4BMWA

Crystal structure of the streptomyces reticuli hbps e78d, e81d double mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
PAAAPVAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYDSADRKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords EXTRACELLULAR HAEM-BINDING PROTEIN
publication title Iron Binding at Specific Sites within the Octameric Hbps Protects Streptomycetes from Iron-Mediated Oxidative Stress.
pubmed doi rcsb
source organism Streptomyces reticuli
total genus 41
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bmwA01
4CLCD 5CX7A 4CLCA 4NKPA 4CLCB 4CLCE 4CLCC 3FPVA 3FPWA 4BMWA 2A2LA
chains in the Genus database with same CATH superfamily
5M18A 5DVAA 2Y2OA 4PAUA 4EBNA 2W0NA 5HDDA 1G6OA 2ZC3B 3N8RA 4E3MA 3ZGAB 3IX8A 5GLAA 2HJ9C 3GTCA 2XFSA 5TFQA 1K56A 4QY5A 2Y2KA 3UPPA 3ZNYA 3FKVA 1HD8A 3MBZA 1PNEA 2JKRI 1CF0A 5LBRA 4QU3A 1YSPA 4MBKA 4UEYA 4I5SA 2XK1A 5AVEA 4BLMA 4U3TA 2OV5A 3B47A 4X55A 3ZFZA 4BBVA 2L1MA 3PTEA 4DJ2A 3VE4A 2GX5A 2XA7M 2FFYA 1W79A 4OQGA 1CQAA 2O9BA 2M7VA 5FASA 5AQ7A 5A93A 3DTEA 1ODVA 5JYPA 5GHZA 4E3KA 2Y2NA 2Y55A 3PYPA 1LSVA 2FFFB 3M6HA 1KDWA 1XXMA 3SS3A 4UA7A 4II7A 2PR6A 3MZDA 2W3EA 5DJUA 2XD5A 2JCHA 2PBDP 2W3DA 5DJTA 2WGIA 1F5MA 5EUAA 4F3LA 2OLVA 3HJKA 1K6RA 3LR5A 3NDGA 4Q0JA 5A90A 1KVMA 4IVKA 2ZM2A 2VK3A 3F1NB 3ULFA 1YLZA 1OTAA 2VGKA 4R0QA 2KOIA 3N6IA 2LB9A 3S22A 3LR4A 1XJ6A 3WWXA 4HNBA 1H3QA 1Z6FA 4ZBEA 2WAEA 5CRFA 1F98A 2LB5A 3MKEA 2HP6A 1EW0A 3N4IA 4I3JA 4NKPA 4KZ6A 1S6RA 4CLCD 4PKYA 1K57A 2G2WA 2HP5A 1XJ3A 4OLGA 2BG1A 4BL2A 2EX9A 2Y2GA 4KQDA 3T4KA 2IA2A 1E3UA 3KYEA 4KG5A 1BTLA 5AQ9A 3EWKA 1Q2PA 1SKOB 3G30A 2X02A 4F94A 1XGIA 4GHIA 4CJNA 3UB9A 2VX8A 4QWOA 1N9OA 4S2PA 2VKSA 2VV6A 4P87A 5FQMA 3LIEA 3B42A 2Z6CA 3UNWA 2ZQDA 4EU0A 2QHKA 4DE3A 4AFIA 2UWXA 1KE3A 4QY6A 5F6AA 4XT2B 3FPVA 4MMNA 3TE8A 2PT7A 2VJWA 3IF6A 5DTSA 4EW7A 2PU2A 3IX3A 2I9VA 3C38A 1K0KA 2PDRA 4LCMA 4X68A 1SDEA 3D72A 4S2KA 2HDSA 4XUZA 4WZ5A 1K56D 3DWZA 1OTBA 4GB7A 4EXOA 2OWHA 4LV2A 5A8BA 4E3IA 5F69A 5EM1A 3MXRA 3GV9A 1RGYA 3QNCA 3WS4A 2W1TB 4MBFA 1GHMA 3LCEA 3H82B 3R4KA 2V20A 3RXXA 4CQHA 3Q7VA 3LY3A 3UPOA 1W63Q 1PZPA 4MN7A 3IWQA 1STZA 4HP9A 4LV0A 1DRMA 1UGUA 4PM9A 5HL6A 1CEFA 3BY9A 4HI4A 5F83A 1BLSA 2VV7A 3OZHA 4K0XA 1L0DA 1CJFA 4EETB 2ZQ7A 4N9KA 3VFHA 3FG8A 2WGWB 3TOIA 3G32A 3HCYA 4GDNA 2C6WB 2CMNA 1FQGA 2A49A 3VV4A 4GS9B 4ETXA 3R7WB 1XPBA 2WKEA 3ZG8B 2V1AA 3P09A 4Y7PA 1OMEA 2PHYA 5U47A 3K2NA 2XR0A 3S4XA 3H9WA 4P6BA 3W4QA 3ZVWA 1L0EA 1G28A 4EQIA 4KUOA 3C4PA 3FKWA 4B93A 1DP8A 1PI4A 3T1XA 1IYQA 3S7PA 1S66L 1MBLA 3LUQA 4R38A 1L2SA 2EFXA 4JXVA 5FAPA 2VGLS 4NXGA 1FR6A 2ZM8A 2O0YA 2L4RA 1VM1A 3VSKA 4CPKA 2BLSA 2ZOHA 4Q8IA 3PBQA 1H8ZA 1K57C 4XXRA 4C3QA 1TS0A 2M1CA 1ESUA 5E2GA 4BBTA 3BFFA 1Q2QA 3O5YA 4DE0A 3VFFA 1T1CA 4IVIA 3K3CA 4KG6A 4QHCA 3LICA 2KLIA 4B4XA 2H5SA 3LEQA 4IUHA 2JKTI 5EVIB 3SH7A 1PWDA 1FCNA 2WYXA 3HLWA 3WS2A 2WADA 3E2LA 5DF8A 4CLCE 4EBLA 3MKFA 1G6AA 1YLYA 2NUPC 4KZ8A 3ZQ5A 4ZDXA 4EERA 3JYIA 4YFMA 3IF6C 3NDEA 2K31A 1F2KA 4FTXA 3MZEA 4Y2FA 3NJAA 4BENA 1FCOA 3NI9A 3VP1A 2GDNA 4X56A 3B33A 4LV1A 4M3KA 3W2ZA 4WZ5C 2HZ5A 5L2FA 4PKYG 3KSHA 3BFDA 1IOUA 2Z2MB 1L3LA 1LI9A 3KX0X 2ZMFA 3VOYA 1GCEA 3IWOA 3RXWA 5KSCA 5EM0A 4L9EA 5FQJA 3MS6A 2O9CA 4BQMA 5A92A 3QP8A 3AGEA 3OLOA 5FI7A 3BRMA 1T1AA 2FZ0A 3A0VA 3H7WA 4PM6A 4E6WA 1TDLA 4N9LA 1TD5A 3PBOA 5CTNA 3ZG5A 2WKHA 3LEZA 4KZ4A 4O8GA 5M19A 1TS6A 3UDXA 4HBTA 4R23A 4R70A 1OTIA 1S1ZA 1W8YA 4CLCA 3K3DA 2VZWA 3ZCZA 4MLLA 3IT9A 1WYBA 2X71A 5EOEA 4Y5FA 3EGDC 2OWJA 1K6SA 3CG5A 3UE6A 3A3IA 5HAQA 1F9IA 1BUEA 3EGXC 5FL3A 5FQKA 5HD5A 5TGFA 4MNRA 4ME4A 3VP4A 1YKDA 4B88A 4WF0A 5CXWA 3JPUA 1NLYA 4L0LA 4FSFA 2ZC5B 1K55C 3MFDA 4K91A 4IEDA 4ARZA 1CI8A 1J9MA 4GW9A 1XFNA 4BMWA 1NRJA 4JGQA 5CEBA 5MC7A 1FIKA 2V8FA 3LY4A 2V1ZA 4RYEA 2Y59A 3S7OA 3HLCA 4OP8A 4KG2A 4BL3A 4O01A 3MQ0A 4GLQA 3VOLA 4FH2A 3LIDA 2Y91A 3ZVTA 5HL1A 4JXSA 2Y2JA 4NXFA 4G3WA 4ZAMA 3FWLA 1VEUA 3OPHA 1BYWA 1CEGA 1Y28A 3Q7ZA 1M6KA 3A0SA 4LRXC 3IQAA 1FSYA 5DKLA 4R1GA 1VETA 1JVJA 4I3IA 2WZZA 5GL9A 5AQAA 3F1PA 1JNUA 5HW3A 2HGVA 4MN6A 3C8CA 1P0ZA 4PMAA 1JWPA 2H10A 2O99A 3C7UA 3TJZC 4Z9QA 4RVAA 3BQAA 2W1RA 4HESA 3MJQA 1YMXA 4HY8A 4ZJ3A 5CHUA 1G68A 3WS5A 1V9ZA 3HUMA 3LIAA 1AXBA 2QWSA 3QHYA 3AGDA 4X1MA 3DWKA 3U2AA 4MCWA 4KQOA 5FSRA 3GR2A 3VE3A 2Q0OA 3EOIA 5DF7A 5F1GA 1SCWA 4PM7A 5D3OA 3O3VA 3T4SA 4OQHA 1NZUA 1N4OA 5L8MA 4X69A 3CUEA 5GLDA 3FYZA 