5DKKA

Structure of the dark-state monomer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
b'FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LOV domain
molecule tags Signaling protein
source organism Phaeodactylum tricornutum
publication title Blue light-induced LOV domain dimerization enhances the affinity of Aureochrome 1a for its target DNA sequence.
pubmed doi rcsb
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dkkA00
4HY8A 2PYRA 5DKLA 3MXQA 4NXBA 5HWTA 5HWWA 5J7EA 4WUJA 3MFXA 3UMEA 2JHEA 1T19A 4L9GA 1OT6A 1D7EA 2A24B 3FC7A 1XJ4A 3C2WA 3BY9A 2QWSA 1V9ZA 2VV8A 4NXGA 4NXEA 2B02A 1F9IA 4F3LA 1S1ZA 2L0WA 1S4SA 5HSQA 3UB8A 1OJ5A 1XJ2A 2J80A 3IBRA 4HQAA 4R3AA 1OJGA 4HJ3A 4KQDA 5A8BA 2D02A 4I38A 4LPZA 1V9YA 3VE3A 4BBVA 2Z6CA 3LIDA 4GCZA 3VOLA 1DP8A 1TS0A 2W27A 2H28A 3LICA 2KX6A 3MR0A 1OTIA 3ICYA 3PHYA 3GECA 4GHIB 4GHIA 4HH3A 1F98A 3EEHA 3F1NB 3F1PB 2L1MA 3G6OA 2V0UA 4HH2A 1T1BA 2YKFA 3UB7A 3BY8A 2PD8A 2PHYA 1TS7A 2JN7A 2V1BA 3BWLA 3NJAA 4LRZE 4YWZA 3ULFA 4PKYA 5DJUA 4LLOB 2PYPA 1OTDA 2P7JA 2Z6DA 3LI8A 4JGQA 4EESA 5AVFA 3F1OB 5F69A 4DJ3A 5TBMA 1TS6A 5I5LA 3NOPC 3HJIA 3P7NA 4WF0A 5F6AA 1DP9A 1S1YA 5DJTA 3OLOA 3A0RA 3IS2B 4JGOA 1G28A 3GDIA 4HJ6A 5J4EA 2YKHA 4R70A 4GW9A 1LL8A 3CWFA 1WA9A 1LSWA 2WKRA 4HNBA 1OTBA 3UMDA 2QKPA 5F68A 2D01A 5HDCA 4I3AA 3K3DA 3LIBA 1DRMA 5HD5A 1LSVA 1LT0A 4WLAA 4HOIA 4HHDA 4I3IA 4KUKA 3KX0X 4GS9B 1XJ6A 4NXFA 1GSWA 1P97A 4L9EA 4WL9A 2QJ7A 2V1AA 4K08A 2PR5A 3A0VA 3CLOA 5IU1A 2OWHA 4DJ2A 2ZOHA 3E4PA 2ZBBA 1N9LA 1JNUA 3F1NA 3LI9A 1TS8A 3NOTC 1NWZA 2OOLA 4HI4A 1XFQA 4R6LA 3HJKA 3RH8B 3H82A 3LUQA 4GS9A 1X0OA 3UE6A 5J3WA 3LIEA 4I5SA 2CMNA 3H7WA 1S4RA 3MQOA 4BBUA 5KIZA 1P0ZA 4EXOA 1T1AA 3T50A 1LSXA 1UWPX 2HV1A 3D72A 4RQ9A 2PD7A 5G4YA 2QHKA 4MN5A 4HJ4A 5TBMB 3H7WB 3F1OA 2WKQA 5DKKA 3IS2A 1D06A 1GSVA 2INWA 5AVEA 3SW1A 2PDRA 4HP9A 4HIAA 2WKPA 2K7SA 2A24A 1OTEA 2ZOIA 3NHQA 1OT9A 3C8CA 4KUOA 4LRXC 1S67L 3E4QA 4R38A 1VB6A 1T18A 3UB9A 1S66L 1GSXA 1XFNA 1EW0A 3H82B 2KDKA 1N9OA 4EW7A 3MQQA 5HDSA 2VLGA 4EEUA 4E04A 5EFWA 5IS1A 5HZHA 1OTAA 3B33A 2OWJA 3H9WA 2BASA 4EQ1A 2PR6A 3MJQA 1BYWA 4M4XA 1KOUA 5HWVA 3RTYA 3LYXA 1ODVA 2QJ5A 3LIAA 3VE4A 2L4RA 2V9AA 2VV7A 3NOUC 4H6JB 4JGPA 2EA9A 3UB6A 4I39A 3K3CA 4PKYG 1UWNX 3CAXA 1Y28A 2GJ3A 4MN6A 2V0WA 2VV6A 2R78A 3A0SA 4EERA 3FG8A 4H6JA 4BBTA 2M1CA 1DP6A 3E4OA 4JGRA 3ZQ5A 4XT2A 4EETB 4L9FA 1N9NA 4LRYC 4HP4A 4B9OA 2W0NA 1T1CA 1MZUA 2VEAA 5F5YA 4EEPA 1XJ3A 3EWKA 5HD3A 1UGUA 3LIFA 3PYPA 4WN5A 4XT2B 4I3JA 5G4ZA 4F3LB 3F1PA 2I9VA 5HDDA
chains in the Genus database with same CATH superfamily
1RGZA 4KQQA 5HWWA 3VP1A 1I5QA 2QPNA 2ZQ9A 3W4OA 5EM1A 2VV8A 1YMSA 2P9VB 2JKTM 4X53A 4GD8A 2J8YA 5FI2A 4E3NA 1FOFA 2WKIA 4E3IA 5BOHA 2V8FA 3S4XA 2D02A 3KYEA 4I38A 1V9YA 2EX6A 1F98A 4NG2A 3BY8A 1TS7A 4KZBA 4ZRRA 3R7WB 4IVKA 3CPTA 3BQAA 3KYQA 4E6WA 4JPMA 3GSGA 1ERQA 2P08A 3T4SA 1CQAA 1LSVA 4HOIA 1YLZA 4S2LA 3MKEA 4O01A 3IF5A 3DTEA 4OLGA 4Q8IA 3F1NA 3T4LA 1NY0A 4BWIA 3Q7ZA 4HJ4A 3LR3A 4IVIA 1D06A 1CF0A 3R4KA 3IWIA 5AQ9A 1VM1A 3W8KA 4P87A 1HTZA 1RP5A 4I39A 5FAPA 4PKYG 1IYQA 1Y28A 4FD8A 2R78A 3SOIA 2M1CA 1DP6A 1TF1A 1HLUP 3IHAA 4GJ4A 2XH9A 4B4XA 5G4ZA 1L0GA 3UB5P 4EWFA 3EQVA 4GKUA 2GDNA 3UPOA 4P6ZM 3VFHA 3VSLA 1SKOB 1O07A 4FH2A 1OMEA 2QWSA 2W3FA 2PRFA 2HZ5A 1VEUB 3U2AA 1ACFA 3S7QA 3VE3A 3GR2A 1YT4A 3PBTA 4HH2A 4LGWA 4X69A 2PD8A 3BYDA 2IWCA 3C4PA 4UEYA 2FZ0A 1JTGA 1LI0A 5F6AA 1S1YA 5DJTA 4OVDA 5FSRA 1WA9A 1LSWA 2EX8A 2QKPA 3O5YA 1DRMA 4OPQA 4OPZA 3TE8A 4GDNA 3MMHA 4ZDXA 4DJ2A 2DCFA 4R6LA 1TS8A 1NWZA 3HJKA 2W3HA 3H82A 5J3WA 3LIEA 1IYPA 1IFQA 4X6TA 4AFIA 4RQ9A 3NI9A 5DVAA 2VA0A 3VP4A 4R38A 1S67L 2V8CA 1FILA 5MC7A 4KQOA 4OKPA 3LO7A 3E2LA 2B5RA 3LY3A 1NZOA 1ODVA 5HX9A 1NYYA 1W5DA 2ZC7A 2J9PA 4MCWA 3ZFZA 3A3JA 1PYYA 4DE0A 4EETB 1YLTA 5GLDA 1KE3A 2Y59A 2W1TB 3DW0A 3EGDC 4PM8A 1FCNA 4DF6A 4PHTA 5J7EA 3IWQA 4MDZA 1S1ZA 3IT9A 4HQAA 3ZCZA 4MN5A 3EEHA 1PI4A 3G6OA 1NRJA 1K6RA 3FYZA 4PKYA 4LLOB 2P7JA 1KE4A 1RGYA 1YSPA 5FQMA 4BMWA 4DXBA 3A0RA 2ZMAA 2ZM8A 4ME4A 2PBDP 3C7UA 2HDQA 1P97A 4L9EA 2RL3A 2PR5A 5L07A 2ZBBA 4HI4A 4CLCE 3WS1A 1MWUA 1TVFA 4XUXA 1YKDA 3WS4A 5FQKA 1XXMA 3PBNA 4O7DA 4G3WA 1XA1A 1YLPA 1GSVA 2WKPA 2R9WA 3CI6A 2Y2MA 4E3OA 3HLGA 1I2SA 5EFWA 4Y17A 3MZDA 3RXWA 3BW6A 3T1XA 1TDLA 3LIAA 2V9AA 5DTSA 1MWTA 3IF6B 5AQAA 4E3JA 3E2KA 4H6JA 2JBFA 3SZTA 1YM1A 4KZAA 4S2MA 3EWKA 3UNWA 4GOGA 3NCKA 4MLLA 5HDDA 4BL3A 1M40A 4NXBA 1TEMA 2GNXA 2PU4A 4S2NA 1H3QA 4C75A 4X25A 2A3UA 2JKRI 3IBRA 3WS5A 2Z6CA 4WUJA 1LLBA 4HH3A 4RVAA 1MWSA 3T4JA 3ULFA 3OZHA 4ZTKA 3LI8A 4CJNA 3F1OB 4U0TA 1G6OA 3Q07A 5I94A 1DP9A 4MEZA 2XD1A 5GLBA 1PZOA 4K0XA 5TGFA 3BFDA 3CWFA 2WKRA 2Y55A 1SDNA 2XD5A 3IWOA 4WBGA 2W1TA 2V1AA 4IHQA 3A0VA 5HAQA 2HDRA 1IYSA 2V2FF 4BLMA 4M3KA 3HUOA 4GNUA 4UQIM 4JF4A 5FASA 3MFDA 2DMWA 4KG5A 1KVMA 1T1AA 1XGJA 2BTFP 1UWPX 3DWKA 2Q9NA 5FAQA 4YFMA 5EM0A 3O87A 1ERMA 5DTKA 3SW1A 1KGEA 1Z09A 5HDSA 5FA7A 2Z2LB 5HZHA 3H9WA 5CHMA 1BYWA 3HL9A 3RTYA 1Y54A 4E6XA 2EA9A 3UB6A 3G4PA 5J8XA 1S0WA 4PAUA 3MSHA 4OONA 5HPIA 