4BMWA

Crystal structure of the streptomyces reticuli hbps e78d, e81d double mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
b'PAAAPVAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYDSADRKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVLGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTRACELLULAR HAEM-BINDING PROTEIN
publication title Iron Binding at Specific Sites within the Octameric Hbps Protects Streptomycetes from Iron-Mediated Oxidative Stress.
pubmed doi rcsb
source organism Streptomyces reticuli
molecule tags Metal binding protein
total genus 41
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bmwA01
4CLCE 4CLCC 3FPWA 4CLCD 4CLCA 4BMWA 4NKPA 5CX7A 2A2LA 3FPVA 4CLCB
chains in the Genus database with same CATH superfamily
1KDSA 4I3IA 1FQGA 3G35A 4JF4A 2XQZA 3UE6A 3ZNTA 1IKGA 1BLHA 3GDIA 1DRMA 3G2ZA 4KZ7A 2J3TD 3MZEA 2IA2A 2XR0A 4EU0A 2A49A 2AVXA 1NZOA 3N8SA 2BTFP 5J8XA 4MN5A 4GJ4A 4JKTA 4LGWA 4EERA 4B9OA 2PYPA 3Q7VA 4G3VA 2Y8HA 3MJQA 4BBUA 4PM5A 4RVAA 4O8GA 4RA7A 3D9YA 3QP2A 4DXCA 2ZL1A 3OLOA 4NEED 1IYSA 2ZM0A 1AXBA 1F2KA 1LSXA 3E4OA 2W3FA 4I3JA 1J3WA 2EX9A 2XK1A 2OOLA 1LSVA 4BD0A 2ZC6B 3T4TA 4ZDXA 3L7HA 1TS7A 3V5MA 4KQQA 1K57A 4IUKA 2QJ7A 5GLBA 2ZQAA 5FA7A 3K3CA 4N9KA 1G28A 2Z6DA 4GW9A 4RYEA 3DTKA 2GX5A 3R7WA 1GHIA 4LRZE 1QMEA 1S66L 5FI6A 4JPMA 2V9AA 4Y0TA 3G34A 3K2NA 3ZYTA 3N6IA 5CERA 4QD4A 2ZLYA 3F1NA 2W3EA 5DFYA 3DBAA 1TF1A 2J9OA 3VE4A 2Z6CA 2ZQ9A 2HJEA 1K38A 2OWHA 1PNEA 2RL3A 3LR4A 2O9CA 4N1HA 5CRFA 2HGVA 3U4LP 3ZCZA 3IX3A 5CECA 4EBPA 2K7SA 3WS1A 1K57C 3P7NA 2XFSA 2D01A 3EQUA 3IX8A 1N9BA 1OTEA 3A3EA 5J3WA 4PM6A 4S2OA 2H5SA 3Q81A 2GJ3A 4IHQA 1M6KA 4Q0IA 4WMCD 3IQAA 5HARA 2PD8A 5HD5A 3HVFA 1FIKA 5DF9A 3T4OA 5EV0A 4E3OA 1I5QA 1JTGA 2O0YA 4HBUA 4HNBA 3T1RA 1KDWA 3KYEA 4S2JA 4BENA 5HDDA 2Y2PA 3KSHA 4KZ5A 2R78A 3UB7A 5F68A 3R7WB 1Z09A 4KZ4A 5DF8A 1SHVA 2KDKA 1XFNA 2PR6A 4JXGA 1IYQA 2ZBBA 1VHMA 4Y17A 5FI2A 5I5LA 2XEPA 4NXFA 1RGYA 5GHZA 1LL8A 1BLSA 1OTAA 1W63Q 5HDSA 4X56A 3NBLA 5CHMA 3C4OA 4B4XA 1OTIA 1XJ3A 4RQ9A 3IF6A 4JXWA 2UV0E 3CPTB 3PTEA 5HAPA 4A5RA 1K6SA 1PI5A 2WGWB 4S2MA 5MC7A 3MR0A 3LR5A 1AWIA 2Q9MA 2EFXA 1OT6A 5DTTA 2VX8A 3LEQA 5HWTA 3CWFA 2DMWA 3UMDA 2WKIA 4OKPA 3P98A 3V39A 3IH8A 3S4XA 4AFIA 3BLMA 4EETB 3T4SA 5A92A 1VEUA 3RTYA 3IBJA 4UAAA 1TDLA 3WS5A 4Y0OA 4PMAA 4NXGA 1GHPA 1JTDA 1LL9A 3EQVA 3EGXC 1RP5A 1FCOA 2PHYA 5K5BA 4EBNA 3PR6A 1L0GA 2YKFA 2J8YA 4RX3A 4QHCA 3W4OA 5TFQA 4OQGA 5FSRA 2PBYA 3N8LA 2Z2LB 3IF6C 3GSGA 1Y28A 3CJMA 1T19A 1UWNX 4KZBA 2Y2NA 2BG1A 3HLGA 4E6XA 1PYYA 4LLOB 5EFWA 3LFVA 3ISGA 4BWIA 3T12B 3IXGA 4E3LA 2WKRA 1FR1A 3F1PA 2HZ5A 1PZOA 2EX8A 3OPHA 3MKFA 5EVID 4PM7A 5E2HA 5EECA 2B18A 5FAQA 1MXOA 3CITA 5M18A 4Y7PA 1DJCA 1GCEA 1MKMA 4IBRA 2JKFA 1Q2QA 2LB9A 4OQHA 1VB6A 3ZNYA 2QZ6A 3V50A 4MBFA 3O5YA 1A0KA 4P85A 5F1FA 1F98A 4FUWA 4OLDA 2IWDA 2V1AA 5FL3A 2QYBA 4WL9A 3HCYA 5HD3A 4Y5FA 3HJIA 3ZG9B 3BFGA 1GHMA 4LRYC 5TBMB 1JVJA 1TS0A 5G4ZA 4WN5A 5HX9A 1OT9A 3QP4A 1PW1A 2PU4A 5M1AA 2XD1A 3OPLA 4LCLA 1F9IA 1ZG4A 5FASA 3GRJA 4HJ4A 4WZ4A 3QP1A 1YMSA 3SH7A 2W0NA 3F1PB 5EPHA 1XGJA 1F5MA 4DDYA 1GA0A 1PI4A 3QP5A 4OQ0A 1FSYA 1VETA 2W3DA 1UWPX 5DVAA 1N9LA 5HFOA 3LEZA 3E2KA 4Y3IA 4LV3A 1NRJA 2A3UA 4RX2A 1MY8A 3UB5P 1SKOA 2B95A 3S7QA 3W2ZA 3FKVA 3WS2A 4QWOA 3FG8A 3K3DA 3Q7ZA 4X25A 5JYOA 3IF5A 4GHIA 3VSLA 1G6AA 1ZKJA 3FKWA 1XX2A 1W7FA 2PT7A 3MF0A 4WELA 2W1TA 3S7OA 1KE0A 1GSXA 3NI9A 2XGNA 4P87A 2XROA 3IXBA 2PU2A 4HIAA 2INWA 4K0XA 1SDEA 4KQOA 3LGOA 4II7A 3A3FA 4JLFA 4HP9A 4NXEA 4N1XA 1ODVA 3RFBA 4R3AA 1WE4A 3OPRA 4C75A 4LCMA 2ZQCA 3F1OA 1YLZA 2I72A 3IH9A 4GN2A 1LHYA 1E4DA 5FDSA 1K54A 2FH5A 3MMHA 3KSIA 2NUTC 4JXSA 5M19A 1K56A 3MQQA 2H10A 4YOFA 2OV5A 1VETB 2JKTM 2ZQDA 1ESIA 5F69A 5FI7A 3HLFA 5IU1A 3TJZC 3RJUA 3PBNA 4I3AA 5BOHA 4ZBEA 1OMEA 4KZ9A 5AJGA 5FATA 3C5AA 2EXAA 1C3BA 3MSHA 2PAVP 4FD8A 1I2WA 3OZHA 4I5SA 3E4PA 4NXBA 4GHIB 3ITBA 5I94A 5CEBA 2W1TB 5EOOA 4EESA 4ESPA 1K54C 2V20A 3D4FA 1ACFA 3ZFZA 3VE3A 1PWCA 1LT0A 3CLOA 4GDBA 5DJTA 4OH0A 4HBTA 5E2FA 1GSVA 4H8RA 3EOIA 4OPQA 4DXBA 3G4PA 1S1ZA 3Q1FA 2OAQ1 5HZHA 2X02A 2ZOHA 3LO7A 2XSSA 3NDEA 3WS4A 2ZQ8A 3TG9A 3ZVTA 3LIEA 4P6ZS 5D3OA 1XJ6A 1YLWA 2JN7A 4XT2B 3NOUC 3BLSA 1S0WA 1N9NA 3HJKA 4PKYG 3IHBA 1W5DA 1E3UD 4PM9A 4GOGA 1P0ZA 3VV4A 1N9OA 1CQAA 3IWOA 4KG6A 3GMWA 1HVBA 1V9YA 3LICA 4X1LA 1NLYA 4JGQA 4IBXA 5FEGA 4BJPA 3IHAA 1CJFA 3ZGAB 4HH2A 5G18A 4H6JB 2WKEA 3BY9A 3JVUA 