5DKKA

Structure of the dark-state monomer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LOV domain
publication title Blue light-induced LOV domain dimerization enhances the affinity of Aureochrome 1a for its target DNA sequence.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
molecule tags Signaling protein
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dkkA00
3LI9A 3FG8A 4F3LA 2W0NA 4EETB 3HJIA 3NHQA 3IS2A 2GJ3A 1GSXA 2D01A 3EWKA 5DJTA 3MR0A 4F3LB 3C8CA 3OLOA 1T1AA 1T1CA 2J80A 5HSQA 1N9LA 3GDIA 1DP8A 1S4SA 3F1OA 3MJQA 5F68A 2QHKA 3CAXA 3UB6A 3HJKA 4JGRA 3A0RA 2WKRA 4GCZA 1OJ5A 2OWJA 4K08A 4NXEA 1V9YA 2KDKA 2PD8A 5DJUA 2WKPA 3F1NB 5HD3A 4KUOA 3F1OB 2ZOIA 1EW0A 3KX0X 2JHEA 4WUJA 3LIDA 2L4RA 3LICA 1T1BA 1DRMA 1XFQA 1VB6A 1XJ4A 4L9EA 1G28A 5HWTA 3LIAA 1ODVA 3VE3A 3RH8B 3CWFA 4I5SA 4HH3A 3LUQA 2P7JA 4EEUA 4PKYA 3NOPC 3E4PA 3H9WA 3A0SA 2A24B 2V0WA 4JGPA 1LSXA 5J4EA 1JNUA 1TS0A 3NOTC 4HH2A 5HZHA 4BBUA 3C2WA 2Z6DA 2PHYA 5TBMA 3UE6A 4HI4A 1KOUA 2PYPA 3A0VA 2B02A 4HNBA 4BBVA 4HQAA 2JN7A 4EW7A 1NWZA 4EEPA 1P0ZA 2M1CA 4EXOA 4EERA 1OT6A 3EEHA 2I9VA 2W27A 2V0UA 5TBMB 4HIAA 2L0WA 3IBRA 4LRXC 2PR6A 1S1ZA 1F9IA 1MZUA 4WF0A 2QJ7A 2R78A 3VE4A 2YKHA 1XJ3A 1GSVA 3GECA 3F1NA 3UB7A 1BYWA 3G6OA 4KUKA 2EA9A 1XJ2A 3VOLA 5HDSA 3E4OA 3LIFA 3T50A 4HHDA 1S67L 1UWNX 2QJ5A 3K3CA 4I3JA 5AVFA 4R3AA 4EQ1A 2VV7A 2Z6CA 1GSWA 3D72A 5HWWA 2V1AA 4MN5A 4HJ6A 2PR5A 4NXBA 4R70A 4HP9A 2A24A 3BWLA 4NXGA 4HP4A 3E4QA 1N9NA 1XJ6A 4H6JB 5HDCA 4B9OA 4WL9A 2VV8A 1UWPX 4HJ3A 4MN6A 1TS6A 2QWSA 1S1YA 3LI8A 4GHIA 5F69A 1F98A 1V9ZA 1N9OA 1D7EA 5I5LA 5HWVA 1UGUA 4DJ3A 3F1PA 3LIEA 1TS8A 5G4YA 4XT2B 1OTBA 1P97A 4WLAA 3P7NA 4PKYG 4GHIB 2CMNA 2PYRA 3K3DA 2YKFA 2PDRA 1OTIA 3CLOA 4LPZA 3F1PB 1T19A 2H28A 2KX6A 2VV6A 2ZOHA 5F5YA 3H82A 4DJ2A 4GW9A 5J3WA 5J7EA 1OTAA 4NXFA 2PD7A 1T18A 3UMDA 3LIBA 4I3IA 4WN5A 5IS1A 3UMEA 3ULFA 1S66L 3LYXA 5DKLA 2VEAA 2HV1A 3H82B 2D02A 2ZBBA 3IS2B 4L9GA 4LLOB 4EESA 5DKKA 4BBTA 3B33A 1Y28A 3MFXA 5A8BA 3MQOA 4H6JA 2OOLA 3FC7A 1OT9A 1XFNA 4JGOA 4R38A 4JGQA 2BASA 3ZQ5A 2V1BA 5F6AA 2OWHA 1LL8A 1DP9A 3H7WA 1OTEA 1OTDA 3MXQA 3UB8A 3PHYA 1TS7A 2L1MA 4I38A 2QKPA 4KQDA 1LT0A 5G4ZA 1X0OA 4E04A 4M4XA 4XT2A 2WKQA 3PYPA 3UB9A 4LRYC 4HOIA 3NJAA 3H7WB 4GS9A 2INWA 4L9FA 3SW1A 3RTYA 3ICYA 1OJGA 1S4RA 2VLGA 5HD5A 1D06A 5AVEA 5KIZA 4I3AA 2V9AA 3MQQA 5HDDA 4HY8A 5IU1A 1LSWA 3BY8A 4YWZA 4GS9B 3BY9A 1DP6A 5EFWA 4RQ9A 1LSVA 4R6LA 4LRZE 1WA9A 3NOUC 2K7SA 4I39A 4HJ4A
chains in the Genus database with same CATH superfamily
2VGLM 4F3LA 1NRFA 3C4OA 1ES5A 4YNRA 1IYQA 1MY8A 3UDXA 2W3EA 2GJ3A 4DF6A 1GSXA 3UPOA 2JKRM 5A90A 4WMCA 3MZFA 2O9AA 5F83A 5DJTA 4PAUA 2X02A 3QNCA 3OLOA 2J80A 4E3KA 5HSQA 4IEDA 1W8YA 1DP8A 4XUXA 5F68A 3S4XA 4K0WA 1E3UD 4OQHA 3UB6A 3TRCA 3VP0A 2NUTC 3A0RA 3AGEA 4L0LA 2WKRA 4UHUA 3GV9A 4K08A 1JWPA 2ZC5B 3Q07A 4FSFA 4DN0A 5U47A 3EEAA 2KDKA 3BLSA 5DJUA 3ZYTA 1GHIA 3G30A 5GLCA 1P9WA 5GLDA 2JKTM 3KX0X 3SZTA 2P04A 1YQSA 3G4PA 1FOFA 5CHJA 3LICA 1TVFA 3EQVA 4ETZA 3LY4A 2ZC4B 2OAQ1 1SDNA 2M7VA 1XA1A 4CLCC 1E25A 3VE3A 3WS0A 4Y17A 1FCMA 2W1TB 3QP1A 2RCXA 1E3UA 3OZHA 4PKYA 3MFDA 3H9WA 4Z9QA 4P85A 5TR7A 3WS5A 2W3HA 2XA7S 1BT5A 3NOTC 2IWDA 1G68A 1SKFA 3T1XA 1U60A 2V1ZA 2B02A 1PZOA 1I2WA 4Y3IA 5FATA 2WZXA 4GB7A 1BLSA 3VP2A 5A92A 4EW7A 1K57C 3CG5A 4JXVA 4EEPA 1MWSA 2HJ9C 2M1CA 1TD5A 4EERA 1OT6A 5FAOA 4GDNA 2H10A 3FZCA 3QP6A 3MKEA 3CMZA 3IBRA 3LFVA 3PBRA 2V2FF 1NYMA 1S1ZA 5EM0A 3CZDA 3IXDA 4KZ7A 1YKDA 1VM1A 1GHMA 5EECA 1XJ3A 1GSVA 3F1NA 3ISGA 2WADA 5AJGA 4KZ6A 4MBHA 1XJ2A 1D1JA 3IWQA 1HVBA 4KG5A 3G2ZA 4P0MA 5C5KA 3E4OA 4CLCD 2XD5A 2C6WB 1QMEA 3LY3A 3T50A 3JPUA 1PWGA 3GR2A 1S67L 3IF5A 5FI6A 2K31A 2VGKA 3K3CA 5HAQA 4B4XA 1KE0A 4P87A 4EQ1A 2Q9MA 3GQZA 4DDSA 1YT4A 3HLEA 4Q8IA 2HP5A 1G6OA 1FCOA 4IBXA 2PR5A 5EVIB 4HP9A 3BWLA 4FOFA 2JE5A 4KZBA 4Y2FA 1IFQA 3T12B 4BMWA 2P9VA 3GMWA 1XPBA 1MBLA 3CHWP 3DAVA 5CGXA 3G32A 5HAIA 4KQRA 4QY6A 4S2OA 2R9WA 5FSRA 2ZC7A 5HDCA 1VEUB 3MSHA 4WEJA 2J9OA 2JKGA 2VV8A 2WYXA 1UWPX 3UNWA 3UE3A 4HJ3A 1I2SA 2WGVA 3N6IA 4ZAMA 2ZD8A 2QWSA 3GVBA 3KSHA 2P08A 2JKRI 3MF0A 1D7EA 3NY4A 5HWVA 4DJ3A 4MBFA 1Q2PA 4R4SA 3LIEA 2GX5A 4XT2B 1P97A 2P74A 1DJCA 2UV0E 4GHIB 2YKFA 4DRTA 1P9RA 1HZOA 1KDSA 1K57A 3B42A 3MXRA 4G3VA 3IH8A 5AQ7A 3Q7ZA 3S7QA 4BWIA 4D2OA 4DXBA 1FILA 5J3WA 1ES2A 2JKTI 4EQIA 3IX4A 3PAGA 4CLCE 3B47A 2PD7A 1PWDA 1T18A 3C38A 3UMEA 5CRFA 3W4OA 5DKLA 2WAFA 2Y2HA 3BFGA 1PNEA 2ZC6B 3NDEA 1L0EA 2HV1A 4N1HA 4PM5A 5FA7A 2Z2MB 1ZC2A 4BL3A 4EESA 2EFUA 5A8BA 4H6JA 4E3MA 3FC7A 1OT9A 5HL6A 5E2EA 1MKIA 1XFNA 4ZJ3A 2V1BA 4GNUA 3T4JA 3ZVWA 4YINA 4GD6A 4JXWA 3UB5P 1PWCA 3GSGA 1CI9A 3Q7VB 3A3JA 2BTFP 1VHMA 2L1MA 2W3GA 4RYEA 5CGSA 2Q9NA 4XUZA 5G4ZA 3M2JA 2Y2MA 3R7WB 2WZZA 3ZG5A 4JF5A 3WS4A 3LR0A 3S7OA 4HOIA 4UA9A 1ES3A 4B4ZA 3SW1A 3IHAA 3RTYA 1OJGA 2VLGA 1D06A 5KIZA 4I3AA 4Y7PA 3MQQA 1IKGA 5CXWA 5HDDA 4HY8A 4ZJ2A 1F5MA 3RXXA 2ZC3B 1YLPA 4D60A 1YAXA 1LI9A 3R4KA 4MEZA 4OOMA 4QU3A 2KOIA 1KVMA 4RQ9A 2MJ6A 4PM8A 1LSVA 3SH7A 5L8MA 4LRZE 4IHQA 5A91A 4I39A 