3E4OA 1KDWA 1ONHA 2Y91A 3ZQ5A 2WUQA 4B9OA 3HCYA 4UA7A 1XPBA 1K56A 3AGDA 5KIZA 2WGWA 4MBKA 2I9VA 2W3EA 3C2WA 5A92A 4Z1WA 5CTMA 3QP5A 1DJAA 1S6RA 4IEDA 1YSQA 4X68A 2BG1A 3G30A 4P6ZS 5E2FA 1ZHHB 5EVIB 3GECA 4CLCB 3UDIA 2JKTI 4LFUA 3I7JA 4QWOA 5D3OA 4DE2A 1PIOA 3JYIA 4EUVA 2Y8HA 5TBMA 5GLCA 2J3WA 1K25A 1ES5A 4ZJ1A 4DE1A 4R70A 1K54C 4FSFA 5F68A 3KX0X 3ZG8B 3D3OA 3CLOA 4HBUA 5M18A 5HW3A 2P9VA 1YAXA 2XQZA 2MJ6A 2G2WA 3MXSA 1MKMA 1NLYA 3QP6A 1LL5A 4KUOA 3NHQA 4FH4A 5EPHA 3UE6A 1FSWA 1GSXA 1JTDA 1PNEA 4DKIA 2ZD8A 3IX8A 3IQAA 4LCLA 4ZJ2A 2WKHA 5HWVA 3MBZA 4C6YA 1YLYA 2JCHA 3VE4A 4KZ5A 3ZYTA 2WAEA 3VMAA 2W3GA 1K4FA 5HAPA 3A3FA 1ONGA 3RFBA 4FCFA 3A0SA 4EERA 1L3LA 4H8RA 3Q81A 3WS0A 4JF5A 2NUPC 3E98A 5GHZA 3PBQA 3OCNA 2B18A 2FH5A 2PYRA 2IA2A 5U47A 3BY9A 2OSUA 4PMAA 1ZTUA 4KZ7A 5HSQA 2J80A 5HAIA 3S22A 1OJGA 2O9CA 5HARA 4LPZA 5CX7A 4BBVA 3PBSA 2KX6A 4YINA 3ZNYA 2JN7A 4HEFA 3IXHA 4R1GA 4EESA 3BFCA 4QHCA 3IH9A 3N6IA 1QMEA 1TDGA 4DN0A 5CEDA 2ACGA 5EOEA 1LT0A 3RJUA 3BFGA 1I2WA 3O88A 3T12B 3SH9A 1E3UD 4PPRA 1K54A 4EXOA 3D72A 3P09A 1PW1A 4XXRA 4CLCD 1FR6A 2Q0OA 2ZMFA 4CPKA 1YPRA 3C8CA 1EW0A 5CXWA 4Y7PA 2PAVP 4MN7A 5IS1A 5A91A 5EVEA 1FQGA 5F1FA 1CI8A 1PW8A 3P98A 1NLZA 2P74A 3T4TA 3CAXA 4BENA 2GJ3A 2EXBA 3TG9A 4N1XA 1XP4A 4R0QA 4ZBEA 2RCXA 1NXYA 4P6BA 3CG5A 4EEPA 4Q0IA 5IHVA 3ZG5A 5CRFA 4WMCD 3VOZA 1U60A 1D7EA 3FC7A 2WADA 4B88A 1ESIA 4LV3A 5F83A 4X1LA 1K55C 2PYPA 3NOPC 1CEGA 2WAFA 3DTKA 2VJWA 3K3DA 4OPRA 3V5MA 4LV2A 4MMNA 3VSKA 4RX3A 3LI9A 4K91A 3RH8B 3NOTC 3S7PA 1AXBA 2C6WB 4II7A 3C30A 4MNRA 4MBHA 4OOYA 2XSSA 1F5MA 3A3DA 1N9OA 4Y13A 1GHIA 3T1QB 4RX2A 3MS6A 1Q2PA 5FI7A 5KSHA 4UA6A 5IT5A 1ZG6A 2VV6A 2VK3A 1GHMA 1SKOA 3LR4A 3V67A 3GVBA 3IX3A 5F5YA 1FIKA 1YMXA 5L2FA 3UDXA 3F1PA 4PM5A 5DKLA 3VP2A 3V3RA 2WKEA 1F9IA 1VHMA 1K57A 3FV7A 1G68A 2DNSA 4KQDA 1K38A 1L0FA 3PAEA 3ICYA 1EI5A 2YKFA 3KO6A 4ID4A 1CK3A 3BLSA 4IBRA 4PM6A 5F69A 3OCLA 4ETZA 5I5LA 4JXSA 3A3IA 3VOYA 1ES2A 1W8QA 5CHJA 5FDHA 4EBPA 3NDGA 4R3BA 5DTTA 1JWVA 4G3VA 4QD4A 4DE3A 3OBFA 2O99A 2GZAA 1JWPA 4WL9A 4BL2A 5FI6A 2VZWA 3ZGAB 5IU1A 1KDSA 2HGVA 1N9LA 2LB5A 3Q7VA 3MQOA 4BBUA 2ZLYA 1N4OA 5G4YA 1VEUA 1OPXA 2QHKA 1VETA 1TD5A 3TSGA 3CITA 5AVEA 5GL9A 2Z2MB 3CPTB 1SZVA 3ZVWA 4Y0OA 2J7VA 3DAVA 3HVFA 5FL3A 3B33A 2H5SA 4JBFA 4BQMA 2J3TD 3GV9A 3GTCA 1K56D 2R9XA 2W0NA 3LEZA 3WWXA 4PM7A 4WN5A 3CJMA 2VX8A 5HWTA 4N9LA 3BJNA 3P01A 2E8JA 2WZZA 1H8YA 2OLVA 1E25A 3NULA 1WE4A 3DWZA 5TJJA 4ARZB 4BD1A 3LR5A 3LICA 5FDSA 4GHIA 3F1NB 3F1PB 3HREA 1CI9A 3JVUA 3JPUA 3DTMA 3P7NA 4WEKA 3IX4A 4WM9A 4GW9A 1FSYA 2QZ6A 4DMZA 5CGXA 1FCMA 3TOIA 5G18A 2ZC3B 1SHVA 3R7WA 2Y2HA 1H8ZA 3Q7VB 2QJ7A 5FQQA 2P04A 4R3JA 5CECA 4RA7A 1L0EA 2XRNA 2XF3A 3CZDA 3GRJA 3KSIA 2HP6A 3OC2A 1H0MA 3H7WB 2INWA 3N7WA 2ZM0A 3B42A 4LV1A 5DF9A 4F3LA 4XUZA 3M2JA 1XFNA 2ZQCA 4EEUA 5CERA 3MJQA 4M4XA 1WYCA 4YOFA 2ZC5B 3LYXA 2HJ9C 5FAOA 2PU2A 1A0KA 2W1RA 5A93A 2ZQAA 2XK1A 3HLDA 2BLSA 2EX2A 3M6BA 1N9NA 2JKGA 1T1CA 3N8LA 1XJ3A 4EU0A 1YLWA 3IBJA 3FPVA 5HL1A 4IJGA 4U3TA 4KZ4A 2JHEA 1T19A 1OT6A 1SCWA 3W4QA 2C5WB 2A2LA 3G31A 3ITBA 1N9BA 2UV0E 5FQJA 4L0LA 1DP8A 5EUAA 3PHYA 5HD5A 1OTIA 4CLCA 3HLCA 1JWZA 2V0UA 3UB7A 1NYMA 4KZ6A 4P85A 4A5RA 2Y79A 4KZ8A 1MXOA 3IS2B 1E3UA 1MY8A 5J4EA 1LL8A 1K4EA 2HDUA 5EE8A 3B3XA 2D01A 5HDCA 1LHYA 4QY5A 3CUEC 3IXGA 4WLAA 3SH8A 4DDSA 4JXGA 2WGVA 2Y2GA 2O9AA 3LCEA 5AQBA 4OLDA 2ZOHA 4Y5FA 1JNUA 4OP5A 1X0OA 5FQIA 1SKFA 4LV0A 3FWLA 2VGLS 2OAQ1 1K6SA 1KVLA 1PI5A 3MZFA 3KYZA 5L10A 2ZJ9A 2EWWA 2A24A 1KGFA 3AGFA 3ZG9B 2KDKA 1QMFA 4P0MA 2ZQ7A 5E2GA 3N8RA 4NK3A 4NEED 4EBLA 3UO9A 4R4SA 2XR0A 3QP4A 2ZL1B 2PR6A 1NJ4A 3SH7A 3D9YA 4UAAA 2JE5A 3NC8A 4OQGA 4FTXA 2JC7A 3OPHA 4QB8A 5EV0A 4KENB 3QP8A 3B47A 3BM6A 3ZG7B 1GA0A 4X55A 2XFTA 5E2EA 1LL9A 4Y0TA 4XT2B 4HY8A 2Y2JA 5JYOA 1XGIA 4BJPA 3T4QA 4NXEA 4BD0A 2Y4AA 3PXPA 2ZQDA 5KMWA 4IUHA 4WYYA 2WGWB 1BZAA 3ITAA 3VOLA 4NKPA 5C5KA 2X01A 2H0TA 4OQIA 4OOMA 1BULA 2EFUA 1FR1A 3W4PA 1Q2QA 2KLIA 3NJAA 2Z6DA 4EQIA 4DJ3A 1Z6FA 4U0XA 1YQSA 3OLOA 1MBLA 5TR7A 2ZC4B 3NIAA 4S2IA 4N92A 5CGWA 1Y4OA 1ZG4A 4I3IA 3O86A 4GS9B 4Z9QA 1ZC2A 3L7HA 2OOLA 5GHXA 3TRCA 3LUQA 4S2OA 3IF6A 3FKWA 5EVID 3CHWP 2HDSA 2FFYA 2XROA 2AVXA 2HF6A 3G35A 4S2JA 5TBMB 3G2YA 4WELA 3GQZA 4HP9A 2HJEA 3FZCA 3VFFA 2PBYA 3E0YA 4R4RA 5EECA 3L9KA 1SDEA 1C3BA 5CHUA 3IF6C 2QYBA 1KOUA 2I72A 2VV7A 3LY4A 5K5BA 5TFQA 2VGKA 3EGXC 4EV4A 4BBTA 4LENA 4E3LA 3HBRA 3CMZA 2IWDA 5HD3A 3SS5A 3LIFA 3ZG0A 4I3JA 4JF6A 1BLSA 3C7VA 3WS2A 2K2NA 3EEAA 2ZMVA 3W2ZA 1OJ5A 4R3AA 4HJ3A 3QHYA 4ZJ3A 1WYBA 3LIDA 1BTLA 3FPWA 3ISGA 2OLUA 4FOFA 2L1MA 1T1BA 2PHYA 4LRZE 3BLMA 3N4IA 2Y2LA 1DJBA 1ALQA 3C38A 1H8MA 3HJIA 5HPFA 1BLCA 3N8SA 4JGOA 1OTBA 3UMDA 1BLPA 3ZDJA 5HL6A 3LIBA 3BQ8A 4OH0A 4HBTA 1HD8A 3EOIA 2H0YA 2OWHA 4JXVA 3SS4A 3U4LP 3MF0A 3AGEA 3OOVA 3T50A 3ZVTA 3OPRA 3F1OA 5DKKA 4OOLA 3QP1A 2K7SA 2GX5A 2FFFB 1YLJA 4EW7A 4DXCA 2ZC6B 4OQ0A 3OPLA 4QJGA 2G2UA 4Y3IA 2QJ5A 3SS3A 2NUTC 3TJZC 1FCOA 4UQIS 2V0WA 4WMCA 3BEBA 2OV5A 4JKTA 4L9FA 3ZHHA 4D60A 1PWDA 3BRMA 3IXBA 2HP5A 4F3LB 5CGSA 4OQHA 