5DKKA

Structure of the dark-state monomer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Blue light-induced LOV domain dimerization enhances the affinity of Aureochrome 1a for its target DNA sequence.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
molecule tags Signaling protein
molecule keywords LOV domain
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dkkA00
3ZQ5A 2W27A 5DJTA 1S1YA 2PHYA 1N9NA 2VV7A 4L9GA 4NXGA 3ULFA 2EA9A 5DKKA 1BYWA 5F5YA 1Y28A 2GJ3A 3E4OA 2OWHA 3K3CA 4RQ9A 2A24A 3FC7A 1OTIA 5HWWA 2OWJA 3BY9A 4R3AA 4WLAA 2V0UA 2Z6DA 3H82B 4R70A 5HDSA 3CWFA 2H28A 3D72A 1GSWA 3GDIA 3FG8A 3P7NA 2W0NA 4HJ6A 5G4YA 3LICA 2QHKA 5J7EA 1TS6A 1GSXA 1T18A 3H7WA 3LUQA 4HHDA 4I3IA 4M4XA 4R6LA 4DJ2A 5IS1A 1UGUA 3F1OA 5TBMB 4H6JB 4F3LA 1F98A 1S4RA 4DJ3A 4NXFA 1S67L 3SW1A 4KUKA 3PYPA 4HIAA 1P97A 2PD7A 4HNBA 1T1AA 3UB8A 3EWKA 1WA9A 4HP9A 2QKPA 5AVEA 4I39A 3OLOA 5A8BA 3F1PA 1OTAA 1T19A 1ODVA 5HSQA 2OOLA 1D06A 3LI8A 3RH8B 5HD3A 3HJIA 3MJQA 3IS2A 4HI4A 3MFXA 1D7EA 2ZOIA 1N9OA 4GS9A 3A0VA 3CLOA 5DJUA 2KX6A 2PD8A 2K7SA 3NOUC 4JGRA 1GSVA 3BY8A 2JN7A 1XJ4A 3H9WA 4HOIA 4HQAA 3A0SA 1OT6A 1EW0A 3RTYA 4LPZA 4WN5A 1OT9A 5F68A 4EXOA 5F69A 4XT2B 2JHEA 3UB9A 4LRZE 3GECA 4NXEA 4WUJA 1TS7A 5HWTA 3LIAA 2WKQA 4LRXC 1F9IA 2VEAA 1TS8A 4B9OA 1XJ2A 2QJ7A 1LL8A 1T1BA 2VV6A 2Z6CA 3NOPC 3UMEA 4GCZA 3G6OA 3LIEA 2VV8A 1KOUA 1V9YA 4LLOB 3F1OB 4I38A 5J3WA 4H6JA 1TS0A 1XJ6A 3UB6A 4LRYC 5F6AA 4BBUA 3H82A 4MN5A 4EEPA 2L1MA 3F1NA 3LI9A 3NOTC 4MN6A 3VE3A 3PHYA 4JGOA 1DP9A 1MZUA 1P0ZA 1S1ZA 1DRMA 1S4SA 2V9AA 2V1BA 3E4QA 4I3AA 2QWSA 4WL9A 2WKPA 1T1CA 2I9VA 3NHQA 3CAXA 3F1NB 4GHIA 2L4RA 2L0WA 2M1CA 1S66L 3LIFA 2PYPA 3E4PA 4HP4A 4GW9A 4JGQA 1JNUA 3VE4A 4HH3A 4K08A 2CMNA 2BASA 4GS9B 2KDKA 5HDDA 3LYXA 1LSXA 3C2WA 4HY8A 5IU1A 4KQDA 1OJ5A 1OTDA 2YKHA 3MQQA 4E04A 4R38A 4EW7A 5HWVA 3KX0X 5J4EA 3K3DA 2PR5A 4PKYA 4JGPA 2D01A 4YWZA 1NWZA 3H7WB 1G28A 2A24B 4L9FA 5AVFA 1UWNX 1DP6A 1VB6A 2ZBBA 5KIZA 2VLGA 2YKFA 1UWPX 2PR6A 4I3JA 4NXBA 3HJKA 1DP8A 2B02A 1XJ3A 4KUOA 3IBRA 1XFNA 1X0OA 2HV1A 4HJ3A 3MR0A 3VOLA 5HZHA 1OTEA 3ICYA 4XT2A 2PDRA 1V9ZA 5G4ZA 5I5LA 4HJ4A 5TBMA 2ZOHA 4EEUA 2P7JA 1LSVA 3B33A 3BWLA 5DKLA 2V1AA 5HDCA 4F3LB 4EERA 2INWA 1LSWA 2V0WA 3A0RA 4WF0A 3NJAA 3UB7A 3UE6A 3EEHA 4GHIB 4HH2A 2R78A 4L9EA 1LT0A 3UMDA 2J80A 4EESA 3F1PB 3LIBA 2QJ5A 4I5SA 4BBTA 1XFQA 4PKYG 4BBVA 3MQOA 1OJGA 3MXQA 4EQ1A 5EFWA 3IS2B 2WKRA 2D02A 3LIDA 1OTBA 5HD5A 4EETB 3T50A 3C8CA 2PYRA 1N9LA
chains in the Genus database with same CATH superfamily
1TDGA 3EQUA 2Z2MB 1SDNA 4QWOA 4UA7A 3E4OA 3BJNA 2WGWB 1FSWA 3BY9A 3OPLA 2EXAA 4BD1A 1FILA 3T4LA 4KZ6A 4YOFA 3GDIA 2W0NA 3CG5A 5E2FA 3MXSA 2ZQ7A 4U0XA 5J8XA 5EM1A 2O9AA 2PD7A 4KZBA 4O8GA 2BLSA 4Z1WA 3BRMA 5F82A 1TF1A 2O9CA 3PAEA 1Q2QA 4Y5FA 2Z2LB 4II7A 5GLDA 2HDSA 4WELA 2Q9NA 2FH5A 1MBLA 4Z9QA 4CLCA 4PM7A 4JLFA 3FPWA 2X01A 3GR2A 4ARZB 5J3WA 3UB6A 3HL9A 4MN5A 3O88A 3BLSA 3IF6A 3ZG8B 3E4QA 1SDEA 4GW9A 4BL2A 3TRCA 2CMNA 2WGWA 3Q7ZA 1MPLA 3C2WA 4B93A 2VGKA 3VP1A 4EW7A 3K3DA 1Z6FA 5LBRA 2B5RA 2WKIA 3DTIA 3LR5A 3H7WB 4L9FA 2ZM8A 5DF7A 2V20A 3PBNA 2K31A 3VSKA 3VOLA 3PBSA 4MCWA 2WADA 2ZJ9A 3S1YA 3OC2A 5TBMA 2P7JA 3WS0A 2Y2JA 3NDEA 3MF0A 4WF0A 1YLPA 2R78A 1L0FA 5FI6A 1N9BA 3LR4A 1KGEA 3PBRA 3ZQ5A 3NBLA 1XA1A 1Y28A 1YSPA 1DY6A 4S2LA 4LCLA 5L2FA 4O0PA 2OWJA 4OPQA 4UEYA 1KE4A 3W4PA 3MKEA 1IELA 2QHKA 5FDSA 1PW8A 3SW1A 3HUOA 4Q0IA 4OQHA 3ZG0A 1ZG4A 4DKIA 3T4SA 2WKEA 1OTAA 2P74A 2Y2OA 4CLCE 4X1LA 3TJZC 3CLOA 4E6WA 1HTZA 4QY5A 3HLDA 3W2ZA 3CZDA 2DCFA 3RTYA 3BFFA 1BZAA 4XT2B 5TFQA 3GECA 3GMWA 2Y2PA 1XJ2A 5HARA 4OP8A 4LLOB 2IWCA 2ZM2A 5FAOA 1KE3A 3R7WA 4NEED 4H8RA 3G2YA 4K08A 4P6ZM 4BJPA 5HFOA 3CUEA 4G3WA 4HY8A 3MQ0A 5HWVA 4DDYA 3UN7A 2BG1A 2QYBA 4FUWA 1DJAA 1FR6A 5IHVA 5FQJA 2JBFA 1K4FA 4GDNA 1E4DA 5HDCA 2ZD8A 1LI9A 3DW0A 1FSYA 4N9KA 4DF6A 3M2JA 3F1NA 1YLWA 2PAVP 3NECA 1N9NA 3UPPA 3ZHHA 4EUZA 4Y7PA 3HREA 4FH2A 2JC7A 4E6XA 5FQ9A 1ZHHB 1YLJA 5G4YA 1ZG6A 5KSCA 2C5WB 2LB9A 3SH8A 3T4JA 3B47A 4FD8A 1JWPA 1T1AA 4UA9A 1IYPA 2O99A 2HDQA 4G3KA 4OQ0A 2W3FA 4OOYA 4PMAA 1XXMA 1E3UA 5FQMA 4PPRA 4A5RA 5AQ9A 1Z09A 5HX9A 1H8YA 4BL3A 1QMFA 2AVXA 1BLCA 2PBYA 4S2IA 4B9OA 2Z6CA 1YSQA 4NETA 3G6OA 3LIEA 4M3KA 4BBUA 2EX2A 1FQGA 4MN6A 3C5AA 2OV5A 1HZOA 4GKUA 2UV0E 2Y2GA 3F1NB 3VE4A 2V8CA 2X02A 5HDDA 3LY4A 5IU1A 4EWFA 3MQQA 4GD6A 4OP5A 1JTGA 5DVAA 4YWZA 4X69A 2LB5A 3TOIA 2XLNA 4EBLA 1VQQA 4NXBA 1BLPA 4DE2A 4KUOA 3U2AA 1YLTA 3IH9A 2DMWA 5BOHA 3E2LA 5G4ZA 4HJ4A 2M7VA 3R7WB 3CJMA 1GHPA 1K56A 4X55A 3NDGA 2QJ5A 3QP2A 3IHAA 4HBTA 4S2OA 2HJ9C 2D02A 4R23A 1TEMA 3C7UA 3MXRA 1F2KA 5HAPA 3A3JA 3DBAA 3R4KA 1BULA 3HLGA 3RXXA 3NC8A 3CPTB 2P08A 1EWZA 2XFTA 4ETXA 3B3XA 5DTSA 2KOIA 1UGUA 4OPRA 2HDRA 1JTDA 1S4RA 3BYDA 1KVLA 4HNBA 4HP9A 3QP1A 3N8LA 4KZ9A 2KX6A 1FR1A 1PW1A 2EFXA 5GHYA 1PNEA 2ZLYA 3MBZA 1ALQA 3QNCA 5HWTA 1H5XA 2EXBA 3UE0A 3VP0A 3V3RA 4ETZA 5HL1A 1W8QA 4I38A 5HPIA 5CTMA 1SKOB 1LI0A 3GTCA 3QP4A 5E43A 2P9VB 3KO6A 2PYPA 1NJ4A 4GD8A 4NKPA 3HLFA 5AQ7A 4BWIA 5CHJA 1K54C 1D1JA 3T4KA 