2PHYA

Photoactive yellow protein, dark state (unbleached)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title 1.4 A structure of photoactive yellow protein, a cytosolic photoreceptor: unusual fold, active site, and chromophore.
pubmed doi rcsb
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2phyA00
1OT9A 3OLOA 4BBUA 5DJUA 1UWPX 5F69A 1ODVA 1P0ZA 2OWJA 4H6JA 4F3LA 1TS8A 4HJ4A 3HJIA 3UB9A 4JGQA 3ICYA 3C2WA 4BBVA 4M4XA 1N9NA 1S67L 3E4QA 5F5YA 4JGPA 4MN5A 4HHDA 5AVEA 3PHYA 2BASA 2D02A 3ZQ5A 4EEUA 3H7WA 5IS1A 4RQ9A 2WKQA 1LSXA 4EW7A 2INWA 1DRMA 4HQAA 4MN6A 3RTYA 4LRZE 1EW0A 4I39A 5G4ZA 3E4OA 2PHYA 3T50A 3LIFA 2KDKA 3LIEA 1UGUA 1LSVA 2JHEA 2V0WA 1OTDA 1OTIA 5DKKA 4HI4A 4R70A 4L9FA 2P7JA 1V9YA 3IS2B 3MXQA 3LIAA 3VE4A 3LUQA 3EWKA 4R38A 3HJKA 2WKPA 4B9OA 5HWVA 1UWNX 3FC7A 1XJ3A 3VOLA 4BBTA 3LI9A 5HDSA 2QWSA 1T1BA 3LIDA 1OJ5A 3RH8B 2VV6A 3F1NA 4EEPA 5HWWA 2EA9A 3MJQA 1V9ZA 2ZBBA 4LRYC 4DJ2A 3F1OA 4WL9A 1T1AA 1VB6A 2VV7A 4GS9B 4WN5A 5AVFA 3B33A 1WA9A 4YWZA 1DP6A 1S4SA 3H82A 2PR6A 1D06A 1N9LA 4K08A 3CAXA 5J7EA 1F9IA 2VEAA 4XT2A 5DJTA 2PDRA 4NXEA 3EEHA 4KQDA 4GCZA 4HNBA 3UB7A 1LSWA 4HY8A 1TS6A 3KX0X 4PKYG 2D01A 2R78A 1XFQA 4EERA 4PKYA 1G28A 1TS7A 2W27A 1XFNA 1T1CA 4I3JA 2L0WA 3LICA 5J3WA 4HOIA 3UB8A 4L9EA 3LIBA 2VV8A 1S1YA 5HWTA 1GSXA 2B02A 4WF0A 4LPZA 3F1PB 2HV1A 3NJAA 4HIAA 4EQ1A 3NOPC 1F98A 3CWFA 4I3IA 5F68A 4NXFA 3K3DA 4GHIB 5DKLA 3IS2A 4I38A 2YKFA 3H9WA 3K3CA 5TBMB 4JGRA 1S66L 5IU1A 4E04A 4KUOA 1JNUA 2GJ3A 2PD7A 3IBRA 3P7NA 1DP9A 3C8CA 3VE3A 4HH2A 2A24B 4R3AA 3MFXA 3D72A 2ZOHA 3BWLA 2QHKA 4LLOB 3UMEA 2JN7A 1DP8A 1OJGA 2L4RA 4EESA 4GW9A 3NOTC 2PD8A 4GS9A 1LL8A 4HP4A 2PYPA 4JGOA 4LRXC 4L9GA 1GSVA 3FG8A 3A0VA 2PR5A 4I5SA 3GDIA 4H6JB 3ULFA 4F3LB 3MR0A 5I5LA 2OOLA 4HP9A 1TS0A 2WKRA 1T19A 5HDDA 2Z6CA 3E4PA 2KX6A 4DJ3A 3SW1A 5HD3A 3NOUC 4WLAA 3H7WB 2QKPA 1GSWA 2L1MA 5HZHA 2V1AA 3UMDA 1OTEA 1OT6A 3PYPA 1OTAA 5F6AA 2OWHA 4HJ3A 1N9OA 3A0SA 1MZUA 3GECA 3MQOA 4I3AA 1S1ZA 5HD5A 5J4EA 4NXBA 2W0NA 3UE6A 3NHQA 3F1PA 3UB6A 5EFWA 1BYWA 2QJ7A 1S4RA 3LI8A 1X0OA 2V9AA 2K7SA 4EETB 2J80A 3G6OA 3LYXA 4HJ6A 4GHIA 4EXOA 4HH3A 5KIZA 5TBMA 2I9VA 1KOUA 1XJ4A 4WUJA 2V0UA 5A8BA 4NXGA 5HDCA 1XJ2A 3F1NB 2M1CA 2QJ5A 5G4YA 1T18A 3CLOA 1LT0A 1NWZA 2V1BA 4KUKA 3F1OB 3MQQA 2H28A 2PYRA 2Z6DA 2A24A 2VLGA 3BY9A 1OTBA 2ZOIA 4R6LA 2CMNA 3H82B 2YKHA 5HSQA 1P97A 1Y28A 4XT2B 1D7EA 3A0RA 1XJ6A 3BY8A
chains in the Genus database with same CATH superfamily
1OT9A 4MMNA 4R4SA 4KZ6A 4BBUA 4DN0A 4X55A 1UWPX 3LGOA 5FQMA 3IF5A 1P0ZA 2OWJA 1TS8A 3VOYA 2OSUA 2Y91A 1PW1A 3CMZA 1N9NA 2Y2QA 4WZ5C 4IUKA 3R7WB 2PRFA 5CERA 1KE3A 5TFQA 2BASA 3ZQ5A 3H7WA 4P0MA 4FSFA 1JWPA 2PT7A 2ZM8A 4E3KA 4WEJA 4PMAA 4BQMA 3UE3A 3IQAA 3LY4A 3K2NA 2KDKA 3ZFZA 1UGUA 1LSVA 2HF6A 2JE5A 1OTIA 1CF0A 3FWLA 4HI4A 4MN7A 3HUMA 4R70A 1SKFA 1IYQA 2OAQ1 3MMHA 3IS2B 3LIAA 3VE4A 3LUQA 3PBTA 3WRTA 2HZ5A 3TOIA 3HJKA 1ESIA 1XJ3A 5KSHA 5KMWA 1NRFA 2J9OA 1SCWA 2HJEA 4LCMA 4JKTA 2JKTM 4S2NA 2ZMAA 5A93A 1OJ5A 3GVBA 2XQZA 3DTIA 3T4TA 3DTKA 2EA9A 1EI5A 2ZBBA 2P04A 3QNBA 3A3IA 4JXVA 4YNRA 4MEZA 1T1AA 3BQAA 4GS9B 3S22A 4WN5A 5AVFA 3ZNTA 3B33A 4YWZA 1DP6A 2ZQAA 3H82A 4FD8A 1WYBA 1D06A 2A49A 4Y3IA 3CAXA 2VEAA 1YKDA 4S2NC 1NZUA 4X53A 3ZG7B 1H0MA 1LI9A 3FZCA 1PWCA 4GNUA 2QZ6A 4OLGA 2O9CA 4NKPA 1H5XA 4OOMA 2DNSA 2LB5A 4OP5A 3KX0X 1K54A 2D01A 1XFQA 2HDQA 5FQQA 1PRQA 3A3JA 2XROA 3HUNA 1HTZA 4CPKA 1EWZA 4X69A 2P08A 1K38A 3IX8A 3WS0A 4I3JA 3IXHA 3BLMA 3LO7A 2BLSA 4MLLA 1N4OA 2L0WA 3QP6A 3BRMA 3QP1A 4L9EA 1BLSA 3LIBA 2VV8A 5HAQA 2EX2A 4BJPA 3T1XA 3W4OA 4LPZA 2XRNA 1NXYA 4KZ4A 4DE3A 3BW6A 4EQ1A 3CWFA 2WAEA 5HPIA 4NXFA 1PZOA 3A3DA 3OPHA 4GHIB 5FDSA 4OPRA 2YKFA 2V8FA 3QP4A 1S66L 3O86A 4KUOA 4Q0HA 2GZAA 1FCMA 2C6WB 3IBRA 3P7NA 3C8CA 3BEBA 1YLYA 3V5MA 4UA7A 4C3QA 4OOYA 3D72A 4X56A 1GHPA 4N1XA 1MXOA 1BTLA 4U0TA 2OLVA 3BFFA 3UPOA 3BJNA 2EWVA 1OPXA 5EOEA 2L4RA 2P9VA 2OAP1 2PD8A 2WZZA 4EQIA 2K31A 3Q7VA 3C4OA 3TRCA 3NCKA 1G6AA 2VK3A 3A0VA 1GHIA 1STZA 3O88A 4CLCB 2JKRM 4S2IA 4H8RA 5FSRA 3I7JA 2HJ9C 4Y15A 5LBRA 5IHVA 5GL9A 4ARZB 4ESPA 4MCWA 2OV5A 3T4OA 1Y54A 5HDDA 3CUEA 1ZKJA 4ZJ3A 2PAVP 3O87A 3NOUC 4YOFA 4G3VA 1NY0A 5I94A 5FQJA 3T4SA 1EROA 3S7NA 4WELA 1L0DA 5M18A 1ZG6A 1OTAA 4B4XA 3ZG8B 5L8MA 5F6AA 4QB8A 1FCNA 2Q9MA 2XSSA 4Q0JA 4Q0IA 1N9OA 4Y2FA 4G3KA 2XGNA 3G31A 1IOUA 3OCLA 4OQGA 5A91A 3UE6A 3NHQA 3F1PA 2HP9A 4Z1WA 4MBFA 5D3OA 2QJ7A 4FUWA 3IF6C 1BLHA 5CGSA 3HBRA 5FAQA 4DE0A 2K7SA 3MBZA 5GLDA 3EQUA 3ZG0A 3LYXA 1CJFA 1KE4A 2X02A 3R4KA 2GNXA 5CX7A 1L2SA 2EFUA 4ZJ1A 5KIZA 3T1RA 2J9PA 3FYZA 1XJ4A 3V39A 2W3GA 2W1RA 3MQ0A 5M19A 4UQIM 4NXGA 1XJ2A 3W4QA 3RXXA 1WYCA 1W5DA 3VFHA 3CLOA 1LT0A 4LFUA 1YLZA 3IX3A 1AWIA 3U4LP 1H3QA 1L0EA 2ZOIA 2CMNA 1TEMA 4P6ZM 2R9WA 1IKGA 5HSQA 3P98A 1JWZA 4N92A 3BY8A 4UQIS 4JF4A 3M2JA 4EWFA 5E43A 4HBUA 2B5RA 3NDGA 1YMXA 5EE8A 4UA9A 2WKHA 4JBFA 3OCNA 4PM6A 4QY5A 5EM0A 4F3LA 4P6ZS 1MWUA 5FDHA 5EPHA 1SKOB 4MBKA 4UA6A 4EBLA 4JGQA 3ICYA 2HP5A 1I5QA 3LFVA 4IUHA 4M4XA 5AQ9A 3UDIA 2JKFA 3C7VA 1DJAA 4ID4A 