3C4PA 1W79A 1ESUA 4MDZA 2XD1A 3NC8A 1H0MA 4B93A 4BD1A 1K4FA 1YLJA 3A3FA 1K54C 5DTKA 4R3BA 2UWXA 1S0WA 3HJIA 3NHQA 4E3OA 5GHXA 3IS2A 2IWBA 2G2UA 3FV7A 3V3SA 3MR0A 3ZHHA 5CTMA 4E3LA 3C8CA 2XEPA 1T1AA 2ZMFA 4EV4A 3GDIA 1S4SA 3F1OA 2QHKA 5LBRA 5CEBA 4EBPA 3HJKA 1RGZA 4Z1WA 2HDQA 2V8CA 2WK0A 4NXEA 1PW8A 2PD8A 3F1NB 3HLBA 2PBYA 1K0KA 3OPLA 1F2KA 2ZOIA 4OOLA 2JHEA 4WUJA 4MLLA 2CC1A 3P98A 3ZG0A 1T1BA 3FKVA 3PBOA 4OPRA 2W3FA 5HWTA 1E4DA 1M6KA 3LIAA 3W4QA 1NY0A 2XDMA 4S2KA 4S2JA 3BRMA 2Y8HA 4R23A 4P6ZM 4X1LA 5CTNA 5G18A 2XFTA 4Y13A 1BZAA 3D9YA 3C5AA 2M7UA 5KSHA 4QJGA 1LSXA 5BOHA 5J4EA 1JNUA 4PHTA 4UEYA 5FDHA 4HH2A 2Y2QA 2WKHA 3TJZC 3UE6A 1KOUA 1JTDA 3LCEA 2QZ6A 2Y4AA 1ALQA 3KO6A 1FIKA 4CLCB 3T4KA 5F1FA 4OLGA 3A3EA 4EUZA 3NCKA 1VETB 3QP2A 2HDRA 2I9VA 1CI8A 2W27A 2HDSA 5TBMB 3IF6C 5FQJA 5TJJA 5EPHA 1KDWA 2J3WA 2PR6A 3KSIA 2AVXA 4E3IA 4WF0A 1YLZA 1K54A 2QJ7A 4NG2A 3VE4A 2YKHA 3UE0A 1A0KA 1YLYA 2ZM8A 3O3VA 2RL3A 4LCMA 5GHYA 3GECA 5IHVA 2ZL1B 3OCLA 3UB7A 1M40A 3PR6A 1ZG4A 2EA9A 5FQMA 4ARZA 4JXGA 3TW8A 2EXAA 3PAEA 4EWFA 4HHDA 3UPNA 4DE2A 5AQBA 2WGIA 1C3BA 4I3JA 3SH8A 2O99A 2Z6CA 3AGDA 2V1AA 3E2KA 4MN5A 4N9LA 1CEFA 4NXBA 1YLTA 3FYZA 1WYCA 5HX9A 2EWVA 2XR0A 4HP4A 3A3DA 3E4QA 3T4OA 3W2ZA 1H3QA 2Y2NA 3BFEA 1XGJA 1DJBA 3VOZA 4H6JB 4Y0TA 4X55A 1BULA 4X1MA 2ZQCA 3PTEA 4B9OA 3LEZA 3IX8A 4PPRA 2PU4A 4ZRRA 3A3IA 4AFIA 1ESIA 4U0TA 3LI8A 3WS2A 2HPBA 1V9ZA 3N4IA 2V8FA 1N9OA 5I5LA 3LEQA 3V3RA 3T1SA 1S6RA 3O86A 2XF3A 3F1PA 1NRJA 1TS8A 1W63Q 2FZ0A 3JVVA 5AQ9A 3N7WA 5K5BA 3HREA 4KQQA 3P7NA 1ERMA 3N8SA 4PKYG 2J9PA 2VK3A 2HJEA 1BLHA 2JCHA 3O5YA 4Y0UA 2PDRA 1OTIA 4WM9A 3CLOA 4LPZA 4EU0A 4M3KA 3CI6A 5KZHA 4UA7A 3NIAA 3VFHA 1XX2A 1ZG6A 3IF6A 3ZDJA 3H82A 4LGWA 4DJ2A 3UO9A 4GW9A 3NBLA 5J7EA 3LR5A 1GHPA 2Y2GA 2WGWB 3LIBA 4WN5A 5DF7A 2XK1A 5IS1A 1S66L 2VA0A 2PAVP 5CGWA 5FASA 4OVDA 2ZQAA 3IXBA 1IELA 2Y2IA 2D02A 2ZBBA 3IS2B 4QB8A 2LB5A 3BQAA 4BBTA 5AQAA 3MFXA 1JWZA 3E98A 3MQOA 3ZFZA 4RX3A 3S7PA 4S2NA 2G7UA 3L9KA 1KE4A 4JGQA 2BASA 1BSGA 3I7JA 3Q81A 3HUNA 3ZQ5A 2OWHA 1OMEA 3BQ8A 1L3LA 3GTCA 4KENB 1OTDA 4CPKA 3RXWA 5FQIA 2VGLS 1N9BA 3HL9A 3P09A 1PRQA 3MS6A 3T4SA 3ZG9B 3QNBA 2QKPA 5GHZA 1AWIA 1LT0A 1X0OA 3PBTA 4MN7A 4E04A 3RFBA 3ZCZA 3PYPA 4X69A 3NJAA 3H7WB 4GS9A 1G6AA 4JF4A 4CQHA 1KE3A 5AVEA 3JYIA 1LSWA 2G2WA 4FCFA 4GZBA 4ZJ1A 3SOIA 4S2IA 5KSCA 2WAEA 5EFWA 5E2FA 5MC7A 3UDFA 2OSUA 5FQKA 1IOUA 2PT7A 1CF0A 4R6LA 1WA9A 1OPXA 5CEDA 3V39A 4HJ4A 1K25A 2E8JA 3LI9A 5E43A 3W8KA 1NYYA 2DRWA 1MXOA 3FKWA 3DTEA 3WWXA 1IEMA 1MWRA 3U4LP 5L07A 2EFXA 3KYEA 3IWOA 4C3QA 3IH9A 4F3LB 2WUQA 4F94A 4QD4A 3ITAA 4IUHA 5EVIC 4UQIM 4RA7A 1WYBA 2C5WB 1GA0A 4WYYA 4E3JA 1N9LA 1YMSA 4DE3A 3DTIA 4JKTA 4GDBA 2ZM2A 4FTXA 1FQGA 2B95A 1OJ5A 2ZM0A 4G3KA 4DXCA 1V9YA 5FI2A 5IT5A 4N1XA 1NZOA 1K55C 5HD3A 4HESA 2GZAA 3BW6A 4GJ4A 5EVEA 1Z09A 1TDGA 3LIDA 2W1TA 4X56A 2A3UA 4WBGA 3ZGAB 3KSGA 3ZG7B 3ITBA 1CEGA 1XJ4A 4L9EA 1G28A 4E6WA 1W8QA 1Y4OA 2Z2LB 3OPRA 1Z6FA 2IA2A 1H8ZA 4A5RA 1NZUA 3RH8B 3T4LA 3SS5A 3T4TA 2PBDP 3WS1A 4B88A 4I5SA 3CUEC 2KLIA 1FR1A 4EEUA 3E4PA 3WRTA 1BTLA 3DW0A 2V0WA 4QHCA 5CHMA 5I94A 1SCWA 1TS0A 5HZHA 1H5XA 3C2WA 4BBUA 1PZPA 2PYPA 4HNBA 2GDNA 2JN7A 2V20A 5EVID 3WRZA 3HLGA 1NWZA 5DFXA 1P0ZA 4UAAA 4II7A 5CERA 4BL2A 3EEHA 4KZ8A 4X68A 3T1RA 3PBQA 2V0UA 3CPTA 2L0WA 4K0XA 2HGVA 3BLMA 4LRXC 4YOFA 3EQUA 3HBRA 5EOOA 2EX6A 1F9IA 4DE1A 5DVAA 4GKUA 2VGJA 4O01A 3EGXC 2R78A 4YFMA 1H8MA 2DNSA 4P6BA 1L0FA 4KZ3A 1BYWA 3IWIA 2Y79A 4IVIA 4LCLA 3VOLA 3LGOA 1IKIA 4HEFA 3LIFA 4BENA 4OQ0A 3UN7A 3HLFA 4GOGA 2QMIA 1UWNX 5FAPA 2QJ5A 5EVIA 4IJGA 3IF6B 3OBFA 3BFCA 4DE0A 4KZ4A 1ACFA 1MWTA 2A49A 1MC0A 3CITA 4OQGA 4WEKA 4OONA 1EI5A 3HUOA 1ERQA 1GSWA 3D72A 2FH5A 5EE8A 5GLAA 2W1RA 5CHUA 2PRFA 5L2FA 2QYBA 5KMWA 4FH4A 1IYOA 3VP1A 1K55A 4R70A 1H8YA 5HW3A 2A24A 1O07A 2Y2KA 3NULA 4NXGA 3MXSA 3VMAA 3ZG8B 2XLNA 1N9NA 3VFFA 1XJ6A 4OPZA 4QY5A 1FSWA 5FEFA 5FEGA 1XKZA 4O0PA 1PW1A 1CK3A 4WL9A 5FAQA 1EWZA 2X71A 2JKFA 2P9VB 2Q0OA 4MN6A 2Y91A 3DBAA 1S1YA 3CUEA 4GHIA 1KVLA 2ZQ7A 3JVUA 1F98A 5E2HA 2VKSA 1UGUA 3OPHA 1BUEA 2ZQDA 5DTSA 3N8RA 3VSLA 3RJUA 3C7UA 3OCNA 3BFFA 2CMNA 4RX2A 2PYRA 5CECA 1L2SA 3UY6A 4O7DA 1T19A 3TOIA 2KX6A 1SZVA 2GNXA 3DWKA 1YSQA 4BJPA 2ZOHA 5F5YA 1GA9A 3VSKA 1OTAA 3LR4A 2VX8A 3IT9A 2IWCA 4Q0IA 3BM6A 3UMDA 4I3IA 4ETXA 1DJAA 4IUKA 2QPNA 4WZ5A 2J8YA 3LO7A 3UPPA 3IXGA 4S2NC 3NDGA 4S2MA 2DCFA 5F82A 1KGFA 3N8LA 2XH9A 4E6XA 5DKKA 4N9KA 1Y28A 3BEBA 4U3TA 3Q7VA 2OOLA 3HUMA 1N4OA 1NLYA 1W5DA 3D4FA 3GRJA 4WELA 3R7WA 3DWZA 5F6AA 1YM1A 1I5QA 5HAPA 4NEED 2VZWA 2ZLYA 4MCWA 1OTEA 5DFYA 3UB8A 3OC2A 3TE8A 1RCJA 3KYZA 2EWWA 1K4EA 4KQDA 3QHYA 4Q0HA 4M4XA 3UB9A 5EV0A 1ONGA 5M18A 2XROA 4L9FA 1PI5A 2W3DA 1S4RA 2B18A 3G2YA 5HD5A 3T1QB 1O7EA 2V9AA 3UE1A 5IU1A 3VP4A 2A2LA 2OLVA 3SS4A 4OKPA 1DY6A 1KGGA 5A93A 4MMNA 2EX8A 3U2AA 3MZDA 4U0XA 5EUAA 1K6SA 4GN2A 3BYDA 4KG6A 3G34A 5GLBA 3C7VA 1SKOA 4KQOA 3HCYA 1HTZA 4H8RA 5J8XA 4NK3A 2J3TC 2ACGA 5D3OA 4OH0A 1QMFA 3T4QA 3QP5A 3FG8A 1K56D 4Q0JA 1LL5A 5DTTA 3S22A 4CJNA 2W0NA 4Y5FA 4EETB 