1T19A

Early intermediate ie2 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t19A00
5HDSA 4HI4A 3A0SA 3F1PB 4KUOA 4NXFA 1GSVA 4PKYG 4HJ6A 3VE4A 4BBVA 5HZHA 4EEPA 4WN5A 2Z6DA 3LIBA 1T1AA 3H9WA 1OT9A 2JN7A 1BYWA 1LSVA 1S1YA 1S66L 2M1CA 2PYRA 3C8CA 2P7JA 3CWFA 3G6OA 3GECA 3H7WB 2W27A 4HQAA 5G4ZA 5HWTA 2QJ7A 3LIAA 5J3WA 4EETB 3B33A 4GHIA 3LUQA 3GDIA 2VV8A 1LL8A 4I39A 4MN6A 4NXGA 4LPZA 2QHKA 3H82B 4RQ9A 1S4RA 2K7SA 5HD3A 3PYPA 1DRMA 1S4SA 1UWNX 1OT6A 3F1OB 3F1NB 4GW9A 1XJ6A 2VEAA 5DJUA 2VLGA 4KUKA 3MR0A 3K3DA 1XFQA 5KIZA 1T1CA 2CMNA 3C2WA 4KQDA 5HSQA 5F6AA 2V0WA 5G4YA 3UE6A 5HWWA 3NJAA 4EERA 1D7EA 3MFXA 3EWKA 3MQOA 4HHDA 3LYXA 3VE3A 1Y28A 5DJTA 1OTBA 2H28A 2OOLA 2V1BA 2WKQA 2QWSA 3NOUC 1LSXA 1DP6A 4I5SA 2I9VA 4GS9B 2QKPA 4JGQA 5HDCA 2BASA 3BY8A 3PHYA 4R70A 1XJ4A 3CLOA 4LRXC 1LSWA 4WL9A 2V9AA 3HJKA 3NOTC 2YKFA 4BBTA 4EEUA 2B02A 2V0UA 1TS8A 5DKKA 4MN5A 3UB7A 2D01A 2L0WA 2PD7A 2YKHA 1TS7A 3LI9A 1EW0A 1T18A 2QJ5A 5F5YA 1NWZA 4B9OA 3SW1A 3LI8A 1N9OA 3FC7A 1XFNA 3ULFA 1V9ZA 3E4OA 3F1OA 4HH3A 2ZBBA 3D72A 3MQQA 4R3AA 4R38A 3UB6A 4F3LB 2PR6A 3F1PA 4NXEA 1TS6A 1P97A 2R78A 2WKRA 5TBMB 2OWJA 2A24A 3LIEA 3CAXA 4NXBA 2J80A 1V9YA 1UGUA 4HJ3A 4XT2A 1F98A 4H6JB 1OJ5A 3VOLA 4EXOA 5AVFA 1DP8A 3H7WA 4HP4A 2V1AA 1UWPX 5J7EA 1OTEA 3RTYA 3E4QA 4HIAA 5HDDA 4BBUA 3FG8A 3UMEA 5HD5A 2OWHA 2ZOIA 4R6LA 4HY8A 2KDKA 1G28A 2W0NA 1JNUA 3MXQA 3UB8A 2JHEA 4LLOB 3UMDA 1ODVA 4EW7A 2PDRA 1X0OA 4JGRA 5TBMA 4L9GA 4I3IA 2VV6A 3BY9A 4L9EA 1OTIA 4PKYA 4LRZE 2ZOHA 3LIDA 4E04A 1KOUA 3NOPC 2VV7A 4EQ1A 1OJGA 2D02A 1GSWA 4DJ3A 3T50A 5HWVA 4H6JA 5IS1A 4GS9A 3BWLA 3OLOA 3IBRA 1XJ2A 3UB9A 1GSXA 3ZQ5A 3EEHA 2A24B 3A0RA 3E4PA 4GHIB 3HJIA 4I3AA 5I5LA 5IU1A 1T19A 4I3JA 5F68A 1XJ3A 1LT0A 1N9NA 1D06A 3P7NA 4YWZA 1VB6A 4JGPA 4HP9A 1N9LA 4WLAA 1MZUA 3ICYA 4HJ4A 2PYPA 3KX0X 1TS0A 3LIFA 1OTAA 1S67L 2PR5A 3MJQA 2PHYA 1S1ZA 4I38A 4DJ2A 4JGOA 5DKLA 1OTDA 3NHQA 3A0VA 3H82A 4HNBA 2L4RA 3IS2A 4M4XA 3IS2B 5J4EA 2EA9A 4WUJA 1P0ZA 4GCZA 4F3LA 3RH8B 2KX6A 3LICA 1DP9A 2L1MA 2Z6CA 1WA9A 5EFWA 2HV1A 4WF0A 5AVEA 3K3CA 2INWA 4XT2B 1F9IA 5F69A 2WKPA 4L9FA 2GJ3A 4EESA 1T1BA 5A8BA 4HOIA 2PD8A 4LRYC 3F1NA 4K08A 4HH2A
chains in the Genus database with same CATH superfamily
2V1ZA 3VV4A 2GZAA 4CQHA 2PU2A 1YMSA 4ETZA 5J3WA 4WZ4A 5FASA 2OSUA 3VFHA 1YAXA 2HJEA 1BLSA 4LPZA 5HD3A 2XGNA 1K55A 3RXXA 4OQ0A 2IWCA 5GLCA 3NY4A 3MQOA 3LYXA 2OOLA 4JGPA 1DP6A 4I5SA 5M18A 2QKPA 4JF5A 2LB5A 3FYZA 2XEPA 4LRXC 4OOMA 3E2LA 3IHAA 3HLGA 5EM1A 2V0UA 2X02A 4JBFA 2PD7A 3MFDA 4IUHA 3EQVA 1ES2A 3UB6A 1P97A 4HJ3A 4FSFA 1L0EA 1G28A 5FI7A 1P9WA 3DAVA 3LR0A 1YKDA 3BY9A 3BFFA 4OQIA 4R3BA 5IS1A 4H6JA 4P6ZM 3SH9A 4R4RA 5I5LA 2IWDA 4L0LA 3SH7A 1HVBA 1MZUA 5EVLA 3QP2A 1H8MA 3CJMA 3UDIA 1PW1A 5CEBA 1YPRA 4QU3A 3MQ0A 5GL9A 3KSGA 1PFLA 3M6HA 1GA9A 4DMZA 4K08A 2P08A 1SHVA 2WADA 4BBVA 3GQZA 3LIBA 1S1YA 3IXHA 3KSFA 3FWLA 2W1TA 4NXGA 1NYMA 3BM6A 5KIZA 1RGYA 4ZJ2A 3UE6A 5KSCA 4EERA 5K5BA 1Y28A 2OLVA 2H28A 2B95A 4DRTA 1SKOA 4OPRA 1QMFA 4LV3A 3ZCZA 4MN5A 2EX9A 1T18A 3G31A 5E43A 1NXYA 1N9OA 3LR5A 3LR4A 5FI6A 2O0YA 4F3LB 4IVKA 5FQQA 3PBQA 1S6RA 4GOGA 5KSHA 2VX8A 3VFFA 2OWHA 5HAIA 1K4EA 3P01A 2G2UA 4OONA 5TR7A 3CMZA 3LFVA 1K6SA 1D1JA 2FFYA 4CLCD 3P98A 2W3FA 2D02A 4GKUA 4UAAA 2ZJ9A 1XJ2A 3UB9A 3G34A 3QHYA 1I2WA 3NCKA 2O99A 4P6ZS 4DJ2A 1VM1A 1ERMA 3WS4A 3R4KA 3IWIA 3PTEA 4BMWA 4WF0A 4KENB 4RA7A 2PD8A 3ZGAB 4JLFA 4DE3A 2Z6DA 1BYWA 1BLHA 4GHIA 1PWGA 4E3LA 1K4FA 3IXGA 2DCFA 3MR0A 4PHTA 3UO9A 4BQMA 2O9BA 4JF6A 3A3IA 5DF9A 1XJ4A 1WYCA 4C75A 4S2KA 3MMHA 2P9VB 4Y15A 2E8IA 3IHBA 4GJ4A 4MDZA 3R7WB 3MS6A 5A90A 1XFNA 2H0TA 4HH3A 3CI6A 1SCWA 5J8XA 3GMWA 1TS6A 2KOIA 1BZAA 3S7QA 2Y2JA 4G3VA 4OLGA 2Z2MB 3L7HA 5LBRA 5KMWA 1DJAA 3UE0A 3T4JA 1BULA 1KGEA 5HFOA 3LIDA 4E3JA 4IJGA 1L3LA 2XSSA 4QY6A 1NZOA 3E4PA 3L9KA 1KDSA 1E25A 3DBAA 4A5RA 3ZG0A 4KG6A 3P09A 4HBTA 4UQIM 1KGFA 2Y2MA 1AXBA 3H82A 1GCEA 3SS3A 3BFEA 4HOIA 2WZXA 5F82A 4MEZA 4KQOA 1PNEA 3W2ZA 2ZM2A 2W1RA 3IF6A 3CZDA 1KGGA 1WYBA 3JVVA 3IS2A 4WUJA 3S7PA 3IX3A 2P74A 1LL8A 4FUWA 4XUZA 3F1NB 3C2WA 2WKIA 3VSLA 5E2GA 5HWWA 5G18A 3ZG5A 4CLCA 1TD5A 3CHWP 1LI0A 2RL3A 3C5AA 3PHYA 2GX5A 3UPOA 4FTXA 2A3UA 1TS7A 2J7VA 4KZ3A 5L8MA 5FQ9A 3PXPA 2PR6A 1VQQA 3QP6A 3IBJA 3LIEA 3OPHA 5HX9A 2ZQCA 2W3HA 3E4QA 3V67A 4D2OA 1ZTUA 2ZOIA 5I94A 3BLMA 4Y0OA 4O7DA 3IWOA 1ODVA 2VGLM 2CC1A 1KOUA 3IT9A 1STZA 3ZQ5A 4WBGA 1TDGA 4UA9A 3KSHA 2W1TB 1A0KA 5F68A 2JBFA 3IQAA 4H8RA 2Y2HA 1N9LA 3ICYA 1IYPA 2M7UA 1GHMA 4N1XA 4S2MA 3A3EA 5J4EA 3IS2B 1FCMA 2V20A 3LICA 2HJ9C 2L1MA 1WA9A 4S2LA 5EFWA 3I7JA 4GDNA 3K3CA 4DDSA 4L9FA 2JKRI 4R0QA 1AWIA 4LRYC 1OMEA 1DJBA 2B5RA 3F1NA 4HI4A 5GLBA 4MMNA 3EOIA 4K0XA 5CHJA 3NIAA 3W4QA 2EWWA 2DRWA 3B33A 1W5DA 4LCMA 3N7WA 4II7A 1S4RA 2VGKA 3GRJA 4CLCE 1Q2QA 5CHUA 3Q82A 1FCOA 4KQDA 5EVIC 2V0WA 3CPTA 4X55A 3UY6A 2Y2LA 1LSXA 3KO6A 1LSWA 5CTNA 3FPWA 2B02A 3BYDA 4JKTA 3UB7A 4BWIA 2YKHA 4KZ5A 4IUKA 4NK3A 4EUVA 4P87A 1IKGA 2EXBA 4X68A 2EX6A 3GVBA 4OQGA 2VA0A 5FEFA 3OC2A 4X25A 