5DKKA

Structure of the dark-state monomer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Blue light-induced LOV domain dimerization enhances the affinity of Aureochrome 1a for its target DNA sequence.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
molecule tags Signaling protein
molecule keywords LOV domain
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dkkA00
2PD7A 3MR0A 1LSVA 5F69A 1KOUA 4NXGA 1OJGA 3MQOA 2VV8A 3BY8A 3ZQ5A 2I9VA 2OWJA 4EXOA 4LRXC 1GSXA 5HDSA 3A0SA 3BY9A 4BBTA 4H6JB 3UB7A 1T1BA 3VOLA 3EWKA 3MFXA 4KUOA 4B9OA 4LRZE 1VB6A 4GS9A 4KUKA 4XT2A 2HV1A 4NXEA 2L1MA 4HH3A 5AVEA 3T50A 1F9IA 4I3JA 5G4ZA 3RH8B 3C8CA 4PKYA 1DP8A 5DKKA 5HWWA 2QJ7A 4I5SA 4E04A 5DJUA 1LT0A 2ZOIA 1OT9A 3BWLA 3LIDA 4JGPA 4M4XA 4GW9A 3MXQA 4LPZA 5IS1A 2QHKA 2KX6A 3HJKA 1N9OA 1Y28A 2QJ5A 4KQDA 4HOIA 3F1OA 5AVFA 1JNUA 1XFQA 1LSWA 4DJ2A 2OWHA 2GJ3A 4EW7A 3F1PA 3B33A 3E4QA 3H7WA 2W27A 3IS2A 4I38A 4HH2A 3LIAA 3PYPA 4K08A 3CLOA 3LIEA 3PHYA 4PKYG 2Z6DA 1WA9A 4WL9A 2V0UA 3UB6A 5HWVA 5KIZA 1XJ6A 1TS8A 2JHEA 4I39A 4XT2B 1DP9A 1OJ5A 4HJ6A 3K3CA 4HQAA 4HP4A 2Z6CA 4WN5A 2YKHA 4HNBA 1P0ZA 5F5YA 3E4OA 5I5LA 3SW1A 3F1NB 1MZUA 2ZBBA 5HDCA 3NOUC 4JGQA 1X0OA 1S1YA 4HI4A 3UMDA 3KX0X 3F1PB 3FG8A 3GDIA 2VV7A 2A24A 5G4YA 1TS6A 3NOTC 4HJ4A 5F68A 3UMEA 1T19A 3FC7A 1GSVA 1OTIA 3OLOA 4L9GA 4LRYC 5J7EA 2B02A 3NHQA 2W0NA 4HJ3A 4HIAA 5DJTA 3RTYA 3LIBA 4EERA 4DJ3A 2V0WA 4EESA 1D7EA 4JGOA 1S1ZA 4MN6A 4WF0A 3A0RA 4I3IA 2JN7A 1S4RA 1F98A 3HJIA 5F6AA 2OOLA 2M1CA 3UB8A 1P97A 4I3AA 4JGRA 3H82A 1LL8A 3ICYA 4HY8A 1XJ2A 4WLAA 1T1CA 3H82B 2PYRA 1UGUA 4NXFA 4R3AA 4EEUA 4F3LB 1D06A 3LI9A 1V9YA 3MJQA 2CMNA 1EW0A 1V9ZA 4WUJA 4EETB 5HSQA 4RQ9A 1XFNA 5HWTA 3CAXA 2V1BA 1N9NA 1DRMA 4HHDA 4L9EA 5HD5A 3F1OB 2J80A 2P7JA 1OTAA 2PR5A 2WKQA 2ZOHA 2D01A 1XJ4A 3UE6A 5IU1A 2V1AA 3VE4A 3C2WA 3H7WB 1S67L 2PYPA 3NJAA 2L4RA 1OT6A 2VV6A 2KDKA 3CWFA 4GHIA 4BBUA 3LUQA 3H9WA 1UWNX 4F3LA 4L9FA 3NOPC 5J4EA 2R78A 2VLGA 2D02A 2L0WA 1BYWA 3E4PA 2EA9A 3LYXA 1S4SA 1TS7A 2H28A 3K3DA 3VE3A 2V9AA 4H6JA 1OTDA 1TS0A 2VEAA 4GHIB 3EEHA 3LICA 5DKLA 5HZHA 1NWZA 2WKPA 4HP9A 3IBRA 4GS9B 1T1AA 1N9LA 2PR6A 3P7NA 3ULFA 4LLOB 2YKFA 3GECA 4GCZA 4EQ1A 2A24B 1UWPX 3UB9A 5A8BA 1GSWA 3G6OA 1XJ3A 5J3WA 1OTEA 2PHYA 4R6LA 1S66L 3D72A 1OTBA 2QWSA 2PD8A 5HD3A 5HDDA 5TBMA 3LI8A 4BBVA 5TBMB 1ODVA 3A0VA 3MQQA 3IS2B 4YWZA 2QKPA 2BASA 1DP6A 2PDRA 2WKRA 5EFWA 4EEPA 4NXBA 4R70A 2K7SA 4R38A 1T18A 2INWA 4MN5A 1G28A 1LSXA 3LIFA 3F1NA
chains in the Genus database with same CATH superfamily
1CI8A 2E8IA 2V20A 2XA7M 1KOUA 4NXGA 2EWWA 2OWJA 3FV7A 1L0DA 4H6JB 3G31A 4Y0UA 3UE1A 4XT2A 5GLDA 4S2JA 3IXBA 2ZQAA 4PKYA 3ZNYA 1YLTA 1NY0A 3BYDA 2HP9A 2QPNA 1KVMA 4GN2A 3KSHA 4P87A 2ZC4B 3HLBA 3B33A 5GLCA 4LFUA 4WL9A 4QJGA 2JE5A 2EX2A 3MS6A 5KIZA 3DBAA 4HP4A 4WBGA 2ZBBA 3UN7A 4G3KA 4MN6A 3VFHA 4Y0OA 3UB8A 3UDIA 4DDSA 5FQKA 4LV1A 4EETB 3LFVA 3IQAA 1KGEA 1TDGA 3CAXA 4HHDA 3F1OB 2ZOHA 3MBZA 5AQ7A 2X02A 1JTDA 5GHZA 5GL9A 4H8RA 1LI9A 1G5UA 1W8QA 3LR4A 3SZTA 4IVKA 2W3HA 3Q7ZA 3DW0A 3ZCZA 2J3TC 4KENB 3W2ZA 2ZMVA 3GRJA 2PDRA 1XKZA 1WE4A 4PMAA 2J8YA 1U60A 2HDUA 1LHYA 1P9RA 1RCJA 2JKTI 3WS2A 2FZ0A 4KZAA 1M6KA 3BRMA 5DVAA 4EBPA 1XGJA 4FUWA 3VOZA 1ZKJA 2P9VB 3SH7A 1FSYA 3H7WA 2EXAA 2VGLS 2P04A 3N8SA 4E3MA 5CHJA 4I39A 2B95A 3SS5A 3NOUC 4ARZA 1BT5A 1TS6A 3NOTC 3U2AA 4DE1A 2JN7A 4O7DA 1F98A 1NLZA 3OBFA 2R9WA 4R3AA 3P09A 3MJQA 3PBRA 3GTCA 2V1AA 2JKRM 2XK1A 3LUQA 4KZ7A 3BFCA 5J8XA 1S4SA 2H28A 4WELA 4S2PA 3P7NA 1FCNA 2HDSA 3C4OA 1ERMA 4NKPA 4PAUA 2PD8A 3U4LP 3T1SA 5A92A 3VP2A 4I3IA 2XF3A 3MF0A 3MR0A 3BY8A 4U0XA 5FDHA 2Y2MA 3QP4A 2NUPC 3HLWA 4U0TA 5CHUA 3UNWA 3NC8A 4S2LA 1GA0A 2H5SA 3N6IA 1YM1A 4OQHA 3BWLA 3BFEA 3ITAA 1K54A 4EW7A 4EUVA 4LV2A 2LB5A 4I38A 4HH2A 1PWGA 3UB6A 1E3UD 4HJ6A 5F5YA 5EM0A 4N1XA 3F1NB 1GCEA 5G4YA 2ZC6B 4MMNA 4L9GA 2EFUA 4QD4A 3HJIA 3ZVWA 4WUJA 2W3FA 3BFGA 4L9EA 4LGWA 4NETA 4GLQA 1PYYA 1LI0A 3G34A 2XD5A 4PM9A 1G68A 5A93A 5CEBA 2R9XA 1OT6A 1PFLA 2M7VA 1CQAA 3LYXA 1JVJA 4WMCD 4H6JA 4E3LA 1FR6A 1BSGA 3IH8A 5TFQA 3G6OA 4S2OA 2PHYA 3EEAA 4PM8A 2A2LA 3RXWA 1ZG4A 3MQQA 3IS2B 1BLHA 2OAP1 1YT4A 4G3WA 2WGWA 4R38A 2INWA 3PBSA 4L0LA 3LIFA 3UE3A 4P6ZS 3UE0A 4B93A 1PWCA 1I2WA 3A0SA 3OCLA 2HJ9C 1PIOA 4X6TA 4GS9A 3Q1FA 4S2IA 3T4QA 2FFFB 4I3JA 5DKKA 2VGJA 4MN7A 2PRFA 1H5XA 3SH9A 2XSSA 4HBUA 5FAPA 4C3QA 2OSUA 1H8YA 1K4FA 2J9PA 3C7VA 2W27A 4ZTKA 4ZJ3A 1J9MA 1PZOA 2WGVA 4QHCA 1TS8A 3C4PA 1QMFA 4D2OA 2EFXA 2W3DA 4RYEA 2W3EA 3UMEA 1I2SA 3HVFA 4JGOA 5TJJA 3W4PA 4HY8A 5D3OA 1UGUA 5CRFA 5FATA 4ZJ1A 2K2NA 1N9NA 5FQMA 5FQIA 1IEMA 4K91A 2ZC7A 4GNUA 3S22A 5IU1A 3VE4A 2LB9A 2WZXA 4DDYA 1SKOB 4BLMA 2W3GA 3UDXA 5HX9A 4BBUA 2ZQ8A 1YLPA 4JF5A 4O0PA 5M1AA 5FASA 3PYPA 1BYWA 1ZHHB 1K57C 3UO9A 2ZM0A 3ZGAB 2PR6A 3S7QA 1GSWA 2PU4A 2DNSA 2O9AA 4GDNA 4LENA 2QKPA 1NRJA 2WKRA 1T18A 3Q07A 3C5AA 3KO6A 2WUQA 4XXRA 1D1JA 3E0YA 1ACFA 2VA0A 1M40A 1PRQA 4OOMA 4KG2A 5FAQA 2Z2MB 3DWZA 4JF6A 3RXXA 4E6WA 3CPTB 4GD6A 1K6RA 3AGDA 2FH5A 3E4QA 2X01A 3B47A 5HWVA 2K31A 1S0WA 4IUHA 2Y2PA 