1LL9A 2H0TA 1PYYA 5FI7A 2D01A 1Y54A 2O9BA 3EWKA 3MMHA 4P6ZS 1MPLA 3L7HA 1T1CA 3CPTB 3QP8A 4R4RA 5FQQA 5M1AA 3MJQA 5FDSA 3OPPA 4X25A 3CAXA 1TF1A 4JGRA 4OLDA 3K2NA 4OOYA 4GCZA 1ZTUA 2OWJA 2DMWA 5FQ9A 3P01A 1SHVA 2WKPA 1PFLA 4EBLA 4KUOA 1K56A 5M19A 3F1OB 1PI4A 1EW0A 2FFYA 4MBKA 2OV5A 4N92A 4RVAA 4X53A 5L10A 2HF6A 2L4RA 4IBRA 2OAP1 1DRMA 2Y59A 5JYOA 1XGIA 5HL1A 2VJWA 2XRNA 2BG1A 1XFQA 1VB6A 2Y55A 3Q82A 4KZAA 1ODVA 4LENA 4PM7A 1JWVA 2Y2LA 2J3TD 4LV2A 3CWFA 3E2LA 3IHBA 4R3JA 5L09A 4HH3A 3LUQA 4Y0OA 2P7JA 1KGEA 1JTGA 4ZTKA 3NOPC 1GCEA 3O88A 4CLCA 3A0SA 2A24B 4G3WA 4EBNA 1VETA 3IQAA 4JGPA 1TEMA 2O0YA 2EXBA 1RGYA 2ZMVA 3MBZA 2XQZA 4Y15A 2Z6DA 2PHYA 4K91A 4ZBEA 5HPFA 5TBMA 4OPYA 4HI4A 3A0VA 4BBVA 2XFSA 3V50A 4HQAA 3M2KA 4OP8A 2WKEA 4EXOA 3FPWA 4OQIA 3M6HA 5DF8A 4PMAA 2FFFB 1BLPA 2ZL1A 3PXPA 2Y2OA 4HIAA 1LLBA 4GD8A 3D3OA 1LI0A 1YLWA 3HLCA 4LV1A 4HBUA 1MZUA 3Q1FA 1HLUP 2PU2A 4WZ4A 3V5MA 2ZQ9A 4BQMA 3HLDA 3G6OA 4KUKA 3IX3A 3BFDA 3E0YA 2EX9A 5HDSA 3SH9A 3KYQA 4R0QA 3MZEA 3TSGA 1IYSA 4R1GA 4ME4A 1XA7A 4DMZA 3AGFA 3UDIA 3W4PA 4X6TA 1CJFA 5HFOA 5HPIA 5F1GA 5AVFA 4R3AA 1NLZA 4QWOA 1LHYA 4JPMA 4ARZB 1ZKJA 2VV7A 2XGNA 2BLSA 2Y2JA 5HWWA 4HJ6A 3CJMA 2EX2A 4KZ9A 4C75A 4UA6A 3BECA 2O9CA 3S1YA 4OP5A 4JXSA 1J9MA 3G35A 4O8GA 5TFQA 5EM1A 1YSPA 1ZHHB 2I72A 1WE4A 3EOIA 2JC7A 4S2LA 2ZQ8A 1L0GA 1STZA 1W63M 3ZVTA 3OOVA 3C30A 2E8IA 4KZ5A 4ZDXA 1YPRA 1HD8A 1TS6A 1J3WA 3HVFA 5F69A 5E2GA 4NETA 3SS3A 3MKFA 1BLCA 4JLFA 3S7NA 5G4YA 4JBFA 5HARA 3FWLA 1OTBA 5CX7A 4WLAA 3K3DA 3HLWA 2J7VA 2HZ5A 3ZNYA 2WGWA 1K6RA 3F1PB 2H28A 4FH2A 5GL9A 1L0DA 4LFUA 4E3NA 4BD0A 2X01A 4BLMA 1XXMA 4WZ5C 2VV6A 1FR6A 3EGDC 3NI9A 2JBFA 2B5RA 5JYPA 2XA7M 1NXYA 1SKOB 1YMXA 4NXFA 2K2NA 1Q2QA 3MQ0A 4FUWA 1K38A 1NJ4A 3V67A 3ULFA 4OPQA 3LYXA 1JVJA 2OLUA 4ESPA 4JF6A 2VEAA 1CQAA 2HP6A 1W7FA 4LV3A 4PM6A 3H82B 3PBSA 3ZNTA 1G5UA 3TG9A 1IYPA 4L9GA 4LLOB 3B3XA 4NKPA 3B33A 5FL3A 1MWUA 3G31A 2R9XA 5EVLA 1VEUA 4PM9A 1VQQA 4QPRA 4GLQA 3DTKA 4JGOA 4R38A 5DF9A 4MNRA 4KG2A 2Y2PA 5EOEA 5TGFA 1XP4A 1LL8A 1DP9A 3H7WA 2XSSA 3MXQA 4XXRA 1TDLA 3PHYA 2WKIA 1FCNA 1TS7A 4C6YA 4I38A 2H5SA 3KSFA 3BJNA 4XT2A 2WKQA 4DKIA 4LRYC 2HDUA 4IVKA 4WMCD 3PBNA 2INWA 1SDEA 3IBJA 2ZJ9A 4S2PA 3NECA 3ICYA 3LR3A 2NUPC 1RP5A 3DTMA 1AXBA 1ES4A 3O87A 4ID4A 2HP9A 1MKMA 4UQIS 3QP4A 4DDYA 3FPVA 1ONHA 4HBTA 2H0YA 3BY8A 1FSYA 4LV0A 2ZMAA 4YWZA 3IXHA 4GS9B 3BY9A 3VV4A 1DP6A 3M6BA 3VP3A 3VOYA 1PIOA 3NOUC 2K7SA 2LB9A 4EUVA 4FD8A 1EROA
chains in the Genus database with same CATH topology
2VGLM 3T4QA 3LI9A 3FG8A 4Q0JA 4B93A 4F3LA 2W0NA 4Y5FA 4YNRA 4EETB 3HJIA 3NHQA 2W3EA 3IS2A 2GJ3A 1GSXA 2JKRM 2D01A 2O9AA 2O9BA 3EWKA 5DJTA 3MR0A 3MMHA 4PAUA 4F3LB 3C8CA 4P6ZS 3OLOA 1T1AA 4IUHA 1T1CA 4UQIM 2J80A 5HSQA 1N9LA 2ZMFA 3GDIA 1DP8A 1S4SA 3F1OA 3MJQA 5F68A 2QHKA 5LBRA 3CAXA 1TF1A 3UB6A 3HJKA 4JGRA 3TRCA 3K2NA 2NUTC 3A0RA 4L0LA 4Z1WA 2WKRA 4GCZA 1OJ5A 1ZTUA 2OWJA 4K08A 4NXEA 4G3KA 1V9YA 2DMWA 5IT5A 4FSFA 4DN0A 3P01A 3EEAA 2KDKA 2PD8A 5DJUA 2WKPA 3F1NB 5HD3A 3ZYTA 4KUOA 2GZAA 3BW6A 4GJ4A 1P9WA 3F1OB 2JKTM 1EW0A 2ZOIA 3KX0X 4OOLA 2JHEA 4WUJA 3LIDA 2HF6A 2P04A 2L4RA 2W1TA 3LICA 2OAP1 1T1BA 1DRMA 3PBOA 3EQVA 4ETZA 2VJWA 2XRNA 2W3FA 3KSGA 2OAQ1 1XFQA 1VB6A 1XJ4A 2M7VA 4L9EA 1G28A 5HWTA 4CLCC 3LIAA 1ODVA 3VE3A 2Y8HA 2IA2A 4P6ZM 3RH8B 2J3TD 3T4LA 3CWFA 3T4TA 4I5SA 2M7UA 2W1TB 4HH3A 3CUEC 2KLIA 3LUQA 2P7JA 4EEUA 4PKYA 3NOPC 5KSHA 3E4PA 4CLCA 3H9WA 3A0SA 2A24B 2V0WA 4G3WA 4JGPA 1LSXA 2W3HA 5J4EA 2XA7S 1JNUA 1TS0A 4PHTA 3NOTC 2O0YA 4UEYA 4HH2A 2ZMVA 5HZHA 4BBUA 3C2WA 2Z6DA 2PHYA 5HPFA 3TJZC 5TBMA 3UE6A 4HI4A 1KOUA 2PYPA 3A0VA 2B02A 4HNBA 4BBVA 4Y3IA 4HQAA 2JN7A 3KO6A 4CLCB 3T4KA 4EW7A 1NWZA 5DFXA 4EEPA 1P0ZA 2HJ9C 2M1CA 1TD5A 4EXOA 4EERA 3FPWA 4II7A 1OT6A 3EEHA 2I9VA 3PXPA 2W27A 3PBQA 2V0UA 5TBMB 2L0WA 4HIAA 2HGVA 3IBRA 4LRXC 3LFVA 4YOFA 5TJJA 3EQUA 3D3OA 3PBRA 2J3WA 2PR6A 1S1ZA 1F9IA 3KSIA 1MZUA 4WF0A 4O01A 2QJ7A 3EGXC 1YKDA 2R78A 3VE4A 2YKHA 1H8MA 1XJ3A 1GSVA 3GECA 3F1NA 5AJGA 3OCLA 3UB7A 1BYWA 2Y79A 3PR6A 3G6OA 4KUKA 2EA9A 1XJ2A 3VOLA 4ARZA 5HDSA 3E0YA 5C5KA 3KYQA 3E4OA 3TW8A 4CLCD 3LIFA 3T50A 4HHDA 1S67L 4ME4A 4DMZA 1UWNX 2QJ5A 4IJGA 2K31A 3OBFA 3K3CA 4I3JA 5HPIA 2O99A 5AVFA 4R3AA 4EQ1A 1MC0A 3CITA 1NLZA 4WEKA 4ARZB 2VV7A 2Z6CA 1GSWA 3D72A 2FH5A 2W1RA 5HWWA 2QYBA 2V1AA 4MN5A 4HJ6A 1G6OA 2PR5A 4NXBA 4R70A 4HP9A 2A24A 2O9CA 3BWLA 4FOFA 4Y2FA 1IFQA 4NXGA 4O8GA 4BMWA 2EWVA 4HP4A 3E4QA 3T4OA 1YSPA 1ZHHB 3W2ZA 1N9NA 1H3QA 3EOIA 1XJ6A 4H6JB 5HDCA 4B9OA 1STZA 1W63M 4WEJA 4O0PA 4WL9A 2VV8A 3OOVA 3C30A 1UWPX 4ZRRA 3UE3A 4HJ3A 4MN6A 4AFIA 1TS6A 3DBAA 2QWSA 1S1YA 3CUEA 3LI8A 4GHIA 3KSHA 5F69A 3JVUA 2P08A 1F98A 1V9ZA 2JKRI 3MF0A 1N9OA 1D7EA 5I5LA 5HWVA 2VKSA 1UGUA 4DJ3A 3F1PA 1NRJA 3S7NA 3LIEA 1TS8A 1W63Q 5G4YA 2GX5A 2FZ0A 4XT2B 3JVVA 1OTBA 1P97A 3OCNA 5K5BA 5CX7A 4WLAA 3P7NA 4PKYG 4GHIB 2CMNA 2PYRA 3K3DA 2YKFA 2HJEA 3O5YA 1P9RA 2PDRA 1OTIA 3CLOA 4LPZA 3F1PB 3B42A 1T19A 4EU0A 2H28A 4G3VA 3CI6A 2KX6A 3S7QA 4BWIA 2GNXA 1YSQA 4BJPA 2VV6A 2ZOHA 3EGDC 5F5YA 3H82A 