5EOOA 2B18A 4ME4A 4LV1A 2PRFA 4EXOA 1BUEA 3H7WA 1MWTA 2HP6A 3WS5A 4HY8A 4PM6A 2H10A 3N8SA 1ERQA 2QMIA 3SH8A 4ETXA 4N9LA 1H0MA 3A3JA 4I3IA 3IH8A 3CG5A 4PKYA 4LRZE 3NOPC 3HBRA 3UN7A 3IBRA 1GSXA 2PBYA 4GHIB 1KE4A 2Y2GA 3TRCA 2PYPA 2J9PA 1OTAA 4IBRA 4X6TA 4I38A 4DE1A 4RX2A 3QP8A 3C4OA 2INWA 5GHZA 1IEMA 5A8BA 3W4OA 3HREA 3O87A 3VOYA 4DXCA 2QZ6A 1OT9A 3C8CA 2XD5A 1K0KA 3NDEA 3T12B 3B47A 5L07A 3H82B 3KYEA 2K7SA 1ZKJA 2HDRA 2JKTI 1Z6FA 3G2ZA 3G32A 3OPRA 4WZ5A 1KE3A 2WKQA 4NXEA 4Y0UA 3IXDA 4EEUA 1J3WA 3B3XA 1FILA 3FC7A 3ISGA 3EGDC 3MQQA 5A93A 3EQUA 4DDYA 4OOLA 3VSKA 1DP8A 1F2KA 4N9KA 1LI9A 2KDKA 4R3JA 4E3IA 4LLOB 4EW7A 5F1GA 1X0OA 3T1RA 3JVUA 5U47A 2WKHA 3Q07A 1ES4A 5IU1A 1DY6A 3T4SA 3WRTA 3EGXC 4BL2A 3Q81A 2Y2PA 3MJQA 4NETA 4JGOA 4OPQA 2PT7A 5HW3A 4XXRA 3WRZA 3PAEA 2V8CA 3VMAA 2Z6CA 5AVEA 3S7OA 1ES5A 4IEDA 1XX2A 2E8JA 4WM9A 4WN5A 2XR0A 2JKFA 2JN7A 2WGIA 4H6JB 3VOZA 1RGZA 2BLSA 3UNWA 4LFUA 2O9AA 4MCWA 3PYPA 1ALQA 1BTLA 4X56A 1XXMA 3UDXA 4Y0TA 1XA1A 4NG2A 2ZLYA 4QHCA 3DW0A 5HPIA 5DKKA 3C7UA 3D3OA 4OVDA 1SDEA 1I2SA 3WS1A 2WZZA 4KG2A 4KZ4A 3E4OA 4PM7A 3D4FA 4OP8A 4DF6A 4ESPA 1BSGA 2P9VA 1OJ5A 4BLMA 5L09A 1TEMA 2PAVP 1LLBA 3DWZA 3M6BA 3MXQA 3UMDA 2ZMAA 2BTFP 3TE8A 3AGDA 5CGWA 3ZNYA 4YNRA 4X1MA 4ARZA 1CEFA 3NC8A 1IKIA 1W63M 4CPKA 3LGOA 4WLAA 4HJ4A 2H0YA 1TS0A 3MKFA 1RP5A 5E2FA 5FQMA 3SS5A 3PBSA 3RH8B 1DP9A 2HV1A 1K57C 1VHMA 3UE3A 4FD8A 1F9IA 5F69A 3VP3A 4QJGA 3CUEA 4HH2A 4O8GA 5HDSA 3F1PB 1GSVA 1ZG6A 4YFMA 3H7WB 1HD8A 2ZM0A 4Q0IA 1PWDA 3UDFA 4BJPA 4LENA 1CF0A 1UWNX 4Y3IA 2J8YA 1KVLA 1PZOA 1XFQA 3A3FA 5G4YA 4EUZA 4QWOA 4B4ZA 3T1QB 1ZC2A 2QWSA 3EEAA 4OQHA 4JGQA 2ZQ9A 2YKFA 4P0MA 4RYEA 4U0TA 5HL1A 2XD1A 5C5KA 2J3TD 2UV0E 2ZL1B 2XROA 1GA0A 5FI2A 5FQJA 3HLEA 3D72A 3O86A 5HARA 1DJCA 4KZ8A 2XDMA 1LL5A 4OOYA 3JPUA 1UGUA 4ZJ1A 1Y4OA 2JKRM 4UA7A 1CJFA 5M19A 5M1AA 1S0WA 2JHEA 1QMEA 1NLZA 3O3VA 4UA6A 5AQ9A 2ZOHA 4EQ1A 4DJ3A 1KVMA 1L0FA 2HF6A 3NULA 3EEHA 3HJIA 1XJ3A 1M6KA 3IXBA 1WE4A 4OP5A 4G3WA 3KX0X 3LIFA 3LR3A 1CQAA 5DKLA 4N1HA 5DF7A 1P9RA 3O88A 4XT2B 3E2KA 5AJGA 4JXWA 4NXFA 1YLJA 5CRFA 1I5QA 2Y4AA 4Y7PA 3PAGA 3G2YA 3BRMA 1XJ6A 4GZBA 4JF4A 2BG1A 4E6XA 3NJAA 3HLCA 3MFXA 1HTZA 2RCXA 5DJTA 2OLUA 2C5WB 2HDSA 3OZHA 3HJKA 3LEQA 3BFGA 1MBLA 1TVFA 4YINA 3CITA 3LI9A 1IELA 4K0WA 2FFFB 3C38A 1YSPA 3G35A 5EVIA 1MWSA 4GNUA 3LO7A 3OCNA 2WKRA 2A24A 1K25A 5CECA 4BENA 1XPBA 4EV4A 3RTYA 4HBUA 2Q0OA 3AGEA 1JWPA 2R9XA 2ZC3B 1BLCA 2XA7S 4FOFA 5GHYA 2NUTC 4L9EA 1PWCA 5AQBA 2ZC5B 3BQAA 3FZCA 1YSQA 3Q7VA 3BWLA 3OLOA 1MWUA 4GS9A 5FDSA 4I3JA 1LT0A 1NRFA 1D06A 3P7NA 4YWZA 2W3EA 1NZUA 5FDHA 4RX3A 4U0XA 5EVIB 1S67L 3UB5P 1OTDA 4KZ9A 2HDUA 3PBOA 1XKZA 2V8FA 2GDNA 3WS0A 4IVIA 1K54C 3VE4A 4EEPA 5TJJA 3TJZC 1PI4A 4X53A 4NKPA 3RFBA 1FIKA 3GDIA 1SDNA 4MN6A 4HESA 4DN0A 1XA7A 3HLDA 4WEJA 2WAFA 5FEGA 5EE8A 3W4PA 5GHXA 4Y13A 2Z2LB 1FQGA 1FSYA 3IX8A 4HHDA 5FSRA 5HWTA 2I9VA 2WGWA 2V9AA 5FQKA 2K2NA 2A49A 3KYZA 3ZG9B 2L0WA 5A92A 1ZG4A 4UEYA 4G3KA 3OPPA 2V2FF 3LI8A 1V9ZA 4JXSA 4S2JA 5DF8A 4R38A 3BW6A 4EBNA 3HUMA 3ZDJA 4B88A 2WYXA 5AVFA 2MJ6A 1VEUB 4R6LA 3UPPA 1YM1A 3N6IA 5TBMA 3N8LA 2AVXA 1F5MA 1EWZA 3M2JA 5DTKA 4E04A 2EXAA 4EWFA 2WAEA 4Y2FA 3GTCA 1PZPA 4S2NC 3AGFA 4Y5FA 4JXGA 4ZRRA 5IHVA 5D3OA 2XQZA 4M3KA 3CPTB 4MBKA 2Y59A 4QPRA 4F3LA 4MBFA 4FCFA 1YQSA 3BQ8A 2WKPA 4EBPA 4R4SA 5HPFA 5E2HA 3V3RA 4HJ6A 3GV9A 5HZHA 3MKEA 3C7VA 3G6OA 1S66L 4WYYA 1ESUA 2EX8A 1E3UA 1YLTA 2ZQAA 1DRMA 1S4SA 1TF1A 3OCLA 4KUKA 1T1CA 2XLNA 3IF6B 4ZAMA 1FOFA 3VE3A 2GNXA 3BEBA 3BY8A 1NLYA 3IF6C 2XRNA 2W3DA 4P85A 1EW0A 4B9OA 4K91A 4KQRA 1TDLA 1YLZA 5TBMB 2WKEA 2OWJA 2UWXA 3QNBA 4EQIA 3CAXA 4CLCB 4XT2A 2K31A 4HP4A 2Y2IA 4Q0JA 5A91A 3ZNTA 3T1SA 4DXBA 5HDDA 1FR1A 5CERA 3WS2A 4ARZB 1LHYA 1IYQA 2JCHA 1JVJA 5E2EA 3Q7ZA 4LGWA 1MPLA 1OJGA 1GSWA 3UE1A 4B93A 3DTEA 2A24B 4DE0A 2Q9MA 1ESIA 2VKSA 4OPZA 4N92A 2J3WA 5DTTA 2PHYA 1U60A 5HL6A 3A0VA 4GCZA 4OH0A 1MKMA 2X01A 4EU0A 3CUEC 4IHQA 1GHPA 1IYSA 1H8YA 3SZTA 2HZ5A 2M1CA 1K38A 4ZBEA 2KLIA 1SZVA 3JYIA 2J9OA 1OT6A 2VEAA 3W8KA 2O9CA 3GSGA 3FPVA 4O01A 5F1FA 1D7EA 3ZG7B 3HVFA 2V1BA 2Y2NA 3VP4A 5HDCA 3Q7VB 5CTMA 4GS9B 3MZFA 5TFQA 4MN7A 2Y79A 2JE5A 3HUNA 3T4KA 1NWZA 4S2IA 2ZBBA 2ZMFA 2R78A 4GD6A 2OAQ1 4D60A 5EPHA 3M2KA 1NJ4A 5J7EA 2V1AA 3IWQA 5JYOA 4HIAA 5HD5A 1MC0A 4WEKA 1Z09A 3RJUA 1MY8A 2PDRA 4JGRA 4MNRA 2WGWB 5CX7A 2VV6A 1OTIA 2ACGA 4E6WA 4F94A 1PW8A 1T19A 2ZD8A 3PBRA 1K57A 1M40A 4BD1A 3OOVA 1H5XA 1BLPA 1J9MA 3BFDA 3TOIA 2ZM8A 1W79A 5DVAA 3LEZA 4HNBA 4GN2A 4M4XA 1ONHA 3MBZA 1P0ZA 4NEED 2ZMVA 2KX6A 2HP5A 1HZOA 1XP4A 4WMCA 5MC7A 1T1BA 3HUOA 1JWVA 2EWVA 1CK3A 2H5SA 3H9WA 2VK3A 4UHUA 3OBFA 2PYRA 3G4PA 5CEDA 3NBLA 3BECA 4I39A 3NECA 2QHKA 3QP1A 1CI9A 4KZ7A 3F1OB 4GW9A 4JPMA 5DFYA 3S7NA 5FAOA 1OPXA 3ITAA 1YLPA 1N4OA 2PU4A 4O0PA 1K56A 5HAPA 5EV0A 1E3UD 3A3DA 3HLBA 3V50A 4R3AA 1H3QA 4QB8A 3DWKA 3NI9A 1KE0A 1UWPX 3HLWA 5AQ7A 2NUPC 5CHMA 4BBUA 5DTSA 1Y54A 3C4PA 5FA7A 2IWBA 2JKGA 4LV0A 3UB8A 3UPNA 1FSWA 4YOFA 1MWRA 4L9GA 4R1GA 5FQIA 3LCEA 2I72A 