R6L A;  4B4Z A;  4HP9 A;  2Z2L B;  3BEB A;  4D60 A;  4HJ3 A;  2Y2M A;  1S67 L;  1TEM A;  4HBT A;  1TVF A;  3HL9 A;  2W1T A;  3UE1 A;  3VMA A;  5G18 A;  3HLE A;  2WZX A;  3T4K A;  1D1J A;  3C4O A;  5CX7 A;  2JKR I;  2OAQ 1;  4YWZ A;  3HJI A;  1RGY A;  4FH4 A;  3ZCZ A;  2DCF A;  2DNS A;  5KSC A;  1K6R A;  1HTZ A;  3NOT C;  4GS9 A;  4HEF A;  2JKR M;  4I3I A;  4BD0 A;  1H3Q A;  3BFE A;  3DTM A;  5CED A;  3CAX A;  3N7W A;  3IXH A;  2V1A A;  4KZ8 A;  5FQQ A;  2JC7 A;  2MJ6 A;  1OTI A;  1L0G A;  1OTA A;  2HV1 A;  5HWV A;  3Q7V B;  3V67 A;  3VE4 A;  5CHM A;  1XX2 A;  1SKF A;  2PBD P;  1JNU A;  4NXB A;  4Z9Q A;  5U47 A;  3CLO A;  3ZG5 A;  1CK3 A;  4KZ5 A;  4S2L A;  4DXC A;  3O86 A;  5GHY A;  2GZA A;  3T1Q B;  4JKT A;  1KE0 A;  4B88 A;  2CC1 A;  3MBZ A;  3PBQ A;  2VJW A;  1IFQ A;  5L09 A;  4IHQ A;  4P6Z M;  1XJ2 A;  1LL5 A;  2P9V B;  4KZB A;  5A93 A;  4LLO B;  4F94 A;  4LPZ A;  3IHA A;  4RA7 A;  2W3F A;  3F1O A;  1H8Y A;  4FH2 A;  3LR0 A;  1Q2P A;  4MBK A;  2ZM2 A;  1BUE A;  2XGN A;  3A3E A;  3MS6 A;  4B9O A;  4PM8 A;  3PBS A;  3PXP A;  5GL9 A;  4HJ4 A;  1T18 A;  2XK1 A;  1ES5 A;  4HP4 A;  2J8Y A;  3BLS A;  1W8Q A;  1FR6 A;  1FOF A;  4L9G A;  4FSF A;  2O9A A;  1MBL A;  2A49 A;  1P97 A;  2HDS A;  2W3G A;  5FAQ A;  3A3D A;  4BBV A;  3LIE A;  4Y7P A;  3H7W A;  1TS6 A;  2WKI A;  1PI4 A;  4QPR A;  2Y2K A;  5DTS A;  1YMX A;  2X71 A;  1KGG A;  4EEP A;  3M2J A;  3L7H A;  4GHI A;  1J9M A;  4GW9 A;  3MQQ A;  4RX3 A;  1CI8 A;  4JPM A;  4B4X A;  3RFB A;  4DRT A;  2BTF P;  3SS4 A;  3TG9 A;  1LL8 A;  3OCL A;  2P74 A;  1P9W A;  1BT5 A;  2QPN A;  1YLT A;  3VP0 A;  3MJQ A;  1HVB A;  3NDG A;  3TW8 A;  3FV7 A;  3BW6 A;  4JGQ A;  3IXB A;  3CUE C;  3HUN A;  3UE6 A;  4R1G A;  5TBM A;  4GNU A;  1W7F A;  2PD7 A;  1C3B A;  1FSW A;  1E3U A;  3UB7 A;  5EV0 A;  2XRO A;  2I72 A;  1L0F A;  4EBN A;  2W0N A;  1WA9 A;  4ZTK A;  3FPV A;  3LI8 A;  1K25 A;  1N9N A;  3IH8 A;  5FAP A;  2H0Y A;  4CQH A;  3P09 A;  5DTT A;  1IKG A;  1VB6 