4GZBA 3FV7A 5FI2A 4EWFA 1NYYA 4HH2A 4E04A 1L0GA 1WYCA 2PYPA 3CAXA 1JTDA 2RCXA 4U0TA 1MPLA 5J3WA 2E8IA 2H0TA 1ZTUA 3LGOA 4R4RA 1IEMA 5GHXA 5TBMA 2PYRA 3IBRA 2ZM0A 3L7HA 4Y13A 2J3WA 2ZC6B 4JGOA 1CK3A 2WK0A 2J9OA 4XUXA 3MQQA 5F1FA 3HLBA 3T4JA 4UQIS 1PIOA 1NYMA 3N8SA 3BLMA 3N7WA 3IF6B 4JF6A 5HAIA 4CLCC 1E4DA 3SS5A 4IBRA 1ERQA 3AGFA 5EE8A 5BOHA 3SH9A 2OSUA 4P0MA 3L9KA 3CJMA 3D4FA 4GCZA 3VSLA 1YLTA 3W8KA 3BYDA 2QZ6A 4YOFA 5G4ZA 4C6YA 2WKRA 2WKQA 2XSSA 1LI0A 3NECA 1K38A 1HZOA 4L9FA 3OCNA 2ZC7A 4GDBA 3G2ZA 2EX2A 2ZC4B 1PFLA 3OC2A 1P97A 3V67A 1Y54A 1DJAA 2IWBA 3GQZA 2JKFA 4FD8A 2VLGA 3C30A 3SOIA 4EUVA 3CHWP 1XP4A 4K0WA 1H0MA 3RH8B 3HLDA 3T12B 2INWA 1DJBA 1O7EA 3U4LP 4UAAA 3E4OA 2DMWA 3T4TA 4KZBA 2DCFA 1KGGA 4EV4A 5EOOA 3A3FA 1P9RA 4E3LA 4JPMA 3LR3A 1SKOA 1KGFA 2HPBA 4NXEA 2EA9A 3VP2A 3BWLA 3KSGA 3P7NA 4FH4A 4BD1A 2WAFA 3PBTA 4ID4A 2Q9NA 4S2OA 4RX3A 4Y17A 2PBYA 1LHYA 2XLNA 3NCKA 4G3KA 5EVEA 5FI6A 4KZ5A 4Z1WA 4L9GA 2VGJA 3RJUA 4DDSA 2Y2MA 2ZD8A 3LYXA 1U60A 4S2MA 2GZAA 1T1BA 4ZTKA 1LT0A 3TSGA 5HZHA 4WMCD 1PZOA 1TF1A 4LLOB 2WGVA 4DKIA 2ZL1B 1TS7A 2W3FA 3CPTA 4P85A 3BY8A 4X53A 5IHVA 5CERA 1I5QA 4XT2A 5FA7A 1N9NA 1FR1A 4B9OA 1IYPA 1LL9A 2EX8A 4OP5A 1NWZA 4HIAA 1MKIA 4OKPA 3BW6A 5G18A 4D2OA 4N1XA 4OLDA 3PBSA 1W7FA 4PPRA 3NHQA 4LRYC 4FCFA 3QP5A 1IYOA 3S1YA 3MXSA 1LLBA 4OOMA 4LFUA 3LI8A 3HLGA 1HTZA 4Y0TA 2Z6DA 2XA7S 4IUKA 5E43A 2ZQ9A 4M4XA 3UMEA 4GNUA 1ALQA 3SH8A 2PRFA 3QP4A 4EEUA 1DP9A 3CUEC 3BLSA 3IXBA 2W1TA 5J8XA 4E3NA 3LO7A 3OPLA 3MR0A 4R4SA 5K5BA 2XDMA 4KZ3A 2EWVA 1GA0A 1QMFA 2XRNA 4HEFA 2OAQ1 4JKTA 4E3JA 5HAPA 1MKMA 3UDFA 1W63M 2B95A 2QJ5A 1MWUA 3T4LA 3FC7A 5E2HA 4OPZA 1GHPA 1V9YA 3RFBA 3ITAA 1N9LA 3MZFA 3BQ8A 3CWFA 3TG9A 4K08A 2R78A 1XA1A 3GDIA 3IS2A 5I5LA 5HDCA 3LIFA 2WGWA 1ES5A 2Q9MA 2W3GA 5HX9A 5DTKA 1HLUP 3R7WA 5CEDA 1KDSA 2FH5A 2R9XA 3BECA 4KZAA 3V50A 3V5MA 4OPYA 4OVDA 3UO9A 3A0RA 3GVBA 4HJ3A 1D7EA 2ZQAA 4JF4A 2HDQA 5FEGA 4H8RA 3HREA 4S2LA 5I94A 3NOUC 1YM1A 5G4YA 2V1BA 4Q0HA 2J7VA 3IH9A 3KO6A 3PBNA 5F68A 3UE3A 1K54A 1GSWA 3CMZA 4WEKA 3W4OA 3QP6A 4YWZA 1FSWA 2A24B 4D60A 2ZJ9A 3MF0A 3WS0A 1JWZA 2JHEA 2JKRM 2KDKA 4CLCB 4HOIA 3F1OB 1LL8A 5AJGA 2HF6A 3DW0A 4ETZA 1OPXA 2J80A 3SZTA 5FQ9A 4E3OA 3OBFA 3QNBA 4DRTA 1S4RA 3VMAA 3T1SA 2H0YA 3A3EA 3ZG0A 4KQRA 2I72A 3A3DA 1TEMA 3S7QA 1ZC2A 1AWIA 1L0FA 1EWZA 1J3WA 4OH0A 1GA9A 2OLUA 4WL9A 2WKPA 3GSGA 4UQIM 5EVIA 3M2JA 3DAVA 1BT5A 3Q81A 4JGPA 4HJ4A 4UA9A 3ZNTA 3IXDA 4H6JB 4WN5A 4KENB 4EEPA 5EVLA 1XA7A 1ES2A 1JWVA 3VP3A 1GSXA 1NLZA 4NXBA 3W4PA 1NJ4A 2EX6A 1ERMA 4E6XA 4RA7A 1VQQA 2DNSA 2HJEA 2ACGA 3ZDJA 5KIZA 5FQIA 3SS4A 2Z2LB 4Y3IA 2GJ3A 1PRQA 2XGNA 3IX4A 4DF6A 3T1RA 3CI6A 1TVFA 2WKIA 2YKHA 2KX6A 5KSHA 2QYBA 4BJPA 1RP5A 3G35A 3G4PA 1FOFA 5EECA 3UE1A 1GHIA 1MZUA 4N1HA 1LL5A 2ZOIA 4JGRA 1OTEA 1DJCA 1X0OA 1RCJA 4X1LA 4S2NA 1K25A 4FUWA 1M40A 2J3TD 4IHQA 2PR5A 3FPWA 1TS8A 1OTDA 2EWWA 5J7EA 3MMHA 4DMZA 4MN5A 1MC0A 1YPRA 2HDUA 5KMWA 2JKGA 3S7NA 4PHTA 3D9YA 3NULA 2RL3A 1QMEA 3DTKA 3HLEA 5L10A 1C3BA 2Y2QA 2Y8HA 1O07A 5E2EA 4WELA 2K7SA 1OJGA 2Y2PA 4B4ZA 4R3AA 5HWWA 3SW1A 2L0WA 4UA6A 1XX2A 2P9VA 3E98A 5HWVA 3MFXA 2JC7A 5DF9A 1PYYA 4U0XA 4F3LB 4IBXA 1YSQA 2R9WA 4KZ9A 5HWTA 3IXHA 2K2NA 2YKFA 5CHMA 4S2JA 1YT4A 5TR7A 3JVUA 1OT6A 3ISGA 4PM8A 4LGWA 3NIAA 2XF3A 4WMCA 5E2FA 4JBFA 1NY0A 4I3AA 5AQBA 4ESPA 3V3SA 3OPRA 3GMWA 3UPNA 2Y2LA 2W27A 4Y0OA 4JXWA 1LSXA 5FQQA 5TBMB 3FZCA 3PR6A 4NEED 5GHYA 3UY6A 2H28A 3TRCA 2XQZA 3RTYA 1T19A 1EROA 4OOYA 4RX2A 1VHMA 2B18A 5FDSA 1K54C 3I7JA 2PAVP 3E0YA 3OPPA 3QP2A 4FOFA 4OONA 1KGEA 1PW1A 4WM9A 2VGLM 1XFQA 4S2IA 1XJ4A 4GD8A 1BULA 3IH8A 4GHIB 4YNRA 4WEJA 4DJ3A 4GKUA 3WRZA 3UB8A 1S67L 4GJ4A 5KZHA 3Q82A 2ZMVA 4G3VA 2M7UA 3HLFA 1BSGA 5GLCA 5EVID 4R6LA 3EQUA 4NETA 4WUJA 3T4OA 5DFXA 5HARA 1MXOA 2P7JA 1W8QA 3E4PA 1TDGA 3UMDA 5EVIC 4KZ7A 5CHJA 2JE5A 3G2YA 3PXPA 3EEHA 4LCLA 4HJ6A 4WBGA 4DN0A 3JVVA 3E4QA 3DTIA 5HPIA 3C7VA 1SZVA 3WS1A 5JYOA 3CZDA 3HJIA 5FATA 3LR0A 2WZXA 4HHDA 1KE4A 4WLAA 1KVLA 4PM5A 3T1QB 2B5RA 5C5KA 1I2WA 1PW8A 2QPNA 4YINA 1I2SA 4NG2A 3P98A 1XKZA 1OJ5A 3MSHA 1D06A 4UHUA 3F1NA 1DY6A 3IF5A 1A0KA 1IELA 1BLHA 2AVXA 2DRWA 3BM6A 4GOGA 3O86A 5HPFA 3KSIA 3Q1FA 2GNXA 3IBJA 2Y2HA 3ZHHA 3WRTA 5FDHA 5DTTA 4R3JA 3O88A 4DE2A 3DTMA 3BJNA 3HBRA 3TW8A 2O9AA 4P6ZS 4HBUA 2VA0A 2V0WA 2P04A 2JN7A 2D01A 5A91A 4S2NC 1FCMA 2VEAA 3Q7VB 5CTMA 4LV3A 1UWNX 1PWCA 3CPTB 4QPRA 3ICYA 1IYSA 3N8LA 3NBLA 1YLPA 2Y4AA 2UV0E 