2WGWB 2WKIA 3E4QA 1E4DA 4JGPA 5FATA 3IX4A 1ZC2A 4MN5A 4HHDA 3MZEA 5DTSA 3PHYA 3UPPA 4BMWA 1XGJA 3HCYA 3N8RA 3NDEA 3E0YA 5IS1A 1GHMA 3C38A 4YFMA 2INWA 4GJ4A 3OPPA 3RXWA 2ZL1B 4HQAA 1TF1A 1FCOA 4WMCD 4LRZE 3IWOA 2XA7S 3BFEA 3RFBA 2PHYA 3CPTA 4S2OA 3MFDA 3QNCA 5FQKA 2H0YA 4EU0A 4DDYA 5EV0A 3KSGA 4OKPA 3VP2A 4Y7PA 1FR1A 2P7JA 4HESA 4Y5FA 3MXQA 5DTTA 2O99A 4UHUA 4ME4A 4R38A 3VFFA 1G68A 1PFLA 2V8CA 5E2GA 4U3TA 5GLAA 3OPLA 3V3RA 3VOLA 3A3EA 1E3UA 1HD8A 4IBRA 1VQQA 4MBHA 2FFFB 3AGDA 3RH8B 4LCLA 2VKSA 3F1NA 5GLBA 2PU2A 4EEPA 5HWWA 3E98A 3PBNA 2ZQ9A 4DJ2A 5A90A 4S2LA 3LEZA 3UE1A 1O07A 4CQHA 1NRJA 2BG1A 2ZQ8A 2XH9A 2H5SA 2ZQCA 5F82A 4XT2A 2XLNA 3LR4A 4B88A 4DE2A 1H8ZA 1W8QA 2PDRA 5BOHA 4NXEA 4Y13A 1YPRA 1YLTA 4JXWA 3EEHA 4GCZA 2EWWA 4HNBA 2VZWA 2B95A 3UB7A 2HDSA 1ESUA 1TD5A 1PWGA 5EVLA 1LL9A 3FV7A 1ONHA 4GZBA 3L9KA 2Y79A 1G28A 1LL5A 3KO6A 5DTKA 1E3UD 3GRJA 2O0YA 4LV2A 1PIOA 1FR6A 3VP1A 2P74A 4C6YA 2W1TA 2Y2OA 5HAPA 3T4KA 3N8LA 4O01A 2ZC6B 1QMEA 3IXGA 4DKIA 5G18A 5HX9A 3OZHA 1SHVA 3NJAA 3G35A 4HIAA 4OP8A 4OQHA 2NUTC 5CHMA 4QY6A 4S2PA 1F98A 4I3IA 4OPQA 1Q2PA 5F68A 1YAXA 4QHCA 4Y0TA 3PBRA 1LHYA 3B3XA 4DF6A 1HZOA 2UWXA 1KVMA 4E3LA 4B93A 1XA7A 2RCXA 4FH4A 5TBMB 5EM1A 5FAPA 1KVLA 2WYXA 4BL3A 4JGRA 3BYDA 3NULA 2GJ3A 3SZTA 1PI5A 1YMSA 3B42A 2X01A 3G34A 3VE3A 1K25A 5FI7A 3EGDC 3FPWA 2J3WA 4IVKA 1NLZA 1F2KA 3BWLA 5DF8A 5AQ7A 4BWIA 3HLGA 1KGGA 4LLOB 3BM6A 3UMEA 4N9LA 1DP8A 1MC0A 4EESA 4RYEA 1W63Q 4PM7A 4HP4A 4LRXC 3UDFA 1U60A 4PAUA 4E3NA 3DTEA 5L2FA 5L09A 4L9GA 3PAEA 1NJ4A 4S2MA 4R4RA 1KE0A 3ULFA 2OOLA 2WGIA 1TS0A 1WE4A 1RCJA 3MS6A 2Z6CA 5J8XA 5MC7A 5FI6A 3E4PA 4XUXA 1FSYA 3RJUA 1KDWA 5HD3A 4IBXA 1RGZA 3H7WB 1E25A 2QKPA 1CEFA 2WKEA 4KG6A 4N1HA 4KZ9A 1K57C 3UMDA 4X68A 3ZG5A 4RX3A 2ZQ7A 3ITBA 4OOLA 2OWHA 3IT9A 4CLCC 3IWQA 3ZG9B 1BSGA 4RX2A 2PBDP 1MZUA 4BL2A 2CC1A 4KZ3A 1CK3A 4X1MA 4NXBA 1W63M 4GKUA 4K91A 3HREA 2I72A 3S1YA 2JKRI 3VP0A 1X0OA 3Q07A 2Y2NA 4EETB 3CI6A 1TDGA 2ZLYA 4HJ6A 1J3WA 4HH3A 1VHMA 1CI9A 3LR0A 2XK1A 4PHTA 3VOZA 4QWOA 2Y8HA 4CLCD 4O8GA 5CTNA 4PPRA 4KQOA 5FL3A 4WUJA 4LV0A 5A8BA 3G2YA 2HGVA 3NC8A 5G4YA 1T18A 1ERMA 2V1BA 3MF0A 1VETA 1IYOA 2EFXA 5K5BA 2A24A 4KENB 3HUOA 1KGEA 5FEFA 3WS2A 4EUZA 4R6LA 3H82B 3UN7A 1BLPA 1M6KA 3GQZA 4EV4A 1Y28A 3A0RA 2HPBA 1XJ6A 5AQAA 3IHBA 3JYIA 4S2KA 1XA1A 5DJUA 1ZHHB 1XP4A 1BT5A 5F69A 1JWVA 3WS1A 1ODVA 4H6JA 1J9MA 4KQRA 2KOIA 3PBQA 2ACGA 3HJIA 4ZTKA 2Y55A 5F83A 4BBVA 3C2WA 5AJGA 4E3JA 4E3IA 5TR7A 4OVDA 1YLWA 3MKEA 3MZDA 4IVIA 1MPLA 5CEDA 5F5YA 3PXPA 3C7UA 5CTMA 3IF6A 1SZVA 5AVEA 4M3KA 4GDBA 4EEUA 1D1JA 3P01A 1NYYA 1ERQA 3N7WA 4OQIA 2WKQA 1LSXA 4EW7A 3E2KA 2VX8A 4PM5A 2Y2HA 4MN6A 4GB7A 3HLFA 3E2LA 3HLWA 1IYPA 1EW0A 4I39A 3E4OA 3T50A 4FOFA 4Y0UA 3LIFA 3EQVA 5FQ9A 4IJGA 3N4IA 3V50A 5HW3A 1OTDA 2DCFA 4PM9A 3PTEA 4GOGA 5DKKA 5GHYA 3ZDJA 4FCFA 5IT5A 4N9KA 2Q9NA 3EWKA 2WKPA 3C4PA 2Y2KA 4UEYA 1UWNX 3HLDA 3A3FA 1PNEA 4NETA 2FZ0A 3LY3A 3QP8A 4CLCE 3TSGA 4P87A 4WMCA 4NEED 1NZOA 4JXSA 2H10A 5AQBA 2VV6A 1VEUA 1XKZA 3LCEA 4GN2A 3B47A 2QPNA 4BENA 1W8YA 2J3TC 1XPBA 3F1OA 4BD1A 2P9VB 4WL9A 5KSCA 4CJNA 2W3HA 1CEGA 3Q7VB 4PM8A 1S4SA 4X1LA 2XR0A 1P9WA 4D60A 2PR6A 3G32A 1N9LA 4YINA 5EVIA 5J7EA 2ZM2A 3OC2A 4BLMA 5E2FA 2XF3A 3QP2A 5DJTA 2V2FF 3Q81A 1Q2QA 2WZXA 1YSQA 5L10A 4GDNA 1XX2A 3KYZA 5KZHA 3MZFA 1PI4A 3D3OA 1W7FA 4HY8A 1TS6A 1I2SA 2JC7A 2ZC5B 2IA2A 2J3TD 4ZAMA 1ZTUA 3EOIA 5A92A 3PR6A 1RGYA 4EERA 4PKYA 5EVIC 5DFYA 3IF6B 2XD5A 3R7WA 3DW0A 4U0XA 1HVBA 2VGKA 1XFNA 2XDMA 5L07A 3T4QA 1ES3A 1TVFA 4UAAA 3CJMA 2EX9A 5HL1A 5J3WA 3HLBA 3TE8A 4HOIA 3UB8A 4QPRA 5DFXA 3CITA 3NY4A 5HWTA 2IWBA 3AGFA 2E8JA 4R1GA 4R23A 3SS5A 2Y2LA 2HV1A 3F1PB 3GTCA 4NG2A 2EXAA 3NOPC 1IKIA 5EVID 3K3DA 1OMEA 2MJ6A 2R9XA 3IS2A 1PZPA 5TGFA 2VGLM 1YT4A 4C75A 1L0GA 2QYBA 2OLUA 2AVXA 1K55C 2ZD8A 2PD7A 3CZDA 1DP9A 2M7UA 5FASA 3TJZC 3SH8A 3FKVA 1ES5A 3W8KA 4KZ8A 3KYEA 4IHQA 2ZOHA 2HDUA 4JXGA 2Z2LB 1W79A 2XFTA 2XFSA 3IH8A 1KDSA 1SDNA 5JYPA 3M2KA 3BFCA 3N6IA 4GS9A 2PYPA 4JGOA 2X71A 3IXBA 5HAIA 4QJGA 1MWTA 4XXRA 1IEMA 4R0QA 1K6SA 4X6TA 4MDZA 4DXBA 1IELA 2PR5A 4I5SA 1LI0A 4MNRA 1PYYA 1YSPA 2XD1A 5EECA 4F3LB 5I5LA 2A2LA 3NBLA 4HP9A 4X25A 4NK3A 1ES4A 4DJ3A 1FQGA 2JKTI 2Y2IA 2EX8A 4GD6A 3M6BA 3OBFA 4WLAA 1GCEA 3C30A 1ACFA 2E8IA 2VA0A 4WM9A 4AFIA 3C5AA 1LLBA 3IBJA 3LEQA 5HZHA 4E6XA 2V1AA 3BLSA 5CRFA 1OT6A 4K0WA 5HPFA 1K56D 2H0TA 3IWIA 3HVFA 3UDXA 3CPTB 2JCHA 2NUPC 3VSKA 4F94A 3GECA 3MQOA 2IWDA 1S1ZA 4ZRRA 2W0NA 1FOFA 3G2ZA 3S7OA 3ISGA 5TJJA 3UB6A 1BYWA 3ZCZA 2G2UA 3KSFA 1L0FA 4DMZA 2J80A 3ITAA 3G6OA 4WYYA 4LV3A 4GHIA 4EXOA 5JYOA 3S7QA 3DWZA 3VV4A 2Y2GA 1FSWA 3MKFA 2I9VA 3SS3A 3ZHHA 4DDSA 1S0WA 3BECA 2V0UA 4ZDXA 1H8MA 4OPZA 5HDCA 3F1NB 1Z09A 2UV0E 2QJ5A 3D4FA 3NI9A 5FI2A 5GLCA 1NWZA 2B18A 2Y2PA 3KYQA 3DTMA 4DE1A 2PYRA 3CHWP 4WBGA 2FFYA 1OTBA 2VGJA 4LV1A 3VP4A 2YKHA 4JPMA 2DMWA 2V1ZA 4WZ4A 3EGXC 1P97A 1CQAA 3Q82A 4XT2B 5GHZA 3IXDA 3T12B 2ZMVA 1K57A 1GA0A 3OLOA 1O7EA 4WEKA 1P9RA 4CLCA 3V3SA 1VM1A 4Z9QA 2W3FA 3CG5A 3UNWA 3UO9A 4HJ4A 3UB9A 4ARZA 