A;  3BLM A;  1MC0 A;  2V2F F;  3U2A A;  1U60 A;  5GLC A;  3VSL A;  3LEZ A;  1YAX A;  3C8C A;  4B93 A;  1ESI A;  4OVD A;  1ZTU A;  2EX2 A;  1XPB A;  2V8F A;  2Y2Q A;  3UPP A;  3BWL A;  2O9C A;  4N1X A;  5AVE A;  5EVL A;  2JKF A;  1MY8 A;  2VGK A;  1G5U A;  4OPZ A;  2OOL A;  3G30 A;  2VX8 A;  4E3K A;  2P7J A;  3K2N A;  3UE3 A;  2NUP C;  2Y2O A;  3ZVW A;  4DDY A;  2G2W A;  5F6A A;  3ZG0 A;  3NUL A;  3PTE A;  4JF6 A;  3ZHH A;  4Q0I A;  4EET B;  2BG1 A;  4NG2 A;  4GDB A;  1S66 L;  3Q7V A;  3NY4 A;  4BD1 A;  1EWZ A;  1IKI A;  4YIN A;  3P01 A;  5J4E A;  3O5Y A;  1KDW A;  4I39 A;  4QHC A;  1D7E A;  5M1A A;  4MDZ A;  4EUV A;  3LYX A;  5HD3 A;  5F1G A;  2OV5 A;  4EUZ A;  4KQO A;  3E0Y A;  2BAS A;  2ZMV A;  1K6S A;  2ZOH A;  1VQQ A;  5E2F A;  2HF6 A;  3GMW A;  4XT2 B;  4JGO A;  3JVV A;  1K54 A;  3BYD A;  2PAV P;  3T50 A;  4Y0U A;  2JHE A;  3ZDJ A;  4PM5 A;  4MCW A;  2P9V A;  2DRW A;  4ETZ A;  1HZO A;  2WGW B;  3VV4 A;  4K08 A;  3LR5 A;  3ZGA B;  3BY9 A;  2R9X A;  5KIZ A;  4R4S A;  1W63 M;  1HD8 A;  2ZC3 B;  4ID4 A;  4R3J A;  3WS2 A;  5DF9 A;  4WZ5 C;  4WM9 A;  4WMC A;  2Y55 A;  1LL9 A;  3IX3 A;  1I2W A;  4Y5F A;  1FIL A;  2J9P A;  3G35 A;  4GN2 A;  4Y0O A;  5LBR A;  3GV9 A;  4KG5 A;  5GHX A;  4PMA A;  1PFL A;  4FD8 A;  2HZ5 A;  2WKR A;  3IX8 A;  1NLY A;  3PR6 A;  4FUW A;  4OON A;  2WZZ A;  3BY8 A;  1ZHH B;  4GJ4 A;  4X56 A;  3QP4 A;  4PM7 A;  4LCL A;  1OT9 A;  3OZH A;  1MPL A;  4P6B A;  4F3L B;  4LRZ E;  4R0Q A;  4UA9 A;  2P04 A;  1N9B A;  4EXO A;  4E3J A;  1AXB A;  4EBP A;  3FPW A;  5KSH A;  2H5S A;  1P0Z A;  4PKY G;  5C5K A;  1EW0 A;  4YNR A;  4MBH A;  3U4L P;  3UDF A;  3EEH A;  2ZLY A;  3KSH A;  3IWI A;  4JF5 A;  3OPR A;  5J3W A;  3CIT A;  1QMF A;  1H8M A;  3UPO A;  2XD1 A;  5F69 A;  1QME A;  3L9K A;  4E04 A;  3C4P A;  1IEM A;  1TD5 A;  3IHB A;  3IF5 A;  5CTN A;  2X01 A;  2PRF A;  2CMN A;  3GSG A;  3EQV A;  3T1R A;  3HLD A;  4BEN A;  4P87 A;  4OQI A;  1TS8 A;  2VA0 A;  3EWK A;  2V9A A;  4L9F A;  