1T19A

Early intermediate ie2 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t19A00
2V0UA 3VOLA 2QWSA 3LI8A 2QKPA 5AVFA 4DJ3A 2VV6A 4L9EA 2KX6A 4BBUA 2QJ5A 1MZUA 3PYPA 5KIZA 3EWKA 5HZHA 2YKFA 2L4RA 4BBTA 1VB6A 1XJ4A 4HNBA 2QHKA 1V9ZA 2R78A 4WLAA 4XT2A 2PR6A 4DJ2A 3ICYA 1N9NA 4NXBA 1GSWA 1S1ZA 1S1YA 4PKYG 1TS8A 3RH8B 4EQ1A 4HIAA 3RTYA 3OLOA 1P0ZA 3BY8A 2M1CA 1T1BA 5TBMA 4MN6A 1BYWA 1UWNX 3A0RA 4MN5A 3MJQA 2PR5A 2VLGA 3F1PA 3VE4A 1OT6A 1DP6A 3H9WA 3IS2A 4JGPA 4EEUA 1XJ3A 1G28A 5IS1A 2P7JA 2KDKA 5HD5A 1OTIA 3EEHA 4HJ4A 2V1BA 1GSXA 2ZOIA 4HJ3A 5HWTA 3H7WA 1S4RA 4BBVA 4GHIB 3E4OA 3E4QA 3LYXA 1OTEA 1LSWA 4GS9B 1T1AA 4LRXC 1OT9A 5DJUA 3GDIA 1N9OA 3ZQ5A 2L0WA 5DKKA 2VV8A 4F3LB 1NWZA 1WA9A 3B33A 3IBRA 3BWLA 5HDDA 5A8BA 5F68A 2V0WA 5HDCA 3F1NB 2PYPA 4LLOB 2W0NA 3HJKA 4LPZA 3P7NA 1XJ2A 4GCZA 3NOTC 4NXGA 3UB6A 5IU1A 1X0OA 4KUKA 1DRMA 1S67L 4L9GA 4EESA 1LSXA 1OJ5A 4PKYA 3G6OA 4HH3A 2QJ7A 2JHEA 2CMNA 3LIAA 1T1CA 3UB8A 4E04A 4I39A 4R70A 3MQOA 4H6JB 4JGRA 1LL8A 3C8CA 5I5LA 5HDSA 1UWPX 2I9VA 4I3AA 4R6LA 2JN7A 1OTBA 4HJ6A 1EW0A 2ZBBA 3KX0X 2PD8A 4EERA 1V9YA 1XFQA 3CLOA 2Z6DA 4M4XA 3F1OA 1N9LA 3LIEA 4HH2A 2OWJA 2H28A 2YKHA 4I3IA 3UE6A 4GHIA 1D7EA 4LRYC 4GS9A 2D01A 5F69A 3LIFA 1XFNA 3FC7A 4GW9A 5HD3A 5F5YA 4XT2B 1S66L 4I3JA 4F3LA 5DJTA 3CWFA 2EA9A 3K3CA 1T18A 4LRZE 3GECA 1LSVA 1DP9A 4NXEA 5HWVA 1D06A 3LUQA 3C2WA 4K08A 5TBMB 3UB7A 3D72A 2V9AA 4JGOA 3A0SA 2WKPA 3BY9A 2PD7A 4WUJA 3FG8A 2A24B 5J4EA 4HP9A 4NXFA 5HWWA 4H6JA 4EEPA 5AVEA 1F9IA 1JNUA 2GJ3A 1LT0A 1DP8A 3SW1A 4EETB 1P97A 2OWHA 2B02A 2D02A 1TS6A 4HI4A 3H82B 3UMEA 1GSVA 3K3DA 3E4PA 4HY8A 4WL9A 5EFWA 3A0VA 1ODVA 4JGQA 2L1MA 3MQQA 3NHQA 2WKRA 1KOUA 1XJ6A 4I5SA 1F98A 3VE3A 4YWZA 5J7EA 2VEAA 3NOUC 3NJAA 3MXQA 3LIBA 3MR0A 2ZOHA 3UMDA 3LIDA 1Y28A 2PYRA 4R38A 5G4YA 4EXOA 5F6AA 3NOPC 5G4ZA 3MFXA 3UB9A 1OTDA 2INWA 2VV7A 4I38A 4HQAA 1UGUA 3F1OB 1OTAA 2V1AA 2OOLA 3F1NA 4HHDA 4RQ9A 4WF0A 1TS0A 4KQDA 4WN5A 4R3AA 4L9FA 2K7SA 2A24A 1S4SA 3PHYA 2BASA 4HOIA 4KUOA 2WKQA 1TS7A 3F1PB 3LICA 3IS2B 4HP4A 2HV1A 3ULFA 2W27A 5J3WA 3LI9A 5HSQA 1T19A 3H7WB 4B9OA 2PDRA 2PHYA 3HJIA 3T50A 3H82A 2Z6CA 5DKLA 2J80A 1OJGA 3CAXA 4EW7A