2XRNA 3BFFA 2H28A 1NRFA 5F82A 1ZG6A 3SH9A 4HH3A 3G32A 3CAXA 4BLMA 5CX7A 3EEAA 1S1YA 4U3TA 3WRTA 2L0WA 2ZMVA 3HLBA 3JYIA 1CI9A 4JGPA 4NKPA 3FZCA 1K4EA 3BRMA 3A3JA 1D7EA 2G2UA 1L2SA 2FFYA 4Y13A 2VV6A 1XJ4A 2C6WB 2I9VA 4NG2A 1JWVA 2HP6A 2ZM8A 4HY8A 1LI9A 1IYOA 3HLEA 2JC7A 2WZXA 5CEDA 4L9EA 1NXYA 1NYYA 3SH8A 1YPRA 3TSGA 3C2WA 5EM0A 4JBFA 3EGDC 4DJ2A 2DNSA 4CQHA 4Q0HA 4K08A 5LBRA 2VKSA 1S4SA 1OJGA 1S4RA 3HL9A 2Y2KA 4HEFA 3KX0X 3C7VA 4BL2A 4EBLA 1KE3A 3V67A 3VFHA 3CPTA 3UPNA 3G6OA 2L4RA 2W27A 4MMNA 4F3LA 2WGWA 4R23A 1SKFA 4BBTA 2WK0A 3T1XA 1VQQA 3OOVA 1YSPA 3DWZA 3IXHA 2OLVA 4F94A 1T1CA 5CHUA 3ICYA 3KO6A 2J3TC 4UQIS 2VGLS 3HUNA 4C6YA 1FILA 5EE8A 4ZAMA 3IBRA 4Z1WA 5GHXA 3UB9A 4WUJA 1MWUA 4X55A 5JYPA 1W63M 4U0XA 4BBVA 5FQQA 1GA9A 4CPKA 1QMFA 1TS8A 5HWWA 1P9RA 1NWZA 1ZHHB 1PRQA 4OVDA 3UDIA 5CTMA 2MJ6A 3NULA 4KQDA 2GZAA 3HLWA 3CUEA 3B33A 1HD8A 4E04A 5TJJA 2A2LA 4GNUA 4BD1A 2ZMFA 1KVMA 2HJ9C 5A8BA 4F3LB 1KGFA 3MZDA 4Y2FA 5AVEA 4EQIA 2HDQA 3LIAA 5F6AA 2JBFA 3SW1A 3NCKA 5DTKA 4GS9B 3O3VA 1UGUA 4E3KA 3H7WA 4K91A 5A91A 2XFTA 3MZFA 2EXBA 3NIAA 2VLGA 3M6BA 1VM1A 4YFMA 4HOIA 2HP5A 3UPPA 4EEUA 2Y91A 2ZC3B 5FQIA 5HL6A 1NY0A 4B88A 1KGGA 4R4SA 2Y2JA 2Y59A 1CK3A 5TBMA 3T1SA 3N8RA 2WKPA 3CUEC 3SS5A 4PM8A 1DP8A 1K0KA 4PPRA 2JKRM 2X01A 3MKEA 4XUZA 2V8CA 1D06A 4FSFA 4QB8A 1RCJA 1OTBA 5IS1A 5EUAA 4E3MA 3VP1A 1H3QA 1H0MA 5HAQA 2K2NA 3FC7A 2QMIA 1ALQA 3QP8A 5F83A 2W3GA 3C30A 2FFFB 1WYBA 4DE3A 1V9ZA 1LL5A 1Y54A 1MZUA 4QY6A 4B93A 2NUPC 4LFUA 3MFXA 1KGEA 4JGOA 4KG5A 1WA9A 3MBZA 2QJ5A 3MQOA 5EVEA 3MS6A 1BSGA 4E3NA 2QHKA 5L8MA 3UDFA 3A0RA 3DTIA 1T1BA 4PHTA 4WYYA 2WKQA 3HUOA 4ZJ3A 3H7WB 2Y2LA 4MBHA 4OONA 2WAEA 3LR0A 4PAUA 3NJAA 3QHYA 1BT5A 3G2YA 4R0QA 3TE8A 3R4KA 4PKYA 3D72A 5DF7A 1CEGA 2KOIA 1YLJA 1MWTA 4P6ZM 3IWQA 4YINA 4FCFA 1YLYA 3OCLA 2Z2MB 3SOIA 1P9WA 1NLZA 3IWIA 5HWVA 4X69A 3ZG8B 4EEPA 5L2FA 3Q82A 3UNWA 4OQIA 1L3LA 3ZHHA 4QY5A 4O0PA 5FDHA 1J9MA 3EEHA 2GNXA 4XXRA 3W4PA 2JCHA 3ZQ5A 4FTXA 4ZJ1A 3S1YA 4DRTA 1MC0A 3ITAA 5CHJA 2E8JA 4HJ3A 1BLPA 1PFLA 2O9BA 2ZC5B 3BM6A 3C38A 2FZ0A 5G4YA 3QNBA 4S2LA 2XD5A 5HDCA 4DE1A 5E2EA 1U60A 3BFEA 4GCZA 4KQRA 5CTNA 5FAPA 3T4KA 2PDRA 2JHEA 4DN0A 4OP8A 4S2IA 3O87A 2WZZA 2YKHA 2V2FF 2HDUA 2JKGA 2X71A 4P6BA 1KOUA 5AQBA 1JNUA 5HSQA 3BQAA 1ERQA 3D3OA 1IKIA 3BJNA 2V0UA 3HUMA 5KMWA 2ZJ9A 1K56D 4UA6A 2Q0OA 1FCNA 1RGZA 3FV7A 1L0DA 1YSQA 3AGEA 3MXRA 1P97A 5U47A 2M7VA 1DJBA 5CGXA 1XFQA 2B5RA 5A93A 3OCNA 3MXSA 1JWZA 5DJUA 1ES4A 3UY6A 4G3KA 2B02A 3BECA 4KZAA 1SZVA 3VP2A 4Y0UA 3O88A 5EVIB 1YM1A 1G6OA 1DP9A 2P9VA 2Y2GA 2P74A 4UHUA 2VGLM 2GDNA 4KG2A 3M6HA 2QWSA 5FQMA 4WM9A 3UE1A 2VJWA 3A0VA 1JWPA 5GLCA 3A0SA 5FQJA 2VA0A 3S22A 2XLNA 4I38A 1OTDA 3PBSA 4GZBA 2E8IA 2XA7S 4HHDA 4XT2A 2Q9NA 3KYZA 4IVIA 4EV4A 3GQZA 2ZC4B 5AQAA 2Y2IA 1G68A 2WKHA 1NJ4A 1Z6FA 4ME4A 3G31A 1T18A 4OOMA 1ONHA 1FSWA 4H6JA 4JF6A 3ZG7B 2WAFA 1NYMA 3T1QB 2J7VA 4B4ZA 2Y55A 4X6TA 2M7UA 3V3RA 4BL3A 4DKIA 2WUQA 4P0MA 4LV0A 1NZUA 3P01A 3E0YA 2WYXA 2P9VB 5EOEA 1ES2A 2PYRA 3PBRA 1BULA 3FPWA 1W8YA 5FQKA 3VOLA 3RXXA 1IEMA 4GD8A 4CLCA 3PHYA 4HJ6A 4WZ5A 3I7JA 5TR7A 4KZ8A 1X0OA 3T4JA 4S2KA 3BFCA 4K0WA 3M2JA 3GECA 4WBGA 3TRCA 1ES5A 2HP9A 3IS2A 3FYZA 1M40A 2P04A 3MFDA 5J4EA 2HF6A 2EX6A 1SCWA 3RH8B 2Y2HA 1XPBA 4WF0A 3ZVWA 2JE5A 3N7WA 2V1BA 3HLDA 4CLCE 4LV1A 4MDZA 4KZ3A 3NECA 1DY6A 4GLQA 4DE2A 4BQMA 2VGJA 1H5XA 4R6LA 3WWXA 1Y4OA 4EW7A 4Y15A 5AQ7A 3MQ0A 2XH9A 3BEBA 3BW6A 4ETZA 4CLCC 4MN7A 5TGFA 1YMXA 3IX4A 5AVFA 4GD6A 4WZ5C 4ARZB 3OBFA 3V3SA 5HW3A 4R70A 1YT4A 3DW0A 2J9PA 3CZDA 3NY4A 3ZG0A 3DWKA 4X1MA 4CLCB 2Y79A 4X53A 3VP4A 3VSKA 2QKPA 3CG5A 4HESA 1E25A 4IEDA 3H82A 1W8QA 1E3UA 5GHYA 1IOUA 1L0EA 3SS3A 2VK3A 3CMZA 4QJGA 3UO9A 3NOPC 3IS2B 2IWCA 2JKRI 2PRFA 4JF5A 1HZOA 4OPYA 3HBRA 4XUXA 4E6WA 2VEAA 3E2LA 2J3WA 4R4RA 2OSUA 1PWGA 3LIBA 4KENB 3JPUA 1EI5A 4UA9A 4KUKA 3M2KA 1H8YA 1FOFA 3C7UA 3KYQA 4DJ3A 3Q7VB 4LENA 4R38A 1XP4A 4GS9A 2EA9A 5FAOA 2WGIA 4MBKA 5GLDA 1ZTUA 5IHVA 2ZL1B 3UMEA 4ZTKA 2HPBA 3GTCA 3UB8A 1DJAA 1HLUP 4R3BA 4OLGA 4QPRA 2L1MA 1S6RA 3AGFA 1L0FA 2ZD8A 3T4LA 1XA7A 1I2SA 1XXMA 5E43A 3C4PA 5DKLA 1EW0A 1MKIA 4HP4A 4IUHA 5KSHA 1LLBA 2R9XA 1CF0A 3H82B 3KSFA 1K25A 4KZ6A 1TDGA 5HAIA 2VGKA 5DTSA 5L07A 3B3XA 3LY4A 4MEZA 3H9WA 2BASA 4EUZA 5A90A 3NOTC 2G7UA 3LUQA 1TS6A 3VP3A 4M3KA 2EWWA 1YAXA 5HPIA 5AQ9A 2UWXA 4ZJ2A 4Q8IA 1O7EA 2CMNA 3F1NB 4N9LA 1BYWA 4R3JA 1BTLA 3BQ8A 4WMCA 1G5UA 3IT9A 3GV9A 3CHWP 2V8FA 3O86A 3AGDA 