1IFQA 5GLBA 2IWDA 5EV0A 1H8MA 4DDYA 2P74A 5CECA 2ZLYA 1MWRA 4JXGA 1OT9A 3V3RA 3ZYTA 2JKTM 3UB7A 4X25A 1YLWA 2X01A 2G2UA 4OQIA 1XGJA 3HUNA 1HVBA 5FEFA 4LENA 1PI5A 1WA9A 3LFVA 1G5UA 1DP6A 1H8YA 3BFCA 1YAXA 2D02A 1T18A 5CGSA 5CGXA 4QB8A 1E25A 2XH9A 3M2KA 2OOLA 1BLCA 4OPQA 4EUZA 4N92A 3Q07A 3P01A 3KYQA 1ZG4A 3O87A 1K4EA 1W5DA 4BBUA 4HH3A 4DXCA 4MDZA 4KUKA 2XFTA 5HSQA 3KSFA 4IJGA 2XROA 1PWGA 1D1JA 3PBRA 3EEAA 4WYYA 2QJ7A 4QJGA 1XJ2A 1S4SA 3T50A 1SHVA 3OCLA 2C5WB 1SDNA 3IS2B 1YLJA 3G31A 5IT5A 2PU4A 4OPRA 1EI5A 3IHBA 3UN7A 1S1YA 2JBFA 3NC8A 3BFGA 1ESIA 4EQ1A 2A2LA 3H82A 1K55A 1MWSA 1Z09A 3KYZA 3ZG7B 3UDIA 2QKPA 3MQOA 1Y4OA 1NXYA 5AVFA 3UE0A 2ZL1A 3UB5P 2EFUA 4ZRRA 3T4QA 5EFWA 3B3XA 5HFOA 5DKKA 3OOVA 1H5XA 2MJ6A 4QD4A 2CC1A 3D3OA 3G6OA 2ZMAA 2BTFP 1JTGA 5M1AA 1UWPX 4O7DA 4C75A 4OQ0A 3LIBA 1E3UD 5IS1A 4JLFA 5J4EA 2A3UA 1IKIA 2HP9A 2J9PA 4GS9A 3A3JA 3M6BA 1N9BA 2ZBBA 3IXGA 5L09A 3C2WA 3G34A 4MEZA 4A5RA 3BFEA 1YQSA 4GD6A 3V39A 4EBPA 5CGWA 4BWIA 3ZG9B 1BZAA 4Q0IA 2ZQCA 2V0UA 5HDSA 4LRZE 3H7WB 1ZHHB 4BD0A 2ZQ8A 1LSWA 4ZJ2A 4OOLA 1P9WA 1ES4A 4Y0UA 3LI9A 1ES3A 3E2KA 3VOZA 5CX7A 1ZKJA 4MBHA 1IKGA 2BASA 1ZG6A 1KOUA 5F5YA 2NUTC 1MY8A 3IHAA 3NOTC 1GSVA 4KQQA 3NOPC 3ITBA 2XD1A 2B02A 4HQAA 2EXAA 3PHYA 2HV1A 2PD8A 5DFYA 4ZJ1A 4O0PA 2V9AA 1WE4A 3MXQA 1BLPA 1KE0A 1MWTA 4ARZB 3HL9A 3C5AA 1NRFA 2E8JA 5FAQA 1ONHA 4DE1A 3PAEA 1S0WA 1CI9A 4X6TA 3GECA 2OAP1 1K4FA 2Y79A 3DBAA 5HD3A 2W3HA 4LPZA 1ONGA 3BEBA 3GRJA 2P08A 2A24A 4GN2A 1FILA 1NZOA 2J8YA 2HDRA 3F1OA 4WZ4A 5EPHA 4HP4A 3CITA 1YMSA 1VEUB 4P6ZM 2P9VB 2G7UA 1ACFA 2QMIA 2XEPA 4NK3A 1VETB 5IU1A 5L07A 3PAGA 3UB6A 2Y2IA 3CLOA 3F1PB 2VV8A 3HVFA 2V8CA 3EQVA 2V2FF 2PD7A 4H6JA 3VP0A 4I39A 2WUQA 5FAOA 2J3TC 4DXBA 3HUOA 3NY4A 4JF5A 5TJJA 5F82A 1VB6A 4RQ9A 1RGZA 4EESA 2EXBA 1SKFA 3C4OA 3IWIA 3QP1A 4Y15A 4R3BA 2IWCA 4I38A
chains in the Genus database with same CATH topology
3NHQA 4LRYC 4PAUA 2W0NA 4Y2FA 5HDDA 1G6OA 3NJAA 1OJ5A 4OOMA 3LI8A 2HJ9C 1D06A 3F1NA 2Z6DA 2XA7S 4IUKA 3B33A 4M4XA 3W2ZA 3UMEA 4PKYG 4EEUA 1DP9A 2JKRI 3KSHA 3CUEC 1IOUA 5LBRA 1YSPA 2ZMFA 3KX0X 4I5SA 4UEYA 5AVEA 2W1TA 5HPFA 3KSIA 4L9EA 3B47A 2GNXA 3MR0A 3IBJA 5K5BA 2O9CA 4BBVA 2L1MA 2EWVA 3OLOA 1T1AA 2FZ0A 3A0VA 3BJNA 3H7WA 4DJ2A 3TW8A 2O9AA 4P6ZS 2XRNA 1TD5A 3PBOA 2VA0A 2V0WA 3VE4A 2P04A 2JN7A 2D01A 2OAQ1 2GX5A 2XA7M 4O8GA 1MKMA 1TS6A 2VEAA 1W63M 2O9BA 2QJ5A 1UWNX 2M7VA 3T4LA 4R70A 4QPRA 1OTIA 3FC7A 3ICYA 1ODVA 1S1ZA 1V9YA 3RFBA 4CLCA 3K3DA 1N9LA 3BQ8A 2VZWA 3CWFA 3PYPA 1LSVA 4K08A 2R78A 3GDIA 4II7A 3IS2A 1IFQA 2PR6A 5I5LA 4Y5FA 3EGDC 2OWJA 5HDCA 2W3EA 1H8MA 5DJUA 3UE6A 2W3DA 3LIFA 5DJTA 1F5MA 1OT9A 1F9IA 4F3LA 3HJKA 3LR5A 4Q0JA 3EGXC 2JKTM 3UB7A 3ZYTA 5FL3A 2W3GA 5HD5A 4ME4A 1YKDA 4WF0A 3R7WA 3F1NB 1WA9A 3LFVA 2FH5A 1NLYA 4L0LA 4FSFA 3ULFA 1DP6A 1YAXA 1OTAA 2D02A 3A0RA 1T18A 2KOIA 2LB9A 4ARZA 3LR4A 4HJ3A 1XJ6A 4GW9A 1XFNA 4HNBA 1D7EA 1H3QA 4BMWA 1NRJA 4JGQA 5MC7A 2OOLA 1F98A 2LB5A 3P01A 3KYQA 3NOUC 5G4YA 2V1BA 4Q0HA 1EW0A 3S7OA 4BBUA 4I3JA 4HH3A 4NKPA 3KO6A 4O01A 3PBNA 4MDZA 4KUKA 5F68A 3UE3A 3MQ0A 1GSWA 4WEKA 5HSQA 4GLQA 3KSFA 3VOLA 4CLCD 3LIDA 4PKYA 4YWZA 2A24B 1XJ3A 4IJGA 3MF0A 4KQDA 2JHEA 2JKRM 2KDKA 3T4KA 2XROA 2IA2A 3PBRA 4CLCB 3EEAA 4HOIA 2QJ7A 1XJ2A 1S4SA 3T50A 4NXFA 3F1OB 4G3WA 1LL8A 3EWKA 3OCLA 5AJGA 2HF6A 4ETZA 1OPXA 2J80A 3IS2B 1BYWA 1Y28A 3OBFA 3A0SA 5IT5A 4LRXC 1S4RA 4GHIA 5DKLA 1S1YA 3UB9A 4I3IA 4EQ1A 3S7QA 2A2LA 3H82A 2VX8A 3KYZA 2QKPA 1N9OA 3F1PA 3MQOA 2VKSA 1JNUA 2HGVA 4MN6A 4WL9A 2VV6A 2WKPA 4UQIM 5AVFA 3LIEA 3C8CA 4JGPA 1P0ZA 3B42A 4HJ4A 4ZRRA 3T4QA 2Z6CA 5EFWA 2O99A 5DKKA 4H6JB 4WN5A 3OOVA 3TJZC 4EU0A 4EEPA 2QHKA 3BQAA 2W1RA 3MJQA 2MJ6A 4AFIA 3D3OA 3G6OA 5F6AA 4HY8A 4XT2B 1GSXA 3FPVA 4MMNA 1NLZA 1V9ZA 4NXBA 2PT7A 2VJWA 3TE8A 1UWPX 3LIAA 4EW7A 3LIBA 2QWSA 2HJEA 5KIZA 2I9VA 3U2AA 3C38A 4MCWA 2PDRA 4KQOA 4Y3IA 2GJ3A 3D72A 3VE3A 5IS1A 3EOIA 5J4EA 3T4SA 3CI6A 5L8MA 4GS9A 2YKHA 1OTBA 2KX6A 3CUEA 2ZBBA 4EXOA 2OWHA 5KSHA 2QYBA 4BJPA 3C2WA 5A8BA 5F69A 4HH2A 4E04A 1MZUA 2W1TB 2PYPA 2ZOIA 4JGRA 3CAXA 1OTEA 4BWIA 1X0OA 3H82B 4Q0IA 5J3WA 2V0UA 5HDSA 4LRZE 3H7WB 1ZHHB 1ZTUA 3R4KA 2J3TD 4IHQA 2PR5A 3FPWA 1TS8A 1OTDA 1LSWA 2EWWA 5TBMA 2PYRA 3IBRA 4CQHA 5J7EA 3MMHA 4DMZA 4MN5A 1MC0A 4OOLA 1P9WA 2J3WA 3S7NA 4JGOA 4PHTA 1W63Q 4MN7A 3MQQA 1STZA 3LI9A 4HP9A 3T4JA 4UQIS 1DRMA 1UGUA 5HL6A 2Y8HA 3BY9A 4HI4A 5CX7A 4WELA 2K7SA 1OJGA 2VV7A 4CLCC 4R3AA 5HWWA 3SW1A 