4G3KA 3QP2A 4C3QA 3UMEA 2X71A 4OPYA 5FATA 2XA7S 4NXGA 3DTIA 1W7FA 2Y2KA 4GD6A 1S4SA 2Y2PA 4S2KA 1GCEA 3TW8A 2H28A 1IKIA 3PTEA 5F82A 2UWXA 2V1BA 3BWLA 3EQUA 4JGQA 5M19A 5EVIC 1W8YA 4LCMA 3VV4A 3GDIA 4HJ6A 1ES4A 2Y2OA 3M2KA 2ZL1A 3HLBA 4D2OA 4HHDA 4KUKA 2EWVA 5EVLA 1KGGA 1KE0A 4K08A 4GZBA 1XFQA 4ARZA 5EVIA 2O9BA 4I5SA 2CMNA 1LSXA 2HV1A 1NRFA 1BSGA 1ZKJA 2WKQA 2EFXA 4Y0UA 3V50A 5CEBA 3E4QA 1S66L 5AQ7A 4N1HA 3UE3A 2EXAA 3PBOA 3WRZA 3ZNTA 2WZXA 3S1YA 2OWJA 4FUWA 1MKIA 2BASA 4IUKA 1RCJA 1IOUA 2V20A 3BECA 3FKVA 3FG8A 2XFSA 5KZHA 4XT2A 3T1RA 1L2SA 4LRYC 5E2HA 1PWGA 1GHPA 5EOOA 1NZUA 1PWCA 5DFYA 3VP3A 2ZQ8A 1V9ZA 1IYOA 2XGNA 1HVBA 3UE1A 3LR0A 1W79A 3Q82A 4GCZA 2OAP1 2W27A 2PT7A 4GHIB 3UY6A 4UA9A 3LFVA 2Y2QA 1PRQA 1CJFA 1F2KA 1TS6A 4WF0A 1E4DA 2XEPA 4O0PA 2WK0A 1G28A 1D1JA 1EWZA 5GHYA 1GA9A 1GSWA 5AJGA 5DFXA 4ZAMA 3E4PA 4N9KA 4GS9A 4R23A 3H7WA 2ZM2A 1AWIA 2EX9A 1P0ZA 1PZPA 2H10A 2Q9MA 4O8GA 1PFLA 4HIAA 1OTEA 2ZOIA 5E43A 1LI9A 3UB9A 1T18A 3C4OA 1K0KA 3H82B 2J3TC 3K2NA 4MBFA 4X56A 3MQQA 4DDYA 4DRTA 4E04A 5M1AA 3BFEA 1OTAA 3GMWA 1M6KA 4X1MA 3C5AA 2M7UA 4EBNA 4H6JB 3LGOA 3K3CA 1K57C 2VGLM 4MN6A 3NECA 4Q0HA 4WZ5C 4HESA 4KG2A 4HP4A 1MZUA 5A90A 1UGUA 2O0YA 3PYPA 4OP8A 3UN7A 4JLFA 4UHUA 3HUMA 1MWRA 3PBRA 4QU3A 1BUEA 3MFXA 3MQ0A 1XJ4A 3G2ZA 3KSFA 2X02A 1ES3A 5DF8A 4GB7A 4B93A 3M6HA 2V1ZA 3UB8A 1DJCA 4E3MA 3D4FA 3G34A 1JVJA 1TS0A 1W63M 5FQ9A 4KQRA 4IBXA 3O3VA 3IXDA 3V39A 1P9RA 5AVFA 1XKZA 5KSCA 1VQQA 3T4OA 1G5UA 2Y2IA 3NDEA 4S2PA 3MKFA 4EUZA 4HNBA 2HP9A 2XA7M 3QNBA 4NXFA 1K55A 2WGIA 2CC1A 3MXRA 4RYEA 2VGJA 2IWBA 2B95A 1BT5A 2PD7A 3MZEA 2A49A 1XX2A 3CUEA 1G6AA 2QMIA 5F1GA 3IS2A 1DY6A 2JKRM 2PDRA 1IELA 1J9MA 1OT9A 1VB6A 2WYXA 3NY4A 2VLGA 2XLNA 3PR6A 1EROA 3UPNA 4EQ1A 1ESUA 1IKGA 1O7EA 4JXWA 4JGPA 3JVVA 1STZA 1UWNX 3HLWA 4Q0JA 1P9WA 5DF7A 3S7OA 4GN2A 4GLQA 2M7VA 4JGRA 5HFOA 4GDBA 4F94A 2VEAA 3KSGA 3T4KA 1MPLA 4B4ZA 3MXQA 1J3WA 4L9GA 2A24B 4E3KA 5CTNA 1MC0A 3DBAA 2B02A 3HLEA 2L0WA 4WZ4A 4PM9A 1XJ2A 3UDFA 5FEFA 5A8BA 4NETA 3V3SA 4WZ5A 4WEJA 3HLFA 3MR0A 1IEMA 1HZOA 4YNRA 4KZ9A 4CQHA 4QY6A 4YWZA 5GLAA 5DJUA 1OTDA 1W63Q 5JYPA 3BFFA 2K31A 4Y2FA 5L8MA 2YKHA 3A3EA 4I3AA 2JKFA 3LEQA 1XJ6A 3Q1FA 3WRTA 2Y2NA 4ESPA 2DRWA 3T1SA 1XA7A 2KOIA 3KSHA 2LB9A 3VP0A 1S4RA 2E8IA 3RXXA 2G7UA 3IH8A 1VETB 3OPPA 3G32A 3IHBA 5L09A 1CEFA 3HUNA 4LRXC 2HPBA 1BLHA 2VKSA 2XDMA 4QPRA 3NBLA 4ETXA 3UE0A 1H5XA 3S7NA 2L4RA 3NOUC 4Y15A 1L0DA 2J9OA 3QNCA 4CLCC 4KG6A 2W3DA 3UPPA 5FEGA 5LBRA 3PAGA 4S2NC 4KZ3A 4K0WA
chains in the Genus database with same CATH topology
2VX8A 5HWTA 4G3KA 5HWWA 2W3EA 3BJNA 3P01A 3UMEA 3C2WA 4Z1WA 2VV8A 2XA7S 4NXGA 2JKTM 1S4SA 1YSQA 5TJJA 4ARZB 3TW8A 2D02A 4I38A 1V9YA 3LR5A 4P6ZS 3LICA 2H28A 1ZHHB 4GHIA 3GECA 4CLCB 1F98A 3F1NB 3F1PB 2JKTI 3BY8A 2V1BA 1TS7A 3BWLA 3EQUA 3JVUA 4JGQA 4ZRRA 4EUVA 3R7WB 2Y8HA 5TBMA 3BQAA 3KYQA 3P7NA 2J3WA 3VV4A 3GDIA 4HJ6A 4WEKA 4R70A 4GW9A 4DMZA 4FSFA 5F68A 2P08A 3T4SA 1LSVA 4HOIA 4HHDA 4KUKA 3R7WA 3KX0X 2EWVA 2QJ7A 4K08A 3D3OA 2P04A 4O01A 3CLOA 3F1NA 1XFQA 4ARZA 3T4LA 2O9BA 4BWIA 4I5SA 2CMNA 2XRNA 1YAXA 2MJ6A 1LSXA 2HV1A 3KSIA 3OC2A 4HJ4A 1MKMA 3H7WB 3LR3A 2WKQA 1NLYA 1D06A 2INWA 3B42A 3NHQA 4KUOA 5DF9A 4F3LA 3E4QA 3UE6A 3R4KA 1S66L 1GSXA 1XFNA 3UE3A 3PBOA 4EEUA 2OWJA 2BASA 3MJQA 4M4XA 4IUKA 5HWVA 4YOFA 1IOUA 3LYXA 2HJ9C 3VE4A 3ZYTA 2W1RA 2W3GA 4I39A 4PKYG 1Y28A 3RFBA 2R78A 3A0SA 4EERA 3FG8A 2M1CA 1DP6A 1TF1A 4XT2A 1N9NA 4LRYC 1T1CA 2NUPC 1XJ3A 3E98A 4EU0A 4GJ4A 3PBQA 5G4ZA 3IBJA 3FPVA 3OCNA 2B18A 2FH5A 2PYRA 3EQVA 2IA2A 4IJGA 4P6ZM 2JHEA 1T19A 5DFYA 1OT6A 3BY9A 2QWSA 1V9ZA 2W3FA 1ZTUA 2A2LA 5HSQA 2J80A 3U2AA 1OJGA 3LR0A 2O9CA 4LPZA 3S7QA 4L0LA 5CX7A 3VE3A 4BBVA 3PBSA 4GCZA 2OAP1 1DP8A 2W27A 3PHYA 5HD5A 3PBTA 2KX6A 1OTIA 4CLCA 2PT7A 4GHIB 4HH2A 2V0UA 3UB7A 2PD8A 2JN7A 3LFVA 4EESA 1TS6A 2Y79A 4UEYA 2FZ0A 4WF0A 5F6AA 4O0PA 1S1YA 5DJTA 3IS2B 1G28A 5J4EA 1LL8A 1WA9A 4DN0A 1LSWA 2QKPA 2D01A 5HDCA 3O5YA 1DRMA 1LT0A 3CUEC 4WLAA 3TE8A 1GSWA 3MMHA 2O9AA 5AJGA 5DFXA 4DJ2A 2ZOHA 3E4PA 4Y5FA 1JNUA 4R6LA 1TS8A 1NWZA 3HJKA 2W3HA 3H82A 4GS9A 1X0OA 5J3WA 3LIEA 3H7WA 1IFQA 2VGLS 2OAQ1 1P0ZA 4EXOA 4AFIA 3D72A 4RQ9A 4O8GA 3KYZA 2VA0A 4CLCD 2EWWA 4HIAA 2A24A 1OTEA 2ZMFA 2ZOIA 3C8CA 1S67L 4R38A 3UB9A 1T18A 5MC7A 3H82B 1EW0A 2J3TC 2KDKA 3K2NA 3MQQA 4E04A 4NEED 4MN7A 4KQOA 5IS1A 1OTAA 2PR6A 2M7UA 1ODVA 1NLZA 4H6JB 3K3CA 3T4TA 2VGLM 4MCWA 3CAXA 2GJ3A 4MN6A 4Q0HA 3B47A 4EETB 4HP4A 1MZUA 4EEPA 4Q0IA 1UGUA 2O0YA 2W1TB 3EGDC 3PYPA 4XT2B 4HY8A 4PHTA 3PBRA 5J7EA 3MFXA 1D7EA 3FC7A 3MQ0A 1XJ4A 3KSFA 4BJPA 3T4QA 4MDZA 4NXEA 4B93A 1S1ZA 3PXPA 3UB8A 4HQAA 4IUHA 3VOLA 4NKPA 5C5KA 1TS0A 1W63M 4OOMA 4MN5A 3EEHA 3G6OA 1NRJA 2KLIA 3NJAA 4PKYA 4LLOB 2PYPA 2Z6DA 2P7JA 1YSPA 1P9RA 5AVFA 4DJ3A 3NOPC 3T4OA 4BMWA 3OLOA 3A0RA 4HNBA 2VJWA 3K3DA 4ME4A 2XA7M 4I3IA 4GS9B 4NXFA 1P97A 4L9EA 4MMNA 2PR5A 3LI9A 2ZBBA 4HI4A 3RH8B 3NOTC 4CLCE 2OOLA 3S7PA 3TRCA 3LUQA 1YKDA 4II7A 2XROA 3C30A 3PBNA 2HF6A 2PD7A 4G3WA 5TBMB 3CUEA 3IS2A 1GSVA 4WELA 2JKRM 2PDRA 2HJEA 2WKPA 4HP9A 