4BMWA

Crystal structure of the streptomyces reticuli hbps e78d, e81d double mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
PAAAPVAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYDSADRKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTRACELLULAR HAEM-BINDING PROTEIN
publication title Iron Binding at Specific Sites within the Octameric Hbps Protects Streptomycetes from Iron-Mediated Oxidative Stress.
pubmed doi rcsb
source organism Streptomyces reticuli
molecule tags Metal binding protein
total genus 41
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bmwA01
4CLCE 4CLCA 4NKPA 4CLCC 3FPWA 4BMWA 5CX7A 3FPVA 4CLCD 4CLCB 2A2LA
chains in the Genus database with same CATH superfamily
5HDSA 3ZDJA 3LIDA 2ZOHA 2QJ5A 2NUTC 3LIFA 3ZVTA 4UA9A 3OLOA 1L2SA 4DE0A 3ISGA 4OOLA 1JWPA 4HQAA 4JXSA 2KDKA 1KE0A 5L2FA 4WLAA 3WS5A 4E04A 2Y8HA 5A91A 2J3TC 4EESA 1NZUA 3DWKA 3A3JA 3FC7A 1W63M 3EGDC 3UO9A 4KQOA 2Y2QA 2XA7M 3G31A 1HVBA 2VV8A 2R9WA 4O7DA 2V0UA 4OPYA 3T4KA 4EU0A 1T19A 1PWDA 4LV2A 4QY5A 3CITA 1WE4A 2HF6A 4EUVA 1BULA 1KOUA 5LBRA 3LUQA 4IUKA 1KGEA 5GHZA 4KENB 3EQUA 5IU1A 2P74A 2IWBA 2Z2MB 1OTDA 3WS1A 3UPPA 2HGVA 3BQAA 2IWCA 5TR7A 1ES4A 3ULFA 1VETB 4JGQA 3O86A 4ZJ1A 3NC8A 1MXOA 4MN7A 1NJ4A 2PT7A 3SOIA 5JYOA 4PKYA 3HREA 1L0FA 4CLCB 1JNUA 3KSIA 5G18A 5EOOA 1YKDA 3HLFA 3BFGA 2H5SA 5DF9A 1EW0A 2JCHA 1DRMA 2EXBA 5CTMA 3W4QA 4K08A 5K5BA 2E8IA 3ZQ5A 1OJ5A 4ARZA 4O0PA 4BMWA 2A2LA 3UE6A 3GV9A 1BTLA 1LL8A 3KSHA 3GR2A 3LY4A 3PAEA 4HIAA 4GDBA 4C6YA 4WZ5A 1MPLA 5HX9A 5F1FA 1K57A 2HDQA 1N9LA 4X69A 5A90A 4Q0JA 2V8FA 2EWWA 1TDLA 3WWXA 4OP8A 4IUHA 3BY8A 3QP8A 2QMIA 1ACFA 3DBAA 4YWZA 2V1BA 4WZ5C 2EXAA 3IHAA 3F1PB 1KE4A 2OOLA 1K57C 2Z6DA 3Q1FA 2OWJA 1QMEA 1NZOA 5L10A 3C8CA 1TEMA 4RVAA 2J9PA 1KE3A 3ZG5A 3BLSA 3NCKA 1PYYA 3S4XA 2P08A 2W3FA 4F94A 5FQJA 3VSLA 5GL9A 2L4RA 1MC0A 3F1OB 3S7PA 3BWLA 4JBFA 2EX9A 4WM9A 4D2OA 4MNRA 1KDSA 3V3SA 3KYEA 2VLGA 3R7WB 4DDSA 3OC2A 3DWZA 5EM0A 5HSQA 3BY9A 3KX0X 4E3JA 4OQHA 4EBLA 1PIOA 4WL9A 3LIEA 1Y28A 5F69A 3SH7A 2JKRM 4MBKA 1L0GA 4A5RA 4QJGA 3IBRA 5AQ9A 1BYWA 1YLTA 2O9AA 3CPTB 3FV7A 1KVMA 3FPVA 1K6SA 4JF6A 4WELA 4UQIM 1XJ3A 1PZPA 2EFXA 2J9OA 3LR0A 3A0SA 2QPNA 3LIAA 3OCNA 5CX7A 4P0MA 3SW1A 1ERMA 2XEPA 4IVKA 5JYPA 3HLCA 1S0WA 1X0OA 1I2SA 2Y2HA 3SH8A 5EVID 3K3CA 2GJ3A 1LL9A 2R78A 4JGRA 3PBOA 3T4LA 5G4YA 4MMNA 3NY4A 1GCEA 4WEKA 1XKZA 3G32A 4YFMA 4HEFA 1L0DA 2DNSA 4GLQA 3T12B 3MKFA 4LCLA 3C7UA 4PMAA 2A24B 3QNCA 1MWSA 2GX5A 4LV0A 1XX2A 1EI5A 4KQDA 3NHQA 4GHIB 5AQ7A 1H5XA 4E3LA 3M2JA 3VP0A 4E6XA 4P6ZM 3CMZA 1BLCA 4WBGA 5HWVA 5L8MA 2WADA 3E2KA 4OONA 3CI6A 3BFDA 2JHEA 2PYRA 3UB9A 5CHMA 4IBXA 3JPUA 5DFYA 5EV0A 2ACGA 2ZM8A 2JKFA 3ZVWA 3W4OA 1XJ4A 4XT2A 4ZRRA 2I9VA 3W4PA 4U0XA 2HPBA 3BEBA 2OLVA 4ETXA 3WS4A 4XXRA 3BFCA 3IF6A 2OSUA 1ONGA 1ES2A 4FSFA 3HCYA 2WKEA 3V5MA 1XXMA 4L0LA 2QWSA 1S1ZA 2ZMFA 1NYYA 5EPHA 5AVEA 2G2UA 5TGFA 1TD5A 1F5MA 5HPFA 4L9GA 4ZAMA 1FILA 2DMWA 2XFSA 1VQQA 3H7WB 2OLUA 2V20A 2JE5A 4OPRA 3IF6C 4X53A 2HV1A 1H8YA 2WGWB 1ZHHB 2H0TA 3S7OA 4BBUA 1OT6A 4MLLA 1K4EA 5E2GA 3CZDA 3UNWA 3UB6A 2B95A 4RQ9A 4JXVA 2ZC4B 1ERQA 4E6WA 2MJ6A 1LSXA 3QNBA 4U0TA 1MY8A 5EFWA 3G2ZA 2Y2GA 1N9NA 1OTAA 1T18A 3C4OA 2WGIA 1UWNX 1HTZA 2P04A 1U60A 3JYIA 3SS3A 1CI8A 1C3BA 2QYBA 1K56A 3UB7A 2HDUA 1DP6A 1K38A 4RX3A 4KG5A 1NLZA 3FYZA 3V3RA 4CQHA 3A0RA 1YLPA 4JF4A 5J8XA 5KSHA 4JKTA 2D02A 3NJAA 4BENA 2WAEA 1QMFA 4GS9A 3PBTA 4K0WA 4E3MA 2KLIA 4HI4A 4OPQA 3C5AA 3UB8A 4JXWA 4X25A 3G34A 1M6KA 1P9WA 1W8YA 1IYQA 1FSWA 2XRNA 3IWIA 3U4LP 1PRQA 2VK3A 3PBRA 3E2LA 3BYDA 1NY0A 5FASA 4B88A 3VE3A 3C38A 2ZM0A 2Y2JA 1W8QA 5AQAA 4GJ4A 4NXBA 4DE1A 2DRWA 2KX6A 1EROA 4EEPA 4R38A 4MN5A 3MS6A 5HWWA 3DTEA 4DRTA 1MKIA 3MQ0A 1ZKJA 1E4DA 5F6AA 2ZC6B 1VM1A 3E4QA 2JKRI 3T1SA 1PNEA 3A0VA 2BTFP 3GRJA 3UN7A 4EQ1A 1O7EA 1FQGA 3LIBA 3CAXA 4QY6A 5EECA 4S2KA 4JXGA 5CGWA 4HJ3A 3LEQA 1S1YA 4D60A 3F1PA 5HAPA 1D1JA 2LB9A 3HVFA 3BLMA 3HUMA 3LO7A 3LR5A 1ZC2A 1T1CA 4IBRA 4X1LA 4HH3A 5CEDA 4KZBA 3B47A 3IBJA 3BFEA 1UWPX 3QP4A 3E4OA 2K7SA 1LT0A 1MKMA 4LPZA 4H6JA 1LSWA 3A3IA 4PKYG 3O88A 1J3WA 3IS2B 1SKOA 1DJBA 1IELA 2P9VB 3BFFA 2VGKA 1CF0A 2XR0A 2PR5A 3L7HA 4QU3A 4NEED 1G28A 5F82A 4QPRA 1DJAA 1GHMA 1VEUB 4GB7A 4EUZA 3GVBA 2VGLS 2WZXA 2W1TB 1YSPA 1NYMA 3Q7VB 3MXQA 1K0KA 1PWGA 2ZQDA 3SS4A 1ESIA 1YLZA 3IXGA 3OPLA 4I3IA 4GDNA 4R0QA 5DTKA 1XP4A 3FZCA 4MN6A 5KIZA 4M3KA 1IYSA 2JKGA 2C5WB 3MQQA 4II7A 1P0ZA 