2BASA 2L0WA 4EETB 1KOUA 5F5YA 2NUTC 3E98A 3NOTC 1GSVA 5HWVA 3NOPC 3MFXA 3FG8A 4GCZA 5DF9A 2B02A 4F3LB 3HCYA 1YSQA 4YOFA 2CMNA 3VV4A 5G4ZA 4GS9B 5HWTA 4HQAA 2WKRA 2WKQA 2XSSA 4ETXA 2K2NA 2YKFA 3R7WB 3PHYA 4L9FA 3JVUA 1OT6A 2HV1A 2V1AA 3OCNA 2PD8A 5DFYA 2PHYA 3K2NA 4O0PA 2V9AA 3H9WA 3OC2A 1P97A 3V67A 3MXQA 1G28A 4I3AA 4KUOA 4B93A 1DP8A 4ARZB 2VLGA 3C30A 4EUVA 3S7PA 1S66L 3LUQA 4R38A 3RH8B 2VGLS 4NXGA 2W27A 2INWA 2O0YA 2L4RA 3GECA 1LSXA 2OAP1 3DBAA 2Y79A 5HD3A 2W3HA 5TBMB 4LPZA 3E4OA 3PR6A 4NEED 2DMWA 2ZOHA 2P08A 2H28A 3T4TA 2A24A 3TRCA 3RTYA 1T19A 1VHMA 2B18A 3PBQA 3E0YA 4FOFA 3F1OA 1P9RA 3LR3A 1TS0A 4NXEA 4HP4A 2EA9A 2M1CA 3BWLA 3CITA 3KSGA 3P7NA 4BBTA 4P6ZM 2VGLM 1XFQA 3PBTA 3O5YA 1XJ4A 2G7UA 4G3KA 4GHIB 1T1CA 4YNRA 4WEJA 4Z1WA 3K3CA 4L9GA 4DJ3A 3UB8A 1S67L 3LICA 4GJ4A 5IU1A 2KLIA 3LYXA 2ZMVA 3UB6A 4G3VA 2GZAA 2M7UA 1T1BA 4R6LA 3EQUA 3CLOA 1LT0A 4WUJA 3F1PB 3T4OA 5HZHA 5DFXA 1TF1A 2VV8A 4IUHA 2JKTI 2P7JA 4LLOB 3EQVA 2PD7A 3E4PA 4H6JA 4I39A 3UMDA 1TS7A 2W3FA 3BY8A 2J3TC 3PXPA 3EEHA 4XT2A 4HJ6A 4DN0A 1N9NA 3JVVA 5TJJA 4CLCE 3E4QA 4B9OA 1VB6A 5HPIA 4RQ9A 1NWZA 4HIAA 3HJIA 2NUPC 3ZQ5A 3LR0A 4EESA 4HHDA 4WLAA 3BW6A 4EERA 5C5KA 3PBSA 2K31A 4I38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC D;  5CX7 A;  4CLC A;  4NKP A;  4CLC B;  4CLC E;  4CLC C;  3FPV A;  3FPW A;  4BMW A;  2A2L A; 
#chains in the Genus database with same CATH topology
 5M18 A;  5DVA A;  2Y2O A;  4PAU A;  4EBN A;  2W0N A;  5HDD A;  1G6O A;  2ZC3 B;  3N8R A;  4E3M A;  3ZGA B;  3IX8 A;  5GLA A;  2HJ9 C;  3GTC A;  2XFS A;  5TFQ A;  1K56 A;  4QY5 A;  2Y2K A;  3UPP A;  3ZNY A;  3FKV A;  1HD8 A;  3MBZ A;  1PNE A;  2JKR I;  1CF0 A;  5LBR A;  4QU3 A;  1YSP A;  4MBK A;  4UEY A;  4I5S A;  2XK1 A;  5AVE A;  4BLM A;  4U3T A;  2OV5 A;  3B47 A;  4X55 A;  3ZFZ A;  4BBV A;  2L1M A;  3PTE A;  4DJ2 A;  3VE4 A;  2GX5 A;  2XA7 M;  2FFY A;  1W79 A;  4OQG A;  1CQA A;  2O9B A;  2M7V A;  5FAS A;  5AQ7 A;  5A93 A;  3DTE A;  1ODV A;  5JYP A;  5GHZ A;  4E3K A;  2Y2N A;  2Y55 A;  3PYP A;  1LSV A;  2FFF B;  3M6H A;  1KDW A;  1XXM A;  3SS3 A;  4UA7 A;  4II7 A;  2PR6 A;  3MZD A;  2W3E A;  5DJU A;  2XD5 A;  2JCH A;  2PBD P;  2W3D A;  5DJT A;  2WGI A;  1F5M A;  5EUA A;  4F3L A;  2OLV A;  3HJK A;  1K6R A;  3LR5 A;  3NDG A;  4Q0J A;  5A90 A;  1KVM A;  4IVK A;  2ZM2 A;  2VK3 A;  3F1N B;  3ULF A;  1YLZ A;  1OTA A;  2VGK A;  4R0Q A;  2KOI A;  3N6I A;  2LB9 A;  3S22 A;  3LR4 A;  1XJ6 A;  3WWX A;  4HNB A;  1H3Q A;  1Z6F A;  4ZBE A;  2WAE A;  5CRF A;  1F98 A;  2LB5 A;  3MKE A;  2HP6 A;  1EW0 A;  3N4I A;  4I3J A;  4NKP A;  4KZ6 A;  1S6R A;  4CLC D;  4PKY A;  1K57 A;  2G2W A;  2HP5 A;  1XJ3 A;  4OLG A;  2BG1 A;  4BL2 A;  2EX9 A;  2Y2G A;  4KQD A;  3T4K A;  2IA2 A;  1E3U A;  3KYE A;  4KG5 A;  1BTL A;  5AQ9 A;  3EWK A;  1Q2P A;  1SKO B;  3G30 A;  2X02 A;  4F94 A;  1XGI A;  4GHI A;  4CJN A;  3UB9 A;  2VX8 A;  4QWO A;  1N9O A;  4S2P A;  2VKS A;  2VV6 A;  4P87 A;  5FQM A;  3LIE A;  3B42 A;  2Z6C A;  3UNW A;  2ZQD A;  4EU0 A;  2QHK A;  4DE3 A;  4AFI A;  2UWX A;  1KE3 A;  4QY6 A;  5F6A A;  4XT2 B;  3FPV A;  4MMN A;  3TE8 A;  2PT7 A;  2VJW A;  3IF6 A;  5DTS A;  4EW7 A;  2PU2 A;  3IX3 A;  2I9V A;  3C38 A;  1K0K A;  2PDR A;  4LCM A;  4X68 A;  1SDE A;  3D72 A;  4S2K A;  2HDS A;  4XUZ A;  4WZ5 A;  1K56 D;  3DWZ A;  1OTB A;  4GB7 A;  4EXO A;  2OWH A;  4LV2 A;  5A8B A;  4E3I A;  5F69 A;  5EM1 A;  3MXR A;  3GV9 A;  1RGY A;  3QNC A;  3WS4 A;  2W1T B;  4MBF A;  1GHM A;  3LCE A;  3H82 B;  3R4K A;  2V20 A;  3RXX A;  4CQH A;  3Q7V A;  3LY3 A;  3UPO A;  1W63 Q;  1PZP A;  4MN7 A;  3IWQ A;  1STZ A;  4HP9 A;  4LV0 A;  1DRM A;  1UGU A;  4PM9 A;  5HL6 A;  1CEF A;  3BY9 A;  4HI4 A;  5F83 A;  1BLS A;  2VV7 A;  3OZH A;  4K0X A;  1L0D A;  1CJF A;  4EET B;  2ZQ7 A;  4N9K A;  3VFH A;  3FG8 A;  2WGW B;  3TOI A;  3G32 A;  3HCY A;  4GDN A;  2C6W B;  2CMN A;  1FQG A;  2A49 A;  3VV4 A;  4GS9 B;  4ETX A;  3R7W B;  1XPB A;  2WKE A;  3ZG8 B;  2V1A A;  3P09 A;  4Y7P A;  1OME A;  2PHY A;  5U47 A;  3K2N A;  2XR0 A;  3S4X A;  3H9W A;  4P6B A;  3W4Q A;  3ZVW A;  1L0E A;  1G28 A;  4EQI A;  4KUO A;  3C4P A;  3FKW A;  4B93 A;  1DP8 A;  1PI4 A;  3T1X A;  1IYQ A;  3S7P A;  1S66 L;  1MBL A;  3LUQ A;  4R38 A;  1L2S A;  2EFX A;  4JXV A;  5FAP A;  2VGL S;  4NXG A;  1FR6 A;  2ZM8 A;  2O0Y A;  2L4R A;  1VM1 A;  3VSK A;  4CPK A;  2BLS A;  2ZOH A;  4Q8I A;  3PBQ A;  