1OT9A 3CI6A 3E0YA 1VB6A 2XSSA 1F5MA 1N9OA 2VLGA 3PR6A 5EFWA 3BW6A 4EQ1A 2QYBA 1KOUA 5KSHA 3LIAA 2VV7A 2V9AA 4JGPA 3JVVA 5K5BA 1STZA 5IT5A 1UWNX 4Q0JA 1P9WA 2VV6A 3S7OA 3EGXC 4GLQA 4H6JA 4BBTA 3LR4A 4JGRA 2M7VA 3V67A 2VEAA 5F5YA 3EWKA 5HD3A 3LIFA 4I3JA 3KSGA 3F1PA 3T4KA 5HDDA 5DKLA 3MXQA 4NXBA 2K2NA 4L9GA 2A24B 3EEAA 1MC0A 2ZMVA 3W2ZA 2GNXA 1H3QA 3DBAA 2B02A 1F9IA 1VHMA 2L0WA 1OJ5A 1XJ2A 2JKRI 3IBRA 4R3AA 4HJ3A 4KQDA 5A8BA 2Z6CA 3LIDA 4WEJA 3FPWA 4WUJA 3MR0A 3ICYA 4HH3A 4FOFA 2L1MA 4YNRA 1T1BA 2YKFA 3T4JA 3KO6A 4CQHA 2PHYA 4LRZE 4YWZA 3ULFA 5DJUA 3LI8A 1OTDA 3F1OB 5F69A 3OCLA 3C38A 4ETZA 5I5LA 1H8MA 1G6OA 1W63Q 2K31A 3HJIA 4Y2FA 5HPFA 1DP9A 4JGOA 5L8MA 2YKHA 3CWFA 2WKRA 1OTBA 3UMDA 4I3AA 5HL6A 3LIBA 3BQ8A 4G3VA 2W1TA 3OBFA 2O99A 2GZAA 1XJ6A 4WL9A 2V1AA 2VZWA 3EOIA 4IHQA 3A0VA 5IU1A 2OWHA 2HGVA 1N9LA 2LB5A 2KOIA 3KSHA 4UQIM 2LB9A 3MQOA 1S4RA 3MF0A 4BBUA 3OOVA 2DMWA 1T1AA 2G7UA 5G4YA 1UWPX 3T50A 1OPXA 2QHKA 1TD5A 3F1OA 5DKKA 4OOLA 3CITA 5AVEA 3SW1A 2K7SA 2GX5A 4LRXC 4EW7A 2VKSA 5HDSA 4QPRA 5FL3A 5HZHA 4ETXA 3B33A 3H9WA 1BYWA 3S7NA 3RTYA 4Y3IA 2QJ5A 2L4RA 3NOUC 2EA9A 3UB6A 2J3TD 2NUTC 3TJZC 4UQIS 4PAUA 2V0WA 4CLCC 2W3DA 5HPIA 3E4OA 3ZQ5A 4L9FA 4B9OA 3HCYA 5LBRA 2W0NA 4WN5A 4F3LB 5KIZA 2I9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HY8 A;  2PYR A;  5DKL A;  3MXQ A;  4NXB A;  5HWT A;  5HWW A;  5J7E A;  4WUJ A;  3MFX A;  3UME A;  2JHE A;  1T19 A;  4L9G A;  1OT6 A;  1D7E A;  2A24 B;  3FC7 A;  1XJ4 A;  3C2W A;  3BY9 A;  2QWS A;  1V9Z A;  2VV8 A;  4NXG A;  4NXE A;  2B02 A;  1F9I A;  4F3L A;  1S1Z A;  2L0W A;  1S4S A;  5HSQ A;  3UB8 A;  1OJ5 A;  1XJ2 A;  2J80 A;  3IBR A;  4HQA A;  4R3A A;  1OJG A;  4HJ3 A;  4KQD A;  5A8B A;  2D02 A;  4I38 A;  4LPZ A;  1V9Y A;  3VE3 A;  4BBV A;  2Z6C A;  3LID A;  4GCZ A;  3VOL A;  1DP8 A;  1TS0 A;  2W27 A;  2H28 A;  3LIC A;  2KX6 A;  3MR0 A;  1OTI A;  3ICY A;  3PHY A;  3GEC A;  4GHI B;  4GHI A;  4HH3 A;  1F98 A;  3EEH A;  3F1N B;  3F1P B;  2L1M A;  3G6O A;  2V0U A;  4HH2 A;  1T1B A;  2YKF A;  3UB7 A;  3BY8 A;  2PD8 A;  2PHY A;  1TS7 A;  2JN7 A;  2V1B A;  3BWL A;  3NJA A;  4LRZ E;  4YWZ A;  3ULF A;  4PKY A;  5DJU A;  4LLO B;  2PYP A;  1OTD A;  2P7J A;  2Z6D A;  3LI8 A;  4JGQ A;  4EES A;  5AVF A;  3F1O B;  5F69 A;  4DJ3 A;  5TBM A;  1TS6 A;  5I5L A;  3NOP C;  3HJI A;  3P7N A;  4WF0 A;  5F6A A;  1DP9 A;  1S1Y A;  5DJT A;  3OLO A;  3A0R A;  3IS2 B;  4JGO A;  1G28 A;  3GDI A;  4HJ6 A;  5J4E A;  2YKH A;  4R70 A;  4GW9 A;  1LL8 A;  3CWF A;  1WA9 A;  1LSW A;  2WKR A;  4HNB A;  1OTB A;  3UMD A;  2QKP A;  5F68 A;  2D01 A;  5HDC A;  4I3A A;  3K3D A;  3LIB A;  1DRM A;  5HD5 A;  1LSV A;  1LT0 A;  4WLA A;  4HOI A;  4HHD A;  4I3I A;  4KUK A;  3KX0 X;  4GS9 B;  1XJ6 A;  4NXF A;  1GSW A;  1P97 A;  4L9E A;  4WL9 A;  2QJ7 A;  2V1A A;  4K08 A;  2PR5 A;  3A0V A;  3CLO A;  5IU1 A;  2OWH A;  4DJ2 A;  2ZOH A;  3E4P A;  2ZBB A;  1N9L A;  1JNU A;  3F1N A;  3LI9 A;  1TS8 A;  3NOT C;  1NWZ A;  2OOL A;  4HI4 A;  1XFQ A;  4R6L A;  3HJK A;  3RH8 B;  3H82 A;  3LUQ A;  4GS9 A;  1X0O A;  3UE6 A;  5J3W A;  3LIE A;  4I5S A;  2CMN A;  3H7W A;  1S4R A;  3MQO A;  4BBU A;  5KIZ A;  1P0Z A;  4EXO A;  1T1A A;  3T50 A;  1LSX A;  1UWP X;  2HV1 A;  3D72 A;  4RQ9 A;  2PD7 A;  5G4Y A;  2QHK A;  4MN5 A;  4HJ4 A;  5TBM B;  3H7W B;  3F1O A;  2WKQ A;  5DKK A;  3IS2 A;  1D06 A;  1GSV A;  2INW A;  5AVE A;  3SW1 A;  2PDR A;  4HP9 A;  4HIA A;  2WKP A;  2K7S A;  2A24 A;  1OTE A;  2ZOI A;  3NHQ A;  1OT9 A;  3C8C A;  4KUO A;  4LRX C;  1S67 L;  3E4Q A;  4R38 A;  1VB6 A;  1T18 A;  3UB9 A;  1S66 L;  1GSX A;  1XFN A;  1EW0 A;  3H82 B;  2KDK A;  1N9O A;  4EW7 A;  3MQQ A;  5HDS A;  2VLG A;  4EEU A;  4E04 A;  5EFW A;  5IS1 A;  5HZH A;  1OTA A;  3B33 A;  2OWJ A;  3H9W A;  2BAS A;  4EQ1 A;  2PR6 A;  3MJQ A;  1BYW A;  4M4X A;  1KOU A;  5HWV A;  3RTY A;  3LYX A;  1ODV A;  2QJ5 A;  3LIA A;  3VE4 A;  2L4R A;  2V9A A;  2VV7 A;  3NOU C;  4H6J B;  4JGP A;  2EA9 A;  3UB6 A;  4I39 A;  3K3C A;  4PKY G;  1UWN X;  3CAX A;  1Y28 A;  2GJ3 A;  4MN6 A;  2V0W A;  2VV6 A;  2R78 A;  3A0S A;  4EER A;  3FG8 A;  4H6J A;  4BBT A;  2M1C A;  1DP6 A;  3E4O A;  4JGR A;  3ZQ5 A;  4XT2 A;  4EET B;  4L9F A;  1N9N A;  4LRY C;  4HP4 A;  4B9O A;  2W0N A;  1T1C A;  1MZU A;  2VEA A;  5F5Y A;  4EEP A;  1XJ3 A;  3EWK A;  5HD3 A;  1UGU A;  3LIF A;  3PYP A;  4WN5 A;  4XT2 B;  4I3J A;  5G4Z A;  4F3L B;  3F1P A;  2I9V A;  5HDD A; 
#chains in the Genus database with same CATH topology