2IA2A 3ZCZA 1LLBA 2PR6A 3IBRA 4KQRA 2ZOHA 3B33A 1IYOA 2Q0OA 5G18A 3EEHA 4HH2A 1AWIA 3PBQA 4I5SA 3MQOA 4Q0HA 1ES4A 5CEBA 2A49A 4CLCB 1KGGA 2PHYA 3KSHA 1BLHA 2V2FF 1O7EA 1NLZA 4R70A 2P9VA 5L8MA 5J7EA 2IWDA 4R6LA 1PRQA 4MLLA 3F1OA 4X25A 4KG5A 3BW6A 3WRZA 1K57A 3UB8A 1IOUA 2HGVA 3WS5A 2OOLA 4MBHA 2C6WB 4KQOA 3CHWP 2J3TC 5JYPA 1XJ4A 1J9MA 4KZ5A 2HJEA 1TDLA 2JHEA 4LRZE 2W3EA 2VEAA 2VJWA 4E3KA 1T1BA 3C4PA 2PU4A 3NI9A 3EGDC 3HLWA 3OOVA 4P0MA 3NOTC 3OZHA 2W1RA 4E3OA 3VP4A 1CF0A 1VEUB 3DAVA 4WEKA 2ZMFA 1S66L 4K0WA 3AGFA 2QZ6A 4LV2A 4PKYA 4ZTKA 1PYYA 2JKRI 2VLGA 5F1GA 3PR6A 1L2SA 2HV1A 4S2MA 4UQIS 4ARZA 2Y8HA 3HBRA 2J3TD 3C7VA 1AXBA 5KZHA 1G68A 1MY8A 2X71A 3HUNA 3U4LP 3LIBA 3RFBA 3G4PA 3VP3A 2WKRA 1ES3A 5FDHA 3M2KA 1RCJA 4WZ4A 1HVBA 4WMCD 4RQ9A 5FEFA 3EQVA 1OPXA 1GCEA 1MC0A 4S2PA 5FL3A 5HWWA 1A0KA 4CJNA 4IBXA 4QHCA 2ZC5B 3SS5A 1XGJA 3H7WA 3GQZA 3ZDJA 4UQIM 1WA9A 1J3WA 1FIKA 3OLOA 2M7UA 2FZ0A 5FAPA 3HLBA 5HL6A 4E3JA 3DWKA 2ZQ9A 2Y2KA 2K7SA 4GDBA 4HOIA 4HQAA 3A0SA 2WAFA 1E3UD 3ZNYA 4JF4A 1TS8A 2OLUA 2WUQA 1NYYA 2HDUA 4ZAMA 2ZL1A 1KDSA 4EU0A 2HZ5A 3G2ZA 5CHUA 4DMZA 3IXGA 2QWSA 3NHQA 3CAXA 4P85A 4Q0JA 4JGQA 4X56A 1MWTA 2JKTM 1PZPA 2KDKA 4UHUA 3LYXA 2J3WA 3UDXA 1OTDA 3UDFA 4JGPA 2JKTI 4HEFA 5FSRA 5A92A 3LEZA 3DTMA 4RVAA 2EWWA 2Y2HA 1YLZA 2OSUA 1P9WA 3VOYA 2GDNA 4EEUA 1XA7A 1GA9A 3OPHA 4YNRA 1W7FA 3IXBA 3A0RA 3UMDA 1SHVA 3O86A 2J9OA 2G7UA 4AFIA 4O01A 4FCFA 3ULFA 4ZJ3A 2ZL1B 5EVEA 1K56D 3WS4A 1YQSA 1G6AA 2A2LA 4LGWA 3LFVA 1MWUA 4Y0TA 3G32A 1GSXA 3BM6A 4GJ4A 4K91A 1EROA 3NULA 4Q8IA 4BD0A 2O0YA 3MFXA 4JXVA 2HP5A 3LCEA 4JGRA 4R3BA 3BY8A 3GV9A 3JVVA 3T1SA 4EXOA 2QPNA 1YT4A 3DWZA 1CI8A 4N9LA 3ZFZA 2XEPA 3UMEA 4JF5A 2J8YA 3IF6C 3IQAA 4NG2A 2Y2NA 3VP2A 2WZXA 1DP9A 3LEQA 3FKWA 3O5YA 3PBTA 1BT5A 5EVID 2W3HA 5J4EA 3KX0X 3Q7VA 2P04A 2ZBBA 4Y15A 1DJCA 3T4TA 1XJ3A 2ACGA 2XDMA 1XFNA 1CEGA 3Q82A 4L0LA 1V9ZA 5HAQA 2DRWA 1PI4A 2V1AA 1SKFA 3NJAA 4OQIA 4GHIB 1LT0A 1CI9A 4MMNA 1JWZA 4OLGA 3T4OA 5HD5A 4PAUA 2V1ZA 1ACFA 3BECA 2ZC4B 5GL9A 1JVJA 1OMEA 4MBFA 3RJUA 3L9KA 1M40A 1GSWA 4S2NC 1K54A 2XH9A 2W1TB 1FOFA 3N6IA 5EVIA 3F1PA 3AGDA 3LI8A 4JXWA 1XPBA 2E8IA 3D4FA 4KZ3A 3ZNTA 1ONHA 1OT9A 5F68A 4MDZA 2WKQA 3FZCA 2ZC7A 3NOPC 5FASA 2H10A 4CLCD 3TW8A 4OPZA 1H0MA 2XR0A 4DXBA 4ZJ1A 1IYSA 5E2EA 1SZVA 4GNUA 4EV4A 3SH9A 2L4RA 2M1CA 3A3EA 3UPNA 5DF8A 1OJ5A 4Y0UA 4E04A 4OVDA 3MS6A 2WK0A 5CGXA 2A24B 5KIZA 5AVFA 2XA7M 3IWQA 5DTTA 4N1XA 3TG9A 3D9YA 1HLUP 1BTLA 5TR7A 3BWLA 4EBPA 2INWA 5DTKA 5GLAA 1LSWA 3KSFA 3PAGA 5CGWA 4BBTA 4JBFA 4MNRA 5F1FA 3SZTA 4Y0OA 1Q2PA 3OPPA 1F5MA 4JXGA 5EOEA 5DJTA 4NXGA 1YKDA 2GJ3A 3MZDA 3FC7A 2XFSA 2Y2MA 1WYCA 5HDSA 5L09A 2ZQ8A 1IKIA 2XF3A 1TS6A 3VFHA 2A3UA 1F98A 1NXYA 1LHYA 1HD8A 5E2HA 5EECA 4FH4A 1BSGA 3D3OA 2W3GA 3KSIA 4BMWA 2JKGA 3VMAA 3MMHA 5GHXA 4LV1A 1EW0A 4P6ZS 3PBOA 4KG6A 4WUJA 2ZM0A 3KYQA 5CX7A 1RGZA 3N8SA 4JPMA 4H6JA 2L1MA 1K0KA 3LI9A 3VE3A 3FPVA 2V9AA 3P98A 3E4PA 4PM8A 4RA7A 1JWVA 3LY3A 3ZVTA 4KQDA 5EPHA 4C6YA 1PWDA 3TE8A 5L10A 2XK1A 3BFGA 2Y2QA 4ID4A 4C3QA 2FFYA 1MKIA 2EFUA 2HPBA 3KYEA 1VEUA 3UE6A 2H0TA 4DDSA 4PKYG 1MXOA 2IWBA 4EETB 5EM0A 4WZ5C 2W3DA 3ITBA 2W27A 4MEZA 2JKRM 5FAQA 1ZC2A 3T1XA 2Y55A 4N1HA 2A24A 2XGNA 1PIOA 3P7NA 3LICA 3UPOA 3E2KA 1K6RA 1LL5A 1P97A 1IEMA 3N7WA 5A8BA 3MZEA 5K5BA 3MJQA 3IS2A 1K55A 2ZOIA 2V8FA 1GSVA 4Y13A 2MJ6A 1CEFA 3PXPA 4E3LA 2WGVA 1ERMA 3UB9A 4NXEA 1GHMA 3LIAA 3M6BA 2R9WA 4LRYC 5F6AA 5EVIC 1P0ZA 5FATA 1KDWA 4B4XA 3T1RA 3VSLA 3IXHA 4YINA 4S2NA 2XA7S 4E3MA 2B18A 5I94A 3QP8A 1L0DA 2Y79A 5A93A 5A90A 3MSHA 2EX9A 2JKFA 5AJGA 3GSGA 3FWLA 4HJ3A 3L7HA 1W8YA 1QMEA 4B4ZA 4GZBA 4KZ7A 3S7NA 4RYEA 2V0WA 1K38A 2VA0A 4ZJ2A 3V3SA 2KLIA 2VKSA 1XFQA 4WMCA 2HF6A 1OJGA 2VZWA 2OLVA 3UO9A 3G30A 1W63M 2EA9A 4B88A 5KSHA 3K2NA 3ZG7B 1OTIA 3ISGA 1KE0A 2V0UA 2ZQDA 2OAQ1 5HW3A 4EBNA 4HHDA 4X1MA 5IS1A 2ZQCA 1ZKJA 3BEBA 3C38A 1CK3A 4Y17A 3S7PA 3QP5A 5AVEA 1XGIA 4OLDA 5HSQA 1T19A 4GS9A 5M19A 4OQGA 3HLCA 5CHMA 3H9WA 4DE0A 4OONA 5DF9A 5F69A 1PZOA 3UB5P 5HPFA 4P87A 1F9IA 1TD5A 2K2NA 4CLCC 1KOUA 5HZHA 2WGIA 3WRTA 1K6SA 2G2WA 3O87A 2I9VA 1BUEA 3S7OA 4GHIA 4BENA 1JNUA 4U0TA 3W8KA 4FTXA 3FKVA 4IUHA 5D3OA 1YM1A 4IEDA 1DP8A 1N4OA 4EQIA 5HAIA 2Y2LA 4CQHA 4R1GA 5DKLA 4MN7A 4EERA 2PT7A 1MWSA 4F94A 4QPRA 5EVIB 1STZA 3MXQA 3IF5A 3LIDA 1OTBA 3DTEA 1PWCA 4P6BA 1W63Q 1N9LA 1S1YA 2VV7A 1IFQA 2Y2IA 3Q7VB 1BYWA 1I2WA 2OWHA 1SCWA 4R3AA 3IX4A 2H28A 3FG8A 3C30A 3T12B 5EVLA 2GNXA 4I3IA 2NUPC 3LUQA 3ZVWA 4OPYA 1VETB 4R4RA 5CTNA 4PHTA 1NY0A 4KENB 1ODVA 4D60A 1XX2A 5L07A 4QU3A 1M6KA 5E2GA 1VM1A 1TVFA 3A0VA 3VFFA 3LGOA 3NOUC 2JN7A 3UE1A 3LR3A 1YPRA 2RL3A 3GRJA 4LPZA 4DXCA 4LRXC 1IKGA 2QJ7A 1KGFA 3P09A 4F3LB 4EEPA 2W1TA 3PHYA 3UY6A 4I3AA 2V1BA 1S0WA 4UAAA 5FQIA 4KZ4A 4YFMA 3OCNA 2WKHA 3G34A 1LSXA 2PR5A 3S4XA 5FQKA 2R9XA 5CEDA 2EX6A 4C75A 4OH0A 4DRTA 1DP6A 1VB6A 2HP6A 3CMZA 4HESA 2DNSA 3HJKA 1L0GA 3TSGA 3MR0A 3IX8A 2XD1A 4QY6A 5F83A 3IHBA 3EGXC 4FSFA 3UB7A 4GN2A 2J80A 3IBJA 4QJGA 1KVMA 1W79A 4Y3IA 1MKMA 4EUVA 5TJJA 3UNWA 4L9GA 3JYIA 5DKKA 5F5YA 