5DKKA

Structure of the dark-state monomer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LOV domain
publication title Blue light-induced LOV domain dimerization enhances the affinity of Aureochrome 1a for its target DNA sequence.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
molecule tags Signaling protein
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dkkA00
5HDSA 4L9GA 2YKFA 4I3IA 3P7NA 2QHKA 1LT0A 2JN7A 4I39A 4E04A 4PKYG 1XFQA 2L4RA 3H7WB 3C2WA 1WA9A 4WL9A 1OTBA 4HIAA 4I38A 3IS2A 2L0WA 1GSWA 3LIEA 5IU1A 2ZOHA 2OWJA 2VV6A 4NXFA 3UB6A 1OJ5A 2PHYA 3LI8A 5A8BA 3MXQA 3CAXA 5J4EA 2K7SA 4GHIA 2QWSA 2M1CA 4HP4A 2INWA 1F98A 1XJ3A 4LRZE 3E4QA 5G4YA 1BYWA 1F9IA 2B02A 4HY8A 2VV8A 2WKQA 2PR5A 5EFWA 3GDIA 5HD5A 1N9LA 3LICA 1G28A 4GS9B 4EXOA 3ZQ5A 4NXGA 5I5LA 3LIBA 2W27A 4LRYC 4M4XA 2A24A 1T1AA 1S4RA 4MN5A 2Z6DA 1UWNX 5IS1A 3G6OA 4LLOB 4DJ2A 4EW7A 2PD7A 5HWWA 4DJ3A 5HWTA 3VOLA 5F68A 2ZOIA 4HH2A 3NOTC 3GECA 4GCZA 1T1CA 5F5YA 2V0UA 3ICYA 2VV7A 3NOPC 3PYPA 4HNBA 1XJ2A 1XJ4A 2HV1A 2QKPA 3F1OB 5HDCA 3RTYA 3D72A 3MQQA 1D7EA 5AVEA 3IS2B 1EW0A 2I9VA 5F69A 4KUKA 4HJ6A 3KX0X 2R78A 1OTAA 3PHYA 4EESA 2H28A 3BWLA 4GHIB 2EA9A 2VEAA 4WN5A 2ZBBA 1T1BA 2L1MA 3K3CA 3F1OA 3NJAA 4NXBA 1D06A 5J3WA 4EETB 1UWPX 2V9AA 5G4ZA 2V1AA 1ODVA 3H82B 2A24B 1S1ZA 2PDRA 4K08A 2PYPA 1X0OA 2KX6A 3LIAA 4F3LA 3LI9A 4JGQA 4I5SA 4BBVA 3CWFA 3UB8A 1DRMA 1DP8A 4EEPA 3H9WA 1S66L 4R70A 1TS8A 3UMEA 1LSWA 4I3AA 2V0WA 3HJIA 3NHQA 3K3DA 3H82A 1T19A 2W0NA 2KDKA 4RQ9A 3A0VA 3LUQA 3MQOA 3BY9A 2CMNA 1V9YA 2WKPA 3UE6A 3E4PA 3F1NB 1KOUA 1NWZA 5DKLA 4WLAA 2V1BA 1DP9A 4MN6A 1OT6A 2OOLA 4R6LA 1S1YA 4WUJA 3UB7A 1TS0A 1GSVA 4HJ4A 4BBUA 3IBRA 1P97A 1S67L 2PYRA 3E4OA 3LIDA 1OTIA 4I3JA 5TBMA 5HZHA 1TS7A 4YWZA 3F1NA 3T50A 2J80A 2WKRA 4HI4A 5HDDA 4LPZA 3NOUC 1OTEA 4F3LB 1OT9A 3MJQA 2VLGA 1N9OA 5HD3A 4HQAA 3VE3A 4L9FA 5HWVA 2YKHA 3HJKA 4H6JA 3CLOA 1XJ6A 1S4SA 4NXEA 3UB9A 4HJ3A 4XT2A 3MR0A 1N9NA 2Z6CA 2BASA 3RH8B 3F1PA 1TS6A 4BBTA 3VE4A 1P0ZA 1OTDA 4JGOA 3A0SA 3FC7A 2P7JA 4JGPA 2PD8A 2QJ5A 5HSQA 2GJ3A 3EEHA 1LSVA 3H7WA 3ULFA 4L9EA 3SW1A 1LSXA 1OJGA 2QJ7A 2JHEA 3UMDA 4WF0A 4KQDA 5AVFA 1T18A 1LL8A 1GSXA 3OLOA 3EWKA 2OWHA 1Y28A 5TBMB 3MFXA 5DJUA 1DP6A 3FG8A 5DKKA 1JNUA 4HH3A 1V9ZA 3B33A 1MZUA 2D02A 4R38A 4PKYA 1XFNA 3LIFA 3LYXA 1VB6A 5J7EA 1UGUA 4R3AA 5DJTA 4EQ1A 5KIZA 4LRXC 3C8CA 4GW9A 4EERA 5F6AA 4H6JB 4HOIA 4B9OA 4HHDA 4GS9A 2PR6A 4JGRA 4EEUA 2D01A 4XT2B 3A0RA 4KUOA 3F1PB 4HP9A 3BY8A
chains in the Genus database with same CATH superfamily
1ERMA 3LY4A 4L9GA 4I3IA 5E2GA 3NDEA 2WYXA 5FAPA 2Z2MB 4GD8A 2XD5A 1LT0A 4KG2A 4DE2A 1BLCA 2XFSA 4IJGA 1LL5A 3GQZA 1VHMA 2EX8A 1W79A 3GVBA 3IT9A 1XFQA 3JYIA 3C2WA 1U60A 4WL9A 1OTBA 3CUEA 3O86A 2M7UA 5IU1A 5FEFA 5DTTA 3T1SA 1PZPA 5M1AA 4KZ6A 3NCKA 3UB6A 1I2WA 2BG1A 1OJ5A 2PHYA 3LI8A 3UN7A 1FSYA 4EBNA 1K55C 2K31A 3RXWA 4IVIA 5HL6A 2ZQAA 4BQMA 1CK3A 1BYWA 1SDNA 2WADA 1TD5A 4HY8A 2VV8A 3N6IA 2LB5A 1N4OA 5EFWA 1N9LA 3LICA 1K57A 1G28A 3IX3A 1YSQA 5DTSA 3L9KA 5KSCA 4X55A 2MJ6A 3G31A 4MN5A 3FKVA 2B18A 4EW7A 2PD7A 2OV5A 3RXXA 4JBFA 4BLMA 4KZ9A 1Q2PA 4QY6A 1YM1A 5D3OA 3E2LA 4KG5A 1MXOA 1XJ2A 4XXRA 5IT5A 3DAVA 5HPIA 3F1OB 2WGWB 1D7EA 3LGOA 3IS2B 1EW0A 4OQIA 3W4QA 2KOIA 3EEAA 1OTAA 3PHYA 2XD1A 3QP5A 5GL9A 3DTEA 1RGZA 5CGXA 1NY0A 4OLDA 4WN5A 4ARZB 2IA2A 4PHTA 2JKFA 3G35A 3HLBA 3MZDA 4O8GA 4ZJ1A 1KDWA 1XXMA 1H8ZA 4LFUA 1PW1A 2I72A 3UPNA 1YSPA 4DXBA 5FA7A 4RX3A 1K4EA 2W1RA 5G4ZA 2XK1A 1RGYA 5FQMA 2A24B 5CHJA 1MC0A 3VOZA 3SOIA 1SCWA 3S7NA 3UE0A 4F3LA 2JKGA 4JGQA 4I5SA 5TR7A 3P01A 3T1QB 1IELA 1SKOB 5GLDA 4BBVA 3UB8A 1KDSA 3Q07A 1NZOA 3S1YA 4UQIS 1TS8A 3OPLA 1ES2A 5MC7A 4AFIA 4WM9A 5A91A 2EXAA 3FYZA 1VEUA 5DTKA 2PU2A 4WMCA 3MBZA 2KDKA 4RQ9A 1BLPA 3MQOA 4KQRA 4GJ4A 3HVFA 3BY9A 2CMNA 4D60A 1V9YA 3UE6A 3PBSA 3E4PA 4EBPA 1PYYA 1JTDA 3IQAA 4R4SA 4B4XA 1NWZA 4B4ZA 4WLAA 4ZDXA 2V1BA 2XROA 4U3TA 5EVIA 4YFMA 3VP2A 3GMWA 1GHIA 3JVUA 3MMHA 1L3LA 4BBUA 2PYRA 3E4OA 1KVLA 2Y2IA 3HUMA 4R3JA 2W3DA 3OOVA 1OTIA 4P87A 5TBMA 1DJCA 1IYQA 3S4XA 5L2FA 1TS7A 1ZHHB 1L2SA 4QJGA 3OCNA 2PAVP 3NDGA 2XDMA 2WKRA 2HDUA 4HI4A 4RA7A 3S7PA 3HREA 1KE4A 4LPZA 2Y2MA 3T12B 2ZM2A 1K56D 2VLGA 4Y5FA 4X68A 5HD3A 3VE3A 4E3NA 4ZJ2A 2YKHA 2H0TA 4H6JA 3TE8A 4WMCD 1AXBA 4RX2A 2Y2OA 4E3OA 1G68A 3ZGAB 4MBHA 1A0KA 4NXEA 4NG2A 4WEJA 1N9NA 3K2NA 2Z6CA 2HDSA 1CF0A 3PBQA 1M6KA 3WS4A 5CXWA 2ZL1A 1XPBA 2BLSA 1TS6A 3VE4A 3PBTA 3P09A 5FQ9A 1IFQA 2HDQA 2Y91A 2VGLS 1E4DA 4D2OA 4OP8A 5CRFA 1K0KA 2PD8A 2QJ5A 3OCLA 5CGWA 2FH5A 4LV3A 4L9EA 3M2KA 1OJGA 4CLCC 4WF0A 5HARA 4KQDA 4ETXA 4RVAA 1T18A 1LL8A 3L7HA 4EQIA 4OKPA 3ZCZA 5HFOA 3C38A 3DTMA 1DJAA 4NEED 3MFXA 3R4KA 3S22A 5EVLA 3FG8A 3SS4A 1SDEA 1JNUA 4KQQA 3LR0A 1V9ZA 3ZDJA 4N9LA 3B33A 4DMZA 2ZQ8A 4OPYA 4R38A 1Y4OA 5U47A 1KE0A 1EWZA 4K0WA 4XUXA 4UEYA 5F1FA 1FIKA 3B47A 3EGDC 4E3JA 4EQ1A 4KZ8A 4Z1WA 3DWZA 4HHDA 3IXDA 3BFDA 4GLQA 2PR6A 3BECA 5FAOA 2D01A 3T4JA 3R7WB 4FTXA 4GDNA 1O07A 3G2ZA 4OQHA 3F1PB 3JPUA 4HP9A 2WKHA 3HBRA 1IKIA 2XRNA 1G6AA 5L09A 3OPPA 1E3UA 2YKFA 