2XFTA 4IBXA 3KSIA 2ZL1A 3QNCA 3A0RA 5CGSA 4I3AA 4WMCD 4EBLA 2G7UA 4ZJ3A 2WUQA 1N9NA 1VB6A 4HP9A 3FV7A 3ZVWA 3MF0A 2PR5A 4KZAA 1E4DA 4S2NA 1ZHHB 2EA9A 1JWZA 4GLQA 4QD4A 4OKPA 1O07A 5GLDA 1HLUP 3TSGA 2GJ3A 5DFXA 1W7FA 3A0SA 2DNSA 2XFSA 3PR6A 4KUOA 4PKYG 2OV5A 2FH5A 3BLSA 2IA2A 3HLFA 1G5UA 1LSVA 4ID4A 4Z1WA 2P7JA 5EVID 2QYBA 4EETB 2QJ7A 3LIAA 2P04A 4WELA 3HCYA 1PIOA 3LUQA 3C30A 2VV8A 3K2NA 4JXVA 5EECA 3T4QA 2Y91A 3MZDA 4E3MA 5F6AA 1MKIA 3V5MA 5HSQA 4GB7A 4R23A 4PM9A 3ZYTA 4U3TA 4S2PA 3PBNA 2QPNA 4BBTA 1TS8A 3ZVTA 3VP0A 2D01A 5L10A 2LB9A 4UQIS 1VEUA 3B42A 1L0DA 4S2OA 4ZTKA 3N4IA 3O5YA 1ES3A 1V9YA 3VP1A 2Y8HA 1NRJA 3VOLA 1OTEA 2Y2QA 2VJWA 3FG8A 1K54A 4P6BA 3MZEA 3V39A 5FATA 3ITBA 4X69A 4ZDXA 1G6OA 1L0GA 4PM8A 1CEGA 2VV7A 4C6YA 2R9WA 3KYQA 5CGXA 1W63Q 3TW8A 4KG5A 1L2SA 4RVAA 3SS4A 5L2FA 1JTDA 2Q9NA 3SOIA 1RCJA 1K6RA 5TGFA 1YLYA 2DMWA 1BT5A 4EESA 1NYYA 2ZQ7A 4KZBA 3ULFA 2G2WA 4E3NA 4LCLA 3OPLA 3WWXA 3GECA 5G4ZA 2W27A 4HQAA 3U2AA 1GHIA 5FAPA 2HDQA 1SKFA 5HAQA 4PAUA 2VGJA 1H8ZA 1PRQA 3PBTA 2EFUA 4PMAA 4FH4A 3S4XA 3ZG8B 1IYOA 1OTBA 2ZC6B 2BASA 3CLOA 4WL9A 3ZFZA 5BOHA 3MXRA 2QJ5A 4QY5A 2HP9A 4CJNA 5FL3A 1ACFA 2WGVA 4Y17A 3F1OA 4GD8A 3T4TA 2Y55A 1KDWA 3S1YA 3IX4A 1G6AA 4MBHA 3IF5A 4NXBA 1IFQA 1F98A 2ZQDA 1K56D 2Y2KA 4B4XA 3VP2A 4OLDA 1MXOA 2W0NA 1K55C 1VETA 1Q2PA 5EOEA 4E3OA 2EFXA 1XGJA 4E3KA 4FH2A 3T50A 5IT5A 3U4LP 3BJNA 3T4LA 1YT4A 2X71A 3N8RA 1NY0A 3MSHA 2L4RA 2W3GA 4X1LA 1C3BA 2ZQ8A 1O7EA 4BD0A 1PI5A 2XH9A 3HL9A 3E98A 4LV2A 4GDBA 2J3TC 1W8YA 1T1AA 2A2LA 1SKOB 3NOUC 2OAP1 3CWFA 3RXWA 4C3QA 2JC7A 4KQQA 2VGLS 4KZ6A 4RQ9A 4CLCC 3FKVA 5DJUA 2VLGA 3K3DA 2CMNA 3GR2A 3DTIA 4BL3A 3QP5A 3EWKA 2ZC7A 3FKWA 5JYPA 4XUXA 3NDGA 4R70A 3LY4A 4Q0HA 5FAQA 4MLLA 5AQAA 3NOTC 1EROA 1LL9A 3S22A 4HEFA 5EUAA 5F5YA 3SW1A 5CXWA 1VETB 2HPBA 5GLAA 2JKTM 4DKIA 3F1PA 2J80A 2WK0A 3IH9A 1FCNA 1CI8A 2EX2A 5EVEA 5KZHA 3UMEA 3ZHHA 1JNUA 5F83A 3V3SA 2PBDP 1JTGA 2XF3A 2ZC4B 3T1XA 2HGVA 2FZ0A 3LY3A 1XGIA 2XK1A 5HWVA 5EM0A 4DE2A 4PPRA 3Q1FA 1G68A 1W8QA 4PM5A 4WZ5C 2XA7M 3G30A 1N9BA 4AFIA 1YMXA 3E0YA 3T4OA 3R7WA 3TG9A 3DTMA 4Q8IA 3BFCA 1S1ZA 3DTKA 3NHQA 1EI5A 2VZWA 3D9YA 1IOUA 1PYYA 3MXSA 1ONGA 2Y2OA 1FR6A 1YLWA 3QP4A 4Z9QA 4OPYA 2C6WB 2M7VA
chains in the Genus database with same CATH topology
4HI4A 2EWVA 3VV4A 4NXFA 2GZAA 4MMNA 4CQHA 3H9WA 3EOIA 3OBFA 2PYRA 2EWWA 4ETZA 5J3WA 3B33A 1YAXA 2HJEA 4I39A 4LPZA 4II7A 2QHKA 5HD3A 1S4RA 3F1OB 4GW9A 1XJ6A 4CLCE 5DFYA 4KQDA 2V0WA 3S7NA 3NJAA 3MFXA 3MQOA 3LYXA 5DJTA 2OOLA 4JGPA 1LSXA 1DP6A 1OPXA 3KO6A 4I5SA 2QKPA 2LB5A 4LRXC 1LSWA 4OOMA 3FPWA 3HJKA 2B02A 2V0UA 4O0PA 3UB7A 3CITA 4BWIA 2PD7A 4IUHA 2YKHA 3LI9A 4IUKA 3C38A 1YSPA 3EQVA 4EUVA 3OCNA 4R3AA 2VA0A 3UB6A 3OC2A 1P97A 2WKRA 2B18A 2A24A 1H3QA 4ME4A 4HJ3A 4FSFA 4EXOA 3H7WA 1UWPX 2NUPC 3RTYA 4BBUA 4HY8A 1G28A 3UB8A 4ETXA 2XA7S 1P9WA 4YOFA 4L9GA 3LR0A 4I3IA 4FOFA 1YKDA 2NUTC 3BY9A 4L9EA 4PKYA 4LRZE 3NOPC 3BQAA 5IS1A 4H6JA 1YSQA 3KSIA 4GS9A 3BWLA 3OLOA 3IBRA 4P6ZM 1GSXA 3A0RA 4GHIB 4I3AA 5I5LA 2G7UA 4I3JA 1LT0A 1N9NA 1D06A 3P7NA 4L0LA 4YWZA 2W3EA 1VB6A 4HP9A 3TRCA 1MZUA 2PYPA 1H8MA 1OTAA 3MF0A 1S67L 2PR5A 4I38A 1OTDA 1ZHHB 2EA9A 3MQ0A 4GLQA 3PBOA 3KSGA 2INWA 5A8BA 2GJ3A 5DFXA 4DMZA 4K08A 3A0SA 2P08A 3PR6A 4KUOA 4PKYG 2FH5A 3VE4A 4BBVA 2IA2A 4EEPA 3LIBA 5TJJA 3TJZC 1OT9A 1S1YA 1LSVA 4Z1WA 3C8CA 2P7JA 3KSFA 2QYBA 4EETB 2QJ7A 3LIAA 4NKPA 2P04A 4WELA 3HCYA 3RFBA 3LUQA 3C30A 2W1TA 3GDIA 2VV8A 3B47A 3K2NA 4MN6A 4NXGA 3T4QA 3H82B 4DN0A 2K7SA 5F6AA 4WEJA 2JKTI 5KIZA 5HSQA 3UE6A 4EERA 4HHDA 5K5BA 1Y28A 2H28A 2WKQA 4NXEA 5HWTA 2I9VA 3ZYTA 3PBNA 2V9AA 2K2NA 4BBTA 4EEUA 1TS8A 4MN5A 3KYZA 2D01A 2L0WA 4UEYA 1T18A 2LB9A 4UQIS 4G3KA 3B42A 3LI8A 1N9OA 3FC7A 3LR5A 1V9ZA 3LR4A 2O0YA 3EGDC 3MQQA 4R38A 4F3LB 3BW6A 3EQUA 3O5YA 1V9YA 3PBQA 2Y8HA 4OOLA 1NRJA 3VOLA 5AVFA 1DP8A 1OTEA 5KSHA 2VX8A 2MJ6A 2VJWA 3FG8A 2OWHA 4R6LA 2KDKA 4LLOB 4EW7A 3P01A 1X0OA 5TBMA 3LFVA 1F5MA 1G6OA 4CLCD 4E04A 3JVUA 2VV7A 2W3FA 2D02A 4Y2FA 1XJ2A 3UB9A 4Y5FA 3KYQA 1W63Q 5IU1A 3T4SA 3TW8A 4ZRRA 3EGXC 2O99A 4P6ZS 3MJQA 4DJ2A 4JGOA 2PT7A 4QPRA 4F3LA 3R4KA 2Z6CA 4BMWA 4WF0A 5AVEA 2DMWA 2M7VA 3S7OA 3BQ8A 2WKPA 4EESA 2PD8A 3ULFA 5HPFA 4HJ6A 5HZHA 4WN5A 2Z6DA 2JN7A 1BYWA 3G6OA 1S66L 4H6JB 3GECA 5G4ZA 2W27A 4HQAA 3U2AA 4GHIA 4PAUA 2O9AA 4MCWA 3PYPA 1DRMA 1S4SA 1TF1A 3OCLA 4KUKA 3MR0A 4PHTA 1T1CA 3PBTA 2O9BA 3VE3A 1OTBA 2GNXA 5DF9A 2BASA 1NLYA 3BY8A 1XJ4A 3CLOA 4WL9A 5HPIA 3MMHA 5DKKA 2XRNA 3D3OA 2W3DA 1EW0A 2QJ5A 4GJ4A 4MDZA 3R7WB 4B9OA 5FL3A 1XFNA 3E4OA 3F1OA 3T4TA 4HH3A 3CI6A 1TS6A 5TBMB 2KOIA 2OWJA 3S7QA 3CAXA 4NXBA 4CLCB 1IFQA 1F98A 4G3VA 4XT2A 1OJ5A 2K31A 4HP4A 4Q0JA 5LBRA 5HDDA 3T4JA 2W0NA 4ARZB 3MXQA 3UMDA 3LIDA 1OJGA 1GSWA 4IJGA 3TE8A 3T50A 5IT5A 4B93A 2XSSA 2A24B 3E4PA 3BJNA 4YNRA 3T4LA 4ARZA 3DBAA 2VKSA 1W63M 4WLAA 2J3WA 4HJ4A 4UQIM 1TS0A 2PHYA 5HL6A 3A0VA 3H82A 2L4RA 2W3GA 4GCZA 3PBSA 3RH8B 1DP9A 2HV1A 1VHMA 3UE3A 1F9IA 5F69A 1MKMA 4EU0A 4HOIA 3CUEC 3E98A 4IHQA 3CUEA 