1G68A 1SZVA 3S22A 2KOIA 5TBMB 4FOFA 4ZDXA 3DW0A 3H82A 2YKFA 5FAOA 2ZQ8A 1ES3A 2PRFA 2GNXA 2JBFA 4MBFA 3T1QB 1K4FA 1Y54A 4FTXA 3VP1A 3V50A 4E3KA 3AGDA 4WMCA 4ME4A 4LGWA 4IEDA 2IA2A 5I94A 3WS0A 2B18A 4RYEA 3HUNA 3HLDA 4OPZA 3NOPC 3MQOA 4ZBEA 3B42A 4JF5A 5FDHA 5G4ZA 4N9LA 4L9EA 3KSGA 1IFQA 4KQRA 4OQ0A 3VP4A 2JKTI 2G7UA 2ZD8A 1NWZA 4KG6A 1XA1A 4IVIA 1E3UA 1HLUP 2UWXA 3UB5P 5L09A 4PAUA 4Y2FA 2XFTA 4HH2A 5TJJA 1CEFA 4HHDA 1KGFA 4MCWA 5CGSA 2PD8A 1D7EA 3IH9A 3CUEA 4OVDA 3HLWA 5GLBA 4I39A 5E2EA 4KZ3A 2OV5A 5CGXA 2WYXA 1W63Q 4UA7A 3T4OA 4HNBA 4OOMA 1G5UA 5HPIA 1K56D 5FQMA 2WGVA 1NRJA 5FAPA 4Z1WA 3QP5A 2PR6A 1S67L 4O01A 1Q2QA 4PM7A 2Q9NA 4Q0HA 3RTYA 3W2ZA 3CUEC 3IX3A 2IWDA 1SHVA 4S2LA 4PM8A 1L0EA 3H9WA 1MZUA 5M1AA 2PU2A 3UY6A 4CLCE 2ZOIA 3VE4A 4H8RA 3WRTA 3MBZA 3M6HA 3HJIA 5FI2A 4NETA 2JN7A 1FOFA 3IT9A 4JPMA 4OQGA 4DJ2A 1I2WA 3OZHA 5KMWA 3OPPA 4DN0A 2EWVA 4FD8A 4NXEA 3UE0A 1YLWA 3NOUC 1IOUA 1BLSA 1YAXA 5J4EA 4NXFA 2ZQ9A 3ZNYA 4GW9A 4XUZA 4EERA 3B33A 2WKQA 4GZBA 2UV0E 1JTDA 5HWTA 5GHYA 3CWFA 2W3DA 2M7UA 1CI9A 1WYBA 5GLDA 2XD1A 4ESPA 4WEJA 4EXOA 3CJMA 1P9RA 3F1NB 4PM6A 3RFBA 3O87A 4F3LB 1GSXA 1ZTUA 4MBHA 3IF5A 3AGEA 1SKFA 2XK1A 3FWLA 3V39A 3AGFA 1JTGA 1PI5A 2H10A 4IJGA 2PBDP 4GD6A 2RCXA 2J3TD 4HBTA 5FDSA 4EQIA 5HDDA 3UDXA 4KZAA 5AJGA 4DXCA 3VFFA 3BM6A 3D3OA 3NOTC 3NI9A 4Y0TA 5U47A 1I5QA 5EOEA 3N4IA 5HZHA 2B02A 1N4OA 1SCWA 2BASA 5J7EA 3HBRA 1LL5A 1H8MA 4EEUA 1GSVA 3HLBA 5DTSA 2ZQ7A 1ES5A 4G3WA 5A8BA 4X56A 3FG8A 3HLEA 5MC7A 2HZ5A 2W3GA 5DF8A 4KUKA 3MXSA 5KSCA 5FAQA 2J7VA 4M4XA 5E43A 3S7NA 4Y3IA 3LICA 1O07A 3T4QA 5GHXA 3LYXA 4UEYA 2WKHA 3PAGA 4ZJ2A 4E3IA 4GN2A 1BLPA 2B5RA 1TS7A 4Q0IA 3IS2A 1KVLA 2P9VA 2Q9MA 3ZG9B 4BL3A 2HJEA 3MXRA 5C5KA 4Y17A 1OT9A 1NXYA 3P98A 2C6WB 2LB5A 3D9YA 3GMWA 4P85A 1PZOA 1A0KA 1PFLA 3T4TA 1BLHA 1H3QA 2W1TA 3BJNA 4BD0A 4R70A 1JWZA 3Q7VA 4OQIA 3UMEA 4R4RA 2EFUA 3MZDA 1Y4OA 2VKSA 2JKTM 4WMCD 1M40A 3A3DA 4JGPA 3PBSA 4ZTKA 1VETA 3K2NA 3B3XA 4KZ8A 1IKGA 1D06A 4B93A 4Y5FA 3TSGA 1HD8A 2O0YA 3MJQA 3LR4A 5EUAA 1KDWA 3ICYA 3T50A 1YT4A 2WKRA 4CLCA 3ZYTA 4Y0UA 3HLGA 2Y55A 5FQKA 1E3UD 4OOYA 4OLDA 4QD4A 1F9IA 3PYPA 2Y2KA 4KQQA 1EWZA 4OH0A 3ZG8B 2XA7S 1OTBA 2Z6CA 5FI6A 5HD5A 5HL6A 3VOZA 4CLCC 1IYPA 2I72A 3EQVA 1S4SA 3IQAA 1FCNA 2K2NA 1F2KA 3MSHA 5DFXA 5DKLA 5EVLA 1N9OA 2VZWA 3D72A 4Y13A 4X68A 3NDGA 5CERA 5HDCA 4U3TA 2V0WA 4LRZE 1PW8A 2XLNA 3ZG0A 1MWUA 1IYOA 2Y91A 4FH2A 4N92A 3O3VA 4EV4A 4BQMA 3GSGA 5IS1A 2G2WA 3LGOA 5IHVA 2YKHA 3CG5A 4OP5A 3G6OA 2XH9A 5EE8A 3UDIA 1CEGA 2PAVP 2XGNA 3T4SA 1RP5A 3L9KA 4DKIA 5F1GA 2A49A 3T4JA 3ZHHA 1PWCA 3NBLA 4GD8A 4EWFA 4XT2B 1ONHA 4AFIA 1XFQA 3TE8A 4P6BA 3FKWA 3NDEA 3OPRA 3MKEA 4PHTA 2GDNA 2HP6A 3G30A 4HP9A 4S2PA 1P97A 3F1OA 3IF6B 5FQ9A 3EEHA 1RCJA 3I7JA 2PD7A 5FEFA 3G4PA 3ZG7B 2HP9A 3C7VA 3R7WA 1S6RA 4UHUA 3EWKA 3WRZA 1XGJA 3ITAA 5CXWA 5CHUA 3E4PA 4LRYC 2OAQ1 2QHKA 3QHYA 5DTTA 3SZTA 3HUOA 3NIAA 1FR1A 1MWTA 3TRCA 2FFYA 2ZQAA 4K91A 4PM9A 1YQSA 2J3WA 3LI8A 1DP8A 1RGYA 5F5YA 3CPTA 3C4PA 5AVFA 2ZC7A 5FL3A 1ODVA 5CEBA 3Q81A 4KZ5A 4WYYA 1MBLA 1K6RA 5I5LA 3KO6A 3C2WA 1ESUA 3RJUA 1KGGA 4G3VA 1T1BA 5DJTA 4DMZA 3DTIA 3IX8A 4BWIA 3IXHA 4HJ4A 5TFQA 2Y2PA 4LENA 3G35A 4DF6A 1E25A 3O5YA 3PR6A 3F1NA 4R1GA 2WKPA 4KZ9A 3VFHA 5EVEA 5E2HA 4F3LA 4DDYA 2EX6A 1LLBA 5HW3A 2WKIA 5DJUA 2HJ9C 4GS9B 5FATA 4YINA 4B4XA 2A24A 3P01A 1H8ZA 2W3HA 4GHIA 3QP2A 4HBUA 1FCOA 2VJWA 2FFFB 2V9AA 1K55A 2M7VA 4X55A 4CPKA 3R4KA 2GZAA 2X71A 3TOIA 5FI7A 3ZNTA 5CTNA 1W7FA 4O8GA 4X6TA 2J8YA 1FCMA 5DKKA 1XGIA 3MZEA 3PBQA 1YSQA 2WZZA 1K55C 2L1MA 3UPOA 2EX2A 4IHQA 3ITBA 3PTEA 3VMAA 4UQIS 2VA0A 1CJFA 3RXXA 2Y2LA 2HDRA 1Z6FA 3D4FA 3HJKA 4BBTA 1IEMA 4HY8A 3MFDA 3JVVA 3A3EA 1W5DA 2W27A 2VGLM 5F68A 3PXPA 1N9BA 3E98A 4QHCA 3U2AA 1VHMA 2P7JA 1K25A 5EVIB 3IWOA 2V1ZA 3H7WA 2Y2IA 3M2KA 3LI9A 1H0MA 1LI9A 2ZL1B 4DE2A 1VB6A 1SDEA 4S2JA 2A3UA 5HL1A 2WGWA 3W8KA 2ZBBA 4CJNA 3VP3A 2NUPC 2VX8A 5L07A 3Q7ZA 1BZAA 3ZFZA 4DXBA 1STZA 2X02A 4BL2A 3HL9A 5CECA 2QZ6A 4P6ZS 3DTKA 1OJGA 3S7QA 1XFNA 4LCMA 4YNRA 3QP6A 3FPWA 4GKUA 3PBNA 4CLCD 4H6JB 1V9ZA 1TVFA 4LFUA 2X01A 3MMHA 3E0YA 3PHYA 2XD5A 2V1AA 1OPXA 4HESA 1SKOB 4LLOB 2PBYA 1ZG6A 3IXBA 4K0XA 3VP2A 3OOVA 2H0YA 3LCEA 4GCZA 2EA9A 3NECA 4GNUA 3SS5A 2PU4A 4EBNA 4HP4A 1TS6A 3A3FA 4FH4A 1OMEA 3IX4A 5KZHA 3S1YA 2PDRA 2V2FF 2L0WA 1NLYA 1OTEA 3KYZA 3KSFA 4NKPA 1FIKA 4E3NA 2ZC3B 2ZJ9A 5GLCA 2W3EA 1SDNA 1OTIA 3NULA 4I38A 3N8RA 4WUJA 3EOIA 2FZ0A 2VEAA 