2ZM8A 2XA7S 5FI6A 2JKRM 2QHKA 1M40A 4I39A 1KGGA 2XFTA 4U0TA 4PKYG 5E2FA 4FCFA 2Y2JA 4Y15A 1YT4A 3KO6A 1ES5A 1PWDA 3ZFZA 4UAAA 5TGFA 2ZC7A 4I38A 3V67A 4C75A 5GLAA 3IS2A 2L0WA 1GSWA 5AQ7A 4QWOA 1C3BA 2VGJA 1JWZA 3E0YA 3MSHA 4MCWA 3E98A 1W63Q 2ZC5B 5F83A 2WKEA 4OPZA 4EUVA 2B5RA 2ZD8A 3MXQA 4ME4A 1OPXA 3DWKA 5J4EA 4R3BA 2P9VB 3WS5A 2M1CA 2INWA 4BWIA 3LR5A 3VMAA 1F98A 2E8IA 4Y13A 1CQAA 1XJ3A 1MKIA 5G4YA 3TJZC 1WE4A 3IBJA 4FOFA 3T1RA 2QZ6A 2BTFP 5K5BA 2WKQA 5HD5A 2J7VA 4GS9B 4DDYA 4OOMA 5GHYA 4UA9A 4NXGA 5IHVA 2GNXA 4FUWA 5I5LA 1XKZA 1ALQA 3LIBA 1W63M 3OC2A 2A24A 1IYPA 3IXGA 2J3TD 4S2NA 2V8FA 2LB9A 5HWWA 3BRMA 5HWTA 2W1TB 4Q0JA 4JXWA 2ZOIA 3NOTC 3GECA 1GA9A 1T1CA 3G30A 3IH9A 3MKFA 4KQOA 3EGXC 5BOHA 3PYPA 1YLTA 3IHAA 5TJJA 4S2JA 5DFXA 1XJ4A 3I7JA 2WGIA 3B42A 2QKPA 1MWTA 4OVDA 2HF6A 1O7EA 3M6HA 4FH4A 3RTYA 5M18A 5FQKA 5GLCA 2X01A 3D4FA 5F69A 4HJ6A 4PM7A 1K54A 4GDBA 4LV0A 2V1ZA 1L0GA 2O9AA 4DDSA 3IX4A 3IWQA 3HL9A 4KZBA 1TVFA 3OZHA 2QMIA 4GHIB 4QPRA 3BQ8A 1I5QA 2EA9A 3WWXA 2ZBBA 2L1MA 2Q9MA 3K3CA 2PRFA 3UO9A 1D1JA 4G3WA 1W7FA 4LV1A 3LCEA 1K6SA 3IF6A 4PM8A 3B3XA 5AQAA 1YMXA 2VK3A 4LCMA 4PMAA 3BFGA 1X0OA 4R4RA 2KX6A 4Y7PA 4PM5A 4O0PA 3C7VA 1VM1A 3LI9A 2W3HA 3KYZA 1PWCA 5FSRA 1JTGA 3UPOA 3BFCA 3CWFA 3A3EA 1NYMA 1XX2A 4LENA 1DP8A 1BLSA 4Y17A 4R70A 5CHMA 4X6TA 2GX5A 4WZ5A 3JVVA 4I3AA 3MZFA 1GHPA 1ZG4A 3NHQA 3H82A 4ESPA 2JBFA 1MBLA 3UB5P 4ZTKA 5M19A 3A0VA 2OLUA 2ZQCA 1RCJA 4IUKA 5E2EA 2WKPA 1VETB 1DJBA 2C6WB 1BT5A 5AJGA 4OQGA 3F1NB 1KOUA 2X02A 4KENB 1L0EA 5DKLA 1DP9A 4CLCD 1OT6A 2XF3A 2ZC6B 3GSGA 4R6LA 1S1YA 3ZG5A 1L0DA 4HJ4A 4N1XA 3QP4A 5AQ9A 1JWVA 1VQQA 4DKIA 2ZQ9A 3DTKA 3GTCA 4YNRA 4RYEA 2VA0A 4HBUA 1J9MA 2IWDA 1TDLA 2J9OA 4GKUA 1KE3A 1OT9A 3QP6A 4F94A 1ERQA 3IHBA 3EOIA 4LV2A 4X1MA 1S4SA 3O5YA 4HJ3A 2W3GA 3R7WA 3MR0A 5A90A 2EX6A 1FCMA 2H5SA 3F1PA 4FSFA 5CERA 3VP0A 4X25A 4DE1A 3QHYA 2FFYA 4UQIM 1PIOA 5J8XA 2Y2HA 3ZG8B 1OTDA 2XQZA 4DE0A 2HZ5A 3A0SA 5KSHA 1IYOA 2P7JA 3MKEA 1EROA 4R0QA 1FQGA 1LSVA 1PW8A 4H8RA 3ULFA 1K56A 1XP4A 2G7UA 2QJ7A 4P6ZS 4GB7A 2JHEA 1AWIA 3UMDA 5AVFA 3WS1A 4LGWA 1NZUA 4OPQA 3OLOA 3ZHHA 1SKFA 2J3WA 2JCHA 3QP1A 2EWVA 2P9VA 2WAFA 3MXRA 4PKYA 2J8YA 3BEBA 4FH2A 3PBNA 2J9PA 3LYXA 4R3AA 2IWCA 1W8QA 5DJTA 5KIZA 2EFXA 3C8CA 4X69A 4GW9A 4GNUA 5F6AA 3VP4A 1BZAA 5FAQA 4B9OA 2OSUA 5EE8A 2Y2LA 1OMEA 4E3MA 4GS9A 3GR2A 4XT2B 4CLCB 4KUOA 3TOIA 4BENA 2O9BA 5FASA 1BTLA 5GHZA 4JF6A 4EWFA 3BY8A 1ZKJA 2JKRI 2W1TA 1K4FA 3SH8A 1K55A 1FOFA 4C3QA 4S2LA 1PI4A 3Q7VB 1WYBA 4OOLA 3UNWA 4BL3A 4PM9A 4E3KA 5E2HA 3EQUA 4P0MA 1Z6FA 3H7WB 4EV4A 3HLDA 1WA9A 2VGLM 2Z2LB 4WEKA 3GRJA 3SZTA 2ZMAA 3KSGA 1SHVA 2VKSA 3LIEA 4NK3A 4Q8IA 3GV9A 5EPHA 2P74A 2OWJA 4NXFA 1KGFA 1G5UA 5DF7A 4P85A 3KSHA 3UDFA 4GHIA 3Q1FA 1K54C 1HVBA 2V8CA 1XGJA 2QWSA 4HP4A 1BULA 2EXBA 3HLCA 3BLSA 4LRZE 3E4QA 3Q7ZA 3V50A 2PU4A 2X71A 4E3LA 5HX9A 3HLEA 4DXCA 4E6XA 1PI5A 2ZC3B 3GDIA 2A2LA 4KG6A 3CUEC 5FDHA 1N9BA 1YMSA 3S7QA 3D3OA 4UA7A 2W27A 5EOEA 1KVMA 3KYQA 4KZ4A 1S4RA 2Z6DA 3T4KA 4L0LA 3IF6C 3G6OA 4K91A 4S2PA 1YQSA 2DCFA 2NUTC 4JKTA 4JXVA 3T4LA 4CPKA 4DJ2A 4QB8A 4B93A 3OPRA 3LEQA 4OOYA 3MFDA 3MXSA 5HAPA 4GCZA 4MDZA 5F5YA 2V0UA 5EOOA 3CG5A 3NOPC 5HPFA 2JKTI 1S0WA 2XA7M 4S2IA 2FFFB 3WRZA 4WBGA 4HEFA 3BM6A 1K57C 2WGVA 1ACFA 4S2KA 3MQQA 5FI7A 5AVEA 3LR3A 4GN2A 4QU3A 1LI9A 4KUKA 1VETA 1YLPA 2R78A 3V5MA 4BL2A 1STZA 3ZNYA 1H5XA 1ONHA 1Y54A 3NC8A 3A3DA 1TDGA 3T1XA 4JXSA 2H0YA 5HAIA 2VEAA 5FATA 1SZVA 3LO7A 4X56A 1T1BA 1CI8A 3F1OA 4X1LA 3NJAA 1ES4A 2WGWA 4NXBA 1XA7A 1K38A 3TSGA 5E43A 3M6BA 5L07A 1UWPX 2V9AA 5CECA 4Z9QA 2V1AA 4BD1A 1L0FA 3CMZA 4QY5A 1S1ZA 5CEDA 3NIAA 4K08A 2PYPA 2HDRA 4ARZA 2EWWA 4N1HA 3AGEA 2JE5A 2EX9A 3NECA 4R1GA 3T4QA 5L10A 3VP1A 3WRTA 4HESA 3IWOA 2HGVA 4X53A 4WZ4A 4QHCA 4IHQA 3DBAA 2XH9A 1H8MA 2V2FF 2ZMVA 2UWXA 2QYBA 2GZAA 3PAGA 1S6RA 4UHUA 5A93A 5HAQA 3LUQA 2Y4AA 5DF8A 1ES3A 1H3QA 3IWIA 3C30A 3C7UA 2XLNA 3T4OA 2ZQDA 1SKOA 3CPTB 2R9WA 4O01A 3O88A 3SS3A 4JXGA 4M3KA 1ZC2A 3UB7A 2ZMFA 2ZJ9A 3NI9A 3IBRA 2P08A 1P97A 1S67L 3V3SA 3LIDA 4BMWA 5CTMA 3QNBA 5DFYA 3M2JA 3N4IA 3UDXA 3AGFA 4I3JA 5HZHA 1ONGA 2XR0A 4YWZA 2XEPA 3BFFA 2J80A 4K0XA 1XGIA 5HDDA 5HL1A 3BLMA 1GCEA 3BW6A 3MJQA 1N9OA 4HQAA 4L9FA 3HJKA 5EVIC 1LHYA 1XJ6A 3FWLA 5A92A 4XT2A 4CLCA 4EU0A 3A3JA 2QPNA 1YAXA 5KMWA 2BASA 3OBFA 2Q0OA 3IXBA 2HJ9C 3W4PA 2DRWA 1YPRA 4NETA 5FL3A 3ZG9B 1P0ZA 3PBOA 4E6WA 3UE1A 1FSWA 1YKDA 3C5AA 3FC7A 3VSLA 3PBRA 3Q7VA 4IBXA 2O99A 3HLGA 5LBRA 2B95A 2GJ3A 5FQQA 1LL9A 1FCNA 3H7WA 3FPWA 3FV7A 2WUQA 3SW1A 4MLLA 1JVJA 1LSXA 3G4PA 3BJNA 3QP2A 3PR6A 5DF9A 2EX2A 1GSXA 4PAUA 3EWKA 3UY6A 4G3KA 5JYOA 1H8YA 3HLWA 1FR6A 3N8SA 2VGKA 1G6OA 2XSSA 5GLBA 4LCLA 4CLCE 1NYYA 1XFNA 3LIFA 3SH9A 2IWBA 1F5MA 4LRXC 3MS6A 3MZEA 1BUEA 4EERA 3A3FA 5EUAA 4HOIA 2Y2PA 4E3IA 2JC7A 3A0RA 5G18A 2CC1A 3LEZA 4WELA 5EVEA 2PBYA 2KLIA 4ETZA 4Y0UA 1FR1A 1E25A 5C5KA 5HDSA 2Y2GA 2XGNA 3P7NA 4Y3IA 5CEBA 4IEDA 2R9XA 4PPRA 3HUOA 2JN7A 2ZC4B 2W3FA 4GZBA 1NXYA 3VOYA 4E04A 4KZ3A 1H0MA 3E2KA 4PM6A 2O9CA 5EV0A 2HP9A 2L4RA 4OQ0A 