5A91A 5JYOA 1NYMA 3AGEA 4QB8A 5EOOA 2JCHA 2Z6DA 1NZUA 4JF6A 4LV0A 1ERQA 3N4IA 3IX3A 2J7VA 2VGJA 1NRFA 3N8RA 4H6JB 5DFYA 5C5KA 1S67L 5FA7A 4KUKA 3JVUA 3EWKA 5CGSA 2OAP1 4QD4A 4GOGA 5HD3A 4HI4A 5FI2A 1S6RA 1NLYA 1K25A 3HUMA 4BQMA 4IBRA 2Y59A 4XXRA 2HP9A 4NK3A 1ZTUA 3HLEA 2VV6A 2WAEA 3BLMA 4Y2FA 5AQBA 4WEJA 4DN0A 3ZG9B 3P01A 1VETA 1MZUA 2VX8A 4MBKA 3FYZA 3LIFA 1VHMA 1I5QA 1H3QA 1NRJA 2BASA 2ZMVA 5M1AA 3LO7A 3A3IA 2YKHA 3E0YA 2Y4AA 3A3FA 2ZMAA 1UWNX 1UWPX 1O07A 2B02A 4KG2A 3DTKA 5CRFA 1OTEA 3ICYA 2ZQAA 4XUZA 2G2UA 1YAXA 4FOFA 3CUEC 5KMWA 3V39A 2I72A 4KQQA 4L9EA 3VV4A 4ZRRA 3UDIA 4BBVA 1LL9A 4LFUA 3IF6B 4GLQA 4PM5A 3OPRA 4KZAA 2EWVA 3ZGAB 3LR0A 4WLAA 1XP4A 2EX8A 4HJ6A 5CERA 4RX2A 4DJ2A 3E98A 1C3BA 3RXWA 5TBMB 1WE4A 3QNBA 3JPUA 4WBGA 4I39A 1D06A 1YLYA 5DJUA 5FEGA 2PD8A 4XUXA 3KSGA 2E8JA 3KYZA 3BFDA 3WWXA 3GVBA 4IVIA 1GA0A 1ES5A 3F1OB 1XJ6A 3Q1FA 1IYQA 4X68A 4JGOA 4R4SA 1DRMA 4OOLA 2WKPA 1PI5A 1T1CA 5GLBA 2L0WA 4O7DA 4HP4A 4OOMA 5U47A 4DE1A 2QMIA 3ITAA 1K4EA 3ZYTA 3MKFA 2D01A 3Q81A 1NWZA 3QHYA 3S22A 5DFXA 1K57C 1K55C 4ZDXA 4ESPA 2GX5A 2BTFP 4CPKA 4XT2A 2PDRA 2XQZA 2ZC3B 1XKZA 5AQAA 1L3LA 4UA6A 4LV3A 1G6OA 3W4QA 3HCYA 1H8ZA 3F1PB 2XRNA 1EI5A 2B95A 1WYBA 3C8CA 2PYRA 3T1QB 3O3VA 1ESUA 4WYYA 4ZBEA 3Q07A 3FV7A 2JE5A 3K3CA 3C4OA 1H8MA 3B42A 5GHZA 5GLCA 3WS2A 2VGLS 3CWFA 4DE3A 3D72A 4PM6A 2H5SA 5M18A 4X53A 2Q9MA 4GB7A 1T18A 3V5MA 4DJ3A 1YMXA 3EEAA 3PYPA 4HIAA 2J9PA 2QKPA 2XROA 1L0EA 4IHQA 3HJIA 2FFFB 2Y91A 3G31A 3NCKA 3UE3A 1ES2A 3HVFA 3VOZA 1W5DA 4WN5A 5EE8A 3BQ8A 4LCMA 3BQAA 3NIAA 3SS4A 2VV8A 1V9YA 3H82A 3IWIA 2CC1A 1CQAA 1S1ZA 2VK3A 2NUTC 4S2JA 1I2SA 2XD5A 4GS9B 1Y54A 3CPTA 4IVKA 3A3DA 3WS1A 1Y4OA 1G5UA 1YMSA 1ONGA 3OBFA 3W4OA 3NY4A 5MC7A 3OCLA 2XSSA 1X0OA 2PRFA 3V67A 4RX3A 5I5LA 4OKPA 3IXDA 4IUKA 1NZOA 4WM9A 3IT9A 1CJFA 5EUAA 4N92A 3PTEA 4EQ1A 4K0XA 4E3NA 5FQQA 4HBUA 3BFEA 4LENA 4JKTA 4S2KA 4BLMA 1FCMA 1MWRA 4WZ5A 4ME4A 1GHIA 4JXSA 4U3TA 2H0YA 3H82B 3CI6A 2O9BA 4M4XA 2RCXA 3MFDA 4F3LA 4NXFA 1SKOA 3EOIA 2WYXA 4PM9A 3M6HA 4X6TA 5TGFA 1ESIA 3RH8B 1DJBA 1D7EA 5IT5A 1N9OA 4KZ8A 5EV0A 2UWXA 4R0QA 1BLSA 3BFCA 1FCNA 1U60A 1OT6A 4R3JA 3S7QA 5FI7A 1TS7A 1E25A 3I7JA 1LL8A 2WZZA 3CITA 3ZG5A 4GCZA 2ZC6B 2GZAA 3SH7A 1TS0A 1S4SA 3MZFA 2PU2A 4WL9A 3IH8A 3T4QA 4HH3A 2VGLM 1RP5A 4D2OA 4R38A 4G3VA 3G35A 1FCOA 5CXWA 3QP6A 1G28A 3SS3A 3SOIA 2YKFA 3IWOA 4I3JA 4E3IA 4IJGA 1PWGA 2PBDP 3V50A 1LSVA 1PFLA 4EESA 1RGYA 5CECA 5EFWA 3IS2B 3T50A 1P9RA
chains in the Genus database with same CATH topology
5DJTA 4NXGA 1YKDA 2PHYA 3EQUA 3KSHA 4L9GA 5DKKA 5F5YA 2GJ3A 3E4OA 3BJNA 1NLZA 3FC7A 3BY9A 2Z6DA 4R70A 5HDSA 3T4LA 4YOFA 3GDIA 5L8MA 2W0NA 5J7EA 1TS6A 4R6LA 3F1OA 4H6JB 5DFYA 1F98A 5C5KA 1S67L 4KUKA 3BW6A 2O9AA 3JVUA 2PD7A 3UB8A 3EWKA 1IOUA 4O8GA 2OAP1 2HGVA 4Z1WA 2OOLA 1TF1A 2O9CA 5HD3A 4HI4A 3D3OA 4Y5FA 2W3GA 4KQOA 3KSIA 4II7A 4BMWA 2J3TC 1NLYA 1XJ4A 3MMHA 4WELA 1EW0A 2HJEA 4P6ZS 2FH5A 2JHEA 3PBOA 4LRZE 4WUJA 2W3EA 4CLCA 2VEAA 2VJWA 3KYQA 1ZTUA 5CX7A 1T1BA 2VV6A 3FPWA 4Y2FA 4ARZB 3EGDC 5J3WA 3UB6A 4H6JA 4WEJA 4DN0A 3OOVA 4MN5A 2L1MA 3LI9A 3NOTC 3P01A 3VE3A 3FPVA 2W1RA 1MZUA 2V9AA 2VX8A 3E4QA 4WEKA 2ZMFA 1S66L 3LIFA 1VHMA 3E4PA 4GW9A 3TRCA 1H3QA 2CMNA 1NRJA 2BASA 2ZMVA 3C2WA 4KQDA 4B93A 2YKHA 4EW7A 3K3DA 4PKYA 3TE8A 5LBRA 3E0YA 3LR5A 3H7WB 4L9FA 1UWNX 3PBNA 2JKRI 2VLGA 1UWPX 2K31A 2B02A 3PR6A 3VOLA 2HV1A 3PBSA 1OTEA 4UQIS 3ICYA 4ARZA 4MCWA 3OC2A 2Y8HA 5TBMA 1YAXA 2P7JA 4FOFA 2J3TD 3CUEC 3MF0A 4WF0A 3UE6A 2R78A 4L9EA 3VV4A 4ZRRA 3LIBA 3RFBA 4PKYG 4BBVA 3LR4A 2WKRA 4EETB 2W3DA 3PBRA 3ZQ5A 2W27A 4GLQA 2JKRM 1Y28A 1YSPA 4RQ9A 3EQVA 2EWVA 1OPXA 5FL3A 1MC0A 2A24A 5HWWA 3LR0A 4O0PA 2OWJA 4UEYA 4WLAA 3P7NA 4HJ6A 3LICA 2QHKA 3H7WA 4DJ2A 3E98A 5TBMB 4UQIM 3SW1A 1P97A 4Q0IA 1WA9A 4I39A 3OLOA 2M7UA 5A8BA 3T4SA 1OTAA 2FZ0A 5K5BA 1D06A 3MJQA 5HL6A 3IS2A 4CLCE 2ZOIA 3TJZC 3CLOA 5DJUA 2PD8A 2K7SA 1GSVA 3W2ZA 2MJ6A 4EUVA 4HOIA 4HQAA 3KSGA 3A0SA 3PXPA 3RTYA 4XT2B 3UB9A 3GECA 4NXEA 3KYZA 3LIAA 1TS8A 1XJ2A 4LLOB 3F1OB 1XJ6A 4EU0A 4LRYC 5F6AA 4DMZA 4JGOA 1P0ZA 3R7WA 1DRMA 2QWSA 4OOLA 2WKPA 1T1CA 3NHQA 3CAXA 4NEED 2L0WA 4JGQA 4Q0JA 4HP4A 4OOMA 4P6ZM 4K08A 2JKTM 2XA7S 4BJPA 2KDKA 3LYXA 2J3WA 3CUEA 4G3WA 2B18A 4HY8A 1OTDA 3ZYTA 3MQ0A 5HWVA 4JGPA 2D01A 2Y79A 2JKTI 1NWZA 5DFXA 2QYBA 2EWWA 5AJGA 1P9WA 2GX5A 4HJ3A 4XT2A 2PDRA 4EEUA 5HDCA 1G6OA 4YNRA 3S7NA 2V0WA 3A0RA 3HCYA 2VA0A 3UMDA 3F1PB 2KLIA 2VKSA 1XFQA 2HF6A 1OJGA 2VZWA 2XRNA 2G7UA 3F1NA 3C8CA 2PYRA 4O01A 4AFIA 1W63M 1N9NA 3ULFA 2EA9A 5KSHA 3K2NA 3K3CA 1OTIA 1H8MA 3B42A 2V0UA 2A2LA 2VGLS 3CWFA 1ZHHB 2OAQ1 3D72A 3LFVA 5G4YA 2LB9A 3T4JA 4HHDA 1GSXA 1T18A 3B47A 5IS1A 4GJ4A 4DJ3A 3C38A 3EEAA 3PYPA 4HIAA 3S7PA 1T1AA 2QKPA 5AVEA 2XROA 2O0YA 5HSQA 1T19A 2O99A 4IHQA 3HJIA 4G3KA 3MFXA 4GS9A 2W3FA 4JGRA 3UE3A 3BY8A 3H9WA 3JVVA 4WN5A 5DF9A 4EXOA 5F69A 3BQ8A 5HPFA 1F9IA 4B9OA 1TD5A 2K2NA 3BQAA 2Z6CA 4CLCC 1YSQA 3UMEA 3G6OA 3LIEA 2VV8A 1KOUA 1V9YA 5HZHA 4BBUA 3H82A 4MN6A 1DP9A 1S1ZA 2NUTC 2I9VA 3F1NB 3S7OA 4GHIA 3O5YA 3VE4A 1JNUA 