2VGJA 4UAAA 2O9BA 2OAP1 5HAIA 1S66L 3DAVA 1HZOA 4N1XA 1J9MA 2EX8A 4R6LA 2ZM2A 5CHJA 3VOLA 2VV6A 3FKVA 3UDFA 5A93A 2XDMA 3OBFA 5J3WA 2Y4AA 3LR3A 2OWHA 3TW8A 1RGZA 3H82B 4DJ3A 5M18A 1YPRA 4PM5A 4XUXA 1TS8A 2AVXA 2WUQA 1GSWA 5HD3A 4GOGA 2CMNA 4ID4A 3MF0A 1GA0A 1YM1A 3UMDA 2BG1A 4E3OA 4NK3A 4G3KA 3CHWP 4Y7PA 4BJPA 3Q07A 4PPRA 4X1MA 5FA7A 4ARZB 3GTCA 3ZCZA 4KZ7A 2HP5A 1GHPA 4L9FA 2W0NA 5EM1A 4LRXC 1BT5A 3UE3A 1FR6A 4FCFA 2R9XA 3MFXA 5DVAA 3VSKA 1TS0A 2WK0A 4FUWA 2JC7A 1UGUA 2ZC5B 2PYPA 3N8SA 1ALQA 4ETZA 3Q82A 4WZ4A 2ZLYA 1Z09A 5FQQA 3N6IA 4I3AA 3M6BA 5CRFA 2Y79A 4N1HA 1GA9A 1Q2PA 1BUEA 4S2NA 2HDSA 1WYCA 3T1XA 2Y2NA 1T1AA 5IT5A 1DY6A 1GHIA 3P09A 3IH8A 2M1CA 4Y0OA 3TG9A 5A92A 1LI0A 1S4RA 4N9KA 1G6OA 4S2IA 4HOIA 4JGOA 3UPNA 5FQIA 2O9CA 3DTMA 1YMXA 3KYQA 4S2NC 4R3AA 4R4SA 2Y2MA 3VOYA 5GLAA 1IKIA 4QWOA 4KUOA 2PHYA 2Q0OA 1VEUA 2INWA 1XA7A 3T1RA 1F98A 1XJ6A 3LEZA 1MWRA 1W79A 3V67A 3QP1A 4DE3A 3RH8B 2J80A 3JVUA 5FSRA 3G2YA 1WA9A 3LY3A 3MZFA 3SH9A 4EETB 4C75A 4WF0A 4I3JA 4MEZA 2ZMVA 2K31A 2ZQCA 1YLJA 1NRFA 3CLOA 3N7WA 1JVJA 4MDZA 3IXDA 4BBVA 3OPHA 2XQZA 4WN5A 2O99A 5BOHA 5M19A 3VV4A 4ZJ3A 1TF1A 4UA6A 2ZMAA 4YOFA 1ZG4A 2V8CA 5TBMA 2FH5A 3BQ8A 4KZ4A 1CK3A 1XJ2A 4HJ6A 4EBPA 3BW6A 4S2MA 3IHBA 2XF3A 2H28A 3C30A 4KG2A 3EGXC 4R23A 1CQAA 3GDIA 5HARA 1BSGA 3IWQA 1DP9A 1K54A 3OCLA 3LFVA 3MR0A 2Y59A 3EEAA 5FEGA 4LV1A 2RL3A 4Z9QA 4QB8A 3RXWA 2QJ7A 2CC1A 4R3BA 5DF7A 5HAQA 1PI4A 1PW1A 5HFOA 4OLGA 1L3LA 1K54C 2BLSA 4NXGA 4KZ6A 4BD1A 5F83A 4Y15A 1AXBA 4C3QA 1XPBA 1LHYA 4R3JA 4OKPA 5E2FA 2XROA 1V9YA 3WS2A 4S2OA 4P87A 3UE1A 3ZGAB 3P7NA 4EW7A 3N8LA 2W1RA 3GECA 3GQZA 2Y2OA 2WAFA 4JLFA 1DJCA 1TDGA 5AQBA 2DCFA 4Q8IA 5EVIA 4BLMA 4B9OA 2D01A 3BRMA 2ZL1A 3BECA 4RA7A 4NG2A 4RX2A 1YLYA 1G6AA 1FSYA 1AWIA 2Z2LB 3TJZC 1LSVA 2VV7A 5D3OA 2XSSA 2QKPA 4LV3A 4B4ZA 1JWVA 2E8JA 1YMSA 5EVIC 4I5SA 3K3DA
chains in the Genus database with same CATH topology
4UQIS 2VA0A 5HDSA 3F1NB 2P04A 3LIDA 2ZOHA 2QJ5A 3RFBA 2NUTC 4F3LB 3LIFA 1GSXA 1ZTUA 3HJKA 2QYBA 4BBTA 3OLOA 3UB7A 1DP6A 4HY8A 4OOLA 3JVVA 1NLZA 4IJGA 4HQAA 2W27A 2VGLM 5F68A 4CQHA 2KDKA 3A0RA 3PXPA 5KSHA 4WLAA 4E04A 2J3TD 3E98A 2D02A 2Y8HA 3U2AA 2J3TC 1VHMA 3NJAA 4EESA 2P7JA 4GS9A 5HDDA 3PBTA 3FC7A 3H7WA 1W63M 5AJGA 3EGDC 3LI9A 2KLIA 4HI4A 4KQOA 3D3OA 2XA7M 3NOTC 2VV8A 1VB6A 2V0UA 3T4KA 4EU0A 3UB8A 1T19A 3CITA 2ZBBA 1P9WA 5HZHA 2NUPC 2VX8A 2HF6A 2B02A 2XRNA 4EUVA 1KOUA 2BASA 3PBRA 5J7EA 5LBRA 3LUQA 1STZA 4IUKA 3C38A 3VE3A 1H8MA 4EEUA 1GSVA 4P6ZS 3EQUA 4GJ4A 4NXBA 1OJGA 4G3WA 5A8BA 5IU1A 2KX6A 3S7QA 1XFNA 1OTDA 4YNRA 3FG8A 3FPWA 4EEPA 3PBNA 5MC7A 2HGVA 4CLCD 2W3GA 4H6JB 4R38A 3BQAA 4MN5A 1V9ZA 4KUKA 5HWWA 3ULFA 4M4XA 3S7NA 3MMHA 3E0YA 3MQ0A 3PHYA 4Y3IA 3LICA 4JGQA 2V1AA 1OPXA 4LLOB 3T4QA 5F6AA 3OOVA 3LYXA 4UEYA 4GCZA 4MN7A 3E4QA 2JKRI 2EA9A 3A0VA 2PT7A 1TS7A 4Q0IA 3IS2A 4PKYA 4EQ1A 4HP4A 1TS6A 4CLCB 3LIBA 1JNUA 3CAXA 3KSIA 1YKDA 2HJEA 2PDRA 5DF9A 1EW0A 5C5KA 2L0WA 4HJ3A 1DRMA 1NLYA 1OTEA 1OT9A 3KSFA 3KYZA 4NKPA 1S1YA 2LB5A 3F1PA 2W3EA 2LB9A 4K08A 5K5BA 1OTIA 3ZQ5A 4I38A 1OJ5A 4ARZA 3LR5A 3T4TA 1H3QA 1T1CA 4WUJA 4O0PA 3EOIA 4BMWA 2W1TA 4HH3A 2A2LA 3UE6A 3BJNA 2FZ0A 2VEAA 4R70A 3B47A 3IBJA 1LL8A 3UMEA 2O9BA 2OAP1 1UWPX 1S66L 3KSHA 3E4OA 2VKSA 2JKTM 2K7SA 1LT0A 4HIAA 1MKMA 4LPZA 4H6JA 1LSWA 4R6LA 4JGPA 3PBSA 3VOLA 2VV6A 1N9LA 4PKYG 3K2NA 3OBFA 5J3WA 3LR3A 3TW8A 2OWHA 1D06A 4B93A 3H82B 3IS2B 4DJ3A 4Q0JA 2EWWA 1TS8A 4Y5FA 1GSWA 5HD3A 2PR5A 2CMNA 4IUHA 3BY8A 3MF0A 4NEED 1G28A 3UMDA 3DBAA 4YWZA 2O0YA 3MJQA 4QPRA 2V1BA 4G3KA 3F1PB 3LR4A 3ICYA 4BJPA 3T50A 4CLCA 2OOLA 2WKRA 3ZYTA 2Z6DA 2OWJA 4ARZB 2VGLS 3C8CA 4L9FA 2W0NA 2W1TB 1YSPA 4LRXC 3UE3A 1F9IA 3MFXA 1TS0A 3PYPA 3MXQA 1UGUA 2W3FA 2P08A 2PYPA 2XA7S 4I3IA 4ETZA 1OTBA 2L4RA 1MC0A 2Z6CA 5HD5A 3F1OB 5HL6A 4CLCC 4I3AA 4MN6A 3S7PA 3BWLA 5KIZA 2Y79A 3EQVA 1S4SA 3MQQA 2K2NA 2VLGA 3R7WB 5DFXA 4II7A 3OC2A 1P0ZA 1T1AA 5IT5A 5HSQA 5DKLA 2KOIA 1N9OA 3BY9A 3KX0X 2VZWA 5TBMB 3D72A 4FOFA 2M1CA 4WL9A 5HDCA 3H82A 2YKFA 3LIEA 1S4RA 1Y28A 2V0WA 1G6OA 4LRZE 4HOIA 5F69A 4JGOA 2GNXA 2O9CA 2JKRM 3KYQA 4R3AA 3IBRA 1BYWA 5IS1A 2O9AA 2YKHA 4KUOA 2PHYA 2INWA 3G6OA 3FPVA 4ME4A 4WELA 4UQIM 1XJ3A 3T4SA 1F98A 1XJ6A 2IA2A 3T4JA 3V67A 2B18A 3LR0A 3RH8B 3A0SA 3LIAA 3OCNA 2J80A 3JVUA 5CX7A 3SW1A 1WA9A 4XT2B 3NOPC 3MQOA 4AFIA 1XFQA 3TE8A 4EETB 3B42A 4WF0A 4I3JA 2ZMVA 2K31A 4PHTA 3CLOA 5G4ZA 4HP9A 4L9EA 1X0OA 3KSGA 1IFQA 4MDZA 1P97A 