3O87A 4DF6A 4HIAA 3UDIA 2H10A 4MN7A 2HPBA 1Z09A 1F2KA 2ZOHA 1NRFA 4DN0A 4OPRA 2DMWA 4A5RA 2VV6A 3FKWA 4R23A 5A8BA 3CAXA 3AGDA 2K7SA 4P6ZM 1GA0A 1W5DA 2Y55A 4MBKA 4CJNA 2HP5A 4ZBEA 1PRQA 1DY6A 3IF5A 5JYPA 2J3TC 3O3VA 1F9IA 2B02A 3N8RA 2WK0A 3RJUA 1WYCA 2PR5A 4BD0A 2Y79A 1Q2QA 4EXOA 3ZQ5A 1FILA 5EM1A 3T4SA 2WAEA 1CJFA 4JF5A 1ZG6A 4LRYC 4JPMA 4M4XA 1T1AA 2ZQ7A 1UWNX 5IS1A 1HTZA 4LLOB 4DJ3A 3VOLA 3W8KA 3C4OA 5F68A 3WS2A 2G2WA 1YLYA 2OLVA 3FPVA 4HH2A 1NLZA 2E8JA 4MEZA 4DRTA 3ICYA 1ZTUA 2VV7A 3KSFA 4BJPA 2ZLYA 3LFVA 2PBDP 4HNBA 4S2MA 4GOGA 3VSKA 2HV1A 2Y2KA 5HDCA 1IKGA 1IYSA 2O0YA 3D72A 5CX7A 2RCXA 3BFEA 4YINA 2Y2QA 2I9VA 3PTEA 1K25A 2A3UA 2W3EA 3VV4A 3CZDA 5L8MA 3KX0X 3VFHA 4ZAMA 4EESA 4ZRRA 4S2NC 2VX8A 3CPTA 2H28A 3IF6B 5EM0A 4KZ5A 3BWLA 3N8LA 2OAQ1 3TG9A 1MKMA 3Q81A 3OPHA 4ZJ3A 1MY8A 2NUPC 2ACGA 2A49A 5FQIA 3T4TA 2VJWA 3NULA 3G34A 3SH7A 3HCYA 4N9KA 1D06A 5J3WA 4EETB 1HLUP 3UPPA 1KGEA 4IUHA 3N7WA 5GHXA 1XA1A 1ODVA 3H82B 1HZOA 3CI6A 4MNRA 5CTNA 3ZVWA 4NKPA 2PDRA 4XUZA 3DTIA 2Y2NA 3LIAA 3NBLA 5EVID 5FEGA 4FD8A 5FDSA 2G2UA 1YLJA 3IXHA 5HW3A 1RP5A 2M7VA 2WZXA 1DRMA 4O7DA 3NY4A 1IOUA 4EEPA 2Y8HA 3H9WA 1S66L 1QMFA 4S2OA 3UMEA 3ZYTA 1LSWA 3QP8A 4EBLA 3HUNA 2V0WA 2Q9NA 3HJIA 3K3DA 1PZOA 3W2ZA 1NJ4A 1HD8A 4YOFA 4G3VA 3CHWP 4KZAA 1I2SA 5EECA 1T19A 2W0NA 5TFQA 5F1GA 4II7A 5CHUA 2AVXA 1MWSA 4CQHA 3MQ0A 5I94A 2V20A 4GD6A 1MPLA 2VZWA 3CJMA 1FCOA 3ITAA 1IEMA 3IX8A 1K6RA 3LR4A 4Q0HA 2OAP1 3P98A 4MN6A 2PT7A 3ISGA 2OOLA 2HJEA 4WUJA 3VP3A 1TS0A 1GSVA 2EFUA 4WZ5C 4ID4A 5F82A 3TRCA 4OONA 4OH0A 3D9YA 2HP6A 3DW0A 3F1NA 5FQJA 1PFLA 3T50A 3ZG7B 3ZG0A 3U2AA 3BYDA 3VFFA 5AQBA 4MBFA 4IBRA 1ESIA 3NOUC 5CGSA 1OTEA 3SS5A 4F3LB 5FI2A 3ITBA 4Y0TA 3FZCA 5HWVA 3IH8A 5KZHA 1J3WA 3CLOA 1GHMA 3Q82A 1JWPA 3RFBA 3W4OA 3UB9A 1LI0A 4OP5A 1BSGA 2K2NA 1VEUB 3TW8A 3RH8B 1NLYA 1P9RA 3ZNTA 1NRJA 3PAEA 3MF0A 4P6BA 4HBTA 4BBTA 2RL3A 1BLHA 4Q0IA 4QD4A 1PWGA 3KYEA 4JGOA 2FZ0A 3A3IA 4JGPA 3BQAA 1MWUA 1LLBA 1TEMA 4MMNA 5HSQA 3EEHA 3EQVA 4OLGA 3G2YA 5EVIB 3WS0A 4Y0OA 3LY3A 3G32A 2DNSA 3S7OA 1PNEA 2WKIA 2ZM0A 1E3UD 4WYYA 2P04A 4B88A 1YLZA 5DVAA 1EI5A 2OWHA 2WZZA 1W8YA 1Y28A 5TBMB 3ZVTA 3UE3A 5DJUA 1DP6A 4DE3A 5DKKA 1TF1A 4HH3A 2Y59A 2C5WB 1CEFA 1MZUA 2D02A 3C4PA 4EUZA 2GDNA 3U4LP 3V39A 4IVKA 2UV0E 1MWRA 4N92A 1VB6A 5J7EA 1UGUA 4JLFA 3V3RA 1ESUA 4KZ7A 4H6JB 4JF4A 1CI9A 1YLWA 1CEGA 4JGRA 4C6YA 4Y2FA 4EEUA 3KSIA 2JKTM 4U0XA 3CITA 3PXPA 1P9WA 1QMEA 3HLFA 4UA6A 3QNCA 2ZL1B
chains in the Genus database with same CATH topology
5C5KA 5HDSA 4L9GA 2YKFA 2JKRI 4I3IA 2W1TA 2XA7S 3P7NA 2JKRM 4Y3IA 2QHKA 1LT0A 2JN7A 4I39A 2W3FA 4E04A 4IJGA 4OOLA 4PKYG 1VHMA 2O9CA 1XFQA 3EQUA 2L4RA 3H7WB 3KO6A 3C2WA 1WA9A 2VGLM 4WEKA 4WL9A 1OTBA 3CUEA 4HIAA 4I38A 3V67A 3KSGA 4MN7A 2M7UA 3IS2A 2L0WA 1GSWA 2VKSA 3LIEA 5IU1A 2ZOHA 3E0YA 4MCWA 3E98A 4DN0A 2DMWA 2OWJA 1W63Q 2VV6A 4NXFA 3UB6A 4EUVA 1OJ5A 2PHYA 3LI8A 5A8BA 3MXQA 4ME4A 1OPXA 3CAXA 5J4EA 2K7SA 4P6ZM 3KSHA 4GHIA 2K31A 2QWSA 2M1CA 4HP4A 2INWA 4BWIA 5HL6A 3LR5A 1F98A 1XJ3A 4LRZE 3E4QA 2J3TC 5G4YA 3TJZC 1BYWA 1F9IA 2B02A 3IBJA 1TD5A 4HY8A 4FOFA 2VV8A 5K5BA 2WKQA 2LB5A 2PR5A 5EFWA 3GDIA 5HD5A 1N9LA 2A2LA 2Y79A 3LICA 1G28A 4GS9B 3CUEC 4EXOA 4OOMA 3ZQ5A 1YSQA 4NXGA 2GNXA 5I5LA 3S7QA 3D3OA 3T4SA 3LIBA 1W63M 2W27A 4LRYC 3OC2A 3KYQA 4M4XA 2A24A 1T1AA 1S4RA 2MJ6A 2J3TD 4MN5A 2Z6DA 1UWNX 3T4KA 5IS1A 4L0LA 3G6OA 4LLOB 2B18A 2NUTC 2LB9A 3T4LA 4DJ2A 2PD7A 4EW7A 4DJ3A 5HWWA 5HWTA 3VOLA 2W1TB 5F68A 4B93A 4Q0JA 2ZOIA 3FPVA 4HH2A 1NLZA 3NOTC 3GECA 4GCZA 1T1CA 4MDZA 5F5YA 2V0UA 4KQOA 3EGXC 3ICYA 1ZTUA 2VV7A 3KSFA 4BJPA 3LFVA 3NOPC 5HPFA 2JKTI 3PYPA 4HNBA 5TJJA 2XA7M 5DFXA 1XJ2A 1XJ4A 5IT5A 2HV1A 3B42A 2QKPA 5HPIA 3F1OB 5HDCA 2HF6A 3RTYA 2O0YA 3D72A 3MQQA 5CX7A 1D7EA 5AVEA 3IS2B 3LR3A 1EW0A 2I9VA 5F69A 2W3EA 4HJ6A 4KUKA 3VV4A 5L8MA 3KX0X 2KOIA 2R78A 3EEAA 1OTAA 3PHYA 1STZA 4EESA 4ZRRA 2VX8A 2H28A 2O9AA 3BWLA 4GHIB 2OAQ1 1MKMA 4QPRA 3BQ8A 2EA9A 2VEAA 2NUPC 4WN5A 4ARZB 2IA2A 4PHTA 3T4TA 2ZBBA 1T1BA 2L1MA 2VJWA 3K3CA 3F1OA 4O8GA 3NJAA 4NXBA 3HCYA 4G3WA 1D06A 5J3WA 4EETB 1UWPX 1YSPA 2V9AA 4IUHA 2W1RA 5G4ZA 2V1AA 1ODVA 3H82B 3CI6A 2A24B 4NKPA 1S1ZA 1MC0A 2PDRA 4K08A 2PYPA 1X0OA 3S7NA 4ARZA 2KX6A 3LIAA 4O0PA 2EWWA 4F3LA 3LI9A 4JGQA 4I5SA 2W3HA 3KYZA 3P01A 3T4QA 4BBVA 2M7VA 3CWFA 3UB8A 1DRMA 2HGVA 1IOUA 1DP8A 4IHQA 2Y8HA 4EEPA 3H9WA 4UQIS 1S66L 4R70A 1TS8A 3DBAA 1H8MA 3UMEA 3ZYTA 5MC7A 1LSWA 4AFIA 2GX5A 3JVVA 4I3AA 2ZMVA 2V0WA 3HJIA 3NHQA 3K3DA 3H82A 2QYBA 2GZAA 3W2ZA 4YOFA 4G3VA 1T19A 2W0NA 2KDKA 4RQ9A 4II7A 3A0VA 3LUQA 3MQOA 4GJ4A 4CQHA 4IUKA 3MQ0A 3BY9A 1H3QA 2CMNA 3C30A 1V9YA 2WKPA 3UE6A 3PBSA 3T4OA 3E4PA 5AJGA 3F1NB 2VZWA 4O01A 1KOUA 1NWZA 5DKLA 4WLAA 2V1BA 3LR4A 4Q0HA 2XROA 1DP9A 2OAP1 4MN6A 4CLCD 2PT7A 1OT6A 2OOLA 2HJEA 4R6LA 1S1YA 4WUJA 2ZMFA 3UB7A 3JVUA 1TS0A 3MMHA 1GSVA 4HJ4A 4BBUA 3IBRA 2P08A 1P97A 1S67L 2PYRA 3E4OA 3LIDA 4BMWA 3TRCA 5DFYA 2W3DA 3OOVA 1OTIA 4YNRA 4I3JA 5TBMA 5HZHA 1TS7A 1ZHHB 4YWZA 3F1NA 3T50A 2VA0A 2J80A 3OCNA 3U2AA 2WKRA 4HI4A 3S7PA 