chains in the Genus database with same CATH superfamily
3O87A 5CTMA 4DE1A 5CX7A 3LI8A 1FSWA 2VGLS 2WZXA 2M7UA 1PZPA 4DJ3A 4BWIA 1TF1A 5TR7A 2GZAA 2VV6A 3HCYA 4EQIA 4OQGA 1K6SA 4OPQA 1MBLA 1MZUA 5HAQA 4N9KA 1VEUA 1W8YA 2L4RA 1H0MA 4YOFA 4U3TA 3DAVA 4CLCE 2A49A 3BFCA 1TDGA 2HJ9C 1U60A 1NY0A 2MJ6A 2XRNA 2Y2GA 2WAFA 4XT2A 3G4PA 4E3JA 4BENA 1ZTUA 3ICYA 2Y2QA 1S1ZA 2Y2LA 4R4RA 1KE0A 3RH8B 4G3KA 2EWVA 4HIAA 3ZDJA 3IH8A 3KYEA 2Y2JA 5TBMA 1T1BA 3G30A 4MN5A 3MJQA 2Q9NA 4S2IA 3H9WA 4ESPA 4JGPA 4GOGA 2WGVA 1OTIA 3HL9A 4CLCB 4HJ4A 1GSXA 3GRJA 4JF6A 4HJ3A 2RCXA 1YSPA 3E4QA 5EVID 2XROA 4LRXC 3NBLA 5FQJA 1OT9A 4O8GA 4S2NA 1KE4A 4DF6A 1IYSA 3OPRA 2VV8A 3ZNYA 4DRTA 1CF0A 1K57C 2XFTA 3IBRA 5HDDA 5A8BA 3G31A 4ETZA 3ZVTA 2DRWA 5F68A 5GLBA 4DE3A 2V0WA 4Y0UA 1GA9A 4GDNA 4KZ6A 3U2AA 4R4SA 2W0NA 3C38A 1XJ2A 4S2JA 1NLYA 3FPVA 4GCZA 3ZG5A 3NOTC 3O3VA 5FAQA 3NI9A 3UB6A 3LR3A 3EOIA 4PM5A 4E3OA 3FZCA 4OOYA 5CERA 4Q0IA 1NJ4A 4EESA 1LSXA 4OVDA 3JPUA 3LO7A 2JHEA 4UHUA 3G2ZA 3UB8A 2K31A 3HUNA 4R70A 3HLCA 4H6JB 3MSHA 1W79A 4R0QA 1DY6A 5I5LA 3NCKA 3TOIA 1PW1A 1Q2QA 5M1AA 1N9BA 1K54C 1KGGA 2ZBBA 3KX0X 4EERA 1XXMA 2J9OA 3F1OA 3LIEA 3E2LA 2Y2KA 3L7HA 2P04A 4HBTA 4I3IA 1F5MA 4Q0HA 4N9LA 1KDWA 4YINA 4O0PA 2FH5A 2H5SA 1D7EA 3PBRA 1SDEA 3DWKA 3QP8A 4NK3A 2JKTI 1H8YA 2ZL1B 3HLWA 3S7PA 4XT2B 1XGJA 2PU4A 2G7UA 3UDIA 2W3DA 3D3OA 4F3LA 2V1ZA 2PRFA 3K3CA 2QZ6A 1T18A 1WYCA 3ZFZA 1H8ZA 1DP9A 3HREA 1ESUA 3LUQA 5FQIA 4X6TA 4LV2A 1NLZA 1FCOA 4OOMA 2XDMA 4BJPA 4FH4A 3G34A 5TBMB 1VETB 4OONA 5EOOA 4N1HA 3D72A 3IH9A 3BY9A 4CLCC 2HPBA 3BW6A 3V3SA 4WZ5A 5EM0A 3SZTA 1CK3A 3VP1A 3MF0A 4C75A 3UE1A 3UE3A 4RX3A 3GVBA 3LR5A 