3F1OA 2JKTI 3K3CA 4BBVA 2G7UA 2GJ3A 2R78A 4JGRA 3EEHA 3PBOA 3T4LA 2PD7A 4WN5A 2O99A 1NWZA 5G4YA 4MMNA 3VV4A 3R7WA 4WEKA 1TF1A 3EWKA 4YOFA 4PAUA 4Y2FA 4GLQA 4HH2A 3E4PA 4LRYC 5TJJA 2A24B 5TBMA 2FH5A 4HHDA 4MCWA 2GX5A 2OAQ1 4KQDA 2PD8A 2QHKA 3BQ8A 1D7EA 3NHQA 4GHIB 1XJ2A 3CUEA 4HJ6A 4I39A 3BW6A 3TRCA 4P6ZM 2H28A 3C30A 1W63Q 3EGXC 3T4OA 5HWVA 4HNBA 4OOMA 5HPIA 5L8MA 2J3WA 3GDIA 3LI8A 1NRJA 1DP9A 1DP8A 5F5YA 3CI6A 4Z1WA 3OCLA 3LFVA 2PR6A 3MR0A 1S67L 2JHEA 3EEAA 5AVFA 2PYRA 4O01A 3UB9A 4Q0HA 5FL3A 3RTYA 1ODVA 3W2ZA 3CUEC 5DFYA 2QJ7A 3H9WA 1MZUA 1XJ4A 3KO6A 3C2WA 4XT2A 2I9VA 4ZRRA 5I5LA 4G3VA 1T1BA 5DJTA 4CLCE 4DMZA 4ETXA 2ZOIA 4BWIA 3VE4A 4HJ4A 4NXGA 3HJIA 2JN7A 4FSFA 3HCYA 3O5YA 3PR6A 4L0LA 3F1NA 2QWSA 2WKPA 1S1ZA 2ZMFA 5AVEA 2XROA 4F3LA 1TD5A 1V9YA 4DJ2A 1F5MA 3P7NA 5DJUA 2HJ9C 5HPFA 4GS9B 4L9GA 4EW7A 4DN0A 2DMWA 2EWVA 3H7WB 2A24A 4NXEA 3P01A 2W1RA 3GECA 2W3HA 4GHIA 2VJWA 3NOUC 1IOUA 2V9AA 2M7VA 2HV1A 1ZHHB 3R4KA 1YAXA 2GZAA 3S7OA 5J4EA 4NXFA 4BBUA 4B9OA 1OT6A 2D01A 4GW9A 4EERA 3B33A 2WKQA 3UB6A 4RQ9A 4O8GA 5HWTA 5DKKA 3CWFA 3TJZC 2MJ6A 3PBQA 2W3DA 1LSVA 2VV7A 1LSXA 1YSQA 5EFWA 2M7UA 2XSSA 1N9NA 2QKPA 1OTAA 2L1MA 1T18A 4WEJA 4I5SA 4EXOA 4IHQA 1P9RA 1UWNX 3K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC E;  4CLC A;  4NKP A;  4CLC C;  3FPW A;  4BMW A;  5CX7 A;  3FPV A;  4CLC D;  4CLC B;  2A2L A; 
#chains in the Genus database with same CATH topology
 5HDS A;  3ZDJ A;  3LID A;  2ZOH A;  2QJ5 A;  2NUT C;  3LIF A;  3ZVT A;  4UA9 A;  3OLO A;  1L2S A;  4DE0 A;  3ISG A;  4OOL A;  1JWP A;  4HQA A;  4JXS A;  2KDK A;  1KE0 A;  5L2F A;  4WLA A;  3WS5 A;  4E04 A;  2Y8H A;  5A91 A;  2J3T C;  4EES A;  1NZU A;  3DWK A;  3A3J A;  3FC7 A;  1W63 M;  3EGD C;  3UO9 A;  4KQO A;  2Y2Q A;  2XA7 M;  3G31 A;  1HVB A;  2VV8 A;  2R9W A;  4O7D A;  2V0U A;  4OPY A;  3T4K A;  4EU0 A;  1T19 A;  1PWD A;  4LV2 A;  4QY5 A;  3CIT A;  1WE4 A;  2HF6 A;  4EUV A;  1BUL A;  1KOU A;  5LBR A;  3LUQ A;  4IUK A;  1KGE A;  5GHZ A;  4KEN B;  3EQU A;  5IU1 A;  2P74 A;  2IWB A;  2Z2M B;  1OTD A;  3WS1 A;  3UPP A;  2HGV A;  3BQA A;  2IWC A;  5TR7 A;  1ES4 A;  3ULF A;  1VET B;  4JGQ A;  3O86 A;  4ZJ1 A;  3NC8 A;  1MXO A;  4MN7 A;  1NJ4 A;  2PT7 A;  3SOI A;  5JYO A;  4PKY A;  3HRE A;  1L0F A;  4CLC B;  1JNU A;  3KSI A;  5G18 A;  5EOO A;  1YKD A;  3HLF A;  3BFG A;  2H5S A;  5DF9 A;  1EW0 A;  2JCH A;  1DRM A;  2EXB A;  5CTM A;  3W4Q A;  4K08 A;  5K5B A;  2E8I A;  3ZQ5 A;  1OJ5 A;  4ARZ A;  4O0P A;  4BMW A;  2A2L A;  3UE6 A;  3GV9 A;  1BTL A;  1LL8 A;  3KSH A;  3GR2 A;  3LY4 A;  3PAE A;  4HIA A;  4GDB A;  4C6Y A;  4WZ5 A;  1MPL A;  5HX9 A;  5F1F A;  1K57 A;  2HDQ A;  1N9L A;  4X69 A;  5A90 A;  4Q0J A;  2V8F A;  2EWW A;  1TDL A;  3WWX A;  4OP8 A;  4IUH A;  3BY8 A;  3QP8 A;  2QMI A;  1ACF A;  3DBA A;  4YWZ A;  2V1B A;  4WZ5 C;  2EXA A;  3IHA A;  3F1P B;  1KE4 A;  2OOL A;  1K57 C;  2Z6D A;  3Q1F A;  2OWJ A;  1QME A;  1NZO A;  5L10 A;  3C8C A;  1TEM A;  4RVA A;  2J9P A;  1KE3 A;  3ZG5 A;  3BLS A;  3NCK A;  1PYY A;  3S4X A;  2P08 A;  2W3F A;  4F94 A;  5FQJ A;  3VSL A;  5GL9 A;  2L4R A;  1MC0 A;  3F1O B;  3S7P A;  3BWL A;  4JBF A;  2EX9 A;  4WM9 A;  4D2O A;  4MNR A;  1KDS A;  3V3S A;  3KYE A;  2VLG A;  3R7W B;  4DDS A;  3OC2 A;  3DWZ A;  5EM0 A;  5HSQ A;  3BY9 A;  3KX0 X;  4E3J A;  4OQH A;  4EBL A;  1PIO A;  4WL9 A;  3LIE A;  1Y28 A;  5F69 A;  3SH7 A;  2JKR M;  4MBK A;  1L0G A;  4A5R A;  4QJG A;  3IBR A;  5AQ9 A;  1BYW A;  1YLT A;  2O9A A;  3CPT B;  3FV7 A;  1KVM A;  3FPV A;  1K6S A;  4JF6 A;  4WEL A;  4UQI M;  1XJ3 A;  1PZP A;  2EFX A;  2J9O A;  3LR0 A;  3A0S A;  2QPN A;  3LIA A;  3OCN A;  5CX7 A;  4P0M A;  3SW1 A;  1ERM A;  2XEP A;  4IVK A;  5JYP A;  3HLC A;  1S0W A;  1X0O A;  1I2S A;  2Y2H A;  3SH8 A;  5EVI D;  3K3C A;  2GJ3 A;  1LL9 A;  2R78 A;  4JGR A;  3PBO A;  3T4L A;  5G4Y A;  4MMN A;  3NY4 A;  1GCE A;  4WEK A;  1XKZ A;  3G32 A;  4YFM A;  4HEF A;  1L0D A;  2DNS A;  4GLQ A;  3T12 B;  3MKF A;  4LCL A;  3C7U A;  4PMA A;  2A24 B;  3QNC A;  1MWS A;  2GX5 A;  4LV0 A;  1XX2 A;  1EI5 A;  4KQD A;  3NHQ A;  4GHI B;  5AQ7 A;  1H5X A;  4E3L A;  3M2J A;  3VP0 A;  4E6X A;  4P6Z M;  3CMZ A;  1BLC A;  4WBG A;  5HWV A;  5L8M A;  2WAD A;  3E2K A;  4OON A;  3CI6 A;  3BFD A;  2JHE A;  2PYR A;  3UB9 A;  5CHM A;  4IBX A;  3JPU A;  5DFY A;  5EV0 A;  2ACG A;  2ZM8 A;  2JKF A;  3ZVW A;  3W4O A;  1XJ4 A;  4XT2 