5HDDA 3BW6A 4LPZA 3NOUC 1OTEA 4F3LB 1OT9A 3MJQA 2VLGA 4Y5FA 1N9OA 5HD3A 4HQAA 3VE3A 3EOIA 4L9FA 5HWVA 2YKHA 3HJKA 4H6JA 3TE8A 3CLOA 1XJ6A 3RFBA 1S4SA 4NXEA 3UB9A 3O5YA 4WEJA 4HJ3A 4XT2A 4CLCA 4EU0A 2W3GA 3R7WA 1N9NA 3MR0A 1YAXA 3K2NA 2K2NA 2BASA 2Z6CA 3TW8A 3RH8B 1NLYA 3OBFA 3F1PA 3PBQA 4FSFA 2HJ9C 1P9RA 1NRJA 3MF0A 5FL3A 1TS6A 4BBTA 3VE4A 4UQIM 4Q0IA 3PBTA 1P0ZA 1IFQA 1OTDA 3PBOA 2VGLS 4JGOA 1YKDA 5KSHA 3A0SA 3FC7A 3PBRA 2FZ0A 2P7JA 4JGPA 3BQAA 2O99A 2PD8A 2QJ5A 3OCLA 5LBRA 4MMNA 5HSQA 2GJ3A 3EEHA 3EQVA 2FH5A 1LSVA 3H7WA 3ULFA 3FPWA 4L9EA 3SW1A 1LSXA 2G7UA 1OJGA 2QJ7A 4P6ZS 4CLCC 3BJNA 2JHEA 3UMDA 4WF0A 4ETXA 4KQDA 3PR6A 5AVFA 3S7OA 5DF9A 1T18A 1LL8A 2P04A 1GSXA 3OLOA 3EWKA 2OWHA 4PAUA 2J3WA 3C38A 4G3KA 1Y28A 4NEED 5TBMB 3UE3A 3MFXA 3R4KA 5DJUA 1DP6A 2EWVA 3FG8A 5DKKA 1G6OA 1TF1A 2XSSA 1JNUA 4HH3A 3LR0A 1V9ZA 3B33A 1MZUA 4DMZA 2D02A 4R38A 4PKYA 4CLCE 1XFNA 3BY8A 3PBNA 4UEYA 3LIFA 3LYXA 1VB6A 5J7EA 1UGUA 1F5MA 3B47A 3EGDC 4R3AA 5DJTA 4EQ1A 5KIZA 4LRXC 3C8CA 4Z1WA 4GW9A 4EERA 5F6AA 4H6JB 4HOIA 4B9OA 4HHDA 4GLQA 2PR6A 4GS9A 4JGRA 4Y2FA 4EEUA 2D01A 4XT2B 4CLCB 3T4JA 3A0RA 3KSIA 2JKTM 3R7WB 3CITA 3PXPA 4KUOA 1P9WA 4WELA 3F1PB 2O9BA 2KLIA 4HP9A 4ETZA 2XRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDS A;  4L9G A;  2YKF A;  4I3I A;  3P7N A;  2QHK A;  1LT0 A;  2JN7 A;  4I39 A;  4E04 A;  4PKY G;  1XFQ A;  2L4R A;  3H7W B;  3C2W A;  1WA9 A;  4WL9 A;  1OTB A;  4HIA A;  4I38 A;  3IS2 A;  2L0W A;  1GSW A;  3LIE A;  5IU1 A;  2ZOH A;  2OWJ A;  2VV6 A;  4NXF A;  3UB6 A;  1OJ5 A;  2PHY A;  3LI8 A;  5A8B A;  3MXQ A;  3CAX A;  5J4E A;  2K7S A;  4GHI A;  2QWS A;  2M1C A;  4HP4 A;  2INW A;  1F98 A;  1XJ3 A;  4LRZ E;  3E4Q A;  5G4Y A;  1BYW A;  1F9I A;  2B02 A;  4HY8 A;  2VV8 A;  2WKQ A;  2PR5 A;  5EFW A;  3GDI A;  5HD5 A;  1N9L A;  3LIC A;  1G28 A;  4GS9 B;  4EXO A;  3ZQ5 A;  4NXG A;  5I5L A;  3LIB A;  2W27 A;  4LRY C;  4M4X A;  2A24 A;  1T1A A;  1S4R A;  4MN5 A;  2Z6D A;  1UWN X;  5IS1 A;  3G6O A;  4LLO B;  4DJ2 A;  4EW7 A;  2PD7 A;  5HWW A;  4DJ3 A;  5HWT A;  3VOL A;  5F68 A;  2ZOI A;  4HH2 A;  3NOT C;  3GEC A;  4GCZ A;  1T1C A;  5F5Y A;  2V0U A;  3ICY A;  2VV7 A;  3NOP C;  3PYP A;  4HNB A;  1XJ2 A;  1XJ4 A;  2HV1 A;  2QKP A;  3F1O B;  5HDC A;  3RTY A;  3D72 A;  3MQQ A;  1D7E A;  5AVE A;  3IS2 B;  1EW0 A;  2I9V A;  5F69 A;  4KUK A;  4HJ6 A;  3KX0 X;  2R78 A;  1OTA A;  3PHY A;  4EES A;  2H28 A;  3BWL A;  4GHI B;  2EA9 A;  2VEA A;  4WN5 A;  2ZBB A;  1T1B A;  2L1M A;  3K3C A;  3F1O A;  3NJA A;  4NXB A;  1D06 A;  5J3W A;  4EET B;  1UWP X;  2V9A A;  5G4Z A;  2V1A A;  1ODV A;  3H82 B;  2A24 B;  1S1Z A;  2PDR A;  4K08 A;  2PYP A;  1X0O A;  2KX6 A;  3LIA A;  4F3L A;  3LI9 A;  4JGQ A;  4I5S A;  4BBV A;  3CWF A;  3UB8 A;  1DRM A;  1DP8 A;  4EEP A;  3H9W A;  1S66 L;  4R70 A;  1TS8 A;  3UME A;  1LSW A;  4I3A A;  2V0W A;  3HJI A;  3NHQ A;  3K3D A;  3H82 A;  1T19 A;  2W0N A;  2KDK A;  4RQ9 A;  3A0V A;  3LUQ A;  3MQO A;  3BY9 A;  2CMN A;  1V9Y A;  2WKP A;  3UE6 A;  3E4P A;  3F1N B;  1KOU A;  1NWZ A;  5DKL A;  4WLA A;  2V1B A;  1DP9 A;  4MN6 A;  1OT6 A;  2OOL A;  4R6L A;  1S1Y A;  4WUJ A;  3UB7 A;  1TS0 A;  1GSV A;  4HJ4 A;  4BBU A;  3IBR A;  1P97 A;  1S67 L;  2PYR A;  3E4O A;  3LID A;  1OTI A;  4I3J A;  5TBM A;  5HZH A;  1TS7 A;  4YWZ A;  3F1N A;  3T50 A;  2J80 A;  2WKR A;  4HI4 A;  5HDD A;  4LPZ A;  3NOU C;  1OTE A;  4F3L B;  1OT9 A;  3MJQ A;  2VLG A;  1N9O A;  5HD3 A;  4HQA A;  3VE3 A;  4L9F A;  5HWV A;  2YKH A;  3HJK A;  4H6J A;  3CLO A;  1XJ6 A;  1S4S A;  4NXE A;  3UB9 A;  4HJ3 A;  4XT2 A;  3MR0 A;  1N9N A;  2Z6C A;  2BAS A;  3RH8 B;  3F1P A;  1TS6 A;  4BBT A;  3VE4 A;  1P0Z A;  1OTD A;  4JGO A;  3A0S A;  3FC7 A;  2P7J A;  4JGP A;  2PD8 A;  2QJ5 A;  5HSQ A;  2GJ3 A;  3EEH A;  1LSV A;  3H7W A;  3ULF A;  4L9E A;  3SW1 A;  1LSX A;  1OJG A;  2QJ7 A;  2JHE A;  3UMD A;  4WF0 A;  4KQD A;  5AVF A;  1T18 A;  1LL8 A;  1GSX A;  3OLO A;  3EWK A;  2OWH A;  1Y28 A;  5TBM B;  3MFX A;  5DJU A;  1DP6 A;  3FG8 A;  5DKK A;  1JNU A;  4HH3 A;  1V9Z A;  3B33 A;  1MZU A;  2D02 A;  4R38 A;  4PKY A;  1XFN A;  3LIF A;  3LYX A;  1VB6 A;  5J7E A;  1UGU A;  4R3A A;  5DJT A;  4EQ1 A;  5KIZ A;  4LRX C;  3C8C A;  4GW9 A;  4EER A;  5F6A A;  4H6J B;  4HOI A;  4B9O A;  4HHD A;  4GS9 A;  2PR6 A;  4JGR A;  4EEU A;  2D01 A;  4XT2 B;  3A0R A;  4KUO A;  3F1P B;  4HP9 A;  3BY8 A; 
#chains in the Genus database with same CATH topology
