2PHYA

Photoactive yellow protein, dark state (unbleached)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title 1.4 A structure of photoactive yellow protein, a cytosolic photoreceptor: unusual fold, active site, and chromophore.
pubmed doi rcsb
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2phyA00
3IBRA 5G4ZA 1Y28A 4WUJA 1DRMA 3H7WA 3LIFA 2VV7A 3GDIA 5HWTA 3VE4A 4I3JA 1LT0A 2YKFA 1G28A 4L9FA 5F5YA 3H7WB 2J80A 1DP8A 2H28A 3H82B 5F69A 4M4XA 3LYXA 4LRYC 1D06A 3IS2A 3OLOA 5KIZA 2A24A 5J4EA 2PD8A 5EFWA 3LIAA 3PYPA 3CWFA 3A0VA 2ZOIA 4F3LA 2PD7A 1EW0A 1XJ4A 4R38A 2Z6CA 1DP6A 2WKRA 3MFXA 1OJ5A 3K3CA 1TS6A 2A24B 4MN5A 4I39A 4GS9A 4F3LB 3MR0A 4HOIA 3CAXA 4LPZA 1OTBA 3A0RA 2D01A 3UB6A 4GS9B 5AVFA 3E4OA 3UB7A 1N9OA 2OOLA 1XFNA 2Z6DA 4DJ3A 4I3IA 1V9ZA 4DJ2A 4EW7A 4GHIA 1X0OA 1LSWA 3B33A 3ICYA 4JGPA 5J7EA 1LSXA 1OT6A 2L0WA 4BBVA 4GHIB 1KOUA 1OTDA 5HDCA 4JGQA 4H6JA 3UE6A 4I38A 4NXEA 2PDRA 2OWHA 5HWVA 4H6JB 4I3AA 5A8BA 5DJUA 5J3WA 2V0WA 2V1AA 2GJ3A 1S1YA 1ODVA 4HNBA 1P97A 4PKYG 1S4SA 2QJ5A 2V1BA 3LIBA 3KX0X 1XJ2A 4NXGA 1OTEA 3UMEA 5HD3A 2OWJA 3MJQA 2WKQA 4EEPA 4EESA 3E4PA 3BY9A 3A0SA 3D72A 5IS1A 5HDDA 3UB8A 3VOLA 3MXQA 4WF0A 2VEAA 4KUOA 2D02A 4L9EA 3LI9A 2INWA 4EEUA 2M1CA 1DP9A 1T18A 2L4RA 1TS0A 3LUQA 1OTIA 5HZHA 4KUKA 2VV8A 2PYRA 2YKHA 3LIDA 3BY8A 3IS2B 1OTAA 4PKYA 3RH8B 3LICA 4RQ9A 4HH3A 1P0ZA 3NOUC 4WLAA 4HIAA 4R3AA 4I5SA 3F1PA 5DJTA 3FC7A 3K3DA 3HJIA 5HWWA 3UB9A 4KQDA 3VE3A 3F1PB 1TS7A 1S66L 1NWZA 4K08A 5HD5A 1GSXA 2WKPA 4GCZA 2ZBBA 4JGRA 3G6OA 2PR5A 1LL8A 1T1AA 4EXOA 3MQOA 1S67L 5HDSA 3FG8A 5IU1A 2PHYA 2ZOHA 1D7EA 4L9GA 2QHKA 2B02A 3F1NA 2P7JA 4NXFA 3RTYA 2I9VA 3P7NA 3EEHA 4LLOB 1UWPX 3LIEA 2L1MA 1N9NA 1T19A 5HSQA 4WN5A 3NOPC 1MZUA 1TS8A 3ZQ5A 4BBTA 2R78A 5I5LA 3E4QA 1F98A 2HV1A 2PR6A 2V9AA 1UGUA 5F6AA 4HJ3A 3H82A 4EERA 4LRXC 2V0UA 4HP9A 2EA9A 3LI8A 5TBMA 1UWNX 2KX6A 4HH2A 4XT2A 1GSWA 1XJ3A 3BWLA 4NXBA 4R6LA 5TBMB 3F1OA 4YWZA 1T1BA 3EWKA 2W0NA 4XT2B 2CMNA 2W27A 3NOTC 3F1OB 3NHQA 1XJ6A 4R70A 3CLOA 3NJAA 2JN7A 3PHYA 2KDKA 2VV6A 4MN6A 2QKPA 2QWSA 2QJ7A 1S1ZA 4EETB 2VLGA 1JNUA 1WA9A 3T50A 3HJKA 1V9YA 4BBUA 1BYWA 1VB6A 3C8CA 1OT9A 5DKLA 4HQAA 4GW9A 5DKKA 1OJGA 3C2WA 3ULFA 4WL9A 5F68A 2K7SA 3H9WA 2JHEA 4HY8A 1LSVA 4E04A 4HP4A 4EQ1A 3F1NB 4HHDA 4JGOA 5G4YA 2BASA 1GSVA 1S4RA 3MQQA 4B9OA 3UMDA 1N9LA 4LRZE 3SW1A 5AVEA 2PYPA 1T1CA 1F9IA 4HJ4A 1XFQA 4HI4A 4HJ6A 3GECA
chains in the Genus database with same CATH superfamily
2VJWA 4LENA 3E0YA 3KYZA 3T4OA 3CITA 3D9YA 3KYEA 1PW1A 2XSSA 1BULA 1K4FA 1G28A 4L9FA 4G3WA 2QZ6A 3NBLA 1DP8A 3Q7VB 1LL9A 2EFXA 3S7OA 4M4XA 2WKIA 4Y7PA 3Q82A 5HX9A 1LL5A 1XXMA 2JKRI 5FI2A 2UWXA 3SH7A 2PD8A 5EFWA 4RA7A 4KQQA 1MKMA 1YLWA 2ZOIA 1EW0A 1XJ4A 5CEDA 3OZHA 4MMNA 1DP6A 2R9XA 3MFXA 3V67A 4U0TA 3BFFA 3G35A 1YSPA 4RYEA 2WGWB 2Z2MB 4F3LB 3LY4A 1U60A 3N4IA 4QU3A 5E43A 4F94A 3CAXA 2WKHA 3DW0A 4JXSA 3NI9A 1OTBA 3A0RA 2D01A 2GX5A 3BLMA 3UPNA 3HCYA 5CRFA 3EEAA 5GL9A 3V3SA 2W1RA 1K54C 5LBRA 3PR6A 4EWFA 1G68A 4Q8IA 3NCKA 1V9ZA 5DTKA 1LLBA 2H10A 1PFLA 4GHIA 4Y13A 3N6IA 4LV0A 3ICYA 2W3DA 4DF6A 4KZBA 4IUKA 5EE8A 4BBVA 3VFFA 4EBNA 5HDCA 1OTDA 4DE2A 3T4TA 4KZ5A 5DVAA 5FQMA 3IH8A 3M2JA 3VMAA 2PDRA 4UQIS 1BTLA 4S2PA 5HWVA 4ZBEA 3RFBA 1FCMA 4JF5A 4I3AA 5A8BA 4PM7A 3GRJA 3PBTA 3HLCA 3MQ0A 2XA7S 2V0WA 1LI0A 3A3IA 2X71A 5CHJA 4C6YA 5F83A 3IBJA 2GJ3A 1P97A 4S2LA 4PKYG 4U0XA 1VEUA 4ZJ2A 2Y2OA 3UDIA 3KX0X 3IXDA 1VETB 5HD3A 5IHVA 3KO6A 4S2OA 2OWJA 5FA7A 2IWCA 4EESA 3BY9A 5TR7A 4PM6A 3A0SA 3JPUA 5HDDA 3UB8A 3VOLA 5FDSA 2HJ9C 2D02A 5CTMA 4L9EA 1GHMA 1YMSA 1E4DA 3GR2A 2XEPA 1PRQA 3GVBA 3WWXA 1NLZA 4KUKA 5HZHA 3IH9A 3R4KA 4FCFA 3WS4A 3SS4A 2JBFA 3BY8A 5GHZA 4PKYA 5HFOA 3WS2A 4IJGA 4HH3A 1TD5A 3MBZA 1MBLA 4HIAA 3F1PA 4WELA 5DJTA 3FC7A 3HLBA 3K3DA 3OOVA 3HJIA 2EXAA 4JPMA 2QYBA 4BQMA 3HVFA 3DTMA 3BFGA 1S66L 4MBHA 3CUEA 5HD5A 5GHXA 1JWVA 1ONGA 1IELA 1L0EA 2XRNA 2Q9NA 1T1AA 4ZAMA 4FSFA 5TFQA 3ZG7B 3ZHHA 4HBTA 1S67L 4PPRA 5IU1A 2IWDA 3GTCA 1FQGA 1H3QA 3KSHA 2PHYA 3ZVTA 1D7EA 5AQ9A 1IYOA 3QNBA 3MXRA 1BZAA 2B02A 2B95A 2XD1A 5HAPA 4DDYA 2G2UA 2I9VA 3BFCA 3P7NA 1FR6A 4KZ6A 5EPHA 1IOUA 3SZTA 1XA7A 3G4PA 4PAUA 2VZWA 4P6ZM 3KSIA 1KE4A 4BD1A 4Q0JA 5HSQA 5AQBA 4WN5A 1MZUA 1MWUA 3C7UA 3WS1A 4BBTA 2R78A 4PM8A 3HLGA 4CLCB 2Y91A 1J3WA 1CI8A 2HV1A 2JKFA 5F6AA 1RP5A 4OOYA 4ETXA 4LRXC 2J3TC 5D3OA 1FILA 4HEFA 4JXVA 1YLYA 4K0XA 2A2LA 5CECA 4IVKA 3JVUA 1ERMA 3ZG0A 2WK0A 3QP1A 3N7WA 2G2WA 3GSGA 1H5XA 3CPTA 5EOEA 2W0NA 4E3LA 3UDFA 3VSKA 2CMNA 4BMWA 3KSGA 5U47A 3NHQA 2P74A 4PMAA 3VP0A 5FAQA 4WMCA 4C3QA 1BT5A 3VP2A 1XGJA 5HAIA 5EECA 4PM9A 3PHYA 4BENA 2QKPA 2RCXA 4IVIA 2QWSA 2PU2A 3W4PA 1WA9A 3T50A 1Y54A 1NZOA 3DBAA 2XF3A 1KDWA 2K2NA 1YKDA 3OPHA 1OT9A 4WBGA 3GV9A 2XFSA 3HL9A 3PBOA 3ULFA 4II7A 5CGSA 2K7SA 4JXWA 2W1TA 3T4LA 4OPYA 4S2IA 2WUQA 3C38A 1IFQA 4OQIA 2OLVA 4CPKA 5EVIA 2ZQ9A 5CEBA 1SKOA 2OLUA 1BLCA 1G5UA 1MWSA 5G4YA 3G32A 3UE3A 1I2SA 4N92A 4O8GA 1P9WA 4LRZE 3SW1A 3UE1A 2PYPA 1F9IA 1KGEA 4HJ4A 3CI6A 3QP2A 4R3JA 1QMFA 3TRCA 1Z09A 2OAP1 