1H8Z A;  1K57 C;  4XXR A;  4C3Q A;  1TS0 A;  2M1C A;  1ESU A;  5E2G A;  4BBT A;  3BFF A;  1Q2Q A;  3O5Y A;  4DE0 A;  3VFF A;  1T1C A;  4IVI A;  3K3C A;  4KG6 A;  4QHC A;  3LIC A;  2KLI A;  4B4X A;  2H5S A;  3LEQ A;  4IUH A;  2JKT I;  5EVI B;  3SH7 A;  1PWD A;  1FCN A;  2WYX A;  3HLW A;  3WS2 A;  2WAD A;  3E2L A;  5DF8 A;  4CLC E;  4EBL A;  3MKF A;  1G6A A;  1YLY A;  2NUP C;  4KZ8 A;  3ZQ5 A;  4ZDX A;  4EER A;  3JYI A;  4YFM A;  3IF6 C;  3NDE A;  2K31 A;  1F2K A;  4FTX A;  3MZE A;  4Y2F A;  3NJA A;  4BEN A;  1FCO A;  3NI9 A;  3VP1 A;  2GDN A;  4X56 A;  3B33 A;  4LV1 A;  4M3K A;  3W2Z A;  4WZ5 C;  2HZ5 A;  5L2F A;  4PKY G;  3KSH A;  3BFD A;  1IOU A;  2Z2M B;  1L3L A;  1LI9 A;  3KX0 X;  2ZMF A;  3VOY A;  1GCE A;  3IWO A;  3RXW A;  5KSC A;  5EM0 A;  4L9E A;  5FQJ A;  3MS6 A;  2O9C A;  4BQM A;  5A92 A;  3QP8 A;  3AGE A;  3OLO A;  5FI7 A;  3BRM A;  1T1A A;  2FZ0 A;  3A0V A;  3H7W A;  4PM6 A;  4E6W A;  1TDL A;  4N9L A;  1TD5 A;  3PBO A;  5CTN A;  3ZG5 A;  2WKH A;  3LEZ A;  4KZ4 A;  4O8G A;  5M19 A;  1TS6 A;  3UDX A;  4HBT A;  4R23 A;  4R70 A;  1OTI A;  1S1Z A;  1W8Y A;  4CLC A;  3K3D A;  2VZW A;  3ZCZ A;  4MLL A;  3IT9 A;  1WYB A;  2X71 A;  5EOE A;  4Y5F A;  3EGD C;  2OWJ A;  1K6S A;  3CG5 A;  3UE6 A;  3A3I A;  5HAQ A;  1F9I A;  1BUE A;  3EGX C;  5FL3 A;  5FQK A;  5HD5 A;  5TGF A;  4MNR A;  4ME4 A;  3VP4 A;  1YKD A;  4B88 A;  4WF0 A;  5CXW A;  3JPU A;  1NLY A;  4L0L A;  4FSF A;  2ZC5 B;  1K55 C;  3MFD A;  4K91 A;  4IED A;  4ARZ A;  1CI8 A;  1J9M A;  4GW9 A;  1XFN A;  4BMW A;  1NRJ A;  4JGQ A;  5CEB A;  5MC7 A;  1FIK A;  2V8F A;  3LY4 A;  2V1Z A;  4RYE A;  2Y59 A;  3S7O A;  3HLC A;  4OP8 A;  4KG2 A;  4BL3 A;  4O01 A;  3MQ0 A;  4GLQ A;  3VOL A;  4FH2 A;  3LID A;  2Y91 A;  3ZVT A;  5HL1 A;  4JXS A;  2Y2J A;  4NXF A;  4G3W A;  4ZAM A;  3FWL A;  1VEU A;  3OPH A;  1BYW A;  1CEG A;  1Y28 A;  3Q7Z A;  1M6K A;  3A0S A;  4LRX C;  3IQA A;  1FSY A;  5DKL A;  4R1G A;  1VET A;  1JVJ A;  4I3I A;  2WZZ A;  5GL9 A;  5AQA A;  3F1P A;  1JNU A;  5HW3 A;  2HGV A;  4MN6 A;  3C8C A;  1P0Z A;  4PMA A;  1JWP A;  2H10 A;  2O99 A;  3C7U A;  3TJZ C;  4Z9Q A;  4RVA A;  3BQA A;  2W1R A;  4HES A;  3MJQ A;  1YMX A;  4HY8 A;  4ZJ3 A;  5CHU A;  1G68 A;  3WS5 A;  1V9Z A;  3HUM A;  3LIA A;  1AXB A;  2QWS A;  3QHY A;  3AGD A;  4X1M A;  3DWK A;  3U2A A;  4MCW A;  4KQO A;  5FSR A;  3GR2 A;  3VE3 A;  2Q0O A;  3EOI A;  5DF7 A;  5F1G A;  1SCW A;  4PM7 A;  5D3O A;  3O3V A;  3T4S A;  4OQH A;  1NZU A;  1N4O A;  5L8M A;  4X69 A;  3CUE A;  5GLD A;  3FYZ A;  4GZB A;  3FV7 A;  5FI2 A;  4EWF A;  1NYY A;  4HH2 A;  4E04 A;  1L0G A;  1WYC A;  2PYP A;  3CAX A;  1JTD A;  2RCX A;  4U0T A;  1MPL A;  5J3W A;  2E8I A;  2H0T A;  1ZTU A;  3LGO A;  4R4R A;  1IEM A;  5GHX A;  5TBM A;  2PYR A;  3IBR A;  2ZM0 A;  3L7H A;  4Y13 A;  2J3W A;  2ZC6 B;  4JGO A;  1CK3 A;  2WK0 A;  2J9O A;  4XUX A;  3MQQ A;  5F1F A;  3HLB A;  3T4J A;  4UQI S;  1PIO A;  1NYM A;  3N8S A;  3BLM A;  3N7W A;  3IF6 B;  4JF6 A;  5HAI A;  4CLC C;  1E4D A;  3SS5 A;  4IBR A;  1ERQ A;  3AGF A;  5EE8 A;  5BOH A;  3SH9 A;  2OSU A;  4P0M A;  3L9K A;  3CJM A;  3D4F A;  4GCZ A;  3VSL A;  1YLT A;  3W8K A;  3BYD A;  2QZ6 A;  4YOF A;  5G4Z A;  4C6Y A;  2WKR A;  2WKQ A;  2XSS A;  1LI0 A;  3NEC A;  1K38 A;  1HZO A;  4L9F A;  3OCN A;  2ZC7 A;  4GDB A;  3G2Z A;  2EX2 A;  2ZC4 B;  1PFL A;  3OC2 A;  1P97 A;  3V67 A;  1Y54 A;  1DJA A;  2IWB A;  3GQZ A;  2JKF A;  4FD8 A;  2VLG A;  3C30 A;  3SOI A;  4EUV A;  3CHW P;  1XP4 A;  4K0W A;  1H0M A;  3RH8 B;  3HLD A;  3T12 B;  2INW A;  1DJB A;  1O7E A;  3U4L P;  4UAA A;  3E4O A;  2DMW A;  3T4T A;  4KZB A;  2DCF A;  1KGG A;  4EV4 A;  5EOO A;  3A3F A;  1P9R A;  4E3L A;  4JPM A;  3LR3 A;  1SKO A;  1KGF A;  2HPB A;  4NXE A;  2EA9 A;  3VP2 A;  3BWL A;  3KSG A;  3P7N A;  4FH4 A;  4BD1 A;  2WAF A;  3PBT A;  4ID4 A;  2Q9N A;  4S2O A;  4RX3 A;  4Y17 A;  2PBY A;  1LHY A;  2XLN A;  3NCK A;  4G3K A;  5EVE A;  5FI6 A;  4KZ5 A;  4Z1W A;  4L9G A;  2VGJ A;  3RJU A;  4DDS A;  2Y2M A;  2ZD8 A;  3LYX A;  1U60 A;  4S2M A;  2GZA A;  1T1B A;  4ZTK A;  1LT0 A;  3TSG A;  5HZH A;  4WMC D;  1PZO A;  1TF1 A;  4LLO B;  2WGV A;  4DKI A;  2ZL1 B;  1TS7 A;  2W3F A;  3CPT A;  4P85 A;  3BY8 A;  4X53 A;  5IHV A;  5CER A;  1I5Q A;  4XT2 A;  5FA7 A;  1N9N A;  1FR1 A;  4B9O A;  1IYP A;  1LL9 A;  2EX8 A;  4OP5 A;  1NWZ A;  4HIA A;  1MKI A;  4OKP A;  