 1ERM A;  3LY4 A;  4L9G A;  4I3I A;  5E2G A;  3NDE A;  2WYX A;  5FAP A;  2Z2M B;  4GD8 A;  2XD5 A;  1LT0 A;  4KG2 A;  4DE2 A;  1BLC A;  2XFS A;  4IJG A;  1LL5 A;  3GQZ A;  1VHM A;  2EX8 A;  1W79 A;  3GVB A;  3IT9 A;  1XFQ A;  3JYI A;  3C2W A;  1U60 A;  4WL9 A;  1OTB A;  3CUE A;  3O86 A;  2M7U A;  5IU1 A;  5FEF A;  5DTT A;  3T1S A;  1PZP A;  5M1A A;  4KZ6 A;  3NCK A;  3UB6 A;  1I2W A;  2BG1 A;  1OJ5 A;  2PHY A;  3LI8 A;  3UN7 A;  1FSY A;  4EBN A;  1K55 C;  2K31 A;  3RXW A;  4IVI A;  5HL6 A;  2ZQA A;  4BQM A;  1CK3 A;  1BYW A;  1SDN A;  2WAD A;  1TD5 A;  4HY8 A;  2VV8 A;  3N6I A;  2LB5 A;  1N4O A;  5EFW A;  1N9L A;  3LIC A;  1K57 A;  1G28 A;  3IX3 A;  1YSQ A;  5DTS A;  3L9K A;  5KSC A;  4X55 A;  2MJ6 A;  3G31 A;  4MN5 A;  3FKV A;  2B18 A;  4EW7 A;  2PD7 A;  2OV5 A;  3RXX A;  4JBF A;  4BLM A;  4KZ9 A;  1Q2P A;  4QY6 A;  1YM1 A;  5D3O A;  3E2L A;  4KG5 A;  1MXO A;  1XJ2 A;  4XXR A;  5IT5 A;  3DAV A;  5HPI A;  3F1O B;  2WGW B;  1D7E A;  3LGO A;  3IS2 B;  1EW0 A;  4OQI A;  3W4Q A;  2KOI A;  3EEA A;  1OTA A;  3PHY A;  2XD1 A;  3QP5 A;  5GL9 A;  3DTE A;  1RGZ A;  5CGX A;  1NY0 A;  4OLD A;  4WN5 A;  4ARZ B;  2IA2 A;  4PHT A;  2JKF A;  3G35 A;  3HLB A;  3MZD A;  4O8G A;  4ZJ1 A;  1KDW A;  1XXM A;  1H8Z A;  4LFU A;  1PW1 A;  2I72 A;  3UPN A;  1YSP A;  4DXB A;  5FA7 A;  4RX3 A;  1K4E A;  2W1R A;  5G4Z A;  2XK1 A;  1RGY A;  5FQM A;  2A24 B;  5CHJ A;  1MC0 A;  3VOZ A;  3SOI A;  1SCW A;  3S7N A;  3UE0 A;  4F3L A;  2JKG A;  4JGQ A;  4I5S A;  5TR7 A;  3P01 A;  3T1Q B;  1IEL A;  1SKO B;  5GLD A;  4BBV A;  3UB8 A;  1KDS A;  3Q07 A;  1NZO A;  3S1Y A;  4UQI S;  1TS8 A;  3OPL A;  1ES2 A;  5MC7 A;  4AFI A;  4WM9 A;  5A91 A;  2EXA A;  3FYZ A;  1VEU A;  5DTK A;  2PU2 A;  4WMC A;  3MBZ A;  2KDK A;  4RQ9 A;  1BLP A;  3MQO A;  4KQR A;  4GJ4 A;  3HVF A;  3BY9 A;  2CMN A;  4D60 A;  1V9Y A;  3UE6 A;  3PBS A;  3E4P A;  4EBP A;  1PYY A;  1JTD A;  3IQA A;  4R4S A;  4B4X A;  1NWZ A;  4B4Z A;  4WLA A;  4ZDX A;  2V1B A;  2XRO A;  4U3T A;  5EVI A;  4YFM A;  3VP2 A;  3GMW A;  1GHI A;  3JVU A;  3MMH A;  1L3L A;  4BBU A;  2PYR A;  3E4O A;  1KVL A;  2Y2I A;  3HUM A;  4R3J A;  2W3D A;  3OOV A;  1OTI A;  4P87 A;  5TBM A;  1DJC A;  1IYQ A;  3S4X A;  5L2F A;  1TS7 A;  1ZHH B;  1L2S A;  4QJG A;  3OCN A;  2PAV P;  3NDG A;  2XDM A;  2WKR A;  2HDU A;  4HI4 A;  4RA7 A;  3S7P A;  3HRE A;  1KE4 A;  4LPZ A;  2Y2M A;  3T12 B;  2ZM2 A;  1K56 D;  2VLG A;  4Y5F A;  4X68 A;  5HD3 A;  3VE3 A;  4E3N A;  4ZJ2 A;  2YKH A;  2H0T A;  4H6J A;  3TE8 A;  4WMC D;  1AXB A;  4RX2 A;  2Y2O A;  4E3O A;  1G68 A;  3ZGA B;  4MBH A;  1A0K A;  4NXE A;  4NG2 A;  4WEJ A;  1N9N A;  3K2N A;  2Z6C A;  2HDS A;  1CF0 A;  3PBQ A;  1M6K A;  3WS4 A;  5CXW A;  2ZL1 A;  1XPB A;  2BLS A;  1TS6 A;  3VE4 A;  3PBT A;  3P09 A;  5FQ9 A;  1IFQ A;  2HDQ A;  2Y91 A;  2VGL S;  1E4D A;  4D2O A;  4OP8 A;  5CRF A;  1K0K A;  2PD8 A;  2QJ5 A;  3OCL A;  5CGW A;  2FH5 A;  4LV3 A;  4L9E A;  3M2K A;  1OJG A;  4CLC C;  4WF0 A;  5HAR A;  4KQD A;  4ETX A;  4RVA A;  1T18 A;  1LL8 A;  3L7H A;  4EQI A;  4OKP A;  3ZCZ A;  5HFO A;  3C38 A;  3DTM A;  1DJA A;  4NEE D;  3MFX A;  3R4K A;  3S22 A;  5EVL A;  3FG8 A;  3SS4 A;  1SDE A;  1JNU A;  4KQQ A;  3LR0 A;  1V9Z A;  3ZDJ A;  4N9L A;  3B33 A;  4DMZ A;  2ZQ8 A;  4OPY A;  4R38 A;  1Y4O A;  5U47 A;  1KE0 A;  1EWZ A;  4K0W A;  4XUX A;  4UEY A;  5F1F A;  1FIK A;  3B47 A;  3EGD C;  4E3J A;  4EQ1 A;  4KZ8 A;  4Z1W A;  3DWZ A;  4HHD A;  3IXD A;  3BFD A;  4GLQ A;  2PR6 A;  3BEC A;  5FAO A;  2D01 A;  3T4J A;  3R7W B;  4FTX A;  4GDN A;  1O07 A;  3G2Z A;  4OQH A;  3F1P B;  3JPU A;  4HP9 A;  2WKH A;  3HBR A;  1IKI A;  2XRN A;  1G6A A;  5L09 A;  3OPP A;  1E3U A;  2YKF A;  2ZM8 A;  2XA7 S;  5FI6 A;  2JKR M;  2QHK A;  1M40 A;  4I39 A;  1KGG A;  2XFT A;  4U0T A;  4PKY G;  5E2F A;  4FCF A;  2Y2J A;  4Y15 A;  1YT4 A;  3KO6 A;  1ES5 A;  1PWD A;  3ZFZ A;  4UAA A;  5TGF A;  2ZC7 A;  4I38 A;  3V67 A;  4C75 A;  5GLA A;  3IS2 A;  2L0W A;  1GSW A;  5AQ7 A;  4QWO A;  1C3B A;  2VGJ A;  1JWZ A;  3E0Y A;  3MSH A;  4MCW A;  3E98 A;  1W63 Q;  2ZC5 B;  5F83 A;  2WKE A;  4OPZ A;  4EUV A;  2B5R A;  2ZD8 A;  3MXQ A;  4ME4 A;  1OPX A;  3DWK A;  5J4E A;  4R3B A;  2P9V B;  3WS5 A;  2M1C A;  2INW A;  4BWI A;  3LR5 A;  3VMA A;  1F98 A;  2E8I A;  4Y13 A;  1CQA A;  1XJ3 A;  1MKI A;  5G4Y A;  3TJZ C;  1WE4 A;  3IBJ A;  4FOF A;  3T1R A;  2QZ6 A;  2BTF P;  5K5B A;  2WKQ A;  5HD5 A;  2J7V A;  4GS9 B;  4DDY A;  4OOM A;  5GHY A;  4UA9 A;  4NXG A;  5IHV A;  2GNX A;  4FUW A;  5I5L A;  1XKZ A;  1ALQ A;  3LIB A;  1W63 M;  3OC2 A;  2A24 A;  1IYP A;  3IXG A;  2J3T D;  4S2N A;  2V8F A;  2LB9 A;  5HWW A;  3BRM A;  5HWT A;  2W1T B;  4Q0J A;  4JXW A;  2ZOI A;  3NOT C;  3GEC A;  1GA9 A;  1T1C A;  3G30 A;  3IH9 A;  3MKF A;  4KQO A;  3EGX C;  5BOH A;  3PYP A;  1YLT A;  3IHA A;  5TJJ A;  4S2J A;  5DFX A;  1XJ4 A;  3I7J A;  2WGI A;  3B42 A;  2QKP A;  1MWT A;  4OVD A;  2HF6 A;  1O7E A;  3M6H A;  4FH4 A;  3RTY A;  5M18 A;  5FQK A;  5GLC A;  2X01 A;  3D4F A;  5F69 A;  4HJ6 A;  4PM7 A;  1K54 A;  4GDB A;  4LV0 A;  2V1Z A;  1L0G A;  2O9A A;  4DDS A;  3IX4 A;  3IWQ A;  3HL9 A;  4KZB A;  1TVF A;  3OZH A;  2QMI A;  4GHI B;  4QPR A;  3BQ8 A;  1I5Q A;  2EA9 A;  3WWX A;  2ZBB A;  2L1M A;  2Q9M A;  3K3C A;  2PRF A;  3UO9 A;  1D1J A;  4G3W A;  1W7F A;  4LV1 A;  3LCE A;  1K6S A;  3IF6 A;  4PM8 A;  3B3X A;  5AQA A;  1YMX A;  2VK3 A;  4LCM A;  4PMA A;  3BFG A;  1X0O A;  4R4R A;  2KX6 A;  4Y7P A;  4PM5 A;  4O0P A;  3C7V A;  1VM1 A;  3LI9 A;  2W3H A;  3KYZ A;  1PWC A;  5FSR A;  1JTG