3K2NA 2ZQ8A 4WUJA 1DRMA 4E3JA 1SZVA 3SOIA 3LGOA 4DE0A 2Q0OA 2VV7A 5FEGA 5MC7A 1PI5A 2WZXA 3SH8A 5FASA 3NULA 2H0TA 1A0KA 1OPXA 2H28A 4PHTA 5CHUA 5A90A 5F69A 3C5AA 4CJNA 4CQHA 1D06A 5KSHA 3IS2A 3ISGA 1GA0A 5J4EA 1C3BA 4LV2A 2QPNA 1K57C 4MLLA 3CWFA 3QHYA 3A0VA 1PYYA 4F3LA 3CPTB 1O7EA 4R38A 1MWRA 4FH4A 2Y4AA 2WKRA 1OJ5A 3K3CA 1TS6A 2A24B 4JLFA 3ZYTA 5JYOA 4I39A 3VP1A 1K38A 4ID4A 3MR0A 2BG1A 1FSWA 4HOIA 5GLCA 3G34A 4G3KA 3BFDA 5L07A 4LPZA 1DJBA 3UB7A 1IYPA 1XFNA 4O7DA 2Z6DA 1CEGA 2JE5A 4GD6A 5FQ9A 4I3IA 1G6OA 1ONHA 1H8MA 1JTDA 3TE8A 3HBRA 5TJJA 3S22A 2O9BA 1FIKA 1NXYA 2ZLYA 2Y79A 1ZHHB 4E3KA 3CZDA 1ES4A 2L0WA 5CHMA 1YT4A 1P9RA 3TG9A 4KZ3A 3BYDA 1JTGA 3G31A 4X56A 1PIOA 4NXEA 2OWHA 2WADA 5FQQA 4MEZA 1SKOB 1K6SA 3M6BA 4H6JB 4Y2FA 5DJUA 1Z6FA 1VQQA 1CEFA 2EXBA 1L0GA 3IX4A 1VETA 1ODVA 3BQ8A 2HDUA 2JCHA 4IBRA 3MSHA 1S4SA 2QJ5A 3IQAA 4X25A 1JWZA 3OCNA 3U4LP 1BUEA 3UMEA 2HF6A 2J9OA 5EV0A 2WKQA 1VM1A 1KE3A 3MXQA 3PBSA 1PWDA 2V1ZA 2VEAA 4KUOA 4OLGA 2H5SA 2HP5A 5HAQA 2J7VA 3ITBA 2KOIA 4JF6A 4R0QA 4Z9QA 2ZQAA 3LEQA 1OTIA 2PYRA 2YKHA 3IS2B 4EUVA 1PZOA 3MFDA 1YLJA 1PNEA 3LICA 2VX8A 1P0ZA 3A3FA 1PZPA 2NUTC 3T1QB 2XD5A 2P9VA 2Y2MA 3FPWA 3S1YA 2GNXA 3FV7A 1L0FA 1NRFA 5DFYA 5HW3A 4KQDA 3VE3A 1H8ZA 1TS7A 2C6WB 4OH0A 2I72A 1GCEA 3UPOA 5KMWA 4JGRA 3G6OA 4WYYA 2PR5A 4ETZA 1HD8A 4X69A 1WYBA 3S7PA 1K56A 3MQOA 4YOFA 3CG5A 5HDSA 3HLFA 4KZ8A 2FFYA 2ZOHA 2X01A 2H0YA 4NXFA 1GHPA 4QJGA 4KQRA 4DN0A 5HL6A 3LIEA 4BL2A 3W8KA 3TSGA 3QP6A 3GQZA 3SS3A 1SDNA 1T19A 3P98A 1CJFA 1W7FA 3T4JA 5EM1A 4CLCA 4R1GA 2ZL1A 3PBRA 2OV5A 4OOLA 1Q2PA 4IUHA 2Y8HA 2P04A 5I5LA 4GKUA 1ZG4A 5FSRA 2ZC3B 2IA2A 4KZ7A 2LB9A 1E25A 1RGZA 2V9AA 1UGUA 2ZM2A 1IKGA 4AFIA 3IX3A 3H82A 5CTNA 5JYPA 4FUWA 2V0UA 3DWZA 2E8JA 3PXPA 3NECA 4ARZB 3BLSA 2EFUA 1GSWA 3BQAA 5FI6A 1KGFA 1K55A 4Y17A 3G2YA 5TBMB 4YWZA 3MXSA 4DMZA 1MY8A 3LR4A 4XT2B 4KZ9A 2XQZA 4XUZA 2Y2HA 3NOTC 4P6ZS 2HGVA 4JF4A 5CERA 2PT7A 4K0WA 3OCLA 4DXCA 4WEKA 1L3LA 2P9VB 3NJAA 2JN7A 3ZG5A 2P08A 3M6HA 4UQIM 2KDKA 2VGLM 1FCNA 2QJ7A 3IT9A 4BD0A 2VLGA 3L9KA 1XX2A 2XA7M 1YAXA 3BFEA 1TDLA 4Y15A 3NY4A 4MN7A 3HJKA 4KZ4A 2FFFB 1VB6A 1S0WA 2V2FF 3C8CA 5DKLA 3T4QA 4KENB 4OKPA 1PWGA 5DKKA 3E98A 1NYMA 3C2WA 4Y0OA 4DXBA 1CI9A 4OP8A 5F68A 4QHCA 3T1RA 1HZOA 1KDSA 1LSVA 3PBQA 3O5YA 2VKSA 4HP4A 4YINA 4EQ1A 1JVJA 4EUZA 2X02A 5GHYA 3IHAA 1W63M 1YMXA 1ZC2A 4KQOA 4CLCC 4OLDA 4ZDXA 2Y2PA 2XR0A 4FD8A 4Y3IA 4X1LA 1E3UA 3UMDA 2VA0A 2DMWA 3JVVA 3MF0A 1DJCA 3EOIA 1T1CA 2CC1A 1XFQA 4GNUA 4HI4A 4HJ6A 5F1FA 3P09A 2PBDP 2ZL1B 3GECA 4UA6A 3IBRA 2Y2GA 1OMEA 3CJMA 4OVDA 2MJ6A 3GDIA 5HWTA 2Q9MA 4QPRA 5FI7A 4UAAA 3HLWA 3R7WB 2O99A 1K55C 3H7WB 1W8QA 4WMCD 3H82B 2WZZA 3DAVA 3SS5A 3RJUA 3EQUA 3NDEA 3LYXA 2DRWA 1MWTA 5F82A 3OLOA 4EV4A 2VK3A 1N9BA 2FZ0A 2A24A 2B5RA 4B4ZA 3U2AA 3LIAA 3PYPA 3Q7ZA 4GDNA 1K57A 1RCJA 3ZCZA 2Z6CA 4S2MA 4GLQA 3BECA 4MN5A 3ZGAB 1H8YA 1QMEA 2HP9A 3DTIA 4GN2A 3CMZA 3OPRA 3UN7A 2FH5A 3FZCA 3QP4A 2IWBA 3UNWA 4GS9B 2W3GA 1GA9A 5HPIA 2OOLA 5EVID 3IF5A 5DFXA 4P87A 3E2KA 2J3WA 3TJZC 2W3EA 4EW7A 4QY5A 2Y2LA 4JBFA 1X0OA 3PAEA 3B33A 3DTEA 3HREA 1K6RA 4KG6A 4OQGA 3O87A 1CQAA 3ZG8B 3LR0A 5E2EA 3ZVWA 2A49A 1KOUA 4CLCE 4JGQA 4H6JA 4OONA 5E2HA 4ME4A 1MXOA 3UE6A 4I38A 2WGIA 4U3TA 1HLUP 1SCWA 2ZQCA 3D4FA 3C30A 5FQKA 5J3WA 1I2WA 4E3OA 3S7QA 1BLSA 2V1AA 5A92A 1S1YA 5FATA 3WS0A 1EI5A 4HNBA 3T12B 1XP4A 3HUNA 2PAVP 2VGKA 2V1BA 3W2ZA 2JKTM 2C5WB 1XJ2A 3LO7A 3NIAA 1ESUA 4MCWA 4LCLA 2XK1A 2ZC6B 3MJQA 2WYXA 3E4PA 2B18A 4FTXA 5FDHA 1NY0A 3D72A 4NKPA 4LCMA 4WM9A 4ZRRA 2KLIA 4WF0A 4GD8A 4EEUA 4IBXA 5EM0A 5KSCA 3V50A 5L09A 4DDSA 1T18A 2L4RA 4P6BA 1TS0A 3WRZA 4DE1A 4OPRA 2DNSA 3N8RA 4QWOA 1OTAA 3S7NA 5E2FA 5A91A 1YLPA 3RH8B 2VGJA 2E8IA 5DF9A 3PAGA 4N1HA 4OP5A 4ZTKA 3NOUC 4OQ0A 4WLAA 4R3AA 4R3BA 5DTSA 2XLNA 3EGDC 5CGXA 2EX2A 4NEED 1G6AA 5HWWA 1W5DA 2PU4A 1GHIA 5EUAA 1L2SA 1NWZA 2A3UA 1JWPA 2HDRA 3MZEA 2M7VA 4RVAA 1ZTUA 2V8FA 3W4OA 2XGNA 2WGVA 3HUOA 3A3DA 1H0MA 3G2ZA 4MDZA 4EXOA 1STZA 1XPBA 3FG8A 4KG2A 4R4RA 3IF6A 3Q1FA 3FWLA 2ZQDA 4L9GA 2QHKA 3F1NA 3VP4A 3RTYA 3O88A 1VHMA 5HPFA 2ZD8A 4OPQA 3EEHA 4B88A 5F1GA 2O9CA 1KE0A 5AQAA 1DY6A 5IT5A 3DTKA 1KVLA 3NOPC 1YLTA 4DRTA 1TS8A 2DCFA 3ZQ5A 1BLHA 3IHBA 3T4SA 3E4QA 4EBLA 3LY3A 2OAQ1 1MC0A 3NC8A 2J9PA 4ARZA 3O86A 4EERA 1D1JA 5I94A 5TBMA 5A93A 3L7HA 5L8MA 3MS6A 4OQHA 4WZ5C 4HH2A 4XT2A 1IYQA 4E3IA 3HLDA 4R6LA 3BM6A 4ZJ1A 4N9KA 3D3OA 1T1BA 2WAFA 1TVFA 4UEYA 1DJAA 4YFMA 1FOFA 2W27A 3LCEA 4DKIA 1FR1A 3F1OB 1LHYA 1BLPA 1K56D 4R70A 2JKRM 3TOIA 1WYCA 1M40A 2VV6A 5G18A 4JXGA 1S1ZA 2ZMVA 4EETB 1W63Q 1L0DA 2AVXA 1JNUA 3QP8A 5M18A 4EQIA 3C7VA 3B42A 1K25A 4BLMA 2K31A 1XGIA 5C5KA 4ESPA 5GLDA 3QP5A 3I7JA 1V9YA 4BBUA 1F5MA 1BYWA 5FQJA 4GW9A 4K91A 2QMIA 3IF6C 1OJGA 3WRTA 4LV3A 4WL9A 3PBNA 4CLCD 3ZNTA 2PRFA 3OBFA 3LFVA 3BW6A 3PTEA 1HVBA 3AGEA 4P85A 2EX9A 4E04A 3C4OA 3V5MA 3LR3A 3IF6B 1NLYA 4Y0UA 4A5RA 5HARA 3BJNA 3MMHA 3F1NB 1ES2A 2NUPC 1Q2QA 2BASA 1HTZA 3UO9A 3EGXC 1S4RA 3MQQA 3Q81A 4S2JA 4Q0HA 2J3TD 2Y2NA 5AVEA 2VGLS 4R4SA 4UA9A 1Y4OA 