4QU3A 5KIZA 1XA1A 4E3IA 3UPOA 3TW8A 1K6RA 1ZC2A 5J7EA 3W4QA 1K55A 2ZOIA 4ZRRA 3QNCA 2D02A 2XA7M 2VV8A 4FOFA 4GB7A 2R9WA 3CI6A 4FH2A 1K4FA 2H0YA 2A24A 3LYXA 3ZDJA 1H8ZA 3PAEA 5F1GA 1IFQA 2PD7A 4S2PA 2IWBA 3VOYA 3LR3A 1MPLA 5E2GA 1LI0A 2DCFA 4MLLA 5F5YA 2HDSA 2ZC7A 2ZQ7A 4D2OA 4DMZA 2O9AA 2C5WB 1YQSA 2ZM2A 5FEFA 4LRXC 1XJ2A 3E98A 4HQAA 3FPVA 1TEMA 1XKZA 2OAP1 4UEYA 3L9KA 3B47A 3MXQA 1CEFA 1KE4A 1K55C 1OJ5A 4MNRA 3ZG5A 2ZMAA 2W3HA 3Q07A 2P08A 3RXWA 1DP6A 2XF3A 4X68A 3IF6B 2JKTI 3PBQA 1CI8A 4L9GA 5HPFA 4UA7A 2HDRA 1EROA 3KSGA 4Z9QA 3UN7A 4LPZA 1IELA 3WRZA 2WADA 5HL1A 2A24B 4Q0JA 2Y2QA 2V0WA 3DAVA 1HTZA 2PR5A 4S2NA 3C8CA 1ES3A 1ERMA 4DE0A 1VEUB 1PIOA 1WYCA 4C3QA 4O7DA 1XGIA 1YLPA 4N92A 4FH4A 1EWZA 4DF6A 3PAGA 2EWVA 3NDGA 1O07A 4EXOA 3SS4A 4O01A 1FCMA 2VV7A 5EVIA 1BLCA 3WS0A 4IJGA 3E4QA 5CXWA 3VP0A 1GSWA 4L9FA 1T1AA 5L09A 4I39A 4JXVA 2W1RA 4WEKA 5L10A 1IYPA 4MN6A 3NHQA 3UE3A 3S7NA 3DTMA 4GKUA 1BZAA 1PZPA 2EX2A 5DFXA 4WEJA 2BLSA 1KVLA 3LIFA 3GVBA 4KUOA 4IVKA 1PW8A 3B42A 4OP5A 1N4OA 3HLCA 4EWFA 2QPNA 1TD5A 2EFUA 1W79A 2M1CA 5CGWA 3LIDA 5EM1A 1MWRA 1OPXA 3PYPA 4S2NC 3DTEA 3NC8A 3T4QA 2V1ZA 5IT5A 2OLUA 3FWLA 4GDNA 2WGVA 4OPZA 3BY8A 4HI4A 1YKDA 4U0TA 4YWZA 1Q2PA 1PWDA 3SZTA 3IXDA 2H0TA 2DRWA 1MWSA 3A3DA 5EVIC 4DDSA 2PBDP 1FR6A 3P09A 3BWLA 3PBTA 4L0LA 5C5KA 3T50A 3EWKA 1S67L 4E3JA 4JGRA 1MBLA 2HV1A 1H8MA 2J80A 3N4IA 1SDNA 5KSCA 4UQIM 3S7PA 2G2WA 3QP6A 3LI8A 2Y2OA 2Y2MA 2ACGA 3BFDA 1STZA 3UE0A 3OPPA 3VFFA 5FQ9A 2VZWA 1BUEA 4EQ1A 2O99A 1D1JA 3TOIA 4D60A 4OPRA 3ULFA 4EUVA 3G30A 1LSWA 4YNRA 3A3IA 3UDXA 3HREA 3LY3A 1YLTA 3BYDA 5GL9A 3VMAA 2CC1A 4CLCD 2RCXA 4BMWA 4LV2A 3U2AA 4NK3A 4MCWA 4OOYA 4CJNA 4WLAA 2K31A 5EVLA 4ETXA 3W8KA 3PXPA 3VOZA 3JVVA 3PBOA 1SKOB 5CGSA 4M4XA 4R1GA 5KZHA 3UB6A 3OC2A 3LI9A 4ARZA 1TVFA 2KLIA 2P7JA 4ID4A 2OWJA 4NETA 5DKKA 2XDMA 2LB5A 5GLAA 4G3WA 1ONGA 3F1OB 3GR2A 4OOLA 1ESUA 2Y4AA 2KX6A 3LCEA
chains in the Genus database with same CATH topology
1ZTUA 1H3QA 3UMEA 3W2ZA 3S7QA 4I3IA 2K2NA 3FC7A 3UB8A 3FG8A 3K3DA 3UE6A 2W3GA 3C30A 4GHIA 3GDIA 4QPRA 1V9ZA 1MZUA 2L1MA 4B93A 2NUPC 2PT7A 3MFXA 3MF0A 4WELA 3T4LA 1DRMA 2W1TA 4JGOA 2J3TD 3S7OA 1WA9A 3MQOA 1GSXA 2QJ5A 5DKLA 2IA2A 4EU0A 1EW0A 4HP4A 2XROA 2QHKA 5L8MA 4IUHA 3A0RA 5KSHA 1T1BA 4PHTA 4HIAA 3H82B 2WKQA 3KSFA 2INWA 4MN5A 3H7WB 4PAUA 4GJ4A 4KQOA 3LR0A 4II7A 3NJAA 4EERA 4HP9A 4B9OA 4NXEA 3TE8A 2PYPA 2BASA 3H9WA 3R4KA 1ODVA 4G3VA 3RFBA 3NOTC 4R3AA 2G7UA 4PKYA 3D72A 3LUQA 2Y8HA 1TS6A 3MJQA 2KOIA 3F1OA 4BBUA 4P6ZM 2EWWA 1YAXA 4O8GA 5HPIA 2FH5A 3MMHA 3OLOA 3KSIA 2NUTC 4NEED 3MQQA 2CMNA 4YOFA 1LSXA 3F1NB 3OCLA 3E4OA 2W3FA 4I3JA 1BYWA 1P9WA 1NLZA 3BQ8A 5HWVA 4EEPA 2JKTM 5F69A 2OOLA 1LSVA 3T4TA 5IU1A 3TJZC 1TS7A 4O0PA 3PBNA 4I3AA 3EEHA 2GNXA 5KIZA 3ZQ5A 4IUKA 2QJ7A 3TW8A 5J7EA 3K3CA 1G28A 5AJGA 2Z6DA 2ZOIA 4GW9A 1MC0A 4ZRRA 2D02A 2XA7M 2VV8A 2GX5A 4FOFA 4HJ3A 3R7WA 4LRZE 1S66L 2O9BA 3C38A 4I5SA 3E4PA 4NXBA 4GHIB 2V9AA 2FZ0A 5G4YA 3CI6A 3K2NA 5HDCA 3ZYTA 2W1TB 4EESA 2A24A 3F1NA 3LYXA 2W3EA 5DFYA 3DBAA 1IFQA 2PD7A 4GCZA 1TF1A 3LR3A 3VE4A 2Z6CA 2HJEA 5F5YA 2OWHA 3LR4A 3T4KA 2PDRA 1LT0A 2JHEA 2O9CA 3CLOA 3VE3A 4DN0A 5DJTA 2HGVA 4DMZA 2YKHA 2O9AA 1GSVA 3EOIA 1KOUA 1JNUA 1S1ZA 5HSQA 2OAQ1 3BQAA 3D3OA 3BJNA 4LRXC 1XJ2A 2V0UA 3E98A 4HQAA 5HZHA 3FPVA 2K7SA 3P7NA 2D01A 3EQUA 2ZOHA 1OTEA 2OAP1 4UEYA 5J3WA 2XSSA 2GJ3A 3B47A 3MXQA 4IHQA 4Q0IA 1YSQA 1OJ5A 1P97A 2PD8A 5HD5A 2M7VA 1XFQA 5DF9A 3T4OA 3LIEA 4P6ZS 1XJ6A 2JN7A 2O0YA 2W3HA 4XT2B 3NOUC 3OCNA 4HNBA 5DJUA 2P08A 1N9NA 1DP6A 4G3KA 5HDDA 3HJKA 4PKYG 2B02A 2JKTI 3KSHA 3VV4A 1P0ZA 3PBQA 1N9OA 2R78A 4L9GA 5HPFA 3UB7A 5F68A 1G6OA 1DP9A 3R7WB 1V9YA 3LICA 1NLYA 4JGQA 3KSGA 2KDKA 2VGLM 4BJPA 4LPZA 1XFNA 2PR6A 4HH2A 2QWSA 2ZBBA 1VHMA 2VJWA 4H6JB 3A0VA 3BY9A 3JVUA 2XRNA 2A24B 4Q0JA 5I5LA 2H28A 4NXFA 2V0WA 2PR5A 3A0SA 2VA0A 3C8CA 1LL8A 4HH3A 4I38A 1OTDA 3CAXA 3PBSA 2XA7S 1OTAA 5CX7A 3EEAA 4HHDA 1S1YA 1W63Q 2L0WA 2ZMVA 5HDSA 4XT2A 4JGPA 3KYZA 4NKPA 1OTIA 2EWVA 1XJ3A 4RQ9A 4EXOA 1D7EA 4O01A 2VV6A 2VV7A 1XJ4A 2I9VA 4ME4A 4IJGA 5MC7A 1T18A 3E4QA 3MR0A 3LR5A 1GSWA 4L9FA 1T1AA 4I39A 1OT6A 4HY8A 4OOMA 2VX8A 2W1RA 4WEKA 4MN6A 3NHQA 3UE3A 5HWTA 3S7NA 3CWFA 2DMWA 4H6JA 4L9EA 3UMDA 5DFXA 4WEJA 3LIFA 3C2WA 2M7UA 4AFIA 4EETB 4KUOA 3EGDC 4DJ2A 3T4SA 3B42A 4CQHA 4Q0HA 4K08A 5LBRA 3P01A 2VKSA 3IBJA 1S4SA 3RTYA 1TD5A 3E0YA 2M1CA 3LIDA 1OJGA 1S4RA 4NXGA 1OPXA 3PYPA 3EQVA 3EGXC 3T4QA 3KX0X 2PYRA 