2DRWA 4JF5A 1ALQA 3GSGA 4E3MA 1S67L 3FKWA 2Y2JA 3W4PA 4KZAA 1ES2A 1BULA 2D02A 4GLQA 2J7VA 5EOOA 2ZC3B 4RQ9A 2V20A 2GX5A 3QP5A 2PU4A 3VP3A 2EXBA 1DRMA 5FQIA 2W1TB 4KG2A 3RTYA 2QMIA 4LENA 5G4ZA 1C3BA 3OPRA 3PBOA 2LB9A 4XUZA 3UE0A 2BTFP 5F1FA 3ZVTA 2J8YA 3LIEA 3MSHA 2JHEA 2V0WA 3BFGA 1IFQA 4HEFA 1K54C 3AGEA 2M7VA 2WGVA 1JTDA 4QD4A 4G3WA 4L9FA 5CHJA 1L3LA 1V9YA 2XEPA 4KZBA 4ETXA 5C5KA 2Y2MA 3JVUA 5CHUA 4E3OA 5DF9A 1G6OA 4B9OA 3BFDA 5HWVA 4RVAA 5HARA 3FC7A 1DJBA 1QMFA 4BBTA 2W3DA 1MKIA 3LI9A 4O7DA 1ZG4A 3FPVA 5HDSA 1YLJA 2QWSA 2C5WB 3U2AA 1T1BA 3LIDA 1XXMA 2ZJ9A 2Q0OA 3P09A 1PWDA 4B4ZA 1GA9A 3MJQA 1V9ZA 4LRYC 3GV9A 4S2JA 1KGFA 4ZJ2A 3O3VA 1VB6A 2A3UA 2VV7A 4ZBEA 2K2NA 3N8SA 4R3JA 1WA9A 2ZMFA 1JTGA 3JPUA 1BZAA 1K6RA 2G2WA 3SH7A 4K08A 1G5UA 1F9IA 1TDLA 2RL3A 2WADA 3SS4A 4OONA 4KQDA 4GD8A 2WUQA 3Q7ZA 3UPNA 3KSHA 4EBNA 1DJCA 1LSWA 3JVVA 2PBYA 4Y0OA 4KG5A 2G7UA 1SKOA 4PKYG 1K4FA 3T1QB 2W3EA 2R78A 1MWRA 3DWKA 4D2OA 1TS7A 2W27A 2WGWA 4P6BA 2Y4AA 1BUEA 5FA7A 1MY8A 1T1CA 3SOIA 3TW8A 1I2WA 1FIKA 2GDNA 1F5MA 5CEBA 2EX6A 3LICA 4OPYA 3PAGA 3VMAA 4RA7A 2HDRA 1JVJA 1AXBA 2ZL1A 5FAOA 1S1YA 5DF7A 5E2EA 1GSXA 3CUEC 3IH9A 3NECA 2B02A 4WF0A 1PW8A 2ZC7A 1MWSA 2WK0A 1ONGA 3TG9A 4KZ7A 1YLPA 1K0KA 5DKLA 3G30A 4I38A 3H9WA 3WWXA 3K3CA 3VSLA 3M6HA 5U47A 4E04A 5IU1A 3S7PA 1JNUA 5E2HA 1SDEA 4OQ0A 1BLCA 4HH2A 2ZC4B 1VETB 3T4LA 3T1SA 3QHYA 3HL9A 1NYMA 2A24B 4JF6A 4R3AA 3MFXA 3ZGAB 3S4XA 2O9AA 2VJWA 4EUVA 2QHKA 4II7A 4A5RA 4IEDA 2Y59A 2JN7A 4KQQA 4OH0A 2HP6A 1OJGA 5GHXA 4GW9A 3NOTC 2ZM0A 1NLYA 1LL8A 3PBSA 3SH9A 1A0KA 3HLEA 1GSVA 3FG8A 4EBPA 3DBAA 2FH5A 3GMWA 3GDIA 5EUAA 4H6JB 1N9BA 3MR0A 4QU3A 5M1AA 4JLFA 4E6WA 2WKRA 1T19A 1K4EA 3HLCA 5CGWA 4O0PA 4LGWA 2KX6A 1DY6A 3BQ8A 5CECA 3SW1A 3ZNYA 2XA7M 1RP5A 5EVEA 3D9YA 3IHAA 1GSWA 2L1MA 5F1GA 5CXWA 1Y4OA 1YQSA 3DAVA 4HBTA 1OTEA 3MXSA 3UY6A 3GR2A 3PYPA 3LR3A 1S6RA 1H8YA 3LR5A 1K55A 4FH2A 4HJ3A 5DVAA 3KSIA 5CGXA 3A0SA 2O9BA 4DRTA 4I3AA 3EEAA 3W2ZA 1MKMA 3ZYTA 5HD5A 5J4EA 3UB5P 2WAFA 3Q1FA 5EFWA 3G4PA 3T4JA 1S4RA 3LI8A 2V9AA 2Z2MB 4Q8IA 1M40A 3V67A 1XGIA 3WRZA 3O5YA 2IWCA 5HFOA 2KLIA 4BD0A 3NIAA 5TBMA 1KOUA 1K56A 3WS4A 2ZQDA 4Y17A 3ZVWA 1VEUB 1MBLA 1FILA 2M1CA 4K0XA 4OLDA 1YM1A 3L7HA 4KZ5A 5FEGA 4KUKA 3F1OB 3MXRA 1HLUP 3MQQA 2H28A 2VGLS 4FTXA 2Z6DA 1Z6FA 2VLGA 1IYSA 3BY9A 2JBFA 4L0LA 1CI8A 4ETZA 5HL6A 5EVIB 4P85A 3OOVA 4WZ5A 3WS5A 1D7EA 2JKGA 4R3BA 4DXCA
chains in the Genus database with same CATH topology
1OT9A 4MMNA 3OLOA 4BBUA 4DN0A 5DJUA 4WEKA 1ZHHB 1P9RA 1UWPX 4CLCA 5F69A 1ODVA 3OCNA 1P0ZA 2OWJA 4H6JA 2W3FA 2KOIA 4F3LA 3PBQA 4P6ZS 1TS8A 4HJ4A 3HJIA 3UB9A 4ARZA 4JGQA 3ICYA 3C2WA 5AJGA 4BBVA 3LFVA 4IUHA 4M4XA 1N9NA 1S67L 4IUKA 3R7WB 3E4QA 5F5YA 3PXPA 4JGPA 4MN5A 4HHDA 5AVEA 3PHYA 2BASA 2D02A 4BMWA 3ZQ5A 3HCYA 4EEUA 3H7WA 4GLQA 3P01A 3E0YA 5IS1A 4RQ9A 2WKQA 1LSXA 4FSFA 2PT7A 3C38A 4EW7A 2GX5A 2VX8A 2INWA 4GJ4A 4WEJA 1DRMA 4HQAA 1TF1A 2W1TB 4MN6A 3UE3A 3RTYA 4LRZE 2XA7S 1EW0A 4I39A 5G4ZA 3K2NA 3RFBA 3E4OA 2PHYA 3T50A 3PBOA 2LB9A 4FOFA 4UQIS 3LIFA 2KDKA 3EQVA 4IJGA 3LIEA 1UGUA 1LSVA 2JHEA 2HF6A 2V0WA 1OTDA 1IFQA 4EU0A 1OTIA 5DKKA 3KSGA 4HI4A 4MN7A 2M7VA 4R70A 2OAQ1 3MMHA 4G3WA 4L9FA 2P7JA 1V9YA 4Y5FA 3IS2B 5IT5A 3MXQA 3LIAA 3VE4A 5C5KA 3LUQA 4ETXA 3PBTA 3JVUA 2O99A 3EWKA 4ME4A 4R38A 5DF9A 1G6OA 3HJKA 2WKPA 4B9OA 5HWVA 4UEYA 1UWNX 3FC7A 1XJ3A 5KSHA 3VOLA 4BBTA 2FZ0A 2HJEA 2W3DA 4CLCE 2JKTM 3LI9A 3FPVA 5HDSA 2QWSA 3U2AA 1T1BA 3LIDA 4NEED 1OJ5A 3RH8B 2VV6A 2VKSA 3F1NA 3T4TA 4EEPA 5HWWA 3E98A 2EA9A 3MJQA 1V9ZA 3B47A 3PBNA 2ZBBA 4LRYC 2J3TC 2P04A 4DJ2A 3F1OA 4YNRA 4WL9A 1T1AA 1VB6A 2VV7A 3BQAA 4GS9B 2K2NA 4WN5A 5AVFA 2W3HA 3B33A 1WA9A 4YWZA 1DP6A 1S4SA 3H82A 1P9WA 2PR6A 4CQHA 1NRJA 1D06A 2ZMFA 1N9LA 4K08A 4Y3IA 3CAXA 5J7EA 1F9IA 2VEAA 4XT2A 1YKDA 3LR4A 3OC2A 5DJTA 2PDRA 4NXEA 1YSQA 3EEHA 4KQDA 4GCZA 2EWWA 4HNBA 2VZWA 3UB7A 3KYZA 3KSHA 2O9CA 4NKPA 1LSWA 3D3OA 4HY8A 1TD5A 1TS6A 3JVVA 4OOMA 2IA2A 2J3TD 2LB5A 1ZTUA 3EOIA 3KX0X 2G7UA 3PR6A 4PKYG 2D01A 2W3EA 2R78A 1XFQA 4EERA 4PKYA 2Y79A 1G28A 1TS7A 2W27A 5DFYA 3R7WA 2XROA 3KO6A 1XFNA 1T1CA 3TW8A 2P08A 2O0YA 3T4QA 4I3JA 1F5MA 2L0WA 3LICA 5J3WA 3TE8A 4HOIA 3UB8A 4L9EA 4QPRA 5DFXA 3LIBA 3CITA 2VV8A 2W1TA 1S1YA 5HWTA 3T4KA 4BJPA 4O01A 1GSXA 3CUEC 2B02A 4WF0A 4LPZA 3F1PB 2XRNA 2HV1A 3BW6A 3NJAA 4HIAA 2NUTC 4EQ1A 3NOPC 1F98A 3CWFA 4I3IA 5F68A 1YAXA 5HPIA 4NXFA 3K3DA 3PBRA 4GHIB 2MJ6A 5DKLA 3IS2A 4B93A 4I38A 2YKFA 3H9WA 3K3CA 2VGLM 5TBMB 2QYBA 4JGRA 1S66L 5IU1A 4E04A 4KUOA 3S7PA 4Q0HA 1JNUA 2GJ3A 2GZAA 3B42A 2PD7A 3IBRA 3P7NA 1DP9A 2M7UA 3C8CA 3TJZC 3VE3A 4HH2A 3EGDC 3FPWA 3T4LA 2J3WA 2A24B 4R3AA 1NLZA 3MFXA 3D72A 4IHQA 2ZOHA 3BWLA 2O9AA 2VJWA 4BWIA 4EUVA 2QHKA 4LLOB 4II7A 3UMEA 2JN7A 3BJNA 2EWVA 1OPXA 1DP8A 1OJGA 2L4RA 1MC0A 4EESA 4GW9A 2OAP1 1W63Q 3NOTC 2PD8A 4GS9A 1NLYA 1LL8A 4HP4A 2PYPA 4JGOA 3PBSA 2K31A 4LRXC 4PAUA 3TRCA 4MDZA 4L9GA 1GSVA 3FG8A 3A0VA 2PR5A 1STZA 4CLCB 2JKRM 4I5SA 3DBAA 2FH5A 3GDIA 4H6JB 1YSPA 2HJ9C 5LBRA 3ULFA 4F3LB 3MR0A 5I5LA 2OOLA 