2HPBA 4IEDA 4N1XA 2ZMAA 1RGYA 5G4ZA 3R7WA 1Y28A 2ACGA 3H7WA 1BSGA 3LIFA 5GLBA 5BOHA 2XH9A 3BEBA 4NK3A 1IYSA 3AGDA 3VE4A 4I3JA 4D2OA 4MNRA 1LT0A 1KGGA 2YKFA 5F5YA 2J80A 1XA1A 3W4QA 1YQSA 1SKFA 5L10A 2O0YA 4XUXA 2BTFP 5DF8A 4QB8A 4E6WA 3IWQA 4BWIA 4LRYC 1CK3A 5KIZA 4KG5A 3OC2A 1YPRA 3NDGA 4LV1A 2M7UA 2PD7A 3LR5A 4X53A 4PM5A 1NZUA 4O0PA 2J8YA 4GS9A 1S6RA 1NYYA 2HJEA 3VP3A 1TF1A 5AQ7A 2ZMFA 3UPPA 3UB6A 3UDXA 5AVFA 3E4OA 5GLAA 1N9OA 4X1MA 4DJ3A 4NG2A 1MPLA 1W8YA 2EWVA 3IWIA 5J8XA 5DTTA 4GB7A 4DJ2A 1E3UD 1LSWA 2EX8A 5AJGA 3RXWA 4JGPA 4Y0TA 5J7EA 5FAPA 2Y59A 1LSXA 1ES3A 1OT6A 4GHIB 2Y55A 2HDSA 4DE3A 1KVMA 4WEJA 5M1AA 4S2NA 4Y5FA 3OPPA 5FAOA 3T1XA 4X6TA 3T1SA 2XDMA 2GDNA 1LI9A 4BL3A 5K5BA 3SH9A 3M2KA 3N8LA 4Z1WA 4GZBA 1ES5A 3LIBA 4MBKA 5TGFA 3IWOA 5EVEA 3VV4A 4NXGA 3AGFA 1OTEA 3A3EA 4RX3A 2Z2LB 4GOGA 1VEUB 4EEPA 2EX6A 1NJ4A 3MZFA 5IS1A 4GDBA 2ZM8A 5HL1A 2ZM0A 1F2KA 4MBFA 3BRMA 3LI9A 1NRJA 2INWA 2M1CA 1DP9A 1FSYA 4E6XA 1EROA 3HLEA 3LUQA 2VV8A 1XKZA 4C75A 2ZC4B 1YLZA 3LIDA 4QD4A 4UA7A 2BLSA 3MKEA 4IHQA 3IXGA 4RQ9A 5CGWA 4L0LA 3V3RA 1CF0A 2HDQA 4I5SA 5DF7A 1WE4A 4S2KA 1TDGA 1PI4A 3TW8A 1TEMA 1ZG6A 1N4OA 2Y2JA 3C4PA 3P01A 3EQVA 3UB9A 3F1PB 3CUEC 3QNCA 4K08A 2HZ5A 1GSXA 1IEMA 2WKPA 2GZAA 4GCZA 2ZBBA 4B4XA 3N8SA 2G7UA 3OPLA 4XXRA 3ZDJA 1IKIA 1LL8A 1YM1A 4BJPA 3UY6A 4P0MA 1J9MA 1I5QA 1AWIA 1EWZA 2Y2QA 4OPZA 4M3KA 4EBPA 2P7JA 5EOOA 4N9LA 4LFUA 3WS5A 4S2NC 1ESIA 3IXHA 3ITAA 4LLOB 1UWPX 2XROA 1K4EA 4D60A 3V39A 2XFTA 2L1MA 2RL3A 4G3VA 4GJ4A 2JKTI 2JC7A 2UV0E 1PW8A 1ERQA 1N9NA 4B93A 5CXWA 1SDEA 4OOMA 4FH2A 4LGWA 1ACFA 3IX8A 3ZFZA 4X68A 3KSFA 3KYQA 1F98A 3VOZA 5EVLA 2PR6A 3RXXA 2V8CA 4HJ3A 4KZAA 5KZHA 4FOFA 1FCOA 3Q7VA 5FQIA 2EWWA 4JKTA 4HP9A 4ZJ3A 2EA9A 3LI8A 4YNRA 1UWNX 2KX6A 4RX2A 2WKEA 3MKFA 5CX7A 1XJ3A 4WZ5A 3FKVA 4R23A 3BWLA 4NXBA 3T4KA 4O01A 4UHUA 3F1OA 2W3HA 2ZQ7A 3Q07A 3UE0A 3EWKA 3VOYA 3B3XA 4QY6A 3E2LA 2V20A 1PWCA 4H8RA 2WGWA 2ZJ9A 3DWKA 3HUMA 1XJ6A 3CLOA 1ZKJA 2PBYA 2OSUA 3A3JA 4MN6A 5FEFA 2WAEA 3S4XA 3ZG9B 1SHVA 4E3NA 2Y2KA 3LEZA 3GMWA 2O9AA 1W79A 1O07A 4HQAA 1AXBA 4X55A 1K54A 4HESA 5FL3A 3H9WA 2ZC7A 2JHEA 5E2GA 4HY8A 3FPVA 3JYIA 2JKGA 5M19A 2W3FA 3UB5P 3FYZA 2Y2IA 5EVIC 2W1TB 4NETA 4WZ4A 3MZDA 1K0KA 2LB5A 4HHDA 4JGOA 2ZC5B 3B47A 5L2FA 3ZNYA 4HBUA 1GSVA 3FKWA 4B9OA 4EU0A 5EVIB 1N9LA 3O3VA 2R9WA 3G30A 4Q0IA 3VSLA 4E3MA 1ALQA 3IXBA 2HP6A 3CHWP 1MKIA 1YSQA 1M6KA 3VFHA
chains in the Genus database with same CATH topology
2VJWA 3IBRA 5G4ZA 3R7WA 3K2NA 1Y28A 4WUJA 1DRMA 3E0YA 3KYZA 3T4OA 3H7WA 3CITA 3LIFA 2VV7A 5MC7A 2MJ6A 3GDIA 5HWTA 3VE4A 4I3JA 4QPRA 2XSSA 3R7WB 1LT0A 2O99A 2YKFA 1G28A 4G3WA 4L9FA 3H7WB 1OPXA 5F5YA 2J80A 1DP8A 2H28A 4PHTA 3H82B 2O0YA 5F69A 3S7OA 4M4XA 3EQUA 4CQHA 4BWIA 3LYXA 4LRYC 1D06A 5KSHA 3IS2A 3OLOA 2JKRI 5KIZA 2FZ0A 2A24A 3OC2A 5J4EA 3U2AA 2PD8A 5EFWA 3LIAA 3PYPA 3CWFA 1MKMA 3A0VA 2M7UA 2ZOIA 4F3LA 2PD7A 1EW0A 1XJ4A 3LR5A 4R38A 2Z6CA 4MMNA 1DP6A 2WKRA 3MFXA 1OJ5A 3V67A 3K3CA 1TS6A 2A24B 4O0PA 4GLQA 1YSPA 3ZYTA 4MN5A 4I39A 4GS9A 4F3LB 3MR0A 4HOIA 2HJEA 4G3KA 1TF1A 3CAXA 2ZMFA 2FH5A 4LPZA 1OTBA 3A0RA 2D01A 3UB6A 2GX5A 4GS9B 5AVFA 3E4OA 3HCYA 2W3GA 3UB7A 5HPIA 1N9OA 2OOLA 1XFNA 2Z6DA 3EEAA 4DJ3A 2W1RA 5LBRA 3PR6A 2EWVA 4I3IA 5DFXA 2J3WA 1V9ZA 4DJ2A 3TJZC 1G6OA 2W3EA 4EW7A 4GHIA 1X0OA 1H8MA 1LSWA 3B33A 5AJGA 3TE8A 5TJJA 3ICYA 2O9BA 2W3DA 4JGPA 2Y79A 1ZHHB 4IUKA 5J7EA 1LSXA 1OT6A 2L0WA 3LR0A 4BBVA 4GHIB 1KOUA 1OTDA 5HDCA 3T4TA 1P9RA 4JGQA 4CLCE 4H6JA 4ME4A 3UE6A 4I38A 4NXEA 2PDRA 2OWHA 4UQIS 4WEJA 5HWVA 3RFBA 4H6JB 4I3AA 4Y5FA 5A8BA 4Y2FA 5DJUA 3C30A 3PBTA 3MQ0A 2XA7S 5J3WA 2V0WA 3S7QA 2V1AA 3IBJA 2GJ3A 1S1YA 1ODVA 4HNBA 1P97A 3BQ8A 4PKYG 1S4SA 5K5BA 2QJ5A 2V1BA 4Z1WA 3OCNA 3W2ZA 3LIBA 3KX0X 2JKTM 3VV4A 1XJ2A 4NXGA 1OTEA 3UMEA 5HD3A 3KO6A 4MCWA 2HF6A 2OWJA 3MJQA 2WKQA 4EEPA 4EESA 3E4PA 3BY9A 2B18A 3A0SA 3D72A 5IS1A 5HDDA 3UB8A 4NKPA 3MXQA 3PBSA 3VOLA 4ZRRA 2KLIA 4WF0A 2VEAA 2HJ9C 4KUOA 2D02A 4L9EA 3LI9A 1NRJA 2INWA 4EEUA 2M1CA 1DP9A 1T18A 2KOIA 2L4RA 1TS0A 3LUQA 1OTIA 1NLZA 4KUKA 5HZHA 2VV8A 3R4KA 2PYRA 2YKHA 3LIDA 3BY8A 3IS2B 1OTAA 3S7NA 4EUVA 4PKYA 3RH8B 4IHQA 3LICA 4RQ9A 4IJGA 2VX8A 1P0ZA 1TD5A 4HH3A 5DF9A 4L0LA 2NUTC 3NOUC 4WLAA 4HIAA 4R3AA 4I5SA 3FPWA 3F1PA 2GNXA 3EGDC 4WELA 5DJTA 3FC7A 3K3DA 3OOVA 3HJIA 3TW8A 5DFYA 2QYBA 4NEED 3P01A 5HWWA 3EQVA 3UB9A 4KQDA 3VE3A 3F1PB 1TS7A 3CUEC 1S66L 1NWZA 4K08A 3CUEA 2M7VA 5HD5A 1ZTUA 1GSXA 2WKPA 4GCZA 2GZAA 2ZBBA 4JGRA 3G6OA 2XRNA 2G7UA 2PR5A 4ETZA 1LL8A 1T1AA 4MDZA 4FSFA 4EXOA 4BJPA 1STZA 3S7PA 3MQOA 1S67L 4YOFA 5HDSA 3FG8A 5IU1A 1H3QA 3KSHA 2PHYA 2ZOHA 1D7EA 4L9GA 2QHKA 2B02A 3F1NA 2P7JA 4NXFA 3RTYA 2I9VA 1VHMA 3P7NA 5HPFA 3EEHA 4LLOB 1UWPX 4DN0A 2XROA 1IOUA 5HL6A 3LIEA 4PAUA 2L1MA 2O9CA 2VZWA 4G3VA 2JKTI 4GJ4A 4P6ZM 3KSIA 1N9NA 4B93A 1T19A 4Q0JA 3T4JA 5HSQA 5IT5A 4CLCA 4OOMA 4WN5A 3NOPC 3PBRA 1MZUA 1TS8A 3ZQ5A 4OOLA 4IUHA 2Y8HA 3KSFA 4BBTA 2R78A 2P04A 3KYQA 5I5LA 3T4SA 3E4QA 1F98A 4CLCB 2IA2A 2OAQ1 1MC0A 2LB9A 2HV1A 4ARZA 2PR6A 2V9AA 1UGUA 