5IT5A 2PHYA 3PBRA 3V67A 3FPWA 5K5BA 3VOLA 3PR6A 3G6OA 2L4RA 2W27A 2YKFA 4MMNA 3BY8A 4CLCA 4HI4A 1YKDA 4YWZA 4F3LA 3PHYA 4HJ6A 4BBTA 3OOVA 1X0OA 1YSPA 3T4JA 1T1CA 1Y28A 1T19A 1UWNX 3ICYA 3KO6A 2J3TC 3GECA 4UQIS 4LLOB 5EFWA 2VGLS 3LFVA 4BWIA 3BWLA 3PBTA 3TRCA 4L0LA 3IS2A 5C5KA 3T50A 3EWKA 1S67L 2P04A 5J4EA 2WKRA 3F1PA 3IBRA 4JGRA 2HF6A 4Z1WA 2HV1A 3UB9A 1H8MA 2J80A 4WUJA 3RH8B 4UQIM 3S7PA 2B18A 4WF0A 3CITA 3LI8A 2V1BA 4CLCE 1W63M 4MDZA 1MKMA 1STZA 4GLQA 4BBVA 2VZWA 4EQ1A 1TS8A 2O99A 5HWWA 1P9RA 2LB9A 1NWZA 1VB6A 1ZHHB 4R6LA 4EW7A 3MQ0A 3O5YA 2MJ6A 3BW6A 3ULFA 1F98A 4EUVA 4KQDA 4ETZA 4CLCC 4MN7A 2V1AA 5FL3A 2QYBA 2GZAA 4WL9A 1LSWA 5AVFA 4YNRA 3HCYA 4ARZB 3OBFA 3CUEA 5HD3A 3B33A 4Y5FA 4E04A 3HJIA 5TJJA 2A2LA 4R70A 2ZMFA 4LRYC 5TBMB 2HJ9C 1TS0A 5G4ZA 5A8BA 4CLCB 4WN5A 4F3LB 2Y79A 4CLCD 4Y2FA 1OT9A 4BMWA 5AVEA 3U2AA 3LIAA 5F6AA 2QKPA 3SW1A 4MCWA 4GS9B 4WLAA 2K31A 4ETXA 3H82A 3PXPA 1UGUA 3H7WA 1IOUA 3JVVA 1F9IA 3PBOA 4HJ4A 2VLGA 3NOPC 3IS2B 4M4XA 2JKRI 4HOIA 2W0NA 3F1PB 4EEUA 2VEAA 3UB6A 3OC2A 5HL6A 1F5MA 3LI9A 4ARZA 2J3WA 2KLIA 2P7JA 2W3DA 3LIBA 1UWPX 1N9LA 5TBMA 2OWJA 4KUKA 4Y3IA 5DKKA 2WKPA 3KYQA 2LB5A 3CUEC 4DJ3A 1DP8A 1NRJA 2JKRM 4R38A 4G3WA 3F1OB 4GS9A 4OOLA 4FSFA 1D06A 2EA9A 1OTBA 5IS1A 2KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC E;  4CLC C;  3FPW A;  4CLC D;  4CLC A;  4BMW A;  4NKP A;  5CX7 A;  2A2L A;  3FPV A;  4CLC B; 
#chains in the Genus database with same CATH topology
 1KDS A;  4I3I A;  1FQG A;  3G35 A;  4JF4 A;  2XQZ A;  3UE6 A;  3ZNT A;  1IKG A;  1BLH A;  3GDI A;  1DRM A;  3G2Z A;  4KZ7 A;  2J3T D;  3MZE A;  2IA2 A;  2XR0 A;  4EU0 A;  2A49 A;  2AVX A;  1NZO A;  3N8S A;  2BTF P;  5J8X A;  4MN5 A;  4GJ4 A;  4JKT A;  4LGW A;  4EER A;  4B9O A;  2PYP A;  3Q7V A;  4G3V A;  2Y8H A;  3MJQ A;  4BBU A;  4PM5 A;  4RVA A;  4O8G A;  4RA7 A;  3D9Y A;  3QP2 A;  4DXC A;  2ZL1 A;  3OLO A;  4NEE D;  1IYS A;  2ZM0 A;  1AXB A;  1F2K A;  1LSX A;  3E4O A;  2W3F A;  4I3J A;  1J3W A;  2EX9 A;  2XK1 A;  2OOL A;  1LSV A;  4BD0 A;  2ZC6 B;  3T4T A;  4ZDX A;  3L7H A;  1TS7 A;  3V5M A;  4KQQ A;  1K57 A;  4IUK A;  2QJ7 A;  5GLB A;  2ZQA A;  5FA7 A;  3K3C A;  4N9K A;  1G28 A;  2Z6D A;  4GW9 A;  4RYE A;  3DTK A;  2GX5 A;  3R7W A;  1GHI A;  4LRZ E;  1QME A;  1S66 L;  5FI6 A;  4JPM A;  2V9A A;  4Y0T A;  3G34 A;  3K2N A;  3ZYT A;  3N6I A;  5CER A;  4QD4 A;  2ZLY A;  3F1N A;  2W3E A;  5DFY A;  3DBA A;  1TF1 A;  2J9O A;  3VE4 A;  2Z6C A;  2ZQ9 A;  2HJE A;  1K38 A;  2OWH A;  1PNE A;  2RL3 A;  3LR4 A;  2O9C A;  4N1H A;  5CRF A;  2HGV A;  3U4L P;  3ZCZ A;  3IX3 A;  5CEC A;  4EBP A;  2K7S A;  3WS1 A;  1K57 C;  3P7N A;  2XFS A;  2D01 A;  3EQU A;  3IX8 A;  1N9B A;  1OTE A;  3A3E A;  5J3W A;  4PM6 A;  4S2O A;  2H5S A;  3Q81 A;  2GJ3 A;  4IHQ A;  1M6K A;  4Q0I A;  4WMC D;  3IQA A;  5HAR A;  2PD8 A;  5HD5 A;  3HVF A;  1FIK A;  5DF9 A;  3T4O A;  5EV0 A;  4E3O A;  1I5Q A;  1JTG A;  2O0Y A;  4HBU A;  4HNB A;  3T1R A;  1KDW A;  3KYE A;  4S2J A;  4BEN A;  5HDD A;  2Y2P A;  3KSH A;  4KZ5 A;  2R78 A;  3UB7 A;  5F68 A;  3R7W B;  1Z09 A;  4KZ4 A;  5DF8 A;  1SHV A;  2KDK A;  1XFN A;  2PR6 A;  4JXG A;  1IYQ A;  2ZBB A;  1VHM A;  4Y17 A;  5FI2 A;  5I5L A;  2XEP A;  4NXF A;  1RGY A;  5GHZ A;  1LL8 A;  1BLS A;  1OTA A;  1W63 Q;  5HDS A;  4X56 A;  3NBL A;  5CHM A;  3C4O A;  4B4X A;  1OTI A;  1XJ3 A;  4RQ9 A;  3IF6 A;  4JXW A;  2UV0 E;  3CPT B;  3PTE A;  5HAP A;  4A5R A;  1K6S A;  1PI5 A;  2WGW B;  4S2M A;  5MC7 A;  3MR0 A;  3LR5 A;  1AWI A;  2Q9M A;  2EFX A;  1OT6 A;  5DTT A;  2VX8 A;  3LEQ A;  5HWT A;  3CWF A;  2DMW A;  3UMD A;  2WKI A;  4OKP A;  3P98 A;  3V39 A;  3IH8 A;  3S4X A;  4AFI A;  3BLM A;  4EET B;  3T4S A;  5A92 A;  1VEU A;  3RTY A;  3IBJ A;  4UAA A;  1TDL A;  3WS5 A;  4Y0O A;  4PMA A;  4NXG A;  1GHP A;  1JTD A;  1LL9 A;  3EQV A;  3EGX C;  1RP5 A;  1FCO A;  2PHY A;  5K5B A;  4EBN A;  3PR6 A;  1L0G A;  2YKF A;  2J8Y A;  4RX3 A;  4QHC A;  3W4O A;  5TFQ A;  4OQG A;  5FSR A;  2PBY A;  3N8L A;  2Z2L B;  3IF6 C;  3GSG A;  1Y28 A;  3CJM A;  1T19 A;  1UWN X;  4KZB A;  2Y2N A;  2BG1 A;  3HLG A;  4E6X A;  1PYY A;  4LLO B;  5EFW A;  3LFV A;  3ISG A;  4BWI A;  3T12 B;  3IXG A;  4E3L A;  2WKR A;  1FR1 A;  3F1P A;  2HZ5 A;  1PZO A;  2EX8 A;  3OPH A;  3MKF A;  5EVI D;  4PM7 A;  5E2H A;  5EEC A;  2B18 A;  5FAQ A;  1MXO A;  3CIT A;  5M18 A;  4Y7P A;  1DJC A;  1GCE A;  1MKM A;  4IBR A;  