3PBTA 4GS9B 5HDDA 5IU1A 2W3HA 3MQQA 5J4EA 3KX0X 4YWZA 2P04A 2LB5A 2ZBBA 3OBFA 4IUHA 5MC7A 4NXBA 3OCLA 1DP8A 3T4TA 1XJ3A 2XSSA 4KUOA 3U2AA 1XFNA 1X0OA 4L0LA 3V67A 2DMWA 1V9ZA 5G4ZA 5I5LA 4CQHA 4HJ4A 2M7VA 4IUKA 5DKLA 2V1AA 4MN7A 3R7WB 4EERA 2PT7A 3NJAA 4GHIB 1LT0A 4QPRA 1STZA 2QJ5A 4MMNA 4EQ1A 3MXQA 2HJ9C 2D02A 3LIDA 3T4OA 1OTBA 5HD5A 4PAUA 1W63Q 1N9LA 1S1YA 2VV7A 3DBAA 3R4KA 1IFQA 1BYWA 2OWHA 4ME4A 4R3AA 3H82B 2P08A 3CI6A 4ETXA 2H28A 1GSWA 3FG8A 3C30A 2O9BA 2GNXA 4I3IA 4M4XA 3LUQA 2NUPC 2KOIA 1UGUA 4F3LA 1S4RA 4NXFA 2W1TB 3EOIA 4HNBA 4HP9A 4PHTA 3F1PA 1ODVA 3RH8B 3LI8A 5IT5A 1D7EA 1N9OA 3A0VA 2KX6A 3NOUC 2JN7A 3LR3A 1OT6A 4LPZA 1OT9A 5F68A 4MDZA 3S7QA 1TS7A 5HWTA 2WKQA 4LRXC 2QJ7A 1LL8A 3CITA 3NOPC 4ETZA 4GCZA 4CLCD 3TW8A 2GZAA 4I38A 4F3LB 1TS0A 5HPIA 4EEPA 2W1TA 3PHYA 1S4SA 4I3AA 4WL9A 2V1BA 3KO6A 2L4RA 2M1CA 3T4QA 2PYPA 4HH3A 3OCNA 2VGLM 1LSXA 1OJ5A 4E04A 4NKPA 4R38A 4G3VA 2PR5A 4BWIA 2IA2A 3T4KA 1G28A 2A24B 5AVFA 5KIZA 1DP6A 1VB6A 2XA7M 2YKFA 2PR6A 4I3JA 3HJKA 4IJGA 3IBRA 3MR0A 2ZOHA 1LSVA 3B33A 3BWLA 2INWA 3EGXC 4FSFA 1LSWA 3KSFA 3UB7A 3EEHA 4HH2A 2J80A 3PBQA 4EESA 4BBTA 3IBJA 4I5SA 3MQOA 4Q0HA 5EFWA 3IS2B 4Y3IA 1F5MA 3T50A 1MKMA 4CLCB 5TJJA 1P9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  2W27 A;  5DJT A;  1S1Y A;  2PHY A;  1N9N A;  2VV7 A;  4L9G A;  4NXG A;  3ULF A;  2EA9 A;  5DKK A;  1BYW A;  5F5Y A;  1Y28 A;  2GJ3 A;  3E4O A;  2OWH A;  3K3C A;  4RQ9 A;  2A24 A;  3FC7 A;  1OTI A;  5HWW A;  2OWJ A;  3BY9 A;  4R3A A;  4WLA A;  2V0U A;  2Z6D A;  3H82 B;  4R70 A;  5HDS A;  3CWF A;  2H28 A;  3D72 A;  1GSW A;  3GDI A;  3FG8 A;  3P7N A;  2W0N A;  4HJ6 A;  5G4Y A;  3LIC A;  2QHK A;  5J7E A;  1TS6 A;  1GSX A;  1T18 A;  3H7W A;  3LUQ A;  4HHD A;  4I3I A;  4M4X A;  4R6L A;  4DJ2 A;  5IS1 A;  1UGU A;  3F1O A;  5TBM B;  4H6J B;  4F3L A;  1F98 A;  1S4R A;  4DJ3 A;  4NXF A;  1S67 L;  3SW1 A;  4KUK A;  3PYP A;  4HIA A;  1P97 A;  2PD7 A;  4HNB A;  1T1A A;  3UB8 A;  3EWK A;  1WA9 A;  4HP9 A;  2QKP A;  5AVE A;  4I39 A;  3OLO A;  5A8B A;  3F1P A;  1OTA A;  1T19 A;  1ODV A;  5HSQ A;  2OOL A;  1D06 A;  3LI8 A;  3RH8 B;  5HD3 A;  3HJI A;  3MJQ A;  3IS2 A;  4HI4 A;  3MFX A;  1D7E A;  2ZOI A;  1N9O A;  4GS9 A;  3A0V A;  3CLO A;  5DJU A;  2KX6 A;  2PD8 A;  2K7S A;  3NOU C;  4JGR A;  1GSV A;  3BY8 A;  2JN7 A;  1XJ4 A;  3H9W A;  4HOI A;  4HQA A;  3A0S A;  1OT6 A;  1EW0 A;  3RTY A;  4LPZ A;  4WN5 A;  1OT9 A;  5F68 A;  4EXO A;  5F69 A;  4XT2 B;  2JHE A;  3UB9 A;  4LRZ E;  3GEC A;  4NXE A;  4WUJ A;  1TS7 A;  5HWT A;  3LIA A;  2WKQ A;  4LRX C;  1F9I A;  2VEA A;  1TS8 A;  4B9O A;  1XJ2 A;  2QJ7 A;  1LL8 A;  1T1B A;  2VV6 A;  2Z6C A;  3NOP C;  3UME A;  4GCZ A;  3G6O A;  3LIE A;  2VV8 A;  1KOU A;  1V9Y A;  4LLO B;  3F1O B;  4I38 A;  5J3W A;  4H6J A;  1TS0 A;  1XJ6 A;  3UB6 A;  4LRY C;  5F6A A;  4BBU A;  3H82 A;  4MN5 A;  4EEP A;  2L1M A;  3F1N A;  3LI9 A;  3NOT C;  4MN6 A;  3VE3 A;  3PHY A;  4JGO A;  1DP9 A;  1MZU A;  1P0Z A;  1S1Z A;  1DRM A;  1S4S A;  2V9A A;  2V1B A;  3E4Q A;  4I3A A;  2QWS A;  4WL9 A;  2WKP A;  1T1C A;  2I9V A;  3NHQ A;  3CAX A;  3F1N B;  4GHI A;  2L4R A;  2L0W A;  2M1C A;  1S66 L;  3LIF A;  2PYP A;  3E4P A;  4HP4 A;  4GW9 A;  4JGQ A;  1JNU A;  3VE4 A;  4HH3 A;  4K08 A;  2CMN A;  2BAS A;  4GS9 B;  2KDK A;  5HDD A;  3LYX A;  1LSX A;  3C2W A;  4HY8 A;  5IU1 A;  4KQD A;  1OJ5 A;  1OTD A;  2YKH A;  3MQQ A;  4E04 A;  4R38 A;  4EW7 A;  5HWV A;  3KX0 X;  5J4E A;  3K3D A;  2PR5 A;  4PKY A;  4JGP A;  2D01 A;  4YWZ A;  1NWZ A;  3H7W B;  1G28 A;  2A24 B;  4L9F A;  5AVF A;  1UWN X;  1DP6 A;  1VB6 A;  2ZBB A;  5KIZ A;  2VLG A;  2YKF A;  1UWP X;  2PR6 A;  4I3J A;  4NXB A;  3HJK A;  1DP8 A;  2B02 A;  1XJ3 A;  4KUO A;  3IBR A;  1XFN A;  1X0O A;  2HV1 A;  4HJ3 A;  3MR0 A;  3VOL A;  5HZH A;  1OTE A;  3ICY A;  4XT2 A;  2PDR A;  1V9Z A;  5G4Z A;  5I5L A;  4HJ4 A;  5TBM A;  2ZOH A;  4EEU A;  2P7J A;  1LSV A;  3B33 A;  3BWL A;  5DKL A;  2V1A A;  5HDC A;  4F3L B;  4EER A;  2INW A;  1LSW A;  2V0W A;  3A0R A;  4WF0 A;  3NJA A;  3UB7 A;  3UE6 A;  3EEH A;  4GHI B;  4HH2 A;  2R78 A;  4L9E A;  1LT0 A;  3UMD A;  2J80 A;  4EES A;  3F1P B;  3LIB A;  2QJ5 A;  4I5S A;  4BBT A;  1XFQ A;  4PKY G;  4BBV A;  3MQO A;  1OJG A;  3MXQ A;  4EQ1 A;  5EFW A;  3IS2 B;  2WKR A;  2D02 A;  3LID A;  1OTB A;  5HD5 A;  4EET B;  3T50 A;  3C8C A;  2PYR A;  1N9L A; 
#chains in the Genus database with same CATH topology