2A2LA 4HP9A 4ARZB 4MCWA 1TS0A 3T4OA 2WKRA 1T19A 5HDDA 2Z6CA 3CUEA 5MC7A 4O0PA 3E4PA 2KX6A 4DJ3A 2JKTI 3BQ8A 3SW1A 5HD3A 2XA7M 3NOUC 4YOFA 3OBFA 4WLAA 3C30A 3H7WB 4G3VA 2QKPA 2VA0A 4AFIA 1GSWA 3IBJA 3T4SA 2L1MA 3S7NA 5HZHA 2V1AA 4WELA 3UMDA 1OTEA 1OT6A 5HPFA 3PYPA 1OTAA 3LR3A 5L8MA 3LR5A 4OOLA 5F6AA 2OWHA 4CLCC 2XSSA 4Q0JA 4HJ3A 2NUPC 4Q0IA 1N9OA 3KSIA 3A0SA 3GECA 1MZUA 2O9BA 4Y2FA 3MQOA 4G3KA 1IOUA 3OCLA 3EEAA 4I3AA 3W2ZA 1S1ZA 1MKMA 3ZYTA 5HD5A 4ZRRA 5J4EA 4NXBA 2W0NA 3UE6A 1W63M 3S7OA 3NHQA 3F1PA 5TJJA 3UB6A 5EFWA 1BYWA 4Z1WA 3T4JA 2JKRI 2QJ7A 3KSFA 1S4RA 3LI8A 1X0OA 2V9AA 4DMZA 2K7SA 4EETB 2J80A 3CI6A 3V67A 3G6OA 3EQUA 3O5YA 3LYXA 4HJ6A 4GHIA 4EXOA 4HH3A 1VHMA 3R4KA 2GNXA 3S7QA 5CX7A 2KLIA 3LR0A 3VV4A 4PHTA 5KIZA 2Y8HA 5TBMA 2I9VA 4CLCD 1KOUA 4O8GA 1XJ4A 4KQOA 2W3GA 2W1RA 2V0UA 3MQ0A 4WUJA 5FL3A 5A8BA 1H8MA 4UQIM 4NXGA 2HGVA 5HDCA 1XJ2A 3F1NB 2M1CA 2QJ5A 5G4YA 1T18A 3CLOA 1LT0A 1NWZA 2V1BA 3MF0A 2B18A 4KUKA 3F1OB 3MQQA 3KYQA 2H28A 2VGLS 2PYRA 2Z6DA 5K5BA 2A24A 2VLGA 3BY9A 1H3QA 1OTBA 2ZOIA 4R6LA 2CMNA 3H82B 2YKHA 2DMWA 4P6ZM 5HSQA 4L0LA 4ETZA 3EGXC 5HL6A 1P97A 3OOVA 1Y28A 4XT2B 1D7EA 3A0RA 1XJ6A 3BY8A 2ZMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT9 A;  3OLO A;  4BBU A;  5DJU A;  1UWP X;  5F69 A;  1ODV A;  1P0Z A;  2OWJ A;  4H6J A;  4F3L A;  1TS8 A;  4HJ4 A;  3HJI A;  3UB9 A;  4JGQ A;  3ICY A;  3C2W A;  4BBV A;  4M4X A;  1N9N A;  1S67 L;  3E4Q A;  5F5Y A;  4JGP A;  4MN5 A;  4HHD A;  5AVE A;  3PHY A;  2BAS A;  2D02 A;  3ZQ5 A;  4EEU A;  3H7W A;  5IS1 A;  4RQ9 A;  2WKQ A;  1LSX A;  4EW7 A;  2INW A;  1DRM A;  4HQA A;  4MN6 A;  3RTY A;  4LRZ E;  1EW0 A;  4I39 A;  5G4Z A;  3E4O A;  2PHY A;  3T50 A;  3LIF A;  2KDK A;  3LIE A;  1UGU A;  1LSV A;  2JHE A;  2V0W A;  1OTD A;  1OTI A;  5DKK A;  4HI4 A;  4R70 A;  4L9F A;  2P7J A;  1V9Y A;  3IS2 B;  3MXQ A;  3LIA A;  3VE4 A;  3LUQ A;  3EWK A;  4R38 A;  3HJK A;  2WKP A;  4B9O A;  5HWV A;  1UWN X;  3FC7 A;  1XJ3 A;  3VOL A;  4BBT A;  3LI9 A;  5HDS A;  2QWS A;  1T1B A;  3LID A;  1OJ5 A;  3RH8 B;  2VV6 A;  3F1N A;  4EEP A;  5HWW A;  2EA9 A;  3MJQ A;  1V9Z A;  2ZBB A;  4LRY C;  4DJ2 A;  3F1O A;  4WL9 A;  1T1A A;  1VB6 A;  2VV7 A;  4GS9 B;  4WN5 A;  5AVF A;  3B33 A;  1WA9 A;  4YWZ A;  1DP6 A;  1S4S A;  3H82 A;  2PR6 A;  1D06 A;  1N9L A;  4K08 A;  3CAX A;  5J7E A;  1F9I A;  2VEA A;  4XT2 A;  5DJT A;  2PDR A;  4NXE A;  3EEH A;  4KQD A;  4GCZ A;  4HNB A;  3UB7 A;  1LSW A;  4HY8 A;  1TS6 A;  3KX0 X;  4PKY G;  2D01 A;  2R78 A;  1XFQ A;  4EER A;  4PKY A;  1G28 A;  1TS7 A;  2W27 A;  1XFN A;  1T1C A;  4I3J A;  2L0W A;  3LIC A;  5J3W A;  4HOI A;  3UB8 A;  4L9E A;  3LIB A;  2VV8 A;  1S1Y A;  5HWT A;  1GSX A;  2B02 A;  4WF0 A;  4LPZ A;  3F1P B;  2HV1 A;  3NJA A;  4HIA A;  4EQ1 A;  3NOP C;  1F98 A;  3CWF A;  4I3I A;  5F68 A;  4NXF A;  3K3D A;  4GHI B;  5DKL A;  3IS2 A;  4I38 A;  2YKF A;  3H9W A;  3K3C A;  5TBM B;  4JGR A;  1S66 L;  5IU1 A;  4E04 A;  4KUO A;  1JNU A;  2GJ3 A;  2PD7 A;  3IBR A;  3P7N A;  1DP9 A;  3C8C A;  3VE3 A;  4HH2 A;  2A24 B;  4R3A A;  3MFX A;  3D72 A;  2ZOH A;  3BWL A;  2QHK A;  4LLO B;  3UME A;  2JN7 A;  1DP8 A;  1OJG A;  2L4R A;  4EES A;  4GW9 A;  3NOT C;  2PD8 A;  4GS9 A;  1LL8 A;  4HP4 A;  2PYP A;  4JGO A;  4LRX C;  4L9G A;  1GSV A;  3FG8 A;  3A0V A;  2PR5 A;  4I5S A;  3GDI A;  4H6J B;  3ULF A;  4F3L B;  3MR0 A;  5I5L A;  2OOL A;  4HP9 A;  1TS0 A;  2WKR A;  1T19 A;  5HDD A;  2Z6C A;  3E4P A;  2KX6 A;  4DJ3 A;  3SW1 A;  5HD3 A;  3NOU C;  4WLA A;  3H7W B;  2QKP A;  1GSW A;  2L1M A;  5HZH A;  2V1A A;  3UMD A;  1OTE A;  1OT6 A;  3PYP A;  1OTA A;  5F6A A;  2OWH A;  4HJ3 A;  1N9O A;  3A0S A;  1MZU A;  3GEC A;  3MQO A;  4I3A A;  1S1Z A;  5HD5 A;  5J4E A;  4NXB A;  2W0N A;  3UE6 A;  3NHQ A;  3F1P A;  3UB6 A;  5EFW A;  1BYW A;  2QJ7 A;  1S4R A;  3LI8 A;  1X0O A;  2V9A A;  2K7S A;  4EET B;  2J80 A;  3G6O A;  3LYX A;  4HJ6 A;  4GHI A;  4EXO A;  4HH3 A;  5KIZ A;  5TBM A;  2I9V A;  1KOU A;  1XJ4 A;  4WUJ A;  2V0U A;  5A8B A;  4NXG A;  5HDC A;  1XJ2 A;  3F1N B;  2M1C A;  2QJ5 A;  5G4Y A;  1T18 A;  3CLO A;  1LT0 A;  1NWZ A;  2V1B A;  4KUK A;  3F1O B;  3MQQ A;  2H28 A;  2PYR A;  2Z6D A;  2A24 A;  2VLG A;  3BY9 A;  1OTB A;  2ZOI A;  4R6L A;  2CMN A;  3H82 B;  2YKH A;  5HSQ A;  1P97 A;  1Y28 A;  4XT2 B;  1D7E A;  3A0R A;  1XJ6 A;  3BY8 A; 
#chains in the Genus database with same CATH topology