5JYOA 2XEPA 2XFSA 4JXSA 2B95A 4KZBA 3BFEA 4Y3IA 4D60A 5GLCA 2HDRA 1SCWA 1F9IA 4HEFA 3BFGA 3OCLA 2ZMAA 5FQMA 2GJ3A 3T4TA 5EE8A 3NECA 2Y8HA 3M2JA 1TS6A 3H82B 4Z1WA 3UMEA 3ZVWA 3FWLA 4YFMA 3V5MA 4HY8A 4WL9A 1PW8A 1YAXA 3S7NA 5DTKA 1XKZA 2EXBA 1W5DA 4HBUA 2P08A 2OAP1 5LBRA 4R3JA 2HDQA 4MDZA 2WKIA 4KENB 3TE8A 4F94A 3GR2A 4I5SA 4WYYA 2EFUA 3WS1A 3JYIA 2XD5A 2Y2MA 4ID4A 4E6WA 4PHTA 3UN7A 4EUVA 1W63M 2ZOHA 4BQMA 2QPNA 3OPHA 2NUPC 3IWQA 1ALQA 4EXOA 5F6AA 4EUZA 3DTIA 1YPRA 5G4ZA 2EX2A 1SHVA 4R1GA 5F1GA 4ZJ3A 4HQAA 3SS5A 3F1OB 3F1NA 1ZG6A 3QP4A 1GHIA 5A91A 3MS6A 3IX8A 4WN5A 3BJNA 5FEFA 2BTFP 4K0XA 3G2YA 4XXRA 1S4SA 4M3KA 4OLDA 3PHYA 1LHYA 2BASA 2Q9MA 3LR0A 3ITBA 4S2MA 3IS2B 4JF4A 1FOFA 2HV1A 2XLNA 5GLDA 2VGJA 2WUQA 5J3WA 3DTMA 4B4ZA 3LI9A 3AGDA 3B47A 2X71A 2PHYA 5CECA 2E8IA 3UB5P 2Z6CA 3VMAA 2VA0A 1OJGA 1K4EA 3WRZA 2ZM0A 5CEBA 3CAXA 2XK1A 5I94A 4FTXA 2OAQ1 4R23A 4OKPA 2ZQ8A 3BRMA 3IXGA 3PBQA 5AVFA 1TDLA 2XQZA 3MBZA 3VSKA 2GX5A 4L9EA 1CI8A 2QJ5A 3PYPA 3G32A 3O5YA 5KIZA 5DF7A 3N7WA 3BECA 1STZA 5EUAA 3E98A 3EWKA 5HZHA 3TG9A 3MXSA 4II7A 3ZYTA 3IF6A 2IWDA 1V9ZA 2EFXA 4ETXA 1GCEA 1OMEA 4CLCD 4DMZA 4ZRRA 2VX8A 3IHBA 4KQRA 3K2NA 2P9VA 3UPNA 1GSWA 4PKYG 3CI6A 3TW8A 1PI5A 4WMCD 1TS8A 1G6AA 3LEZA 4XUZA 4JBFA 2W3EA 3U4LP 3RTYA 3OLOA 2ZMFA 4WZ4A 2ZQ7A 1ZG4A 1P0ZA 4MEZA 3S22A 3HLEA 1GA0A 3RXWA 5JYPA 1CEGA 4MN6A 3A0RA 1BLPA 4EBLA 2VLGA 1E3UD 3F1PA 3EGDC 3VE4A 1DP6A 3AGEA 1RGZA 2KLIA 3ZG8B 2VGKA 4EEUA 3A3EA 2W3FA 3EEHA 4S2OA 2V1BA 5HPFA 3W4QA 4WEJA 1J3WA 1AWIA 1S4RA 5AQ7A 4GHIB 4BBVA 4EBNA 3QP1A 1OTEA 4GS9B 1PRQA 3CUEA 4PM6A 1QMEA 1T1AA 2R9WA 2ACGA 5DF8A 3BYDA 4KG6A 3EQUA 2H0TA 3O86A 1N9OA 4X56A 1XA7A 4Q0JA 3BFFA 1ZKJA 3V50A 4QB8A 2L0WA 4Y7PA 4IVIA 1FILA 3CG5A 3KYQA 1ES3A 3QP6A 4KZ7A 1NWZA 3TSGA 2OLVA 2PBYA 3BWLA 5FL3A 4EU0A 4C6YA 2E8JA 4WBGA 5HDCA 3F1NB 4LLOB 3HJKA 1LL9A 3IBJA 3KSGA 1CEFA 2JKFA 1Z09A 4KUKA 3IX4A 2UWXA 1TD5A 