3BW6 A;  5G18 A;  4D2O A;  4N1X A;  4OLD A;  3PBS A;  1W7F A;  4PPR A;  3NHQ A;  4LRY C;  4FCF A;  3QP5 A;  1IYO A;  3S1Y A;  3MXS A;  1LLB A;  4OOM A;  4LFU A;  3LI8 A;  3HLG A;  1HTZ A;  4Y0T A;  2Z6D A;  2XA7 S;  4IUK A;  5E43 A;  2ZQ9 A;  4M4X A;  3UME A;  4GNU A;  1ALQ A;  3SH8 A;  2PRF A;  3QP4 A;  4EEU A;  1DP9 A;  3CUE C;  3BLS A;  3IXB A;  2W1T A;  5J8X A;  4E3N A;  3LO7 A;  3OPL A;  3MR0 A;  4R4S A;  5K5B A;  2XDM A;  4KZ3 A;  2EWV A;  1GA0 A;  1QMF A;  2XRN A;  4HEF A;  2OAQ 1;  4JKT A;  4E3J A;  5HAP A;  1MKM A;  3UDF A;  1W63 M;  2B95 A;  2QJ5 A;  1MWU A;  3T4L A;  3FC7 A;  5E2H A;  4OPZ A;  1GHP A;  1V9Y A;  3RFB A;  3ITA A;  1N9L A;  3MZF A;  3BQ8 A;  3CWF A;  3TG9 A;  4K08 A;  2R78 A;  1XA1 A;  3GDI A;  3IS2 A;  5I5L A;  5HDC A;  3LIF A;  2WGW A;  1ES5 A;  2Q9M A;  2W3G A;  5HX9 A;  5DTK A;  1HLU P;  3R7W A;  5CED A;  1KDS A;  2FH5 A;  2R9X A;  3BEC A;  4KZA A;  3V50 A;  3V5M A;  4OPY A;  4OVD A;  3UO9 A;  3A0R A;  3GVB A;  4HJ3 A;  1D7E A;  2ZQA A;  4JF4 A;  2HDQ A;  5FEG A;  4H8R A;  3HRE A;  4S2L A;  5I94 A;  3NOU C;  1YM1 A;  5G4Y A;  2V1B A;  4Q0H A;  2J7V A;  3IH9 A;  3KO6 A;  3PBN A;  5F68 A;  3UE3 A;  1K54 A;  1GSW A;  3CMZ A;  4WEK A;  3W4O A;  3QP6 A;  4YWZ A;  1FSW A;  2A24 B;  4D60 A;  2ZJ9 A;  3MF0 A;  3WS0 A;  1JWZ A;  2JHE A;  2JKR M;  2KDK A;  4CLC B;  4HOI A;  3F1O B;  1LL8 A;  5AJG A;  2HF6 A;  3DW0 A;  4ETZ A;  1OPX A;  2J80 A;  3SZT A;  5FQ9 A;  4E3O A;  3OBF A;  3QNB A;  4DRT A;  1S4R A;  3VMA A;  3T1S A;  2H0Y A;  3A3E A;  3ZG0 A;  4KQR A;  2I72 A;  3A3D A;  1TEM A;  3S7Q A;  1ZC2 A;  1AWI A;  1L0F A;  1EWZ A;  1J3W A;  4OH0 A;  1GA9 A;  2OLU A;  4WL9 A;  2WKP A;  3GSG A;  4UQI M;  5EVI A;  3M2J A;  3DAV A;  1BT5 A;  3Q81 A;  4JGP A;  4HJ4 A;  4UA9 A;  3ZNT A;  3IXD A;  4H6J B;  4WN5 A;  4KEN B;  4EEP A;  5EVL A;  1XA7 A;  1ES2 A;  1JWV A;  3VP3 A;  1GSX A;  1NLZ A;  4NXB A;  3W4P A;  1NJ4 A;  2EX6 A;  1ERM A;  4E6X A;  4RA7 A;  1VQQ A;  2DNS A;  2HJE A;  2ACG A;  3ZDJ A;  5KIZ A;  5FQI A;  3SS4 A;  2Z2L B;  4Y3I A;  2GJ3 A;  1PRQ A;  2XGN A;  3IX4 A;  4DF6 A;  3T1R A;  3CI6 A;  1TVF A;  2WKI A;  2YKH A;  2KX6 A;  5KSH A;  2QYB A;  4BJP A;  1RP5 A;  3G35 A;  3G4P A;  1FOF A;  5EEC A;  3UE1 A;  1GHI A;  1MZU A;  4N1H A;  1LL5 A;  2ZOI A;  4JGR A;  1OTE A;  1DJC A;  1X0O A;  1RCJ A;  4X1L A;  4S2N A;  1K25 A;  4FUW A;  1M40 A;  2J3T D;  4IHQ A;  2PR5 A;  3FPW A;  1TS8 A;  1OTD A;  2EWW A;  5J7E A;  3MMH A;  4DMZ A;  4MN5 A;  1MC0 A;  1YPR A;  2HDU A;  5KMW A;  2JKG A;  3S7N A;  4PHT A;  3D9Y A;  3NUL A;  2RL3 A;  1QME A;  3DTK A;  3HLE A;  5L10 A;  1C3B A;  2Y2Q A;  2Y8H A;  1O07 A;  5E2E A;  4WEL A;  2K7S A;  1OJG A;  2Y2P A;  4B4Z A;  4R3A A;  5HWW A;  3SW1 A;  2L0W A;  4UA6 A;  1XX2 A;  2P9V A;  3E98 A;  5HWV A;  3MFX A;  2JC7 A;  5DF9 A;  1PYY A;  4U0X A;  4F3L B;  4IBX A;  1YSQ A;  2R9W A;  4KZ9 A;  5HWT A;  3IXH A;  2K2N A;  2YKF A;  5CHM A;  4S2J A;  1YT4 A;  5TR7 A;  3JVU A;  1OT6 A;  3ISG A;  4PM8 A;  4LGW A;  3NIA A;  2XF3 A;  4WMC A;  5E2F A;  4JBF A;  1NY0 A;  4I3A A;  5AQB A;  4ESP A;  3V3S A;  3OPR A;  3GMW A;  3UPN A;  2Y2L A;  2W27 A;  4Y0O A;  4JXW A;  1LSX A;  5FQQ A;  5TBM B;  3FZC A;  3PR6 A;  4NEE D;  5GHY A;  3UY6 A;  2H28 A;  3TRC A;  2XQZ A;  3RTY A;  1T19 A;  1ERO A;  4OOY A;  4RX2 A;  1VHM A;  2B18 A;  5FDS A;  1K54 C;  3I7J A;  2PAV P;  3E0Y A;  3OPP A;  3QP2 A;  4FOF A;  4OON A;  1KGE A;  1PW1 A;  4WM9 A;  2VGL M;  1XFQ A;  4S2I A;  1XJ4 A;  4GD8 A;  1BUL A;  3IH8 A;  4GHI B;  4YNR A;  4WEJ A;  4DJ3 A;  4GKU A;  3WRZ A;  3UB8 A;  1S67 L;  4GJ4 A;  5KZH A;  3Q82 A;  2ZMV A;  4G3V A;  2M7U A;  3HLF A;  1BSG A;  5GLC A;  5EVI D;  4R6L A;  3EQU A;  4NET A;  4WUJ A;  3T4O A;  5DFX A;  5HAR A;  1MXO A;  2P7J A;  1W8Q A;  3E4P A;  1TDG A;  3UMD A;  5EVI C;  4KZ7 A;  5CHJ A;  2JE5 A;  3G2Y A;  3PXP A;  3EEH A;  4LCL A;  4HJ6 A;  4WBG A;  4DN0 A;  3JVV A;  3E4Q A;  3DTI A;  5HPI A;  3C7V A;  1SZV A;  3WS1 A;  5JYO A;  3CZD A;  3HJI A;  5FAT A;  3LR0 A;  2WZX A;  4HHD A;  1KE4 A;  4WLA A;  1KVL A;  4PM5 A;  3T1Q B;  2B5R A;  5C5K A;  1I2W A;  1PW8 A;  2QPN A;  4YIN A;  1I2S A;  4NG2 A;  3P98 A;  1XKZ A;  1OJ5 A;  3MSH A;  1D06 A;  4UHU A;  3F1N A;  1DY6 A;  3IF5 A;  1A0K A;  1IEL A;  1BLH A;  2AVX A;  2DRW A;  3BM6 A;  4GOG A;  3O86 A;  5HPF A;  3KSI A;  3Q1F A;  2GNX A;  3IBJ A;  2Y2H