 1OT9 A;  4MMN A;  4R4S A;  4KZ6 A;  4BBU A;  4DN0 A;  4X55 A;  1UWP X;  3LGO A;  5FQM A;  3IF5 A;  1P0Z A;  2OWJ A;  1TS8 A;  3VOY A;  2OSU A;  2Y91 A;  1PW1 A;  3CMZ A;  1N9N A;  2Y2Q A;  4WZ5 C;  4IUK A;  3R7W B;  2PRF A;  5CER A;  1KE3 A;  5TFQ A;  2BAS A;  3ZQ5 A;  3H7W A;  4P0M A;  4FSF A;  1JWP A;  2PT7 A;  2ZM8 A;  4E3K A;  4WEJ A;  4PMA A;  4BQM A;  3UE3 A;  3IQA A;  3LY4 A;  3K2N A;  2KDK A;  3ZFZ A;  1UGU A;  1LSV A;  2HF6 A;  2JE5 A;  1OTI A;  1CF0 A;  3FWL A;  4HI4 A;  4MN7 A;  3HUM A;  4R70 A;  1SKF A;  1IYQ A;  2OAQ 1;  3MMH A;  3IS2 B;  3LIA A;  3VE4 A;  3LUQ A;  3PBT A;  3WRT A;  2HZ5 A;  3TOI A;  3HJK A;  1ESI A;  1XJ3 A;  5KSH A;  5KMW A;  1NRF A;  2J9O A;  1SCW A;  2HJE A;  4LCM A;  4JKT A;  2JKT M;  4S2N A;  2ZMA A;  5A93 A;  1OJ5 A;  3GVB A;  2XQZ A;  3DTI A;  3T4T A;  3DTK A;  2EA9 A;  1EI5 A;  2ZBB A;  2P04 A;  3QNB A;  3A3I A;  4JXV A;  4YNR A;  4MEZ A;  1T1A A;  3BQA A;  4GS9 B;  3S22 A;  4WN5 A;  5AVF A;  3ZNT A;  3B33 A;  4YWZ A;  1DP6 A;  2ZQA A;  3H82 A;  4FD8 A;  1WYB A;  1D06 A;  2A49 A;  4Y3I A;  3CAX A;  2VEA A;  1YKD A;  4S2N C;  1NZU A;  4X53 A;  3ZG7 B;  1H0M A;  1LI9 A;  3FZC A;  1PWC A;  4GNU A;  2QZ6 A;  4OLG A;  2O9C A;  4NKP A;  1H5X A;  4OOM A;  2DNS A;  2LB5 A;  4OP5 A;  3KX0 X;  1K54 A;  2D01 A;  1XFQ A;  2HDQ A;  5FQQ A;  1PRQ A;  3A3J A;  2XRO A;  3HUN A;  1HTZ A;  4CPK A;  1EWZ A;  4X69 A;  2P08 A;  1K38 A;  3IX8 A;  3WS0 A;  4I3J A;  3IXH A;  3BLM A;  3LO7 A;  2BLS A;  4MLL A;  1N4O A;  2L0W A;  3QP6 A;  3BRM A;  3QP1 A;  4L9E A;  1BLS A;  3LIB A;  2VV8 A;  5HAQ A;  2EX2 A;  4BJP A;  3T1X A;  3W4O A;  4LPZ A;  2XRN A;  1NXY A;  4KZ4 A;  4DE3 A;  3BW6 A;  4EQ1 A;  3CWF A;  2WAE A;  5HPI A;  4NXF A;  1PZO A;  3A3D A;  3OPH A;  4GHI B;  5FDS A;  4OPR A;  2YKF A;  2V8F A;  3QP4 A;  1S66 L;  3O86 A;  4KUO A;  4Q0H A;  2GZA A;  1FCM A;  2C6W B;  3IBR A;  3P7N A;  3C8C A;  3BEB A;  1YLY A;  3V5M A;  4UA7 A;  4C3Q A;  4OOY A;  3D72 A;  4X56 A;  1GHP A;  4N1X A;  1MXO A;  1BTL A;  4U0T A;  2OLV A;  3BFF A;  3UPO A;  3BJN A;  2EWV A;  1OPX A;  5EOE A;  2L4R A;  2P9V A;  2OAP 1;  2PD8 A;  2WZZ A;  4EQI A;  2K31 A;  3Q7V A;  3C4O A;  3TRC A;  3NCK A;  1G6A A;  2VK3 A;  3A0V A;  1GHI A;  1STZ A;  3O88 A;  4CLC B;  2JKR M;  4S2I A;  4H8R A;  5FSR A;  3I7J A;  2HJ9 C;  4Y15 A;  5LBR A;  5IHV A;  5GL9 A;  4ARZ B;  4ESP A;  4MCW A;  2OV5 A;  3T4O A;  1Y54 A;  5HDD A;  3CUE A;  1ZKJ A;  4ZJ3 A;  2PAV P;  3O87 A;  3NOU C;  4YOF A;  4G3V A;  1NY0 A;  5I94 A;  5FQJ A;  3T4S A;  1ERO A;  3S7N A;  4WEL A;  1L0D A;  5M18 A;  1ZG6 A;  1OTA A;  4B4X A;  3ZG8 B;  5L8M A;  5F6A A;  4QB8 A;  1FCN A;  2Q9M A;  2XSS A;  4Q0J A;  4Q0I A;  1N9O A;  4Y2F A;  4G3K A;  2XGN A;  3G31 A;  1IOU A;  3OCL A;  4OQG A;  5A91 A;  3UE6 A;  3NHQ A;  3F1P A;  2HP9 A;  4Z1W A;  4MBF A;  5D3O A;  2QJ7 A;  4FUW A;  3IF6 C;  1BLH A;  5CGS A;  3HBR A;  5FAQ A;  4DE0 A;  2K7S A;  3MBZ A;  5GLD A;  3EQU A;  3ZG0 A;  3LYX A;  1CJF A;  1KE4 A;  2X02 A;  3R4K A;  2GNX A;  5CX7 A;  1L2S A;  2EFU A;  4ZJ1 A;  5KIZ A;  3T1R A;  2J9P A;  3FYZ A;  1XJ4 A;  3V39 A;  2W3G A;  2W1R A;  3MQ0 A;  5M19 A;  4UQI M;  4NXG A;  1XJ2 A;  3W4Q A;  3RXX A;  1WYC A;  1W5D A;  3VFH A;  3CLO A;  1LT0 A;  4LFU A;  1YLZ A;  3IX3 A;  1AWI A;  3U4L P;  1H3Q A;  1L0E A;  2ZOI A;  2CMN A;  1TEM A;  4P6Z M;  2R9W A;  1IKG A;  5HSQ A;  3P98 A;  1JWZ A;  4N92 A;  3BY8 A;  4UQI S;  4JF4 A;  3M2J A;  4EWF A;  5E43 A;  4HBU A;  2B5R A;  3NDG A;  1YMX A;  5EE8 A;  4UA9 A;  2WKH A;  4JBF A;  3OCN A;  4PM6 A;  4QY5 A;  5EM0 A;  4F3L A;  4P6Z S;  1MWU A;  5FDH A;  5EPH A;  1SKO B;  4MBK A;  4UA6 A;  4EBL A;  4JGQ A;  3ICY A;  2HP5 A;  1I5Q A;  3LFV A;  4IUH A;  4M4X A;  5AQ9 A;  3UDI A;  2JKF A;  3C7V A;  1DJA A;  4ID4 A;  2WGW B;  2WKI A;  3E4Q A;  1E4D A;  4JGP A;  5FAT A;  3IX4 A;  1ZC2 A;  4MN5 A;  4HHD A;  3MZE A;  5DTS A;  3PHY A;  3UPP A;  4BMW A;  1XGJ A;  3HCY A;  3N8R A;  3NDE A;  3E0Y A;  5IS1 A;  1GHM A;  3C38 A;  4YFM A;  2INW A;  4GJ4 A;  3OPP A;  3RXW A;  2ZL1 B;  4HQA A;  1TF1 A;  1FCO A;  4WMC D;  4LRZ E;  3IWO A;  2XA7 S;  3BFE A;  3RFB A;  2PHY A;  3CPT A;  4S2O A;  3MFD A;  3QNC A;  5FQK A;  2H0Y A;  4EU0 A;  4DDY A;  5EV0 A;  3KSG A;  4OKP A;  3VP2 A;  4Y7P A;  1FR1 A;  2P7J A;  4HES A;  4Y5F A;  3MXQ A;  5DTT A;  2O99 A;  4UHU A;  4ME4 A;  4R38 A;  3VFF A;  1G68 A;  1PFL A;  2V8C A;  5E2G A;  4U3T A;  5GLA A;  3OPL A;  3V3R A;  3VOL A;  3A3E A;  1E3U A;  1HD8 A;  4IBR A;  1VQQ A;  4MBH A;  2FFF B;  3AGD A;  3RH8 B;  4LCL A;  2VKS A;  3F1N A;  5GLB A;  2PU2 A;  4EEP A;  5HWW A;  3E98 A;  3PBN A;  2ZQ9 A;  4DJ2 A;  5A90 A;  4S2L A;  3LEZ A;  3UE1 A;  1O07 A;  4CQH A;  1NRJ A;  2BG1 A;  2ZQ8 A;  2XH9 A;  2H5S A;  2ZQC A;  5F82 A;  4XT2 A;  2XLN A;  3LR4 A;  4B88 A;  4DE2 A;  1H8Z A;  1W8Q A;  2PDR A;  5BOH A;  4NXE A;  4Y13 A;  1YPR A;  1YLT A;  4JXW A;  3EEH A;  4GCZ A;  2EWW A;  4HNB A;  2VZW A;  2B95 A;  3UB7 A;  2HDS A;  1ESU A;  1TD5 A;  1PWG A;  5EVL A;  1LL9 A;  3FV7 A;  1ONH A;  4GZB A;  3L9K A;  2Y79 A;  1G28 A;  1LL5 A;  3KO6 A;  5DTK A;  1E3U D;  3GRJ A;  2O0Y A;  4LV2 A;  1PIO A;  1FR6 A;  3VP1 A;  2P74 A;  4C6Y A;  2W1T A;  2Y2O A;  5HAP A;  3T4K A;  3N8L A;  4O01 A;  2ZC6 B;  1QME A;  3IXG A;  4DKI A;  5G18 A;  5HX9 A;  3OZH A;  1SHV A;  3NJA A;  3G35 A;  4HIA A;  4OP8 A;  4OQH A;  2NUT C;  5CHM A;  4QY6 A;  4S2P A;  1F98 A;  4I3I A;  4OPQ A;  1Q2P A;  5F68 A;  1YAX A;  4QHC A;  4Y0T A;  3PBR A;  1LHY A;  3B3X A;  4DF6 A;  1HZO A;  2UWX A;  1KVM A;  4E3L A;  4B93 A;  1XA7 