4KZ9A 1CK3A 4G3VA 2Y2NA 3OC2A 2WADA 3ZHHA 3HUNA 3IWQA 1LLBA 3LR0A 2A24A 1T19A 4MBHA 4EERA 4UEYA 1S4RA 3ZVTA 3TG9A 2BG1A 2BLSA 2P9VA 2WGWB 2ZQ9A 4R3JA 3IX3A 1VHMA 2J80A 2ZC3B 1K54C 2VGLM 3EQVA 5AQ9A 2KDKA 4C6YA 1ZTUA 4RX3A 5HL6A 3T1XA 4HBTA 4JBFA 2EA9A 1FIKA 3DTEA 5JYPA 2V2FF 3HLCA 4IVIA 1YQSA 3O5YA 4Q0IA 1YMSA 3FYZA 3M6BA 1PWDA 2VV8A 3FWLA 5DF7A 4XUXA 3AGEA 3E2LA 4BD1A 3OPRA 3VOLA 4JKTA 5L07A 5IHVA 2ZD8A 4R1GA 2UV0E 5HAQA 3LIDA 1OT9A 3ZG8B 2E8JA 3IH9A 1XX2A 5FDSA 5TGFA 3DAVA 5CX7A 1JNUA 4D60A 3BEBA 3WWXA 4X1LA 1L0FA 3NDGA 3RFBA 1CF0A 2V0UA 4FD8A 4X56A 1XJ6A 3E4OA 3CUEC 2XA7S 2ZL1A 1TF1A 1F2KA 3IT9A 1ONHA 3T4LA 4ARZB 3VP3A 3T4KA 1ESIA 3H82A 4NXFA 3BLMA 5GLBA 3E2KA 4DF6A 3MXSA 4XUZA 3UPNA 2J9OA 2NUTC 3JVUA 1OTAA 1XP4A 3GQZA 2PYPA 1MKIA 3CWFA 3H9WA 3A3IA 4KZ8A 3KYQA 4GOGA 3Q7VA 4P85A 5EVIA 2Y2LA 2DMWA 2JC7A 3LEQA 4LLOB 5BOHA 1WYBA 1EI5A 3UB9A 4BL3A 3V67A 1S66L 5L09A 5CTNA 1XA7A 5HDDA 5AJGA 1H8ZA 1DP6A 2B18A 2GNXA 3UY6A 1BLSA 4PHTA 2PBYA 1YLJA 5E2EA 5E2HA 3F1NA 4WM9A 5EOOA 2GDNA 1GA9A 3TSGA 3JPUA 4GJ4A 4ZJ2A 1Q2QA 2EX6A 5EVID 1PI5A 5EVIC 3Q81A 4NG2A 3SH8A 4EBNA 3N4IA 3MXQA 2HP6A 1MXOA 4JXGA 3EQUA 3F1OA 1LSWA 3P98A 5C5KA 3RJUA 4KG5A 1FR1A 3WS0A 3PAGA 3LO7A 1K4EA 3LIEA 4GKUA 2JKGA 1W63M 4XT2B 4MDZA 3NULA 1PW8A 5EE8A 5AQAA 2B5RA 2VV7A 3UMDA 4O8GA 4ETXA 4OOYA 3RTYA 4Z9QA 3QP1A 3R4KA 3UB5P 2OOLA 4B4XA 3PBOA 2PYRA 5MC7A 1D06A 3L9KA 1V9YA 2CMNA 4PM5A 4RA7A 1DRMA 2BTFP 2A49A 4GDBA 3A3JA 3ITBA 2JKRI 1YSQA 2VEAA 5DKLA 2MJ6A 3K2NA 2Q0OA 3GECA 1IYQA 4EQ1A 3NIAA 2A24B 2XR0A 1ES4A 1L3LA 3PBTA 4BBVA 3LY3A 3GSGA 5F1GA 4DKIA 1STZA 1CEFA 4Y15A 4I5SA 3DTMA 1W63Q 3BECA 3HCYA 4X68A 4WEKA 1OJGA 1EROA 3BY9A 4S2NA 2ZM2A 3LGOA 3MZEA 4QB8A 2HPBA 2Y2IA 2VGKA 1YPRA 3CI6A 4R4RA 5HWWA 1LT0A 3ZG0A 3BM6A 4X55A 3ZNTA 2WKEA 3UPPA 4OPRA 3VP4A 1Y28A 2HP5A 1ESUA 2VX8A 2GJ3A 1IYOA 4BJPA 4BWIA 2H10A 2WAFA 2C6WB 3P01A 3IF6C 2Z2LB 3CLOA 2ZMAA 3EOIA 2O9CA 4HNBA 1P0ZA 1VETB 1HD8A 1MZUA 4ZBEA 1NLYA 1O07A 5EV0A 1K25A 1SCWA 1A0KA 3NHQA 3UPOA 3A3EA 1S1ZA 4WF0A 1NRFA 3PR6A 4JGRA 1LL8A 3JYIA 5E43A 4NEED 4Y3IA 3C7UA 4II7A 4F94A 2V1BA 2EX9A 2PR5A 3IHBA 5HL1A 4E3KA 3IF6A 4DRTA 1WYCA 4IEDA 3EGDC 1HLUP 4FTXA 1ONGA 5FI6A 1IFQA 1TS0A 3KSGA 3EEHA 1JWVA 5HZHA 2WKPA 4HP9A 1L0GA 3OPLA 3V3SA 5IT5A 4DXBA 2EXBA 3C30A 2HDRA 1G6OA 4DMZA 1AWIA 1PNEA 3T1RA 3ZQ5A 4IBXA 4QPRA 1MY8A 2O0YA 3VP0A 3MFXA 5EUAA 1K55C 3IX4A 1F9IA 4ZAMA 4B4ZA 4Y7PA 1RGZA 5E2FA 2QJ5A 2OV5A 3SOIA 4Y0TA 1IKGA 2Z6DA 1CJFA 1XA1A 2XFSA 4QWOA 1K0KA 5FL3A 4DE2A 4HI4A 1DJAA 2W0NA 4WZ5C 3BFDA 5J4EA 2M1CA 4WLAA 3ISGA 3OPHA 4JF4A 3G2YA 3G35A 3HLDA 1N9BA 3BJNA 3LY4A 4LV0A 1NJ4A 2VLGA 2AVXA 5G18A 3N7WA 4MLLA 3IBRA 5EVIB 4MBFA 1N9LA 2RL3A 3C38A 1NYMA 2ZJ9A 2OLVA 2IWDA 4QY6A 3D72A 4YNRA 3LI8A 3KSIA 2Y4AA 5FI7A 2O99A 3W4OA 5CGSA 3NBLA 4UHUA 5HFOA 1L0EA 4MN5A 2IWCA 5F82A 3S7OA 1TVFA 3CITA 1I5QA 2XRNA 1P9WA 3N8RA 4GZBA 3BW6A 3TE8A 5DTSA 3QP5A 1BLPA 2OAQ1 4LRZE 4OPZA 3W4QA 1GHMA 2L1MA 1SDEA 2I72A 3HLGA 2XH9A 5AVEA 4WMCA 2UWXA 4OLGA 4OONA 1YLZA 1SKFA 4R3BA 2QHKA 3E98A 3O87A 3NCKA 1N9OA 4PM6A 1BULA 1XFQA 3A3DA 3FKVA 4U3TA 2XROA 3O88A 3W8KA 3LCEA 1S6RA 1VETA 4PKYG 2XFTA 1ERQA 1WA9A 1DP9A 1KDSA 5FEFA 4EWFA 5HPFA 2X71A 3FC7A 5J7EA 1IYPA 3V3RA 3EGXC 4HJ3A 5DF8A 2V0WA 1W5DA 4UQIM 4EESA 3S7PA 3ZG9B 3VOYA 4ZDXA 3IXHA 5CXWA 5F68A 3GV9A 1YAXA 1E3UA 3QHYA 1KDWA 3LI9A 1KE0A 5HWTA 4Z1WA 4E6XA 2P7JA 3G2ZA 5DTKA 2Y2JA 1VEUA 2VV6A 4Q0HA 4WYYA 3CJMA 2J3TD 4OQGA 4OKPA 5FI2A 2Y8HA 2RCXA 3S1YA 3ULFA 2YKFA 3PXPA 3QP8A 2QWSA 5TBMA 2G2UA 5U47A 3S4XA 4BQMA 3O86A 1VQQA 1IKIA 4JXVA 1FSWA 3VSKA 4DE0A 5M19A 1NYYA 2H0TA 4Q8IA 5EM1A 5CEDA 4OH0A 3C8CA 1VEUB 4LPZA 2KLIA 3HL9A 1SHVA 2A3UA 2ZC5B 4DXCA 3G4PA 2DRWA 2Q9MA 3VV4A 4PM7A 4FSFA 3NECA 5KSCA 3WRTA 4EV4A 3OZHA 1LL5A 3LIBA 1D7EA 4KZBA 2XGNA 4KZ6A 1IYSA 1T1CA 3V5MA 1ZG6A 3FPWA 3WS5A 1MBLA 5DF9A 4IUKA 1XFNA 1Z6FA 1YKDA 3Q7VB 5HD5A 1W7FA 4IBRA 2Y2HA 3NJAA 2L4RA 4GHIA 3I7JA 1SZVA 4Y13A 1TS7A 3K3DA 2JKTM 2IA2A 1NWZA 5HAIA 1FOFA 4GCZA 4S2MA 5GLAA 4OQ0A 3ZG7B 1EWZA 4EEPA 3LR3A 4NXBA 4S2NC 4DN0A 4R0QA 4KZ4A 4KQQA 1G28A 5CGWA 4MBKA 2J3WA 1NXYA 1LSVA 3GVBA 3QNCA 4EXOA 4OP5A 1N4OA 5HDSA 4CLCD 3IBJA 4S2KA 1Y4OA 4KUKA 5K5BA 3MZFA 5DTTA 4NXEA 5GHXA 5HARA 2M7UA 1W8YA 5G4ZA 1DP8A 1C3BA 4QU3A 5F83A 4K0XA 4P6BA 3MSHA 2H0YA 5CECA 3G32A 1NZUA 3NDEA 1JWPA 1CEGA 1IOUA 5GHYA 3HJKA 5CGXA 1MKMA 4HOIA 4OQIA 2QZ6A 2XQZA 4RX2A 4GD8A 4CJNA 1K6SA 3T4SA 2ACGA 3G30A 1Y54A 3MMHA 3SW1A 2VZWA 5FAOA 5CERA 3KX0X 3FG8A 3IF6B 1GSVA 5DJTA 1K55A 3HBRA 1P97A 4OLDA 5LBRA 2WGIA 4F3LB 1F5MA 1EW0A 2FFYA 1Q2PA 3V39A 3UE6A 4GB7A 5EECA 3H7WB 3NY4A 2ZQDA 5EOEA 3O3VA 2R78A 1YLWA 5A90A 1HTZA 3L7HA 4DE3A 1H8MA 4GS9B 4OVDA 3UDFA 1H0MA 4BENA 3B42A 5A8BA 3T1QB 3D4FA 5HD3A 1MWUA 3ZFZA 1G6AA 1O7EA 3A0VA 4Y5FA 1H3QA 3WS1A 1KGGA 2P08A 2Y59A 3T12B 2PD7A 4CLCC 2HF6A 3PAEA 4LRXC 4E3NA 2VK3A 4A5RA 4B9OA 4P0MA 4ME4A 2Q9NA 5FQJA 1K57A 4E3JA 1ALQA 1KE4A 4GW9A 5EVEA 5L2FA 5KMWA 1MWTA 5AVFA 1ZC2A 2OWHA 4C75A 4EQIA 2JCHA 3LIAA 3GMWA 2JHEA 1OJ5A 1RP5A 2Z6CA 3BLSA 