2JKF A;  1Q2Q A;  2LB9 A;  4OQH A;  1VB6 A;  3ZNY A;  2QZ6 A;  3V50 A;  4MBF A;  3O5Y A;  1A0K A;  4P85 A;  5F1F A;  1F98 A;  4FUW A;  4OLD A;  2IWD A;  2V1A A;  5FL3 A;  2QYB A;  4WL9 A;  3HCY A;  5HD3 A;  4Y5F A;  3HJI A;  3ZG9 B;  3BFG A;  1GHM A;  4LRY C;  5TBM B;  1JVJ A;  1TS0 A;  5G4Z A;  4WN5 A;  5HX9 A;  1OT9 A;  3QP4 A;  1PW1 A;  2PU4 A;  5M1A A;  2XD1 A;  3OPL A;  4LCL A;  1F9I A;  1ZG4 A;  5FAS A;  3GRJ A;  4HJ4 A;  4WZ4 A;  3QP1 A;  1YMS A;  3SH7 A;  2W0N A;  3F1P B;  5EPH A;  1XGJ A;  1F5M A;  4DDY A;  1GA0 A;  1PI4 A;  3QP5 A;  4OQ0 A;  1FSY A;  1VET A;  2W3D A;  1UWP X;  5DVA A;  1N9L A;  5HFO A;  3LEZ A;  3E2K A;  4Y3I A;  4LV3 A;  1NRJ A;  2A3U A;  4RX2 A;  1MY8 A;  3UB5 P;  1SKO A;  2B95 A;  3S7Q A;  3W2Z A;  3FKV A;  3WS2 A;  4QWO A;  3FG8 A;  3K3D A;  3Q7Z A;  4X25 A;  5JYO A;  3IF5 A;  4GHI A;  3VSL A;  1G6A A;  1ZKJ A;  3FKW A;  1XX2 A;  1W7F A;  2PT7 A;  3MF0 A;  4WEL A;  2W1T A;  3S7O A;  1KE0 A;  1GSX A;  3NI9 A;  2XGN A;  4P87 A;  2XRO A;  3IXB A;  2PU2 A;  4HIA A;  2INW A;  4K0X A;  1SDE A;  4KQO A;  3LGO A;  4II7 A;  3A3F A;  4JLF A;  4HP9 A;  4NXE A;  4N1X A;  1ODV A;  3RFB A;  4R3A A;  1WE4 A;  3OPR A;  4C75 A;  4LCM A;  2ZQC A;  3F1O A;  1YLZ A;  2I72 A;  3IH9 A;  4GN2 A;  1LHY A;  1E4D A;  5FDS A;  1K54 A;  2FH5 A;  3MMH A;  3KSI A;  2NUT C;  4JXS A;  5M19 A;  1K56 A;  3MQQ A;  2H10 A;  4YOF A;  2OV5 A;  1VET B;  2JKT M;  2ZQD A;  1ESI A;  5F69 A;  5FI7 A;  3HLF A;  5IU1 A;  3TJZ C;  3RJU A;  3PBN A;  4I3A A;  5BOH A;  4ZBE A;  1OME A;  4KZ9 A;  5AJG A;  5FAT A;  3C5A A;  2EXA A;  1C3B A;  3MSH A;  2PAV P;  4FD8 A;  1I2W A;  3OZH A;  4I5S A;  3E4P A;  4NXB A;  4GHI B;  3ITB A;  5I94 A;  5CEB A;  2W1T B;  5EOO A;  4EES A;  4ESP A;  1K54 C;  2V20 A;  3D4F A;  1ACF A;  3ZFZ A;  3VE3 A;  1PWC A;  1LT0 A;  3CLO A;  4GDB A;  5DJT A;  4OH0 A;  4HBT A;  5E2F A;  1GSV A;  4H8R A;  3EOI A;  4OPQ A;  4DXB A;  3G4P A;  1S1Z A;  3Q1F A;  2OAQ 1;  5HZH A;  2X02 A;  2ZOH A;  3LO7 A;  2XSS A;  3NDE A;  3WS4 A;  2ZQ8 A;  3TG9 A;  3ZVT A;  3LIE A;  4P6Z S;  5D3O A;  1XJ6 A;  1YLW A;  2JN7 A;  4XT2 B;  3NOU C;  3BLS A;  1S0W A;  1N9N A;  3HJK A;  4PKY G;  3IHB A;  1W5D A;  1E3U D;  4PM9 A;  4GOG A;  1P0Z A;  3VV4 A;  1N9O A;  1CQA A;  3IWO A;  4KG6 A;  3GMW A;  1HVB A;  1V9Y A;  3LIC A;  4X1L A;  1NLY A;  4JGQ A;  4IBX A;  5FEG A;  4BJP A;  3IHA A;  1CJF A;  3ZGA B;  4HH2 A;  5G18 A;  4H6J B;  2WKE A;  3BY9 A;  3JVU A;  2XRN A;  3BFF A;  2H28 A;  1NRF A;  5F82 A;  1ZG6 A;  3SH9 A;  4HH3 A;  3G32 A;  3CAX A;  4BLM A;  5CX7 A;  3EEA A;  1S1Y A;  4U3T A;  3WRT A;  2L0W A;  2ZMV A;  3HLB A;  3JYI A;  1CI9 A;  4JGP A;  4NKP A;  3FZC A;  1K4E A;  3BRM A;  3A3J A;  1D7E A;  2G2U A;  1L2S A;  2FFY A;  4Y13 A;  2VV6 A;  1XJ4 A;  2C6W B;  2I9V A;  4NG2 A;  1JWV A;  2HP6 A;  2ZM8 A;  4HY8 A;  1LI9 A;  1IYO A;  3HLE A;  2JC7 A;  2WZX A;  5CED A;  4L9E A;  1NXY A;  1NYY A;  3SH8 A;  1YPR A;  3TSG A;  3C2W A;  5EM0 A;  4JBF A;  3EGD C;  4DJ2 A;  2DNS A;  4CQH A;  4Q0H A;  4K08 A;  5LBR A;  2VKS A;  1S4S A;  1OJG A;  1S4R A;  3HL9 A;  2Y2K A;  4HEF A;  3KX0 X;  3C7V A;  4BL2 A;  4EBL A;  1KE3 A;  3V67 A;  3VFH A;  3CPT A;  3UPN A;  3G6O A;  2L4R A;  2W27 A;  4MMN A;  4F3L A;  2WGW A;  4R23 A;  1SKF A;  4BBT A;  2WK0 A;  3T1X A;  1VQQ A;  3OOV A;  1YSP A;  3DWZ A;  3IXH A;  2OLV A;  4F94 A;  1T1C A;  5CHU A;  3ICY A;  3KO6 A;  2J3T C;  4UQI S;  2VGL S;  3HUN A;  4C6Y A;  1FIL A;  5EE8 A;  4ZAM A;  3IBR A;  4Z1W A;  5GHX A;  3UB9 A;  4WUJ A;  1MWU A;  4X55 A;  5JYP A;  1W63 M;  4U0X A;  4BBV A;  5FQQ A;  1GA9 A;  4CPK A;  1QMF A;  1TS8 A;  5HWW A;  1P9R A;  1NWZ A;  1ZHH B;  1PRQ A;  4OVD A;  3UDI A;  5CTM A;  2MJ6 A;  3NUL A;  4KQD A;  2GZA A;  3HLW A;  3CUE A;  3B33 A;  1HD8 A;  4E04 A;  5TJJ A;  2A2L A;  4GNU A;  4BD1 A;  2ZMF A;  1KVM A;  2HJ9 C;  5A8B A;  4F3L B;  1KGF A;  3MZD A;  4Y2F A;  5AVE A;  4EQI A;  2HDQ A;  3LIA A;  5F6A A;  2JBF A;  3SW1 A;  3NCK A;  5DTK A;  4GS9 B;  3O3V A;  1UGU A;  4E3K A;  3H7W A;  4K91 A;  5A91 A;  2XFT A;  3MZF A;  2EXB A;  3NIA A;  2VLG A;  3M6B A;  1VM1 A;  4YFM A;  4HOI A;  2HP5 A;  3UPP A;  4EEU A;  2Y91 A;  2ZC3 B;  5FQI A;  5HL6 A;  1NY0 A;  4B88 A;  1KGG A;  4R4S A;  2Y2J A;  2Y59 A;  1CK3 A;  5TBM A;  3T1S A;  3N8R A;  2WKP A;  3CUE C;  3SS5 A;  4PM8 A;  1DP8 A;  1K0K A;  4PPR A;  2JKR M;  2X01 A;  3MKE