4FUWA 4OOLA 4L9GA 3Q7VA 1BSGA 1OJ5A 2PT7A 3LY4A 5CEDA 2Y55A 2QJ7A 1IFQA 2V8CA 4WEKA 3WS0A 1IKIA 3ZG7B 1FCNA 1BTLA 3MQOA 4JGRA 1LL8A 1K6RA 2K2NA 4GJ4A 3C8CA 1RCJA 1YLJA 5GHZA 5F82A 1YT4A 2P74A 3GTCA 3W4PA 2X02A 4IVKA 4C3QA 1PZOA 2WKHA 2XD1A 4LV1A 2ZC7A 3MXRA 3WS2A 4Y0OA 2HP9A 4R6LA 3VP3A 2J8YA 3MZFA 2XA7S 4MNRA 1O07A 1XFQA 3CLOA 2Z6DA 3HLFA 2OWJA 2H28A 3R7WA 2EX8A 4OPYA 3UE6A 3HUOA 4LRYC 3RXXA 1VQQA 5GLAA 1XFNA 5HD3A 4UAAA 5D3OA 3RJUA 2OSUA 1S66L 3BQAA 5MC7A 4I3JA 5DJTA 3CWFA 4GKUA 2P9VB 3MZEA 3A3JA 1N4OA 5FQ9A 4LRZE 5HPIA 1D06A 3C2WA 3T12B 4K08A 2GDNA 1FQGA 3PBNA 3QNCA 1Y4OA 3T4JA 5EVIA 2ZC6B 2V9AA 4IUKA 3A0SA 2ZM2A 2WKPA 5L07A 1DJCA 4RA7A 4NG2A 4E3LA 3IHAA 5GL9A 4WUJA 4QU3A 4OPZA 2J9PA 3IT9A 5J4EA 3NULA 4HP9A 3PXPA 1KGEA 1Z6FA 4NXFA 3VFHA 4EEPA 2J3TC 1JTDA 4GZBA 1FIKA 4P6ZS 2Y79A 4LFUA 4E6XA 4QY6A 4GB7A 3HVFA 2JKRM 2B02A 5TJJA 2WZZA 4K0WA 5FA7A 3E4PA 4ARZA 3BLMA 4E3MA 1SDNA 2ZMVA 2L1MA 3D9YA 1YQSA 4ZJ1A 1YLYA 4X55A 1KOUA 5FATA 5FI2A 1PYYA 4QJGA 1JWVA 1P9WA 1PI4A 4R3BA 5M18A 3A3DA 2G2WA 4UQIS 1H3QA 3Q7VB 4UEYA 4Y17A 1HTZA 1VEUB 4LCMA 2C5WB 3OC2A 2VEAA 3NJAA 5FQQA 1L0EA 3MXQA 1G5UA 5AQAA 3MR0A 4QD4A 1YSQA 2PAVP 3C4OA 1D1JA 4N92A 4R38A 5HL1A 4RX2A 4WELA 1Q2PA 5FEGA 2WGWA 3AGFA 3NOPC 4LV0A 3DBAA 1ES2A 1OPXA 1A0KA 1W63Q 5AQ9A 1F2KA 4JF5A 4Y2FA 1OTDA 2INWA 1JWPA 1UGUA 2WYXA 4KZ8A 1H8MA 3FYZA 2JBFA 1M40A 1BT5A 1OTAA 1TEMA 2IWCA 2V1AA 2OOLA 4HHDA 3HLDA 3WS4A 4OQIA 1S0WA 4DE0A 3R7WB 1IOUA 4WF0A 1KGFA 2O9CA 4OP8A 3FKVA 2A24A 3VOYA 4D2OA 5E2FA 2WKQA 1TS7A 4KG5A 2V2FF 1AXBA 5HARA 4IHQA 1KVLA 4FH2A 3IXHA 3QP2A 2Y4AA 2KOIA 1I2WA 4P0MA 3UPPA 1O7EA 3UPOA 4KZ3A 3VV4A 5DKLA 3CJMA 4DKIA 5F83A 1BZAA 1XX2A 2QWSA 1YM1A 2Y2OA 2DNSA 4DN0A 3C5AA 2CC1A 4HESA 2W3GA 4BBUA 4ZBEA 3V39A 4NETA 3TRCA 3NY4A 3PBOA 1YLPA 3UY6A 3ZG0A 1RGYA 3CITA 1C3BA 4BBTA 1VHMA 3D4FA 1VB6A 3WRTA 5EOEA 1NZOA 4MLLA 5CGXA 5HX9A 1IELA 3B3XA 4NEED 4MBKA 