A;  2RCX A;  4FH4 A;  5TBM B;  5EM1 A;  5FAP A;  1KVL A;  2WYX A;  4BL3 A;  4JGR A;  3BYD A;  3NUL A;  2GJ3 A;  3SZT A;  1PI5 A;  1YMS A;  3B42 A;  2X01 A;  3G34 A;  3VE3 A;  1K25 A;  5FI7 A;  3EGD C;  3FPW A;  2J3W A;  4IVK A;  1NLZ A;  1F2K A;  3BWL A;  5DF8 A;  5AQ7 A;  4BWI A;  3HLG A;  1KGG A;  4LLO B;  3BM6 A;  3UME A;  4N9L A;  1DP8 A;  1MC0 A;  4EES A;  4RYE A;  1W63 Q;  4PM7 A;  4HP4 A;  4LRX C;  3UDF A;  1U60 A;  4PAU A;  4E3N A;  3DTE A;  5L2F A;  5L09 A;  4L9G A;  3PAE A;  1NJ4 A;  4S2M A;  4R4R A;  1KE0 A;  3ULF A;  2OOL A;  2WGI A;  1TS0 A;  1WE4 A;  1RCJ A;  3MS6 A;  2Z6C A;  5J8X A;  5MC7 A;  5FI6 A;  3E4P A;  4XUX A;  1FSY A;  3RJU A;  1KDW A;  5HD3 A;  4IBX A;  1RGZ A;  3H7W B;  1E25 A;  2QKP A;  1CEF A;  2WKE A;  4KG6 A;  4N1H A;  4KZ9 A;  1K57 C;  3UMD A;  4X68 A;  3ZG5 A;  4RX3 A;  2ZQ7 A;  3ITB A;  4OOL A;  2OWH A;  3IT9 A;  4CLC C;  3IWQ A;  3ZG9 B;  1BSG A;  4RX2 A;  2PBD P;  1MZU A;  4BL2 A;  2CC1 A;  4KZ3 A;  1CK3 A;  4X1M A;  4NXB A;  1W63 M;  4GKU A;  4K91 A;  3HRE A;  2I72 A;  3S1Y A;  2JKR I;  3VP0 A;  1X0O A;  3Q07 A;  2Y2N A;  4EET B;  3CI6 A;  1TDG A;  2ZLY A;  4HJ6 A;  1J3W A;  4HH3 A;  1VHM A;  1CI9 A;  3LR0 A;  2XK1 A;  4PHT A;  3VOZ A;  4QWO A;  2Y8H A;  4CLC D;  4O8G A;  5CTN A;  4PPR A;  4KQO A;  5FL3 A;  4WUJ A;  4LV0 A;  5A8B A;  3G2Y A;  2HGV A;  3NC8 A;  5G4Y A;  1T18 A;  1ERM A;  2V1B A;  3MF0 A;  1VET A;  1IYO A;  2EFX A;  5K5B A;  2A24 A;  4KEN B;  3HUO A;  1KGE A;  5FEF A;  3WS2 A;  4EUZ A;  4R6L A;  3H82 B;  3UN7 A;  1BLP A;  1M6K A;  3GQZ A;  4EV4 A;  1Y28 A;  3A0R A;  2HPB A;  1XJ6 A;  5AQA A;  3IHB A;  3JYI A;  4S2K A;  1XA1 A;  5DJU A;  1ZHH B;  1XP4 A;  1BT5 A;  5F69 A;  1JWV A;  3WS1 A;  1ODV A;  4H6J A;  1J9M A;  4KQR A;  2KOI A;  3PBQ A;  2ACG A;  3HJI A;  4ZTK A;  2Y55 A;  5F83 A;  4BBV A;  3C2W A;  5AJG A;  4E3J A;  4E3I A;  5TR7 A;  4OVD A;  1YLW A;  3MKE A;  3MZD A;  4IVI A;  1MPL A;  5CED A;  5F5Y A;  3PXP A;  3C7U A;  5CTM A;  3IF6 A;  1SZV A;  5AVE A;  4M3K A;  4GDB A;  4EEU A;  1D1J A;  3P01 A;  1NYY A;  1ERQ A;  3N7W A;  4OQI A;  2WKQ A;  1LSX A;  4EW7 A;  3E2K A;  2VX8 A;  4PM5 A;  2Y2H A;  4MN6 A;  4GB7 A;  3HLF A;  3E2L A;  3HLW A;  1IYP A;  1EW0 A;  4I39 A;  3E4O A;  3T50 A;  4FOF A;  4Y0U A;  3LIF A;  3EQV A;  5FQ9 A;  4IJG A;  3N4I A;  3V50 A;  5HW3 A;  1OTD A;  2DCF A;  4PM9 A;  3PTE A;  4GOG A;  5DKK A;  5GHY A;  3ZDJ A;  4FCF A;  5IT5 A;  4N9K A;  2Q9N A;  3EWK A;  2WKP A;  3C4P A;  2Y2K A;  4UEY A;  1UWN X;  3HLD A;  3A3F A;  1PNE A;  4NET A;  2FZ0 A;  3LY3 A;  3QP8 A;  4CLC E;  3TSG A;  4P87 A;  4WMC A;  4NEE D;  1NZO A;  4JXS A;  2H10 A;  5AQB A;  2VV6 A;  1VEU A;  1XKZ A;  3LCE A;  4GN2 A;  3B47 A;  2QPN A;  4BEN A;  1W8Y A;  2J3T C;  1XPB A;  3F1O A;  4BD1 A;  2P9V B;  4WL9 A;  5KSC A;  4CJN A;  2W3H A;  1CEG A;  3Q7V B;  4PM8 A;  1S4S A;  4X1L A;  2XR0 A;  1P9W A;  4D60 A;  2PR6 A;  3G32 A;  1N9L A;  4YIN A;  5EVI A;  5J7E A;  2ZM2 A;  3OC2 A;  4BLM A;  5E2F A;  2XF3 A;  3QP2 A;  5DJT A;  2V2F F;  3Q81 A;  1Q2Q A;  2WZX A;  1YSQ A;  5L10 A;  4GDN A;  1XX2 A;  3KYZ A;  5KZH A;  3MZF A;  1PI4 A;  3D3O A;  1W7F A;  4HY8 A;  1TS6 A;  1I2S A;  2JC7 A;  2ZC5 B;  2IA2 A;  2J3T D;  4ZAM A;  1ZTU A;  3EOI A;  5A92 A;  3PR6 A;  1RGY A;  4EER A;  4PKY A;  5EVI C;  5DFY A;  3IF6 B;  2XD5 A;  3R7W A;  3DW0 A;  4U0X A;  1HVB A;  2VGK A;  1XFN A;  2XDM A;  5L07 A;  3T4Q A;  1ES3 A;  1TVF A;  4UAA A;  3CJM A;  2EX9 A;  5HL1 A;  5J3W A;  3HLB A;  3TE8 A;  4HOI A;  3UB8 A;  4QPR A;  5DFX A;  3CIT A;  3NY4 A;  5HWT A;  2IWB A;  3AGF A;  2E8J A;  4R1G A;  4R23 A;  3SS5 A;  2Y2L A;  2HV1 A;  3F1P B;  3GTC A;  4NG2 A;  2EXA A;  3NOP C;  1IKI A;  5EVI D;  3K3D A;  1OME A;  2MJ6 A;  2R9X A;  3IS2 A;  1PZP A;  5TGF A;  2VGL M;  1YT4 A;  4C75 A;  1L0G A;  2QYB A;  2OLU A;  2AVX A;  1K55 C;  2ZD8 A;  2PD7 A;  3CZD A;  1DP9 A;  2M7U A;  5FAS A;  3TJZ C;  3SH8 A;  3FKV A;  1ES5 A;  3W8K A;  4KZ8 A;  3KYE A;  4IHQ A;  2ZOH A;  2HDU A;  4JXG A;  2Z2L B;  1W79 A;  2XFT A;  2XFS A;  3IH8 A;  1KDS A;  1SDN A;  5JYP A;  3M2K A;  3BFC A;  3N6I A;  4GS9 A;  2PYP A;  4JGO A;  2X71 A;  3IXB A;  5HAI A;  4QJG A;  1MWT A;  4XXR A;  1IEM A;  4R0Q A;  1K6S A;  4X6T A;  4MDZ A;  4DXB A;  1IEL A;  2PR5 A;  4I5S A;  1LI0 A;  4MNR A;  1PYY A;  1YSP A;  2XD1 A;  5EEC A;  4F3L B;  5I5L A;  2A2L A;  3NBL A;  4HP9 A;  4X25 A;  4NK3 A;  1ES4 A;  4DJ3 A;  1FQG A;  2JKT I;  2Y2I A;  2EX8 A;  4GD6 A;  3M6B A;  3OBF A;  4WLA A;  1GCE A;  3C30 A;  1ACF A;  2E8I A;  2VA0 A;  4WM9 A;  4AFI A;  3C5A A;  1LLB A;  3IBJ A;  3LEQ A;  5HZH A;  4E6X A;  2V1A A;  3BLS A;  5CRF A;  1OT6 A;  4K0W A;  5HPF A;  1K56 D;  2H0T A;  3IWI A;  3HVF A;  3UDX A;  3CPT B;  2JCH A;  2NUP C;  3VSK A;  4F94 A;  3GEC A;  3MQO A;  2IWD A;  1S1Z A;  4ZRR A;  2W0N A;  1FOF A;  3G2Z A;  3S7O A;  3ISG A;  5TJJ A;  3UB6 A;  1BYW A;  3ZCZ A;  2G2U A;  3KSF A;  1L0F A;  4DMZ A;  2J80 A;  3ITA A;  3G6O