2ZM0 A;  3S22 A;  3IWO A;  4MN7 A;  5HWW A;  4NXE A;  4EER A;  1SKO B;  4WL9 A;  5L2F A;  4DDS A;  2VGJ A;  3VP4 A;  1S4S A;  3GR2 A;  3NOP C;  5M19 A;  5HL1 A;  3KYQ A;  3BFF A;  1GSW A;  1CQA A;  1ZKJ A;  5FQI A;  3T12 B;  3MXQ A;  3UPN A;  3V5M A;  1BSG A;  2EA9 A;  1DJB A;  2R78 A;  1XKZ A;  4Y3I A;  3LR3 A;  4S2N A;  4LFU A;  3UDI A;  2WKE A;  4HIA A;  3IXG A;  4EBL A;  3E4P A;  1LHY A;  3EGD C;  4YOF A;  1NXY A;  4E3L A;  3A0S A;  4UA7 A;  3FKV A;  2B18 A;  3SH9 A;  1O07 A;  3DWZ A;  1MWU A;  1ONG A;  1YLJ A;  4MN5 A;  5TFQ A;  2ZOI A;  2QYB A;  1ES4 A;  5EVI C;  2FFF B;  3SS5 A;  3C30 A;  1GHI A;  3MMH A;  5G4Y A;  3CUE A;  4XT2 A;  4P85 A;  5CHJ A;  2R9W A;  3LCE A;  4BJP A;  4Y15 A;  1XXM A;  2A24 B;  4ZAM A;  3LIA A;  5F82 A;  5A92 A;  1MKM A;  1NY0 A;  4OP8 A;  1DJA A;  2HP9 A;  3MFX A;  2WGW A;  5E2E A;  3RJU A;  1ERM A;  2ZM8 A;  4OPY A;  4R38 A;  2B5R A;  4LV1 A;  2XA7 S;  3ZG8 B;  3LGO A;  2I9V A;  2Y91 A;  2VV7 A;  4CLC C;  3HLF A;  2X02 A;  3SH8 A;  3QNC A;  2V8C A;  3V50 A;  4ZJ2 A;  5CER A;  1GSX A;  2Y2I A;  1IEL A;  3ICY A;  2JKG A;  4E3I A;  5JYO A;  2V20 A;  3N8S A;  3PAE A;  3IF6 C;  3FWL A;  3LFV A;  1E4D A;  2PR5 A;  5AQA A;  2Y2J A;  1YLZ A;  1NJ4 A;  1G6O A;  3QP6 A;  2VV8 A;  1I2S A;  3C38 A;  4P0M A;  4DJ3 A;  2M1C A;  3DAV A;  1WYC A;  2K31 A;  5DJU A;  4F3L A;  5HZH A;  1VHM A;  1Z6F A;  3LI9 A;  1KE4 A;  4R23 A;  2QZ6 A;  4DE1 A;  3SW1 A;  3BM6 A;  5DFX A;  2AVX A;  1F5M A;  1PRQ A;  3TRC A;  2B95 A;  3ITB A;  3Q1F A;  1NRF A;  3G6O A;  3SOI A;  3D3O A;  4K0X A;  4XUX A;  2Z6C A;  4LRX C;  2JKT I;  4GD6 A;  1YLY A;  3VOL A;  4PHT A;  4Z1W A;  3N8L A;  5A91 A;  4BMW A;  1PWG A;  1P9R A;  4IED A;  4N1H A;  3QHY A;  4Y17 A;  5EVI B;  3BFG A;  4NXG A;  3S7Q A;  5MC7 A;  5GLB A;  2OAP 1;  4OLD A;  1FSY A;  5CHU A;  1T19 A;  2JKT M;  5HWT A;  1K56 D;  3FG8 A;  1X0O A;  4WEK A;  5F83 A;  3CHW P;  2Y2H A;  3KSF A;  3OOV A;  3A3F A;  2FH5 A;  4S2J A;  3EGX C;  1D06 