1PWCA 5CHMA 2PR6A 5FDSA 4NXBA 1S1YA 4CPKA 2VGLM 3HLGA 3UO9A 3MKFA 1LI0A 4EQ1A 5KMWA 1K57A 2J3TD 1MWRA 2WGIA 1W7FA 2XSSA 3ITAA 3S7QA 2W1TA 3Q07A 1FCMA 4Y5FA 1SKOA 2PR5A 1K25A 1TVFA 4FD8A 3SOIA 1XJ3A 1G28A 1PIOA 2P7JA 2KDKA 5HD5A 2VZWA 2ZC5B 2HP5A 4ME4A 5HWTA 3H7WA 4CJNA 3E4OA 1FSYA 3W8KA 2ZC4B 4LGWA 1NRJA 5DJUA 3IF5A 4B88A 2NUTC 5HFOA 2Y2PA 4F3LB 2A3UA 1MWUA 1EI5A 3B33A 1K54A 2Y91A 4BD0A 5M19A 2JC7A 4GLQA 4LPZA 1CQAA 3HLBA 3I7JA 2JKRI 4NXGA 5J8XA 2JKGA 3SH9A 2HZ5A 4OH0A 4KZ9A 2O0YA 4BL2A 1CJFA 3GMWA 1DRMA 1S67L 2HDUA 1P9RA 4PKYA 3G6OA 5CHJA 1HZOA 2ZM8A 4IJGA 4S2KA 2J3WA 2V20A 2VKSA 2CMNA 3LIAA 1K55A 4E04A 4I39A 4QHCA 3W2ZA 3LY3A 4UA6A 2W1RA 2HGVA 4S2NC 3HBRA 3OBFA 5TGFA 1PWGA 2LB9A 5HDSA 3WWXA 3IWIA 3P09A 1UWPX 2JCHA 1BUEA 1YLZA 3N8SA 1OTBA 5EVIC 5KSHA 4NKPA 2DCFA 2PD8A 2HJEA 4WM9A 3MZDA 3KO6A 5CGSA 1LI9A 4PMAA 2XF3A 4M4XA 3KSHA 1N9LA 3KYZA 4HH2A 2EWWA 4OQHA 4A5RA 3DTEA 4CLCA 1MY8A 4DXBA 2DMWA 2ZQAA 2R9XA 4KQQA 1BLCA 3M6HA 1G6OA 4IEDA 4WMCA 1K56D 1IKGA 4GW9A 1PFLA 5EPHA 4P6BA 3ZG9B 5DTSA 3T4OA 5EECA 5E2EA 1FR1A 4KZ4A 5F1FA 4L0LA 1E3UA 4U0XA 1LSVA 3IXBA 5HL6A 1GHPA 4NXEA 4P85A 2H10A 1XA1A 5A93A 3S1YA 3T4SA 3GV9A 3FKWA 3UB7A 3S4XA 3VP4A 1SKOB 1MWTA 4JGOA 3VOZA 3BEBA 3PAEA 1JWZA 3FG8A 4JXGA 2O99A 3CMZA 3C30A 3C4PA 5HWWA 4H6JA 3PBTA 3QHYA 1ONHA 2ZD8A 3A3IA 5AVEA 3Q1FA 2WK0A 3P01A 3E2KA 3EGXC 2OV5A 3PTEA 1L3LA 4EETB 3JVUA 4JKTA 2GNXA 3CPTA 3MFDA 2WKEA 3DTKA 4HI4A 3S7OA 3DW0A 3K3DA 3T1RA 1I2SA 4QY5A 3Q81A 4U0TA 3LCEA 4Q8IA 4S2PA 3LEQA 3VP2A 2IWBA 3BLSA 1XJ6A 1XP4A 4X25A 4QWOA 4WZ5C 1F98A 2LB5A 2FZ0A 3HUMA 4FSFA 2ZL1A 1XPBA 3IWOA 4YWZA 5J7EA 5DFXA 1L0GA 3T4KA 3IF6B 3LIDA 1K0KA 1VM1A 5A90A 1MWSA 2B5RA 2PYRA 5G4YA 5G18A 1K4FA 3UNWA 3MFXA 3OCNA 1VETA 3C7UA 2VV7A 3SS4A 1NXYA 4I38A 4BD1A 5DF9A 2ZJ9A 1ONGA 4Y0TA 4JLFA 4X1LA 5FQKA 2PU2A 2FFFB 1MKIA 4L9FA 2RL3A 4JXWA 4HOIA 4KUOA 3QNBA 4IBXA 3F1PB 3LICA 4ZJ2A 3NC8A 