 1RGZ A;  4KQQ A;  5HWW A;  3VP1 A;  1I5Q A;  2QPN A;  2ZQ9 A;  3W4O A;  5EM1 A;  2VV8 A;  1YMS A;  2P9V B;  2JKT M;  4X53 A;  4GD8 A;  2J8Y A;  5FI2 A;  4E3N A;  1FOF A;  2WKI A;  4E3I A;  5BOH A;  2V8F A;  3S4X A;  2D02 A;  3KYE A;  4I38 A;  1V9Y A;  2EX6 A;  1F98 A;  4NG2 A;  3BY8 A;  1TS7 A;  4KZB A;  4ZRR A;  3R7W B;  4IVK A;  3CPT A;  3BQA A;  3KYQ A;  4E6W A;  4JPM A;  3GSG A;  1ERQ A;  2P08 A;  3T4S A;  1CQA A;  1LSV A;  4HOI A;  1YLZ A;  4S2L A;  3MKE A;  4O01 A;  3IF5 A;  3DTE A;  4OLG A;  4Q8I A;  3F1N A;  3T4L A;  1NY0 A;  4BWI A;  3Q7Z A;  4HJ4 A;  3LR3 A;  4IVI A;  1D06 A;  1CF0 A;  3R4K A;  3IWI A;  5AQ9 A;  1VM1 A;  3W8K A;  4P87 A;  1HTZ A;  1RP5 A;  4I39 A;  5FAP A;  4PKY G;  1IYQ A;  1Y28 A;  4FD8 A;  2R78 A;  3SOI A;  2M1C A;  1DP6 A;  1TF1 A;  1HLU P;  3IHA A;  4GJ4 A;  2XH9 A;  4B4X A;  5G4Z A;  1L0G A;  3UB5 P;  4EWF A;  3EQV A;  4GKU A;  2GDN A;  3UPO A;  4P6Z M;  3VFH A;  3VSL A;  1SKO B;  1O07 A;  4FH2 A;  1OME A;  2QWS A;  2W3F A;  2PRF A;  2HZ5 A;  1VEU B;  3U2A A;  1ACF A;  3S7Q A;  3VE3 A;  3GR2 A;  1YT4 A;  3PBT A;  4HH2 A;  4LGW A;  4X69 A;  2PD8 A;  3BYD A;  2IWC A;  3C4P A;  4UEY A;  2FZ0 A;  1JTG A;  1LI0 A;  5F6A A;  1S1Y A;  5DJT A;  4OVD A;  5FSR A;  1WA9 A;  1LSW A;  2EX8 A;  2QKP A;  3O5Y A;  1DRM A;  4OPQ A;  4OPZ A;  3TE8 A;  4GDN A;  3MMH A;  4ZDX A;  4DJ2 A;  2DCF A;  4R6L A;  1TS8 A;  1NWZ A;  3HJK A;  2W3H A;  3H82 A;  5J3W A;  3LIE A;  1IYP A;  1IFQ A;  4X6T A;  4AFI A;  4RQ9 A;  3NI9 A;  5DVA A;  2VA0 A;  3VP4 A;  4R38 A;  1S67 L;  2V8C A;  1FIL A;  5MC7 A;  4KQO A;  4OKP A;  3LO7 A;  3E2L A;  2B5R A;  3LY3 A;  1NZO A;  1ODV A;  5HX9 A;  1NYY A;  1W5D A;  2ZC7 A;  2J9P A;  4MCW A;  3ZFZ A;  3A3J A;  1PYY A;  4DE0 A;  4EET B;  1YLT A;  5GLD A;  1KE3 A;  2Y59 A;  2W1T B;  3DW0 A;  3EGD C;  4PM8 A;  1FCN A;  4DF6 A;  4PHT A;  5J7E A;  3IWQ A;  4MDZ A;  1S1Z A;  3IT9 A;  4HQA A;  3ZCZ A;  4MN5 A;  3EEH A;  1PI4 A;  3G6O A;  1NRJ A;  1K6R A;  3FYZ A;  4PKY A;  4LLO B;  2P7J A;  1KE4 A;  1RGY A;  1YSP A;  5FQM A;  4BMW A;  4DXB A;  3A0R A;  2ZMA A;  2ZM8 A;  4ME4 A;  2PBD P;  3C7U A;  2HDQ A;  1P97 A;  4L9E A;  2RL3 A;  2PR5 A;  5L07 A;  2ZBB A;  4HI4 A;  4CLC E;  3WS1 A;  1MWU A;  1TVF A;  4XUX A;  1YKD A;  3WS4 A;  5FQK A;  1XXM A;  3PBN A;  4O7D A;  4G3W A;  1XA1 A;  1YLP A;  1GSV A;  2WKP A;  2R9W A;  3CI6 A;  2Y2M A;  4E3O A;  3HLG A;  1I2S A;  5EFW A;  4Y17 A;  3MZD A;  3RXW A;  3BW6 A;  3T1X A;  1TDL A;  3LIA A;  2V9A A;  5DTS A;  1MWT A;  3IF6 B;  5AQA A;  4E3J A;  3E2K A;  4H6J A;  2JBF A;  3SZT A;  1YM1 A;  4KZA A;  4S2M A;  3EWK A;  3UNW A;  4GOG A;  3NCK A;  4MLL A;  5HDD A;  4BL3 A;  1M40 A;  4NXB A;  1TEM A;  2GNX A;  2PU4 A;  4S2N A;  1H3Q A;  4C75 A;  4X25 A;  2A3U A;  2JKR I;  3IBR A;  3WS5 A;  2Z6C A;  4WUJ A;  1LLB A;  4HH3 A;  4RVA A;  1MWS A;  3T4J A;  3ULF A;  3OZH A;  4ZTK A;  3LI8 A;  4CJN A;  3F1O B;  4U0T A;  1G6O A;  3Q07 A;  5I94 A;  1DP9 A;  4MEZ A;  2XD1 A;  5GLB A;  1PZO A;  4K0X A;  5TGF A;  3BFD A;  3CWF A;  2WKR A;  2Y55 A;  1SDN A;  2XD5 A;  3IWO A;  4WBG A;  2W1T A;  2V1A A;  4IHQ A;  3A0V A;  5HAQ A;  2HDR A;  1IYS A;  2V2F F;  4BLM A;  4M3K A;  3HUO A;  4GNU A;  4UQI M;  4JF4 A;  5FAS A;  3MFD A;  2DMW A;  4KG5 A;  1KVM A;  1T1A A;  1XGJ A;  2BTF P;  1UWP X;  3DWK A;  2Q9N A;  5FAQ A;  4YFM A;  5EM0 A;  3O87 A;  1ERM A;  5DTK A;  3SW1 A;  1KGE A;  1Z09 A;  5HDS A;  5FA7 A;  2Z2L B;  5HZH A;  3H9W A;  5CHM A;  1BYW A;  3HL9 A;  3RTY A;  1Y54 A;  4E6X A;  2EA9 A;  3UB6 A;  3G4P A;  5J8X A;  1S0W A;  4PAU A;  3MSH A;  4OON A;  5HPI A;  3E4O A;  1KDW A;  1ONH A;  2Y91 A;  3ZQ5 A;  2WUQ A;  4B9O A;  3HCY A;  4UA7 A;  1XPB A;  1K56 A;  3AGD A;  5KIZ A;  2WGW A;  4MBK A;  2I9V A;  2W3E A;  3C2W A;  5A92 A;  4Z1W A;  5CTM A;  3QP5 A;  1DJA A;  1S6R A;  4IED A;  1YSQ A;  4X68 A;  2BG1 A;  3G30 A;  4P6Z S;  5E2F A;  1ZHH B;  5EVI B;  3GEC A;  4CLC B;  3UDI A;  2JKT I;  4LFU A;  3I7J A;  4QWO A;  5D3O A;  4DE2 A;  1PIO A;  3JYI A;  4EUV A;  2Y8H A;  5TBM A;  5GLC A;  2J3W A;  1K25 A;  1ES5 A;  4ZJ1 A;  4DE1 A;  4R70 A;  1K54 C;  4FSF A;  5F68 A;  3KX0 X;  3ZG8 B;  3D3O A;  3CLO A;  4HBU A;  5M18 A;  5HW3 A;  2P9V A;  1YAX A;  2XQZ A;  2MJ6 A;  2G2W A;  3MXS A;  1MKM A;  1NLY A;  3QP6 A;  1LL5 A;  4KUO A;  3NHQ A;  4FH4 A;  5EPH A;  3UE6 A;  1FSW A;  1GSX A;  1JTD A;  1PNE A;  4DKI A;  2ZD8 A;  3IX8 A;  3IQA A;  4LCL A;  4ZJ2 A;  2WKH A;  5HWV A;  3MBZ A;  4C6Y A;  1YLY A;  2JCH A;  3VE4 A;  4KZ5 A;  3ZYT A;  2WAE A;  3VMA A;  2W3G A;  1K4F A;  5HAP A;  3A3F A;  1ONG A;  3RFB A;  4FCF A;  3A0S A;  4EER A;  1L3L A;  4H8R A;  3Q81 A;  3WS0 A;  4JF5 A;  2NUP C;  3E98 A;  5GHZ A;  3PBQ A;  3OCN A;  2B18 A;  2FH5 A;  2PYR A;  2IA2 A;  5U47 A;  3BY9 A;  2OSU A;  4PMA A;  1ZTU A;  4KZ7 A;  5HSQ A;  2J80 A;  5HAI A;  3S22 A;  1OJG A;  2O9C A;  5HAR A;  4LPZ A;  5CX7 A;  4BBV A;  3PBS A;  2KX6 A;  4YIN A;  3ZNY A;  2JN7 A;  4HEF A;  3IXH A;  4R1G A;  4EES A;  3BFC A;  4QHC A;  3IH9 A;  3N6I A;  1QME A;  1TDG A;  4DN0 A;  5CED A;  2ACG A;  5EOE A;  1LT0 A;  3RJU A;  3BFG A;  1I2W A;  3O88 A;  3T12 B;  3SH9 A;  1E3U D;  4PPR A;  1K54 A;  4EXO A;  3D72 A;  3P09 A;  1PW1 A;  4XXR A;  4CLC D;  1FR6 A;  2Q0O A;  2ZMF A;  4CPK A;  1YPR A;  3C8C A;  1EW0 A;  5CXW A;  4Y7P A;  2PAV P;  4MN7 A;  5IS1 A;  5A91 A;  5EVE A;  1FQG A;  5F1F A;  1CI8 A;  1PW8 A;  3P98 A;  1NLZ A;  2P74 A;  3T4T A;  3CAX A;  4BEN A;  2GJ3 A;  2EXB A;  3TG9 A;  4N1X A;  1XP4 A;  4R0Q A;  