4DJ2A 4GW9A 5J3WA 2JKTI 5J7EA 1OTAA 3LR4A 4CLCE 2XA7M 3LR5A 2VX8A 4NXFA 3B47A 4Q0IA 2PD7A 1T18A 2K2NA 3UMDA 3LIBA 4I3IA 4WN5A 4ETXA 5IS1A 3MQ0A 3C38A 3UMEA 3V67A 4IUKA 3ULFA 1S66L 2VA0A 3LYXA 5DKLA 2VEAA 2HV1A 3H82B 3PBSA 2D02A 2ZBBA 3IS2B 4L9GA 4LLOB 4EESA 2LB5A 3BQAA 5DKKA 4BBTA 4NKPA 3B33A 5FL3A 1Y28A 3MFXA 3E98A 5A8BA 3MQOA 4H6JA 2OOLA 3FC7A 1OT9A 5HL6A 1NLYA 3S7PA 2G7UA 1XFNA 4QPRA 4GLQA 4JGOA 4R38A 4JGQA 2BASA 5DF9A 4WELA 3R7WA 3ZQ5A 2V1BA 5F6AA 2OWHA 3BQ8A 3T4JA 1LL8A 4NEED 1DP9A 2VZWA 3H7WA 4MCWA 1OTEA 1OTDA 2XSSA 3MXQA 5DFYA 3UB8A 3OC2A 3TE8A 2VGLS 1VHMA 3PHYA 1TS7A 3T4SA 2L1MA 2W3GA 4I38A 2QKPA 2EWWA 3KYZA 3KSFA 3BJNA 4KQDA 1LT0A 5G4ZA 1X0OA 3PBTA 4MN7A 4Q0HA 3R7WB 4E04A 4M4XA 4XT2A 2WKQA 3RFBA 3PYPA 3UB9A 3LR0A 4LRYC 3S7OA 4HOIA 3NJAA 3H7WB 4GS9A 2XROA 3PBNA 2INWA 4CQHA 3IBJA 4L9FA 3SW1A 2W3DA 3RTYA 3ICYA 1OJGA 1S4RA 2B18A 2VLGA 3LR3A 1D06A 5HD5A 2NUPC 5AVEA 5KIZA 4I3AA 2V9AA 1MKMA 3MQQA 4UQIS 5HDDA 4HY8A 3FPVA 5IU1A 1LSWA 1F5MA 2A2LA 1YAXA 3BY8A 4MMNA 3U2AA 4YWZA 4GS9B 3BY9A 3VV4A 1DP6A 5EFWA 3R4KA 4OOMA 2KOIA 5MC7A 4RQ9A 2MJ6A 1LSVA 1IOUA 2PT7A 4KQOA 3HCYA 5L8MA 4R6LA 4LRZE 4IHQA 1WA9A 1OPXA 3NOUC 2K7SA 2LB9A 4I39A 4EUVA 2J3TC 4HJ4A 4MDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI9 A;  3FG8 A;  4F3L A;  2W0N A;  4EET B;  3HJI A;  3NHQ A;  3IS2 A;  2GJ3 A;  1GSX A;  2D01 A;  3EWK A;  5DJT A;  3MR0 A;  4F3L B;  3C8C A;  3OLO A;  1T1A A;  1T1C A;  2J80 A;  5HSQ A;  1N9L A;  3GDI A;  1DP8 A;  1S4S A;  3F1O A;  3MJQ A;  5F68 A;  2QHK A;  3CAX A;  3UB6 A;  3HJK A;  4JGR A;  3A0R A;  2WKR A;  4GCZ A;  1OJ5 A;  2OWJ A;  4K08 A;  4NXE A;  1V9Y A;  2KDK A;  2PD8 A;  5DJU A;  2WKP A;  3F1N B;  5HD3 A;  4KUO A;  3F1O B;  2ZOI A;  1EW0 A;  3KX0 X;  2JHE A;  4WUJ A;  3LID A;  2L4R A;  3LIC A;  1T1B A;  1DRM A;  1XFQ A;  1VB6 A;  1XJ4 A;  4L9E A;  1G28 A;  5HWT A;  3LIA A;  1ODV A;  3VE3 A;  3RH8 B;  3CWF A;  4I5S A;  4HH3 A;  3LUQ A;  2P7J A;  4EEU A;  4PKY A;  3NOP C;  3E4P A;  3H9W A;  3A0S A;  2A24 B;  2V0W A;  4JGP A;  1LSX A;  5J4E A;  1JNU A;  1TS0 A;  3NOT C;  4HH2 A;  5HZH A;  4BBU A;  3C2W A;  2Z6D A;  2PHY A;  5TBM A;  3UE6 A;  4HI4 A;  1KOU A;  2PYP A;  3A0V A;  2B02 A;  4HNB A;  4BBV A;  4HQA A;  2JN7 A;  4EW7 A;  1NWZ A;  4EEP A;  1P0Z A;  2M1C A;  4EXO A;  4EER A;  1OT6 A;  3EEH A;  2I9V A;  2W27 A;  2V0U A;  5TBM B;  4HIA A;  2L0W A;  3IBR A;  4LRX C;  2PR6 A;  1S1Z A;  1F9I A;  1MZU A;  4WF0 A;  2QJ7 A;  2R78 A;  3VE4 A;  2YKH A;  1XJ3 A;  1GSV A;  3GEC A;  3F1N A;  3UB7 A;  1BYW A;  3G6O A;  4KUK A;  2EA9 A;  1XJ2 A;  3VOL A;  5HDS A;  3E4O A;  3LIF A;  3T50 A;  4HHD A;  1S67 L;  1UWN X;  2QJ5 A;  3K3C A;  4I3J A;  5AVF A;  4R3A A;  4EQ1 A;  2VV7 A;  2Z6C A;  1GSW A;  3D72 A;  5HWW A;  2V1A A;  4MN5 A;  4HJ6 A;  2PR5 A;  4NXB A;  4R70 A;  4HP9 A;  2A24 A;  3BWL A;  4NXG A;  4HP4 A;  3E4Q A;  1N9N A;  1XJ6 A;  4H6J B;  5HDC A;  4B9O A;  4WL9 A;  2VV8 A;  1UWP X;  4HJ3 A;  4MN6 A;  1TS6 A;  2QWS A;  1S1Y A;  3LI8 A;  4GHI A;  5F69 A;  1F98 A;  1V9Z A;  1N9O A;  1D7E A;  5I5L A;  5HWV A;  1UGU A;  4DJ3 A;  3F1P A;  3LIE A;  1TS8 A;  5G4Y A;  4XT2 B;  1OTB A;  1P97 A;  4WLA A;  3P7N A;  4PKY G;  4GHI B;  2CMN A;  2PYR A;  3K3D A;  2YKF A;  2PDR A;  1OTI A;  3CLO A;  4LPZ A;  3F1P B;  1T19 A;  2H28 A;  2KX6 A;  2VV6 A;  2ZOH A;  5F5Y A;  3H82 A;  4DJ2 A;  4GW9 A;  5J3W A;  5J7E A;  1OTA A;  4NXF A;  2PD7 A;  1T18 A;  3UMD A;  3LIB A;  4I3I A;  4WN5 A;  5IS1 A;  3UME A;  3ULF A;  1S66 L;  3LYX A;  5DKL A;  2VEA A;  2HV1 A;  3H82 B;  2D02 A;  2ZBB A;  3IS2 B;  4L9G A;  4LLO B;  4EES A;  5DKK A;  4BBT A;  3B33 A;  1Y28 A;  3MFX A;  5A8B A;  3MQO A;  4H6J A;  2OOL A;  3FC7 A;  1OT9 A;  1XFN A;  4JGO A;  4R38 A;  4JGQ A;  2BAS A;  3ZQ5 A;  2V1B A;  5F6A A;  2OWH A;  1LL8 A;  1DP9 A;  3H7W A;  1OTE A;  1OTD A;  3MXQ A;  3UB8 A;  3PHY A;  1TS7 A;  2L1M A;  4I38 A;  2QKP A;  4KQD A;  1LT0 A;  5G4Z A;  1X0O A;  4E04 A;  4M4X A;  4XT2 A;  2WKQ A;  3PYP A;  3UB9 A;  4LRY C;  4HOI A;  3NJA A;  3H7W B;  4GS9 A;  2INW A;  4L9F A;  3SW1 A;  3RTY A;  3ICY A;  1OJG A;  1S4R A;  2VLG A;  5HD5 A;  1D06 A;  5AVE A;  5KIZ A;  4I3A A;  2V9A A;  3MQQ A;  5HDD A;  4HY8 A;  5IU1 A;  1LSW A;  3BY8 A;  4YWZ A;  4GS9 B;  3BY9 A;  1DP6 A;  5EFW A;  4RQ9 A;  1LSV A;  4R6L A;  4LRZ E;  1WA9 A;  3NOU C;  2K7S A;  4I39 A;  4HJ4 A; 
#chains in the Genus database with same CATH topology