A;  4L0L A;  3TJZ C;  1LT0 A;  1FCN A;  2WAF A;  3OLO A;  1BUL A;  4MLL A;  1TDL A;  3KO6 A;  3BJN A;  2LB9 A;  1ZC2 A;  5CGX A;  1SKO A;  4DF6 A;  1LLB A;  1E25 A;  4Y2F A;  1Y4O A;  2V1B A;  3OBF A;  4QY6 A;  4ESP A;  2NUT C;  1S4R A;  3T4O A;  1S1Y A;  4X1L A;  3IX4 A;  2H0T A;  4WZ5 A;  4RYE A;  1MZU A;  3NEC A; 
#chains in the Genus database with same CATH homology
 2J3T D;  1NLZ A;  4P6Z S;  4Q0H A;  4ZRR A;  4HOI A;  3MR0 A;  1OJG A;  4Q0I A;  5J7E A;  2FZ0 A;  2XRN A;  4EET B;  3S7N A;  2A2L A;  4H6J A;  1S66 L;  4G3K A;  2YKH A;  2PD8 A;  3T4T A;  2J3T C;  5IS1 A;  3P01 A;  5J4E A;  3O5Y A;  4DJ2 A;  4I39 A;  1OTD A;  1D7E A;  4MDZ A;  4EUV A;  3LYX A;  1GSV A;  1F9I A;  2DMW A;  5HD3 A;  1XFQ A;  2VEA A;  4G3V A;  4KQO A;  3E0Y A;  2BAS A;  2ZMV A;  2ZOH A;  1TS7 A;  4PAU A;  4I3J A;  2QJ7 A;  4PKY A;  3IS2 A;  3T4Q A;  5HDC A;  2Y79 A;  4BBT A;  2HF6 A;  2W3H A;  4XT2 B;  4JGO A;  2QWS A;  3JVV A;  5L8M A;  3VE3 A;  3CWF A;  3EOI A;  5HL6 A;  4MN6 A;  5F5Y A;  3GEC A;  2GX5 A;  2QHK A;  3KYZ A;  2D02 A;  3T50 A;  3S7P A;  5AJG A;  2A24 A;  4G3W A;  2JHE A;  3E98 A;  3NOU C;  3R7W B;  2XSS A;  4MCW A;  5DJT A;  2LB5 A;  3KSG A;  4ETZ A;  3VV4 A;  4K08 A;  3H82 A;  2PT7 A;  3LR5 A;  3BY9 A;  3RTY A;  3F1O B;  4EW7 A;  1NRJ A;  5KIZ A;  3UB6 A;  2M7U A;  2VV6 A;  1W63 M;  3B47 A;  1YKD A;  4ARZ A;  5DF9 A;  2VGL S;  4NEE D;  2VLG A;  1STZ A;  2L1M A;  3P7N A;  3B33 A;  3LR4 A;  4HI4 A;  3LIB A;  4Y5F A;  1UWN X;  3H7W B;  5LBR A;  3K3C A;  2YKF A;  2W1R A;  1V9Z A;  4BBU A;  4HHD A;  4GHI B;  1S1Z A;  2WKR A;  1XJ4 A;  4FOF A;  4WEL A;  1NLY A;  3PR6 A;  2XA7 M;  3BY8 A;  1ZHH B;  4GJ4 A;  3UB9 A;  1XJ3 A;  5I5L A;  4L9E A;  4UQI M;  1OT9 A;  4CLC B;  3RH8 B;  3F1P B;  4R70 A;  2PYP A;  4F3L B;  3IBJ A;  4OOL A;  4DMZ A;  4LRZ E;  1TF1 A;  2P08 A;  2P04 A;  1IOU A;  5TBM B;  4EXO A;  3NJA A;  5HPF A;  1T1C A;  3UME A;  2M7V A;  1N9O A;  2GNX A;  2HJ9 C;  3FPW A;  5KSH A;  4O0P