4ZBE A;  2RCX A;  1NXY A;  4P6B A;  3CG5 A;  4EEP A;  4Q0I A;  5IHV A;  3ZG5 A;  5CRF A;  4WMC D;  3VOZ A;  1U60 A;  1D7E A;  3FC7 A;  2WAD A;  4B88 A;  1ESI A;  4LV3 A;  5F83 A;  4X1L A;  1K55 C;  2PYP A;  3NOP C;  1CEG A;  2WAF A;  3DTK A;  2VJW A;  3K3D A;  4OPR A;  3V5M A;  4LV2 A;  4MMN A;  3VSK A;  4RX3 A;  3LI9 A;  4K91 A;  3RH8 B;  3NOT C;  3S7P A;  1AXB A;  2C6W B;  4II7 A;  3C30 A;  4MNR A;  4MBH A;  4OOY A;  2XSS A;  1F5M A;  3A3D A;  1N9O A;  4Y13 A;  1GHI A;  3T1Q B;  4RX2 A;  3MS6 A;  1Q2P A;  5FI7 A;  5KSH A;  4UA6 A;  5IT5 A;  1ZG6 A;  2VV6 A;  2VK3 A;  1GHM A;  1SKO A;  3LR4 A;  3V67 A;  3GVB A;  3IX3 A;  5F5Y A;  1FIK A;  1YMX A;  5L2F A;  3UDX A;  3F1P A;  4PM5 A;  5DKL A;  3VP2 A;  3V3R A;  2WKE A;  1F9I A;  1VHM A;  1K57 A;  3FV7 A;  1G68 A;  2DNS A;  4KQD A;  1K38 A;  1L0F A;  3PAE A;  3ICY A;  1EI5 A;  2YKF A;  3KO6 A;  4ID4 A;  1CK3 A;  3BLS A;  4IBR A;  4PM6 A;  5F69 A;  3OCL A;  4ETZ A;  5I5L A;  4JXS A;  3A3I A;  3VOY A;  1ES2 A;  1W8Q A;  5CHJ A;  5FDH A;  4EBP A;  3NDG A;  4R3B A;  5DTT A;  1JWV A;  4G3V A;  4QD4 A;  4DE3 A;  3OBF A;  2O99 A;  2GZA A;  1JWP A;  4WL9 A;  4BL2 A;  5FI6 A;  2VZW A;  3ZGA B;  5IU1 A;  1KDS A;  2HGV A;  1N9L A;  2LB5 A;  3Q7V A;  3MQO A;  4BBU A;  2ZLY A;  1N4O A;  5G4Y A;  1VEU A;  1OPX A;  2QHK A;  1VET A;  1TD5 A;  3TSG A;  3CIT A;  5AVE A;  5GL9 A;  2Z2M B;  3CPT B;  1SZV A;  3ZVW A;  4Y0O A;  2J7V A;  3DAV A;  3HVF A;  5FL3 A;  3B33 A;  2H5S A;  4JBF A;  4BQM A;  2J3T D;  3GV9 A;  3GTC A;  1K56 D;  2R9X A;  2W0N A;  3LEZ A;  3WWX A;  4PM7 A;  4WN5 A;  3CJM A;  2VX8 A;  5HWT A;  4N9L A;  3BJN A;  3P01 A;  2E8J A;  2WZZ A;  1H8Y A;  2OLV A;  1E25 A;  3NUL A;  1WE4 A;  3DWZ A;  5TJJ A;  4ARZ B;  4BD1 A;  3LR5 A;  3LIC A;  5FDS A;  4GHI A;  3F1N B;  3F1P B;  3HRE A;  1CI9 A;  3JVU A;  3JPU A;  3DTM A;  3P7N A;  4WEK A;  3IX4 A;  4WM9 A;  4GW9 A;  1FSY A;  2QZ6 A;  4DMZ A;  5CGX A;  1FCM A;  3TOI A;  5G18 A;  2ZC3 B;  1SHV A;  3R7W A;  2Y2H A;  1H8Z A;  3Q7V B;  2QJ7 A;  5FQQ A;  2P04 A;  4R3J A;  5CEC A;  4RA7 A;  1L0E A;  2XRN A;  2XF3 A;  3CZD A;  3GRJ A;  3KSI A;  2HP6 A;  3OC2 A;  1H0M A;  3H7W B;  2INW A;  3N7W A;  2ZM0 A;  3B42 A;  4LV1 A;  5DF9 A;  4F3L A;  4XUZ A;  3M2J A;  1XFN A;  2ZQC A;  4EEU A;  5CER A;  3MJQ A;  4M4X A;  1WYC A;  4YOF A;  2ZC5 B;  3LYX A;  2HJ9 C;  5FAO A;  2PU2 A;  1A0K A;  2W1R A;  5A93 A;  2ZQA A;  2XK1 A;  3HLD A;  2BLS A;  2EX2 A;  3M6B A;  1N9N A;  2JKG A;  1T1C A;  3N8L A;  1XJ3 A;  4EU0 A;  1YLW A;  3IBJ A;  3FPV A;  5HL1 A;  4IJG A;  4U3T A;  4KZ4 A;  2JHE A;  1T19 A;  1OT6 A;  1SCW A;  3W4Q A;  2C5W B;  2A2L A;  3G31 A;  3ITB A;  1N9B A;  2UV0 E;  5FQJ A;  4L0L A;  1DP8 A;  5EUA A;  3PHY A;  5HD5 A;  1OTI A;  4CLC A;  3HLC A;  1JWZ A;  2V0U A;  3UB7 A;  1NYM A;  4KZ6 A;  4P85 A;  4A5R A;  2Y79 A;  4KZ8 A;  1MXO A;  3IS2 B;  1E3U A;  1MY8 A;  5J4E A;  1LL8 A;  1K4E A;  2HDU A;  5EE8 A;  3B3X A;  2D01 A;  5HDC A;  1LHY A;  4QY5 A;  3CUE C;  3IXG A;  4WLA A;  3SH8 A;  4DDS A;  4JXG A;  2WGV A;  2Y2G A;  2O9A A;  3LCE A;  5AQB A;  4OLD A;  2ZOH A;  4Y5F A;  1JNU A;  4OP5 A;  1X0O A;  5FQI A;  1SKF A;  4LV0 A;  3FWL A;  2VGL S;  2OAQ 1;  1K6S A;  1KVL A;  1PI5 A;  3MZF A;  3KYZ A;  5L10 A;  2ZJ9 A;  2EWW A;  2A24 A;  1KGF A;  3AGF A;  3ZG9 B;  2KDK A;  1QMF A;  4P0M A;  2ZQ7 A;  5E2G A;  3N8R A;  4NK3 A;  4NEE D;  4EBL A;  3UO9 A;  4R4S A;  2XR0 A;  3QP4 A;  2ZL1 B;  2PR6 A;  1NJ4 A;  3SH7 A;  3D9Y A;  4UAA A;  2JE5 A;  3NC8 A;  4OQG A;  4FTX A;  2JC7 A;  3OPH A;  4QB8 A;  5EV0 A;  4KEN B;  3QP8 A;  3B47 A;  3BM6 A;  3ZG7 B;  1GA0 A;  4X55 A;  2XFT A;  5E2E A;  1LL9 A;  4Y0T A;  4XT2 B;  4HY8 A;  2Y2J A;  5JYO A;  1XGI A;  4BJP A;  3T4Q A;  4NXE A;  4BD0 A;  2Y4A A;  3PXP A;  2ZQD A;  5KMW A;  4IUH A;  4WYY A;  2WGW B;  1BZA A;  3ITA A;  3VOL A;  4NKP A;  5C5K A;  2X01 A;  2H0T A;  4OQI A;  4OOM A;  1BUL A;  2EFU A;  1FR1 A;  3W4P A;  1Q2Q A;  2KLI A;  3NJA A;  2Z6D A;  4EQI A;  4DJ3 A;  1Z6F A;  4U0X A;  1YQS A;  3OLO A;  1MBL A;  5TR7 A;  2ZC4 B;  3NIA A;  4S2I A;  4N92 A;  5CGW A;  1Y4O A;  1ZG4 A;  4I3I A;  3O86 A;  4GS9 B;  4Z9Q A;  1ZC2 A;  3L7H A;  2OOL A;  5GHX A;  3TRC A;  3LUQ A;  4S2O A;  3IF6 A;  3FKW A;  5EVI D;  3CHW P;  2HDS A;  2FFY A;  2XRO A;  2AVX A;  2HF6 A;  3G35 A;  4S2J A;  5TBM B;  3G2Y A;  4WEL A;  3GQZ A;  4HP9 A;  2HJE A;  3FZC A;  3VFF A;  2PBY A;  3E0Y A;  4R4R A;  5EEC A;  3L9K A;  1SDE A;  1C3B A;  5CHU A;  3IF6 C;  2QYB A;  1KOU A;  2I72 A;  2VV7 A;  3LY4 A;  5K5B A;  5TFQ A;  2VGK A;  3EGX C;  4EV4 A;  4BBT A;  4LEN A;  4E3L A;  3HBR A;  3CMZ A;  2IWD A;  5HD3 A;  3SS5 A;  3LIF A;  3ZG0 A;  4I3J A;  4JF6 A;  1BLS A;  3C7V A;  3WS2 A;  2K2N A;  3EEA A;  2ZMV A;  3W2Z A;  1OJ5 A;  4R3A A;  4HJ3 A;  3QHY A;  4ZJ3 A;  1WYB A;  3LID A;  1BTL A;  3FPW A;  3ISG A;  2OLU A;  4FOF A;  2L1M A;  1T1B A;  2PHY A;  4LRZ E;  3BLM A;  3N4I A;  2Y2L A;  1DJB A;  1ALQ A;  3C38 A;  1H8M A;  3HJI A;  