 2VGL M;  4F3L A;  1NRF A;  3C4O A;  1ES5 A;  4YNR A;  1IYQ A;  1MY8 A;  3UDX A;  2W3E A;  2GJ3 A;  4DF6 A;  1GSX A;  3UPO A;  2JKR M;  5A90 A;  4WMC A;  3MZF A;  2O9A A;  5F83 A;  5DJT A;  4PAU A;  2X02 A;  3QNC A;  3OLO A;  2J80 A;  4E3K A;  5HSQ A;  4IED A;  1W8Y A;  1DP8 A;  4XUX A;  5F68 A;  3S4X A;  4K0W A;  1E3U D;  4OQH A;  3UB6 A;  3TRC A;  3VP0 A;  2NUT C;  3A0R A;  3AGE A;  4L0L A;  2WKR A;  4UHU A;  3GV9 A;  4K08 A;  1JWP A;  2ZC5 B;  3Q07 A;  4FSF A;  4DN0 A;  5U47 A;  3EEA A;  2KDK A;  3BLS A;  5DJU A;  3ZYT A;  1GHI A;  3G30 A;  5GLC A;  1P9W A;  5GLD A;  2JKT M;  3KX0 X;  3SZT A;  2P04 A;  1YQS A;  3G4P A;  1FOF A;  5CHJ A;  3LIC A;  1TVF A;  3EQV A;  4ETZ A;  3LY4 A;  2ZC4 B;  2OAQ 1;  1SDN A;  2M7V A;  1XA1 A;  4CLC C;  1E25 A;  3VE3 A;  3WS0 A;  4Y17 A;  1FCM A;  2W1T B;  3QP1 A;  2RCX A;  1E3U A;  3OZH A;  4PKY A;  3MFD A;  3H9W A;  4Z9Q A;  4P85 A;  5TR7 A;  3WS5 A;  2W3H A;  2XA7 S;  1BT5 A;  3NOT C;  2IWD A;  1G68 A;  1SKF A;  3T1X A;  1U60 A;  2V1Z A;  2B02 A;  1PZO A;  1I2W A;  4Y3I A;  5FAT A;  2WZX A;  4GB7 A;  1BLS A;  3VP2 A;  5A92 A;  4EW7 A;  1K57 C;  3CG5 A;  4JXV A;  4EEP A;  1MWS A;  2HJ9 C;  2M1C A;  1TD5 A;  4EER A;  1OT6 A;  5FAO A;  4GDN A;  2H10 A;  3FZC A;  3QP6 A;  3MKE A;  3CMZ A;  3IBR A;  3LFV A;  3PBR A;  2V2F F;  1NYM A;  1S1Z A;  5EM0 A;  3CZD A;  3IXD A;  4KZ7 A;  1YKD A;  1VM1 A;  1GHM A;  5EEC A;  1XJ3 A;  1GSV A;  3F1N A;  3ISG A;  2WAD A;  5AJG A;  4KZ6 A;  4MBH A;  1XJ2 A;  1D1J A;  3IWQ A;  1HVB A;  4KG5 A;  3G2Z A;  4P0M A;  5C5K A;  3E4O A;  4CLC D;  2XD5 A;  2C6W B;  1QME A;  3LY3 A;  3T50 A;  3JPU A;  1PWG A;  3GR2 A;  1S67 L;  3IF5 A;  5FI6 A;  2K31 A;  2VGK A;  3K3C A;  5HAQ A;  4B4X A;  1KE0 A;  4P87 A;  4EQ1 A;  2Q9M A;  3GQZ A;  4DDS A;  1YT4 A;  3HLE A;  4Q8I A;  2HP5 A;  1G6O A;  1FCO A;  4IBX A;  2PR5 A;  5EVI B;  4HP9 A;  3BWL A;  4FOF A;  2JE5 A;  4KZB A;  4Y2F A;  1IFQ A;  3T12 B;  4BMW A;  2P9V A;  3GMW A;  1XPB A;  1MBL A;  3CHW P;  3DAV A;  5CGX A;  3G32 A;  5HAI A;  4KQR A;  4QY6 A;  4S2O A;  2R9W A;  5FSR A;  2ZC7 A;  5HDC A;  1VEU B;  3MSH A;  4WEJ A;  2J9O A;  2JKG A;  2VV8 A;  2WYX A;  1UWP X;  3UNW A;  3UE3 A;  4HJ3 A;  1I2S A;  2WGV A;  3N6I A;  4ZAM A;  2ZD8 A;  2QWS A;  3GVB A;  3KSH A;  2P08 A;  2JKR I;  3MF0 A;  1D7E A;  3NY4 A;  5HWV A;  4DJ3 A;  4MBF A;  1Q2P A;  4R4S A;  3LIE A;  2GX5 A;  4XT2 B;  1P97 A;  2P74 A;  1DJC A;  2UV0 E;  4GHI B;  2YKF A;  4DRT A;  1P9R A;  1HZO A;  1KDS A;  1K57 A;  3B42 A;  3MXR A;  4G3V A;  3IH8 A;  5AQ7 A;  3Q7Z A;  3S7Q A;  4BWI A;  4D2O A;  4DXB A;  1FIL A;  5J3W A;  1ES2 A;  2JKT I;  4EQI A;  3IX4 A;  3PAG A;  4CLC E;  3B47 A;  2PD7 A;  1PWD A;  1T18 A;  3C38 A;  3UME A;  5CRF A;  3W4O A;  5DKL A;  2WAF A;  2Y2H A;  3BFG A;  1PNE A;  2ZC6 B;  3NDE A;  1L0E A;  2HV1 A;  4N1H A;  4PM5 A;  5FA7 A;  2Z2M B;  1ZC2 A;  4BL3 A;  4EES A;  2EFU A;  5A8B A;  4H6J A;  4E3M A;  3FC7 A;  1OT9 A;  5HL6 A;  5E2E A;  1MKI A;  1XFN A;  4ZJ3 A;  2V1B A;  4GNU A;  3T4J A;  3ZVW A;  4YIN A;  4GD6 A;  4JXW A;  3UB5 P;  1PWC A;  3GSG A;  1CI9 A;  3Q7V B;  3A3J A;  2BTF P;  1VHM A;  2L1M A;  2W3G A;  4RYE A;  5CGS A;  2Q9N A;  4XUZ A;  5G4Z A;  3M2J A;  2Y2M A;  3R7W B;  2WZZ A;  3ZG5 A;  4JF5 A;  3WS4 A;  3LR0 A;  3S7O A;  4HOI A;  4UA9 A;  1ES3 A;  4B4Z A;  3SW1 A;  3IHA A;  3RTY A;  1OJG A;  2VLG A;  1D06 A;  5KIZ A;  4I3A A;  4Y7P A;  3MQQ A;  1IKG A;  5CXW A;  5HDD A;  4HY8 A;  4ZJ2 A;  1F5M A;  3RXX A;  2ZC3 B;  1YLP A;  4D60 A;  1YAX A;  1LI9 A;  3R4K A;  4MEZ A;  4OOM A;  4QU3 A;  2KOI A;  1KVM A;  4RQ9 A;  2MJ6 A;  4PM8 A;  1LSV A;  3SH7 A;  5L8M A;  4LRZ E;  4IHQ A;  5A91 A;  4I39 A;  3C4P A;  1W79 A;  1ESU A;  4MDZ A;  2XD1 A;  3NC8 A;  1H0M A;  4B93 A;  4BD1 A;  1K4F A;  1YLJ A;  3A3F A;  1K54 C;  5DTK A;  4R3B A;  2UWX A;  1S0W A;  3HJI A;  3NHQ A;  4E3O A;  5GHX A;  3IS2 A;  2IWB A;  2G2U A;  3FV7 A;  3V3S A;  3MR0 A;  3ZHH A;  5CTM A;  4E3L A;  3C8C A;  2XEP A;  1T1A A;  2ZMF A;  4EV4 A;  3GDI A;  1S4S A;  3F1O A;  2QHK A;  5LBR A;  5CEB A;  4EBP A;  3HJK A;  1RGZ A;  4Z1W A;  2HDQ A;  2V8C A;  2WK0 A;  4NXE A;  1PW8 A;  2PD8 A;  3F1N B;  3HLB A;  2PBY A;  1K0K A;  3OPL A;  1F2K A;  2ZOI A;  4OOL A;  2JHE A;  4WUJ A;  4MLL A;  2CC1 A;  3P98 A;  3ZG0 A;  1T1B A;  3FKV A;  3PBO A;  4OPR A;  2W3F A;  5HWT A;  1E4D A;  1M6K A;  3LIA A;  3W4Q A;  1NY0 A;  2XDM A;  4S2K A;  4S2J A;  3BRM A;  2Y8H A;  4R23 A;  4P6Z M;  4X1L A;  5CTN A;  5G18 A;  2XFT A;  4Y13 A;  1BZA A;  3D9Y A;  3C5A A;  2M7U A;  5KSH A;  4QJG A;  1LSX A;  5BOH A;  5J4E A;  1JNU A;  4PHT A;  4UEY A;  5FDH A;  4HH2 A;  2Y2Q A;  2WKH A;  3TJZ C;  3UE6 A;  1KOU A;  1JTD A;  3LCE A;  2QZ6 A;  2Y4A A;  1ALQ A;  3KO6 A;  1FIK A;  4CLC B;  3T4K A;  5F1F A;  4OLG A;  3A3E A;  4EUZ A;  3NCK A;  1VET B;  3QP2 A;  2HDR A;  2I9V A;  1CI8 A;  2W27 A;  2HDS A;  5TBM B;  3IF6 C;  5FQJ A;  5TJJ A;  5EPH A;  1KDW A;  2J3W A;  2PR6 A;  3KSI A;  2AVX A;  4E3I A;  4WF0 A;  1YLZ A;  1K54 A;  2QJ7 A;  4NG2 A;  3VE4 A;  2YKH A;  3UE0 A;  1A0K A;  1YLY A;  2ZM8 A;  3O3V A;  2RL3 A;  4LCM A;  5GHY A;  3GEC A;  5IHV A;  2ZL1 B;  3OCL A;  3UB7 A;  1M40 A;  3PR6 A;  1ZG4 A;  2EA9 A;  5FQM A;  4ARZ A;  4JXG A;  3TW8 A;  2EXA A;  3PAE A;  4EWF A;  4HHD A;  3UPN A;  4DE2 A;  5AQB A;  2WGI A;  1C3B A;  4I3J A;  3SH8 A;  2O99 A;  2Z6C A;  3AGD A;  2V1A A;  3E2K A;  4MN5 A;  4N9L A;  1CEF A;  4NXB A;  1YLT A;  3FYZ A;  1WYC A;  5HX9 A;  2EWV A;  2XR0 A;  4HP4 A;  3A3D A;  3E4Q A;  3T4O A;  3W2Z