 1TDG A;  3EQU A;  2Z2M B;  1SDN A;  4QWO A;  4UA7 A;  3E4O A;  3BJN A;  2WGW B;  1FSW A;  3BY9 A;  3OPL A;  2EXA A;  4BD1 A;  1FIL A;  3T4L A;  4KZ6 A;  4YOF A;  3GDI A;  2W0N A;  3CG5 A;  5E2F A;  3MXS A;  2ZQ7 A;  4U0X A;  5J8X A;  5EM1 A;  2O9A A;  2PD7 A;  4KZB A;  4O8G A;  2BLS A;  4Z1W A;  3BRM A;  5F82 A;  1TF1 A;  2O9C A;  3PAE A;  1Q2Q A;  4Y5F A;  2Z2L B;  4II7 A;  5GLD A;  2HDS A;  4WEL A;  2Q9N A;  2FH5 A;  1MBL A;  4Z9Q A;  4CLC A;  4PM7 A;  4JLF A;  3FPW A;  2X01 A;  3GR2 A;  4ARZ B;  5J3W A;  3UB6 A;  3HL9 A;  4MN5 A;  3O88 A;  3BLS A;  3IF6 A;  3ZG8 B;  3E4Q A;  1SDE A;  4GW9 A;  4BL2 A;  3TRC A;  2CMN A;  2WGW A;  3Q7Z A;  1MPL A;  3C2W A;  4B93 A;  2VGK A;  3VP1 A;  4EW7 A;  3K3D A;  1Z6F A;  5LBR A;  2B5R A;  2WKI A;  3DTI A;  3LR5 A;  3H7W B;  4L9F A;  2ZM8 A;  5DF7 A;  2V20 A;  3PBN A;  2K31 A;  3VSK A;  3VOL A;  3PBS A;  4MCW A;  2WAD A;  2ZJ9 A;  3S1Y A;  3OC2 A;  5TBM A;  2P7J A;  3WS0 A;  2Y2J A;  3NDE A;  3MF0 A;  4WF0 A;  1YLP A;  2R78 A;  1L0F A;  5FI6 A;  1N9B A;  3LR4 A;  1KGE A;  3PBR A;  3ZQ5 A;  3NBL A;  1XA1 A;  1Y28 A;  1YSP A;  1DY6 A;  4S2L A;  4LCL A;  5L2F A;  4O0P A;  2OWJ A;  4OPQ A;  4UEY A;  1KE4 A;  3W4P A;  3MKE A;  1IEL A;  2QHK A;  5FDS A;  1PW8 A;  3SW1 A;  3HUO A;  4Q0I A;  4OQH A;  3ZG0 A;  1ZG4 A;  4DKI A;  3T4S A;  2WKE A;  1OTA A;  2P74 A;  2Y2O A;  4CLC E;  4X1L A;  3TJZ C;  3CLO A;  4E6W A;  1HTZ A;  4QY5 A;  3HLD A;  3W2Z A;  3CZD A;  2DCF A;  3RTY A;  3BFF A;  1BZA A;  4XT2 B;  5TFQ A;  3GEC A;  3GMW A;  2Y2P A;  1XJ2 A;  5HAR A;  4OP8 A;  4LLO B;  2IWC A;  2ZM2 A;  5FAO A;  1KE3 A;  3R7W A;  4NEE D;  4H8R A;  3G2Y A;  4K08 A;  4P6Z M;  4BJP A;  5HFO A;  3CUE A;  4G3W A;  4HY8 A;  3MQ0 A;  5HWV A;  4DDY A;  3UN7 A;  2BG1 A;  2QYB A;  4FUW A;  1DJA A;  1FR6 A;  5IHV A;  5FQJ A;  2JBF A;  1K4F A;  4GDN A;  1E4D A;  5HDC A;  2ZD8 A;  1LI9 A;  3DW0 A;  1FSY A;  4N9K A;  4DF6 A;  3M2J A;  3F1N A;  1YLW A;  2PAV P;  3NEC A;  1N9N A;  3UPP A;  3ZHH A;  4EUZ A;  4Y7P A;  3HRE A;  4FH2 A;  2JC7 A;  4E6X A;  5FQ9 A;  1ZHH B;  1YLJ A;  5G4Y A;  1ZG6 A;  5KSC A;  2C5W B;  2LB9 A;  3SH8 A;  3T4J A;  3B47 A;  4FD8 A;  1JWP A;  1T1A A;  4UA9 A;  1IYP A;  2O99 A;  2HDQ A;  4G3K A;  4OQ0 A;  2W3F A;  4OOY A;  4PMA A;  1XXM A;  1E3U A;  5FQM A;  4PPR A;  4A5R A;  5AQ9 A;  1Z09 A;  5HX9 A;  1H8Y A;  4BL3 A;  1QMF A;  2AVX A;  1BLC A;  2PBY A;  4S2I A;  4B9O A;  2Z6C A;  1YSQ A;  4NET A;  3G6O A;  3LIE A;  4M3K A;  4BBU A;  2EX2 A;  1FQG A;  4MN6 A;  3C5A A;  2OV5 A;  1HZO A;  4GKU A;  2UV0 E;  2Y2G A;  3F1N B;  3VE4 A;  2V8C A;  2X02 A;  5HDD A;  3LY4 A;  5IU1 A;  4EWF A;  3MQQ A;  4GD6 A;  4OP5 A;  1JTG A;  5DVA A;  4YWZ A;  4X69 A;  2LB5 A;  3TOI A;  2XLN A;  4EBL A;  1VQQ A;  4NXB A;  1BLP A;  4DE2 A;  4KUO A;  3U2A A;  1YLT A;  3IH9 A;  2DMW A;  5BOH A;  3E2L A;  5G4Z A;  4HJ4 A;  2M7V A;  3R7W B;  3CJM A;  1GHP A;  1K56 A;  4X55 A;  3NDG A;  2QJ5 A;  3QP2 A;  3IHA A;  4HBT A;  4S2O A;  2HJ9 C;  2D02 A;  4R23 A;  1TEM A;  3C7U A;  3MXR A;  1F2K A;  5HAP A;  3A3J A;  3DBA A;  3R4K A;  1BUL A;  3HLG A;  3RXX A;  3NC8 A;  3CPT B;  2P08 A;  1EWZ A;  2XFT A;  4ETX A;  3B3X A;  5DTS A;  2KOI A;  1UGU A;  4OPR A;  2HDR A;  1JTD A;  1S4R A;  3BYD A;  1KVL A;  4HNB A;  4HP9 A;  3QP1 A;  3N8L A;  4KZ9 A;  2KX6 A;  1FR1 A;  1PW1 A;  2EFX A;  5GHY A;  1PNE A;  2ZLY A;  3MBZ A;  1ALQ A;  3QNC A;  5HWT A;  1H5X A;  2EXB A;  3UE0 A;  3VP0 A;  3V3R A;  4ETZ A;  5HL1 A;  1W8Q A;  4I38 A;  5HPI A;  5CTM A;  1SKO B;  1LI0 A;  3GTC A;  3QP4 A;  5E43 A;  2P9V B;  3KO6 A;  2PYP A;  1NJ4 A;  4GD8 A;  4NKP A;  3HLF A;  5AQ7 A;  4BWI A;  5CHJ A;  1K54 C;  1D1J A;  3T4K A;  2IA2 A;  3ZCZ A;  1LLB A;  2PR6 A;  3IBR A;  4KQR A;  2ZOH A;  3B33 A;  1IYO A;  2Q0O A;  5G18 A;  3EEH A;  4HH2 A;  1AWI A;  3PBQ A;  4I5S A;  3MQO A;  4Q0H A;  1ES4 A;  5CEB A;  2A49 A;  4CLC B;  1KGG A;  2PHY A;  3KSH A;  1BLH A;  2V2F F;  1O7E A;  1NLZ A;  4R70 A;  2P9V A;  5L8M A;  5J7E A;  2IWD A;  4R6L A;  1PRQ A;  4MLL A;  3F1O A;  4X25 A;  4KG5 A;  3BW6 A;  3WRZ A;  1K57 A;  3UB8 A;  1IOU A;  2HGV A;  3WS5 A;  2OOL A;  4MBH A;  2C6W B;  4KQO A;  3CHW P;  2J3T C;  5JYP A;  1XJ4 A;  1J9M A;  4KZ5 A;  2HJE A;  1TDL A;  2JHE A;  4LRZ E;  2W3E A;  2VEA A;  2VJW A;  4E3K A;  1T1B A;  3C4P A;  2PU4 A;  3NI9 A;  3EGD C;  3HLW A;  3OOV A;  4P0M A;  3NOT C;  3OZH A;  2W1R A;  4E3O A;  3VP4 A;  1CF0 A;  1VEU B;  3DAV A;  4WEK A;  2ZMF A;  1S66 L;  4K0W A;  3AGF A;  2QZ6 A;  4LV2 A;  4PKY A;  4ZTK A;  1PYY A;  2JKR I;  2VLG A;  5F1G A;  3PR6 A;  1L2S A;  2HV1 A;  4S2M A;  4UQI S;  4ARZ A;  2Y8H A;  3HBR A;  2J3T D;  3C7V A;  1AXB A;  5KZH A;  1G68 A;  1MY8 A;  2X71 A;  3HUN A;  3U4L P;  3LIB A;  3RFB A;  3G4P A;  3VP3 A;  2WKR A;  1ES3 A;  5FDH A;  3M2K A;  1RCJ A;  4WZ4 A;  1HVB A;  4WMC D;  4RQ9 A;  5FEF A;  3EQV A;  1OPX A;  1GCE A;  1MC0 A;  4S2P A;  5FL3 A;  5HWW A;  1A0K A;  4CJN A;  4IBX A;  4QHC A;  2ZC5 B;  3SS5 A;  1XGJ A;  3H7W A;  3GQZ A;  3ZDJ A;  4UQI M;  1WA9 A;  1J3W A;  1FIK A;  3OLO A;  2M7U A;  2FZ0 A;  5FAP A;  3HLB A;  5HL6 A;  4E3J A;  3DWK A;  2ZQ9 A;  2Y2K A;  2K7S A;  4GDB A;  4HOI A;  4HQA A;  3A0S A;  2WAF A;  1E3U D;  3ZNY A;  4JF4 A;  1TS8 A;  2OLU A;  2WUQ A;  1NYY A;  2HDU A;  4ZAM A;  2ZL1 A;  1KDS A;  4EU0 A;  2HZ5 A;  3G2Z A;  5CHU A;  4DMZ A;  3IXG A;  2QWS A;  3NHQ A;  3CAX A;  4P85 A;  4Q0J A;  4JGQ A;  4X56 A;  1MWT A;  2JKT M;  1PZP A;  2KDK A;  4UHU A;  3LYX A;  2J3W A;  3UDX A;  1OTD A;  3UDF A;  4JGP A;  2JKT