5F6AA 4AFIA 4HJ3A 4FOFA 3H82A 4ETXA 4EERA 4LRXC 2EWWA 2J3TC 2V0UA 4HP9A 2EA9A 3LI8A 5TBMA 3PXPA 4YNRA 5L8MA 1UWNX 2KX6A 4ARZB 2A2LA 5CX7A 4HH2A 4XT2A 1GSWA 3JVUA 3BQAA 1XJ3A 3BWLA 4NXBA 4R6LA 4O01A 3T4KA 3D3OA 5TBMB 3F1OA 2W3HA 1T1BA 4YWZA 3EWKA 4DMZA 2W0NA 4UEYA 3LR4A 4XT2B 2CMNA 4BMWA 2W27A 3NOTC 4P6ZS 3KSGA 2HGVA 3F1OB 2PT7A 3NHQA 1XJ6A 3OCLA 4WEKA 4R70A 2JKRM 3CLOA 3NJAA 2JN7A 2P08A 4UQIM 3PHYA 2KDKA 2VGLM 2VV6A 4MN6A 2QKPA 2QWSA 2QJ7A 1S1ZA 2ZMVA 4EETB 1W63Q 2VLGA 1JNUA 1WA9A 2XA7M 3T50A 3B42A 1YAXA 3DBAA 2K31A 4MN7A 3HJKA 5C5KA 2K2NA 2O9AA 1V9YA 4BBUA 1F5MA 1YKDA 1BYWA 1VB6A 3C8CA 1OT9A 5DKLA 3T4QA 4HQAA 4GW9A 5DKKA 3E98A 1OJGA 3C2WA 3PBOA 3ULFA 4II7A 5FL3A 4WL9A 5F68A 2K7SA 2W1TA 3H9WA 3PBNA 3T4LA 4CLCD 2JHEA 4HY8A 3FPVA 3C38A 3OBFA 3LFVA 2W3FA 1IFQA 3BW6A 1LSVA 4E04A 3PBQA 3LR3A 3O5YA 1NLYA 2VKSA 3BJNA 3MMHA 2W1TB 4HP4A 4EQ1A 2LB5A 3F1NB 4HHDA 1W63M 4JGOA 2NUPC 4KQOA 3B47A 5G4YA 2BASA 3UE3A 1GSVA 3EGXC 4CLCC 1S4RA 3MQQA 4B9OA 4EU0A 4Y3IA 4O8GA 3UMDA 4Q0HA 1N9LA 1P9WA 2J3TD 2VA0A 4LRZE 3SW1A 2DMWA 3JVVA 3MF0A 5AVEA 2VGLS 2PYPA 3EOIA 4Q0IA 1T1CA 1F9IA 4HJ4A 1XFQA 3CI6A 4HI4A 4HJ6A 1YSQA 3TRCA 2OAP1 3GECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBR A;  5G4Z A;  1Y28 A;  4WUJ A;  1DRM A;  3H7W A;  3LIF A;  2VV7 A;  3GDI A;  5HWT A;  3VE4 A;  4I3J A;  1LT0 A;  2YKF A;  1G28 A;  4L9F A;  5F5Y A;  3H7W B;  2J80 A;  1DP8 A;  2H28 A;  3H82 B;  5F69 A;  4M4X A;  3LYX A;  4LRY C;  1D06 A;  3IS2 A;  3OLO A;  5KIZ A;  2A24 A;  5J4E A;  2PD8 A;  5EFW A;  3LIA A;  3PYP A;  3CWF A;  3A0V A;  2ZOI A;  4F3L A;  2PD7 A;  1EW0 A;  1XJ4 A;  4R38 A;  2Z6C A;  1DP6 A;  2WKR A;  3MFX A;  1OJ5 A;  3K3C A;  1TS6 A;  2A24 B;  4MN5 A;  4I39 A;  4GS9 A;  4F3L B;  3MR0 A;  4HOI A;  3CAX A;  4LPZ A;  1OTB A;  3A0R A;  2D01 A;  3UB6 A;  4GS9 B;  5AVF A;  3E4O A;  3UB7 A;  1N9O A;  2OOL A;  1XFN A;  2Z6D A;  4DJ3 A;  4I3I A;  1V9Z A;  4DJ2 A;  4EW7 A;  4GHI A;  1X0O A;  1LSW A;  3B33 A;  3ICY A;  4JGP A;  5J7E A;  1LSX A;  1OT6 A;  2L0W A;  4BBV A;  4GHI B;  1KOU A;  1OTD A;  5HDC A;  4JGQ A;  4H6J A;  3UE6 A;  4I38 A;  4NXE A;  2PDR A;  2OWH A;  5HWV A;  4H6J B;  4I3A A;  5A8B A;  5DJU A;  5J3W A;  2V0W A;  2V1A A;  2GJ3 A;  1S1Y A;  1ODV A;  4HNB A;  1P97 A;  4PKY G;  1S4S A;  2QJ5 A;  2V1B A;  3LIB A;  3KX0 X;  1XJ2 A;  4NXG A;  1OTE A;  3UME A;  5HD3 A;  2OWJ A;  3MJQ A;  2WKQ A;  4EEP A;  4EES A;  3E4P A;  3BY9 A;  3A0S A;  3D72 A;  5IS1 A;  5HDD A;  3UB8 A;  3VOL A;  3MXQ A;  4WF0 A;  2VEA A;  4KUO A;  2D02 A;  4L9E A;  3LI9 A;  2INW A;  4EEU A;  2M1C A;  1DP9 A;  1T18 A;  2L4R A;  1TS0 A;  3LUQ A;  1OTI A;  5HZH A;  4KUK A;  2VV8 A;  2PYR A;  2YKH A;  3LID A;  3BY8 A;  3IS2 B;  1OTA A;  4PKY A;  3RH8 B;  3LIC A;  4RQ9 A;  4HH3 A;  1P0Z A;  3NOU C;  4WLA A;  4HIA A;  4R3A A;  4I5S A;  3F1P A;  5DJT A;  3FC7 A;  3K3D A;  3HJI A;  5HWW A;  3UB9 A;  4KQD A;  3VE3 A;  3F1P B;  1TS7 A;  1S66 L;  1NWZ A;  4K08 A;  5HD5 A;  1GSX A;  2WKP A;  4GCZ A;  2ZBB A;  4JGR A;  3G6O A;  2PR5 A;  1LL8 A;  1T1A A;  4EXO A;  3MQO A;  1S67 L;  5HDS A;  3FG8 A;  5IU1 A;  2PHY A;  2ZOH A;  1D7E A;  4L9G A;  2QHK A;  2B02 A;  3F1N A;  2P7J A;  4NXF A;  3RTY A;  2I9V A;  3P7N A;  3EEH A;  4LLO B;  1UWP X;  3LIE A;  2L1M A;  1N9N A;  1T19 A;  5HSQ A;  4WN5 A;  3NOP C;  1MZU A;  1TS8 A;  3ZQ5 A;  4BBT A;  2R78 A;  5I5L A;  3E4Q A;  1F98 A;  2HV1 A;  2PR6 A;  2V9A A;  1UGU A;  5F6A A;  4HJ3 A;  3H82 A;  4EER A;  4LRX C;  2V0U A;  4HP9 A;  2EA9 A;  3LI8 A;  5TBM A;  1UWN X;  2KX6 A;  4HH2 A;  4XT2 A;  1GSW A;  1XJ3 A;  3BWL A;  4NXB A;  4R6L A;  5TBM B;  3F1O A;  4YWZ A;  1T1B A;  3EWK A;  2W0N A;  4XT2 B;  2CMN A;  2W27 A;  3NOT C;  3F1O B;  3NHQ A;  1XJ6 A;  4R70 A;  3CLO A;  3NJA A;  2JN7 A;  3PHY A;  2KDK A;  2VV6 A;  4MN6 A;  2QKP A;  2QWS A;  2QJ7 A;  1S1Z A;  4EET B;  2VLG A;  1JNU A;  1WA9 A;  3T50 A;  3HJK A;  1V9Y A;  4BBU A;  1BYW A;  1VB6 A;  3C8C A;  1OT9 A;  5DKL A;  4HQA A;  4GW9 A;  5DKK A;  1OJG A;  3C2W A;  3ULF A;  4WL9 A;  5F68 A;  2K7S A;  3H9W A;  2JHE A;  4HY8 A;  1LSV A;  4E04 A;  4HP4 A;  4EQ1 A;  3F1N B;  4HHD A;  4JGO A;  5G4Y A;  2BAS A;  1GSV A;  1S4R A;  3MQQ A;  4B9O A;  3UMD A;  1N9L A;  4LRZ E;  3SW1 A;  5AVE A;  2PYP A;  1T1C A;  1F9I A;  4HJ4 A;  1XFQ A;  4HI4 A;  4HJ6 A;  3GEC A; 
#chains in the Genus database with same CATH topology