2DCFA 4HESA 4UA6A 3GDIA 1ES2A 3OLOA 1OTIA 3CMZA 4AFIA 4X53A 2C5WB 5HW3A 5EPHA 1FILA 4CLCE 4I3AA 4OPQA 3H82B 4WZ5A 3LEZA 1E4DA 3IF5A 2XLNA 1SDNA 3BFFA 1BTLA 3FPVA 4JXWA 4YFMA 4F3LA 1XPBA 1FQGA 2L0WA 3VE3A 4CLCB 5A91A 3IX8A 3QP6A 1T1AA 5FEGA 3IWOA 4EBLA 1KE3A 3MXRA 1BLCA 4B88A 4HEFA 1KGFA 5TBMB 3PTEA 3MQ0A 3IHAA 5I94A 3S7NA 4N9KA 4NK3A 1YSPA 2V8CA 1JWZA 5EFWA 2VKSA 1K56A 4BMWA 4E3IA 4KG6A 3R7WA 1HVBA 1GHIA 3HLFA 1MC0A 1MPLA 4KZ5A 4BL2A 3CUEA 2XEPA 1XGIA 2QYBA 2I9VA 4KQRA 4BBTA 1T1BA 1BZAA 4KUOA 4Y2FA 4JLFA 3JVVA 3A3FA 1VM1A 2W1TB 3T50A 3RH8B 3MFDA 4OP8A 2QJ7A 2CC1A 2ZOIA 4M3KA 3PBNA 5AQBA 5FA7A 4IHQA 4KQDA 4DJ2A 3WS4A 5HAPA 1ES5A 2Y2GA 4K08A 4FH2A 3QNBA 1L2SA 4LV3A 3ZDJA 1X0OA 4LCMA 3VP1A 5DFYA 1FCMA 2B02A 4DJ3A 5F6AA 2JBFA 3IXGA 4JPMA 3HREA 2PU2A 2IWBA 4EEUA 4WEJA 1V9ZA 2QMIA 4FOFA 1XXMA 3HUOA 5FQ9A 2EX8A 3C2WA 2W1TA 4MEZA 2Y2QA 3NOPC 4ETZA 3DWKA 3IWIA 4E04A 4X69A 1OTDA 1K38A 2GX5A 5FQQA 2PT7A 3T4JA 1DY6A 1XJ3A 5KSHA 1OTBA 4UQIS 3D9YA 4X25A 2J7VA 1ODVA 4YWZA 2VJWA 1OMEA 4Y17A 2K7SA 3VMAA 4JXSA 4R4SA 2Y55A 1JTGA 3ZYTA 4LCLA 1OPXA 1DJCA 5EVLA 1GSXA 2WYXA 3VSLA 1IELA 3EWKA 1VB6A 1TEMA 2HV1A 4KQOA 3TOIA 3TRCA 2PBDP 4HH3A 1Z09A 1NZOA 2XD1A 1KVLA 5DJUA 2WAEA 2Y2OA 2KX6A 1YMXA 1HZOA 1TDLA 1AXBA 2WK0A 1E25A 3BQAA 2Y91A 3KSFA 3Q82A 3PHYA 2GZAA 4MCWA 4Q0JA 2O9BA 3VFFA 4HQAA 1FCOA 4WN5A 4CLCA 4JGQA 3MZDA 3F1PB 1ES3A 5KZHA 4HIAA 4N92A 4MNRA 2WKHA 3BQ8A 5F1FA 4ESPA 2HJEA 2ZMFA 3T4OA 2HGVA 2Y79A 5HSQA 2ZM8A 4RQ9A 3CPTA 1RGYA 2HDQA 1MWRA 1XJ4A 2EWVA 1S67L 3PBQA 3TW8A 5L10A 1UWNX 4L9FA 4ZRRA 2OLUA 3SS3A 2V1ZA 4K0WA 4N1HA 5IS1A 2V9AA 4GHIB 3OPPA 4UA9A 2V8FA 3MKFA 1SKOA 1UWPX 4E3OA 1CI9A 1MWSA 2PAVP 4CPKA 4N9LA 5M18A 4QY5A 3FKWA 1K56D 1YLYA 4FH4A 3HLEA 2WKIA 3TJZC 3KYZA 5F69A 3MKEA 3M6HA 3MQOA 4FCFA 4YINA 5FSRA 3CZDA 4EUZA 4O01A 3UB7A 2ZLYA 1LL9A 5TR7A 5JYOA 5DFXA 3GR2A 4UAAA 5CHMA 3NI9A 4JGPA 4M4XA 4ID4A 3M2KA 3F1PA 3SS4A 3IS2A 3OCNA 2G2WA 3CHWP 3T4TA 1DJBA 3K3CA 2YKHA 2ZQCA 5I5LA 4R23A 5HDCA 2JKFA 1PW1A 2ZQ7A 3KYEA 3ZG5A 1S1YA 3DTKA 1BUEA 2P74A 4RVAA 4HJ4A 4KZ3A 4LRYC 1TD5A 3IXDA 2WZZA 3A0RA 3LR5A 3ICYA 4IJGA 1XJ2A 4OOLA 2XDMA 1PZPA 3V50A 1W79A 2G7UA 4CQHA 2WKQA 2D01A 3OOVA 3WRZA 3D3OA 4X1MA 3CG5A 3FZCA 4P6ZM 1PI4A 3N8LA 2D02A 3E4PA 5CTMA 3LICA 2W1RA 4BD0A 3B3XA 1QMEA 5J3WA 2Y2KA 1OTEA 3M2JA 3HUMA 4R6LA 3AGFA 5E2GA 2BASA 3DTIA 4OPYA 3QP2A 1J3WA 2HZ5A 4YOFA 4R70A 4PPRA 2ZL1B 1GHPA 3R7WB 4UA7A 4EU0A 5L8MA 4WZ4A 1LSXA 5HPIA 2KOIA
chains in the Genus database with same CATH topology
2PD7A 3KO6A 4CLCC 2XA7M 1KOUA 2HF6A 4NXGA 3ZQ5A 2EWWA 2OWJA 4LRXC 4QPRA 3E0YA 4H6JB 2O0YA 4B9OA 3MFXA 2VA0A 4XT2A 4ME4A 4OOMA 1F9IA 4PKYA 4GW9A 3KSHA 2QJ5A 5AVFA 2OWHA 2FH5A 3B33A 3E4QA 3LIAA 3B47A 4WL9A 5KIZA 2Z6DA 5HWVA 2K31A 4IUHA 2JHEA 3DBAA 1OJ5A 4G3VA 3OC2A 4HP4A 2Z6CA 2ZBBA 5FL3A 4HI4A 3LR0A 3GDIA 2A24A 1T19A 3OLOA 1OTIA 4AFIA 2W0NA 4EERA 4G3KA 5J4EA 4MN6A 4UEYA 4CLCE 1S4RA 2M1CA 3UB8A 4I3AA 4WLAA 3H82B 4EETB 3LFVA 3CAXA 4HHDA 3F1OB 1VHMA 2J80A 2ZOHA 2VGLM 3BJNA 3EQVA 3FPVA 2KDKA 4F3LA 1ZTUA 5HL6A 2VLGA 2L0WA 2EA9A 3VE3A 4CLCB 3LR4A 3IBRA 1T1AA 1N9LA 2W3HA 3C38A 2J3TC 3D72A 3W2ZA 4YNRA 2ZMVA 3LI8A 5TBMB 3KSIA 3MQ0A 3S7NA 3O5YA 2O99A 4Q0IA 1YSPA 2PDRA 5EFWA 2VKSA 4BMWA 4MN5A 3R7WA 3S7OA 3CITA 1MC0A 2XRNA 3CUEA 1P9WA 2QYBA 2VV8A 2I9VA 3BW6A 3TE8A 4BBTA 1P9RA 1T1BA 3VOLA 4KUOA 2JKTI 2OAQ1 4LRZE 4Y2FA 2FZ0A 2L1MA 3JVVA 2W1TB 5AVEA 3T50A 3RH8B 2QJ7A 2ZOIA 1OT9A 3LIDA 3PBNA 2QHKA 3E98A 4IHQA 1N9OA 4KQDA 5CX7A 4DJ2A 1JNUA 1XFQA 2XROA 3H7WA 4PKYG 2VGLS 4K08A 2P04A 1WA9A 3RFBA 2V0UA 1XJ6A 4I39A 1DP9A 5HPFA 3E4OA 3CUEC 3NOUC 4ARZA 1X0OA 2XA7S 1TS6A 3NOTC 3FC7A 5J7EA 3U2AA 1TF1A 5DFYA 2B02A 3EGXC 4HJ3A 3T4LA 2V0WA 4UQIM 4ARZB 4DJ3A 5F6AA 4EESA 3S7PA 3T4KA 2JN7A 1F98A 1NLZA 5F68A 3H82A 3OBFA 4NXFA 4EEUA 4R3AA 1YAXA 3LI9A 4WEJA 3MJQA 3PBRA 1V9ZA 4FOFA 5HWTA 4Z1WA 2NUTC 3JVUA 2P7JA 1OTAA 2V1AA 3C2WA 2PYPA 2JKRM 2W1TA 2VV6A 3CWFA 4Q0HA 3LUQA 3H9WA 3NOPC 2J3TD 4ETZA 3KYQA 4E04A 1S4SA 2H28A 1OTDA 4WELA 2DMWA 2GX5A 2Y8HA 2PT7A 3P7NA 3ULFA 4LLOB 2YKFA 3PXPA 3T4JA 3UB9A 1XJ3A 5KSHA 3V67A 4NKPA 1S66L 1OTBA 2QWSA 2PD8A 4PAUA 5AJGA 5HDDA 5TBMA 4UQIS 1ODVA 4YWZA 1DP6A 2B18A 2GNXA 2VJWA 4PHTA 2K7SA 4I3IA 3ZYTA 3F1NA 3MF0A 3MR0A 1OPXA 3BY8A 1GSXA 3EWKA 4GJ4A 1VB6A 2NUPC 2HV1A 4KQOA 3TRCA 4HH3A 3C8CA 5DJUA 3BWLA 3MXQA 4LPZA 2KX6A 3EQUA 2KLIA 3F1OA 3BQAA 1LSWA 5C5KA 4EW7A 4EUVA 3KSFA 2LB5A 4I38A 4HH2A 3VV4A 3LIEA 3PHYA 3UB6A 2GZAA 1W63M 4MCWA 4Q0JA 4XT2B 4FSFA 4MDZA 2O9BA 4HJ6A 4HQAA 5F5YA 4WN5A 4CLCA 3F1NB 4JGQA 3F1PB 2VV7A 5G4YA 4MMNA 3UMDA 4O8GA 4ETXA 4L9GA 4HIAA 3RTYA 3LIBA 1D7EA 3R4KA 3HJIA 3BQ8A 2OOLA 2HJEA 2ZMFA 1T1CA 3PBOA 2PYRA 3T4OA 3FPWA 5MC7A 1D06A 1V9YA 2HGVA 2CMNA 5DF9A 4IUKA 2Y79A 4WUJA 5HSQA 4RQ9A 1XFNA 2W3FA 1DRMA 1YKDA 4L9EA 4GLQA 5HD5A 1XJ4A 2EWVA 1S67L 3NJAA 2L4RA 1OT6A 3PBQA 4GHIA 3TW8A 1UWNX 4L9FA 4ZRRA 2M7VA 2JKRI 1YSQA 3LYXA 5IS1A 1TS7A 3K3DA 2JKTM 2V9AA 4H6JA 2VEAA 4GHIB 2IA2A 5DKLA 1NWZA 2MJ6A 3K2NA 3GECA 4GCZA 4EQ1A 2A24B 1UWPX 3G6OA 2PHYA 