A;  4XUZ A;  2V8C A;  1D06 A;  4FSF A;  4QB8 A;  1RCJ A;  1OTB A;  5IS1 A;  5EUA A;  4E3M A;  3VP1 A;  1H3Q A;  1H0M A;  5HAQ A;  2K2N A;  3FC7 A;  2QMI A;  1ALQ A;  3QP8 A;  5F83 A;  2W3G A;  3C30 A;  2FFF B;  1WYB A;  4DE3 A;  1V9Z A;  1LL5 A;  1Y54 A;  1MZU A;  4QY6 A;  4B93 A;  2NUP C;  4LFU A;  3MFX A;  1KGE A;  4JGO A;  4KG5 A;  1WA9 A;  3MBZ A;  2QJ5 A;  3MQO A;  5EVE A;  3MS6 A;  1BSG A;  4E3N A;  2QHK A;  5L8M A;  3UDF A;  3A0R A;  3DTI A;  1T1B A;  4PHT A;  4WYY A;  2WKQ A;  3HUO A;  4ZJ3 A;  3H7W B;  2Y2L A;  4MBH A;  4OON A;  2WAE A;  3LR0 A;  4PAU A;  3NJA A;  3QHY A;  1BT5 A;  3G2Y A;  4R0Q A;  3TE8 A;  3R4K A;  4PKY A;  3D72 A;  5DF7 A;  1CEG A;  2KOI A;  1YLJ A;  1MWT A;  4P6Z M;  3IWQ A;  4YIN A;  4FCF A;  1YLY A;  3OCL A;  2Z2M B;  3SOI A;  1P9W A;  1NLZ A;  3IWI A;  5HWV A;  4X69 A;  3ZG8 B;  4EEP A;  5L2F A;  3Q82 A;  3UNW A;  4OQI A;  1L3L A;  3ZHH A;  4QY5 A;  4O0P A;  5FDH A;  1J9M A;  3EEH A;  2GNX A;  4XXR A;  3W4P A;  2JCH A;  3ZQ5 A;  4FTX A;  4ZJ1 A;  3S1Y A;  4DRT A;  1MC0 A;  3ITA A;  5CHJ A;  2E8J A;  4HJ3 A;  1BLP A;  1PFL A;  2O9B A;  2ZC5 B;  3BM6 A;  3C38 A;  2FZ0 A;  5G4Y A;  3QNB A;  4S2L A;  2XD5 A;  5HDC A;  4DE1 A;  5E2E A;  1U60 A;  3BFE A;  4GCZ A;  4KQR A;  5CTN A;  5FAP A;  3T4K A;  2PDR A;  2JHE A;  4DN0 A;  4OP8 A;  4S2I A;  3O87 A;  2WZZ A;  2YKH A;  2V2F F;  2HDU A;  2JKG A;  2X71 A;  4P6B A;  1KOU A;  5AQB A;  1JNU A;  5HSQ A;  3BQA A;  1ERQ A;  3D3O A;  1IKI A;  3BJN A;  2V0U A;  3HUM A;  5KMW A;  2ZJ9 A;  1K56 D;  4UA6 A;  2Q0O A;  1FCN A;  1RGZ A;  3FV7 A;  1L0D A;  1YSQ A;  3AGE A;  3MXR A;  1P97 A;  5U47 A;  2M7V A;  1DJB A;  5CGX A;  1XFQ A;  2B5R A;  5A93 A;  3OCN A;  3MXS A;  1JWZ A;  5DJU A;  1ES4 A;  3UY6 A;  4G3K A;  2B02 A;  3BEC A;  4KZA A;  1SZV A;  3VP2 A;  4Y0U A;  3O88 A;  5EVI B;  1YM1 A;  1G6O A;  1DP9 A;  2P9V A;  2Y2G A;  2P74 A;  4UHU A;  2VGL M;  2GDN A;  4KG2 A;  3M6H A;  2QWS A;  5FQM A;  4WM9 A;  3UE1 A;  2VJW A;  3A0V A;  1JWP A;  5GLC A;  3A0S A;  5FQJ A;  2VA0 A;  3S22 A;  2XLN A;  4I38 A;  1OTD A;  3PBS A;  4GZB A;  2E8I A;  2XA7 S;  4HHD A;  4XT2 A;  2Q9N A;  3KYZ A;  4IVI A;  4EV4 A;  3GQZ A;  2ZC4 B;  5AQA A;  2Y2I A;  1G68 A;  2WKH A;  1NJ4 A;  1Z6F A;  4ME4 A;  3G31 A;  1T18 A;  4OOM A;  1ONH A;  1FSW A;  4H6J A;  4JF6 A;  3ZG7 B;  2WAF A;  1NYM A;  3T1Q B;  2J7V A;  4B4Z A;  2Y55 A;  4X6T A;  2M7U A;  3V3R A;  4BL3 A;  4DKI A;  2WUQ A;  4P0M A;  4LV0 A;  1NZU A;  3P01 A;  3E0Y A;  2WYX A;  2P9V B;  5EOE A;  1ES2 A;  2PYR A;  3PBR A;  1BUL A;  3FPW A;  1W8Y A;  5FQK A;  3VOL A;  3RXX A;  1IEM A;  4GD8 A;  4CLC A;  3PHY A;  4HJ6 A;  4WZ5 A;  3I7J A;  5TR7 A;  4KZ8 A;  1X0O A;  3T4J A;  4S2K A;  3BFC A;  4K0W A;  3M2J A;  3GEC A;  4WBG A;  3TRC A;  1ES5 A;  2HP9 A;  3IS2 A;  3FYZ A;  1M40 A;  2P04 A;  3MFD A;  5J4E A;  2HF6 A;  2EX6 A;  1SCW A;  3RH8 B;  2Y2H A;  1XPB A;  4WF0 A;  3ZVW A;  2JE5 A;  3N7W A;  2V1B A;  3HLD A;  4CLC E;  4LV1 A;  4MDZ A;  4KZ3 A;  3NEC A;  1DY6 A;  4GLQ A;  4DE2 A;  4BQM A;  2VGJ A;  1H5X A;  4R6L A;  3WWX A;  1Y4O A;  4EW7 A;  4Y15 A;  5AQ7 A;  3MQ0 A;  2XH9 A;  3BEB A;  3BW6 A;  4ETZ A;  4CLC C;  4MN7 A;  5TGF A;  1YMX A;  3IX4 A;  5AVF A;  4GD6 A;  4WZ5 C;  4ARZ B;  3OBF A;  3V3S A;  5HW3 A;  4R70 A;  1YT4 A;  3DW0 A;  2J9P A;  3CZD A;  3NY4 A;  3ZG0 A;  3DWK A;  4X1M A;  4CLC B;  2Y79 A;  4X53 A;  3VP4 A;  3VSK A;  2QKP A;  3CG5 A;  4HES A;  1E25 A;  4IED A;  3H82 A;  1W8Q A;  1E3U A;  5GHY A;  1IOU A;  1L0E A;  3SS3 A;  2VK3 A;  3CMZ A;  4QJG A;  3UO9 A;  3NOP C;  3IS2 B;  2IWC A;  2JKR I;  2PRF A;  4JF5 A;  1HZO A;  4OPY A;  3HBR A;  4XUX A;  4E6W A;  2VEA A;  3E2L A;  2J3W A;  4R4R A;  2OSU A;  1PWG A;  3LIB A;  4KEN B;  3JPU A;  1EI5 A;  4UA9 A;  4KUK A;  3M2K A;  1H8Y A;  1FOF A;  3C7U A;  3KYQ A;  4DJ3 A;  3Q7V B;  4LEN A;  4R38 A;  1XP4 A;  4GS9 A;  2EA9 A;  5FAO A;  2WGI A;  4MBK A;  5GLD A;  1ZTU A;  5IHV A;  2ZL1 B;  3UME A;  4ZTK A;  2HPB A;  3GTC A;  3UB8 A;  1DJA A;  1HLU P;  4R3B A;  4OLG A;  4QPR A;  2L1M A;  1S6R A;  3AGF A;  1L0F A;  2ZD8 A;  3T4L A;  1XA7 A;  1I2S A;  1XXM A;  5E43 A;  3C4P A;  5DKL A;  1EW0 A;  1MKI A;  4HP4 A;  4IUH A;  5KSH A;  1LLB A;  2R9X A;  1CF0 A;  3H82 B;  3KSF A;  1K25 A;  4KZ6 A;  1TDG A;  5HAI A;  2VGK A;  5DTS A;  5L07 A;  3B3X A;  3LY4 A;  4MEZ A;  3H9W A;  2BAS A;  4EUZ A;  5A90 A;  