A;  4ZRR A;  2I9V A;  3W4P A;  4U0X A;  2HPB A;  3BEB A;  2OLV A;  4ETX A;  3WS4 A;  4XXR A;  3BFC A;  3IF6 A;  2OSU A;  1ONG A;  1ES2 A;  4FSF A;  3HCY A;  2WKE A;  3V5M A;  1XXM A;  4L0L A;  2QWS A;  1S1Z A;  2ZMF A;  1NYY A;  5EPH A;  5AVE A;  2G2U A;  5TGF A;  1TD5 A;  1F5M A;  5HPF A;  4L9G A;  4ZAM A;  1FIL A;  2DMW A;  2XFS A;  1VQQ A;  3H7W B;  2OLU A;  2V20 A;  2JE5 A;  4OPR A;  3IF6 C;  4X53 A;  2HV1 A;  1H8Y A;  2WGW B;  1ZHH B;  2H0T A;  3S7O A;  4BBU A;  1OT6 A;  4MLL A;  1K4E A;  5E2G A;  3CZD A;  3UNW A;  3UB6 A;  2B95 A;  4RQ9 A;  4JXV A;  2ZC4 B;  1ERQ A;  4E6W A;  2MJ6 A;  1LSX A;  3QNB A;  4U0T A;  1MY8 A;  5EFW A;  3G2Z A;  2Y2G A;  1N9N A;  1OTA A;  1T18 A;  3C4O A;  2WGI A;  1UWN X;  1HTZ A;  2P04 A;  1U60 A;  3JYI A;  3SS3 A;  1CI8 A;  1C3B A;  2QYB A;  1K56 A;  3UB7 A;  2HDU A;  1DP6 A;  1K38 A;  4RX3 A;  4KG5 A;  1NLZ A;  3FYZ A;  3V3R A;  4CQH A;  3A0R A;  1YLP A;  4JF4 A;  5J8X A;  5KSH A;  4JKT A;  2D02 A;  3NJA A;  4BEN A;  2WAE A;  1QMF A;  4GS9 A;  3PBT A;  4K0W A;  4E3M A;  2KLI A;  4HI4 A;  4OPQ A;  3C5A A;  3UB8 A;  4JXW A;  4X25 A;  3G34 A;  1M6K A;  1P9W A;  1W8Y A;  1IYQ A;  1FSW A;  2XRN A;  3IWI A;  3U4L P;  1PRQ A;  2VK3 A;  3PBR A;  3E2L A;  3BYD A;  1NY0 A;  5FAS A;  4B88 A;  3VE3 A;  3C38 A;  2ZM0 A;  2Y2J A;  1W8Q A;  5AQA A;  4GJ4 A;  4NXB A;  4DE1 A;  2DRW A;  2KX6 A;  1ERO A;  4EEP A;  4R38 A;  4MN5 A;  3MS6 A;  5HWW A;  3DTE A;  4DRT A;  1MKI A;  3MQ0 A;  1ZKJ A;  1E4D A;  5F6A A;  2ZC6 B;  1VM1 A;  3E4Q A;  2JKR I;  3T1S A;  1PNE A;  3A0V A;  2BTF P;  3GRJ A;  3UN7 A;  4EQ1 A;  1O7E A;  1FQG A;  3LIB A;  3CAX A;  4QY6 A;  5EEC A;  4S2K A;  4JXG A;  5CGW A;  4HJ3 A;  3LEQ A;  1S1Y A;  4D60 A;  3F1P A;  5HAP A;  1D1J A;  2LB9 A;  3HVF A;  3BLM A;  3HUM A;  3LO7 A;  3LR5 A;  1ZC2 A;  1T1C A;  4IBR A;  4X1L A;  4HH3 A;  5CED A;  4KZB A;  3B47 A;  3IBJ A;  3BFE A;  1UWP X;  3QP4 A;  3E4O A;  2K7S A;  1LT0 A;  1MKM A;  4LPZ A;  4H6J A;  1LSW A;  3A3I A;  4PKY G;  3O88 A;  1J3W A;  3IS2 B;  1SKO A;  1DJB A;  1IEL A;  2P9V B;  3BFF A;  2VGK A;  1CF0 A;  2XR0 A;  2PR5 A;  3L7H A;  4QU3 A;  4NEE D;  1G28 A;  5F82 A;  4QPR A;  1DJA A;  1GHM A;  1VEU B;  4GB7 A;  4EUZ A;  3GVB A;  2VGL S;  2WZX A;  2W1T B;  1YSP A;  1NYM A;  3Q7V B;  3MXQ A;  1K0K A;  1PWG A;  2ZQD A;  3SS4 A;  1ESI A;  1YLZ A;  3IXG A;  3OPL A;  4I3I A;  4GDN A;  4R0Q A;  5DTK A;  1XP4 A;  3FZC A;  4MN6 A;  5KIZ A;  4M3K A;  1IYS A;  2JKG A;  2C5W B;  3MQQ A;  4II7 A;  1P0Z A;  1G68 A;  1SZV A;  3S22 A;  2KOI A;  5TBM B;  4FOF A;  4ZDX A;  3DW0 A;  3H82 A;  2YKF A;  5FAO A;  2ZQ8 A;  1ES3 A;  2PRF A;  2GNX A;  2JBF A;  4MBF A;  3T1Q B;  1K4F A;  1Y54 A;  4FTX A;  3VP1 A;  3V50 A;  4E3K A;  3AGD A;  4WMC A;  4ME4 A;  4LGW A;  4IED A;  2IA2 A;  5I94 A;  3WS0 A;  2B18 A;  4RYE A;  3HUN A;  3HLD A;  4OPZ A;  3NOP C;  3MQO A;  4ZBE A;  3B42 A;  4JF5 A;  5FDH A;  5G4Z A;  4N9L A;  4L9E A;  3KSG A;  1IFQ A;  4KQR A;  4OQ0 A;  3VP4 A;  2JKT I;  2G7U A;  2ZD8 A;  1NWZ A;  4KG6 A;  1XA1 A;  4IVI A;  1E3U A;  1HLU P;  2UWX A;  3UB5 P;  5L09 A;  4PAU A;  4Y2F A;  2XFT A;  4HH2 A;  5TJJ A;  1CEF A;  4HHD A;  1KGF A;  4MCW A;  5CGS A;  2PD8 A;  1D7E A;  3IH9 A;  3CUE A;  4OVD A;  3HLW A;  5GLB A;  4I39 A;  5E2E A;  4KZ3 A;  2OV5 A;  5CGX A;  2WYX A;  1W63 Q;  4UA7 A;  3T4O A;  4HNB A;  4OOM A;  1G5U A;  5HPI A;  1K56 D;  5FQM A;  2WGV A;  1NRJ A;  5FAP A;  4Z1W A;  3QP5 A;  2PR6 A;  1S67 L;  4O01 A;  1Q2Q A;  4PM7 A;  2Q9N A;  4Q0H A;  3RTY A;  3W2Z A;  3CUE C;  3IX3 A;  2IWD A;  1SHV A;  4S2L A;  4PM8 A;  1L0E A;  3H9W A;  1MZU A;  5M1A A;  2PU2 A;  3UY6 A;  4CLC E;  2ZOI A;  3VE4 A;  4H8R A;  3WRT A;  3MBZ A;  3M6H A;  3HJI A;  5FI2 A;  4NET A;  2JN7 A;  1FOF A;  3IT9 A;  4JPM A;  4OQG A;  4DJ2 A;  1I2W A;  3OZH A;  5KMW A;  3OPP A;  4DN0 A;  2EWV A;  4FD8 A;  4NXE A;  3UE0 A;  1YLW A;  3NOU C;  1IOU A;  1BLS A;  1YAX A;  5J4E A;  4NXF A;  2ZQ9 A;  3ZNY A;  4GW9 A;  4XUZ A;  4EER A;  3B33 A;  2WKQ A;  4GZB A;  2UV0 E;  1JTD A;  5HWT A;  5GHY A;  3CWF A;  2W3D A;  2M7U A;  1CI9 A;  1WYB A;  5GLD A;  2XD1 A;  4ESP A;  4WEJ A;  4EXO A;  3CJM A;  1P9R A;  3F1N B;  4PM6 A;  3RFB A;  3O87 A;  4F3L B;  1GSX A;  1ZTU A;  4MBH A;  3IF5 A;  3AGE A;  1SKF A;  2XK1 A;  3FWL A;  3V39 A;  3AGF A;  1JTG A;  1PI5 A;  2H10 A;  4IJG A;  2PBD P;  4GD6 A;  2RCX A;  