3EEAA 3PBTA 2A2LA 4BBVA 3MQQA 3IS2B 2OAP1 4EEPA 3LR3A 4G3WA 4NXBA 1STZA 4DN0A 4R38A 2INWA 3PBSA 1G28A 4L0LA 3LIFA 2J3WA 1W63Q 3HCYA 4I5SA 1LSVA 3TJZC 3KYZA 3UE3A 5F69A 4WEKA 1OJGA 3MQOA 4P6ZS 4B93A 4EXOA 5HDSA 3A0SA 3BY9A 4CLCD 3OCLA 2HJ9C 3IBJA 4O01A 3UB7A 4GS9A 4KUKA 5K5BA 3T4QA 4NXEA 2M7UA 5DFXA 5G4ZA 4I3JA 3CI6A 1DP8A 5DKKA 4MN7A 5HWWA 1LT0A 2XSSA 4JGPA 4M4XA 1IOUA 3HJKA 1MKMA 1Y28A 4HOIA 2VX8A 2GJ3A 3F1PA 4BJPA 4BWIA 2W27A 3IS2A 3OCNA 3P01A 3CLOA 3EOIA 1TS8A 3T4TA 2O9CA 3T4SA 3K3CA 2YKHA 4HNBA 1P0ZA 3MMHA 5I5LA 3SW1A 2W3DA 2VZWA 1MZUA 5HDCA 1NLYA 1S1YA 3KX0X 3FG8A 2W3EA 4HJ4A 3UMEA 1GSVA 4LRYC 1TD5A 3NHQA 5DJTA 4JGOA 1S1ZA 4WF0A 3A0RA 5TJJA 3PR6A 1P97A 4JGRA 3LR5A 1LL8A 3ICYA 4HY8A 1XJ2A 4IJGA 5LBRA 1UGUA 4F3LB 4NEED 4Y3IA 1F5MA 1EW0A 4II7A 4OOLA 2V1BA 2K2NA 1N9NA 2G7UA 2PR5A 4CQHA 2WKQA 3UE6A 2D01A 3OOVA 5IU1A 3VE4A 3H7WB 2LB9A 3D3OA 2W3GA 4BBUA 4P6ZM 4O0PA 3EGDC 2R78A 2D02A 3E4PA 1BYWA 1ZHHB 3PYPA 1IFQA 1H8MA 1TS0A 3KSGA 3EEHA 3LICA 5HZHA 2WKPA 4HP9A 2W1RA 4GS9B 2PR6A 3S7QA 3B42A 5IT5A 5A8BA 1GSWA 5J3WA 1OTEA 4R6LA 5HD3A 2O9AA 3A0VA 2QKPA 2BASA 4Y5FA 1H3QA 1NRJA 2WKRA 3C30A 4YOFA 1G6OA 4R70A 1T18A 3R7WB 4EU0A 2P08A 4DMZA 5L8MA 1LSXA 5HPIA 2KOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD7 A;  3MR0 A;  1LSV A;  5F69 A;  1KOU A;  4NXG A;  1OJG A;  3MQO A;  2VV8 A;  3BY8 A;  3ZQ5 A;  2I9V A;  2OWJ A;  4EXO A;  4LRX C;  1GSX A;  5HDS A;  3A0S A;  3BY9 A;  4BBT A;  4H6J B;  3UB7 A;  1T1B A;  3VOL A;  3EWK A;  3MFX A;  4KUO A;  4B9O A;  4LRZ E;  1VB6 A;  4GS9 A;  4KUK A;  4XT2 A;  2HV1 A;  4NXE A;  2L1M A;  4HH3 A;  5AVE A;  3T50 A;  1F9I A;  4I3J A;  5G4Z A;  3RH8 B;  3C8C A;  4PKY A;  1DP8 A;  5DKK A;  5HWW A;  2QJ7 A;  4I5S A;  4E04 A;  5DJU A;  1LT0 A;  2ZOI A;  1OT9 A;  3BWL A;  3LID A;  4JGP A;  4M4X A;  4GW9 A;  3MXQ A;  4LPZ A;  5IS1 A;  2QHK A;  2KX6 A;  3HJK A;  1N9O A;  1Y28 A;  2QJ5 A;  4KQD A;  4HOI A;  3F1O A;  5AVF A;  1JNU A;  1XFQ A;  1LSW A;  4DJ2 A;  2OWH A;  2GJ3 A;  4EW7 A;  3F1P A;  3B33 A;  3E4Q A;  3H7W A;  2W27 A;  3IS2 A;  4I38 A;  4HH2 A;  3LIA A;  3PYP A;  4K08 A;  3CLO A;  3LIE A;  3PHY A;  4PKY G;  2Z6D A;  1WA9 A;  4WL9 A;  2V0U A;  3UB6 A;  5HWV A;  5KIZ A;  1XJ6 A;  1TS8 A;  2JHE A;  4I39 A;  4XT2 B;  1DP9 A;  1OJ5 A;  4HJ6 A;  3K3C A;  4HQA A;  4HP4 A;  2Z6C A;  4WN5 A;  2YKH A;  4HNB A;  1P0Z A;  5F5Y A;  3E4O A;  5I5L A;  3SW1 A;  3F1N B;  1MZU A;  2ZBB A;  5HDC A;  3NOU C;  4JGQ A;  1X0O A;  1S1Y A;  4HI4 A;  3UMD A;  3KX0 X;  3F1P B;  3FG8 A;  3GDI A;  2VV7 A;  2A24 A;  5G4Y A;  1TS6 A;  3NOT C;  4HJ4 A;  5F68 A;  3UME A;  1T19 A;  3FC7 A;  1GSV A;  1OTI A;  3OLO A;  4L9G A;  4LRY C;  5J7E A;  2B02 A;  3NHQ A;  2W0N A;  4HJ3 A;  4HIA A;  5DJT A;  3RTY A;  3LIB A;  4EER A;  4DJ3 A;  2V0W A;  4EES A;  1D7E A;  4JGO A;  1S1Z A;  4MN6 A;  4WF0 A;  3A0R A;  4I3I A;  2JN7 A;  1S4R A;  1F98 A;  3HJI A;  5F6A A;  2OOL A;  2M1C A;  3UB8 A;  1P97 A;  4I3A A;  4JGR A;  3H82 A;  1LL8 A;  3ICY A;  4HY8 A;  1XJ2 A;  4WLA A;  1T1C A;  3H82 B;  2PYR A;  1UGU A;  4NXF A;  4R3A A;  4EEU A;  4F3L B;  1D06 A;  3LI9 A;  1V9Y A;  3MJQ A;  2CMN A;  1EW0 A;  1V9Z A;  4WUJ A;  4EET B;  5HSQ A;  4RQ9 A;  1XFN A;  5HWT A;  3CAX A;  2V1B A;  1N9N A;  1DRM A;  4HHD A;  4L9E A;  5HD5 A;  3F1O B;  2J80 A;  2P7J A;  1OTA A;  2PR5 A;  2WKQ A;  2ZOH A;  2D01 A;  1XJ4 A;  3UE6 A;  5IU1 A;  2V1A A;  3VE4 A;  3C2W A;  3H7W B;  1S67 L;  2PYP A;  3NJA A;  2L4R A;  1OT6 A;  2VV6 A;  2KDK A;  3CWF A;  4GHI A;  4BBU A;  3LUQ A;  3H9W A;  1UWN X;  4F3L A;  4L9F A;  3NOP C;  5J4E A;  2R78 A;  2VLG A;  2D02 A;  2L0W A;  1BYW A;  3E4P A;  2EA9 A;  3LYX A;  1S4S A;  1TS7 A;  2H28 A;  3K3D A;  3VE3 A;  2V9A A;  4H6J A;  1OTD A;  1TS0 A;  2VEA A;  4GHI B;  3EEH A;  3LIC A;  5DKL A;  5HZH A;  1NWZ A;  2WKP A;  4HP9 A;  3IBR A;  4GS9 B;  1T1A A;  1N9L A;  2PR6 A;  3P7N A;  3ULF A;  4LLO B;  2YKF A;  3GEC A;  4GCZ A;  4EQ1 A;  2A24 B;  1UWP X;  3UB9 A;  5A8B A;  1GSW A;  3G6O A;  1XJ3 A;  5J3W A;  1OTE A;  2PHY A;  4R6L A;  1S66 L;  3D72 A;  1OTB A;  2QWS A;  2PD8 A;  5HD3 A;  5HDD A;  5TBM A;  3LI8 A;  4BBV A;  5TBM B;  1ODV A;  3A0V A;  3MQQ A;  3IS2 B;  4YWZ A;  2QKP A;  2BAS A;  1DP6 A;  2PDR A;  2WKR A;  5EFW A;  4EEP A;  4NXB A;  4R70 A;  2K7S A;  4R38 A;  1T18 A;  2INW A;  4MN5 A;  1G28 A;  1LSX A;  3LIF A;  3F1N A; 
#chains in the Genus database with same CATH topology