A;  1H3Q A;  2Y2N A;  3BFE A;  1XGJ A;  1DJB A;  3VOZ A;  4H6J B;  4Y0T A;  4X55 A;  1BUL A;  4X1M A;  2ZQC A;  3PTE A;  4B9O A;  3LEZ A;  3IX8 A;  4PPR A;  2PU4 A;  4ZRR A;  3A3I A;  4AFI A;  1ESI A;  4U0T A;  3LI8 A;  3WS2 A;  2HPB A;  1V9Z A;  3N4I A;  2V8F A;  1N9O A;  5I5L A;  3LEQ A;  3V3R A;  3T1S A;  1S6R A;  3O86 A;  2XF3 A;  3F1P A;  1NRJ A;  1TS8 A;  1W63 Q;  2FZ0 A;  3JVV A;  5AQ9 A;  3N7W A;  5K5B A;  3HRE A;  4KQQ A;  3P7N A;  1ERM A;  3N8S A;  4PKY G;  2J9P A;  2VK3 A;  2HJE A;  1BLH A;  2JCH A;  3O5Y A;  4Y0U A;  2PDR A;  1OTI A;  4WM9 A;  3CLO A;  4LPZ A;  4EU0 A;  4M3K A;  3CI6 A;  5KZH A;  4UA7 A;  3NIA A;  3VFH A;  1XX2 A;  1ZG6 A;  3IF6 A;  3ZDJ A;  3H82 A;  4LGW A;  4DJ2 A;  3UO9 A;  4GW9 A;  3NBL A;  5J7E A;  3LR5 A;  1GHP A;  2Y2G A;  2WGW B;  3LIB A;  4WN5 A;  5DF7 A;  2XK1 A;  5IS1 A;  1S66 L;  2VA0 A;  2PAV P;  5CGW A;  5FAS A;  4OVD A;  2ZQA A;  3IXB A;  1IEL A;  2Y2I A;  2D02 A;  2ZBB A;  3IS2 B;  4QB8 A;  2LB5 A;  3BQA A;  4BBT A;  5AQA A;  3MFX A;  1JWZ A;  3E98 A;  3MQO A;  3ZFZ A;  4RX3 A;  3S7P A;  4S2N A;  2G7U A;  3L9K A;  1KE4 A;  4JGQ A;  2BAS A;  1BSG A;  3I7J A;  3Q81 A;  3HUN A;  3ZQ5 A;  2OWH A;  1OME A;  3BQ8 A;  1L3L A;  3GTC A;  4KEN B;  1OTD A;  4CPK A;  3RXW A;  5FQI A;  2VGL S;  1N9B A;  3HL9 A;  3P09 A;  1PRQ A;  3MS6 A;  3T4S A;  3ZG9 B;  3QNB A;  2QKP A;  5GHZ A;  1AWI A;  1LT0 A;  1X0O A;  3PBT A;  4MN7 A;  4E04 A;  3RFB A;  3ZCZ A;  3PYP A;  4X69 A;  3NJA A;  3H7W B;  4GS9 A;  1G6A A;  4JF4 A;  4CQH A;  1KE3 A;  5AVE A;  3JYI A;  1LSW A;  2G2W A;  4FCF A;  4GZB A;  4ZJ1 A;  3SOI A;  4S2I A;  5KSC A;  2WAE A;  5EFW A;  5E2F A;  5MC7 A;  3UDF A;  2OSU A;  5FQK A;  1IOU A;  2PT7 A;  1CF0 A;  4R6L A;  1WA9 A;  1OPX A;  5CED A;  3V39 A;  4HJ4 A;  1K25 A;  2E8J A;  3LI9 A;  5E43 A;  3W8K A;  1NYY A;  2DRW A;  1MXO A;  3FKW A;  3DTE A;  3WWX A;  1IEM A;  1MWR A;  3U4L P;  5L07 A;  2EFX A;  3KYE A;  3IWO A;  4C3Q A;  3IH9 A;  4F3L B;  2WUQ A;  4F94 A;  4QD4 A;  3ITA A;  4IUH A;  5EVI C;  4UQI M;  4RA7 A;  1WYB A;  2C5W B;  1GA0 A;  4WYY A;  4E3J A;  1N9L A;  1YMS A;  4DE3 A;  3DTI A;  4JKT A;  4GDB A;  2ZM2 A;  4FTX A;  1FQG A;  2B95 A;  1OJ5 A;  2ZM0 A;  4G3K A;  4DXC A;  1V9Y A;  5FI2 A;  5IT5 A;  4N1X A;  1NZO A;  1K55 C;  5HD3 A;  4HES A;  2GZA A;  3BW6 A;  4GJ4 A;  5EVE A;  1Z09 A;  1TDG A;  3LID A;  2W1T A;  4X56 A;  2A3U A;  4WBG A;  3ZGA B;  3KSG A;  3ZG7 B;  3ITB A;  1CEG A;  1XJ4 A;  4L9E A;  1G28 A;  4E6W A;  1W8Q A;  1Y4O A;  2Z2L B;  3OPR A;  1Z6F A;  2IA2 A;  1H8Z A;  4A5R A;  1NZU A;  3RH8 B;  3T4L A;  3SS5 A;  3T4T A;  2PBD P;  3WS1 A;  4B88 A;  4I5S A;  3CUE C;  2KLI A;  1FR1 A;  4EEU A;  3E4P A;  3WRT A;  1BTL A;  3DW0 A;  2V0W A;  4QHC A;  5CHM A;  5I94 A;  1SCW A;  1TS0 A;  5HZH A;  1H5X A;  3C2W A;  4BBU A;  1PZP A;  2PYP A;  4HNB A;  2GDN A;  2JN7 A;  2V20 A;  5EVI D;  3WRZ A;  3HLG A;  1NWZ A;  5DFX A;  1P0Z A;  4UAA A;  4II7 A;  5CER A;  4BL2 A;  3EEH A;  4KZ8 A;  4X68 A;  3T1R A;  3PBQ A;  2V0U A;  3CPT A;  2L0W A;  4K0X A;  2HGV A;  3BLM A;  4LRX C;  4YOF A;  3EQU A;  3HBR A;  5EOO A;  2EX6 A;  1F9I A;  4DE1 A;  5DVA A;  4GKU A;  2VGJ A;  4O01 A;  3EGX C;  2R78 A;  4YFM A;  1H8M A;  2DNS A;  4P6B A;  1L0F A;  4KZ3 A;  1BYW A;  3IWI A;  2Y79 A;  4IVI A;  4LCL A;  3VOL A;  3LGO A;  1IKI A;  4HEF A;  3LIF A;  4BEN A;  4OQ0 A;  3UN7 A;  3HLF A;  4GOG A;  2QMI A;  1UWN X;  5FAP A;  2QJ5 A;  5EVI A;  4IJG A;  3IF6 B;  3OBF A;  3BFC A;  4DE0 A;  4KZ4 A;  1ACF A;  1MWT A;  2A49 A;  1MC0 A;  3CIT A;  4OQG A;  4WEK A;  4OON A;  1EI5 A;  3HUO A;  1ERQ A;  1GSW A;  3D72 A;  2FH5 A;  5EE8 A;  5GLA A;  2W1R A;  5CHU A;  2PRF A;  5L2F A;  2QYB A;  5KMW A;  4FH4 A;  1IYO A;  3VP1 A;  1K55 A;  4R70 A;  1H8Y A;  5HW3 A;  2A24 A;  1O07 A;  2Y2K A;  3NUL A;  4NXG A;  3MXS A;  3VMA A;  3ZG8 B;  2XLN A;  1N9N A;  3VFF A;  1XJ6 A;  4OPZ A;  4QY5 A;  1FSW A;  5FEF A;  5FEG A;  1XKZ A;  4O0P A;  1PW1 A;  1CK3 A;  4WL9 A;  5FAQ A;  1EWZ A;  2X71 A;  2JKF A;  2P9V B;  2Q0O A;  4MN6 A;  2Y91 A;  3DBA A;  1S1Y A;  3CUE A;  4GHI A;  1KVL A;  2ZQ7 A;  3JVU A;  1F98 A;  5E2H A;  2VKS A;  1UGU A;  3OPH A;  1BUE A;  2ZQD A;  5DTS A;  3N8R A;  3VSL A;  3RJU A;  3C7U A;  3OCN A;  3BFF A;  2CMN A;  4RX2 A;  2PYR A;  5CEC A;  1L2S A;  3UY6 A;  4O7D A;  1T19 A;  3TOI A;  2KX6 A;  1SZV A;  2GNX A;  3DWK A;  1YSQ A;  4BJP A;  2ZOH A;  5F5Y A;  1GA9 A;  3VSK A;  1OTA A;  3LR4 A;  2VX8 A;  3IT9 A;  2IWC A;  4Q0I A;  3BM6 A;  3UMD A;  4I3I A;  4ETX A;  1DJA A;  4IUK A;  2QPN A;  4WZ5 A;  2J8Y A;  3LO7 A;  3UPP A;  3IXG A;  4S2N C;  3NDG A;  4S2M A;  2DCF A;  5F82 A;  1KGF A;  3N8L A;  2XH9 A;  4E6X A;  5DKK A;  4N9K A;  1Y28 A;  3BEB A;  4U3T A;  3Q7V A;  2OOL A;  3HUM A;  1N4O A;  1NLY A;  1W5D A;  3D4F A;  3GRJ A;  4WEL A;  3R7W A;  3DWZ A;  5F6A A;  1YM1 A;  1I5Q A;  5HAP A;  4NEE D;  2VZW A;  2ZLY A;  4MCW A;  1OTE A;  5DFY A;  3UB8 A;  3OC2 A;  3TE8 A;  1RCJ A;  3KYZ A;  