5HPF A;  1BLC A;  3N8S A;  4JGO A;  1OTB A;  3UMD A;  1BLP A;  3ZDJ A;  5HL6 A;  3LIB A;  3BQ8 A;  4OH0 A;  4HBT A;  1HD8 A;  3EOI A;  2H0Y A;  2OWH A;  4JXV A;  3SS4 A;  3U4L P;  3MF0 A;  3AGE A;  3OOV A;  3T50 A;  3ZVT A;  3OPR A;  3F1O A;  5DKK A;  4OOL A;  3QP1 A;  2K7S A;  2GX5 A;  2FFF B;  1YLJ A;  4EW7 A;  4DXC A;  2ZC6 B;  4OQ0 A;  3OPL A;  4QJG A;  2G2U A;  4Y3I A;  2QJ5 A;  3SS3 A;  2NUT C;  3TJZ C;  1FCO A;  4UQI S;  2V0W A;  4WMC A;  3BEB A;  2OV5 A;  4JKT A;  4L9F A;  3ZHH A;  4D60 A;  1PWD A;  3BRM A;  3IXB A;  2HP5 A;  4F3L B;  5CGS A;  4OQH A;  4G3K A;  3QP2 A;  4C3Q A;  3UME A;  2X71 A;  4OPY A;  5FAT A;  2XA7 S;  4NXG A;  3DTI A;  1W7F A;  2Y2K A;  4GD6 A;  1S4S A;  2Y2P A;  4S2K A;  1GCE A;  3TW8 A;  2H28 A;  1IKI A;  3PTE A;  5F82 A;  2UWX A;  2V1B A;  3BWL A;  3EQU A;  4JGQ A;  5M19 A;  5EVI C;  1W8Y A;  4LCM A;  3VV4 A;  3GDI A;  4HJ6 A;  1ES4 A;  2Y2O A;  3M2K A;  2ZL1 A;  3HLB A;  4D2O A;  4HHD A;  4KUK A;  2EWV A;  5EVL A;  1KGG A;  1KE0 A;  4K08 A;  4GZB A;  1XFQ A;  4ARZ A;  5EVI A;  2O9B A;  4I5S A;  2CMN A;  1LSX A;  2HV1 A;  1NRF A;  1BSG A;  1ZKJ A;  2WKQ A;  2EFX A;  4Y0U A;  3V50 A;  5CEB A;  3E4Q A;  1S66 L;  5AQ7 A;  4N1H A;  3UE3 A;  2EXA A;  3PBO A;  3WRZ A;  3ZNT A;  2WZX A;  3S1Y A;  2OWJ A;  4FUW A;  1MKI A;  2BAS A;  4IUK A;  1RCJ A;  1IOU A;  2V20 A;  3BEC A;  3FKV A;  3FG8 A;  2XFS A;  5KZH A;  4XT2 A;  3T1R A;  1L2S A;  4LRY C;  5E2H A;  1PWG A;  1GHP A;  5EOO A;  1NZU A;  1PWC A;  5DFY A;  3VP3 A;  2ZQ8 A;  1V9Z A;  1IYO A;  2XGN A;  1HVB A;  3UE1 A;  3LR0 A;  1W79 A;  3Q82 A;  4GCZ A;  2OAP 1;  2W27 A;  2PT7 A;  4GHI B;  3UY6 A;  4UA9 A;  3LFV A;  2Y2Q A;  1PRQ A;  1CJF A;  1F2K A;  1TS6 A;  4WF0 A;  1E4D A;  2XEP A;  4O0P A;  2WK0 A;  1G28 A;  1D1J A;  1EWZ A;  5GHY A;  1GA9 A;  1GSW A;  5AJG A;  5DFX A;  4ZAM A;  3E4P A;  4N9K A;  4GS9 A;  4R23 A;  3H7W A;  2ZM2 A;  1AWI A;  2EX9 A;  1P0Z A;  1PZP A;  2H10 A;  2Q9M A;  4O8G A;  1PFL A;  4HIA A;  1OTE A;  2ZOI A;  5E43 A;  1LI9 A;  3UB9 A;  1T18 A;  3C4O A;  1K0K A;  3H82 B;  2J3T C;  3K2N A;  4MBF A;  4X56 A;  3MQQ A;  4DDY A;  4DRT A;  4E04 A;  5M1A A;  3BFE A;  1OTA A;  3GMW A;  1M6K A;  4X1M A;  3C5A A;  2M7U A;  4EBN A;  4H6J B;  3LGO A;  3K3C A;  1K57 C;  2VGL M;  4MN6 A;  3NEC A;  4Q0H A;  4WZ5 C;  4HES A;  4KG2 A;  4HP4 A;  1MZU A;  5A90 A;  1UGU A;  2O0Y A;  3PYP A;  4OP8 A;  3UN7 A;  4JLF A;  4UHU A;  3HUM A;  1MWR A;  3PBR A;  4QU3 A;  1BUE A;  3MFX A;  3MQ0 A;  1XJ4 A;  3G2Z A;  3KSF A;  2X02 A;  1ES3 A;  5DF8 A;  4GB7 A;  4B93 A;  3M6H A;  2V1Z A;  3UB8 A;  1DJC A;  4E3M A;  3D4F A;  3G34 A;  1JVJ A;  1TS0 A;  1W63 M;  5FQ9 A;  4KQR A;  4IBX A;  3O3V A;  3IXD A;  3V39 A;  1P9R A;  5AVF A;  1XKZ A;  5KSC A;  1VQQ A;  3T4O A;  1G5U A;  2Y2I A;  3NDE A;  4S2P A;  3MKF A;  4EUZ A;  4HNB A;  2HP9 A;  2XA7 M;  3QNB A;  4NXF A;  1K55 A;  2WGI A;  2CC1 A;  3MXR A;  4RYE A;  2VGJ A;  2IWB A;  2B95 A;  1BT5 A;  2PD7 A;  3MZE A;  2A49 A;  1XX2 A;  3CUE A;  1G6A A;  2QMI A;  5F1G A;  3IS2 A;  1DY6 A;  2JKR M;  2PDR A;  1IEL A;  1J9M A;  1OT9 A;  1VB6 A;  2WYX A;  3NY4 A;  2VLG A;  2XLN A;  3PR6 A;  1ERO A;  3UPN A;  4EQ1 A;  1ESU A;  1IKG A;  1O7E A;  4JXW A;  4JGP A;  3JVV A;  1STZ A;  1UWN X;  3HLW A;  4Q0J A;  1P9W A;  5DF7 A;  3S7O A;  4GN2 A;  4GLQ A;  2M7V A;  4JGR A;  5HFO A;  4GDB A;  4F94 A;  2VEA A;  3KSG A;  3T4K A;  1MPL A;  4B4Z A;  3MXQ A;  1J3W A;  4L9G A;  2A24 B;  4E3K A;  5CTN A;  1MC0 A;  3DBA A;  2B02 A;  3HLE A;  2L0W A;  4WZ4 A;  4PM9 A;  1XJ2 A;  3UDF A;  5FEF A;  5A8B A;  4NET A;  3V3S A;  4WZ5 A;  4WEJ A;  3HLF A;  3MR0 A;  1IEM A;  1HZO A;  4YNR A;  4KZ9 A;  4CQH A;  4QY6 A;  4YWZ A;  5GLA A;  5DJU A;  1OTD A;  1W63 Q;  5JYP A;  3BFF A;  2K31 A;  4Y2F A;  5L8M A;  2YKH A;  3A3E A;  4I3A A;  2JKF A;  3LEQ A;  1XJ6 A;  3Q1F A;  3WRT A;  2Y2N A;  4ESP A;  2DRW A;  3T1S A;  1XA7 A;  2KOI A;  3KSH A;  2LB9 A;  3VP0 A;  1S4R A;  2E8I A;  3RXX A;  2G7U A;  3IH8 A;  1VET B;  3OPP A;  3G32 A;  3IHB A;  5L09 A;  1CEF A;  3HUN A;  4LRX C;  2HPB A;  1BLH A;  2VKS A;  2XDM A;  4QPR A;  3NBL A;  4ETX A;  3UE0 A;  1H5X A;  3S7N A;  2L4R A;  3NOU C;  4Y15 A;  1L0D A;  2J9O A;  3QNC A;  4CLC C;  4KG6 A;  2W3D A;  3UPP A;  5FEG A;  5LBR A;  3PAG A;  4S2N C;  4KZ3 A;  4K0W A; 
#chains in the Genus database with same CATH homology