2J3T D;  4HBT A;  5FDS A;  4EQI A;  5HDD A;  3UDX A;  4KZA A;  5AJG A;  4DXC A;  3VFF A;  3BM6 A;  3D3O A;  3NOT C;  3NI9 A;  4Y0T A;  5U47 A;  1I5Q A;  5EOE A;  3N4I A;  5HZH A;  2B02 A;  1N4O A;  1SCW A;  2BAS A;  5J7E A;  3HBR A;  1LL5 A;  1H8M A;  4EEU A;  1GSV A;  3HLB A;  5DTS A;  2ZQ7 A;  1ES5 A;  4G3W A;  5A8B A;  4X56 A;  3FG8 A;  3HLE A;  5MC7 A;  2HZ5 A;  2W3G A;  5DF8 A;  4KUK A;  3MXS A;  5KSC A;  5FAQ A;  2J7V A;  4M4X A;  5E43 A;  3S7N A;  4Y3I A;  3LIC A;  1O07 A;  3T4Q A;  5GHX A;  3LYX A;  4UEY A;  2WKH A;  3PAG A;  4ZJ2 A;  4E3I A;  4GN2 A;  1BLP A;  2B5R A;  1TS7 A;  4Q0I A;  3IS2 A;  1KVL A;  2P9V A;  2Q9M A;  3ZG9 B;  4BL3 A;  2HJE A;  3MXR A;  5C5K A;  4Y17 A;  1OT9 A;  1NXY A;  3P98 A;  2C6W B;  2LB5 A;  3D9Y A;  3GMW A;  4P85 A;  1PZO A;  1A0K A;  1PFL A;  3T4T A;  1BLH A;  1H3Q A;  2W1T A;  3BJN A;  4BD0 A;  4R70 A;  1JWZ A;  3Q7V A;  4OQI A;  3UME A;  4R4R A;  2EFU A;  3MZD A;  1Y4O A;  2VKS A;  2JKT M;  4WMC D;  1M40 A;  3A3D A;  4JGP A;  3PBS A;  4ZTK A;  1VET A;  3K2N A;  3B3X A;  4KZ8 A;  1IKG A;  1D06 A;  4B93 A;  4Y5F A;  3TSG A;  1HD8 A;  2O0Y A;  3MJQ A;  3LR4 A;  5EUA A;  1KDW A;  3ICY A;  3T50 A;  1YT4 A;  2WKR A;  4CLC A;  3ZYT A;  4Y0U A;  3HLG A;  2Y55 A;  5FQK A;  1E3U D;  4OOY A;  4OLD A;  4QD4 A;  1F9I A;  3PYP A;  2Y2K A;  4KQQ A;  1EWZ A;  4OH0 A;  3ZG8 B;  2XA7 S;  1OTB A;  2Z6C A;  5FI6 A;  5HD5 A;  5HL6 A;  3VOZ A;  4CLC C;  1IYP A;  2I72 A;  3EQV A;  1S4S A;  3IQA A;  1FCN A;  2K2N A;  1F2K A;  3MSH A;  5DFX A;  5DKL A;  5EVL A;  1N9O A;  2VZW A;  3D72 A;  4Y13 A;  4X68 A;  3NDG A;  5CER A;  5HDC A;  4U3T A;  2V0W A;  4LRZ E;  1PW8 A;  2XLN A;  3ZG0 A;  1MWU A;  1IYO A;  2Y91 A;  4FH2 A;  4N92 A;  3O3V A;  4EV4 A;  4BQM A;  3GSG A;  5IS1 A;  2G2W A;  3LGO A;  5IHV A;  2YKH A;  3CG5 A;  4OP5 A;  3G6O A;  2XH9 A;  5EE8 A;  3UDI A;  1CEG A;  2PAV P;  2XGN A;  3T4S A;  1RP5 A;  3L9K A;  4DKI A;  5F1G A;  2A49 A;  3T4J A;  3ZHH A;  1PWC A;  3NBL A;  4GD8 A;  4EWF A;  4XT2 B;  1ONH A;  4AFI A;  1XFQ A;  3TE8 A;  4P6B A;  3FKW A;  3NDE A;  3OPR A;  3MKE A;  4PHT A;  2GDN A;  2HP6 A;  3G30 A;  4HP9 A;  4S2P A;  1P97 A;  3F1O A;  3IF6 B;  5FQ9 A;  3EEH A;  1RCJ A;  3I7J A;  2PD7 A;  5FEF A;  3G4P A;  3ZG7 B;  2HP9 A;  3C7V A;  3R7W A;  1S6R A;  4UHU A;  3EWK A;  3WRZ A;  1XGJ A;  3ITA A;  5CXW A;  5CHU A;  3E4P A;  4LRY C;  2OAQ 1;  2QHK A;  3QHY A;  5DTT A;  3SZT A;  3HUO A;  3NIA A;  1FR1 A;  1MWT A;  3TRC A;  2FFY A;  2ZQA A;  4K91 A;  4PM9 A;  1YQS A;  2J3W A;  3LI8 A;  1DP8 A;  1RGY A;  5F5Y A;  3CPT A;  3C4P A;  5AVF A;  2ZC7 A;  5FL3 A;  1ODV A;  5CEB A;  3Q81 A;  4KZ5 A;  4WYY A;  1MBL A;  1K6R A;  5I5L A;  3KO6 A;  3C2W A;  1ESU A;  3RJU A;  1KGG A;  4G3V A;  1T1B A;  5DJT A;  4DMZ A;  3DTI A;  3IX8 A;  4BWI A;  3IXH A;  4HJ4 A;  5TFQ A;  2Y2P A;  4LEN A;  3G35 A;  4DF6 A;  1E25 A;  3O5Y A;  3PR6 A;  3F1N A;  4R1G A;  2WKP A;  4KZ9 A;  3VFH A;  5EVE A;  5E2H A;  4F3L A;  4DDY A;  2EX6 A;  1LLB A;  5HW3 A;  2WKI A;  5DJU A;  2HJ9 C;  4GS9 B;  5FAT A;  4YIN A;  4B4X A;  2A24 A;  3P01 A;  1H8Z A;  2W3H A;  4GHI A;  3QP2 A;  4HBU A;  1FCO A;  2VJW A;  2FFF B;  2V9A A;  1K55 A;  2M7V A;  4X55 A;  4CPK A;  3R4K A;  2GZA A;  2X71 A;  3TOI A;  5FI7 A;  3ZNT A;  5CTN A;  1W7F A;  4O8G A;  4X6T A;  2J8Y A;  1FCM A;  5DKK A;  1XGI A;  3MZE A;  3PBQ A;  1YSQ A;  2WZZ A;  1K55 C;  2L1M A;  3UPO A;  2EX2 A;  4IHQ A;  3ITB A;  3PTE A;  3VMA A;  4UQI S;  2VA0 A;  1CJF A;  3RXX A;  2Y2L A;  2HDR A;  1Z6F A;  3D4F A;  3HJK A;  4BBT A;  1IEM A;  4HY8 A;  3MFD A;  3JVV A;  3A3E A;  1W5D A;  2W27 A;  2VGL M;  5F68 A;  3PXP A;  1N9B A;  3E98 A;  4QHC A;  3U2A A;  1VHM A;  2P7J A;  1K25 A;  5EVI B;  3IWO A;  2V1Z A;  3H7W A;  2Y2I A;  3M2K A;  3LI9 A;  1H0M A;  1LI9 A;  2ZL1 B;  4DE2 A;  1VB6 A;  1SDE A;  4S2J A;  2A3U A;  5HL1 A;  2WGW A;  3W8K A;  2ZBB A;  4CJN A;  3VP3 A;  2NUP C;  2VX8 A;  5L07 A;  3Q7Z A;  1BZA A;  3ZFZ A;  4DXB A;  1STZ A;  2X02 A;  4BL2 A;  3HL9 A;  5CEC A;  2QZ6 A;  4P6Z S;  3DTK A;  1OJG A;  3S7Q A;  1XFN A;  4LCM A;  4YNR A;  3QP6 A;  3FPW A;  4GKU A;  3PBN A;  4CLC D;  4H6J B;  1V9Z A;  1TVF A;  4LFU A;  2X01 A;  3MMH A;  3E0Y A;  3PHY A;  2XD5 A;  2V1A A;  1OPX A;  4HES A;  1SKO B;  4LLO B;  2PBY A;  1ZG6 A;  3IXB A;  4K0X A;  3VP2 A;  3OOV A;  2H0Y A;  3LCE A;  4GCZ A;  2EA9 A;  3NEC