 1CI8 A;  2E8I A;  2V20 A;  2XA7 M;  1KOU A;  4NXG A;  2EWW A;  2OWJ A;  3FV7 A;  1L0D A;  4H6J B;  3G31 A;  4Y0U A;  3UE1 A;  4XT2 A;  5GLD A;  4S2J A;  3IXB A;  2ZQA A;  4PKY A;  3ZNY A;  1YLT A;  1NY0 A;  3BYD A;  2HP9 A;  2QPN A;  1KVM A;  4GN2 A;  3KSH A;  4P87 A;  2ZC4 B;  3HLB A;  3B33 A;  5GLC A;  4LFU A;  4WL9 A;  4QJG A;  2JE5 A;  2EX2 A;  3MS6 A;  5KIZ A;  3DBA A;  4HP4 A;  4WBG A;  2ZBB A;  3UN7 A;  4G3K A;  4MN6 A;  3VFH A;  4Y0O A;  3UB8 A;  3UDI A;  4DDS A;  5FQK A;  4LV1 A;  4EET B;  3LFV A;  3IQA A;  1KGE A;  1TDG A;  3CAX A;  4HHD A;  3F1O B;  2ZOH A;  3MBZ A;  5AQ7 A;  2X02 A;  1JTD A;  5GHZ A;  5GL9 A;  4H8R A;  1LI9 A;  1G5U A;  1W8Q A;  3LR4 A;  3SZT A;  4IVK A;  2W3H A;  3Q7Z A;  3DW0 A;  3ZCZ A;  2J3T C;  4KEN B;  3W2Z A;  2ZMV A;  3GRJ A;  2PDR A;  1XKZ A;  1WE4 A;  4PMA A;  2J8Y A;  1U60 A;  2HDU A;  1LHY A;  1P9R A;  1RCJ A;  2JKT I;  3WS2 A;  2FZ0 A;  4KZA A;  1M6K A;  3BRM A;  5DVA A;  4EBP A;  1XGJ A;  4FUW A;  3VOZ A;  1ZKJ A;  2P9V B;  3SH7 A;  1FSY A;  3H7W A;  2EXA A;  2VGL S;  2P04 A;  3N8S A;  4E3M A;  5CHJ A;  4I39 A;  2B95 A;  3SS5 A;  3NOU C;  4ARZ A;  1BT5 A;  1TS6 A;  3NOT C;  3U2A A;  4DE1 A;  2JN7 A;  4O7D A;  1F98 A;  1NLZ A;  3OBF A;  2R9W A;  4R3A A;  3P09 A;  3MJQ A;  3PBR A;  3GTC A;  2V1A A;  2JKR M;  2XK1 A;  3LUQ A;  4KZ7 A;  3BFC A;  5J8X A;  1S4S A;  2H28 A;  4WEL A;  4S2P A;  3P7N A;  1FCN A;  2HDS A;  3C4O A;  1ERM A;  4NKP A;  4PAU A;  2PD8 A;  3U4L P;  3T1S A;  5A92 A;  3VP2 A;  4I3I A;  2XF3 A;  3MF0 A;  3MR0 A;  3BY8 A;  4U0X A;  5FDH A;  2Y2M A;  3QP4 A;  2NUP C;  3HLW A;  4U0T A;  5CHU A;  3UNW A;  3NC8 A;  4S2L A;  1GA0 A;  2H5S A;  3N6I A;  1YM1 A;  4OQH A;  3BWL A;  3BFE A;  3ITA A;  1K54 A;  4EW7 A;  4EUV A;  4LV2 A;  2LB5 A;  4I38 A;  4HH2 A;  1PWG A;  3UB6 A;  1E3U D;  4HJ6 A;  5F5Y A;  5EM0 A;  4N1X A;  3F1N B;  1GCE A;  5G4Y A;  2ZC6 B;  4MMN A;  4L9G A;  2EFU A;  4QD4 A;  3HJI A;  3ZVW A;  4WUJ A;  2W3F A;  3BFG A;  4L9E A;  4LGW A;  4NET A;  4GLQ A;  1PYY A;  1LI0 A;  3G34 A;  2XD5 A;  4PM9 A;  1G68 A;  5A93 A;  5CEB A;  2R9X A;  1OT6 A;  1PFL A;  2M7V A;  1CQA A;  3LYX A;  1JVJ A;  4WMC D;  4H6J A;  4E3L A;  1FR6 A;  1BSG A;  3IH8 A;  5TFQ A;  3G6O A;  4S2O A;  2PHY A;  3EEA A;  4PM8 A;  2A2L A;  3RXW A;  1ZG4 A;  3MQQ A;  3IS2 B;  1BLH A;  2OAP 1;  1YT4 A;  4G3W A;  2WGW A;  4R38 A;  2INW A;  3PBS A;  4L0L A;  3LIF A;  3UE3 A;  4P6Z S;  3UE0 A;  4B93 A;  1PWC A;  1I2W A;  3A0S A;  3OCL A;  2HJ9 C;  1PIO A;  4X6T A;  4GS9 A;  3Q1F A;  4S2I A;  3T4Q A;  2FFF B;  4I3J A;  5DKK A;  2VGJ A;  4MN7 A;  2PRF A;  1H5X A;  3SH9 A;  2XSS A;  4HBU A;  5FAP A;  4C3Q A;  2OSU A;  1H8Y A;  1K4F A;  2J9P A;  3C7V A;  2W27 A;  4ZTK A;  4ZJ3 A;  1J9M A;  1PZO A;  2WGV A;  4QHC A;  1TS8 A;  3C4P A;  1QMF A;  4D2O A;  2EFX A;  2W3D A;  4RYE A;  2W3E A;  3UME A;  1I2S A;  3HVF A;  4JGO A;  5TJJ A;  3W4P A;  4HY8 A;  5D3O A;  1UGU A;  5CRF A;  5FAT A;  4ZJ1 A;  2K2N A;  1N9N A;  5FQM A;  5FQI A;  1IEM A;  4K91 A;  2ZC7 A;  4GNU A;  3S22 A;  5IU1 A;  3VE4 A;  2LB9 A;  2WZX A;  4DDY A;  1SKO B;  4BLM A;  2W3G A;  3UDX A;  5HX9 A;  4BBU A;  2ZQ8 A;  1YLP A;  4JF5 A;  4O0P A;  5M1A A;  5FAS A;  3PYP A;  1BYW A;  1ZHH B;  1K57 C;  3UO9 A;  2ZM0 A;  3ZGA B;  2PR6 A;  3S7Q A;  1GSW A;  2PU4 A;  2DNS A;  2O9A A;  4GDN A;  4LEN A;  2QKP A;  1NRJ A;  2WKR A;  1T18 A;  3Q07 A;  3C5A A;  3KO6 A;  2WUQ A;  4XXR A;  1D1J A;  3E0Y A;  1ACF A;  2VA0 A;  1M40 A;  1PRQ A;  4OOM A;  4KG2 A;  5FAQ A;  2Z2M B;  3DWZ A;  4JF6 A;  3RXX A;  4E6W A;  3CPT B;  4GD6 A;  1K6R A;  3AGD A;  2FH5 A;  3E4Q A;  2X01 A;  3B47 A;  5HWV A;  2K31 A;  1S0W A;  4IUH A;  2Y2P A;  4KZ9 A;  1CK3 A;  4G3V A;  2Y2N A;  3OC2 A;  2WAD A;  3ZHH A;  3HUN A;  3IWQ A;  1LLB A;  3LR0 A;  2A24 A;  1T19 A;  4MBH A;  4EER A;  4UEY A;  1S4R A;  3ZVT A;  3TG9 A;  2BG1 A;  2BLS A;  2P9V A;  2WGW B;  2ZQ9 A;  4R3J A;  3IX3 A;  1VHM A;  2J80 A;  2ZC3 B;  1K54 C;  2VGL M;  3EQV A;  5AQ9 A;  2KDK A;  4C6Y A;  1ZTU A;  4RX3 A;  5HL6 A;  3T1X A;  4HBT A;  4JBF A;  2EA9 A;  1FIK A;  3DTE A;  5JYP A;  2V2F F;  3HLC A;  4IVI A;  1YQS A;  3O5Y A;  4Q0I A;  1YMS A;  3FYZ A;  3M6B A;  1PWD A;  2VV8 A;  3FWL A;  5DF7 A;  4XUX A;  3AGE A;  3E2L A;  4BD1 A;  3OPR A;  3VOL A;  4JKT A;  5L07 A;  5IHV A;  2ZD8 A;  4R1G A;  2UV0 E;  5HAQ A;  3LID A;  1OT9 A;  3ZG8 B;  2E8J A;  3IH9 A;  1XX2 A;  5FDS A;  5TGF A;  3DAV A;  5CX7 A;  1JNU A;  4D60 A;  3BEB A;  3WWX A;  4X1L A;  1L0F A;  3NDG A;  3RFB A;  1CF0 A;  2V0U A;  4FD8 A;  4X56 A;  1XJ6 A;  3E4O A;  3CUE C;  2XA7 S;  2ZL1 A;  1TF1 A;  1F2K A;  3IT9 A;  1ONH A;  3T4L A;  4ARZ B;  3VP3 A;  3T4K A;  1ESI A;  3H82 A;  4NXF A;  3BLM A;  5GLB A;  3E2K A;  4DF6 A;  3MXS A;  4XUZ A;  3UPN A;  2J9O A;  2NUT C;  3JVU A;  1OTA A;  1XP4 A;  3GQZ A;  2PYP A;  1MKI A;  3CWF A;  3H9W A;  3A3I A;  4KZ8 A;  3KYQ A;  4GOG A;  3Q7V A;  4P85 A;  5EVI A;  2Y2L A;  2DMW A;  2JC7 A;  3LEQ A;  4LLO B;  5BOH A;  1WYB A;  1EI5 A;  3UB9 A;  4BL3 A;  3V67 A;  1S66 L;  5L09 A;  5CTN A;  1XA7 A;  5HDD A;  5AJG A;  1H8Z A;  1DP6 A;  2B18 A;  2GNX A;  3UY6 A;  1BLS A;  4PHT A;  2PBY A;  1YLJ A;  5E2E A;  5E2H A;  3F1N A;  4WM9 A;  5EOO A;  2GDN A;  1GA9 A;  3TSG A;  3JPU A;  4GJ4 A;  4ZJ2 A;  1Q2Q A;  2EX6 A;  5EVI D;  1PI5 A;  5EVI C;  3Q81 A;  4NG2 A;  3SH8 A;  4EBN A;  3N4I A;  3MXQ A;  2HP6 A;  1MXO A;  4JXG A;  3EQU A;  3F1O A;  1LSW A;  3P98 A;  5C5K A;  3RJU A;  4KG5 A;  1FR1 A;  3WS0 A;  3PAG A;  3LO7 A;  1K4E A;  3LIE A;  4GKU