A;  3UPO A;  3BFC A;  3CWF A;  3A3E A;  1NYM A;  1XX2 A;  4LEN A;  1DP8 A;  1BLS A;  4Y17 A;  4R70 A;  5CHM A;  4X6T A;  2GX5 A;  4WZ5 A;  3JVV A;  4I3A A;  3MZF A;  1GHP A;  1ZG4 A;  3NHQ A;  3H82 A;  4ESP A;  2JBF A;  1MBL A;  3UB5 P;  4ZTK A;  5M19 A;  3A0V A;  2OLU A;  2ZQC A;  1RCJ A;  4IUK A;  5E2E A;  2WKP A;  1VET B;  1DJB A;  2C6W B;  1BT5 A;  5AJG A;  4OQG A;  3F1N B;  1KOU A;  2X02 A;  4KEN B;  1L0E A;  5DKL A;  1DP9 A;  4CLC D;  1OT6 A;  2XF3 A;  2ZC6 B;  3GSG A;  4R6L A;  1S1Y A;  3ZG5 A;  1L0D A;  4HJ4 A;  4N1X A;  3QP4 A;  5AQ9 A;  1JWV A;  1VQQ A;  4DKI A;  2ZQ9 A;  3DTK A;  3GTC A;  4YNR A;  4RYE A;  2VA0 A;  4HBU A;  1J9M A;  2IWD A;  1TDL A;  2J9O A;  4GKU A;  1KE3 A;  1OT9 A;  3QP6 A;  4F94 A;  1ERQ A;  3IHB A;  3EOI A;  4LV2 A;  4X1M A;  1S4S A;  3O5Y A;  4HJ3 A;  2W3G A;  3R7W A;  3MR0 A;  5A90 A;  2EX6 A;  1FCM A;  2H5S A;  3F1P A;  4FSF A;  5CER A;  3VP0 A;  4X25 A;  4DE1 A;  3QHY A;  2FFY A;  4UQI M;  1PIO A;  5J8X A;  2Y2H A;  3ZG8 B;  1OTD A;  2XQZ A;  4DE0 A;  2HZ5 A;  3A0S A;  5KSH A;  1IYO A;  2P7J A;  3MKE A;  1ERO A;  4R0Q A;  1FQG A;  1LSV A;  1PW8 A;  4H8R A;  3ULF A;  1K56 A;  1XP4 A;  2G7U A;  2QJ7 A;  4P6Z S;  4GB7 A;  2JHE A;  1AWI A;  3UMD A;  5AVF A;  3WS1 A;  4LGW A;  1NZU A;  4OPQ A;  3OLO A;  3ZHH A;  1SKF A;  2J3W A;  2JCH A;  3QP1 A;  2EWV A;  2P9V A;  2WAF A;  3MXR A;  4PKY A;  2J8Y A;  3BEB A;  4FH2 A;  3PBN A;  2J9P A;  3LYX A;  4R3A A;  2IWC A;  1W8Q A;  5DJT A;  5KIZ A;  2EFX A;  3C8C A;  4X69 A;  4GW9 A;  4GNU A;  5F6A A;  3VP4 A;  1BZA A;  5FAQ A;  4B9O A;  2OSU A;  5EE8 A;  2Y2L A;  1OME A;  4E3M A;  4GS9 A;  3GR2 A;  4XT2 B;  4CLC B;  4KUO A;  3TOI A;  4BEN A;  2O9B A;  5FAS A;  1BTL A;  5GHZ A;  4JF6 A;  4EWF A;  3BY8 A;  1ZKJ A;  2JKR I;  2W1T A;  1K4F A;  3SH8 A;  1K55 A;  1FOF A;  4C3Q A;  4S2L A;  1PI4 A;  3Q7V B;  1WYB A;  4OOL A;  3UNW A;  4BL3 A;  4PM9 A;  4E3K A;  5E2H A;  3EQU A;  4P0M A;  1Z6F A;  3H7W B;  4EV4 A;  3HLD A;  1WA9 A;  2VGL M;  2Z2L B;  4WEK A;  3GRJ A;  3SZT A;  2ZMA A;  3KSG A;  1SHV A;  2VKS A;  3LIE A;  4NK3 A;  4Q8I A;  3GV9 A;  5EPH A;  2P74 A;  2OWJ A;  4NXF A;  1KGF A;  1G5U A;  5DF7 A;  4P85 A;  3KSH A;  3UDF A;  4GHI A;  3Q1F A;  1K54 C;  1HVB A;  2V8C A;  1XGJ A;  2QWS A;  4HP4 A;  1BUL A;  2EXB A;  3HLC A;  3BLS A;  4LRZ E;  3E4Q A;  3Q7Z A;  3V50 A;  2PU4 A;  2X71 A;  4E3L A;  5HX9 A;  3HLE A;  4DXC A;  4E6X A;  1PI5 A;  2ZC3 B;  3GDI A;  2A2L A;  4KG6 A;  3CUE C;  5FDH A;  1N9B A;  1YMS A;  3S7Q A;  3D3O A;  4UA7 A;  2W27 A;  5EOE A;  1KVM A;  3KYQ A;  4KZ4 A;  1S4R A;  2Z6D A;  3T4K A;  4L0L A;  3IF6 C;  3G6O A;  4K91 A;  4S2P A;  1YQS A;  2DCF A;  2NUT C;  4JKT A;  4JXV A;  3T4L A;  4CPK A;  4DJ2 A;  4QB8 A;  4B93 A;  3OPR A;  3LEQ A;  4OOY A;  3MFD A;  3MXS A;  5HAP A;  4GCZ A;  4MDZ A;  5F5Y A;  2V0U A;  5EOO A;  3CG5 A;  3NOP C;  5HPF A;  2JKT I;  1S0W A;  2XA7 M;  4S2I A;  2FFF B;  3WRZ A;  4WBG A;  4HEF A;  3BM6 A;  1K57 C;  2WGV A;  1ACF A;  4S2K A;  3MQQ A;  5FI7 A;  5AVE A;  3LR3 A;  4GN2 A;  4QU3 A;  1LI9 A;  4KUK A;  1VET A;  1YLP A;  2R78 A;  3V5M A;  4BL2 A;  1STZ A;  3ZNY A;  1H5X A;  1ONH A;  1Y54 A;  3NC8 A;  3A3D A;  1TDG A;  3T1X A;  4JXS A;  2H0Y A;  5HAI A;  2VEA A;  5FAT A;  1SZV A;  3LO7 A;  4X56 A;  1T1B A;  1CI8 A;  3F1O A;  4X1L A;  3NJA A;  1ES4 A;  2WGW A;  4NXB A;  1XA7 A;  1K38 A;  3TSG A;  5E43 A;  3M6B A;  5L07 A;  1UWP X;  2V9A A;  5CEC A;  4Z9Q A;  2V1A A;  4BD1 A;  1L0F A;  3CMZ A;  4QY5 A;  1S1Z A;  5CED A;  3NIA A;  4K08 A;  2PYP A;  2HDR A;  4ARZ A;  2EWW A;  4N1H A;  3AGE A;  2JE5 A;  2EX9 A;  3NEC A;  4R1G A;  3T4Q A;  5L10 A;  3VP1 A;  3WRT A;  4HES A;  3IWO A;  2HGV A;  4X53 A;  4WZ4 A;  4QHC A;  4IHQ A;  3DBA A;  2XH9 A;  1H8M A;  2V2F F;  2ZMV A;  2UWX A;  2QYB A;  2GZA A;  3PAG A;  1S6R A;  4UHU A;  5A93 A;  5HAQ A;  3LUQ A;  2Y4A A;  5DF8 A;  1ES3 A;  1H3Q A;  3IWI A;  3C30 A;  3C7U A;  2XLN A;  3T4O A;  2ZQD A;  1SKO A;  3CPT B;  2R9W A;  4O01 A;  3O88 A;  3SS3 A;  4JXG A;  4M3K A;  1ZC2 A;  3UB7 A;  2ZMF A;  2ZJ9 A;  3NI9 A;  3IBR A;  2P08 A;  1P97 A;  1S67 L;  3V3S A;  3LID A;  4BMW A;  5CTM A;  3QNB A;  5DFY A;  3M2J A;  3N4I A;  3UDX A;  3AGF A;  4I3J A;  5HZH A;  1ONG A;  2XR0 A;  4YWZ A;  2XEP A;  3BFF A;  2J80 A;  4K0X A;  1XGI A;  5HDD A;  5HL1 A;  3BLM A;  1GCE A;  3BW6 A;  3MJQ A;  1N9O A;  4HQA A;  4L9F A;  3HJK A;  5EVI C;  1LHY A;  1XJ6 A;  3FWL A;  5A92 A;  4XT2 A;  4CLC A;  4EU0 A;  3A3J A;  2QPN A;  1YAX A;  5KMW A;  2BAS A;  3OBF A;  2Q0O A;  3IXB A;  2HJ9 C;  3W4P A;  2DRW A;  1YPR A;  4NET A;  5FL3 A;  3ZG9 B;  1P0Z A;  3PBO A;  4E6W A;  3UE1 A;  1FSW A;  1YKD A;  3C5A A;  3FC7 A;  3VSL A;  3PBR A;  3Q7V A;  4IBX A;  2O99 A;  3HLG A;  5LBR A;  2B95 A;  2GJ3 A;  5FQQ A;  1LL9 A;  1FCN A;  3H7W A;  3FPW A;  3FV7 A;  2WUQ A;  3SW1 A;  4MLL A;  1JVJ A;  1LSX A;  3G4P A;  3BJN A;  3QP2 A;  3PR6 A;  5DF9 A;  2EX2 A;  1GSX A;  4PAU A;  3EWK A;  3UY6 A;  