4HH2A 4KQOA 4O8GA 5HDSA 3F1PB 3W2ZA 1GSVA 2W1RA 2J3TC 1T1AA 3JVVA 2A2LA 3NOUC 3IS2A 2M1CA 2OAP1 3CWFA 4WUJA 3S7PA 3H7WB 2KLIA 4Q0IA 1LL8A 2VGLS 4RQ9A 4BJPA 4CLCC 1UWNX 3F1NB 1OT6A 4Y3IA 5DJUA 2VEAA 2VLGA 3K3DA 1XFQA 2CMNA 3C2WA 2O9CA 5G4YA 5HWWA 3FPVA 4O01A 1D7EA 3EWKA 4CLCA 1TD5A 2V1BA 2QWSA 3EEAA 5HDCA 4GS9B 4JGQA 3PHYA 4MN7A 2Y79A 4Q0HA 4R70A 2GX5A 3NOTC 2YKFA 5C5KA 2J3TD 1TS7A 2XROA 5F5YA 3SW1A 3T4KA 1NWZA 5L8MA 2ZBBA 3D72A 3PXPA 2JKTM 2ZMFA 2PR6A 3F1PA 2R78A 2OAQ1 3IBJA 3LIEA 2J80A 1UGUA 5J7EA 2V1AA 2JKRM 2W3HA 3E4QA 4HIAA 3V67A 3UMEA 5HD5A 1ZTUA 2ZOIA 1MC0A 1JNUA 2JHEA 1ODVA 1NLZA 4WEKA 2PDRA 2VGLM 4JGRA 2HGVA 2FZ0A 2VV6A 5CX7A 1OTIA 2ZOHA 4EQ1A 1KOUA 4DJ3A 5HWVA 1STZA 2HF6A 3ZQ5A 3EEHA 3KSHA 2W1TB 3HJIA 2XA7M 1T19A 5F68A 1XJ3A 4AFIA 3E0YA 3T4OA 3PBRA 1N9LA 3OOVA 3ICYA 4G3WA 2M7UA 3KX0X 3R7WA 3LIFA 3LR3A 1S1ZA 5DKLA 3NHQA 4HNBA 2VZWA 5J4EA 4M4XA 3IS2B 1P0ZA 4NEED 2ZMVA 2KX6A 1IOUA 3LICA 2HJ9C 2L1MA 1WA9A 5EFWA 1P9RA 3K3CA 4XT2B 5MC7A 4L9FA 5AJGA 1T1BA 2JKRI 4LRYC 3F1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDS A;  4HI4 A;  3A0S A;  3F1P B;  4KUO A;  4NXF A;  1GSV A;  4PKY G;  4HJ6 A;  3VE4 A;  4BBV A;  5HZH A;  4EEP A;  4WN5 A;  2Z6D A;  3LIB A;  1T1A A;  3H9W A;  1OT9 A;  2JN7 A;  1BYW A;  1LSV A;  1S1Y A;  1S66 L;  2M1C A;  2PYR A;  3C8C A;  2P7J A;  3CWF A;  3G6O A;  3GEC A;  3H7W B;  2W27 A;  4HQA A;  5G4Z A;  5HWT A;  2QJ7 A;  3LIA A;  5J3W A;  4EET B;  3B33 A;  4GHI A;  3LUQ A;  3GDI A;  2VV8 A;  1LL8 A;  4I39 A;  4MN6 A;  4NXG A;  4LPZ A;  2QHK A;  3H82 B;  4RQ9 A;  1S4R A;  2K7S A;  5HD3 A;  3PYP A;  1DRM A;  1S4S A;  1UWN X;  1OT6 A;  3F1O B;  3F1N B;  4GW9 A;  1XJ6 A;  2VEA A;  5DJU A;  2VLG A;  4KUK A;  3MR0 A;  3K3D A;  1XFQ A;  5KIZ A;  1T1C A;  2CMN A;  3C2W A;  4KQD A;  5HSQ A;  5F6A A;  2V0W A;  5G4Y A;  3UE6 A;  5HWW A;  3NJA A;  4EER A;  1D7E A;  3MFX A;  3EWK A;  3MQO A;  4HHD A;  3LYX A;  3VE3 A;  1Y28 A;  5DJT A;  1OTB A;  2H28 A;  2OOL A;  2V1B A;  2WKQ A;  2QWS A;  3NOU C;  1LSX A;  1DP6 A;  4I5S A;  2I9V A;  4GS9 B;  2QKP A;  4JGQ A;  5HDC A;  2BAS A;  3BY8 A;  3PHY A;  4R70 A;  1XJ4 A;  3CLO A;  4LRX C;  1LSW A;  4WL9 A;  2V9A A;  3HJK A;  3NOT C;  2YKF A;  4BBT A;  4EEU A;  2B02 A;  2V0U A;  1TS8 A;  5DKK A;  4MN5 A;  3UB7 A;  2D01 A;  2L0W A;  2PD7 A;  2YKH A;  1TS7 A;  3LI9 A;  1EW0 A;  1T18 A;  2QJ5 A;  5F5Y A;  1NWZ A;  4B9O A;  3SW1 A;  3LI8 A;  1N9O A;  3FC7 A;  1XFN A;  3ULF A;  1V9Z A;  3E4O A;  3F1O A;  4HH3 A;  2ZBB A;  3D72 A;  3MQQ A;  4R3A A;  4R38 A;  3UB6 A;  4F3L B;  2PR6 A;  3F1P A;  4NXE A;  1TS6 A;  1P97 A;  2R78 A;  2WKR A;  5TBM B;  2OWJ A;  2A24 A;  3LIE A;  3CAX A;  4NXB A;  2J80 A;  1V9Y A;  1UGU A;  4HJ3 A;  4XT2 A;  1F98 A;  4H6J B;  1OJ5 A;  3VOL A;  4EXO A;  5AVF A;  1DP8 A;  3H7W A;  4HP4 A;  2V1A A;  1UWP X;  5J7E A;  1OTE A;  3RTY A;  3E4Q A;  4HIA A;  5HDD A;  4BBU A;  3FG8 A;  3UME A;  5HD5 A;  2OWH A;  2ZOI A;  4R6L A;  4HY8 A;  2KDK A;  1G28 A;  2W0N A;  1JNU A;  3MXQ A;  3UB8 A;  2JHE A;  4LLO B;  3UMD A;  1ODV A;  4EW7 A;  2PDR A;  1X0O A;  4JGR A;  5TBM A;  4L9G A;  4I3I A;  2VV6 A;  3BY9 A;  4L9E A;  1OTI A;  4PKY A;  4LRZ E;  2ZOH A;  3LID A;  4E04 A;  1KOU A;  3NOP C;  2VV7 A;  4EQ1 A;  1OJG A;  2D02 A;  1GSW A;  4DJ3 A;  3T50 A;  5HWV A;  4H6J A;  5IS1 A;  4GS9 A;  3BWL A;  3OLO A;  3IBR A;  1XJ2 A;  3UB9 A;  1GSX A;  3ZQ5 A;  3EEH A;  2A24 B;  3A0R A;  3E4P A;  4GHI B;  3HJI A;  4I3A A;  5I5L A;  5IU1 A;  1T19 A;  4I3J A;  5F68 A;  1XJ3 A;  1LT0 A;  1N9N A;  1D06 A;  3P7N A;  4YWZ A;  1VB6 A;  4JGP A;  4HP9 A;  1N9L A;  4WLA A;  1MZU A;  3ICY A;  4HJ4 A;  2PYP A;  3KX0 X;  1TS0 A;  3LIF A;  1OTA A;  1S67 L;  2PR5 A;  3MJQ A;  2PHY A;  1S1Z A;  4I38 A;  4DJ2 A;  4JGO A;  5DKL A;  1OTD A;  3NHQ A;  3A0V A;  3H82 A;  4HNB A;  2L4R A;  3IS2 A;  4M4X A;  3IS2 B;  5J4E A;  2EA9 A;  4WUJ A;  1P0Z A;  4GCZ A;  4F3L A;  3RH8 B;  2KX6 A;  3LIC A;  1DP9 A;  2L1M A;  2Z6C A;  1WA9 A;  5EFW A;  2HV1 A;  4WF0 A;  5AVE A;  3K3C A;  2INW A;  4XT2 B;  1F9I A;  5F69 A;  2WKP A;  4L9F A;  2GJ3 A;  4EES A;  1T1B A;  5A8B A;  4HOI A;  2PD8 A;  4LRY C;  3F1N A;  4K08 A;  4HH2 A; 
#chains in the Genus database with same CATH topology