A;  5DKL A;  1DRM A;  1P0Z A;  4PKY G;  1DP9 A;  1XFN A;  2EWW A;  5C5K A;  1EW0 A;  2D01 A;  1NWZ A;  4YNR A;  3NHQ A;  3EEH A;  1LSW A;  1T1A A;  4CLC E;  3KSH A;  1V9Y A;  5J3W A;  3CIT A;  1H8M A;  3H9W A;  5F68 A;  3BQA A;  3B42 A;  4R6L A;  4HP9 A;  5F69 A;  2W3E A;  4E04 A;  4HJ3 A;  2O9B A;  1TD5 A;  1OJ5 A;  1S67 L;  3PYP A;  2QKP A;  2W1T A;  3A0R A;  4JGP A;  3UMD A;  5DKK A;  2J80 A;  3T4K A;  2IA2 A;  2CMN A;  3EQV A;  5CX7 A;  2JKR I;  2OAQ 1;  4YWZ A;  3E4Q A;  3HJI A;  5HSQ A;  1TS8 A;  4EES A;  2KDK A;  4O8G A;  2KOI A;  2VA0 A;  3EWK A;  2V9A A;  4L9F A;  3LIF A;  1UWP X;  3FC7 A;  2WKQ A;  4MN7 A;  5HWW A;  3HCY A;  4NXE A;  4EER A;  5G4Z A;  3NOT C;  4GS9 A;  1N9L A;  4WL9 A;  3F1N B;  1S4S A;  1OTE A;  2JKR M;  4I3I A;  3NOP C;  1H3Q A;  2Y8H A;  2W3D A;  4HY8 A;  3CAX A;  3KYQ A;  5HPI A;  1XJ6 A;  2PHY A;  1GSW A;  2V1A A;  3EEA A;  2HJE A;  4HH2 A;  3T4S A;  1LSV A;  1OPX A;  3R4K A;  3MXQ A;  2Z6D A;  2EA9 A;  4I5S A;  2R78 A;  2MJ6 A;  4Y3I A;  1OTI A;  3LR3 A;  1G28 A;  4GCZ A;  4O01 A;  1OTA A;  2HV1 A;  4WUJ A;  5HWV A;  4KUK A;  4HIA A;  4H6J B;  3V67 A;  3VE4 A;  3E4P A;  3EGD C;  3PBO A;  4WN5 A;  4YOF A;  3UB8 A;  4II7 A;  3PBN A;  5HD5 A;  4M4X A;  1JNU A;  3A0S A;  2B18 A;  4I3A A;  4NXB A;  4WF0 A;  3PHY A;  3CLO A;  5IU1 A;  4MN5 A;  4R3A A;  2ZOI A;  2QYB A;  3C30 A;  3IS2 B;  4HQA A;  2GZA A;  3MMH A;  4NKP A;  3EQU A;  5G4Y A;  2HGV A;  3CUE A;  2W27 A;  4WEJ A;  4XT2 A;  3PBQ A;  2VJW A;  1IFQ A;  4BJP A;  2INW A;  4IHQ A;  2A24 B;  4P6Z M;  3LIA A;  1XJ2 A;  3R7W A;  4CLC D;  5IT5 A;  1MKM A;  4LLO B;  3MFX A;  4EEU A;  3BQ8 A;  4LPZ A;  3H82 B;  3S7O A;  4JGR A;  3HJK A;  4R38 A;  2W3F A;  3F1O A;  3IBR A;  2XA7 S;  2I9V A;  3GDI A;  2VV7 A;  4OOM A;  4CLC C;  3LR0 A;  4UQI S;  4B9O A;  4DN0 A;  2EWV A;  3PBS A;  2V0U A;  3PXP A;  4GLQ A;  4HJ4 A;  4ARZ B;  1T18 A;  3D72 A;  1GSX A;  2PR6 A;  3ICY A;  3K3D A;  4HP4 A;  2OWH A;  3CI6 A;  3MF0 A;  