2EWW A;  1K4E A;  4KQD A;  3QHY A;  4Q0H A;  4M4X A;  3UB9 A;  5EV0 A;  1ONG A;  5M18 A;  2XRO A;  4L9F A;  1PI5 A;  2W3D A;  1S4R A;  2B18 A;  3G2Y A;  5HD5 A;  3T1Q B;  1O7E A;  2V9A A;  3UE1 A;  5IU1 A;  3VP4 A;  2A2L A;  2OLV A;  3SS4 A;  4OKP A;  1DY6 A;  1KGG A;  5A93 A;  4MMN A;  2EX8 A;  3U2A A;  3MZD A;  4U0X A;  5EUA A;  1K6S A;  4GN2 A;  3BYD A;  4KG6 A;  3G34 A;  5GLB A;  3C7V A;  1SKO A;  4KQO A;  3HCY A;  1HTZ A;  4H8R A;  5J8X A;  4NK3 A;  2J3T C;  2ACG A;  5D3O A;  4OH0 A;  1QMF A;  3T4Q A;  3QP5 A;  3FG8 A;  1K56 D;  4Q0J A;  1LL5 A;  5DTT A;  3S22 A;  4CJN A;  2W0N A;  4Y5F A;  4EET B;  1LL9 A;  2H0T A;  1PYY A;  5FI7 A;  2D01 A;  1Y54 A;  2O9B A;  3EWK A;  3MMH A;  4P6Z S;  1MPL A;  3L7H A;  1T1C A;  3CPT B;  3QP8 A;  4R4R A;  5FQQ A;  5M1A A;  3MJQ A;  5FDS A;  3OPP A;  4X25 A;  3CAX A;  1TF1 A;  4JGR A;  4OLD A;  3K2N A;  4OOY A;  4GCZ A;  1ZTU A;  2OWJ A;  2DMW A;  5FQ9 A;  3P01 A;  1SHV A;  2WKP A;  1PFL A;  4EBL A;  4KUO A;  1K56 A;  5M19 A;  3F1O B;  1PI4 A;  1EW0 A;  2FFY A;  4MBK A;  2OV5 A;  4N92 A;  4RVA A;  4X53 A;  5L10 A;  2HF6 A;  2L4R A;  4IBR A;  2OAP 1;  1DRM A;  2Y59 A;  5JYO A;  1XGI A;  5HL1 A;  2VJW A;  2XRN A;  2BG1 A;  1XFQ A;  1VB6 A;  2Y55 A;  3Q82 A;  4KZA A;  1ODV A;  4LEN A;  4PM7 A;  1JWV A;  2Y2L A;  2J3T D;  4LV2 A;  3CWF A;  3E2L A;  3IHB A;  4R3J A;  5L09 A;  4HH3 A;  3LUQ A;  4Y0O A;  2P7J A;  1KGE A;  1JTG A;  4ZTK A;  3NOP C;  1GCE A;  3O88 A;  4CLC A;  3A0S A;  2A24 B;  4G3W A;  4EBN A;  1VET A;  3IQA A;  4JGP A;  1TEM A;  2O0Y A;  2EXB A;  1RGY A;  2ZMV A;  3MBZ A;  2XQZ A;  4Y15 A;  2Z6D A;  2PHY A;  4K91 A;  4ZBE A;  5HPF A;  5TBM A;  4OPY A;  4HI4 A;  3A0V A;  4BBV A;  2XFS A;  3V50 A;  4HQA A;  3M2K A;  4OP8 A;  2WKE A;  4EXO A;  3FPW A;  4OQI A;  3M6H A;  5DF8 A;  4PMA A;  2FFF B;  1BLP A;  2ZL1 A;  3PXP A;  2Y2O A;  4HIA A;  1LLB A;  4GD8 A;  3D3O A;  1LI0 A;  1YLW A;  3HLC A;  4LV1 A;  4HBU A;  1MZU A;  3Q1F A;  1HLU P;  2PU2 A;  4WZ4 A;  3V5M A;  2ZQ9 A;  4BQM A;  3HLD A;  3G6O A;  4KUK A;  3IX3 A;  3BFD A;  3E0Y A;  2EX9 A;  5HDS A;  3SH9 A;  3KYQ A;  4R0Q A;  3MZE A;  3TSG A;  1IYS A;  4R1G A;  4ME4 A;  1XA7 A;  4DMZ A;  3AGF A;  3UDI A;  3W4P A;  4X6T A;  1CJF A;  5HFO A;  5HPI A;  5F1G A;  5AVF A;  4R3A A;  1NLZ A;  4QWO A;  1LHY A;  4JPM A;  4ARZ B;  1ZKJ A;  2VV7 A;  2XGN A;  2BLS A;  2Y2J A;  5HWW A;  4HJ6 A;  3CJM A;  2EX2 A;  4KZ9 A;  4C75 A;  4UA6 A;  3BEC A;  2O9C A;  3S1Y A;  4OP5 A;  4JXS A;  1J9M A;  3G35 A;  4O8G A;  5TFQ A;  5EM1 A;  1YSP A;  1ZHH B;  2I72 A;  1WE4 A;  3EOI A;  2JC7 A;  4S2L A;  2ZQ8 A;  1L0G A;  1STZ A;  1W63 M;  3ZVT A;  3OOV A;  3C30 A;  2E8I A;  4KZ5 A;  4ZDX A;  1YPR A;  1HD8 A;  1TS6 A;  1J3W A;  3HVF A;  5F69 A;  5E2G A;  4NET A;  3SS3 A;  3MKF A;  1BLC A;  4JLF A;  3S7N A;  5G4Y A;  4JBF A;  5HAR A;  3FWL A;  1OTB A;  5CX7 A;  4WLA A;  3K3D A;  3HLW A;  2J7V A;  2HZ5 A;  3ZNY A;  2WGW A;  1K6R A;  3F1P B;  2H28 A;  4FH2 A;  5GL9 A;  1L0D A;  4LFU A;  4E3N A;  4BD0 A;  2X01 A;  4BLM A;  1XXM A;  4WZ5 C;  2VV6 A;  1FR6 A;  3EGD C;  3NI9 A;  2JBF A;  2B5R A;  5JYP A;  2XA7 M;  1NXY A;  1SKO B;  1YMX A;  4NXF A;  2K2N A;  1Q2Q A;  3MQ0 A;  4FUW A;  1K38 A;  1NJ4 A;  3V67 A;  3ULF A;  4OPQ A;  3LYX A;  1JVJ A;  2OLU A;  4ESP A;  4JF6 A;  2VEA A;  1CQA A;  2HP6 A;  1W7F A;  4LV3 A;  4PM6 A;  3H82 B;  3PBS A;  3ZNT A;  1G5U A;  3TG9 A;  1IYP A;  4L9G A;  4LLO B;  3B3X A;  4NKP A;  3B33 A;  5FL3 A;  1MWU A;  3G31 A;  2R9X A;  5EVL A;  1VEU A;  4PM9 A;  1VQQ A;  4QPR A;  4GLQ A;  3DTK A;  4JGO A;  4R38 A;  5DF9 A;  4MNR A;  4KG2 A;  2Y2P A;  5EOE A;  5TGF A;  1XP4 A;  1LL8 A;  1DP9 A;  3H7W A;  2XSS A;  3MXQ A;  4XXR A;  1TDL A;  3PHY A;  2WKI A;  1FCN A;  1TS7 A;  4C6Y A;  4I38 A;  2H5S A;  3KSF A;  3BJN A;  4XT2 A;  2WKQ A;  4DKI A;  4LRY C;  2HDU A;  4IVK A;  4WMC D;  3PBN A;  2INW A;  1SDE A;  3IBJ A;  2ZJ9 A;  4S2P A;  3NEC A;  3ICY A;  3LR3 A;  2NUP C;  1RP5 A;  3DTM A;  1AXB A;  1ES4 A;  3O87 A;  4ID4 A;  2HP9 A;  1MKM A;  4UQI S;  3QP4 A;  4DDY A;  3FPV A;  1ONH A;  4HBT A;  2H0Y A;  3BY8 A;  1FSY A;  4LV0 A;  2ZMA A;  4YWZ A;  3IXH A;  4GS9 B;  3BY9 A;  3VV4 A;  1DP6 A;  3M6B A;  3VP3 A;  3VOY A;  1PIO A;  3NOU C;  2K7S A;  2LB9 A;  4EUV A;  4FD8 A;  1ERO A; 
#chains in the Genus database with same CATH homology