A;  3ZHH A;  3WRT A;  5FDH A;  5DTT A;  4R3J A;  3O88 A;  4DE2 A;  3DTM A;  3BJN A;  3HBR A;  3TW8 A;  2O9A A;  4P6Z S;  4HBU A;  2VA0 A;  2V0W A;  2P04 A;  2JN7 A;  2D01 A;  5A91 A;  4S2N C;  1FCM A;  2VEA A;  3Q7V B;  5CTM A;  4LV3 A;  1UWN X;  1PWC A;  3CPT B;  4QPR A;  3ICY A;  1IYS A;  3N8L A;  3NBL A;  1YLP A;  2Y4A A;  2UV0 E;  1IFQ A;  5GLB A;  2IWD A;  5EV0 A;  1H8M A;  4DDY A;  2P74 A;  5CEC A;  2ZLY A;  1MWR A;  4JXG A;  1OT9 A;  3V3R A;  3ZYT A;  2JKT M;  3UB7 A;  4X25 A;  1YLW A;  2X01 A;  2G2U A;  4OQI A;  1XGJ A;  3HUN A;  1HVB A;  5FEF A;  4LEN A;  1PI5 A;  1WA9 A;  3LFV A;  1G5U A;  1DP6 A;  1H8Y A;  3BFC A;  1YAX A;  2D02 A;  1T18 A;  5CGS A;  5CGX A;  4QB8 A;  1E25 A;  2XH9 A;  3M2K A;  2OOL A;  1BLC A;  4OPQ A;  4EUZ A;  4N92 A;  3Q07 A;  3P01 A;  3KYQ A;  1ZG4 A;  3O87 A;  1K4E A;  1W5D A;  4BBU A;  4HH3 A;  4DXC A;  4MDZ A;  4KUK A;  2XFT A;  5HSQ A;  3KSF A;  4IJG A;  2XRO A;  1PWG A;  1D1J A;  3PBR A;  3EEA A;  4WYY A;  2QJ7 A;  4QJG A;  1XJ2 A;  1S4S A;  3T50 A;  1SHV A;  3OCL A;  2C5W B;  1SDN A;  3IS2 B;  1YLJ A;  3G31 A;  5IT5 A;  2PU4 A;  4OPR A;  1EI5 A;  3IHB A;  3UN7 A;  1S1Y A;  2JBF A;  3NC8 A;  3BFG A;  1ESI A;  4EQ1 A;  2A2L A;  3H82 A;  1K55 A;  1MWS A;  1Z09 A;  3KYZ A;  3ZG7 B;  3UDI A;  2QKP A;  3MQO A;  1Y4O A;  1NXY A;  5AVF A;  3UE0 A;  2ZL1 A;  3UB5 P;  2EFU A;  4ZRR A;  3T4Q A;  5EFW A;  3B3X A;  5HFO A;  5DKK A;  3OOV A;  1H5X A;  2MJ6 A;  4QD4 A;  2CC1 A;  3D3O A;  3G6O A;  2ZMA A;  2BTF P;  1JTG A;  5M1A A;  1UWP X;  4O7D A;  4C75 A;  4OQ0 A;  3LIB A;  1E3U D;  5IS1 A;  4JLF A;  5J4E A;  2A3U A;  1IKI A;  2HP9 A;  2J9P A;  4GS9 A;  3A3J A;  3M6B A;  1N9B A;  2ZBB A;  3IXG A;  5L09 A;  3C2W A;  3G34 A;  4MEZ A;  4A5R A;  3BFE A;  1YQS A;  4GD6 A;  3V39 A;  4EBP A;  5CGW A;  4BWI A;  3ZG9 B;  1BZA A;  4Q0I A;  2ZQC A;  2V0U A;  5HDS A;  4LRZ E;  3H7W B;  1ZHH B;  4BD0 A;  2ZQ8 A;  1LSW A;  4ZJ2 A;  4OOL A;  1P9W A;  1ES4 A;  4Y0U A;  3LI9 A;  1ES3 A;  3E2K A;  3VOZ A;  5CX7 A;  1ZKJ A;  4MBH A;  1IKG A;  2BAS A;  1ZG6 A;  1KOU A;  5F5Y A;  2NUT C;  1MY8 A;  3IHA A;  3NOT C;  1GSV A;  4KQQ A;  3NOP C;  3ITB A;  2XD1 A;  2B02 A;  4HQA A;  2EXA A;  3PHY A;  2HV1 A;  2PD8 A;  5DFY A;  4ZJ1 A;  4O0P A;  2V9A A;  1WE4 A;  3MXQ A;  1BLP A;  1KE0 A;  1MWT A;  4ARZ B;  3HL9 A;  3C5A A;  1NRF A;  2E8J A;  5FAQ A;  1ONH A;  4DE1 A;  3PAE A;  1S0W A;  1CI9 A;  4X6T A;  3GEC A;  2OAP 1;  1K4F A;  2Y79 A;  3DBA A;  5HD3 A;  2W3H A;  4LPZ A;  1ONG A;  3BEB A;  3GRJ A;  2P08 A;  2A24 A;  4GN2 A;  1FIL A;  1NZO A;  2J8Y A;  2HDR A;  3F1O A;  4WZ4 A;  5EPH A;  4HP4 A;  3CIT A;  1YMS A;  1VEU B;  4P6Z M;  2P9V B;  2G7U A;  1ACF A;  2QMI A;  2XEP A;  4NK3 A;  1VET B;  5IU1 A;  5L07 A;  3PAG A;  3UB6 A;  2Y2I A;  3CLO A;  3F1P B;  2VV8 A;  3HVF A;  2V8C A;  3EQV A;  2V2F F;  2PD7 A;  4H6J A;  3VP0 A;  4I39 A;  2WUQ A;  5FAO A;  2J3T C;  4DXB A;  3HUO A;  3NY4 A;  4JF5 A;  5TJJ A;  5F82 A;  1VB6 A;  4RQ9 A;  1RGZ A;  4EES A;  2EXB A;  1SKF A;  3C4O A;  3IWI A;  3QP1 A;  4Y15 A;  4R3B A;  2IWC A;  4I38 A; 
#chains in the Genus database with same CATH homology
 3NHQ A;  4LRY C;  4PAU A;  2W0N A;  4Y2F A;  5HDD A;  1G6O A;  3NJA A;  1OJ5 A;  4OOM A;  3LI8 A;  2HJ9 C;  1D06 A;  3F1N A;  2Z6D A;  2XA7 S;  4IUK A;  3B33 A;  4M4X A;  3W2Z A;  3UME A;  4PKY G;  4EEU A;  1DP9 A;  2JKR I;  3KSH A;  3CUE C;  1IOU A;  5LBR A;  1YSP A;  2ZMF A;  3KX0 X;  4I5S A;  4UEY A;  5AVE A;  2W1T A;  5HPF A;  3KSI A;  4L9E A;  3B47 A;  2GNX A;  3MR0 A;  3IBJ A;  5K5B A;  2O9C A;  4BBV A;  2L1M A;  2EWV A;  3OLO A;  1T1A A;  2FZ0 A;  3A0V A;  3BJN A;  3H7W A;  4DJ2 A;  3TW8 A;  2O9A A;  4P6Z S;  2XRN A;  1TD5 A;  3PBO A;  2VA0 A;  2V0W A;  3VE4 A;  2P04 A;  2JN7 A;  2D01 A;  2OAQ 1;  2GX5 A;  2XA7 M;  4O8G A;  1MKM A;  1TS6 A;  2VEA A;  1W63 M;  2O9B A;  2QJ5 A;  1UWN X;  2M7V A;  3T4L A;  4R70 A;  4QPR A;  1OTI A;  3FC7 A;  3ICY A;  1ODV A;  1S1Z A;  1V9Y A;  3RFB A;  4CLC A;  3K3D A;  1N9L A;  3BQ8 A;  2VZW A;  3CWF A;  3PYP A;  1LSV A;  4K08 A;  2R78 A;  3GDI A;  4II7 A;  3IS2 A;  1IFQ A;  2PR6 A;  5I5L A;  4Y5F A;  3EGD C;  2OWJ A;  5HDC A;  2W3E A;  1H8M A;  5DJU A;  3UE6 A;  2W3D A;  3LIF A;  5DJT A;  1F5M A;  1OT9 A;  1F9I A;  4F3L A;  3HJK A;  3LR5 A;  4Q0J A;  3EGX C;  2JKT M;  3UB7 A;  3ZYT A;  5FL3 A;  2W3G A;  5HD5 A;  4ME4 