A;  4WYY A;  4LV3 A;  4GHI A;  4EXO A;  5JYO A;  3S7Q A;  3DWZ A;  3VV4 A;  2Y2G A;  1FSW A;  3MKF A;  2I9V A;  3SS3 A;  3ZHH A;  4DDS A;  1S0W A;  3BEC A;  2V0U A;  4ZDX A;  1H8M A;  4OPZ A;  5HDC A;  3F1N B;  1Z09 A;  2UV0 E;  2QJ5 A;  3D4F A;  3NI9 A;  5FI2 A;  5GLC A;  1NWZ A;  2B18 A;  2Y2P A;  3KYQ A;  3DTM A;  4DE1 A;  2PYR A;  3CHW P;  4WBG A;  2FFY A;  1OTB A;  2VGJ A;  4LV1 A;  3VP4 A;  2YKH A;  4JPM A;  2DMW A;  2V1Z A;  4WZ4 A;  3EGX C;  1P97 A;  1CQA A;  3Q82 A;  4XT2 B;  5GHZ A;  3IXD A;  3T12 B;  2ZMV A;  1K57 A;  1GA0 A;  3OLO A;  1O7E A;  4WEK A;  1P9R A;  4CLC A;  3V3S A;  1VM1 A;  4Z9Q A;  2W3F A;  3CG5 A;  3UNW A;  3UO9 A;  4HJ4 A;  3UB9 A;  4ARZ A;  2DRW A;  4JF5 A;  1ALQ A;  3GSG A;  4E3M A;  1S67 L;  3FKW A;  2Y2J A;  3W4P A;  4KZA A;  1ES2 A;  1BUL A;  2D02 A;  4GLQ A;  2J7V A;  5EOO A;  2ZC3 B;  4RQ9 A;  2V20 A;  2GX5 A;  3QP5 A;  2PU4 A;  3VP3 A;  2EXB A;  1DRM A;  5FQI A;  2W1T B;  4KG2 A;  3RTY A;  2QMI A;  4LEN A;  5G4Z A;  1C3B A;  3OPR A;  3PBO A;  2LB9 A;  4XUZ A;  3UE0 A;  2BTF P;  5F1F A;  3ZVT A;  2J8Y A;  3LIE A;  3MSH A;  2JHE A;  2V0W A;  3BFG A;  1IFQ A;  4HEF A;  1K54 C;  3AGE A;  2M7V A;  2WGV A;  1JTD A;  4QD4 A;  4G3W A;  4L9F A;  5CHJ A;  1L3L A;  1V9Y A;  2XEP A;  4KZB A;  4ETX A;  5C5K A;  2Y2M A;  3JVU A;  5CHU A;  4E3O A;  5DF9 A;  1G6O A;  4B9O A;  3BFD A;  5HWV A;  4RVA A;  5HAR A;  3FC7 A;  1DJB A;  1QMF A;  4BBT A;  2W3D A;  1MKI A;  3LI9 A;  4O7D A;  1ZG4 A;  3FPV A;  5HDS A;  1YLJ A;  2QWS A;  2C5W B;  3U2A A;  1T1B A;  3LID A;  1XXM A;  2ZJ9 A;  2Q0O A;  3P09 A;  1PWD A;  4B4Z A;  1GA9 A;  3MJQ A;  1V9Z A;  4LRY C;  3GV9 A;  4S2J A;  1KGF A;  4ZJ2 A;  3O3V A;  1VB6 A;  2A3U A;  2VV7 A;  4ZBE A;  2K2N A;  3N8S A;  4R3J A;  1WA9 A;  2ZMF A;  1JTG A;  3JPU A;  1BZA A;  1K6R A;  2G2W A;  3SH7 A;  4K08 A;  1G5U A;  1F9I A;  1TDL A;  2RL3 A;  2WAD A;  3SS4 A;  4OON A;  4KQD A;  4GD8 A;  2WUQ A;  3Q7Z A;  3UPN A;  3KSH A;  4EBN A;  1DJC A;  1LSW A;  3JVV A;  2PBY A;  4Y0O A;  4KG5 A;  2G7U A;  1SKO A;  4PKY G;  1K4F A;  3T1Q B;  2W3E A;  2R78 A;  1MWR A;  3DWK A;  4D2O A;  1TS7 A;  2W27 A;  2WGW A;  4P6B A;  2Y4A A;  1BUE A;  5FA7 A;  1MY8 A;  1T1C A;  3SOI A;  3TW8 A;  1I2W A;  1FIK A;  2GDN A;  1F5M A;  5CEB A;  2EX6 A;  3LIC A;  4OPY A;  3PAG A;  3VMA A;  4RA7 A;  2HDR A;  1JVJ A;  1AXB A;  2ZL1 A;  5FAO A;  1S1Y A;  5DF7 A;  5E2E A;  1GSX A;  3CUE C;  3IH9 A;  3NEC A;  2B02 A;  4WF0 A;  1PW8 A;  2ZC7 A;  1MWS A;  2WK0 A;  1ONG A;  3TG9 A;  4KZ7 A;  1YLP A;  1K0K A;  5DKL A;  3G30 A;  4I38 A;  3H9W A;  3WWX A;  3K3C A;  3VSL A;  3M6H A;  5U47 A;  4E04 A;  5IU1 A;  3S7P A;  1JNU A;  5E2H A;  1SDE A;  4OQ0 A;  1BLC A;  4HH2 A;  2ZC4 B;  1VET B;  3T4L A;  3T1S A;  3QHY A;  3HL9 A;  1NYM A;  2A24 B;  4JF6 A;  4R3A A;  3MFX A;  3ZGA B;  3S4X A;  2O9A A;  2VJW A;  4EUV A;  2QHK A;  4II7 A;  4A5R A;  4IED A;  2Y59 A;  2JN7 A;  4KQQ A;  4OH0 A;  2HP6 A;  1OJG A;  5GHX A;  4GW9 A;  3NOT C;  2ZM0 A;  1NLY A;  1LL8 A;  3PBS A;  3SH9 A;  1A0K A;  3HLE A;  1GSV A;  3FG8 A;  4EBP A;  3DBA A;  2FH5 A;  3GMW A;  3GDI A;  5EUA A;  4H6J B;  1N9B A;  3MR0 A;  4QU3 A;  5M1A A;  4JLF A;  4E6W A;  2WKR A;  1T19 A;  1K4E A;  3HLC A;  5CGW A;  4O0P A;  4LGW A;  2KX6 A;  1DY6 A;  3BQ8 A;  5CEC A;  3SW1 A;  3ZNY A;  2XA7 M;  1RP5 A;  5EVE A;  3D9Y A;  3IHA A;  1GSW A;  2L1M A;  5F1G A;  5CXW A;  1Y4O A;  1YQS A;  3DAV A;  4HBT A;  1OTE A;  3MXS A;  3UY6 A;  3GR2 A;  3PYP A;  3LR3 A;  1S6R A;  1H8Y A;  3LR5 A;  1K55 A;  4FH2 A;  4HJ3 A;  5DVA A;  3KSI A;  5CGX A;  3A0S A;  2O9B A;  4DRT A;  4I3A A;  3EEA A;  3W2Z A;  1MKM A;  3ZYT A;  5HD5 A;  5J4E A;  3UB5 P;  2WAF A;  3Q1F A;  5EFW A;  3G4P A;  3T4J A;  1S4R A;  3LI8 A;  2V9A A;  2Z2M B;  4Q8I A;  1M40 A;  3V67 A;  1XGI A;  3WRZ A;  3O5Y A;  2IWC A;  5HFO A;  2KLI A;  4BD0 A;  3NIA A;  5TBM A;  1KOU A;  1K56 A;  3WS4 A;  2ZQD A;  4Y17 A;  3ZVW A;  1VEU B;  1MBL A;  1FIL A;  2M1C A;  4K0X A;  4OLD A;  1YM1 A;  3L7H A;  4KZ5 A;  5FEG A;  4KUK A;  3F1O B;  3MXR A;  1HLU P;  3MQQ A;  2H28 A;  2VGL S;  4FTX A;  2Z6D A;  1Z6F A;  2VLG A;  1IYS A;  3BY9 A;  2JBF A;  4L0L A;  1CI8 A;  4ETZ A;  5HL6 A;  5EVI B;  4P85 A;  3OOV A;  4WZ5 A;  3WS5 A;  1D7E A;  2JKG A;  4R3B A;  4DXC A; 
#chains in the Genus database with same CATH homology