 2VGL M;  3T4Q A;  3LI9 A;  3FG8 A;  4Q0J A;  4B93 A;  4F3L A;  2W0N A;  4Y5F A;  4YNR A;  4EET B;  3HJI A;  3NHQ A;  2W3E A;  3IS2 A;  2GJ3 A;  1GSX A;  2JKR M;  2D01 A;  2O9A A;  2O9B A;  3EWK A;  5DJT A;  3MR0 A;  3MMH A;  4PAU A;  4F3L B;  3C8C A;  4P6Z S;  3OLO A;  1T1A A;  4IUH A;  1T1C A;  4UQI M;  2J80 A;  5HSQ A;  1N9L A;  2ZMF A;  3GDI A;  1DP8 A;  1S4S A;  3F1O A;  3MJQ A;  5F68 A;  2QHK A;  5LBR A;  3CAX A;  1TF1 A;  3UB6 A;  3HJK A;  4JGR A;  3TRC A;  3K2N A;  2NUT C;  3A0R A;  4L0L A;  4Z1W A;  2WKR A;  4GCZ A;  1OJ5 A;  1ZTU A;  2OWJ A;  4K08 A;  4NXE A;  4G3K A;  1V9Y A;  2DMW A;  5IT5 A;  4FSF A;  4DN0 A;  3P01 A;  3EEA A;  2KDK A;  2PD8 A;  5DJU A;  2WKP A;  3F1N B;  5HD3 A;  3ZYT A;  4KUO A;  2GZA A;  3BW6 A;  4GJ4 A;  1P9W A;  3F1O B;  2JKT M;  1EW0 A;  2ZOI A;  3KX0 X;  4OOL A;  2JHE A;  4WUJ A;  3LID A;  2HF6 A;  2P04 A;  2L4R A;  2W1T A;  3LIC A;  2OAP 1;  1T1B A;  1DRM A;  3PBO A;  3EQV A;  4ETZ A;  2VJW A;  2XRN A;  2W3F A;  3KSG A;  2OAQ 1;  1XFQ A;  1VB6 A;  1XJ4 A;  2M7V A;  4L9E A;  1G28 A;  5HWT A;  4CLC C;  3LIA A;  1ODV A;  3VE3 A;  2Y8H A;  2IA2 A;  4P6Z M;  3RH8 B;  2J3T D;  3T4L A;  3CWF A;  3T4T A;  4I5S A;  2M7U A;  2W1T B;  4HH3 A;  3CUE C;  2KLI A;  3LUQ A;  2P7J A;  4EEU A;  4PKY A;  3NOP C;  5KSH A;  3E4P A;  4CLC A;  3H9W A;  3A0S A;  2A24 B;  2V0W A;  4G3W A;  4JGP A;  1LSX A;  2W3H A;  5J4E A;  2XA7 S;  1JNU A;  1TS0 A;  4PHT A;  3NOT C;  2O0Y A;  4UEY A;  4HH2 A;  2ZMV A;  5HZH A;  4BBU A;  3C2W A;  2Z6D A;  2PHY A;  5HPF A;  3TJZ C;  5TBM A;  3UE6 A;  4HI4 A;  1KOU A;  2PYP A;  3A0V A;  2B02 A;  4HNB A;  4BBV A;  4Y3I A;  4HQA A;  2JN7 A;  3KO6 A;  4CLC B;  3T4K A;  4EW7 A;  1NWZ A;  5DFX A;  4EEP A;  1P0Z A;  2HJ9 C;  2M1C A;  1TD5 A;  4EXO A;  4EER A;  3FPW A;  4II7 A;  1OT6 A;  3EEH A;  2I9V A;  3PXP A;  2W27 A;  3PBQ A;  2V0U A;  5TBM B;  2L0W A;  4HIA A;  2HGV A;  3IBR A;  4LRX C;  3LFV A;  4YOF A;  5TJJ A;  3EQU A;  3D3O A;  3PBR A;  2J3W A;  2PR6 A;  1S1Z A;  1F9I A;  3KSI A;  1MZU A;  4WF0 A;  4O01 A;  2QJ7 A;  3EGX C;  1YKD A;  2R78 A;  3VE4 A;  2YKH A;  1H8M A;  1XJ3 A;  1GSV A;  3GEC A;  3F1N A;  5AJG A;  3OCL A;  3UB7 A;  1BYW A;  2Y79 A;  3PR6 A;  3G6O A;  4KUK A;  2EA9 A;  1XJ2 A;  3VOL A;  4ARZ A;  5HDS A;  3E0Y A;  5C5K A;  3KYQ A;  3E4O A;  3TW8 A;  4CLC D;  3LIF A;  3T50 A;  4HHD A;  1S67 L;  4ME4 A;  4DMZ A;  1UWN X;  2QJ5 A;  4IJG A;  2K31 A;  3OBF A;  3K3C A;  4I3J A;  5HPI A;  2O99 A;  5AVF A;  4R3A A;  4EQ1 A;  1MC0 A;  3CIT A;  1NLZ A;  4WEK A;  4ARZ B;  2VV7 A;  2Z6C A;  1GSW A;  3D72 A;  2FH5 A;  2W1R A;  5HWW A;  2QYB A;  2V1A A;  4MN5 A;  4HJ6 A;  1G6O A;  2PR5 A;  4NXB A;  4R70 A;  4HP9 A;  2A24 A;  2O9C A;  3BWL A;  4FOF A;  4Y2F A;  1IFQ A;  4NXG A;  4O8G A;  4BMW A;  2EWV A;  4HP4 A;  3E4Q A;  3T4O A;  1YSP A;  1ZHH B;  3W2Z A;  1N9N A;  1H3Q A;  3EOI A;  1XJ6 A;  4H6J B;  5HDC A;  4B9O A;  1STZ A;  1W63 M;  4WEJ A;  4O0P A;  4WL9 A;  2VV8 A;  3OOV A;  3C30 A;  1UWP X;  4ZRR A;  3UE3 A;  4HJ3 A;  4MN6 A;  4AFI A;  1TS6 A;  3DBA A;  2QWS A;  1S1Y A;  3CUE A;  3LI8 A;  4GHI A;  3KSH A;  5F69 A;  3JVU A;  2P08 A;  1F98 A;  1V9Z A;  2JKR I;  3MF0 A;  1N9O A;  1D7E A;  5I5L A;  5HWV A;  2VKS A;  1UGU A;  4DJ3 A;  3F1P A;  1NRJ A;  3S7N A;  3LIE A;  1TS8 A;  1W63 Q;  5G4Y A;  2GX5 A;  2FZ0 A;  4XT2 B;  3JVV A;  1OTB A;  1P97 A;  3OCN A;  5K5B A;  5CX7 A;  4WLA A;  3P7N A;  4PKY G;  4GHI B;  2CMN A;  2PYR A;  3K3D A;  2YKF A;  2HJE A;  3O5Y A;  1P9R A;  2PDR A;  1OTI A;  3CLO A;  4LPZ A;  3F1P B;  3B42 A;  1T19 A;  4EU0 A;  2H28 A;  4G3V A;  3CI6 A;  2KX6 A;  3S7Q A;  4BWI A;  2GNX A;  1YSQ A;  4BJP A;  2VV6 A;  2ZOH A;  3EGD C;  5F5Y A;  3H82 A;  4DJ2 A;  4GW9 A;  5J3W A;  2JKT I;  5J7E A;  1OTA A;  3LR4 A;  4CLC E;  2XA7 M;  3LR5 A;  2VX8 A;  4NXF A;  3B47 A;  4Q0I A;  2PD7 A;  1T18 A;  2K2N A;  3UMD A;  3LIB A;  4I3I A;  4WN5 A;  4ETX A;  5IS1 A;  3MQ0 A;  3C38 A;  3UME A;  3V67 A;  4IUK A;  3ULF A;  1S66 L;  2VA0 A;  3LYX A;  5DKL A;  2VEA A;  2HV1 A;  3H82 B;  3PBS A;  2D02 A;  2ZBB A;  3IS2 B;  4L9G A;  4LLO B;  4EES A;  2LB5 A;  3BQA A;  5DKK A;  4BBT A;  4NKP A;  3B33 A;  5FL3 A;  1Y28 A;  3MFX A;  3E98 A;  5A8B A;  3MQO A;  4H6J A;  2OOL A;  3FC7 A;  1OT9 A;  5HL6 A;  1NLY A;  3S7P A;  2G7U A;  1XFN A;  4QPR A;  4GLQ A;  4JGO A;  4R38 A;  4JGQ A;  2BAS A;  5DF9 A;  4WEL A;  3R7W A;  3ZQ5 A;  2V1B A;  5F6A A;  2OWH A;  3BQ8 A;  3T4J A;  1LL8 A;  4NEE D;  1DP9 A;  2VZW A;  3H7W A;  4MCW A;  1OTE A;  1OTD A;  2XSS A;  3MXQ A;  5DFY A;  3UB8 A;  3OC2 A;  3TE8 A;  2VGL S;  1VHM A;  3PHY A;  1TS7 A;  3T4S A;  2L1M A;  2W3G A;  4I38 A;  2QKP A;  2EWW A;  3KYZ A;  3KSF A;  3BJN A;  4KQD A;  1LT0 A;  5G4Z A;  1X0O A;  3PBT A;  4MN7 A;  4Q0H A;  3R7W B;  4E04 A;  4M4X A;  4XT2 A;  2WKQ A;  3RFB A;  3PYP A;  3UB9 A;  3LR0 A;  4LRY C;  3S7O A;  4HOI A;  3NJA A;  3H7W B;  4GS9 A;  2XRO A;  3PBN A;  2INW A;  4CQH A;  3IBJ A;  4L9F A;  3SW1 A;  2W3D A;  3RTY A;  3ICY A;  1OJG A;  1S4R A;  2B18 A;  2VLG A;  3LR3 A;  1D06 A;  5HD5 A;  2NUP C;  5AVE A;  5KIZ A;  4I3A A;  2V9A A;  1MKM A;  3MQQ A;  4UQI S;  5HDD A;  4HY8 A;  3FPV A;  5IU1 A;  1LSW A;  1F5M A;  2A2L A;  1YAX A;  3BY8 A;  4MMN A;  3U2A A;  4YWZ A;  4GS9 B;  3BY9 A;  3VV4 A;  1DP6 A;  5EFW A;  3R4K A;  4OOM A;  2KOI A;  5MC7 A;  4RQ9 A;  2MJ6 A;  1LSV A;  1IOU A;  2PT7 A;  4KQO A;  3HCY A;  5L8M A;  4R6L A;  4LRZ E;  4IHQ A;  1WA9 A;  1OPX A;  3NOU C;  2K7S A;  2LB9 A;  4I39 A;  4EUV A;  2J3T C;  4HJ4 A;  4MDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...