4G3K A;  5JYO A;  1H8Y A;  3HLW A;  1FR6 A;  3N8S A;  2VGK A;  1G6O A;  2XSS A;  5GLB A;  4LCL A;  4CLC E;  1NYY A;  1XFN A;  3LIF A;  3SH9 A;  2IWB A;  1F5M A;  4LRX C;  3MS6 A;  3MZE A;  1BUE A;  4EER A;  3A3F A;  5EUA A;  4HOI A;  2Y2P A;  4E3I A;  2JC7 A;  3A0R A;  5G18 A;  2CC1 A;  3LEZ A;  4WEL A;  5EVE A;  2PBY A;  2KLI A;  4ETZ A;  4Y0U A;  1FR1 A;  1E25 A;  5C5K A;  5HDS A;  2Y2G A;  2XGN A;  3P7N A;  4Y3I A;  5CEB A;  4IED A;  2R9X A;  4PPR A;  3HUO A;  2JN7 A;  2ZC4 B;  2W3F A;  4GZB A;  1NXY A;  3VOY A;  4E04 A;  4KZ3 A;  1H0M A;  3E2K A;  4PM6 A;  2O9C A;  5EV0 A;  2HP9 A;  2L4R A;  4OQ0 A;  3O87 A;  4DF6 A;  4HIA A;  3UDI A;  2H10 A;  4MN7 A;  2HPB A;  1Z09 A;  1F2K A;  2ZOH A;  1NRF A;  4DN0 A;  4OPR A;  2DMW A;  4A5R A;  2VV6 A;  3FKW A;  4R23 A;  5A8B A;  3CAX A;  3AGD A;  2K7S A;  4P6Z M;  1GA0 A;  1W5D A;  2Y55 A;  4MBK A;  4CJN A;  2HP5 A;  4ZBE A;  1PRQ A;  1DY6 A;  3IF5 A;  5JYP A;  2J3T C;  3O3V A;  1F9I A;  2B02 A;  3N8R A;  2WK0 A;  3RJU A;  1WYC A;  2PR5 A;  4BD0 A;  2Y79 A;  1Q2Q A;  4EXO A;  3ZQ5 A;  1FIL A;  5EM1 A;  3T4S A;  2WAE A;  1CJF A;  4JF5 A;  1ZG6 A;  4LRY C;  4JPM A;  4M4X A;  1T1A A;  2ZQ7 A;  1UWN X;  5IS1 A;  1HTZ A;  4LLO B;  4DJ3 A;  3VOL A;  3W8K A;  3C4O A;  5F68 A;  3WS2 A;  2G2W A;  1YLY A;  2OLV A;  3FPV A;  4HH2 A;  1NLZ A;  2E8J A;  4MEZ A;  4DRT A;  3ICY A;  1ZTU A;  2VV7 A;  3KSF A;  4BJP A;  2ZLY A;  3LFV A;  2PBD P;  4HNB A;  4S2M A;  4GOG A;  3VSK A;  2HV1 A;  2Y2K A;  5HDC A;  1IKG A;  1IYS A;  2O0Y A;  3D72 A;  5CX7 A;  2RCX A;  3BFE A;  4YIN A;  2Y2Q A;  2I9V A;  3PTE A;  1K25 A;  2A3U A;  2W3E A;  3VV4 A;  3CZD A;  5L8M A;  3KX0 X;  3VFH A;  4ZAM A;  4EES A;  4ZRR A;  4S2N C;  2VX8 A;  3CPT A;  2H28 A;  3IF6 B;  5EM0 A;  4KZ5 A;  3BWL A;  3N8L A;  2OAQ 1;  3TG9 A;  1MKM A;  3Q81 A;  3OPH A;  4ZJ3 A;  1MY8 A;  2NUP C;  2ACG A;  2A49 A;  5FQI A;  3T4T A;  2VJW A;  3NUL A;  3G34 A;  3SH7 A;  3HCY A;  4N9K A;  1D06 A;  5J3W A;  4EET B;  1HLU P;  3UPP A;  1KGE A;  4IUH A;  3N7W A;  5GHX A;  1XA1 A;  1ODV A;  3H82 B;  1HZO A;  3CI6 A;  4MNR A;  5CTN A;  3ZVW A;  4NKP A;  2PDR A;  4XUZ A;  3DTI A;  2Y2N A;  3LIA A;  3NBL A;  5EVI D;  5FEG A;  4FD8 A;  5FDS A;  2G2U A;  1YLJ A;  3IXH A;  5HW3 A;  1RP5 A;  2M7V A;  2WZX A;  1DRM A;  4O7D A;  3NY4 A;  1IOU A;  4EEP A;  2Y8H A;  3H9W A;  1S66 L;  1QMF A;  4S2O A;  3UME A;  3ZYT A;  1LSW A;  3QP8 A;  4EBL A;  3HUN A;  2V0W A;  2Q9N A;  3HJI A;  3K3D A;  1PZO A;  3W2Z A;  1NJ4 A;  1HD8 A;  4YOF A;  4G3V A;  3CHW P;  4KZA A;  1I2S A;  5EEC A;  1T19 A;  2W0N A;  5TFQ A;  5F1G A;  4II7 A;  5CHU A;  2AVX A;  1MWS A;  4CQH A;  3MQ0 A;  5I94 A;  2V20 A;  4GD6 A;  1MPL A;  2VZW A;  3CJM A;  1FCO A;  3ITA A;  1IEM A;  3IX8 A;  1K6R A;  3LR4 A;  4Q0H A;  2OAP 1;  3P98 A;  4MN6 A;  2PT7 A;  3ISG A;  2OOL A;  2HJE A;  4WUJ A;  3VP3 A;  1TS0 A;  1GSV A;  2EFU A;  4WZ5 C;  4ID4 A;  5F82 A;  3TRC A;  4OON A;  4OH0 A;  3D9Y A;  2HP6 A;  3DW0 A;  3F1N A;  5FQJ A;  1PFL A;  3T50 A;  3ZG7 B;  3ZG0 A;  3U2A A;  3BYD A;  3VFF A;  5AQB A;  4MBF A;  4IBR A;  1ESI A;  3NOU C;  5CGS A;  1OTE A;  3SS5 A;  4F3L B;  5FI2 A;  3ITB A;  4Y0T A;  3FZC A;  5HWV A;  3IH8 A;  5KZH A;  1J3W A;  3CLO A;  1GHM A;  3Q82 A;  1JWP A;  3RFB A;  3W4O A;  3UB9 A;  1LI0 A;  4OP5 A;  1BSG A;  2K2N A;  1VEU B;  3TW8 A;  3RH8 B;  1NLY A;  1P9R A;  3ZNT A;  1NRJ A;  3PAE A;  3MF0 A;  4P6B A;  4HBT A;  4BBT A;  2RL3 A;  1BLH A;  4Q0I A;  4QD4 A;  1PWG A;  3KYE A;  4JGO A;  2FZ0 A;  3A3I A;  4JGP A;  3BQA A;  1MWU A;  1LLB A;  1TEM A;  4MMN A;  5HSQ A;  3EEH A;  3EQV A;  4OLG A;  3G2Y A;  5EVI B;  3WS0 A;  4Y0O A;  3LY3 A;  3G32 A;  2DNS A;  3S7O A;  1PNE A;  2WKI A;  2ZM0 A;  1E3U D;  4WYY A;  2P04 A;  4B88 A;  1YLZ A;  5DVA A;  1EI5 A;  2OWH A;  2WZZ A;  1W8Y A;  1Y28 A;  5TBM B;  3ZVT A;  3UE3 A;  5DJU A;  1DP6 A;  4DE3 A;  5DKK A;  1TF1 A;  4HH3 A;  2Y59 A;  2C5W B;  1CEF A;  1MZU A;  2D02 A;  3C4P A;  4EUZ A;  2GDN A;  3U4L P;  3V39 A;  4IVK A;  2UV0 E;  1MWR A;  4N92 A;  1VB6 A;  5J7E A;  1UGU A;  4JLF A;  3V3R A;  1ESU A;  4KZ7 A;  4H6J B;  4JF4 A;  1CI9 A;  1YLW A;  1CEG A;  4JGR A;  4C6Y A;  4Y2F A;  4EEU A;  3KSI A;  2JKT M;  4U0X A;  3CIT A;  3PXP A;  1P9W A;  1QME A;  3HLF A;  4UA6 A;  3QNC A;  2ZL1 B; 
#chains in the Genus database with same CATH homology