I;  4HEF A;  5FSR A;  5A92 A;  3LEZ A;  3DTM A;  4RVA A;  2EWW A;  2Y2H A;  1YLZ A;  2OSU A;  1P9W A;  3VOY A;  2GDN A;  4EEU A;  1XA7 A;  1GA9 A;  3OPH A;  4YNR A;  1W7F A;  3IXB A;  3A0R A;  3UMD A;  1SHV A;  3O86 A;  2J9O A;  2G7U A;  4AFI A;  4O01 A;  4FCF A;  3ULF A;  4ZJ3 A;  2ZL1 B;  5EVE A;  1K56 D;  3WS4 A;  1YQS A;  1G6A A;  2A2L A;  4LGW A;  3LFV A;  1MWU A;  4Y0T A;  3G32 A;  1GSX A;  3BM6 A;  4GJ4 A;  4K91 A;  1ERO A;  3NUL A;  4Q8I A;  4BD0 A;  2O0Y A;  3MFX A;  4JXV A;  2HP5 A;  3LCE A;  4JGR A;  4R3B A;  3BY8 A;  3GV9 A;  3JVV A;  3T1S A;  4EXO A;  2QPN A;  1YT4 A;  3DWZ A;  1CI8 A;  4N9L A;  3ZFZ A;  2XEP A;  3UME A;  4JF5 A;  2J8Y A;  3IF6 C;  3IQA A;  4NG2 A;  2Y2N A;  3VP2 A;  2WZX A;  1DP9 A;  3LEQ A;  3FKW A;  3O5Y A;  3PBT A;  1BT5 A;  5EVI D;  2W3H A;  5J4E A;  3KX0 X;  3Q7V A;  2P04 A;  2ZBB A;  4Y15 A;  1DJC A;  3T4T A;  1XJ3 A;  2ACG A;  2XDM A;  1XFN A;  1CEG A;  3Q82 A;  4L0L A;  1V9Z A;  5HAQ A;  2DRW A;  1PI4 A;  2V1A A;  1SKF A;  3NJA A;  4OQI A;  4GHI B;  1LT0 A;  1CI9 A;  4MMN A;  1JWZ A;  4OLG A;  3T4O A;  5HD5 A;  4PAU A;  2V1Z A;  1ACF A;  3BEC A;  2ZC4 B;  5GL9 A;  1JVJ A;  1OME A;  4MBF A;  3RJU A;  3L9K A;  1M40 A;  1GSW A;  4S2N C;  1K54 A;  2XH9 A;  2W1T B;  1FOF A;  3N6I A;  5EVI A;  3F1P A;  3AGD A;  3LI8 A;  4JXW A;  1XPB A;  2E8I A;  3D4F A;  4KZ3 A;  3ZNT A;  1ONH A;  1OT9 A;  5F68 A;  4MDZ A;  2WKQ A;  3FZC A;  2ZC7 A;  3NOP C;  5FAS A;  2H10 A;  4CLC D;  3TW8 A;  4OPZ A;  1H0M A;  2XR0 A;  4DXB A;  4ZJ1 A;  1IYS A;  5E2E A;  1SZV A;  4GNU A;  4EV4 A;  3SH9 A;  2L4R A;  2M1C A;  3A3E A;  3UPN A;  5DF8 A;  1OJ5 A;  4Y0U A;  4E04 A;  4OVD A;  3MS6 A;  2WK0 A;  5CGX A;  2A24 B;  5KIZ A;  5AVF A;  2XA7 M;  3IWQ A;  5DTT A;  4N1X A;  3TG9 A;  3D9Y A;  1HLU P;  1BTL A;  5TR7 A;  3BWL A;  4EBP A;  2INW A;  5DTK A;  5GLA A;  1LSW A;  3KSF A;  3PAG A;  5CGW A;  4BBT A;  4JBF A;  4MNR A;  5F1F A;  3SZT A;  4Y0O A;  1Q2P A;  3OPP A;  1F5M A;  4JXG A;  5EOE A;  5DJT A;  4NXG A;  1YKD A;  2GJ3 A;  3MZD A;  3FC7 A;  2XFS A;  2Y2M A;  1WYC A;  5HDS A;  5L09 A;  2ZQ8 A;  1IKI A;  2XF3 A;  1TS6 A;  3VFH A;  2A3U A;  1F98 A;  1NXY A;  1LHY A;  1HD8 A;  5E2H A;  5EEC A;  4FH4 A;  1BSG A;  3D3O A;  2W3G A;  3KSI A;  4BMW A;  2JKG A;  3VMA A;  3MMH A;  5GHX A;  4LV1 A;  1EW0 A;  4P6Z S;  3PBO A;  4KG6 A;  4WUJ A;  2ZM0 A;  3KYQ A;  5CX7 A;  1RGZ A;  3N8S A;  4JPM A;  4H6J A;  2L1M A;  1K0K A;  3LI9 A;  3VE3 A;  3FPV A;  2V9A A;  3P98 A;  3E4P A;  4PM8 A;  4RA7 A;  1JWV A;  3LY3 A;  3ZVT A;  4KQD A;  5EPH A;  4C6Y A;  1PWD A;  3TE8 A;  5L10 A;  2XK1 A;  3BFG A;  2Y2Q A;  4ID4 A;  4C3Q A;  2FFY A;  1MKI A;  2EFU A;  2HPB A;  3KYE A;  1VEU A;  3UE6 A;  2H0T A;  4DDS A;  4PKY G;  1MXO A;  2IWB A;  4EET B;  5EM0 A;  4WZ5 C;  2W3D A;  3ITB A;  2W27 A;  4MEZ A;  2JKR M;  5FAQ A;  1ZC2 A;  3T1X A;  2Y55 A;  4N1H A;  2A24 A;  2XGN A;  1PIO A;  3P7N A;  3LIC A;  3UPO A;  3E2K A;  1K6R A;  1LL5 A;  1P97 A;  1IEM A;  3N7W A;  5A8B A;  3MZE A;  5K5B A;  3MJQ A;  3IS2 A;  1K55 A;  2ZOI A;  2V8F A;  1GSV A;  4Y13 A;  2MJ6 A;  1CEF A;  3PXP A;  4E3L A;  2WGV A;  1ERM A;  3UB9 A;  4NXE A;  1GHM A;  3LIA A;  3M6B A;  2R9W A;  4LRY C;  5F6A A;  5EVI C;  1P0Z A;  5FAT A;  1KDW A;  4B4X A;  3T1R A;  3VSL A;  3IXH A;  4YIN A;  4S2N A;  2XA7 S;  4E3M A;  2B18 A;  5I94 A;  3QP8 A;  1L0D A;  2Y79 A;  5A93 A;  5A90 A;  3MSH A;  2EX9 A;  2JKF A;  5AJG A;  3GSG A;  3FWL A;  4HJ3 A;  3L7H A;  1W8Y A;  1QME A;  4B4Z A;  4GZB A;  4KZ7 A;  3S7N A;  4RYE A;  2V0W A;  1K38 A;  2VA0 A;  4ZJ2 A;  3V3S A;  2KLI A;  2VKS A;  1XFQ A;  4WMC A;  2HF6 A;  1OJG A;  2VZW A;  2OLV A;  3UO9 A;  3G30 A;  1W63 M;  2EA9 A;  4B88 A;  5KSH A;  3K2N A;  3ZG7 B;  1OTI A;  3ISG A;  1KE0 A;  2V0U A;  2ZQD A;  2OAQ 1;  5HW3 A;  4EBN A;  4HHD A;  4X1M A;  5IS1 A;  2ZQC A;  1ZKJ A;  3BEB A;  3C38 A;  1CK3 A;  4Y17 A;  3S7P A;  3QP5 A;  5AVE A;  1XGI A;  4OLD A;  5HSQ A;  1T19 A;  4GS9 A;  5M19 A;  4OQG A;  3HLC A;  5CHM A;  3H9W A;  4DE0 A;  4OON A;  5DF9 A;  5F69 A;  1PZO A;  3UB5 P;  5HPF A;  4P87 A;  1F9I A;  1TD5 A;  2K2N A;  4CLC C;  1KOU A;  5HZH A;  2WGI A;  3WRT A;  1K6S A;  2G2W A;  3O87 A;  2I9V A;  1BUE A;  3S7O A;  4GHI A;  4BEN A;  1JNU A;  4U0T A;  3W8K A;  4FTX A;  3FKV A;  4IUH A;  5D3O A;  1YM1 A;  4IED A;  1DP8 A;  1N4O A;  4EQI A;  5HAI A;  2Y2L A;  4CQH A;  4R1G A;  5DKL A;  4MN7 A;  4EER A;  2PT7 A;  1MWS A;  4F94 A;  4QPR A;  5EVI B;  1STZ A;  3MXQ A;  3IF5 A;  3LID A;  1OTB A;  3DTE A;  1PWC A;  4P6B A;  1W63 Q;  1N9L A;  1S1Y A;  2VV7 A;  1IFQ A;  2Y2I A;  3Q7V B;  1BYW A;  1I2W A;  2OWH A;  1SCW A;  4R3A A;  3IX4 A;  2H28 A;  3FG8 A;  3C30 A;  3T12 B;  5EVL A;  2GNX A;  4I3I A;  2NUP C;  3LUQ A;  3ZVW A;  4OPY A;  1VET B;  4R4R A;  5CTN A;  4PHT A;  1NY0 A;  4KEN B;  1ODV A;  4D60 A;  1XX2 A;  5L07 A;  4QU3 A;  1M6K A;  5E2G A;  1VM1 A;  1TVF A;  3A0V A;  3VFF A;  3LGO A;  3NOU C;  2JN7 A;  3UE1 A;  3LR3 A;  