3NOT C;  2G7U A;  3LUQ A;  1TS6 A;  3VP3 A;  4M3K A;  2EWW A;  1YAX A;  5HPI A;  5AQ9 A;  2UWX A;  4ZJ2 A;  4Q8I A;  1O7E A;  2CMN A;  3F1N B;  4N9L A;  1BYW A;  4R3J A;  1BTL A;  3BQ8 A;  4WMC A;  1G5U A;  3IT9 A;  3GV9 A;  3CHW P;  2V8F A;  3O86 A;  3AGD A;  4QU3 A;  5KIZ A;  1XA1 A;  4E3I A;  3UPO A;  3TW8 A;  1K6R A;  1ZC2 A;  5J7E A;  3W4Q A;  1K55 A;  2ZOI A;  4ZRR A;  3QNC A;  2D02 A;  2XA7 M;  2VV8 A;  4FOF A;  4GB7 A;  2R9W A;  3CI6 A;  4FH2 A;  1K4F A;  2H0Y A;  2A24 A;  3LYX A;  3ZDJ A;  1H8Z A;  3PAE A;  5F1G A;  1IFQ A;  2PD7 A;  4S2P A;  2IWB A;  3VOY A;  3LR3 A;  1MPL A;  5E2G A;  1LI0 A;  2DCF A;  4MLL A;  5F5Y A;  2HDS A;  2ZC7 A;  2ZQ7 A;  4D2O A;  4DMZ A;  2O9A A;  2C5W B;  1YQS A;  2ZM2 A;  5FEF A;  4LRX C;  1XJ2 A;  3E98 A;  4HQA A;  3FPV A;  1TEM A;  1XKZ A;  2OAP 1;  4UEY A;  3L9K A;  3B47 A;  3MXQ A;  1CEF A;  1KE4 A;  1K55 C;  1OJ5 A;  4MNR A;  3ZG5 A;  2ZMA A;  2W3H A;  3Q07 A;  2P08 A;  3RXW A;  1DP6 A;  2XF3 A;  4X68 A;  3IF6 B;  2JKT I;  3PBQ A;  1CI8 A;  4L9G A;  5HPF A;  4UA7 A;  2HDR A;  1ERO A;  3KSG A;  4Z9Q A;  3UN7 A;  4LPZ A;  1IEL A;  3WRZ A;  2WAD A;  5HL1 A;  2A24 B;  4Q0J A;  2Y2Q A;  2V0W A;  3DAV A;  1HTZ A;  2PR5 A;  4S2N A;  3C8C A;  1ES3 A;  1ERM A;  4DE0 A;  1VEU B;  1PIO A;  1WYC A;  4C3Q A;  4O7D A;  1XGI A;  1YLP A;  4N92 A;  4FH4 A;  1EWZ A;  4DF6 A;  3PAG A;  2EWV A;  3NDG A;  1O07 A;  4EXO A;  3SS4 A;  4O01 A;  1FCM A;  2VV7 A;  5EVI A;  1BLC A;  3WS0 A;  4IJG A;  3E4Q A;  5CXW A;  3VP0 A;  1GSW A;  4L9F A;  1T1A A;  5L09 A;  4I39 A;  4JXV A;  2W1R A;  4WEK A;  5L10 A;  1IYP A;  4MN6 A;  3NHQ A;  3UE3 A;  3S7N A;  3DTM A;  4GKU A;  1BZA A;  1PZP A;  2EX2 A;  5DFX A;  4WEJ A;  2BLS A;  1KVL A;  3LIF A;  3GVB A;  4KUO A;  4IVK A;  1PW8 A;  3B42 A;  4OP5 A;  1N4O A;  3HLC A;  4EWF A;  2QPN A;  1TD5 A;  2EFU A;  1W79 A;  2M1C A;  5CGW A;  3LID A;  5EM1 A;  1MWR A;  1OPX A;  3PYP A;  4S2N C;  3DTE A;  3NC8 A;  3T4Q A;  2V1Z A;  5IT5 A;  2OLU A;  3FWL A;  4GDN A;  2WGV A;  4OPZ A;  3BY8 A;  4HI4 A;  1YKD A;  4U0T A;  4YWZ A;  1Q2P A;  1PWD A;  3SZT A;  3IXD A;  2H0T A;  2DRW A;  1MWS A;  3A3D A;  5EVI C;  4DDS A;  2PBD P;  1FR6 A;  3P09 A;  3BWL A;  3PBT A;  4L0L A;  5C5K A;  3T50 A;  3EWK A;  1S67 L;  4E3J A;  4JGR A;  1MBL A;  2HV1 A;  1H8M A;  2J80 A;  3N4I A;  1SDN A;  5KSC A;  4UQI M;  3S7P A;  2G2W A;  3QP6 A;  3LI8 A;  2Y2O A;  2Y2M A;  2ACG A;  3BFD A;  1STZ A;  3UE0 A;  3OPP A;  3VFF A;  5FQ9 A;  2VZW A;  1BUE A;  4EQ1 A;  2O99 A;  1D1J A;  3TOI A;  4D60 A;  4OPR A;  3ULF A;  4EUV A;  3G30 A;  1LSW A;  4YNR A;  3A3I A;  3UDX A;  3HRE A;  3LY3 A;  1YLT A;  3BYD A;  5GL9 A;  3VMA A;  2CC1 A;  4CLC D;  2RCX A;  4BMW A;  4LV2 A;  3U2A A;  4NK3 A;  4MCW A;  4OOY A;  4CJN A;  4WLA A;  2K31 A;  5EVL A;  4ETX A;  3W8K A;  3PXP A;  3VOZ A;  3JVV A;  3PBO A;  1SKO B;  5CGS A;  4M4X A;  4R1G A;  5KZH A;  3UB6 A;  3OC2 A;  3LI9 A;  4ARZ A;  1TVF A;  2KLI A;  2P7J A;  4ID4 A;  2OWJ A;  4NET A;  5DKK A;  2XDM A;  2LB5 A;  5GLA A;  4G3W A;  1ONG A;  3F1O B;  3GR2 A;  4OOL A;  1ESU A;  2Y4A A;  2KX6 A;  3LCE A; 
#chains in the Genus database with same CATH homology
 1ZTU A;  1H3Q A;  3UME A;  3W2Z A;  3S7Q A;  4I3I A;  2K2N A;  3FC7 A;  3UB8 A;  3FG8 A;  3K3D A;  3UE6 A;  2W3G A;  3C30 A;  4GHI A;  3GDI A;  4QPR A;  1V9Z A;  1MZU A;  2L1M A;  4B93 A;  2NUP C;  2PT7 A;  3MFX A;  3MF0 A;  4WEL A;  3T4L A;  1DRM A;  2W1T A;  4JGO A;  2J3T D;  3S7O A;  1WA9 A;  3MQO A;  1GSX A;  2QJ5 A;  5DKL A;  2IA2 A;  4EU0 A;  1EW0 A;  4HP4 A;  2XRO A;  2QHK A;  5L8M A;  4IUH A;  3A0R A;  5KSH A;  1T1B A;  4PHT A;  4HIA A;  3H82 B;  2WKQ A;  3KSF A;  2INW A;  4MN5 A;  3H7W B;  4PAU A;  4GJ4 A;  4KQO A;  3LR0 A;  4II7 A;  3NJA A;  4EER A;  4HP9 A;  4B9O A;  4NXE A;  3TE8 A;  2PYP A;  2BAS A;  3H9W A;  3R4K A;  1ODV A;  4G3V A;  3RFB A;  3NOT C;  4R3A A;  2G7U A;  4PKY A;  3D72 A;  3LUQ A;  2Y8H A;  1TS6 A;  3MJQ A;  2KOI A;  3F1O A;  4BBU A;  4P6Z M;  2EWW A;  1YAX A;  4O8G A;  5HPI A;  2FH5 A;  3MMH A;  3OLO A;  3KSI A;  2NUT C;  4NEE D;  3MQQ A;  2CMN A;  4YOF A;  1LSX A;  3F1N B;  3OCL A;  3E4O A;  2W3F A;  4I3J A;  1BYW A;  1P9W A;  1NLZ A;  3BQ8 A;  5HWV A;  4EEP A;  2JKT M;  5F69 A;  2OOL A;  1LSV A;  3T4T A;  5IU1 A;  3TJZ C;  1TS7 A;  4O0P A;  3PBN A;  4I3A A;  3EEH A;  2GNX A;  5KIZ A;  3ZQ5 A;  4IUK A;  2QJ7 A;  