 5C5K A;  5HDS A;  4L9G A;  2YKF A;  2JKR I;  4I3I A;  2W1T A;  2XA7 S;  3P7N A;  2JKR M;  4Y3I A;  2QHK A;  1LT0 A;  2JN7 A;  4I39 A;  2W3F A;  4E04 A;  4IJG A;  4OOL A;  4PKY G;  1VHM A;  2O9C A;  1XFQ A;  3EQU A;  2L4R A;  3H7W B;  3KO6 A;  3C2W A;  1WA9 A;  2VGL M;  4WEK A;  4WL9 A;  1OTB A;  3CUE A;  4HIA A;  4I38 A;  3V67 A;  3KSG A;  4MN7 A;  2M7U A;  3IS2 A;  2L0W A;  1GSW A;  2VKS A;  3LIE A;  5IU1 A;  2ZOH A;  3E0Y A;  4MCW A;  3E98 A;  4DN0 A;  2DMW A;  2OWJ A;  1W63 Q;  2VV6 A;  4NXF A;  3UB6 A;  4EUV A;  1OJ5 A;  2PHY A;  3LI8 A;  5A8B A;  3MXQ A;  4ME4 A;  1OPX A;  3CAX A;  5J4E A;  2K7S A;  4P6Z M;  3KSH A;  4GHI A;  2K31 A;  2QWS A;  2M1C A;  4HP4 A;  2INW A;  4BWI A;  5HL6 A;  3LR5 A;  1F98 A;  1XJ3 A;  4LRZ E;  3E4Q A;  2J3T C;  5G4Y A;  3TJZ C;  1BYW A;  1F9I A;  2B02 A;  3IBJ A;  1TD5 A;  4HY8 A;  4FOF A;  2VV8 A;  5K5B A;  2WKQ A;  2LB5 A;  2PR5 A;  5EFW A;  3GDI A;  5HD5 A;  1N9L A;  2A2L A;  2Y79 A;  3LIC A;  1G28 A;  4GS9 B;  3CUE C;  4EXO A;  4OOM A;  3ZQ5 A;  1YSQ A;  4NXG A;  2GNX A;  5I5L A;  3S7Q A;  3D3O A;  3T4S A;  3LIB A;  1W63 M;  2W27 A;  4LRY C;  3OC2 A;  3KYQ A;  4M4X A;  2A24 A;  1T1A A;  1S4R A;  2MJ6 A;  2J3T D;  4MN5 A;  2Z6D A;  1UWN X;  3T4K A;  5IS1 A;  4L0L A;  3G6O A;  4LLO B;  2B18 A;  2NUT C;  2LB9 A;  3T4L A;  4DJ2 A;  2PD7 A;  4EW7 A;  4DJ3 A;  5HWW A;  5HWT A;  3VOL A;  2W1T B;  5F68 A;  4B93 A;  4Q0J A;  2ZOI A;  3FPV A;  4HH2 A;  1NLZ A;  3NOT C;  3GEC A;  4GCZ A;  1T1C A;  4MDZ A;  5F5Y A;  2V0U A;  4KQO A;  3EGX C;  3ICY A;  1ZTU A;  2VV7 A;  3KSF A;  4BJP A;  3LFV A;  3NOP C;  5HPF A;  2JKT I;  3PYP A;  4HNB A;  5TJJ A;  2XA7 M;  5DFX A;  1XJ2 A;  1XJ4 A;  5IT5 A;  2HV1 A;  3B42 A;  2QKP A;  5HPI A;  3F1O B;  5HDC A;  2HF6 A;  3RTY A;  2O0Y A;  3D72 A;  3MQQ A;  5CX7 A;  1D7E A;  5AVE A;  3IS2 B;  3LR3 A;  1EW0 A;  2I9V A;  5F69 A;  2W3E A;  4HJ6 A;  4KUK A;  3VV4 A;  5L8M A;  3KX0 X;  2KOI A;  2R78 A;  3EEA A;  1OTA A;  3PHY A;  1STZ A;  4EES A;  4ZRR A;  2VX8 A;  2H28 A;  2O9A A;  3BWL A;  4GHI B;  2OAQ 1;  1MKM A;  4QPR A;  3BQ8 A;  2EA9 A;  2VEA A;  2NUP C;  4WN5 A;  4ARZ B;  2IA2 A;  4PHT A;  3T4T A;  2ZBB A;  1T1B A;  2L1M A;  2VJW A;  3K3C A;  3F1O A;  4O8G A;  3NJA A;  4NXB A;  3HCY A;  4G3W A;  1D06 A;  5J3W A;  4EET B;  1UWP X;  1YSP A;  2V9A A;  4IUH A;  2W1R A;  5G4Z A;  2V1A A;  1ODV A;  3H82 B;  3CI6 A;  2A24 B;  4NKP A;  1S1Z A;  1MC0 A;  2PDR A;  4K08 A;  2PYP A;  1X0O A;  3S7N A;  4ARZ A;  2KX6 A;  3LIA A;  4O0P A;  2EWW A;  4F3L A;  3LI9 A;  4JGQ A;  4I5S A;  2W3H A;  3KYZ A;  3P01 A;  3T4Q A;  4BBV A;  2M7V A;  3CWF A;  3UB8 A;  1DRM A;  2HGV A;  1IOU A;  1DP8 A;  4IHQ A;  2Y8H A;  4EEP A;  3H9W A;  4UQI S;  1S66 L;  4R70 A;  1TS8 A;  3DBA A;  1H8M A;  3UME A;  3ZYT A;  5MC7 A;  1LSW A;  4AFI A;  2GX5 A;  3JVV A;  4I3A A;  2ZMV A;  2V0W A;  3HJI A;  3NHQ A;  3K3D A;  3H82 A;  2QYB A;  2GZA A;  3W2Z A;  4YOF A;  4G3V A;  1T19 A;  2W0N A;  2KDK A;  4RQ9 A;  4II7 A;  3A0V A;  3LUQ A;  3MQO A;  4GJ4 A;  4CQH A;  4IUK A;  3MQ0 A;  3BY9 A;  1H3Q A;  2CMN A;  3C30 A;  1V9Y A;  2WKP A;  3UE6 A;  3PBS A;  3T4O A;  3E4P A;  5AJG A;  3F1N B;  2VZW A;  4O01 A;  1KOU A;  1NWZ A;  5DKL A;  4WLA A;  2V1B A;  3LR4 A;  4Q0H A;  2XRO A;  1DP9 A;  2OAP 1;  4MN6 A;  4CLC D;  2PT7 A;  1OT6 A;  2OOL A;  2HJE A;  4R6L A;  1S1Y A;  4WUJ A;  2ZMF A;  3UB7 A;  3JVU A;  1TS0 A;  3MMH A;  1GSV A;  4HJ4 A;  4BBU A;  3IBR A;  2P08 A;  1P97 A;  1S67 L;  2PYR A;  3E4O A;  3LID A;  4BMW A;  3TRC A;  5DFY A;  2W3D A;  3OOV A;  1OTI A;  4YNR A;  4I3J A;  5TBM A;  5HZH A;  1TS7 A;  1ZHH B;  4YWZ A;  3F1N A;  3T50 A;  2VA0 A;  2J80 A;  3OCN A;  3U2A A;  2WKR A;  4HI4 A;  3S7P A;  5HDD A;  3BW6 A;  4LPZ A;  3NOU C;  1OTE A;  4F3L B;  1OT9 A;  3MJQ A;  2VLG A;  4Y5F A;  1N9O A;  5HD3 A;  4HQA A;  3VE3 A;  3EOI A;  4L9F A;  5HWV A;  2YKH A;  3HJK A;  4H6J A;  3TE8 A;  3CLO A;  1XJ6 A;  3RFB A;  1S4S A;  4NXE A;  3UB9 A;  3O5Y A;  4WEJ A;  4HJ3 A;  4XT2 A;  4CLC A;  4EU0 A;  2W3G A;  3R7W A;  1N9N A;  3MR0 A;  1YAX A;  3K2N A;  2K2N A;  2BAS A;  2Z6C A;  3TW8 A;  3RH8 B;  1NLY A;  3OBF A;  3F1P A;  3PBQ A;  4FSF A;  2HJ9 C;  1P9R A;  1NRJ A;  3MF0 A;  5FL3 A;  1TS6 A;  4BBT A;  3VE4 A;  4UQI M;  4Q0I A;  3PBT A;  1P0Z A;  1IFQ A;  1OTD A;  3PBO A;  2VGL S;  4JGO A;  1YKD A;  5KSH A;  3A0S A;  3FC7 A;  3PBR A;  2FZ0 A;  2P7J A;  4JGP A;  3BQA A;  2O99 A;  2PD8 A;  2QJ5 A;  3OCL A;  5LBR A;  4MMN A;  5HSQ A;  2GJ3 A;  3EEH A;  3EQV A;  2FH5 A;  1LSV A;  3H7W A;  3ULF A;  3FPW A;  4L9E A;  3SW1 A;  1LSX A;  2G7U A;  1OJG A;  2QJ7 A;  4P6Z S;  4CLC C;  3BJN A;  2JHE A;  3UMD A;  4WF0 A;  4ETX A;  4KQD A;  3PR6 A;  5AVF A;  3S7O A;  5DF9 A;  1T18 A;  1LL8 A;  2P04 A;  1GSX A;  3OLO A;  3EWK A;  2OWH A;  4PAU A;  2J3W A;  3C38 A;  4G3K A;  1Y28 A;  4NEE D;  5TBM B;  3UE3 A;  3MFX A;  3R4K A;  5DJU A;  1DP6 A;  2EWV A;  3FG8 A;  5DKK A;  1G6O A;  1TF1 A;  2XSS A;  1JNU A;  4HH3 A;  3LR0 A;  1V9Z A;  3B33 A;  1MZU A;  4DMZ A;  2D02 A;  4R38 A;  4PKY A;  4CLC E;  1XFN A;  3BY8 A;  3PBN A;  4UEY A;  3LIF A;  3LYX A;  1VB6 A;  5J7E A;  1UGU A;  1F5M A;  3B47 A;  3EGD C;  4R3A A;  5DJT A;  4EQ1 A;  5KIZ A;  4LRX C;  3C8C A;  4Z1W A;  4GW9 A;  4EER A;  5F6A A;  4H6J B;  4HOI A;  4B9O A;  4HHD A;  4GLQ A;  2PR6 A;  4GS9 A;  4JGR A;  4Y2F A;  4EEU A;  2D01 A;  4XT2 B;  4CLC B;  3T4J A;  3A0R A;  3KSI A;  2JKT M;  3R7W B;  3CIT A;  3PXP A;  4KUO A;  1P9W A;  4WEL A;  3F1P B;  2O9B A;  2KLI A;  4HP9 A;  4ETZ A;  2XRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...