4PM9A 5CTNA 5E2HA 5TFQA 3ULFA 1BLHA 2FFYA 2QMIA 2W27A 4RYEA 5HSQA 3ZCZA 1T19A 3G35A 4ZTKA 4X68A 3NDGA 3H82A 4EW7A 5DTTA 2V0UA 3VOLA 5CHUA 2QKPA 2JE5A 4B4XA 4X1MA 2EX9A 2KX6A 3N8LA 1G68A 2OLUA 4BMWA 3M6BA 5FASA 5IHVA 4H8RA 2H0YA 5AJGA 2AVXA 1ES4A 2YKFA 3B42A 1XJ4A 1IYQA 2WADA 4HNBA 2A2LA 1IYPA 2QHKA 3N8RA 3Q7ZA 2R78A 4ZAMA 4WLAA 1ACFA 1YKDA 5L2FA 4E3KA 1NZUA 4DJ2A 2V8FA 4K91A 1N9NA 4KZAA 1LL5A 4GD6A 3CPTB 1EROA 4BLMA 1NYYA 1HD8A 2O9BA 4EWFA 4XUXA 3BY8A 4MBFA 2M1CA 5GHXA 3L9KA 3PR6A 1BYWA 1UWNX 1EWZA 5KSCA 2Y59A 1OT6A 1JTGA 1ERQA 1L0DA 3IS2A 4IBRA 1MPLA 4GD8A 5IS1A 2EX6A 1K55C 2Y2HA 4DE2A 1SZVA 1PWDA 2ZOIA 4DXCA 1IYOA 3IF6C 2Z2LB 2PBDP 4OPRA 3LYXA 5CXWA 1LSWA 2QYBA 1ERMA 3GDIA 2W3HA 3ZQ5A 4X69A 1DJAA 1NYMA 5DKKA 3IX3A 3CHWP 1RP5A 4N1XA 1WA9A 3RFBA 3M2KA 4FCFA 1I5QA 3EQVA 1S6RA 4OQ0A 4E3IA 5FI7A 3ZGAB 4PM7A 3LR4A 2PYPA 1YMSA 2ZLYA 4X53A 3MMHA 4Z9QA 5HAIA 3P7NA 5E43A 3FPWA 5FDHA 3R4KA 3LFVA 5FAOA 2BLSA 3IXDA 2EXAA 4MCWA 5EVIB 5IU1A 1X0OA 2X01A 2ZQDA 3VP0A 1WE4A 1FR6A 4EV4A 4HH3A 3EEAA 4P87A 4GNUA 3OOVA 4MN7A 2Z2MB 4OP5A 3CUEC 1T1CA 1GHMA 1MXOA 1J9MA 4KZ5A 4Y13A 1CI9A 3BM6A 5U47A 1NRFA 2I9VA 4I3AA 2JN7A 2Y2IA 4JXVA 4HJ6A 1YMXA 1EW0A 5KZHA 3LGOA 2ZQ9A 4GDBA 3JVVA 1Y54A 1V9YA 5DVAA 1HLUP 3A3FA 1ZHHB 2YKHA 3E0YA 4ARZB 4PPRA 3ISGA 4G3VA 3UE0A 2XR0A 4GHIA 3N4IA 3C7VA 5EVEA 4G3WA 2I72A 3FV7A 4GS9A 2D01A 1IEMA 5F69A 3LIFA 3FC7A 3KSIA 2IA2A 3ZNTA 5F5YA 1KE3A 3TJZC 4EBPA 5GHYA 2XH9A 3ZHHA 4OLGA 2EA9A 4MBHA 1MKMA 2C6WB 3GECA 2XA7M 5EM1A 5HWVA 5E2GA 3GQZA 3SH8A 4DDSA 1DJBA 2G2UA 4DDYA 2WGWB 1H5XA 2UV0E 1XGIA 2ZC3B 2M7VA 1M6KA 5L10A 3V3RA 3W4OA 4Y15A 4UA7A 2ZQCA 2PD7A 1L0FA 2A24B 3NIAA 1E25A 4O01A 3MKEA 1K38A 2HP6A 4LCLA 1YLTA 4E3NA 1HVBA 3OZHA 1JNUA 5EV0A 1SKFA 2HF6A 2O9AA 1LT0A 4LENA 1DP8A 3SS3A 3SW1A 1P97A 1ES5A 2OWHA 5HAPA 3GSGA 2D02A 2WAEA 5HW3A 1GSVA 3V67A 1ESIA 3T1QB 5CRFA 4GN2A 4UA9A 5K5BA 5EFWA 3A0VA 1BULA 3IQAA 