 2V1Z A;  3VV4 A;  2GZA A;  4CQH A;  2PU2 A;  1YMS A;  4ETZ A;  5J3W A;  4WZ4 A;  5FAS A;  2OSU A;  3VFH A;  1YAX A;  2HJE A;  1BLS A;  4LPZ A;  5HD3 A;  2XGN A;  1K55 A;  3RXX A;  4OQ0 A;  2IWC A;  5GLC A;  3NY4 A;  3MQO A;  3LYX A;  2OOL A;  4JGP A;  1DP6 A;  4I5S A;  5M18 A;  2QKP A;  4JF5 A;  2LB5 A;  3FYZ A;  2XEP A;  4LRX C;  4OOM A;  3E2L A;  3IHA A;  3HLG A;  5EM1 A;  2V0U A;  2X02 A;  4JBF A;  2PD7 A;  3MFD A;  4IUH A;  3EQV A;  1ES2 A;  3UB6 A;  1P97 A;  4HJ3 A;  4FSF A;  1L0E A;  1G28 A;  5FI7 A;  1P9W A;  3DAV A;  3LR0 A;  1YKD A;  3BY9 A;  3BFF A;  4OQI A;  4R3B A;  5IS1 A;  4H6J A;  4P6Z M;  3SH9 A;  4R4R A;  5I5L A;  2IWD A;  4L0L A;  3SH7 A;  1HVB A;  1MZU A;  5EVL A;  3QP2 A;  1H8M A;  3CJM A;  3UDI A;  1PW1 A;  5CEB A;  1YPR A;  4QU3 A;  3MQ0 A;  5GL9 A;  3KSG A;  1PFL A;  3M6H A;  1GA9 A;  4DMZ A;  4K08 A;  2P08 A;  1SHV A;  2WAD A;  4BBV A;  3GQZ A;  3LIB A;  1S1Y A;  3IXH A;  3KSF A;  3FWL A;  2W1T A;  4NXG A;  1NYM A;  3BM6 A;  5KIZ A;  1RGY A;  4ZJ2 A;  3UE6 A;  5KSC A;  4EER A;  5K5B A;  1Y28 A;  2OLV A;  2H28 A;  2B95 A;  4DRT A;  1SKO A;  4OPR A;  1QMF A;  4LV3 A;  3ZCZ A;  4MN5 A;  2EX9 A;  1T18 A;  3G31 A;  5E43 A;  1NXY A;  1N9O A;  3LR5 A;  3LR4 A;  5FI6 A;  2O0Y A;  4F3L B;  4IVK A;  5FQQ A;  3PBQ A;  1S6R A;  4GOG A;  5KSH A;  2VX8 A;  3VFF A;  2OWH A;  5HAI A;  1K4E A;  3P01 A;  2G2U A;  4OON A;  5TR7 A;  3CMZ A;  3LFV A;  1K6S A;  1D1J A;  2FFY A;  4CLC D;  3P98 A;  2W3F A;  2D02 A;  4GKU A;  4UAA A;  2ZJ9 A;  1XJ2 A;  3UB9 A;  3G34 A;  3QHY A;  1I2W A;  3NCK A;  2O99 A;  4P6Z S;  4DJ2 A;  1VM1 A;  1ERM A;  3WS4 A;  3R4K A;  3IWI A;  3PTE A;  4BMW A;  4WF0 A;  4KEN B;  4RA7 A;  2PD8 A;  3ZGA B;  4JLF A;  4DE3 A;  2Z6D A;  1BYW A;  1BLH A;  4GHI A;  1PWG A;  4E3L A;  1K4F A;  3IXG A;  2DCF A;  3MR0 A;  4PHT A;  3UO9 A;  4BQM A;  2O9B A;  4JF6 A;  3A3I A;  5DF9 A;  1XJ4 A;  1WYC A;  4C75 A;  4S2K A;  3MMH A;  2P9V B;  4Y15 A;  2E8I A;  3IHB A;  4GJ4 A;  4MDZ A;  3R7W B;  3MS6 A;  5A90 A;  1XFN A;  2H0T A;  4HH3 A;  3CI6 A;  1SCW A;  5J8X A;  3GMW A;  1TS6 A;  2KOI A;  1BZA A;  3S7Q A;  2Y2J A;  4G3V A;  4OLG A;  2Z2M B;  3L7H A;  5LBR A;  5KMW A;  1DJA A;  3UE0 A;  3T4J A;  1BUL A;  1KGE A;  5HFO A;  3LID A;  4E3J A;  4IJG A;  1L3L A;  2XSS A;  4QY6 A;  1NZO A;  3E4P A;  3L9K A;  1KDS A;  1E25 A;  3DBA A;  4A5R A;  3ZG0 A;  4KG6 A;  3P09 A;  4HBT A;  4UQI M;  1KGF A;  2Y2M A;  1AXB A;  3H82 A;  1GCE A;  3SS3 A;  3BFE A;  4HOI A;  2WZX A;  5F82 A;  4MEZ A;  4KQO A;  1PNE A;  3W2Z A;  2ZM2 A;  2W1R A;  3IF6 A;  3CZD A;  1KGG A;  1WYB A;  3JVV A;  3IS2 A;  4WUJ A;  3S7P A;  3IX3 A;  2P74 A;  1LL8 A;  4FUW A;  4XUZ A;  3F1N B;  3C2W A;  2WKI A;  3VSL A;  5E2G A;  5HWW A;  5G18 A;  3ZG5 A;  4CLC A;  1TD5 A;  3CHW P;  1LI0 A;  2RL3 A;  3C5A A;  3PHY A;  2GX5 A;  3UPO A;  4FTX A;  2A3U A;  1TS7 A;  2J7V A;  4KZ3 A;  5L8M A;  5FQ9 A;  3PXP A;  2PR6 A;  1VQQ A;  3QP6 A;  3IBJ A;  3LIE A;  3OPH A;  5HX9 A;  2ZQC A;  2W3H A;  3E4Q A;  3V67 A;  4D2O A;  1ZTU A;  2ZOI A;  5I94 A;  3BLM A;  4Y0O A;  4O7D A;  3IWO A;  1ODV A;  2VGL M;  2CC1 A;  1KOU A;  3IT9 A;  1STZ A;  3ZQ5 A;  4WBG A;  1TDG A;  4UA9 A;  3KSH A;  2W1T B;  1A0K A;  5F68 A;  2JBF A;  3IQA A;  4H8R A;  2Y2H A;  1N9L A;  3ICY A;  1IYP A;  2M7U A;  1GHM A;  4N1X A;  4S2M A;  3A3E A;  5J4E A;  3IS2 B;  1FCM A;  2V20 A;  3LIC A;  2HJ9 C;  2L1M A;  1WA9 A;  4S2L A;  5EFW A;  3I7J A;  4GDN A;  3K3C A;  4DDS A;  4L9F A;  2JKR I;  4R0Q A;  1AWI A;  4LRY C;  1OME A;  1DJB A;  2B5R A;  3F1N A;  4HI4 A;  5GLB A;  4MMN A;  3EOI A;  4K0X A;  5CHJ A;  3NIA A;  3W4Q A;  2EWW A;  2DRW A;  3B33 A;  1W5D A;  4LCM A;  3N7W A;  4II7 A;  1S4R A;  2VGK A;  3GRJ A;  4CLC E;  1Q2Q A;  5CHU A;  3Q82 A;  1FCO A;  4KQD A;  5EVI C;  2V0W A;  3CPT A;  4X55 A;  3UY6 A;  2Y2L A;  1LSX A;  3KO6 A;  1LSW A;  5CTN A;  3FPW A;  2B02 A;  3BYD A;  4JKT A;  3UB7 A;  4BWI A;  2YKH A;  4KZ5 A;  4IUK A;  4NK3 A;  4EUV A;  4P87 A;  1IKG A;  2EXB A;  4X68 A;  2EX6 A;  3GVB A;  4OQG A;  2VA0 A;  5FEF A;  3OC2 A;  4X25 A;  5EOO A;  2B18 A;  4ME4 A;  4LV1 A;  2PRF A;  4EXO A;  1BUE A;  3H7W A;  1MWT A;  2HP6 A;  3WS5 A;  4HY8 A;  4PM6 A;  2H10 A;  3N8S A;  1ERQ A;  2QMI A;  3SH8 A;  4ETX A;  4N9L A;  1H0M A;  3A3J A;  4I3I A;  3IH8 A;  3CG5 A;  4PKY A;  4LRZ E;  3NOP C;  3HBR A;  3UN7 A;  3IBR A;  1GSX A;  2PBY A;  4GHI B;  1KE4 A;  2Y2G A;  3TRC A;  2PYP A;  2J9P A;  1OTA A;  4IBR A;  4X6T A;  4I38 A;  4DE1 A;  4RX2 A;  3QP8 A;  3C4O A;  2INW A;  5GHZ A;  1IEM A;  5A8B A;  3W4O A;  3HRE A;  3O87 A;  3VOY A;  4DXC A;  2QZ6 A;  1OT9 A;  3C8C A;  2XD5 A;  1K0K A;  3NDE A;  3T12 B;  3B47 A;  5L07 A;  3H82 B;  3KYE A;  2K7S A;  1ZKJ A;  2HDR A;  2JKT I;  1Z6F A;  3G2Z A;  3G32 A;  3OPR A;  4WZ5 A;  1KE3 A;  2WKQ A;  4NXE A;  4Y0U A;  3IXD A;  4EEU A;  1J3W A;  3B3X A;  1FIL A;  3FC7 A;  3ISG A;  3EGD C;  3MQQ A;  5A93 A;  3EQU A;  4DDY A;  4OOL A;  3VSK A;  1DP8 A;  1F2K A;  4N9K A;  1LI9 A;  2KDK A;  4R3J A;  4E3I A;  4LLO B;  4EW7 A;  5F1G A;  1X0O A;  3T1R A;  3JVU A;  5U47 A;  2WKH A;  3Q07 A;  1ES4 A;  5IU1 A;  1DY6 A;  3T4S A;  3WRT A;  3EGX C;  4BL2 A;  3Q81 A;  2Y2P A;  3MJQ A;  4NET A;  4JGO A;  4OPQ A;  2PT7 A;  5HW3 A;  4XXR A;  3WRZ A;  3PAE A;  2V8C A;  3VMA A;  2Z6C A;  5AVE A;  3S7O A;  1ES5 A;  4IED A;  1XX2 A;  2E8J A;  4WM9 A;  4WN5 A;  2XR0 A;  2JKF A;  2JN7 A;  2WGI A;  4H6J B;  3VOZ A;  1RGZ A;  2BLS A;  3UNW A;  4LFU A;  2O9A A;  4MCW A;  3PYP A;  1ALQ A;  1BTL A;  4X56 A;  1XXM A;  3UDX A;  4Y0T A;  1XA1 A;  4NG2 A;  2ZLY A;  4QHC A;  3DW0 A;  5HPI A;  5DKK A;  3C7U A;  3D3O A;  4OVD