 2VX8 A;  5HWT A;  4G3K A;  5HWW A;  2W3E A;  3BJN A;  3P01 A;  3UME A;  3C2W A;  4Z1W A;  2VV8 A;  2XA7 S;  4NXG A;  2JKT M;  1S4S A;  1YSQ A;  5TJJ A;  4ARZ B;  3TW8 A;  2D02 A;  4I38 A;  1V9Y A;  3LR5 A;  4P6Z S;  3LIC A;  2H28 A;  1ZHH B;  4GHI A;  3GEC A;  4CLC B;  1F98 A;  3F1N B;  3F1P B;  2JKT I;  3BY8 A;  2V1B A;  1TS7 A;  3BWL A;  3EQU A;  3JVU A;  4JGQ A;  4ZRR A;  4EUV A;  3R7W B;  2Y8H A;  5TBM A;  3BQA A;  3KYQ A;  3P7N A;  2J3W A;  3VV4 A;  3GDI A;  4HJ6 A;  4WEK A;  4R70 A;  4GW9 A;  4DMZ A;  4FSF A;  5F68 A;  2P08 A;  3T4S A;  1LSV A;  4HOI A;  4HHD A;  4KUK A;  3R7W A;  3KX0 X;  2EWV A;  2QJ7 A;  4K08 A;  3D3O A;  2P04 A;  4O01 A;  3CLO A;  3F1N A;  1XFQ A;  4ARZ A;  3T4L A;  2O9B A;  4BWI A;  4I5S A;  2CMN A;  2XRN A;  1YAX A;  2MJ6 A;  1LSX A;  2HV1 A;  3KSI A;  3OC2 A;  4HJ4 A;  1MKM A;  3H7W B;  3LR3 A;  2WKQ A;  1NLY A;  1D06 A;  2INW A;  3B42 A;  3NHQ A;  4KUO A;  5DF9 A;  4F3L A;  3E4Q A;  3UE6 A;  3R4K A;  1S66 L;  1GSX A;  1XFN A;  3UE3 A;  3PBO A;  4EEU A;  2OWJ A;  2BAS A;  3MJQ A;  4M4X A;  4IUK A;  5HWV A;  4YOF A;  1IOU A;  3LYX A;  2HJ9 C;  3VE4 A;  3ZYT A;  2W1R A;  2W3G A;  4I39 A;  4PKY G;  1Y28 A;  3RFB A;  2R78 A;  3A0S A;  4EER A;  3FG8 A;  2M1C A;  1DP6 A;  1TF1 A;  4XT2 A;  1N9N A;  4LRY C;  1T1C A;  2NUP C;  1XJ3 A;  3E98 A;  4EU0 A;  4GJ4 A;  3PBQ A;  5G4Z A;  3IBJ A;  3FPV A;  3OCN A;  2B18 A;  2FH5 A;  2PYR A;  3EQV A;  2IA2 A;  4IJG A;  4P6Z M;  2JHE A;  1T19 A;  5DFY A;  1OT6 A;  3BY9 A;  2QWS A;  1V9Z A;  2W3F A;  1ZTU A;  2A2L A;  5HSQ A;  2J80 A;  3U2A A;  1OJG A;  3LR0 A;  2O9C A;  4LPZ A;  3S7Q A;  4L0L A;  5CX7 A;  3VE3 A;  4BBV A;  3PBS A;  4GCZ A;  2OAP 1;  1DP8 A;  2W27 A;  3PHY A;  5HD5 A;  3PBT A;  2KX6 A;  1OTI A;  4CLC A;  2PT7 A;  4GHI B;  4HH2 A;  2V0U A;  3UB7 A;  2PD8 A;  2JN7 A;  3LFV A;  4EES A;  1TS6 A;  2Y79 A;  4UEY A;  2FZ0 A;  4WF0 A;  5F6A A;  4O0P A;  1S1Y A;  5DJT A;  3IS2 B;  1G28 A;  5J4E A;  1LL8 A;  1WA9 A;  4DN0 A;  1LSW A;  2QKP A;  2D01 A;  5HDC A;  3O5Y A;  1DRM A;  1LT0 A;  3CUE C;  4WLA A;  3TE8 A;  1GSW A;  3MMH A;  2O9A A;  5AJG A;  5DFX A;  4DJ2 A;  2ZOH A;  3E4P A;  4Y5F A;  1JNU A;  4R6L A;  1TS8 A;  1NWZ A;  3HJK A;  2W3H A;  3H82 A;  4GS9 A;  1X0O A;  5J3W A;  3LIE A;  3H7W A;  1IFQ A;  2VGL S;  2OAQ 1;  1P0Z A;  4EXO A;  4AFI A;  3D72 A;  4RQ9 A;  4O8G A;  3KYZ A;  2VA0 A;  4CLC D;  2EWW A;  4HIA A;  2A24 A;  1OTE A;  2ZMF A;  2ZOI A;  3C8C A;  1S67 L;  4R38 A;  3UB9 A;  1T18 A;  5MC7 A;  3H82 B;  1EW0 A;  2J3T C;  2KDK A;  3K2N A;  3MQQ A;  4E04 A;  4NEE D;  4MN7 A;  4KQO A;  5IS1 A;  1OTA A;  2PR6 A;  2M7U A;  1ODV A;  1NLZ A;  4H6J B;  3K3C A;  3T4T A;  2VGL M;  4MCW A;  3CAX A;  2GJ3 A;  4MN6 A;  4Q0H A;  3B47 A;  4EET B;  4HP4 A;  1MZU A;  4EEP A;  4Q0I A;  1UGU A;  2O0Y A;  2W1T B;  3EGD C;  3PYP A;  4XT2 B;  4HY8 A;  4PHT A;  3PBR A;  5J7E A;  3MFX A;  1D7E A;  3FC7 A;  3MQ0 A;  1XJ4 A;  3KSF A;  4BJP A;  3T4Q A;  4MDZ A;  4NXE A;  4B93 A;  1S1Z A;  3PXP A;  3UB8 A;  4HQA A;  4IUH A;  3VOL A;  4NKP A;  5C5K A;  1TS0 A;  1W63 M;  4OOM A;  4MN5 A;  3EEH A;  3G6O A;  1NRJ A;  2KLI A;  3NJA A;  4PKY A;  4LLO B;  2PYP A;  2Z6D A;  2P7J A;  1YSP A;  1P9R A;  5AVF A;  4DJ3 A;  3NOP C;  3T4O A;  4BMW A;  3OLO A;  3A0R A;  4HNB A;  2VJW A;  3K3D A;  4ME4 A;  2XA7 M;  4I3I A;  4GS9 B;  4NXF A;  1P97 A;  4L9E A;  4MMN A;  2PR5 A;  3LI9 A;  2ZBB A;  4HI4 A;  3RH8 B;  3NOT C;  4CLC E;  2OOL A;  3S7P A;  3TRC A;  3LUQ A;  1YKD A;  4II7 A;  2XRO A;  3C30 A;  3PBN A;  2HF6 A;  2PD7 A;  4G3W A;  5TBM B;  3CUE A;  3IS2 A;  1GSV A;  4WEL A;  2JKR M;  2PDR A;  2HJE A;  2WKP A;  4HP9 A;  1OT9 A;  3CI6 A;  3E0Y A;  1VB6 A;  2XSS A;  1F5M A;  1N9O A;  2VLG A;  3PR6 A;  5EFW A;  3BW6 A;  4EQ1 A;  2QYB A;  1KOU A;  5KSH A;  3LIA A;  2VV7 A;  2V9A A;  4JGP A;  3JVV A;  5K5B A;  1STZ A;  5IT5 A;  1UWN X;  4Q0J A;  1P9W A;  2VV6 A;  3S7O A;  3EGX C;  4GLQ A;  4H6J A;  4BBT A;  3LR4 A;  4JGR A;  2M7V A;  3V67 A;  2VEA A;  5F5Y A;  3EWK A;  5HD3 A;  3LIF A;  4I3J A;  3KSG A;  3F1P A;  3T4K A;  5HDD A;  5DKL A;  3MXQ A;  4NXB A;  2K2N A;  4L9G A;  2A24 B;  3EEA A;  1MC0 A;  2ZMV A;  3W2Z A;  2GNX A;  1H3Q A;  3DBA A;  2B02 A;  1F9I A;  1VHM A;  2L0W A;  1OJ5 A;  1XJ2 A;  2JKR I;  3IBR A;  4R3A A;  4HJ3 A;  4KQD A;  5A8B A;  2Z6C A;  3LID A;  4WEJ A;  3FPW A;  4WUJ A;  3MR0 A;  3ICY A;  4HH3 A;  4FOF A;  2L1M A;  4YNR A;  1T1B A;  2YKF A;  3T4J A;  3KO6 A;  4CQH A;  2PHY A;  4LRZ E;  4YWZ A;  3ULF A;  5DJU A;  3LI8 A;  1OTD A;  3F1O B;  5F69 A;  3OCL A;  3C38 A;  4ETZ A;  5I5L A;  1H8M A;  1G6O A;  1W63 Q;  2K31 A;  3HJI A;  4Y2F A;  5HPF A;  1DP9 A;  4JGO A;  5L8M A;  2YKH A;  3CWF A;  2WKR A;  1OTB A;  3UMD A;  4I3A A;  5HL6 A;  3LIB A;  3BQ8 A;  4G3V A;  2W1T A;  3OBF A;  2O99 A;  2GZA A;  1XJ6 A;  4WL9 A;  2V1A A;  2VZW A;  3EOI A;  4IHQ A;  3A0V A;  5IU1 A;  2OWH A;  2HGV A;  1N9L A;  2LB5 A;  2KOI A;  3KSH A;  4UQI M;  2LB9 A;  3MQO A;  1S4R A;  3MF0 A;  4BBU A;  3OOV A;  2DMW A;  1T1A A;  2G7U A;  5G4Y A;  1UWP X;  3T50 A;  1OPX A;  2QHK A;  1TD5 A;  3F1O A;  5DKK A;  4OOL A;  3CIT A;  5AVE A;  3SW1 A;  2K7S A;  2GX5 A;  4LRX C;  4EW7 A;  2VKS A;  5HDS A;  4QPR A;  5FL3 A;  5HZH A;  4ETX A;  3B33 A;  3H9W A;  1BYW A;  3S7N A;  3RTY A;  4Y3I A;  2QJ5 A;  2L4R A;  3NOU C;  2EA9 A;  3UB6 A;  2J3T D;  2NUT C;  3TJZ C;  4UQI S;  4PAU A;  2V0W A;  4CLC C;  2W3D A;  5HPI A;  3E4O A;  3ZQ5 A;  4L9F A;  4B9O A;  3HCY A;  5LBR A;  2W0N A;  4WN5 A;  4F3L B;  5KIZ A;  2I9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...