1ODVA 3T4QA 1WYBA 4JGQA 3KSFA 5FAPA 3MQQA 3NHQA 3UDXA 2VK3A 3WS5A 2B18A 2WKRA 3T1SA 3SH7A 2Y2NA 4JPMA 1L2SA 3VSLA 3VE3A 5CGWA 3OPLA 1LLBA 4KG2A 2VJWA 3PBSA 5DFYA 3QP5A 3P98A 3NOUC 1E4DA 3N6IA 3LIBA 5L09A 3UMDA 3Q82A 2XGNA 4P6ZM 1Y28A 5FSRA 3T4LA 3BFDA 4YNRA 1KVMA 3T1XA 1JVJA 1ZC2A 4RVAA 3CZDA 3UB9A 5C5KA 4IUHA 1MC0A 4AFIA 4PAUA 1K56A 4B93A 1KDSA 1BLSA 3OPPA 4RQ9A 1YLWA 2JKTM 4QPRA 1TS0A 3UDFA 4KQDA 4BL3A 4R3AA 4KQOA 5L8MA 4O7DA 2K7SA 4UQIM 2W1TB 3VFFA 5IT5A 2Q0OA 5FI6A 4S2LA 3BQ8A 3PAGA 1PNEA 4MMNA 1QMFA 4HP4A 2BG1A 4PM8A 3O88A 4LV3A 3MQ0A 5BOHA 5AQBA 2HDSA 4FOFA 3H7WB 4B9OA 5A92A 1W8QA 2PDRA 4CQHA 3HJIA 3T50A 3DWZA 5EVLA 3NDEA 2J80A 4ZDXA 2J7VA
chains in the Genus database with same CATH topology
2V0UA 3VOLA 2QWSA 5CX7A 3LI8A 2OAQ1 2VGLS 3PBQA 2QKPA 5AVFA 2M7UA 4DJ3A 4DN0A 4BWIA 1TF1A 2GZAA 2VV6A 3HCYA 2GX5A 4L9EA 2KX6A 2W3GA 4BBUA 4BMWA 2QJ5A 1MZUA 3TRCA 3PYPA 3O5YA 5AJGA 5KIZA 3PBOA 1STZA 3E98A 3EWKA 5HZHA 2YKFA 3CITA 2L4RA 1VHMA 4BBTA 1VB6A 3B42A 4II7A 4YOFA 3ZYTA 1XJ4A 4CLCE 4HNBA 2A2LA 2QHKA 1V9ZA 2HJ9C 2R78A 4ETXA 2MJ6A 4WLAA 4NEED 1YKDA 2XRNA 4CLCD 4XT2A 4DMZA 4ZRRA 2VX8A 2PR6A 4DJ2A 1ZTUA 3ICYA 1N9NA 3K2NA 4NXBA 1GSWA 1S1ZA 1S1YA 4PKYG 3CI6A 3TW8A 2O9BA 2VGLM 1TS8A 3RH8B 4G3KA 2EWVA 4EQ1A 2W3EA 4HIAA 3RTYA 2J3TD 3OLOA 2ZMFA 2XSSA 1P0ZA 3BY8A 3S7QA 2M1CA 1T1BA 5TBMA 2W1TA 4MN6A 3PR6A 1BYWA 1UWNX 3A0RA 4MN5A 4Y5FA 3MJQA 2PR5A 2VLGA 3F1PA 3EGDC 3VE4A 1OT6A 1DP6A 3H9WA 2KLIA 3IS2A 4JGPA 4EEUA 1XJ3A 1G28A 5IS1A 2P7JA 2KDKA 5HD5A 1OTIA 2W3FA 3EEHA 4CLCB 4HJ4A 2V1BA 2VZWA 1GSXA 5HPFA 4WEJA 2ZOIA 4HJ3A 4ME4A 5HWTA 3H7WA 1S4RA 1YSPA 4GHIB 4BBVA 3E4OA 3E4QA 3LYXA 1OTEA 1LSWA 4GS9B 3CUEA 1T1AA 2XROA 4LRXC 2QYBA 1OT9A 4O8GA 3EQUA 1NRJA 5DJUA 3GDIA 2W3HA 1N9OA 4Q0JA 2NUTC 3ZQ5A 2L0WA 5DKKA 2VV8A 3KYQA 4F3LB 1NWZA 1WA9A 3B33A 3RFBA 3IBRA 3BWLA 5FL3A 5HDDA 5A8BA 3EQVA 4ETZA 4EU0A 5F68A 2V0WA 3LR4A 5HDCA 