1YPR A;  2RL3 A;  3GRJ A;  4LPZ A;  4DXC A;  4LRX C;  1IKG A;  2QJ7 A;  1KGF A;  3P09 A;  4F3L B;  4EEP A;  2W1T A;  3PHY A;  3UY6 A;  4I3A A;  2V1B A;  1S0W A;  4UAA A;  5FQI A;  4KZ4 A;  4YFM A;  3OCN A;  2WKH A;  3G34 A;  1LSX A;  2PR5 A;  3S4X A;  5FQK A;  2R9X A;  5CED A;  2EX6 A;  4C75 A;  4OH0 A;  4DRT A;  1DP6 A;  1VB6 A;  2HP6 A;  3CMZ A;  4HES A;  2DNS A;  3HJK A;  1L0G A;  3TSG A;  3MR0 A;  3IX8 A;  2XD1 A;  4QY6 A;  5F83 A;  3IHB A;  3EGX C;  4FSF A;  3UB7 A;  4GN2 A;  2J80 A;  3IBJ A;  4QJG A;  1KVM A;  1W79 A;  4Y3I A;  1MKM A;  4EUV A;  5TJJ A;  3UNW A;  4L9G A;  3JYI A;  5DKK A;  5F5Y A;  5A91 A;  5JYO A;  1NYM A;  3AGE A;  4QB8 A;  5EOO A;  2JCH A;  2Z6D A;  1NZU A;  4JF6 A;  4LV0 A;  1ERQ A;  3N4I A;  3IX3 A;  2J7V A;  2VGJ A;  1NRF A;  3N8R A;  4H6J B;  5DFY A;  5C5K A;  1S67 L;  5FA7 A;  4KUK A;  3JVU A;  3EWK A;  5CGS A;  2OAP 1;  4QD4 A;  4GOG A;  5HD3 A;  4HI4 A;  5FI2 A;  1S6R A;  1NLY A;  1K25 A;  3HUM A;  4BQM A;  4IBR A;  2Y59 A;  4XXR A;  2HP9 A;  4NK3 A;  1ZTU A;  3HLE A;  2VV6 A;  2WAE A;  3BLM A;  4Y2F A;  5AQB A;  4WEJ A;  4DN0 A;  3ZG9 B;  3P01 A;  1VET A;  1MZU A;  2VX8 A;  4MBK A;  3FYZ A;  3LIF A;  1VHM A;  1I5Q A;  1H3Q A;  1NRJ A;  2BAS A;  2ZMV A;  5M1A A;  3LO7 A;  3A3I A;  2YKH A;  3E0Y A;  2Y4A A;  3A3F A;  2ZMA A;  1UWN X;  1UWP X;  1O07 A;  2B02 A;  4KG2 A;  3DTK A;  5CRF A;  1OTE A;  3ICY A;  2ZQA A;  4XUZ A;  2G2U A;  1YAX A;  4FOF A;  3CUE C;  5KMW A;  3V39 A;  2I72 A;  4KQQ A;  4L9E A;  3VV4 A;  4ZRR A;  3UDI A;  4BBV A;  1LL9 A;  4LFU A;  3IF6 B;  4GLQ A;  4PM5 A;  3OPR A;  4KZA A;  2EWV A;  3ZGA B;  3LR0 A;  4WLA A;  1XP4 A;  2EX8 A;  4HJ6 A;  5CER A;  4RX2 A;  4DJ2 A;  3E98 A;  1C3B A;  3RXW A;  5TBM B;  1WE4 A;  3QNB A;  3JPU A;  4WBG A;  4I39 A;  1D06 A;  1YLY A;  5DJU A;  5FEG A;  2PD8 A;  4XUX A;  3KSG A;  2E8J A;  3KYZ A;  3BFD A;  3WWX A;  3GVB A;  4IVI A;  1GA0 A;  1ES5 A;  3F1O B;  1XJ6 A;  3Q1F A;  1IYQ A;  4X68 A;  4JGO A;  4R4S A;  1DRM A;  4OOL A;  2WKP A;  1PI5 A;  1T1C A;  5GLB A;  2L0W A;  4O7D A;  4HP4 A;  4OOM A;  5U47 A;  4DE1 A;  2QMI A;  3ITA A;  1K4E A;  3ZYT A;  3MKF A;  2D01 A;  3Q81 A;  1NWZ A;  3QHY A;  3S22 A;  5DFX A;  1K57 C;  1K55 C;  4ZDX A;  4ESP A;  2GX5 A;  2BTF P;  4CPK A;  4XT2 A;  2PDR A;  2XQZ A;  2ZC3 B;  1XKZ A;  5AQA A;  1L3L A;  4UA6 A;  4LV3 A;  1G6O A;  3W4Q A;  3HCY A;  1H8Z A;  3F1P B;  2XRN A;  1EI5 A;  2B95 A;  1WYB A;  3C8C A;  2PYR A;  3T1Q B;  3O3V A;  1ESU A;  4WYY A;  4ZBE A;  3Q07 A;  3FV7 A;  2JE5 A;  3K3C A;  3C4O A;  1H8M A;  3B42 A;  5GHZ A;  5GLC A;  3WS2 A;  2VGL S;  3CWF A;  4DE3 A;  3D72 A;  4PM6 A;  2H5S A;  5M18 A;  4X53 A;  2Q9M A;  4GB7 A;  1T18 A;  3V5M A;  4DJ3 A;  1YMX A;  3EEA A;  3PYP A;  4HIA A;  2J9P A;  2QKP A;  2XRO A;  1L0E A;  4IHQ A;  3HJI A;  2FFF B;  2Y91 A;  3G31 A;  3NCK A;  3UE3 A;  1ES2 A;  3HVF A;  3VOZ A;  1W5D A;  4WN5 A;  5EE8 A;  3BQ8 A;  4LCM A;  3BQA A;  3NIA A;  3SS4 A;  2VV8 A;  1V9Y A;  3H82 A;  3IWI A;  2CC1 A;  1CQA A;  1S1Z A;  2VK3 A;  2NUT C;  4S2J A;  1I2S A;  2XD5 A;  4GS9 B;  1Y54 A;  3CPT A;  4IVK A;  3A3D A;  3WS1 A;  1Y4O A;  1G5U A;  1YMS A;  1ONG A;  3OBF A;  3W4O A;  3NY4 A;  5MC7 A;  3OCL A;  2XSS A;  1X0O A;  2PRF A;  3V67 A;  4RX3 A;  5I5L A;  4OKP A;  3IXD A;  4IUK A;  1NZO A;  4WM9 A;  3IT9 A;  1CJF A;  5EUA A;  4N92 A;  3PTE A;  4EQ1 A;  4K0X A;  4E3N A;  5FQQ A;  4HBU A;  3BFE A;  4LEN A;  4JKT A;  4S2K A;  4BLM A;  1FCM A;  1MWR A;  4WZ5 A;  4ME4 A;  1GHI A;  4JXS A;  4U3T A;  2H0Y A;  3H82 B;  3CI6 A;  2O9B A;  4M4X A;  2RCX A;  3MFD A;  4F3L A;  4NXF A;  1SKO A;  3EOI A;  2WYX A;  4PM9 A;  3M6H A;  4X6T A;  5TGF A;  1ESI A;  3RH8 B;  1DJB A;  1D7E A;  5IT5 A;  1N9O A;  4KZ8 A;  5EV0 A;  2UWX A;  4R0Q A;  1BLS A;  3BFC A;  1FCN A;  1U60 A;  1OT6 A;  4R3J A;  3S7Q A;  5FI7 A;  1TS7 A;  1E25 A;  3I7J A;  1LL8 A;  2WZZ A;  3CIT A;  3ZG5 A;  4GCZ A;  2ZC6 B;  2GZA A;  3SH7 A;  1TS0 A;  1S4S A;  3MZF A;  2PU2 A;  4WL9 A;  3IH8 A;  3T4Q A;  4HH3 A;  2VGL M;  1RP5 A;  4D2O A;  4R38 A;  4G3V A;  3G35 A;  1FCO A;  5CXW A;  3QP6 A;  1G28 A;  3SS3 A;  3SOI A;  2YKF A;  3IWO A;  4I3J A;  4E3I A;  4IJG A;  1PWG A;  2PBD P;  3V50 A;  1LSV A;  1PFL A;  4EES A;  1RGY A;  5CEC A;  5EFW A;  3IS2 B;  3T50 A;  1P9R A; 
#chains in the Genus database with same CATH homology