A;  4GNU A;  3SS5 A;  2PU4 A;  4EBN A;  4HP4 A;  1TS6 A;  3A3F A;  4FH4 A;  1OME A;  3IX4 A;  5KZH A;  3S1Y A;  2PDR A;  2V2F F;  2L0W A;  1NLY A;  1OTE A;  3KYZ A;  3KSF A;  4NKP A;  1FIK A;  4E3N A;  2ZC3 B;  2ZJ9 A;  5GLC A;  2W3E A;  1SDN A;  1OTI A;  3NUL A;  4I38 A;  3N8R A;  4WUJ A;  3EOI A;  2FZ0 A;  2VEA A;  2VGJ A;  4UAA A;  2O9B A;  2OAP 1;  5HAI A;  1S66 L;  3DAV A;  1HZO A;  4N1X A;  1J9M A;  2EX8 A;  4R6L A;  2ZM2 A;  5CHJ A;  3VOL A;  2VV6 A;  3FKV A;  3UDF A;  5A93 A;  2XDM A;  3OBF A;  5J3W A;  2Y4A A;  3LR3 A;  2OWH A;  3TW8 A;  1RGZ A;  3H82 B;  4DJ3 A;  5M18 A;  1YPR A;  4PM5 A;  4XUX A;  1TS8 A;  2AVX A;  2WUQ A;  1GSW A;  5HD3 A;  4GOG A;  2CMN A;  4ID4 A;  3MF0 A;  1GA0 A;  1YM1 A;  3UMD A;  2BG1 A;  4E3O A;  4NK3 A;  4G3K A;  3CHW P;  4Y7P A;  4BJP A;  3Q07 A;  4PPR A;  4X1M A;  5FA7 A;  4ARZ B;  3GTC A;  3ZCZ A;  4KZ7 A;  2HP5 A;  1GHP A;  4L9F A;  2W0N A;  5EM1 A;  4LRX C;  1BT5 A;  3UE3 A;  1FR6 A;  4FCF A;  2R9X A;  3MFX A;  5DVA A;  3VSK A;  1TS0 A;  2WK0 A;  4FUW A;  2JC7 A;  1UGU A;  2ZC5 B;  2PYP A;  3N8S A;  1ALQ A;  4ETZ A;  3Q82 A;  4WZ4 A;  2ZLY A;  1Z09 A;  5FQQ A;  3N6I A;  4I3A A;  3M6B A;  5CRF A;  2Y79 A;  4N1H A;  1GA9 A;  1Q2P A;  1BUE A;  4S2N A;  2HDS A;  1WYC A;  3T1X A;  2Y2N A;  1T1A A;  5IT5 A;  1DY6 A;  1GHI A;  3P09 A;  3IH8 A;  2M1C A;  4Y0O A;  3TG9 A;  5A92 A;  1LI0 A;  1S4R A;  4N9K A;  1G6O A;  4S2I A;  4HOI A;  4JGO A;  3UPN A;  5FQI A;  2O9C A;  3DTM A;  1YMX A;  3KYQ A;  4S2N C;  4R3A A;  4R4S A;  2Y2M A;  3VOY A;  5GLA A;  1IKI A;  4QWO A;  4KUO A;  2PHY A;  2Q0O A;  1VEU A;  2INW A;  1XA7 A;  3T1R A;  1F98 A;  1XJ6 A;  3LEZ A;  1MWR A;  1W79 A;  3V67 A;  3QP1 A;  4DE3 A;  3RH8 B;  2J80 A;  3JVU A;  5FSR A;  3G2Y A;  1WA9 A;  3LY3 A;  3MZF A;  3SH9 A;  4EET B;  4C75 A;  4WF0 A;  4I3J A;  4MEZ A;  2ZMV A;  2K31 A;  2ZQC A;  1YLJ A;  1NRF A;  3CLO A;  3N7W A;  1JVJ A;  4MDZ A;  3IXD A;  4BBV A;  3OPH A;  2XQZ A;  4WN5 A;  2O99 A;  5BOH A;  5M19 A;  3VV4 A;  4ZJ3 A;  1TF1 A;  4UA6 A;  2ZMA A;  4YOF A;  1ZG4 A;  2V8C A;  5TBM A;  2FH5 A;  3BQ8 A;  4KZ4 A;  1CK3 A;  1XJ2 A;  4HJ6 A;  4EBP A;  3BW6 A;  4S2M A;  3IHB A;  2XF3 A;  2H28 A;  3C30 A;  4KG2 A;  3EGX C;  4R23 A;  1CQA A;  3GDI A;  5HAR A;  1BSG A;  3IWQ A;  1DP9 A;  1K54 A;  3OCL A;  3LFV A;  3MR0 A;  2Y59 A;  3EEA A;  5FEG A;  4LV1 A;  2RL3 A;  4Z9Q A;  4QB8 A;  3RXW A;  2QJ7 A;  2CC1 A;  4R3B A;  5DF7 A;  5HAQ A;  1PI4 A;  1PW1 A;  5HFO A;  4OLG A;  1L3L A;  1K54 C;  2BLS A;  4NXG A;  4KZ6 A;  4BD1 A;  5F83 A;  4Y15 A;  1AXB A;  4C3Q A;  1XPB A;  1LHY A;  4R3J A;  4OKP A;  5E2F A;  2XRO A;  1V9Y A;  3WS2 A;  4S2O A;  4P87 A;  3UE1 A;  3ZGA B;  3P7N A;  4EW7 A;  3N8L A;  2W1R A;  3GEC A;  3GQZ A;  2Y2O A;  2WAF A;  4JLF A;  1DJC A;  1TDG A;  5AQB A;  2DCF A;  4Q8I A;  5EVI A;  4BLM A;  4B9O A;  2D01 A;  3BRM A;  2ZL1 A;  3BEC A;  4RA7 A;  4NG2 A;  4RX2 A;  1YLY A;  1G6A A;  1FSY A;  1AWI A;  2Z2L B;  3TJZ C;  1LSV A;  2VV7 A;  5D3O A;  2XSS A;  2QKP A;  4LV3 A;  4B4Z A;  1JWV A;  2E8J A;  1YMS A;  5EVI C;  4I5S A;  3K3D A; 
#chains in the Genus database with same CATH homology
 4UQI S;  2VA0 A;  5HDS A;  3F1N B;  2P04 A;  3LID A;  2ZOH A;  2QJ5 A;  3RFB A;  2NUT C;  4F3L B;  3LIF A;  1GSX A;  1ZTU A;  3HJK A;  2QYB A;  4BBT A;  3OLO A;  3UB7 A;  1DP6 A;  4HY8 A;  4OOL A;  3JVV A;  1NLZ A;  4IJG A;  4HQA A;  2W27 A;  2VGL M;  5F68 A;  4CQH A;  2KDK A;  3A0R A;  3PXP A;  5KSH A;  4WLA A;  4E04 A;  2J3T D;  3E98 A;  2D02 A;  2Y8H A;  3U2A A;  2J3T C;  1VHM A;  3NJA A;  4EES A;  2P7J A;  4GS9 A;  5HDD A;  3PBT A;  3FC7 A;  3H7W A;  1W63 M;  5AJG A;  3EGD C;  3LI9 A;  2KLI A;  4HI4 A;  4KQO A;  3D3O A;  2XA7 M;  3NOT C;  2VV8 A;  1VB6 A;  2V0U A;  3T4K A;  4EU0 A;  3UB8 A;  1T19 A;  3CIT A;  2ZBB A;  1P9W A;  5HZH A;  2NUP C;  2VX8 A;  2HF6 A;  2B02 A;  2XRN A;  4EUV A;  1KOU A;  2BAS A;  3PBR A;  5J7E A;  5LBR A;  3LUQ A;  1STZ A;  4IUK A;  3C38 A;  3VE3 A;  1H8M A;  4EEU A;  1GSV A;  4P6Z S;  3EQU A;  4GJ4 A;  4NXB A;  1OJG A;  4G3W A;  5A8B A;  5IU1 A;  2KX6 A;  3S7Q A;  1XFN A;  1OTD A;  4YNR A;  3FG8 A;  3FPW A;  4EEP A;  3PBN A;  5MC7 A;  2HGV A;  4CLC D;  2W3G A;  4H6J B;  4R38 A;  3BQA A;  4MN5 A;  1V9Z A;  4KUK A;  5HWW A;  3ULF A;  4M4X A;  3S7N A;  3MMH A;  3E0Y A;  3MQ0 A;  3PHY A;  4Y3I A;  3LIC A;  4JGQ A;  2V1A A;  