A;  2JKG A;  1W63 M;  4XT2 B;  4MDZ A;  3NUL A;  1PW8 A;  5EE8 A;  5AQA A;  2B5R A;  2VV7 A;  3UMD A;  4O8G A;  4ETX A;  4OOY A;  3RTY A;  4Z9Q A;  3QP1 A;  3R4K A;  3UB5 P;  2OOL A;  4B4X A;  3PBO A;  2PYR A;  5MC7 A;  1D06 A;  3L9K A;  1V9Y A;  2CMN A;  4PM5 A;  4RA7 A;  1DRM A;  2BTF P;  2A49 A;  4GDB A;  3A3J A;  3ITB A;  2JKR I;  1YSQ A;  2VEA A;  5DKL A;  2MJ6 A;  3K2N A;  2Q0O A;  3GEC A;  1IYQ A;  4EQ1 A;  3NIA A;  2A24 B;  2XR0 A;  1ES4 A;  1L3L A;  3PBT A;  4BBV A;  3LY3 A;  3GSG A;  5F1G A;  4DKI A;  1STZ A;  1CEF A;  4Y15 A;  4I5S A;  3DTM A;  1W63 Q;  3BEC A;  3HCY A;  4X68 A;  4WEK A;  1OJG A;  1ERO A;  3BY9 A;  4S2N A;  2ZM2 A;  3LGO A;  3MZE A;  4QB8 A;  2HPB A;  2Y2I A;  2VGK A;  1YPR A;  3CI6 A;  4R4R A;  5HWW A;  1LT0 A;  3ZG0 A;  3BM6 A;  4X55 A;  3ZNT A;  2WKE A;  3UPP A;  4OPR A;  3VP4 A;  1Y28 A;  2HP5 A;  1ESU A;  2VX8 A;  2GJ3 A;  1IYO A;  4BJP A;  4BWI A;  2H10 A;  2WAF A;  2C6W B;  3P01 A;  3IF6 C;  2Z2L B;  3CLO A;  2ZMA A;  3EOI A;  2O9C A;  4HNB A;  1P0Z A;  1VET B;  1HD8 A;  1MZU A;  4ZBE A;  1NLY A;  1O07 A;  5EV0 A;  1K25 A;  1SCW A;  1A0K A;  3NHQ A;  3UPO A;  3A3E A;  1S1Z A;  4WF0 A;  1NRF A;  3PR6 A;  4JGR A;  1LL8 A;  3JYI A;  5E43 A;  4NEE D;  4Y3I A;  3C7U A;  4II7 A;  4F94 A;  2V1B A;  2EX9 A;  2PR5 A;  3IHB A;  5HL1 A;  4E3K A;  3IF6 A;  4DRT A;  1WYC A;  4IED A;  3EGD C;  1HLU P;  4FTX A;  1ONG A;  5FI6 A;  1IFQ A;  1TS0 A;  3KSG A;  3EEH A;  1JWV A;  5HZH A;  2WKP A;  4HP9 A;  1L0G A;  3OPL A;  3V3S A;  5IT5 A;  4DXB A;  2EXB A;  3C30 A;  2HDR A;  1G6O A;  4DMZ A;  1AWI A;  1PNE A;  3T1R A;  3ZQ5 A;  4IBX A;  4QPR A;  1MY8 A;  2O0Y A;  3VP0 A;  3MFX A;  5EUA A;  1K55 C;  3IX4 A;  1F9I A;  4ZAM A;  4B4Z A;  4Y7P A;  1RGZ A;  5E2F A;  2QJ5 A;  2OV5 A;  3SOI A;  4Y0T A;  1IKG A;  2Z6D A;  1CJF A;  1XA1 A;  2XFS A;  4QWO A;  1K0K A;  5FL3 A;  4DE2 A;  4HI4 A;  1DJA A;  2W0N A;  4WZ5 C;  3BFD A;  5J4E A;  2M1C A;  4WLA A;  3ISG A;  3OPH A;  4JF4 A;  3G2Y A;  3G35 A;  3HLD A;  1N9B A;  3BJN A;  3LY4 A;  4LV0 A;  1NJ4 A;  2VLG A;  2AVX A;  5G18 A;  3N7W A;  4MLL A;  3IBR A;  5EVI B;  4MBF A;  1N9L A;  2RL3 A;  3C38 A;  1NYM A;  2ZJ9 A;  2OLV A;  2IWD A;  4QY6 A;  3D72 A;  4YNR A;  3LI8 A;  3KSI A;  2Y4A A;  5FI7 A;  2O99 A;  3W4O A;  5CGS A;  3NBL A;  4UHU A;  5HFO A;  1L0E A;  4MN5 A;  2IWC A;  5F82 A;  3S7O A;  1TVF A;  3CIT A;  1I5Q A;  2XRN A;  1P9W A;  3N8R A;  4GZB A;  3BW6 A;  3TE8 A;  5DTS A;  3QP5 A;  1BLP A;  2OAQ 1;  4LRZ E;  4OPZ A;  3W4Q A;  1GHM A;  2L1M A;  1SDE A;  2I72 A;  3HLG A;  2XH9 A;  5AVE A;  4WMC A;  2UWX A;  4OLG A;  4OON A;  1YLZ A;  1SKF A;  4R3B A;  2QHK A;  3E98 A;  3O87 A;  3NCK A;  1N9O A;  4PM6 A;  1BUL A;  1XFQ A;  3A3D A;  3FKV A;  4U3T A;  2XRO A;  3O88 A;  3W8K A;  3LCE A;  1S6R A;  1VET A;  4PKY G;  2XFT A;  1ERQ A;  1WA9 A;  1DP9 A;  1KDS A;  5FEF A;  4EWF A;  5HPF A;  2X71 A;  3FC7 A;  5J7E A;  1IYP A;  3V3R A;  3EGX C;  4HJ3 A;  5DF8 A;  2V0W A;  1W5D A;  4UQI M;  4EES A;  3S7P A;  3ZG9 B;  3VOY A;  4ZDX A;  3IXH A;  5CXW A;  5F68 A;  3GV9 A;  1YAX A;  1E3U A;  3QHY A;  1KDW A;  3LI9 A;  1KE0 A;  5HWT A;  4Z1W A;  4E6X A;  2P7J A;  3G2Z A;  5DTK A;  2Y2J A;  1VEU A;  2VV6 A;  4Q0H A;  4WYY A;  3CJM A;  2J3T D;  4OQG A;  4OKP A;  5FI2 A;  2Y8H A;  2RCX A;  3S1Y A;  3ULF A;  2YKF A;  3PXP A;  3QP8 A;  2QWS A;  5TBM A;  2G2U A;  5U47 A;  3S4X A;  4BQM A;  3O86 A;  1VQQ A;  1IKI A;  4JXV A;  1FSW A;  3VSK A;  4DE0 A;  5M19 A;  1NYY A;  2H0T A;  4Q8I A;  5EM1 A;  5CED A;  4OH0 A;  3C8C A;  1VEU B;  4LPZ A;  2KLI A;  3HL9 A;  1SHV A;  2A3U A;  2ZC5 B;  4DXC A;  3G4P A;  2DRW A;  2Q9M A;  3VV4 A;  4PM7 A;  4FSF A;  3NEC A;  5KSC A;  3WRT A;  4EV4 A;  3OZH A;  1LL5 A;  3LIB A;  1D7E A;  4KZB A;  2XGN A;  4KZ6 A;  1IYS A;  1T1C A;  3V5M A;  1ZG6 A;  3FPW A;  3WS5 A;  1MBL A;  5DF9 A;  4IUK A;  1XFN A;  1Z6F A;  1YKD A;  3Q7V B;  5HD5 A;  1W7F A;  4IBR A;  2Y2H A;  3NJA A;  2L4R A;  4GHI A;  3I7J A;  1SZV A;  4Y13 A;  1TS7 A;  3K3D A;  2JKT M;  2IA2 A;  1NWZ A;  5HAI A;  1FOF A;  4GCZ A;  4S2M A;  5GLA A;  4OQ0 A;  3ZG7 B;  1EWZ A;  4EEP A;  3LR3 A;  4NXB A;  4S2N C;  4DN0 A;  4R0Q A;  4KZ4 A;  4KQQ A;  1G28 A;  5CGW A;  4MBK A;  2J3W A;  1NXY A;  1LSV A;  3GVB A;  3QNC A;  4EXO A;  4OP5 A;  1N4O A;  5HDS A;  4CLC D;  3IBJ A;  4S2K A;  1Y4O A;  4KUK A;  5K5B A;  3MZF A;  5DTT A;  4NXE A;  5GHX A;  5HAR A;  2M7U A;  1W8Y A;  5G4Z A;  1DP8 A;  1C3B A;  4QU3 A;  5F83 A;  4K0X A;  4P6B A;  3MSH A;  2H0Y A;  5CEC A;  3G32 A;  1NZU A;  3NDE A;  1JWP A;  1CEG A;  1IOU A;  5GHY A;  3HJK A;  5CGX A;  1MKM A;  4HOI A;  4OQI A;  2QZ6 A;  2XQZ A;  4RX2 A;  4GD8 A;  4CJN A;  1K6S A;  3T4S A;  2ACG A;  3G30 A;  1Y54 A;  3MMH A;  3SW1 A;  2VZW A;  5FAO A;  5CER A;  3KX0 X;  3FG8 A;  3IF6 B;  1GSV A;  5DJT A;  1K55 A;  3HBR A;  1P97 A;  4OLD A;  5LBR A;  2WGI A;  4F3L B;  1F5M A;  1EW0 A;  2FFY A;  1Q2P A;  3V39 A;  3UE6 A;  4GB7 A;  5EEC A;  3H7W B;  