A;  1SDE A;  1I2S A;  3WS1 A;  2WZZ A;  4KG2 A;  4KZ4 A;  3E4O A;  4PM7 A;  3D4F A;  4OP8 A;  4DF6 A;  4ESP A;  1BSG A;  2P9V A;  1OJ5 A;  4BLM A;  5L09 A;  1TEM A;  2PAV P;  1LLB A;  3DWZ A;  3M6B A;  3MXQ A;  3UMD A;  2ZMA A;  2BTF P;  3TE8 A;  3AGD A;  5CGW A;  3ZNY A;  4YNR A;  4X1M A;  4ARZ A;  1CEF A;  3NC8 A;  1IKI A;  1W63 M;  4CPK A;  3LGO A;  4WLA A;  4HJ4 A;  2H0Y A;  1TS0 A;  3MKF A;  1RP5 A;  5E2F A;  5FQM A;  3SS5 A;  3PBS A;  3RH8 B;  1DP9 A;  2HV1 A;  1K57 C;  1VHM A;  3UE3 A;  4FD8 A;  1F9I A;  5F69 A;  3VP3 A;  4QJG A;  3CUE A;  4HH2 A;  4O8G A;  5HDS A;  3F1P B;  1GSV A;  1ZG6 A;  4YFM A;  3H7W B;  1HD8 A;  2ZM0 A;  4Q0I A;  1PWD A;  3UDF A;  4BJP A;  4LEN A;  1CF0 A;  1UWN X;  4Y3I A;  2J8Y A;  1KVL A;  1PZO A;  1XFQ A;  3A3F A;  5G4Y A;  4EUZ A;  4QWO A;  4B4Z A;  3T1Q B;  1ZC2 A;  2QWS A;  3EEA A;  4OQH A;  4JGQ A;  2ZQ9 A;  2YKF A;  4P0M A;  4RYE A;  4U0T A;  5HL1 A;  2XD1 A;  5C5K A;  2J3T D;  2UV0 E;  2ZL1 B;  2XRO A;  1GA0 A;  5FI2 A;  5FQJ A;  3HLE A;  3D72 A;  3O86 A;  5HAR A;  1DJC A;  4KZ8 A;  2XDM A;  1LL5 A;  4OOY A;  3JPU A;  1UGU A;  4ZJ1 A;  1Y4O A;  2JKR M;  4UA7 A;  1CJF A;  5M19 A;  5M1A A;  1S0W A;  2JHE A;  1QME A;  1NLZ A;  3O3V A;  4UA6 A;  5AQ9 A;  2ZOH A;  4EQ1 A;  4DJ3 A;  1KVM A;  1L0F A;  2HF6 A;  3NUL A;  3EEH A;  3HJI A;  1XJ3 A;  1M6K A;  3IXB A;  1WE4 A;  4OP5 A;  4G3W A;  3KX0 X;  3LIF A;  3LR3 A;  1CQA A;  5DKL A;  4N1H A;  5DF7 A;  1P9R A;  3O88 A;  4XT2 B;  3E2K A;  5AJG A;  4JXW A;  4NXF A;  1YLJ A;  5CRF A;  1I5Q A;  2Y4A A;  4Y7P A;  3PAG A;  3G2Y A;  3BRM A;  1XJ6 A;  4GZB A;  4JF4 A;  2BG1 A;  4E6X A;  3NJA A;  3HLC A;  3MFX A;  1HTZ A;  2RCX A;  5DJT A;  2OLU A;  2C5W B;  2HDS A;  3OZH A;  3HJK A;  3LEQ A;  3BFG A;  1MBL A;  1TVF A;  4YIN A;  3CIT A;  3LI9 A;  1IEL A;  4K0W A;  2FFF B;  3C38 A;  1YSP A;  3G35 A;  5EVI A;  1MWS A;  4GNU A;  3LO7 A;  3OCN A;  2WKR A;  2A24 A;  1K25 A;  5CEC A;  4BEN A;  1XPB A;  4EV4 A;  3RTY A;  4HBU A;  2Q0O A;  3AGE A;  1JWP A;  2R9X A;  2ZC3 B;  1BLC A;  2XA7 S;  4FOF A;  5GHY A;  2NUT C;  4L9E A;  1PWC A;  5AQB A;  2ZC5 B;  3BQA A;  3FZC A;  1YSQ A;  3Q7V A;  3BWL A;  3OLO A;  1MWU A;  4GS9 A;  5FDS A;  4I3J A;  1LT0 A;  1NRF A;  1D06 A;  3P7N A;  4YWZ A;  2W3E A;  1NZU A;  5FDH A;  4RX3 A;  4U0X A;  5EVI B;  1S67 L;  3UB5 P;  1OTD A;  4KZ9 A;  2HDU A;  3PBO A;  1XKZ A;  2V8F A;  2GDN A;  3WS0 A;  4IVI A;  1K54 C;  3VE4 A;  4EEP A;  5TJJ A;  3TJZ C;  1PI4 A;  4X53 A;  4NKP A;  3RFB A;  1FIK A;  3GDI A;  1SDN A;  4MN6 A;  4HES A;  4DN0 A;  1XA7 A;  3HLD A;  4WEJ A;  2WAF A;  5FEG A;  5EE8 A;  3W4P A;  5GHX A;  4Y13 A;  2Z2L B;  1FQG A;  1FSY A;  3IX8 A;  4HHD A;  5FSR A;  5HWT A;  2I9V A;  2WGW A;  2V9A A;  5FQK A;  2K2N A;  2A49 A;  3KYZ A;  3ZG9 B;  2L0W A;  5A92 A;  1ZG4 A;  4UEY A;  4G3K A;  3OPP A;  2V2F F;  3LI8 A;  1V9Z A;  4JXS A;  4S2J A;  5DF8 A;  4R38 A;  3BW6 A;  4EBN A;  3HUM A;  3ZDJ A;  4B88 A;  2WYX A;  5AVF A;  2MJ6 A;  1VEU B;  4R6L A;  3UPP A;  1YM1 A;  3N6I A;  5TBM A;  3N8L A;  2AVX A;  1F5M A;  1EWZ A;  3M2J A;  5DTK A;  4E04 A;  2EXA A;  4EWF A;  2WAE A;  4Y2F A;  3GTC A;  1PZP A;  4S2N C;  3AGF A;  4Y5F A;  4JXG A;  4ZRR A;  5IHV A;  5D3O A;  2XQZ A;  4M3K A;  3CPT B;  4MBK A;  2Y59 A;  4QPR A;  4F3L A;  4MBF A;  4FCF A;  1YQS A;  3BQ8 A;  2WKP A;  4EBP A;  4R4S A;  5HPF A;  5E2H A;  3V3R A;  4HJ6 A;  3GV9 A;  5HZH A;  3MKE A;  3C7V A;  3G6O A;  1S66 L;  4WYY A;  1ESU A;  2EX8 A;  1E3U A;  1YLT A;  2ZQA A;  1DRM A;  1S4S A;  1TF1 A;  3OCL A;  4KUK A;  1T1C A;  2XLN A;  3IF6 B;  4ZAM A;  1FOF A;  3VE3 A;  2GNX A;  3BEB A;  3BY8 A;  1NLY A;  3IF6 C;  2XRN A;  2W3D A;  4P85 A;  1EW0 A;  4B9O A;  4K91 A;  4KQR A;  1TDL A;  1YLZ A;  5TBM B;  2WKE A;  2OWJ A;  2UWX A;  3QNB A;  4EQI A;  3CAX A;  4CLC B;  4XT2 A;  2K31 A;  4HP4 A;  2Y2I A;  4Q0J A;  5A91 A;  3ZNT A;  3T1S A;  4DXB A;  5HDD A;  1FR1 A;  5CER A;  3WS2 A;  4ARZ B;  1LHY A;  1IYQ A;  2JCH A;  1JVJ A;  5E2E A;  3Q7Z A;  4LGW A;  1MPL A;  1OJG A;  1GSW A;  3UE1 A;  4B93 A;  3DTE A;  2A24 B;  4DE0 A;  2Q9M A;  1ESI A;  2VKS A;  4OPZ A;  4N92 A;  2J3W A;  5DTT A;  2PHY A;  1U60 A;  5HL6 A;  3A0V A;  4GCZ A;  4OH0 A;  1MKM A;  2X01 A;  4EU0 A;  3CUE C;  4IHQ A;  1GHP A;  1IYS A;  1H8Y A;  3SZT A;  2HZ5 A;  2M1C A;  1K38 A;  4ZBE A;  2KLI A;  1SZV A;  3JYI A;  2J9O A;  1OT6 A;  2VEA A;  3W8K A;  2O9C A;  3GSG A;  3FPV A;  4O01 A;  5F1F A;  1D7E A;  3ZG7 B;  3HVF A;  2V1B A;  2Y2N A;  3VP4 A;  5HDC A;  3Q7V B;  5CTM A;  4GS9 B;  3MZF A;  5TFQ A;  4MN7 A;  2Y79 A;  2JE5 A;  3HUN A;  3T4K A;  1NWZ A;  4S2I A;  2ZBB A;  2ZMF A;  2R78 A;  4GD6 A;  2OAQ 1;  4D60 A;  5EPH A;  3M2K A;  1NJ4 A;  5J7E A;  2V1A A;  3IWQ A;  5JYO A;  4HIA A;  5HD5 A;  1MC0 A;  4WEK A;  1Z09 A;  3RJU A;  1MY8 A;  2PDR A;  4JGR A;  4MNR A;  2WGW B;  5CX7 A;  2VV6 A;  1OTI A;  2ACG A;  4E6W A;  4F94 A;  1PW8 A;  1T19 A;  2ZD8 A;  