1OPX A;  4LLO B;  3T4Q A;  5F6A A;  3OOV A;  3LYX A;  4UEY A;  4GCZ A;  4MN7 A;  3E4Q A;  2JKR I;  2EA9 A;  3A0V A;  2PT7 A;  1TS7 A;  4Q0I A;  3IS2 A;  4PKY A;  4EQ1 A;  4HP4 A;  1TS6 A;  4CLC B;  3LIB A;  1JNU A;  3CAX A;  3KSI A;  1YKD A;  2HJE A;  2PDR A;  5DF9 A;  1EW0 A;  5C5K A;  2L0W A;  4HJ3 A;  1DRM A;  1NLY A;  1OTE A;  1OT9 A;  3KSF A;  3KYZ A;  4NKP A;  1S1Y A;  2LB5 A;  3F1P A;  2W3E A;  2LB9 A;  4K08 A;  5K5B A;  1OTI A;  3ZQ5 A;  4I38 A;  1OJ5 A;  4ARZ A;  3LR5 A;  3T4T A;  1H3Q A;  1T1C A;  4WUJ A;  4O0P A;  3EOI A;  4BMW A;  2W1T A;  4HH3 A;  2A2L A;  3UE6 A;  3BJN A;  2FZ0 A;  2VEA A;  4R70 A;  3B47 A;  3IBJ A;  1LL8 A;  3UME A;  2O9B A;  2OAP 1;  1UWP X;  1S66 L;  3KSH A;  3E4O A;  2VKS A;  2JKT M;  2K7S A;  1LT0 A;  4HIA A;  1MKM A;  4LPZ A;  4H6J A;  1LSW A;  4R6L A;  4JGP A;  3PBS A;  3VOL A;  2VV6 A;  1N9L A;  4PKY G;  3K2N A;  3OBF A;  5J3W A;  3LR3 A;  3TW8 A;  2OWH A;  1D06 A;  4B93 A;  3H82 B;  3IS2 B;  4DJ3 A;  4Q0J A;  2EWW A;  1TS8 A;  4Y5F A;  1GSW A;  5HD3 A;  2PR5 A;  2CMN A;  4IUH A;  3BY8 A;  3MF0 A;  4NEE D;  1G28 A;  3UMD A;  3DBA A;  4YWZ A;  2O0Y A;  3MJQ A;  4QPR A;  2V1B A;  4G3K A;  3F1P B;  3LR4 A;  3ICY A;  4BJP A;  3T50 A;  4CLC A;  2OOL A;  2WKR A;  3ZYT A;  2Z6D A;  2OWJ A;  4ARZ B;  2VGL S;  3C8C A;  4L9F A;  2W0N A;  2W1T B;  1YSP A;  4LRX C;  3UE3 A;  1F9I A;  3MFX A;  1TS0 A;  3PYP A;  3MXQ A;  1UGU A;  2W3F A;  2P08 A;  2PYP A;  2XA7 S;  4I3I A;  4ETZ A;  1OTB A;  2L4R A;  1MC0 A;  2Z6C A;  5HD5 A;  3F1O B;  5HL6 A;  4CLC C;  4I3A A;  4MN6 A;  3S7P A;  3BWL A;  5KIZ A;  2Y79 A;  3EQV A;  1S4S A;  3MQQ A;  2K2N A;  2VLG A;  3R7W B;  5DFX A;  4II7 A;  3OC2 A;  1P0Z A;  1T1A A;  5IT5 A;  5HSQ A;  5DKL A;  2KOI A;  1N9O A;  3BY9 A;  3KX0 X;  2VZW A;  5TBM B;  3D72 A;  4FOF A;  2M1C A;  4WL9 A;  5HDC A;  3H82 A;  2YKF A;  3LIE A;  1S4R A;  1Y28 A;  2V0W A;  1G6O A;  4LRZ E;  4HOI A;  5F69 A;  4JGO A;  2GNX A;  2O9C A;  2JKR M;  3KYQ A;  4R3A A;  3IBR A;  1BYW A;  5IS1 A;  2O9A A;  2YKH A;  4KUO A;  2PHY A;  2INW A;  3G6O A;  3FPV A;  4ME4 A;  4WEL A;  4UQI M;  1XJ3 A;  3T4S A;  1F98 A;  1XJ6 A;  2IA2 A;  3T4J A;  3V67 A;  2B18 A;  3LR0 A;  3RH8 B;  3A0S A;  3LIA A;  3OCN A;  2J80 A;  3JVU A;  5CX7 A;  3SW1 A;  1WA9 A;  4XT2 B;  3NOP C;  3MQO A;  4AFI A;  1XFQ A;  3TE8 A;  4EET B;  3B42 A;  4WF0 A;  4I3J A;  2ZMV A;  2K31 A;  4PHT A;  3CLO A;  5G4Z A;  4HP9 A;  4L9E A;  1X0O A;  3KSG A;  1IFQ A;  4MDZ A;  1P97 A;  3F1O A;  2JKT I;  3K3C A;  4BBV A;  2G7U A;  2GJ3 A;  2R78 A;  4JGR A;  3EEH A;  3PBO A;  3T4L A;  2PD7 A;  4WN5 A;  2O99 A;  1NWZ A;  5G4Y A;  4MMN A;  3VV4 A;  3R7W A;  4WEK A;  1TF1 A;  3EWK A;  4YOF A;  4PAU A;  4Y2F A;  4GLQ A;  4HH2 A;  3E4P A;  4LRY C;  5TJJ A;  2A24 B;  5TBM A;  2FH5 A;  4HHD A;  4MCW A;  2GX5 A;  2OAQ 1;  4KQD A;  2PD8 A;  2QHK A;  3BQ8 A;  1D7E A;  3NHQ A;  4GHI B;  1XJ2 A;  3CUE A;  4HJ6 A;  4I39 A;  3BW6 A;  3TRC A;  4P6Z M;  2H28 A;  3C30 A;  1W63 Q;  3EGX C;  3T4O A;  5HWV A;  4HNB A;  4OOM A;  5HPI A;  5L8M A;  2J3W A;  3GDI A;  3LI8 A;  1NRJ A;  1DP9 A;  1DP8 A;  5F5Y A;  3CI6 A;  4Z1W A;  3OCL A;  3LFV A;  2PR6 A;  3MR0 A;  1S67 L;  2JHE A;  3EEA A;  5AVF A;  2PYR A;  4O01 A;  3UB9 A;  4Q0H A;  5FL3 A;  3RTY A;  1ODV A;  3W2Z A;  3CUE C;  5DFY A;  2QJ7 A;  3H9W A;  1MZU A;  1XJ4 A;  3KO6 A;  3C2W A;  4XT2 A;  2I9V A;  4ZRR A;  5I5L A;  4G3V A;  1T1B A;  5DJT A;  4CLC E;  4DMZ A;  4ETX A;  2ZOI A;  4BWI A;  3VE4 A;  4HJ4 A;  4NXG A;  3HJI A;  2JN7 A;  4FSF A;  3HCY A;  3O5Y A;  3PR6 A;  4L0L A;  3F1N A;  2QWS A;  2WKP A;  1S1Z A;  2ZMF A;  5AVE A;  2XRO A;  4F3L A;  1TD5 A;  1V9Y A;  4DJ2 A;  1F5M A;  3P7N A;  5DJU A;  2HJ9 C;  5HPF A;  4GS9 B;  4L9G A;  4EW7 A;  4DN0 A;  2DMW A;  2EWV A;  3H7W B;  2A24 A;  4NXE A;  3P01 A;  2W1R A;  3GEC A;  2W3H A;  4GHI A;  2VJW A;  3NOU C;  1IOU A;  2V9A A;  2M7V A;  2HV1 A;  1ZHH B;  3R4K A;  1YAX A;  2GZA A;  3S7O A;  5J4E A;  4NXF A;  4BBU A;  4B9O A;  1OT6 A;  2D01 A;  4GW9 A;  4EER A;  3B33 A;  2WKQ A;  3UB6 A;  4RQ9 A;  4O8G A;  5HWT A;  5DKK A;  3CWF A;  3TJZ C;  2MJ6 A;  3PBQ A;  2W3D A;  1LSV A;  2VV7 A;  1LSX A;  1YSQ A;  5EFW A;  2M7U A;  2XSS A;  1N9N A;  2QKP A;  1OTA A;  2L1M A;  1T18 A;  4WEJ A;  4I5S A;  4EXO A;  4IHQ A;  1P9R A;  1UWN X;  3K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...