 2VJW A;  4LEN A;  3E0Y A;  3KYZ A;  3T4O A;  3CIT A;  3D9Y A;  3KYE A;  1PW1 A;  2XSS A;  1BUL A;  1K4F A;  1G28 A;  4L9F A;  4G3W A;  2QZ6 A;  3NBL A;  1DP8 A;  3Q7V B;  1LL9 A;  2EFX A;  3S7O A;  4M4X A;  2WKI A;  4Y7P A;  3Q82 A;  5HX9 A;  1LL5 A;  1XXM A;  2JKR I;  5FI2 A;  2UWX A;  3SH7 A;  2PD8 A;  5EFW A;  4RA7 A;  4KQQ A;  1MKM A;  1YLW A;  2ZOI A;  1EW0 A;  1XJ4 A;  5CED A;  3OZH A;  4MMN A;  1DP6 A;  2R9X A;  3MFX A;  3V67 A;  4U0T A;  3BFF A;  3G35 A;  1YSP A;  4RYE A;  2WGW B;  2Z2M B;  4F3L B;  3LY4 A;  1U60 A;  3N4I A;  4QU3 A;  5E43 A;  4F94 A;  3CAX A;  2WKH A;  3DW0 A;  4JXS A;  3NI9 A;  1OTB A;  3A0R A;  2D01 A;  2GX5 A;  3BLM A;  3UPN A;  3HCY A;  5CRF A;  3EEA A;  5GL9 A;  3V3S A;  2W1R A;  1K54 C;  5LBR A;  3PR6 A;  4EWF A;  1G68 A;  4Q8I A;  3NCK A;  1V9Z A;  5DTK A;  1LLB A;  2H10 A;  1PFL A;  4GHI A;  4Y13 A;  3N6I A;  4LV0 A;  3ICY A;  2W3D A;  4DF6 A;  4KZB A;  4IUK A;  5EE8 A;  4BBV A;  3VFF A;  4EBN A;  5HDC A;  1OTD A;  4DE2 A;  3T4T A;  4KZ5 A;  5DVA A;  5FQM A;  3IH8 A;  3M2J A;  3VMA A;  2PDR A;  4UQI S;  1BTL A;  4S2P A;  5HWV A;  4ZBE A;  3RFB A;  1FCM A;  4JF5 A;  4I3A A;  5A8B A;  4PM7 A;  3GRJ A;  3PBT A;  3HLC A;  3MQ0 A;  2XA7 S;  2V0W A;  1LI0 A;  3A3I A;  2X71 A;  5CHJ A;  4C6Y A;  5F83 A;  3IBJ A;  2GJ3 A;  1P97 A;  4S2L A;  4PKY G;  4U0X A;  1VEU A;  4ZJ2 A;  2Y2O A;  3UDI A;  3KX0 X;  3IXD A;  1VET B;  5HD3 A;  5IHV A;  3KO6 A;  4S2O A;  2OWJ A;  5FA7 A;  2IWC A;  4EES A;  3BY9 A;  5TR7 A;  4PM6 A;  3A0S A;  3JPU A;  5HDD A;  3UB8 A;  3VOL A;  5FDS A;  2HJ9 C;  2D02 A;  5CTM A;  4L9E A;  1GHM A;  1YMS A;  1E4D A;  3GR2 A;  2XEP A;  1PRQ A;  3GVB A;  3WWX A;  1NLZ A;  4KUK A;  5HZH A;  3IH9 A;  3R4K A;  4FCF A;  3WS4 A;  3SS4 A;  2JBF A;  3BY8 A;  5GHZ A;  4PKY A;  5HFO A;  3WS2 A;  4IJG A;  4HH3 A;  1TD5 A;  3MBZ A;  1MBL A;  4HIA A;  3F1P A;  4WEL A;  5DJT A;  3FC7 A;  3HLB A;  3K3D A;  3OOV A;  3HJI A;  2EXA A;  4JPM A;  2QYB A;  4BQM A;  3HVF A;  3DTM A;  3BFG A;  1S66 L;  4MBH A;  3CUE A;  5HD5 A;  5GHX A;  1JWV A;  1ONG A;  1IEL A;  1L0E A;  2XRN A;  2Q9N A;  1T1A A;  4ZAM A;  4FSF A;  5TFQ A;  3ZG7 B;  3ZHH A;  4HBT A;  1S67 L;  4PPR A;  5IU1 A;  2IWD A;  3GTC A;  1FQG A;  1H3Q A;  3KSH A;  2PHY A;  3ZVT A;  1D7E A;  5AQ9 A;  1IYO A;  3QNB A;  3MXR A;  1BZA A;  2B02 A;  2B95 A;  2XD1 A;  5HAP A;  4DDY A;  2G2U A;  2I9V A;  3BFC A;  3P7N A;  1FR6 A;  4KZ6 A;  5EPH A;  1IOU A;  3SZT A;  1XA7 A;  3G4P A;  4PAU A;  2VZW A;  4P6Z M;  3KSI A;  1KE4 A;  4BD1 A;  4Q0J A;  5HSQ A;  5AQB A;  4WN5 A;  1MZU A;  1MWU A;  3C7U A;  3WS1 A;  4BBT A;  2R78 A;  4PM8 A;  3HLG A;  4CLC B;  2Y91 A;  1J3W A;  1CI8 A;  2HV1 A;  2JKF A;  5F6A A;  1RP5 A;  4OOY A;  4ETX A;  4LRX C;  2J3T C;  5D3O A;  1FIL A;  4HEF A;  4JXV A;  1YLY A;  4K0X A;  2A2L A;  5CEC A;  4IVK A;  3JVU A;  1ERM A;  3ZG0 A;  2WK0 A;  3QP1 A;  3N7W A;  2G2W A;  3GSG A;  1H5X A;  3CPT A;  5EOE A;  2W0N A;  4E3L A;  3UDF A;  3VSK A;  2CMN A;  4BMW A;  3KSG A;  5U47 A;  3NHQ A;  2P74 A;  4PMA A;  3VP0 A;  5FAQ A;  4WMC A;  4C3Q A;  1BT5 A;  3VP2 A;  1XGJ A;  5HAI A;  5EEC A;  4PM9 A;  3PHY A;  4BEN A;  2QKP A;  2RCX A;  4IVI A;  2QWS A;  2PU2 A;  3W4P A;  1WA9 A;  3T50 A;  1Y54 A;  1NZO A;  3DBA A;  2XF3 A;  1KDW A;  2K2N A;  1YKD A;  3OPH A;  1OT9 A;  4WBG A;  3GV9 A;  2XFS A;  3HL9 A;  3PBO A;  3ULF A;  4II7 A;  5CGS A;  2K7S A;  4JXW A;  2W1T A;  3T4L A;  4OPY A;  4S2I A;  2WUQ A;  3C38 A;  1IFQ A;  4OQI A;  2OLV A;  4CPK A;  5EVI A;  2ZQ9 A;  5CEB A;  1SKO A;  2OLU A;  1BLC A;  1G5U A;  1MWS A;  5G4Y A;  3G32 A;  3UE3 A;  1I2S A;  4N92 A;  4O8G A;  1P9W A;  4LRZ E;  3SW1 A;  3UE1 A;  2PYP A;  1F9I A;  1KGE A;  4HJ4 A;  3CI6 A;  3QP2 A;  4R3J A;  1QMF A;  3TRC A;  1Z09 A;  2OAP 1;  3K2N A;  2ZQ8 A;  4WUJ A;  1DRM A;  4E3J A;  1SZV A;  3SOI A;  3LGO A;  4DE0 A;  2Q0O A;  2VV7 A;  5FEG A;  5MC7 A;  1PI5 A;  2WZX A;  3SH8 A;  5FAS A;  3NUL A;  2H0T A;  1A0K A;  1OPX A;  2H28 A;  4PHT A;  5CHU A;  5A90 A;  5F69 A;  3C5A A;  4CJN A;  4CQH A;  1D06 A;  5KSH A;  3IS2 A;  3ISG A;  1GA0 A;  5J4E A;  1C3B A;  4LV2 A;  2QPN A;  1K57 C;  4MLL A;  3CWF A;  3QHY A;  3A0V A;  1PYY A;  4F3L A;  3CPT B;  1O7E A;  4R38 A;  1MWR A;  4FH4 A;  2Y4A A;  2WKR A;  1OJ5 A;  3K3C A;  1TS6 A;  2A24 B;  4JLF A;  3ZYT A;  5JYO A;  4I39 A;  3VP1 A;  1K38 A;  4ID4 A;  3MR0 A;  2BG1 A;  1FSW A;  4HOI A;  5GLC A;  3G34 A;  4G3K A;  3BFD A;  5L07 A;  4LPZ A;  1DJB A;  3UB7 A;  1IYP A;  1XFN A;  4O7D A;  2Z6D A;  1CEG A;  2JE5 A;  4GD6 A;  5FQ9 A;  4I3I A;  1G6O A;  1ONH A;  1H8M A;  1JTD A;  3TE8 A;  3HBR A;  5TJJ A;  3S22 A;  2O9B A;  1FIK A;  1NXY A;  2ZLY A;  2Y79 A;  1ZHH B;  4E3K A;  3CZD A;  1ES4 A;  2L0W A;  5CHM A;  1YT4 A;  1P9R A;  3TG9 A;  4KZ3 A;  3BYD A;  1JTG A;  3G31 A;  4X56 A;  1PIO A;  4NXE A;  2OWH A;  2WAD A;  5FQQ A;  4MEZ A;  1SKO B;  1K6S A;  3M6B A;  4H6J B;  4Y2F A;  5DJU A;  1Z6F A;  1VQQ A;  1CEF A;  2EXB A;  1L0G A;  3IX4 A;  1VET A;  1ODV A;  3BQ8 A;  2HDU A;  2JCH A;  4IBR A;  3MSH A;  1S4S A;  2QJ5 A;  3IQA A;  4X25 A;  1JWZ A;  3OCN A;  3U4L P;  1BUE A;  3UME A;  2HF6 A;  2J9O A;  5EV0 A;  2WKQ A;  1VM1 A;  1KE3 A;  3MXQ A;  3PBS A;  1PWD A;  2V1Z A;  2VEA A;  4KUO A;  4OLG A;  2H5S A;  2HP5 A;  5HAQ A;  2J7V A;  3ITB A;  2KOI A;  4JF6 A;  4R0Q A;  4Z9Q A;  2ZQA A;  3LEQ A;  1OTI A;  2PYR A;  2YKH A;  3IS2 B;  4EUV A;  1PZO A;  3MFD A;  1YLJ A;  1PNE A;  3LIC A;  2VX8 A;  1P0Z A;  3A3F A;  1PZP A;  2NUT C;  3T1Q B;  2XD5 A;  2P9V A;  2Y2M A;  3FPW A;  3S1Y A;  2GNX