 5DJT A;  4NXG A;  1YKD A;  2PHY A;  3EQU A;  3KSH A;  4L9G A;  5DKK A;  5F5Y A;  2GJ3 A;  3E4O A;  3BJN A;  1NLZ A;  3FC7 A;  3BY9 A;  2Z6D A;  4R70 A;  5HDS A;  3T4L A;  4YOF A;  3GDI A;  5L8M A;  2W0N A;  5J7E A;  1TS6 A;  4R6L A;  3F1O A;  4H6J B;  5DFY A;  1F98 A;  5C5K A;  1S67 L;  4KUK A;  3BW6 A;  2O9A A;  3JVU A;  2PD7 A;  3UB8 A;  3EWK A;  1IOU A;  4O8G A;  2OAP 1;  2HGV A;  4Z1W A;  2OOL A;  1TF1 A;  2O9C A;  5HD3 A;  4HI4 A;  3D3O A;  4Y5F A;  2W3G A;  4KQO A;  3KSI A;  4II7 A;  4BMW A;  2J3T C;  1NLY A;  1XJ4 A;  3MMH A;  4WEL A;  1EW0 A;  2HJE A;  4P6Z S;  2FH5 A;  2JHE A;  3PBO A;  4LRZ E;  4WUJ A;  2W3E A;  4CLC A;  2VEA A;  2VJW A;  3KYQ A;  1ZTU A;  5CX7 A;  1T1B A;  2VV6 A;  3FPW A;  4Y2F A;  4ARZ B;  3EGD C;  5J3W A;  3UB6 A;  4H6J A;  4WEJ A;  4DN0 A;  3OOV A;  4MN5 A;  2L1M A;  3LI9 A;  3NOT C;  3P01 A;  3VE3 A;  3FPV A;  2W1R A;  1MZU A;  2V9A A;  2VX8 A;  3E4Q A;  4WEK A;  2ZMF A;  1S66 L;  3LIF A;  1VHM A;  3E4P A;  4GW9 A;  3TRC A;  1H3Q A;  2CMN A;  1NRJ A;  2BAS A;  2ZMV A;  3C2W A;  4KQD A;  4B93 A;  2YKH A;  4EW7 A;  3K3D A;  4PKY A;  3TE8 A;  5LBR A;  3E0Y A;  3LR5 A;  3H7W B;  4L9F A;  1UWN X;  3PBN A;  2JKR I;  2VLG A;  1UWP X;  2K31 A;  2B02 A;  3PR6 A;  3VOL A;  2HV1 A;  3PBS A;  1OTE A;  4UQI S;  3ICY A;  4ARZ A;  4MCW A;  3OC2 A;  2Y8H A;  5TBM A;  1YAX A;  2P7J A;  4FOF A;  2J3T D;  3CUE C;  3MF0 A;  4WF0 A;  3UE6 A;  2R78 A;  4L9E A;  3VV4 A;  4ZRR A;  3LIB A;  3RFB A;  4PKY G;  4BBV A;  3LR4 A;  2WKR A;  4EET B;  2W3D A;  3PBR A;  3ZQ5 A;  2W27 A;  4GLQ A;  2JKR M;  1Y28 A;  1YSP A;  4RQ9 A;  3EQV A;  2EWV A;  1OPX A;  5FL3 A;  1MC0 A;  2A24 A;  5HWW A;  3LR0 A;  4O0P A;  2OWJ A;  4UEY A;  4WLA A;  3P7N A;  4HJ6 A;  3LIC A;  2QHK A;  3H7W A;  4DJ2 A;  3E98 A;  5TBM B;  4UQI M;  3SW1 A;  1P97 A;  4Q0I A;  1WA9 A;  4I39 A;  3OLO A;  2M7U A;  5A8B A;  3T4S A;  1OTA A;  2FZ0 A;  5K5B A;  1D06 A;  3MJQ A;  5HL6 A;  3IS2 A;  4CLC E;  2ZOI A;  3TJZ C;  3CLO A;  5DJU A;  2PD8 A;  2K7S A;  1GSV A;  3W2Z A;  2MJ6 A;  4EUV A;  4HOI A;  4HQA A;  3KSG A;  3A0S A;  3PXP A;  3RTY A;  4XT2 B;  3UB9 A;  3GEC A;  4NXE A;  3KYZ A;  3LIA A;  1TS8 A;  1XJ2 A;  4LLO B;  3F1O B;  1XJ6 A;  4EU0 A;  4LRY C;  5F6A A;  4DMZ A;  4JGO A;  1P0Z A;  3R7W A;  1DRM A;  2QWS A;  4OOL A;  2WKP A;  1T1C A;  3NHQ A;  3CAX A;  4NEE D;  2L0W A;  4JGQ A;  4Q0J A;  4HP4 A;  4OOM A;  4P6Z M;  4K08 A;  2JKT M;  2XA7 S;  4BJP A;  2KDK A;  3LYX A;  2J3W A;  3CUE A;  4G3W A;  2B18 A;  4HY8 A;  1OTD A;  3ZYT A;  3MQ0 A;  5HWV A;  4JGP A;  2D01 A;  2Y79 A;  2JKT I;  1NWZ A;  5DFX A;  2QYB A;  2EWW A;  5AJG A;  1P9W A;  2GX5 A;  4HJ3 A;  4XT2 A;  2PDR A;  4EEU A;  5HDC A;  1G6O A;  4YNR A;  3S7N A;  2V0W A;  3A0R A;  3HCY A;  2VA0 A;  3UMD A;  3F1P B;  2KLI A;  2VKS A;  1XFQ A;  2HF6 A;  1OJG A;  2VZW A;  2XRN A;  2G7U A;  3F1N A;  3C8C A;  2PYR A;  4O01 A;  4AFI A;  1W63 M;  1N9N A;  3ULF A;  2EA9 A;  5KSH A;  3K2N A;  3K3C A;  1OTI A;  1H8M A;  3B42 A;  2V0U A;  2A2L A;  2VGL S;  3CWF A;  1ZHH B;  2OAQ 1;  3D72 A;  3LFV A;  5G4Y A;  2LB9 A;  3T4J A;  4HHD A;  1GSX A;  1T18 A;  3B47 A;  5IS1 A;  4GJ4 A;  4DJ3 A;  3C38 A;  3EEA A;  3PYP A;  4HIA A;  3S7P A;  1T1A A;  2QKP A;  5AVE A;  2XRO A;  2O0Y A;  5HSQ A;  1T19 A;  2O99 A;  4IHQ A;  3HJI A;  4G3K A;  3MFX A;  4GS9 A;  2W3F A;  4JGR A;  3UE3 A;  3BY8 A;  3H9W A;  3JVV A;  4WN5 A;  5DF9 A;  4EXO A;  5F69 A;  3BQ8 A;  5HPF A;  1F9I A;  4B9O A;  1TD5 A;  2K2N A;  3BQA A;  2Z6C A;  4CLC C;  1YSQ A;  3UME A;  3G6O A;  3LIE A;  2VV8 A;  1KOU A;  1V9Y A;  5HZH A;  4BBU A;  3H82 A;  4MN6 A;  1DP9 A;  1S1Z A;  2NUT C;  2I9V A;  3F1N B;  3S7O A;  4GHI A;  3O5Y A;  3VE4 A;  1JNU A;  3PBT A;  4GS9 B;  5HDD A;  5IU1 A;  2W3H A;  3MQQ A;  5J4E A;  3KX0 X;  4YWZ A;  2P04 A;  2LB5 A;  2ZBB A;  3OBF A;  4IUH A;  5MC7 A;  4NXB A;  3OCL A;  1DP8 A;  3T4T A;  1XJ3 A;  2XSS A;  4KUO A;  3U2A A;  1XFN A;  1X0O A;  4L0L A;  3V67 A;  2DMW A;  1V9Z A;  5G4Z A;  5I5L A;  4CQH A;  4HJ4 A;  2M7V A;  4IUK A;  5DKL A;  2V1A A;  4MN7 A;  3R7W B;  4EER A;  2PT7 A;  3NJA A;  4GHI B;  1LT0 A;  4QPR A;  1STZ A;  2QJ5 A;  4MMN A;  4EQ1 A;  3MXQ A;  2HJ9 C;  2D02 A;  3LID A;  3T4O A;  1OTB A;  5HD5 A;  4PAU A;  1W63 Q;  1N9L A;  1S1Y A;  2VV7 A;  3DBA A;  3R4K A;  1IFQ A;  1BYW A;  2OWH A;  4ME4 A;  4R3A A;  3H82 B;  2P08 A;  3CI6 A;  4ETX A;  2H28 A;  1GSW A;  3FG8 A;  3C30 A;  2O9B A;  2GNX A;  4I3I A;  4M4X A;  3LUQ A;  2NUP C;  2KOI A;  1UGU A;  4F3L A;  1S4R A;  4NXF A;  2W1T B;  3EOI A;  4HNB A;  4HP9 A;  4PHT A;  3F1P A;  1ODV A;  3RH8 B;  3LI8 A;  5IT5 A;  1D7E A;  1N9O A;  3A0V A;  2KX6 A;  3NOU C;  2JN7 A;  3LR3 A;  1OT6 A;  4LPZ A;  1OT9 A;  5F68 A;  4MDZ A;  3S7Q A;  1TS7 A;  5HWT A;  2WKQ A;  4LRX C;  2QJ7 A;  1LL8 A;  3CIT A;  3NOP C;  4ETZ A;  4GCZ A;  4CLC D;  3TW8 A;  2GZA A;  4I38 A;  4F3L B;  1TS0 A;  5HPI A;  4EEP A;  2W1T A;  3PHY A;  1S4S A;  4I3A A;  4WL9 A;  2V1B A;  3KO6 A;  2L4R A;  2M1C A;  3T4Q A;  2PYP A;  4HH3 A;  3OCN A;  2VGL M;  1LSX A;  1OJ5 A;  4E04 A;  4NKP A;  4R38 A;  4G3V A;  2PR5 A;  4BWI A;  2IA2 A;  3T4K A;  1G28 A;  2A24 B;  5AVF A;  5KIZ A;  1DP6 A;  1VB6 A;  2XA7 M;  2YKF A;  2PR6 A;  4I3J A;  3HJK A;  4IJG A;  3IBR A;  3MR0 A;  2ZOH A;  1LSV A;  3B33 A;  3BWL A;  2INW A;  3EGX C;  4FSF A;  1LSW A;  3KSF A;  3UB7 A;  3EEH A;  4HH2 A;  2J80 A;  3PBQ A;  4EES A;  4BBT A;  3IBJ A;  4I5S A;  3MQO A;  4Q0H A;  5EFW A;  3IS2 B;  4Y3I A;  1F5M A;  3T50 A;  1MKM A;  4CLC B;  5TJJ A;  1P9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...