3TW8 A;  5J7E A;  3K3C A;  1G28 A;  5AJG A;  2Z6D A;  2ZOI A;  4GW9 A;  1MC0 A;  4ZRR A;  2D02 A;  2XA7 M;  2VV8 A;  2GX5 A;  4FOF A;  4HJ3 A;  3R7W A;  4LRZ E;  1S66 L;  2O9B A;  3C38 A;  4I5S A;  3E4P A;  4NXB A;  4GHI B;  2V9A A;  2FZ0 A;  5G4Y A;  3CI6 A;  3K2N A;  5HDC A;  3ZYT A;  2W1T B;  4EES A;  2A24 A;  3F1N A;  3LYX A;  2W3E A;  5DFY A;  3DBA A;  1IFQ A;  2PD7 A;  4GCZ A;  1TF1 A;  3LR3 A;  3VE4 A;  2Z6C A;  2HJE A;  5F5Y A;  2OWH A;  3LR4 A;  3T4K A;  2PDR A;  1LT0 A;  2JHE A;  2O9C A;  3CLO A;  3VE3 A;  4DN0 A;  5DJT A;  2HGV A;  4DMZ A;  2YKH A;  2O9A A;  1GSV A;  3EOI A;  1KOU A;  1JNU A;  1S1Z A;  5HSQ A;  2OAQ 1;  3BQA A;  3D3O A;  3BJN A;  4LRX C;  1XJ2 A;  2V0U A;  3E98 A;  4HQA A;  5HZH A;  3FPV A;  2K7S A;  3P7N A;  2D01 A;  3EQU A;  2ZOH A;  1OTE A;  2OAP 1;  4UEY A;  5J3W A;  2XSS A;  2GJ3 A;  3B47 A;  3MXQ A;  4IHQ A;  4Q0I A;  1YSQ A;  1OJ5 A;  1P97 A;  2PD8 A;  5HD5 A;  2M7V A;  1XFQ A;  5DF9 A;  3T4O A;  3LIE A;  4P6Z S;  1XJ6 A;  2JN7 A;  2O0Y A;  2W3H A;  4XT2 B;  3NOU C;  3OCN A;  4HNB A;  5DJU A;  2P08 A;  1N9N A;  1DP6 A;  4G3K A;  5HDD A;  3HJK A;  4PKY G;  2B02 A;  2JKT I;  3KSH A;  3VV4 A;  1P0Z A;  3PBQ A;  1N9O A;  2R78 A;  4L9G A;  5HPF A;  3UB7 A;  5F68 A;  1G6O A;  1DP9 A;  3R7W B;  1V9Y A;  3LIC A;  1NLY A;  4JGQ A;  3KSG A;  2KDK A;  2VGL M;  4BJP A;  4LPZ A;  1XFN A;  2PR6 A;  4HH2 A;  2QWS A;  2ZBB A;  1VHM A;  2VJW A;  4H6J B;  3A0V A;  3BY9 A;  3JVU A;  2XRN A;  2A24 B;  4Q0J A;  5I5L A;  2H28 A;  4NXF A;  2V0W A;  2PR5 A;  3A0S A;  2VA0 A;  3C8C A;  1LL8 A;  4HH3 A;  4I38 A;  1OTD A;  3CAX A;  3PBS A;  2XA7 S;  1OTA A;  5CX7 A;  3EEA A;  4HHD A;  1S1Y A;  1W63 Q;  2L0W A;  2ZMV A;  5HDS A;  4XT2 A;  4JGP A;  3KYZ A;  4NKP A;  1OTI A;  2EWV A;  1XJ3 A;  4RQ9 A;  4EXO A;  1D7E A;  4O01 A;  2VV6 A;  2VV7 A;  1XJ4 A;  2I9V A;  4ME4 A;  4IJG A;  5MC7 A;  1T18 A;  3E4Q A;  3MR0 A;  3LR5 A;  1GSW A;  4L9F A;  1T1A A;  4I39 A;  1OT6 A;  4HY8 A;  4OOM A;  2VX8 A;  2W1R A;  4WEK A;  4MN6 A;  3NHQ A;  3UE3 A;  5HWT A;  3S7N A;  3CWF A;  2DMW A;  4H6J A;  4L9E A;  3UMD A;  5DFX A;  4WEJ A;  3LIF A;  3C2W A;  2M7U A;  4AFI A;  4EET B;  4KUO A;  3EGD C;  4DJ2 A;  3T4S A;  3B42 A;  4CQH A;  4Q0H A;  4K08 A;  5LBR A;  3P01 A;  2VKS A;  3IBJ A;  1S4S A;  3RTY A;  1TD5 A;  3E0Y A;  2M1C A;  3LID A;  1OJG A;  1S4R A;  4NXG A;  1OPX A;  3PYP A;  3EQV A;  3EGX C;  3T4Q A;  3KX0 X;  2PYR A;  5IT5 A;  2PHY A;  3PBR A;  3V67 A;  3FPW A;  5K5B A;  3VOL A;  3PR6 A;  3G6O A;  2L4R A;  2W27 A;  2YKF A;  4MMN A;  3BY8 A;  4CLC A;  4HI4 A;  1YKD A;  4YWZ A;  4F3L A;  3PHY A;  4HJ6 A;  4BBT A;  3OOV A;  1X0O A;  1YSP A;  3T4J A;  1T1C A;  1Y28 A;  1T19 A;  1UWN X;  3ICY A;  3KO6 A;  2J3T C;  3GEC A;  4UQI S;  4LLO B;  5EFW A;  2VGL S;  3LFV A;  4BWI A;  3BWL A;  3PBT A;  3TRC A;  4L0L A;  3IS2 A;  5C5K A;  3T50 A;  3EWK A;  1S67 L;  2P04 A;  5J4E A;  2WKR A;  3F1P A;  3IBR A;  4JGR A;  2HF6 A;  4Z1W A;  2HV1 A;  3UB9 A;  1H8M A;  2J80 A;  4WUJ A;  3RH8 B;  4UQI M;  3S7P A;  2B18 A;  4WF0 A;  3CIT A;  3LI8 A;  2V1B A;  4CLC E;  1W63 M;  4MDZ A;  1MKM A;  1STZ A;  4GLQ A;  4BBV A;  2VZW A;  4EQ1 A;  1TS8 A;  2O99 A;  5HWW A;  1P9R A;  2LB9 A;  1NWZ A;  1VB6 A;  1ZHH B;  4R6L A;  4EW7 A;  3MQ0 A;  3O5Y A;  2MJ6 A;  3BW6 A;  3ULF A;  1F98 A;  4EUV A;  4KQD A;  4ETZ A;  4CLC C;  4MN7 A;  2V1A A;  5FL3 A;  2QYB A;  2GZA A;  4WL9 A;  1LSW A;  5AVF A;  4YNR A;  3HCY A;  4ARZ B;  3OBF A;  3CUE A;  5HD3 A;  3B33 A;  4Y5F A;  4E04 A;  3HJI A;  5TJJ A;  2A2L A;  4R70 A;  2ZMF A;  4LRY C;  5TBM B;  2HJ9 C;  1TS0 A;  5G4Z A;  5A8B A;  4CLC B;  4WN5 A;  4F3L B;  2Y79 A;  4CLC D;  4Y2F A;  1OT9 A;  4BMW A;  5AVE A;  3U2A A;  3LIA A;  5F6A A;  2QKP A;  3SW1 A;  4MCW A;  4GS9 B;  4WLA A;  2K31 A;  4ETX A;  3H82 A;  3PXP A;  1UGU A;  3H7W A;  1IOU A;  3JVV A;  1F9I A;  3PBO A;  4HJ4 A;  2VLG A;  3NOP C;  3IS2 B;  4M4X A;  2JKR I;  4HOI A;  2W0N A;  3F1P B;  4EEU A;  2VEA A;  3UB6 A;  3OC2 A;  5HL6 A;  1F5M A;  3LI9 A;  4ARZ A;  2J3W A;  2KLI A;  2P7J A;  2W3D A;  3LIB A;  1UWP X;  1N9L A;  5TBM A;  2OWJ A;  4KUK A;  4Y3I A;  5DKK A;  2WKP A;  3KYQ A;  2LB5 A;  3CUE C;  4DJ3 A;  1DP8 A;  1NRJ A;  2JKR M;  4R38 A;  4G3W A;  3F1O B;  4GS9 A;  4OOL A;  4FSF A;  1D06 A;  2EA9 A;  1OTB A;  5IS1 A;  2KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...