A;  3FV7 A;  1L0F A;  1NRF A;  5DFY A;  5HW3 A;  4KQD A;  3VE3 A;  1H8Z A;  1TS7 A;  2C6W B;  4OH0 A;  2I72 A;  1GCE A;  3UPO A;  5KMW A;  4JGR A;  3G6O A;  4WYY A;  2PR5 A;  4ETZ A;  1HD8 A;  4X69 A;  1WYB A;  3S7P A;  1K56 A;  3MQO A;  4YOF A;  3CG5 A;  5HDS A;  3HLF A;  4KZ8 A;  2FFY A;  2ZOH A;  2X01 A;  2H0Y A;  4NXF A;  1GHP A;  4QJG A;  4KQR A;  4DN0 A;  5HL6 A;  3LIE A;  4BL2 A;  3W8K A;  3TSG A;  3QP6 A;  3GQZ A;  3SS3 A;  1SDN A;  1T19 A;  3P98 A;  1CJF A;  1W7F A;  3T4J A;  5EM1 A;  4CLC A;  4R1G A;  2ZL1 A;  3PBR A;  2OV5 A;  4OOL A;  1Q2P A;  4IUH A;  2Y8H A;  2P04 A;  5I5L A;  4GKU A;  1ZG4 A;  5FSR A;  2ZC3 B;  2IA2 A;  4KZ7 A;  2LB9 A;  1E25 A;  1RGZ A;  2V9A A;  1UGU A;  2ZM2 A;  1IKG A;  4AFI A;  3IX3 A;  3H82 A;  5CTN A;  5JYP A;  4FUW A;  2V0U A;  3DWZ A;  2E8J A;  3PXP A;  3NEC A;  4ARZ B;  3BLS A;  2EFU A;  1GSW A;  3BQA A;  5FI6 A;  1KGF A;  1K55 A;  4Y17 A;  3G2Y A;  5TBM B;  4YWZ A;  3MXS A;  4DMZ A;  1MY8 A;  3LR4 A;  4XT2 B;  4KZ9 A;  2XQZ A;  4XUZ A;  2Y2H A;  3NOT C;  4P6Z S;  2HGV A;  4JF4 A;  5CER A;  2PT7 A;  4K0W A;  3OCL A;  4DXC A;  4WEK A;  1L3L A;  2P9V B;  3NJA A;  2JN7 A;  3ZG5 A;  2P08 A;  3M6H A;  4UQI M;  2KDK A;  2VGL M;  1FCN A;  2QJ7 A;  3IT9 A;  4BD0 A;  2VLG A;  3L9K A;  1XX2 A;  2XA7 M;  1YAX A;  3BFE A;  1TDL A;  4Y15 A;  3NY4 A;  4MN7 A;  3HJK A;  4KZ4 A;  2FFF B;  1VB6 A;  1S0W A;  2V2F F;  3C8C A;  5DKL A;  3T4Q A;  4KEN B;  4OKP A;  1PWG A;  5DKK A;  3E98 A;  1NYM A;  3C2W A;  4Y0O A;  4DXB A;  1CI9 A;  4OP8 A;  5F68 A;  4QHC A;  3T1R A;  1HZO A;  1KDS A;  1LSV A;  3PBQ A;  3O5Y A;  2VKS A;  4HP4 A;  4YIN A;  4EQ1 A;  1JVJ A;  4EUZ A;  2X02 A;  5GHY A;  3IHA A;  1W63 M;  1YMX A;  1ZC2 A;  4KQO A;  4CLC C;  4OLD A;  4ZDX A;  2Y2P A;  2XR0 A;  4FD8 A;  4Y3I A;  4X1L A;  1E3U A;  3UMD A;  2VA0 A;  2DMW A;  3JVV A;  3MF0 A;  1DJC A;  3EOI A;  1T1C A;  2CC1 A;  1XFQ A;  4GNU A;  4HI4 A;  4HJ6 A;  5F1F A;  3P09 A;  2PBD P;  2ZL1 B;  3GEC A;  4UA6 A;  3IBR A;  2Y2G A;  1OME A;  3CJM A;  4OVD A;  2MJ6 A;  3GDI A;  5HWT A;  2Q9M A;  4QPR A;  5FI7 A;  4UAA A;  3HLW A;  3R7W B;  2O99 A;  1K55 C;  3H7W B;  1W8Q A;  4WMC D;  3H82 B;  2WZZ A;  3DAV A;  3SS5 A;  3RJU A;  3EQU A;  3NDE A;  3LYX A;  2DRW A;  1MWT A;  5F82 A;  3OLO A;  4EV4 A;  2VK3 A;  1N9B A;  2FZ0 A;  2A24 A;  2B5R A;  4B4Z A;  3U2A A;  3LIA A;  3PYP A;  3Q7Z A;  4GDN A;  1K57 A;  1RCJ A;  3ZCZ A;  2Z6C A;  4S2M A;  4GLQ A;  3BEC A;  4MN5 A;  3ZGA B;  1H8Y A;  1QME A;  2HP9 A;  3DTI A;  4GN2 A;  3CMZ A;  3OPR A;  3UN7 A;  2FH5 A;  3FZC A;  3QP4 A;  2IWB A;  3UNW A;  4GS9 B;  2W3G A;  1GA9 A;  5HPI A;  2OOL A;  5EVI D;  3IF5 A;  5DFX A;  4P87 A;  3E2K A;  2J3W A;  3TJZ C;  2W3E A;  4EW7 A;  4QY5 A;  2Y2L A;  4JBF A;  1X0O A;  3PAE A;  3B33 A;  3DTE A;  3HRE A;  1K6R A;  4KG6 A;  4OQG A;  3O87 A;  1CQA A;  3ZG8 B;  3LR0 A;  5E2E A;  3ZVW A;  2A49 A;  1KOU A;  4CLC E;  4JGQ A;  4H6J A;  4OON A;  5E2H A;  4ME4 A;  1MXO A;  3UE6 A;  4I38 A;  2WGI A;  4U3T A;  1HLU P;  1SCW A;  2ZQC A;  3D4F A;  3C30 A;  5FQK A;  5J3W A;  1I2W A;  4E3O A;  3S7Q A;  1BLS A;  2V1A A;  5A92 A;  1S1Y A;  5FAT A;  3WS0 A;  1EI5 A;  4HNB A;  3T12 B;  1XP4 A;  3HUN A;  2PAV P;  2VGK A;  2V1B A;  3W2Z A;  2JKT M;  2C5W B;  1XJ2 A;  3LO7 A;  3NIA A;  1ESU A;  4MCW A;  4LCL A;  2XK1 A;  2ZC6 B;  3MJQ A;  2WYX A;  3E4P A;  2B18 A;  4FTX A;  5FDH A;  1NY0 A;  3D72 A;  4NKP A;  4LCM A;  4WM9 A;  4ZRR A;  2KLI A;  4WF0 A;  4GD8 A;  4EEU A;  4IBX A;  5EM0 A;  5KSC A;  3V50 A;  5L09 A;  4DDS A;  1T18 A;  2L4R A;  4P6B A;  1TS0 A;  3WRZ A;  4DE1 A;  4OPR A;  2DNS A;  3N8R A;  4QWO A;  1OTA A;  3S7N A;  5E2F A;  5A91 A;  1YLP A;  3RH8 B;  2VGJ A;  2E8I A;  5DF9 A;  3PAG A;  4N1H A;  4OP5 A;  4ZTK A;  3NOU C;  4OQ0 A;  4WLA A;  4R3A A;  4R3B A;  5DTS A;  2XLN A;  3EGD C;  5CGX A;  2EX2 A;  4NEE D;  1G6A A;  5HWW A;  1W5D A;  2PU4 A;  1GHI A;  5EUA A;  1L2S A;  1NWZ A;  2A3U A;  1JWP A;  2HDR A;  3MZE A;  2M7V A;  4RVA A;  1ZTU A;  2V8F A;  3W4O A;  2XGN A;  2WGV A;  3HUO A;  3A3D A;  1H0M A;  3G2Z A;  4MDZ A;  4EXO A;  1STZ A;  1XPB A;  3FG8 A;  4KG2 A;  4R4R A;  3IF6 A;  3Q1F A;  3FWL A;  2ZQD A;  4L9G A;  2QHK A;  3F1N A;  3VP4 A;  3RTY A;  3O88 A;  1VHM A;  5HPF A;  2ZD8 A;  4OPQ A;  3EEH A;  4B88 A;  5F1G A;  2O9C A;  1KE0 A;  5AQA A;  1DY6 A;  5IT5 A;  3DTK A;  1KVL A;  3NOP C;  1YLT A;  4DRT A;  1TS8 A;  2DCF A;  3ZQ5 A;  1BLH A;  3IHB A;  3T4S A;  3E4Q A;  4EBL A;  3LY3 A;  2OAQ 1;  1MC0 A;  3NC8 A;  2J9P A;  4ARZ A;  3O86 A;  4EER A;  1D1J A;  5I94 A;  5TBM A;  5A93 A;  3L7H A;  5L8M A;  3MS6 A;  4OQH A;  4WZ5 C;  4HH2 A;  4XT2 A;  1IYQ A;  4E3I A;  3HLD A;  4R6L A;  3BM6 A;  4ZJ1 A;  4N9K A;  3D3O A;  1T1B A;  2WAF A;  1TVF A;  4UEY A;  1DJA A;  4YFM A;  1FOF A;  2W27 A;  3LCE A;  4DKI A;  1FR1 A;  3F1O B;  1LHY A;  1BLP A;  1K56 D;  4R70 A;  2JKR M;  3TOI A;  1WYC A;  1M40 A;  2VV6 A;  5G18 A;  4JXG A;  1S1Z A;  2ZMV