3NY4 A;  2ZQD A;  5EOE A;  3O3V A;  2R78 A;  1YLW A;  5A90 A;  1HTZ A;  3L7H A;  4DE3 A;  1H8M A;  4GS9 B;  4OVD A;  3UDF A;  1H0M A;  4BEN A;  3B42 A;  5A8B A;  3T1Q B;  3D4F A;  5HD3 A;  1MWU A;  3ZFZ A;  1G6A A;  1O7E A;  3A0V A;  4Y5F A;  1H3Q A;  3WS1 A;  1KGG A;  2P08 A;  2Y59 A;  3T12 B;  2PD7 A;  4CLC C;  2HF6 A;  3PAE A;  4LRX C;  4E3N A;  2VK3 A;  4A5R A;  4B9O A;  4P0M A;  4ME4 A;  2Q9N A;  5FQJ A;  1K57 A;  4E3J A;  1ALQ A;  1KE4 A;  4GW9 A;  5EVE A;  5L2F A;  5KMW A;  1MWT A;  5AVF A;  1ZC2 A;  2OWH A;  4C75 A;  4EQI A;  2JCH A;  3LIA A;  3GMW A;  2JHE A;  1OJ5 A;  1RP5 A;  2Z6C A;  3BLS A;  2DCF A;  4HES A;  4UA6 A;  3GDI A;  1ES2 A;  3OLO A;  1OTI A;  3CMZ A;  4AFI A;  4X53 A;  2C5W B;  5HW3 A;  5EPH A;  1FIL A;  4CLC E;  4I3A A;  4OPQ A;  3H82 B;  4WZ5 A;  3LEZ A;  1E4D A;  3IF5 A;  2XLN A;  1SDN A;  3BFF A;  1BTL A;  3FPV A;  4JXW A;  4YFM A;  4F3L A;  1XPB A;  1FQG A;  2L0W A;  3VE3 A;  4CLC B;  5A91 A;  3IX8 A;  3QP6 A;  1T1A A;  5FEG A;  3IWO A;  4EBL A;  1KE3 A;  3MXR A;  1BLC A;  4B88 A;  4HEF A;  1KGF A;  5TBM B;  3PTE A;  3MQ0 A;  3IHA A;  5I94 A;  3S7N A;  4N9K A;  4NK3 A;  1YSP A;  2V8C A;  1JWZ A;  5EFW A;  2VKS A;  1K56 A;  4BMW A;  4E3I A;  4KG6 A;  3R7W A;  1HVB A;  1GHI A;  3HLF A;  1MC0 A;  1MPL A;  4KZ5 A;  4BL2 A;  3CUE A;  2XEP A;  1XGI A;  2QYB A;  2I9V A;  4KQR A;  4BBT A;  1T1B A;  1BZA A;  4KUO A;  4Y2F A;  4JLF A;  3JVV A;  3A3F A;  1VM1 A;  2W1T B;  3T50 A;  3RH8 B;  3MFD A;  4OP8 A;  2QJ7 A;  2CC1 A;  2ZOI A;  4M3K A;  3PBN A;  5AQB A;  5FA7 A;  4IHQ A;  4KQD A;  4DJ2 A;  3WS4 A;  5HAP A;  1ES5 A;  2Y2G A;  4K08 A;  4FH2 A;  3QNB A;  1L2S A;  4LV3 A;  3ZDJ A;  1X0O A;  4LCM A;  3VP1 A;  5DFY A;  1FCM A;  2B02 A;  4DJ3 A;  5F6A A;  2JBF A;  3IXG A;  4JPM A;  3HRE A;  2PU2 A;  2IWB A;  4EEU A;  4WEJ A;  1V9Z A;  2QMI A;  4FOF A;  1XXM A;  3HUO A;  5FQ9 A;  2EX8 A;  3C2W A;  2W1T A;  4MEZ A;  2Y2Q A;  3NOP C;  4ETZ A;  3DWK A;  3IWI A;  4E04 A;  4X69 A;  1OTD A;  1K38 A;  2GX5 A;  5FQQ A;  2PT7 A;  3T4J A;  1DY6 A;  1XJ3 A;  5KSH A;  1OTB A;  4UQI S;  3D9Y A;  4X25 A;  2J7V A;  1ODV A;  4YWZ A;  2VJW A;  1OME A;  4Y17 A;  2K7S A;  3VMA A;  4JXS A;  4R4S A;  2Y55 A;  1JTG A;  3ZYT A;  4LCL A;  1OPX A;  1DJC A;  5EVL A;  1GSX A;  2WYX A;  3VSL A;  1IEL A;  3EWK A;  1VB6 A;  1TEM A;  2HV1 A;  4KQO A;  3TOI A;  3TRC A;  2PBD P;  4HH3 A;  1Z09 A;  1NZO A;  2XD1 A;  1KVL A;  5DJU A;  2WAE A;  2Y2O A;  2KX6 A;  1YMX A;  1HZO A;  1TDL A;  1AXB A;  2WK0 A;  1E25 A;  3BQA A;  2Y91 A;  3KSF A;  3Q82 A;  3PHY A;  2GZA A;  4MCW A;  4Q0J A;  2O9B A;  3VFF A;  4HQA A;  1FCO A;  4WN5 A;  4CLC A;  4JGQ A;  3MZD A;  3F1P B;  1ES3 A;  5KZH A;  4HIA A;  4N92 A;  4MNR A;  2WKH A;  3BQ8 A;  5F1F A;  4ESP A;  2HJE A;  2ZMF A;  3T4O A;  2HGV A;  2Y79 A;  5HSQ A;  2ZM8 A;  4RQ9 A;  3CPT A;  1RGY A;  2HDQ A;  1MWR A;  1XJ4 A;  2EWV A;  1S67 L;  3PBQ A;  3TW8 A;  5L10 A;  1UWN X;  4L9F A;  4ZRR A;  2OLU A;  3SS3 A;  2V1Z A;  4K0W A;  4N1H A;  5IS1 A;  2V9A A;  4GHI B;  3OPP A;  4UA9 A;  2V8F A;  3MKF A;  1SKO A;  1UWP X;  4E3O A;  1CI9 A;  1MWS A;  2PAV P;  4CPK A;  4N9L A;  5M18 A;  4QY5 A;  3FKW A;  1K56 D;  1YLY A;  4FH4 A;  3HLE A;  2WKI A;  3TJZ C;  3KYZ A;  5F69 A;  3MKE A;  3M6H A;  3MQO A;  4FCF A;  4YIN A;  5FSR A;  3CZD A;  4EUZ A;  4O01 A;  3UB7 A;  2ZLY A;  1LL9 A;  5TR7 A;  5JYO A;  5DFX A;  3GR2 A;  4UAA A;  5CHM A;  3NI9 A;  4JGP A;  4M4X A;  4ID4 A;  3M2K A;  3F1P A;  3SS4 A;  3IS2 A;  3OCN A;  2G2W A;  3CHW P;  3T4T A;  1DJB A;  3K3C A;  2YKH A;  2ZQC A;  5I5L A;  4R23 A;  5HDC A;  2JKF A;  1PW1 A;  2ZQ7 A;  3KYE A;  3ZG5 A;  1S1Y A;  3DTK A;  1BUE A;  2P74 A;  4RVA A;  4HJ4 A;  4KZ3 A;  4LRY C;  1TD5 A;  3IXD A;  2WZZ A;  3A0R A;  3LR5 A;  3ICY A;  4IJG A;  1XJ2 A;  4OOL A;  2XDM A;  1PZP A;  3V50 A;  1W79 A;  2G7U A;  4CQH A;  2WKQ A;  2D01 A;  3OOV A;  3WRZ A;  3D3O A;  4X1M A;  3CG5 A;  3FZC A;  4P6Z M;  1PI4 A;  3N8L A;  2D02 A;  3E4P A;  5CTM A;  3LIC A;  2W1R A;  4BD0 A;  3B3X A;  1QME A;  5J3W A;  2Y2K A;  1OTE A;  3M2J A;  3HUM A;  4R6L A;  3AGF A;  5E2G A;  2BAS A;  3DTI A;  4OPY A;  3QP2 A;  1J3W A;  2HZ5 A;  4YOF A;  4R70 A;  4PPR A;  2ZL1 B;  1GHP A;  3R7W B;  4UA7 A;  4EU0 A;  5L8M A;  4WZ4 A;  1LSX A;  5HPI A;  2KOI A; 
#chains in the Genus database with same CATH homology