5AVF A;  4L9G A;  4FSF A;  3ULF A;  2O9A A;  1P97 A;  2W3G A;  4BBV A;  1BYW A;  3LIE A;  2ZMF A;  4KUO A;  1LSX A;  4HH3 A;  3H7W A;  5HDD A;  4BWI A;  3LFV A;  1TS6 A;  3T4J A;  2K2N A;  4QPR A;  1T1B A;  1OTB A;  4EU0 A;  4Q0J A;  2L4R A;  2PR5 A;  4UEY A;  1UGU A;  4EEP A;  4GHI A;  3OC2 A;  5EFW A;  4GW9 A;  3MQQ A;  1G6O A;  3ZQ5 A;  3RFB A;  2VV8 A;  3C38 A;  5DFY A;  2L0W A;  1LL8 A;  3E4O A;  3OCL A;  4DJ3 A;  1P9W A;  2M1C A;  4ME4 A;  4CLC A;  3F1P A;  2K31 A;  3MJQ A;  5DJU A;  3ZYT A;  4F3L A;  5HZH A;  3TW8 A;  3BW6 A;  1VHM A;  2G7U A;  4IUH A;  1OT6 A;  4JGQ A;  3CUE C;  2VGL M;  3LI9 A;  3UE6 A;  2KX6 A;  5TBM A;  2O99 A;  3A0V A;  3SW1 A;  2O0Y A;  5DFX A;  3C2W A;  3LUQ A;  2PD7 A;  2KLI A;  1F5M A;  3TRC A;  4IUK A;  4ETX A;  3UB7 A;  3DBA A;  3G6O A;  2XRO A;  3D3O A;  1W63 Q;  3LID A;  2Z6C A;  4LRX C;  2JKT I;  3W2Z A;  3OCN A;  5A8B A;  2J3W A;  3VOL A;  2W0N A;  5K5B A;  4MMN A;  4WLA A;  4PHT A;  4Z1W A;  1WA9 A;  3PBR A;  4BMW A;  3FPV A;  3LI8 A;  1ODV A;  3JVU A;  1P9R A;  1N9N A;  4HJ6 A;  1YSP A;  4RQ9 A;  1TS0 A;  2VKS A;  4CQH A;  1VB6 A;  2PDR A;  4NXG A;  3S7Q A;  5MC7 A;  1MC0 A;  2OAP 1;  4LRY C;  3U2A A;  2H28 A;  1KOU A;  2W1T B;  2OWJ A;  4IJG A;  2B02 A;  2GJ3 A;  4AFI A;  1T19 A;  2QJ5 A;  2JKT M;  5HWT A;  3PBT A;  4EQ1 A;  3FG8 A;  4HNB A;  1X0O A;  4WEK A;  1YAX A;  3C8C A;  3KSF A;  2K7S A;  3OOV A;  5HDS A;  1YSQ A;  4KQD A;  4B93 A;  2FH5 A;  3EGX C;  1ZTU A;  1D06 A;  4L0L A;  3TJZ C;  1LT0 A;  2V0W A;  3OLO A;  5TJJ A;  3T4L A;  3BWL A;  1DP6 A;  2O9C A;  3KO6 A;  5AVE A;  3BJN A;  2LB9 A;  2VZW A;  1Y28 A;  1F98 A;  2JN7 A;  3KX0 X;  4GS9 B;  4I38 A;  5FL3 A;  3F1N A;  4NXF A;  4Y2F A;  2V1B A;  2ZBB A;  3OBF A;  2OOL A;  3KSI A;  2NUT C;  3MQ0 A;  1S4R A;  2VX8 A;  3T4O A;  1S1Y A;  2P7J A;  3K2N A;  2PYR A;  2WKP A;  3TE8 A;  3UE3 A;  2NUP C;  1MZU A;  3MQO A;  3LIC A;  1DP8 A;  5F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...