A;  4EET B;  1W63 Q;  1L0D A;  2AVX A;  1JNU A;  3QP8 A;  5M18 A;  4EQI A;  3C7V A;  3B42 A;  1K25 A;  4BLM A;  2K31 A;  1XGI A;  5C5K A;  4ESP A;  5GLD A;  3QP5 A;  3I7J A;  1V9Y A;  4BBU A;  1F5M A;  1BYW A;  5FQJ A;  4GW9 A;  4K91 A;  2QMI A;  3IF6 C;  1OJG A;  3WRT A;  4LV3 A;  4WL9 A;  3PBN A;  4CLC D;  3ZNT A;  2PRF A;  3OBF A;  3LFV A;  3BW6 A;  3PTE A;  1HVB A;  3AGE A;  4P85 A;  2EX9 A;  4E04 A;  3C4O A;  3V5M A;  3LR3 A;  3IF6 B;  1NLY A;  4Y0U A;  4A5R A;  5HAR A;  3BJN A;  3MMH A;  3F1N B;  1ES2 A;  2NUP C;  1Q2Q A;  2BAS A;  1HTZ A;  3UO9 A;  3EGX C;  1S4R A;  3MQQ A;  3Q81 A;  4S2J A;  4Q0H A;  2J3T D;  2Y2N A;  5AVE A;  2VGL S;  4R4S A;  4UA9 A;  1Y4O A;  2HPB A;  4IED A;  4N1X A;  2ZMA A;  1RGY A;  5G4Z A;  3R7W A;  1Y28 A;  2ACG A;  3H7W A;  1BSG A;  3LIF A;  5GLB A;  5BOH A;  2XH9 A;  3BEB A;  4NK3 A;  1IYS A;  3AGD A;  3VE4 A;  4I3J A;  4D2O A;  4MNR A;  1LT0 A;  1KGG A;  2YKF A;  5F5Y A;  2J80 A;  1XA1 A;  3W4Q A;  1YQS A;  1SKF A;  5L10 A;  2O0Y A;  4XUX A;  2BTF P;  5DF8 A;  4QB8 A;  4E6W A;  3IWQ A;  4BWI A;  4LRY C;  1CK3 A;  5KIZ A;  4KG5 A;  3OC2 A;  1YPR A;  3NDG A;  4LV1 A;  2M7U A;  2PD7 A;  3LR5 A;  4X53 A;  4PM5 A;  1NZU A;  4O0P A;  2J8Y A;  4GS9 A;  1S6R A;  1NYY A;  2HJE A;  3VP3 A;  1TF1 A;  5AQ7 A;  2ZMF A;  3UPP A;  3UB6 A;  3UDX A;  5AVF A;  3E4O A;  5GLA A;  1N9O A;  4X1M A;  4DJ3 A;  4NG2 A;  1MPL A;  1W8Y A;  2EWV A;  3IWI A;  5J8X A;  5DTT A;  4GB7 A;  4DJ2 A;  1E3U D;  1LSW A;  2EX8 A;  5AJG A;  3RXW A;  4JGP A;  4Y0T A;  5J7E A;  5FAP A;  2Y59 A;  1LSX A;  1ES3 A;  1OT6 A;  4GHI B;  2Y55 A;  2HDS A;  4DE3 A;  1KVM A;  4WEJ A;  5M1A A;  4S2N A;  4Y5F A;  3OPP A;  5FAO A;  3T1X A;  4X6T A;  3T1S A;  2XDM A;  2GDN A;  1LI9 A;  4BL3 A;  5K5B A;  3SH9 A;  3M2K A;  3N8L A;  4Z1W A;  4GZB A;  1ES5 A;  3LIB A;  4MBK A;  5TGF A;  3IWO A;  5EVE A;  3VV4 A;  4NXG A;  3AGF A;  1OTE A;  3A3E A;  4RX3 A;  2Z2L B;  4GOG A;  1VEU B;  4EEP A;  2EX6 A;  1NJ4 A;  3MZF A;  5IS1 A;  4GDB A;  2ZM8 A;  5HL1 A;  2ZM0 A;  1F2K A;  4MBF A;  3BRM A;  3LI9 A;  1NRJ A;  2INW A;  2M1C A;  1DP9 A;  1FSY A;  4E6X A;  1ERO A;  3HLE A;  3LUQ A;  2VV8 A;  1XKZ A;  4C75 A;  2ZC4 B;  1YLZ A;  3LID A;  4QD4 A;  4UA7 A;  2BLS A;  3MKE A;  4IHQ A;  3IXG A;  4RQ9 A;  5CGW A;  4L0L A;  3V3R A;  1CF0 A;  2HDQ A;  4I5S A;  5DF7 A;  1WE4 A;  4S2K A;  1TDG A;  1PI4 A;  3TW8 A;  1TEM A;  1ZG6 A;  1N4O A;  2Y2J A;  3C4P A;  3P01 A;  3EQV A;  3UB9 A;  3F1P B;  3CUE C;  3QNC A;  4K08 A;  2HZ5 A;  1GSX A;  1IEM A;  2WKP A;  2GZA A;  4GCZ A;  2ZBB A;  4B4X A;  3N8S A;  2G7U A;  3OPL A;  4XXR A;  3ZDJ A;  1IKI A;  1LL8 A;  1YM1 A;  4BJP A;  3UY6 A;  4P0M A;  1J9M A;  1I5Q A;  1AWI A;  1EWZ A;  2Y2Q A;  4OPZ A;  4M3K A;  4EBP A;  2P7J A;  5EOO A;  4N9L A;  4LFU A;  3WS5 A;  4S2N C;  1ESI A;  3IXH A;  3ITA A;  4LLO B;  1UWP X;  2XRO A;  1K4E A;  4D60 A;  3V39 A;  2XFT A;  2L1M A;  2RL3 A;  4G3V A;  4GJ4 A;  2JKT I;  2JC7 A;  2UV0 E;  1PW8 A;  1ERQ A;  1N9N A;  4B93 A;  5CXW A;  1SDE A;  4OOM A;  4FH2 A;  4LGW A;  1ACF A;  3IX8 A;  3ZFZ A;  4X68 A;  3KSF A;  3KYQ A;  1F98 A;  3VOZ A;  5EVL A;  2PR6 A;  3RXX A;  2V8C A;  4HJ3 A;  4KZA A;  5KZH A;  4FOF A;  1FCO A;  3Q7V A;  5FQI A;  2EWW A;  4JKT A;  4HP9 A;  4ZJ3 A;  2EA9 A;  3LI8 A;  4YNR A;  1UWN X;  2KX6 A;  4RX2 A;  2WKE A;  3MKF A;  5CX7 A;  1XJ3 A;  4WZ5 A;  3FKV A;  4R23 A;  3BWL A;  4NXB A;  3T4K A;  4O01 A;  4UHU A;  3F1O A;  2W3H A;  2ZQ7 A;  3Q07 A;  3UE0 A;  3EWK A;  3VOY A;  3B3X A;  4QY6 A;  3E2L A;  2V20 A;  1PWC A;  4H8R A;  2WGW A;  2ZJ9 A;  3DWK A;  3HUM A;  1XJ6 A;  3CLO A;  1ZKJ A;  2PBY A;  2OSU A;  3A3J A;  4MN6 A;  5FEF A;  2WAE A;  3S4X A;  3ZG9 B;  1SHV A;  4E3N A;  2Y2K A;  3LEZ A;  3GMW A;  2O9A A;  1W79 A;  1O07 A;  4HQA A;  1AXB A;  4X55 A;  1K54 A;  4HES A;  5FL3 A;  3H9W A;  2ZC7 A;  2JHE A;  5E2G A;  4HY8 A;  3FPV A;  3JYI A;  2JKG A;  5M19 A;  2W3F A;  3UB5 P;  3FYZ A;  2Y2I A;  5EVI C;  2W1T B;  4NET A;  4WZ4 A;  3MZD A;  1K0K A;  2LB5 A;  4HHD A;  4JGO A;  2ZC5 B;  3B47 A;  5L2F A;  3ZNY A;  4HBU A;  1GSV A;  3FKW A;  4B9O A;  4EU0 A;  5EVI B;  1N9L A;  3O3V A;  2R9W A;  3G30 A;  4Q0I A;  3VSL A;  4E3M A;  1ALQ A;  3IXB A;  2HP6 A;  3CHW P;  1MKI A;  1YSQ A;  1M6K A;  3VFH A; 
#chains in the Genus database with same CATH homology