 2PD7 A;  3KO6 A;  4CLC C;  2XA7 M;  1KOU A;  2HF6 A;  4NXG A;  3ZQ5 A;  2EWW A;  2OWJ A;  4LRX C;  4QPR A;  3E0Y A;  4H6J B;  2O0Y A;  4B9O A;  3MFX A;  2VA0 A;  4XT2 A;  4ME4 A;  4OOM A;  1F9I A;  4PKY A;  4GW9 A;  3KSH A;  2QJ5 A;  5AVF A;  2OWH A;  2FH5 A;  3B33 A;  3E4Q A;  3LIA A;  3B47 A;  4WL9 A;  5KIZ A;  2Z6D A;  5HWV A;  2K31 A;  4IUH A;  2JHE A;  3DBA A;  1OJ5 A;  4G3V A;  3OC2 A;  4HP4 A;  2Z6C A;  2ZBB A;  5FL3 A;  4HI4 A;  3LR0 A;  3GDI A;  2A24 A;  1T19 A;  3OLO A;  1OTI A;  4AFI A;  2W0N A;  4EER A;  4G3K A;  5J4E A;  4MN6 A;  4UEY A;  4CLC E;  1S4R A;  2M1C A;  3UB8 A;  4I3A A;  4WLA A;  3H82 B;  4EET B;  3LFV A;  3CAX A;  4HHD A;  3F1O B;  1VHM A;  2J80 A;  2ZOH A;  2VGL M;  3BJN A;  3EQV A;  3FPV A;  2KDK A;  4F3L A;  1ZTU A;  5HL6 A;  2VLG A;  2L0W A;  2EA9 A;  3VE3 A;  4CLC B;  3LR4 A;  3IBR A;  1T1A A;  1N9L A;  2W3H A;  3C38 A;  2J3T C;  3D72 A;  3W2Z A;  4YNR A;  2ZMV A;  3LI8 A;  5TBM B;  3KSI A;  3MQ0 A;  3S7N A;  3O5Y A;  2O99 A;  4Q0I A;  1YSP A;  2PDR A;  5EFW A;  2VKS A;  4BMW A;  4MN5 A;  3R7W A;  3S7O A;  3CIT A;  1MC0 A;  2XRN A;  3CUE A;  1P9W A;  2QYB A;  2VV8 A;  2I9V A;  3BW6 A;  3TE8 A;  4BBT A;  1P9R A;  1T1B A;  3VOL A;  4KUO A;  2JKT I;  2OAQ 1;  4LRZ E;  4Y2F A;  2FZ0 A;  2L1M A;  3JVV A;  2W1T B;  5AVE A;  3T50 A;  3RH8 B;  2QJ7 A;  2ZOI A;  1OT9 A;  3LID A;  3PBN A;  2QHK A;  3E98 A;  4IHQ A;  1N9O A;  4KQD A;  5CX7 A;  4DJ2 A;  1JNU A;  1XFQ A;  2XRO A;  3H7W A;  4PKY G;  2VGL S;  4K08 A;  2P04 A;  1WA9 A;  3RFB A;  2V0U A;  1XJ6 A;  4I39 A;  1DP9 A;  5HPF A;  3E4O A;  3CUE C;  3NOU C;  4ARZ A;  1X0O A;  2XA7 S;  1TS6 A;  3NOT C;  3FC7 A;  5J7E A;  3U2A A;  1TF1 A;  5DFY A;  2B02 A;  3EGX C;  4HJ3 A;  3T4L A;  2V0W A;  4UQI M;  4ARZ B;  4DJ3 A;  5F6A A;  4EES A;  3S7P A;  3T4K A;  2JN7 A;  1F98 A;  1NLZ A;  5F68 A;  3H82 A;  3OBF A;  4NXF A;  4EEU A;  4R3A A;  1YAX A;  3LI9 A;  4WEJ A;  3MJQ A;  3PBR A;  1V9Z A;  4FOF A;  5HWT A;  4Z1W A;  2NUT C;  3JVU A;  2P7J A;  1OTA A;  2V1A A;  3C2W A;  2PYP A;  2JKR M;  2W1T A;  2VV6 A;  3CWF A;  4Q0H A;  3LUQ A;  3H9W A;  3NOP C;  2J3T D;  4ETZ A;  3KYQ A;  4E04 A;  1S4S A;  2H28 A;  1OTD A;  4WEL A;  2DMW A;  2GX5 A;  2Y8H A;  2PT7 A;  3P7N A;  3ULF A;  4LLO B;  2YKF A;  3PXP A;  3T4J A;  3UB9 A;  1XJ3 A;  5KSH A;  3V67 A;  4NKP A;  1S66 L;  1OTB A;  2QWS A;  2PD8 A;  4PAU A;  5AJG A;  5HDD A;  5TBM A;  4UQI S;  1ODV A;  4YWZ A;  1DP6 A;  2B18 A;  2GNX A;  2VJW A;  4PHT A;  2K7S A;  4I3I A;  3ZYT A;  3F1N A;  3MF0 A;  3MR0 A;  1OPX A;  3BY8 A;  1GSX A;  3EWK A;  4GJ4 A;  1VB6 A;  2NUP C;  2HV1 A;  4KQO A;  3TRC A;  4HH3 A;  3C8C A;  5DJU A;  3BWL A;  3MXQ A;  4LPZ A;  2KX6 A;  3EQU A;  2KLI A;  3F1O A;  3BQA A;  1LSW A;  5C5K A;  4EW7 A;  4EUV A;  3KSF A;  2LB5 A;  4I38 A;  4HH2 A;  3VV4 A;  3LIE A;  3PHY A;  3UB6 A;  2GZA A;  1W63 M;  4MCW A;  4Q0J A;  4XT2 B;  4FSF A;  4MDZ A;  2O9B A;  4HJ6 A;  4HQA A;  5F5Y A;  4WN5 A;  4CLC A;  3F1N B;  4JGQ A;  3F1P B;  2VV7 A;  5G4Y A;  4MMN A;  3UMD A;  4O8G A;  4ETX A;  4L9G A;  4HIA A;  3RTY A;  3LIB A;  1D7E A;  3R4K A;  3HJI A;  3BQ8 A;  2OOL A;  2HJE A;  2ZMF A;  1T1C A;  3PBO A;  2PYR A;  3T4O A;  3FPW A;  5MC7 A;  1D06 A;  1V9Y A;  2HGV A;  2CMN A;  5DF9 A;  4IUK A;  2Y79 A;  4WUJ A;  5HSQ A;  4RQ9 A;  1XFN A;  2W3F A;  1DRM A;  1YKD A;  4L9E A;  4GLQ A;  5HD5 A;  1XJ4 A;  2EWV A;  1S67 L;  3NJA A;  2L4R A;  1OT6 A;  3PBQ A;  4GHI A;  3TW8 A;  1UWN X;  4L9F A;  4ZRR A;  2M7V A;  2JKR I;  1YSQ A;  3LYX A;  5IS1 A;  1TS7 A;  3K3D A;  2JKT M;  2V9A A;  4H6J A;  2VEA A;  4GHI B;  2IA2 A;  5DKL A;  1NWZ A;  2MJ6 A;  3K2N A;  3GEC A;  4GCZ A;  4EQ1 A;  2A24 B;  1UWP X;  3G6O A;  2PHY A;  3EEA A;  3PBT A;  2A2L A;  4BBV A;  3MQQ A;  3IS2 B;  2OAP 1;  4EEP A;  3LR3 A;  4G3W A;  4NXB A;  1STZ A;  4DN0 A;  4R38 A;  2INW A;  3PBS A;  1G28 A;  4L0L A;  3LIF A;  2J3W A;  1W63 Q;  3HCY A;  4I5S A;  1LSV A;  3TJZ C;  3KYZ A;  3UE3 A;  5F69 A;  4WEK A;  1OJG A;  3MQO A;  4P6Z S;  4B93 A;  4EXO A;  5HDS A;  3A0S A;  3BY9 A;  4CLC D;  3OCL A;  2HJ9 C;  3IBJ A;  4O01 A;  3UB7 A;  4GS9 A;  4KUK A;  5K5B A;  3T4Q A;  4NXE A;  2M7U A;  5DFX A;  5G4Z A;  4I3J A;  3CI6 A;  1DP8 A;  5DKK A;  4MN7 A;  5HWW A;  1LT0 A;  2XSS A;  4JGP A;  4M4X A;  1IOU A;  3HJK A;  1MKM A;  1Y28 A;  4HOI A;  2VX8 A;  2GJ3 A;  3F1P A;  4BJP A;  4BWI A;  2W27 A;  3IS2 A;  3OCN A;  3P01 A;  3CLO A;  3EOI A;  1TS8 A;  3T4T A;  2O9C A;  3T4S A;  3K3C A;  2YKH A;  4HNB A;  1P0Z A;  3MMH A;  5I5L A;  3SW1 A;  2W3D A;  2VZW A;  1MZU A;  5HDC A;  1NLY A;  1S1Y A;  3KX0 X;  3FG8 A;  2W3E A;  4HJ4 A;  3UME A;  1GSV A;  4LRY C;  1TD5 A;  3NHQ A;  5DJT A;  4JGO A;  1S1Z A;  4WF0 A;  3A0R A;  5TJJ A;  3PR6 A;  1P97 A;  4JGR A;  3LR5 A;  1LL8 A;  3ICY A;  4HY8 A;  1XJ2 A;  4IJG A;  5LBR A;  1UGU A;  4F3L B;  4NEE D;  4Y3I A;  1F5M A;  1EW0 A;  4II7 A;  4OOL A;  2V1B A;  2K2N A;  1N9N A;  2G7U A;  2PR5 A;  4CQH A;  2WKQ A;  3UE6 A;  2D01 A;  3OOV A;  5IU1 A;  3VE4 A;  3H7W B;  2LB9 A;  3D3O A;  2W3G A;  4BBU A;  4P6Z M;  4O0P A;  3EGD C;  2R78 A;  2D02 A;  3E4P A;  1BYW A;  1ZHH B;  3PYP A;  1IFQ A;  1H8M A;  1TS0 A;  3KSG A;  3EEH A;  3LIC A;  5HZH A;  2WKP A;  4HP9 A;  2W1R A;  4GS9 B;  2PR6 A;  3S7Q A;  3B42 A;  5IT5 A;  5A8B A;  1GSW A;  5J3W A;  1OTE A;  4R6L A;  5HD3 A;  2O9A A;  3A0V A;  2QKP A;  2BAS A;  4Y5F A;  1H3Q A;  1NRJ A;  2WKR A;  3C30 A;  4YOF A;  1G6O A;  4R70 A;  1T18 A;  3R7W B;  4EU0 A;  2P08 A;  4DMZ A;  5L8M A;  1LSX A;  5HPI A;  2KOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...