3PBR A;  1K57 A;  1M40 A;  4BD1 A;  3OOV A;  1H5X A;  1BLP A;  1J9M A;  3BFD A;  3TOI A;  2ZM8 A;  1W79 A;  5DVA A;  3LEZ A;  4HNB A;  4GN2 A;  4M4X A;  1ONH A;  3MBZ A;  1P0Z A;  4NEE D;  2ZMV A;  2KX6 A;  2HP5 A;  1HZO A;  1XP4 A;  4WMC A;  5MC7 A;  1T1B A;  3HUO A;  1JWV A;  2EWV A;  1CK3 A;  2H5S A;  3H9W A;  2VK3 A;  4UHU A;  3OBF A;  2PYR A;  3G4P A;  5CED A;  3NBL A;  3BEC A;  4I39 A;  3NEC A;  2QHK A;  3QP1 A;  1CI9 A;  4KZ7 A;  3F1O B;  4GW9 A;  4JPM A;  5DFY A;  3S7N A;  5FAO A;  1OPX A;  3ITA A;  1YLP A;  1N4O A;  2PU4 A;  4O0P A;  1K56 A;  5HAP A;  5EV0 A;  1E3U D;  3A3D A;  3HLB A;  3V50 A;  4R3A A;  1H3Q A;  4QB8 A;  3DWK A;  3NI9 A;  1KE0 A;  1UWP X;  3HLW A;  5AQ7 A;  2NUP C;  5CHM A;  4BBU A;  5DTS A;  1Y54 A;  3C4P A;  5FA7 A;  2IWB A;  2JKG A;  4LV0 A;  3UB8 A;  3UPN A;  1FSW A;  4YOF A;  1MWR A;  4L9G A;  4R1G A;  5FQI A;  3LCE A;  2I72 A;  2XFT A;  4IBX A;  3KSI A;  2ZL1 A;  3QNC A;  3A0R A;  5CGS A;  4I3A A;  4WMC D;  4EBL A;  2G7U A;  4ZJ3 A;  2WUQ A;  1N9N A;  1VB6 A;  4HP9 A;  3FV7 A;  3ZVW A;  3MF0 A;  2PR5 A;  4KZA A;  1E4D A;  4S2N A;  1ZHH B;  2EA9 A;  1JWZ A;  4GLQ A;  4QD4 A;  4OKP A;  1O07 A;  5GLD A;  1HLU P;  3TSG A;  2GJ3 A;  5DFX A;  1W7F A;  3A0S A;  2DNS A;  2XFS A;  3PR6 A;  4KUO A;  4PKY G;  2OV5 A;  2FH5 A;  3BLS A;  2IA2 A;  3HLF A;  1G5U A;  1LSV A;  4ID4 A;  4Z1W A;  2P7J A;  5EVI D;  2QYB A;  4EET B;  2QJ7 A;  3LIA A;  2P04 A;  4WEL A;  3HCY A;  1PIO A;  3LUQ A;  3C30 A;  2VV8 A;  3K2N A;  4JXV A;  5EEC A;  3T4Q A;  2Y91 A;  3MZD A;  4E3M A;  5F6A A;  1MKI A;  3V5M A;  5HSQ A;  4GB7 A;  4R23 A;  4PM9 A;  3ZYT A;  4U3T A;  4S2P A;  3PBN A;  2QPN A;  4BBT A;  1TS8 A;  3ZVT A;  3VP0 A;  2D01 A;  5L10 A;  2LB9 A;  4UQI S;  1VEU A;  3B42 A;  1L0D A;  4S2O A;  4ZTK A;  3N4I A;  3O5Y A;  1ES3 A;  1V9Y A;  3VP1 A;  2Y8H A;  1NRJ A;  3VOL A;  1OTE A;  2Y2Q A;  2VJW A;  3FG8 A;  1K54 A;  4P6B A;  3MZE A;  3V39 A;  5FAT A;  3ITB A;  4X69 A;  4ZDX A;  1G6O A;  1L0G A;  4PM8 A;  1CEG A;  2VV7 A;  4C6Y A;  2R9W A;  3KYQ A;  5CGX A;  1W63 Q;  3TW8 A;  4KG5 A;  1L2S A;  4RVA A;  3SS4 A;  5L2F A;  1JTD A;  2Q9N A;  3SOI A;  1RCJ A;  1K6R A;  5TGF A;  1YLY A;  2DMW A;  1BT5 A;  4EES A;  1NYY A;  2ZQ7 A;  4KZB A;  3ULF A;  2G2W A;  4E3N A;  4LCL A;  3OPL A;  3WWX A;  3GEC A;  5G4Z A;  2W27 A;  4HQA A;  3U2A A;  1GHI A;  5FAP A;  2HDQ A;  1SKF A;  5HAQ A;  4PAU A;  2VGJ A;  1H8Z A;  1PRQ A;  3PBT A;  2EFU A;  4PMA A;  4FH4 A;  3S4X A;  3ZG8 B;  1IYO A;  1OTB A;  2ZC6 B;  2BAS A;  3CLO A;  4WL9 A;  3ZFZ A;  5BOH A;  3MXR A;  2QJ5 A;  4QY5 A;  2HP9 A;  4CJN A;  5FL3 A;  1ACF A;  2WGV A;  4Y17 A;  3F1O A;  4GD8 A;  3T4T A;  2Y55 A;  1KDW A;  3S1Y A;  3IX4 A;  1G6A A;  4MBH A;  3IF5 A;  4NXB A;  1IFQ A;  1F98 A;  2ZQD A;  1K56 D;  2Y2K A;  4B4X A;  3VP2 A;  4OLD A;  1MXO A;  2W0N A;  1K55 C;  1VET A;  1Q2P A;  5EOE A;  4E3O A;  2EFX A;  1XGJ A;  4E3K A;  4FH2 A;  3T50 A;  5IT5 A;  3U4L P;  3BJN A;  3T4L A;  1YT4 A;  2X71 A;  3N8R A;  1NY0 A;  3MSH A;  2L4R A;  2W3G A;  4X1L A;  1C3B A;  2ZQ8 A;  1O7E A;  4BD0 A;  1PI5 A;  2XH9 A;  3HL9 A;  3E98 A;  4LV2 A;  4GDB A;  2J3T C;  1W8Y A;  1T1A A;  2A2L A;  1SKO B;  3NOU C;  2OAP 1;  3CWF A;  3RXW A;  4C3Q A;  2JC7 A;  4KQQ A;  2VGL S;  4KZ6 A;  4RQ9 A;  4CLC C;  3FKV A;  5DJU A;  2VLG A;  3K3D A;  2CMN A;  3GR2 A;  3DTI A;  4BL3 A;  3QP5 A;  3EWK A;  2ZC7 A;  3FKW A;  5JYP A;  4XUX A;  3NDG A;  4R70 A;  3LY4 A;  4Q0H A;  5FAQ A;  4MLL A;  5AQA A;  3NOT C;  1ERO A;  1LL9 A;  3S22 A;  4HEF A;  5EUA A;  5F5Y A;  3SW1 A;  5CXW A;  1VET B;  2HPB A;  5GLA A;  2JKT M;  4DKI A;  3F1P A;  2J80 A;  2WK0 A;  3IH9 A;  1FCN A;  1CI8 A;  2EX2 A;  5EVE A;  5KZH A;  3UME A;  3ZHH A;  1JNU A;  5F83 A;  3V3S A;  2PBD P;  1JTG A;  2XF3 A;  2ZC4 B;  3T1X A;  2HGV A;  2FZ0 A;  3LY3 A;  1XGI A;  2XK1 A;  5HWV A;  5EM0 A;  4DE2 A;  4PPR A;  3Q1F A;  1G68 A;  1W8Q A;  4PM5 A;  4WZ5 C;  2XA7 M;  3G30 A;  1N9B A;  4AFI A;  1YMX A;  3E0Y A;  3T4O A;  3R7W A;  3TG9 A;  3DTM A;  4Q8I A;  3BFC A;  1S1Z A;  3DTK A;  3NHQ A;  1EI5 A;  2VZW A;  3D9Y A;  1IOU A;  1PYY A;  3MXS A;  1ONG A;  2Y2O A;  1FR6 A;  1YLW A;  3QP4 A;  4Z9Q A;  4OPY A;  2C6W B;  2M7V A; 
#chains in the Genus database with same CATH homology