 2VJW A;  3IBR A;  5G4Z A;  3R7W A;  3K2N A;  1Y28 A;  4WUJ A;  1DRM A;  3E0Y A;  3KYZ A;  3T4O A;  3H7W A;  3CIT A;  3LIF A;  2VV7 A;  5MC7 A;  2MJ6 A;  3GDI A;  5HWT A;  3VE4 A;  4I3J A;  4QPR A;  2XSS A;  3R7W B;  1LT0 A;  2O99 A;  2YKF A;  1G28 A;  4G3W A;  4L9F A;  3H7W B;  1OPX A;  5F5Y A;  2J80 A;  1DP8 A;  2H28 A;  4PHT A;  3H82 B;  2O0Y A;  5F69 A;  3S7O A;  4M4X A;  3EQU A;  4CQH A;  4BWI A;  3LYX A;  4LRY C;  1D06 A;  5KSH A;  3IS2 A;  3OLO A;  2JKR I;  5KIZ A;  2FZ0 A;  2A24 A;  3OC2 A;  5J4E A;  3U2A A;  2PD8 A;  5EFW A;  3LIA A;  3PYP A;  3CWF A;  1MKM A;  3A0V A;  2M7U A;  2ZOI A;  4F3L A;  2PD7 A;  1EW0 A;  1XJ4 A;  3LR5 A;  4R38 A;  2Z6C A;  4MMN A;  1DP6 A;  2WKR A;  3MFX A;  1OJ5 A;  3V67 A;  3K3C A;  1TS6 A;  2A24 B;  4O0P A;  4GLQ A;  1YSP A;  3ZYT A;  4MN5 A;  4I39 A;  4GS9 A;  4F3L B;  3MR0 A;  4HOI A;  2HJE A;  4G3K A;  1TF1 A;  3CAX A;  2ZMF A;  2FH5 A;  4LPZ A;  1OTB A;  3A0R A;  2D01 A;  3UB6 A;  2GX5 A;  4GS9 B;  5AVF A;  3E4O A;  3HCY A;  2W3G A;  3UB7 A;  5HPI A;  1N9O A;  2OOL A;  1XFN A;  2Z6D A;  3EEA A;  4DJ3 A;  2W1R A;  5LBR A;  3PR6 A;  2EWV A;  4I3I A;  5DFX A;  2J3W A;  1V9Z A;  4DJ2 A;  3TJZ C;  1G6O A;  2W3E A;  4EW7 A;  4GHI A;  1X0O A;  1H8M A;  1LSW A;  3B33 A;  5AJG A;  3TE8 A;  5TJJ A;  3ICY A;  2O9B A;  2W3D A;  4JGP A;  2Y79 A;  1ZHH B;  4IUK A;  5J7E A;  1LSX A;  1OT6 A;  2L0W A;  3LR0 A;  4BBV A;  4GHI B;  1KOU A;  1OTD A;  5HDC A;  3T4T A;  1P9R A;  4JGQ A;  4CLC E;  4H6J A;  4ME4 A;  3UE6 A;  4I38 A;  4NXE A;  2PDR A;  2OWH A;  4UQI S;  4WEJ A;  5HWV A;  3RFB A;  4H6J B;  4I3A A;  4Y5F A;  5A8B A;  4Y2F A;  5DJU A;  3C30 A;  3PBT A;  3MQ0 A;  2XA7 S;  5J3W A;  2V0W A;  3S7Q A;  2V1A A;  3IBJ A;  2GJ3 A;  1S1Y A;  1ODV A;  4HNB A;  1P97 A;  3BQ8 A;  4PKY G;  1S4S A;  5K5B A;  2QJ5 A;  2V1B A;  4Z1W A;  3OCN A;  3W2Z A;  3LIB A;  3KX0 X;  2JKT M;  3VV4 A;  1XJ2 A;  4NXG A;  1OTE A;  3UME A;  5HD3 A;  3KO6 A;  4MCW A;  2HF6 A;  2OWJ A;  3MJQ A;  2WKQ A;  4EEP A;  4EES A;  3E4P A;  3BY9 A;  2B18 A;  3A0S A;  3D72 A;  5IS1 A;  5HDD A;  3UB8 A;  4NKP A;  3MXQ A;  3PBS A;  3VOL A;  4ZRR A;  2KLI A;  4WF0 A;  2VEA A;  2HJ9 C;  4KUO A;  2D02 A;  4L9E A;  3LI9 A;  1NRJ A;  2INW A;  4EEU A;  2M1C A;  1DP9 A;  1T18 A;  2KOI A;  2L4R A;  1TS0 A;  3LUQ A;  1OTI A;  1NLZ A;  4KUK A;  5HZH A;  2VV8 A;  3R4K A;  2PYR A;  2YKH A;  3LID A;  3BY8 A;  3IS2 B;  1OTA A;  3S7N A;  4EUV A;  4PKY A;  3RH8 B;  4IHQ A;  3LIC A;  4RQ9 A;  4IJG A;  2VX8 A;  1P0Z A;  1TD5 A;  4HH3 A;  5DF9 A;  4L0L A;  2NUT C;  3NOU C;  4WLA A;  4HIA A;  4R3A A;  4I5S A;  3FPW A;  3F1P A;  2GNX A;  3EGD C;  4WEL A;  5DJT A;  3FC7 A;  3K3D A;  3OOV A;  3HJI A;  3TW8 A;  5DFY A;  2QYB A;  4NEE D;  3P01 A;  5HWW A;  3EQV A;  3UB9 A;  4KQD A;  3VE3 A;  3F1P B;  1TS7 A;  3CUE C;  1S66 L;  1NWZ A;  4K08 A;  3CUE A;  2M7V A;  5HD5 A;  1ZTU A;  1GSX A;  2WKP A;  4GCZ A;  2GZA A;  2ZBB A;  4JGR A;  3G6O A;  2XRN A;  2G7U A;  2PR5 A;  4ETZ A;  1LL8 A;  1T1A A;  4MDZ A;  4FSF A;  4EXO A;  4BJP A;  1STZ A;  3S7P A;  3MQO A;  1S67 L;  4YOF A;  5HDS A;  3FG8 A;  5IU1 A;  1H3Q A;  3KSH A;  2PHY A;  2ZOH A;  1D7E A;  4L9G A;  2QHK A;  2B02 A;  3F1N A;  2P7J A;  4NXF A;  3RTY A;  2I9V A;  1VHM A;  3P7N A;  5HPF A;  3EEH A;  4LLO B;  1UWP X;  4DN0 A;  2XRO A;  1IOU A;  5HL6 A;  3LIE A;  4PAU A;  2L1M A;  2O9C A;  2VZW A;  4G3V A;  2JKT I;  4GJ4 A;  4P6Z M;  3KSI A;  1N9N A;  4B93 A;  1T19 A;  4Q0J A;  3T4J A;  5HSQ A;  5IT5 A;  4CLC A;  4OOM A;  4WN5 A;  3NOP C;  3PBR A;  1MZU A;  1TS8 A;  3ZQ5 A;  4OOL A;  4IUH A;  2Y8H A;  3KSF A;  4BBT A;  2R78 A;  2P04 A;  3KYQ A;  5I5L A;  3T4S A;  3E4Q A;  1F98 A;  4CLC B;  2IA2 A;  2OAQ 1;  1MC0 A;  2LB9 A;  2HV1 A;  4ARZ A;  2PR6 A;  2V9A A;  1UGU A;  5F6A A;  4AFI A;  4HJ3 A;  4FOF A;  3H82 A;  4ETX A;  4EER A;  4LRX C;  2EWW A;  2J3T C;  2V0U A;  4HP9 A;  2EA9 A;  3LI8 A;  5TBM A;  3PXP A;  4YNR A;  5L8M A;  1UWN X;  2KX6 A;  4ARZ B;  2A2L A;  5CX7 A;  4HH2 A;  4XT2 A;  1GSW A;  3JVU A;  3BQA A;  1XJ3 A;  3BWL A;  4NXB A;  4R6L A;  4O01 A;  3T4K A;  3D3O A;  5TBM B;  3F1O A;  2W3H A;  1T1B A;  4YWZ A;  3EWK A;  4DMZ A;  2W0N A;  4UEY A;  3LR4 A;  4XT2 B;  2CMN A;  4BMW A;  2W27 A;  3NOT C;  4P6Z S;  3KSG A;  2HGV A;  3F1O B;  2PT7 A;  3NHQ A;  1XJ6 A;  3OCL A;  4WEK A;  4R70 A;  2JKR M;  3CLO A;  3NJA A;  2JN7 A;  2P08 A;  4UQI M;  3PHY A;  2KDK A;  2VGL M;  2VV6 A;  4MN6 A;  2QKP A;  2QWS A;  2QJ7 A;  1S1Z A;  2ZMV A;  4EET B;  1W63 Q;  2VLG A;  1JNU A;  1WA9 A;  2XA7 M;  3T50 A;  3B42 A;  1YAX A;  3DBA A;  2K31 A;  4MN7 A;  3HJK A;  5C5K A;  2K2N A;  2O9A A;  1V9Y A;  4BBU A;  1F5M A;  1YKD A;  1BYW A;  1VB6 A;  3C8C A;  1OT9 A;  5DKL A;  3T4Q A;  4HQA A;  4GW9 A;  5DKK A;  3E98 A;  1OJG A;  3C2W A;  3PBO A;  3ULF A;  4II7 A;  5FL3 A;  4WL9 A;  5F68 A;  2K7S A;  2W1T A;  3H9W A;  3PBN A;  3T4L A;  4CLC D;  2JHE A;  4HY8 A;  3FPV A;  3C38 A;  3OBF A;  3LFV A;  2W3F A;  1IFQ A;  3BW6 A;  1LSV A;  4E04 A;  3PBQ A;  3LR3 A;  3O5Y A;  1NLY A;  2VKS A;  3BJN A;  3MMH A;  2W1T B;  4HP4 A;  4EQ1 A;  2LB5 A;  3F1N B;  4HHD A;  1W63 M;  4JGO A;  2NUP C;  4KQO A;  3B47 A;  5G4Y A;  2BAS A;  3UE3 A;  1GSV A;  3EGX C;  4CLC C;  1S4R A;  3MQQ A;  4B9O A;  4EU0 A;  4Y3I A;  4O8G A;  3UMD A;  4Q0H A;  1N9L A;  1P9W A;  2J3T D;  2VA0 A;  4LRZ E;  3SW1 A;  2DMW A;  3JVV A;  3MF0 A;  5AVE A;  2VGL S;  2PYP A;  3EOI A;  4Q0I A;  1T1C A;  1F9I A;  4HJ4 A;  1XFQ A;  3CI6 A;  4HI4 A;  4HJ6 A;  1YSQ A;  3TRC A;  2OAP 1;  3GEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...