 1OT9 A;  4MMN A;  3OLO A;  4BBU A;  4DN0 A;  5DJU A;  4WEK A;  1ZHH B;  1P9R A;  1UWP X;  4CLC A;  5F69 A;  1ODV A;  3OCN A;  1P0Z A;  2OWJ A;  4H6J A;  2W3F A;  2KOI A;  4F3L A;  3PBQ A;  4P6Z S;  1TS8 A;  4HJ4 A;  3HJI A;  3UB9 A;  4ARZ A;  4JGQ A;  3ICY A;  3C2W A;  5AJG A;  4BBV A;  3LFV A;  4IUH A;  4M4X A;  1N9N A;  1S67 L;  4IUK A;  3R7W B;  3E4Q A;  5F5Y A;  3PXP A;  4JGP A;  4MN5 A;  4HHD A;  5AVE A;  3PHY A;  2BAS A;  2D02 A;  4BMW A;  3ZQ5 A;  3HCY A;  4EEU A;  3H7W A;  4GLQ A;  3P01 A;  3E0Y A;  5IS1 A;  4RQ9 A;  2WKQ A;  1LSX A;  4FSF A;  2PT7 A;  3C38 A;  4EW7 A;  2GX5 A;  2VX8 A;  2INW A;  4GJ4 A;  4WEJ A;  1DRM A;  4HQA A;  1TF1 A;  2W1T B;  4MN6 A;  3UE3 A;  3RTY A;  4LRZ E;  2XA7 S;  1EW0 A;  4I39 A;  5G4Z A;  3K2N A;  3RFB A;  3E4O A;  2PHY A;  3T50 A;  3PBO A;  2LB9 A;  4FOF A;  4UQI S;  3LIF A;  2KDK A;  3EQV A;  4IJG A;  3LIE A;  1UGU A;  1LSV A;  2JHE A;  2HF6 A;  2V0W A;  1OTD A;  1IFQ A;  4EU0 A;  1OTI A;  5DKK A;  3KSG A;  4HI4 A;  4MN7 A;  2M7V A;  4R70 A;  2OAQ 1;  3MMH A;  4G3W A;  4L9F A;  2P7J A;  1V9Y A;  4Y5F A;  3IS2 B;  5IT5 A;  3MXQ A;  3LIA A;  3VE4 A;  5C5K A;  3LUQ A;  4ETX A;  3PBT A;  3JVU A;  2O99 A;  3EWK A;  4ME4 A;  4R38 A;  5DF9 A;  1G6O A;  3HJK A;  2WKP A;  4B9O A;  5HWV A;  4UEY A;  1UWN X;  3FC7 A;  1XJ3 A;  5KSH A;  3VOL A;  4BBT A;  2FZ0 A;  2HJE A;  2W3D A;  4CLC E;  2JKT M;  3LI9 A;  3FPV A;  5HDS A;  2QWS A;  3U2A A;  1T1B A;  3LID A;  4NEE D;  1OJ5 A;  3RH8 B;  2VV6 A;  2VKS A;  3F1N A;  3T4T A;  4EEP A;  5HWW A;  3E98 A;  2EA9 A;  3MJQ A;  1V9Z A;  3B47 A;  3PBN A;  2ZBB A;  4LRY C;  2J3T C;  2P04 A;  4DJ2 A;  3F1O A;  4YNR A;  4WL9 A;  1T1A A;  1VB6 A;  2VV7 A;  3BQA A;  4GS9 B;  2K2N A;  4WN5 A;  5AVF A;  2W3H A;  3B33 A;  1WA9 A;  4YWZ A;  1DP6 A;  1S4S A;  3H82 A;  1P9W A;  2PR6 A;  4CQH A;  1NRJ A;  1D06 A;  2ZMF A;  1N9L A;  4K08 A;  4Y3I A;  3CAX A;  5J7E A;  1F9I A;  2VEA A;  4XT2 A;  1YKD A;  3LR4 A;  3OC2 A;  5DJT A;  2PDR A;  4NXE A;  1YSQ A;  3EEH A;  4KQD A;  4GCZ A;  2EWW A;  4HNB A;  2VZW A;  3UB7 A;  3KYZ A;  3KSH A;  2O9C A;  4NKP A;  1LSW A;  3D3O A;  4HY8 A;  1TD5 A;  1TS6 A;  3JVV A;  4OOM A;  2IA2 A;  2J3T D;  2LB5 A;  1ZTU A;  3EOI A;  3KX0 X;  2G7U A;  3PR6 A;  4PKY G;  2D01 A;  2W3E A;  2R78 A;  1XFQ A;  4EER A;  4PKY A;  2Y79 A;  1G28 A;  1TS7 A;  2W27 A;  5DFY A;  3R7W A;  2XRO A;  3KO6 A;  1XFN A;  1T1C A;  3TW8 A;  2P08 A;  2O0Y A;  3T4Q A;  4I3J A;  1F5M A;  2L0W A;  3LIC A;  5J3W A;  3TE8 A;  4HOI A;  3UB8 A;  4L9E A;  4QPR A;  5DFX A;  3LIB A;  3CIT A;  2VV8 A;  2W1T A;  1S1Y A;  5HWT A;  3T4K A;  4BJP A;  4O01 A;  1GSX A;  3CUE C;  2B02 A;  4WF0 A;  4LPZ A;  3F1P B;  2XRN A;  2HV1 A;  3BW6 A;  3NJA A;  4HIA A;  2NUT C;  4EQ1 A;  3NOP C;  1F98 A;  3CWF A;  4I3I A;  5F68 A;  1YAX A;  5HPI A;  4NXF A;  3K3D A;  3PBR A;  4GHI B;  2MJ6 A;  5DKL A;  3IS2 A;  4B93 A;  4I38 A;  2YKF A;  3H9W A;  3K3C A;  2VGL M;  5TBM B;  2QYB A;  4JGR A;  1S66 L;  5IU1 A;  4E04 A;  4KUO A;  3S7P A;  4Q0H A;  1JNU A;  2GJ3 A;  2GZA A;  3B42 A;  2PD7 A;  3IBR A;  3P7N A;  1DP9 A;  2M7U A;  3C8C A;  3TJZ C;  3VE3 A;  4HH2 A;  3EGD C;  3FPW A;  3T4L A;  2J3W A;  2A24 B;  4R3A A;  1NLZ A;  3MFX A;  3D72 A;  4IHQ A;  2ZOH A;  3BWL A;  2O9A A;  2VJW A;  4BWI A;  4EUV A;  2QHK A;  4LLO B;  4II7 A;  3UME A;  2JN7 A;  3BJN A;  2EWV A;  1OPX A;  1DP8 A;  1OJG A;  2L4R A;  1MC0 A;  4EES A;  4GW9 A;  2OAP 1;  1W63 Q;  3NOT C;  2PD8 A;  4GS9 A;  1NLY A;  1LL8 A;  4HP4 A;  2PYP A;  4JGO A;  3PBS A;  2K31 A;  4LRX C;  4PAU A;  3TRC A;  4MDZ A;  4L9G A;  1GSV A;  3FG8 A;  3A0V A;  2PR5 A;  1STZ A;  4CLC B;  2JKR M;  4I5S A;  3DBA A;  2FH5 A;  3GDI A;  4H6J B;  1YSP A;  2HJ9 C;  5LBR A;  3ULF A;  4F3L B;  3MR0 A;  5I5L A;  2OOL A;  2A2L A;  4HP9 A;  4ARZ B;  4MCW A;  1TS0 A;  3T4O A;  2WKR A;  1T19 A;  5HDD A;  2Z6C A;  3CUE A;  5MC7 A;  4O0P A;  3E4P A;  2KX6 A;  4DJ3 A;  2JKT I;  3BQ8 A;  3SW1 A;  5HD3 A;  2XA7 M;  3NOU C;  4YOF A;  3OBF A;  4WLA A;  3C30 A;  3H7W B;  4G3V A;  2QKP A;  2VA0 A;  4AFI A;  1GSW A;  3IBJ A;  3T4S A;  2L1M A;  3S7N A;  5HZH A;  2V1A A;  4WEL A;  3UMD A;  1OTE A;  1OT6 A;  5HPF A;  3PYP A;  1OTA A;  3LR3 A;  5L8M A;  3LR5 A;  4OOL A;  5F6A A;  2OWH A;  4CLC C;  2XSS A;  4Q0J A;  4HJ3 A;  2NUP C;  4Q0I A;  1N9O A;  3KSI A;  3A0S A;  3GEC A;  1MZU A;  2O9B A;  4Y2F A;  3MQO A;  4G3K A;  1IOU A;  3OCL A;  3EEA A;  4I3A A;  3W2Z A;  1S1Z A;  1MKM A;  3ZYT A;  5HD5 A;  4ZRR A;  5J4E A;  4NXB A;  2W0N A;  3UE6 A;  1W63 M;  3S7O A;  3NHQ A;  3F1P A;  5TJJ A;  3UB6 A;  5EFW A;  1BYW A;  4Z1W A;  3T4J A;  2JKR I;  2QJ7 A;  3KSF A;  1S4R A;  3LI8 A;  1X0O A;  2V9A A;  4DMZ A;  2K7S A;  4EET B;  2J80 A;  3CI6 A;  3V67 A;  3G6O A;  3EQU A;  3O5Y A;  3LYX A;  4HJ6 A;  4GHI A;  4EXO A;  4HH3 A;  1VHM A;  3R4K A;  2GNX A;  3S7Q A;  5CX7 A;  2KLI A;  3LR0 A;  3VV4 A;  4PHT A;  5KIZ A;  2Y8H A;  5TBM A;  2I9V A;  4CLC D;  1KOU A;  4O8G A;  1XJ4 A;  4KQO A;  2W3G A;  2W1R A;  2V0U A;  3MQ0 A;  4WUJ A;  5FL3 A;  5A8B A;  1H8M A;  4UQI M;  4NXG A;  2HGV A;  5HDC A;  1XJ2 A;  3F1N B;  2M1C A;  2QJ5 A;  5G4Y A;  1T18 A;  3CLO A;  1LT0 A;  1NWZ A;  2V1B A;  3MF0 A;  2B18 A;  4KUK A;  3F1O B;  3MQQ A;  3KYQ A;  2H28 A;  2VGL S;  2PYR A;  2Z6D A;  5K5B A;  2A24 A;  2VLG A;  3BY9 A;  1H3Q A;  1OTB A;  2ZOI A;  4R6L A;  2CMN A;  3H82 B;  2YKH A;  2DMW A;  4P6Z M;  5HSQ A;  4L0L A;  4ETZ A;  3EGX C;  5HL6 A;  1P97 A;  3OOV A;  1Y28 A;  4XT2 B;  1D7E A;  3A0R A;  1XJ6 A;  3BY8 A;  2ZMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...