A;  1YKD A;  4WF0 A;  3R7W A;  3F1N B;  1WA9 A;  3LFV A;  2FH5 A;  1NLY A;  4L0L A;  4FSF A;  3ULF A;  1DP6 A;  1YAX A;  1OTA A;  2D02 A;  3A0R A;  1T18 A;  2KOI A;  2LB9 A;  4ARZ A;  3LR4 A;  4HJ3 A;  1XJ6 A;  4GW9 A;  1XFN A;  4HNB A;  1D7E A;  1H3Q A;  4BMW A;  1NRJ A;  4JGQ A;  5MC7 A;  2OOL A;  1F98 A;  2LB5 A;  3P01 A;  3KYQ A;  3NOU C;  5G4Y A;  2V1B A;  4Q0H A;  1EW0 A;  3S7O A;  4BBU A;  4I3J A;  4HH3 A;  4NKP A;  3KO6 A;  4O01 A;  3PBN A;  4MDZ A;  4KUK A;  5F68 A;  3UE3 A;  3MQ0 A;  1GSW A;  4WEK A;  5HSQ A;  4GLQ A;  3KSF A;  3VOL A;  4CLC D;  3LID A;  4PKY A;  4YWZ A;  2A24 B;  1XJ3 A;  4IJG A;  3MF0 A;  4KQD A;  2JHE A;  2JKR M;  2KDK A;  3T4K A;  2XRO A;  2IA2 A;  3PBR A;  4CLC B;  3EEA A;  4HOI A;  2QJ7 A;  1XJ2 A;  1S4S A;  3T50 A;  4NXF A;  3F1O B;  4G3W A;  1LL8 A;  3EWK A;  3OCL A;  5AJG A;  2HF6 A;  4ETZ A;  1OPX A;  2J80 A;  3IS2 B;  1BYW A;  1Y28 A;  3OBF A;  3A0S A;  5IT5 A;  4LRX C;  1S4R A;  4GHI A;  5DKL A;  1S1Y A;  3UB9 A;  4I3I A;  4EQ1 A;  3S7Q A;  2A2L A;  3H82 A;  2VX8 A;  3KYZ A;  2QKP A;  1N9O A;  3F1P A;  3MQO A;  2VKS A;  1JNU A;  2HGV A;  4MN6 A;  4WL9 A;  2VV6 A;  2WKP A;  4UQI M;  5AVF A;  3LIE A;  3C8C A;  4JGP A;  1P0Z A;  3B42 A;  4HJ4 A;  4ZRR A;  3T4Q A;  2Z6C A;  5EFW A;  2O99 A;  5DKK A;  4H6J B;  4WN5 A;  3OOV A;  3TJZ C;  4EU0 A;  4EEP A;  2QHK A;  3BQA A;  2W1R A;  3MJQ A;  2MJ6 A;  4AFI A;  3D3O A;  3G6O A;  5F6A A;  4HY8 A;  4XT2 B;  1GSX A;  3FPV A;  4MMN A;  1NLZ A;  1V9Z A;  4NXB A;  2PT7 A;  2VJW A;  3TE8 A;  1UWP X;  3LIA A;  4EW7 A;  3LIB A;  2QWS A;  2HJE A;  5KIZ A;  2I9V A;  3U2A A;  3C38 A;  4MCW A;  2PDR A;  4KQO A;  4Y3I A;  2GJ3 A;  3D72 A;  3VE3 A;  5IS1 A;  3EOI A;  5J4E A;  3T4S A;  3CI6 A;  5L8M A;  4GS9 A;  2YKH A;  1OTB A;  2KX6 A;  3CUE A;  2ZBB A;  4EXO A;  2OWH A;  5KSH A;  2QYB A;  4BJP A;  3C2W A;  5A8B A;  5F69 A;  4HH2 A;  4E04 A;  1MZU A;  2W1T B;  2PYP A;  2ZOI A;  4JGR A;  3CAX A;  1OTE A;  4BWI A;  1X0O A;  3H82 B;  4Q0I A;  5J3W A;  2V0U A;  5HDS A;  4LRZ E;  3H7W B;  1ZHH B;  1ZTU A;  3R4K A;  2J3T D;  4IHQ A;  2PR5 A;  3FPW A;  1TS8 A;  1OTD A;  1LSW A;  2EWW A;  5TBM A;  2PYR A;  3IBR A;  4CQH A;  5J7E A;  3MMH A;  4DMZ A;  4MN5 A;  1MC0 A;  4OOL A;  1P9W A;  2J3W A;  3S7N A;  4JGO A;  4PHT A;  1W63 Q;  4MN7 A;  3MQQ A;  1STZ A;  3LI9 A;  4HP9 A;  3T4J A;  4UQI S;  1DRM A;  1UGU A;  5HL6 A;  2Y8H A;  3BY9 A;  4HI4 A;  5CX7 A;  4WEL A;  2K7S A;  1OJG A;  2VV7 A;  4CLC C;  4R3A A;  5HWW A;  3SW1 A;  2BAS A;  2L0W A;  4EET B;  1KOU A;  5F5Y A;  2NUT C;  3E98 A;  3NOT C;  1GSV A;  5HWV A;  3NOP C;  3MFX A;  3FG8 A;  4GCZ A;  5DF9 A;  2B02 A;  4F3L B;  3HCY A;  1YSQ A;  4YOF A;  2CMN A;  3VV4 A;  5G4Z A;  4GS9 B;  5HWT A;  4HQA A;  2WKR A;  2WKQ A;  2XSS A;  4ETX A;  2K2N A;  2YKF A;  3R7W B;  3PHY A;  4L9F A;  3JVU A;  1OT6 A;  2HV1 A;  2V1A A;  3OCN A;  2PD8 A;  5DFY A;  2PHY A;  3K2N A;  4O0P A;  2V9A A;  3H9W A;  3OC2 A;  1P97 A;  3V67 A;  3MXQ A;  1G28 A;  4I3A A;  4KUO A;  4B93 A;  1DP8 A;  4ARZ B;  2VLG A;  3C30 A;  4EUV A;  3S7P A;  1S66 L;  3LUQ A;  4R38 A;  3RH8 B;  2VGL S;  4NXG A;  2W27 A;  2INW A;  2O0Y A;  2L4R A;  3GEC A;  1LSX A;  2OAP 1;  3DBA A;  2Y79 A;  5HD3 A;  2W3H A;  5TBM B;  4LPZ A;  3E4O A;  3PR6 A;  4NEE D;  2DMW A;  2ZOH A;  2P08 A;  2H28 A;  3T4T A;  2A24 A;  3TRC A;  3RTY A;  1T19 A;  1VHM A;  2B18 A;  3PBQ A;  3E0Y A;  4FOF A;  3F1O A;  1P9R A;  3LR3 A;  1TS0 A;  4NXE A;  4HP4 A;  2EA9 A;  2M1C A;  3BWL A;  3CIT A;  3KSG A;  3P7N A;  4BBT A;  4P6Z M;  2VGL M;  1XFQ A;  3PBT A;  3O5Y A;  1XJ4 A;  2G7U A;  4G3K A;  4GHI B;  1T1C A;  4YNR A;  4WEJ A;  4Z1W A;  3K3C A;  4L9G A;  4DJ3 A;  3UB8 A;  1S67 L;  3LIC A;  4GJ4 A;  5IU1 A;  2KLI A;  3LYX A;  2ZMV A;  3UB6 A;  4G3V A;  2GZA A;  2M7U A;  1T1B A;  4R6L A;  3EQU A;  3CLO A;  1LT0 A;  4WUJ A;  3F1P B;  3T4O A;  5HZH A;  5DFX A;  1TF1 A;  2VV8 A;  4IUH A;  2JKT I;  2P7J A;  4LLO B;  3EQV A;  2PD7 A;  3E4P A;  4H6J A;  4I39 A;  3UMD A;  1TS7 A;  2W3F A;  3BY8 A;  2J3T C;  3PXP A;  3EEH A;  4XT2 A;  4HJ6 A;  4DN0 A;  1N9N A;  3JVV A;  5TJJ A;  4CLC E;  3E4Q A;  4B9O A;  1VB6 A;  5HPI A;  4RQ9 A;  1NWZ A;  4HIA A;  3HJI A;  2NUP C;  3ZQ5 A;  3LR0 A;  4EES A;  4HHD A;  4WLA A;  3BW6 A;  4EER A;  5C5K A;  3PBS A;  2K31 A;  4I38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...