 4HI4 A;  2EWV A;  3VV4 A;  4NXF A;  2GZA A;  4MMN A;  4CQH A;  3H9W A;  3EOI A;  3OBF A;  2PYR A;  2EWW A;  4ETZ A;  5J3W A;  3B33 A;  1YAX A;  2HJE A;  4I39 A;  4LPZ A;  4II7 A;  2QHK A;  5HD3 A;  1S4R A;  3F1O B;  4GW9 A;  1XJ6 A;  4CLC E;  5DFY A;  4KQD A;  2V0W A;  3S7N A;  3NJA A;  3MFX A;  3MQO A;  3LYX A;  5DJT A;  2OOL A;  4JGP A;  1LSX A;  1DP6 A;  1OPX A;  3KO6 A;  4I5S A;  2QKP A;  2LB5 A;  4LRX C;  1LSW A;  4OOM A;  3FPW A;  3HJK A;  2B02 A;  2V0U A;  4O0P A;  3UB7 A;  3CIT A;  4BWI A;  2PD7 A;  4IUH A;  2YKH A;  3LI9 A;  4IUK A;  3C38 A;  1YSP A;  3EQV A;  4EUV A;  3OCN A;  4R3A A;  2VA0 A;  3UB6 A;  3OC2 A;  1P97 A;  2WKR A;  2B18 A;  2A24 A;  1H3Q A;  4ME4 A;  4HJ3 A;  4FSF A;  4EXO A;  3H7W A;  1UWP X;  2NUP C;  3RTY A;  4BBU A;  4HY8 A;  1G28 A;  3UB8 A;  4ETX A;  2XA7 S;  1P9W A;  4YOF A;  4L9G A;  3LR0 A;  4I3I A;  4FOF A;  1YKD A;  2NUT C;  3BY9 A;  4L9E A;  4PKY A;  4LRZ E;  3NOP C;  3BQA A;  5IS1 A;  4H6J A;  1YSQ A;  3KSI A;  4GS9 A;  3BWL A;  3OLO A;  3IBR A;  4P6Z M;  1GSX A;  3A0R A;  4GHI B;  4I3A A;  5I5L A;  2G7U A;  4I3J A;  1LT0 A;  1N9N A;  1D06 A;  3P7N A;  4L0L A;  4YWZ A;  2W3E A;  1VB6 A;  4HP9 A;  3TRC A;  1MZU A;  2PYP A;  1H8M A;  1OTA A;  3MF0 A;  1S67 L;  2PR5 A;  4I38 A;  1OTD A;  1ZHH B;  2EA9 A;  3MQ0 A;  4GLQ A;  3PBO A;  3KSG A;  2INW A;  5A8B A;  2GJ3 A;  5DFX A;  4DMZ A;  4K08 A;  3A0S A;  2P08 A;  3PR6 A;  4KUO A;  4PKY G;  2FH5 A;  3VE4 A;  4BBV A;  2IA2 A;  4EEP A;  3LIB A;  5TJJ A;  3TJZ C;  1OT9 A;  1S1Y A;  1LSV A;  4Z1W A;  3C8C A;  2P7J A;  3KSF A;  2QYB A;  4EET B;  2QJ7 A;  3LIA A;  4NKP A;  2P04 A;  4WEL A;  3HCY A;  3RFB A;  3LUQ A;  3C30 A;  2W1T A;  3GDI A;  2VV8 A;  3B47 A;  3K2N A;  4MN6 A;  4NXG A;  3T4Q A;  3H82 B;  4DN0 A;  2K7S A;  5F6A A;  4WEJ A;  2JKT I;  5KIZ A;  5HSQ A;  3UE6 A;  4EER A;  4HHD A;  5K5B A;  1Y28 A;  2H28 A;  2WKQ A;  4NXE A;  5HWT A;  2I9V A;  3ZYT A;  3PBN A;  2V9A A;  2K2N A;  4BBT A;  4EEU A;  1TS8 A;  4MN5 A;  3KYZ A;  2D01 A;  2L0W A;  4UEY A;  1T18 A;  2LB9 A;  4UQI S;  4G3K A;  3B42 A;  3LI8 A;  1N9O A;  3FC7 A;  3LR5 A;  1V9Z A;  3LR4 A;  2O0Y A;  3EGD C;  3MQQ A;  4R38 A;  4F3L B;  3BW6 A;  3EQU A;  3O5Y A;  1V9Y A;  3PBQ A;  2Y8H A;  4OOL A;  1NRJ A;  3VOL A;  5AVF A;  1DP8 A;  1OTE A;  5KSH A;  2VX8 A;  2MJ6 A;  2VJW A;  3FG8 A;  2OWH A;  4R6L A;  2KDK A;  4LLO B;  4EW7 A;  3P01 A;  1X0O A;  5TBM A;  3LFV A;  1F5M A;  1G6O A;  4CLC D;  4E04 A;  3JVU A;  2VV7 A;  2W3F A;  2D02 A;  4Y2F A;  1XJ2 A;  3UB9 A;  4Y5F A;  3KYQ A;  1W63 Q;  5IU1 A;  3T4S A;  3TW8 A;  4ZRR A;  3EGX C;  2O99 A;  4P6Z S;  3MJQ A;  4DJ2 A;  4JGO A;  2PT7 A;  4QPR A;  4F3L A;  3R4K A;  2Z6C A;  4BMW A;  4WF0 A;  5AVE A;  2DMW A;  2M7V A;  3S7O A;  3BQ8 A;  2WKP A;  4EES A;  2PD8 A;  3ULF A;  5HPF A;  4HJ6 A;  5HZH A;  4WN5 A;  2Z6D A;  2JN7 A;  1BYW A;  3G6O A;  1S66 L;  4H6J B;  3GEC A;  5G4Z A;  2W27 A;  4HQA A;  3U2A A;  4GHI A;  4PAU A;  2O9A A;  4MCW A;  3PYP A;  1DRM A;  1S4S A;  1TF1 A;  3OCL A;  4KUK A;  3MR0 A;  4PHT A;  1T1C A;  3PBT A;  2O9B A;  3VE3 A;  1OTB A;  2GNX A;  5DF9 A;  2BAS A;  1NLY A;  3BY8 A;  1XJ4 A;  3CLO A;  4WL9 A;  5HPI A;  3MMH A;  5DKK A;  2XRN A;  3D3O A;  2W3D A;  1EW0 A;  2QJ5 A;  4GJ4 A;  4MDZ A;  3R7W B;  4B9O A;  5FL3 A;  1XFN A;  3E4O A;  3F1O A;  3T4T A;  4HH3 A;  3CI6 A;  1TS6 A;  5TBM B;  2KOI A;  2OWJ A;  3S7Q A;  3CAX A;  4NXB A;  4CLC B;  1IFQ A;  1F98 A;  4G3V A;  4XT2 A;  1OJ5 A;  2K31 A;  4HP4 A;  4Q0J A;  5LBR A;  5HDD A;  3T4J A;  2W0N A;  4ARZ B;  3MXQ A;  3UMD A;  3LID A;  1OJG A;  1GSW A;  4IJG A;  3TE8 A;  3T50 A;  5IT5 A;  4B93 A;  2XSS A;  2A24 B;  3E4P A;  3BJN A;  4YNR A;  3T4L A;  4ARZ A;  3DBA A;  2VKS A;  1W63 M;  4WLA A;  2J3W A;  4HJ4 A;  4UQI M;  1TS0 A;  2PHY A;  5HL6 A;  3A0V A;  3H82 A;  2L4R A;  2W3G A;  4GCZ A;  3PBS A;  3RH8 B;  1DP9 A;  2HV1 A;  1VHM A;  3UE3 A;  1F9I A;  5F69 A;  1MKM A;  4EU0 A;  4HOI A;  3CUE C;  3E98 A;  4IHQ A;  3CUE A;  4HH2 A;  4KQO A;  4O8G A;  5HDS A;  3F1P B;  3W2Z A;  1GSV A;  2W1R A;  2J3T C;  1T1A A;  3JVV A;  2A2L A;  3NOU C;  3IS2 A;  2M1C A;  2OAP 1;  3CWF A;  4WUJ A;  3S7P A;  3H7W B;  2KLI A;  4Q0I A;  1LL8 A;  2VGL S;  4RQ9 A;  4BJP A;  4CLC C;  1UWN X;  3F1N B;  1OT6 A;  4Y3I A;  5DJU A;  2VEA A;  2VLG A;  3K3D A;  1XFQ A;  2CMN A;  3C2W A;  2O9C A;  5G4Y A;  5HWW A;  3FPV A;  4O01 A;  1D7E A;  3EWK A;  4CLC A;  1TD5 A;  2V1B A;  2QWS A;  3EEA A;  5HDC A;  4GS9 B;  4JGQ A;  3PHY A;  4MN7 A;  2Y79 A;  4Q0H A;  4R70 A;  2GX5 A;  3NOT C;  2YKF A;  5C5K A;  2J3T D;  1TS7 A;  2XRO A;  5F5Y A;  3SW1 A;  3T4K A;  1NWZ A;  5L8M A;  2ZBB A;  3D72 A;  3PXP A;  2JKT M;  2ZMF A;  2PR6 A;  3F1P A;  2R78 A;  2OAQ 1;  3IBJ A;  3LIE A;  2J80 A;  1UGU A;  5J7E A;  2V1A A;  2JKR M;  2W3H A;  3E4Q A;  4HIA A;  3V67 A;  3UME A;  5HD5 A;  1ZTU A;  2ZOI A;  1MC0 A;  1JNU A;  2JHE A;  1ODV A;  1NLZ A;  4WEK A;  2PDR A;  2VGL M;  4JGR A;  2HGV A;  2FZ0 A;  2VV6 A;  5CX7 A;  1OTI A;  2ZOH A;  4EQ1 A;  1KOU A;  4DJ3 A;  5HWV A;  1STZ A;  2HF6 A;  3ZQ5 A;  3EEH A;  3KSH A;  2W1T B;  3HJI A;  2XA7 M;  1T19 A;  5F68 A;  1XJ3 A;  4AFI A;  3E0Y A;  3T4O A;  3PBR A;  1N9L A;  3OOV A;  3ICY A;  4G3W A;  2M7U A;  3KX0 X;  3R7W A;  3LIF A;  3LR3 A;  1S1Z A;  5DKL A;  3NHQ A;  4HNB A;  2VZW A;  5J4E A;  4M4X A;  3IS2 B;  1P0Z A;  4NEE D;  2ZMV A;  2KX6 A;  1IOU A;  3LIC A;  2HJ9 C;  2L1M A;  1WA9 A;  5EFW A;  1P9R A;  3K3C A;  4XT2 B;  5MC7 A;  4L9F A;  5AJG A;  1T1B A;  2JKR I;  4LRY C;  3F1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...