3F1NB 2PYPA 4GLQA 3U2AA 4LLOB 2W0NA 3HJKA 3C38A 3MMHA 4LPZA 3P7NA 1XJ2A 1NLYA 3FPVA 3FPWA 4GCZA 3NOTC 2JKRI 4NXGA 3R4KA 3IBJA 3LFVA 3LR3A 3UB6A 3KSGA 3EOIA 2O0YA 4MCWA 5IU1A 1X0OA 4KUKA 1TD5A 4OOLA 1DRMA 4Q0IA 1S67L 4L9GA 4EESA 1LSXA 1OJ5A 2PT7A 1P9RA 4PKYA 3G6OA 4HH3A 4IJGA 3EEAA 4MN7A 3OOVA 2J3WA 1IFQA 2JHEA 2QJ7A 2VKSA 4WEKA 2CMNA 3CUEC 1T1CA 2K31A 3LIAA 3UB8A 4E04A 4I39A 4R70A 3W2ZA 3MQOA 2W1RA 4H6JB 2HGVA 4JGRA 1LL8A 2K2NA 4GJ4A 3C8CA 3OBFA 5I5LA 2LB9A 5HDSA 1UWPX 2I9VA 4I3AA 4R6LA 2JN7A 1OTBA 2XA7S 5KSHA 4HJ6A 4NKPA 1EW0A 2ZBBA 3KX0X 2PD8A 4EERA 2HJEA 3KO6A 3JVVA 1V9YA 1XFQA 3CLOA 2Z6DA 4M4XA 3F1OA 3KSHA 3LIEA 1N9LA 3KYZA 1ZHHB 4HH2A 2OWJA 2EWWA 2H28A 2YKHA 3R7WA 2P04A 3E0YA 4I3IA 4ARZB 4CLCA 1F5MA 4Q0HA 2DMWA 4O0PA 4G3VA 2FH5A 3UE6A 4GHIA 1D7EA 3PBRA 4LRYC 4G3WA 4GS9A 2D01A 5F69A 3LIFA 1G6OA 1XFNA 3FC7A 3KSIA 2IA2A 2JKTI 4GW9A 5HD3A 3T4OA 5F5YA 3S7PA 4XT2B 3TJZC 2G7UA 1S66L 3BQAA 2W3DA 5MC7A 3D3OA 4I3JA 5DJTA 4F3LA 3CWFA 2EA9A 4L0LA 3K3CA 1T18A 4LRZE 1MKMA 3GECA 5HPIA 1LSVA 1DP9A 2XA7M 5HL6A 4NXEA 5HWVA 1D06A 3LUQA 3C2WA 4K08A 1NLZA 4OOMA 4BJPA 3T4SA 5TBMB 3PBNA 3T4JA 3UB7A 2M7VA 3D72A 2V9AA 4IUKA 4JGOA 3A0SA 2WKPA 3BY9A 4CLCC 3BW6A 2PD7A 4WUJA 3FG8A 2O99A 3MF0A 2A24B 3UE3A 5J4EA 3C30A 4HP9A 3PXPA 3LR5A 4O01A 4NXFA 5HWWA 4H6JA 3PBTA 4Y3IA 4EEPA 2J3TC 5AVEA 1F9IA 1JNUA 2HF6A 2O9AA 3OCLA 3P01A 2GJ3A 1LT0A 3EGXC 1DP8A 4P6ZS 3SW1A 3T4TA 4EETB 2Y79A 3JVUA 1P97A 2OWHA 2GNXA 2JKRM 2B02A 2Y8HA 2D02A 1TS6A 4HI4A 5TJJA 3S7OA 3H82B 4Z1WA 3UMEA 1GSVA 3V67A 3K3DA 3E4PA 4HY8A 4WL9A 1YAXA 3S7NA 5K5BA 5EFWA 3A0VA 4ARZA 1ODVA 3T4QA 2P08A 2ZMVA 4JGQA 3KSFA 2L1MA 2OAP1 5LBRA 3MQQA 3NHQA 2B18A 2WKRA 1KOUA 4MDZA 1XJ6A 3TE8A 4I5SA 1P9WA 1F98A 2LB5A 2FZ0A 4FSFA 4UQIS 1H3QA 4UEYA 3VE3A 2VJWA 3PBSA 4PHTA 5DFYA 3OC2A 4YWZA 5J7EA 2VEAA 3NOUC 3NJAA 5DFXA 3MXQA 3LIBA 1W63M 4EUVA 3MR0A 2ZOHA 3UMDA 3T4KA 1YSQA 3LIDA 4P6ZM 1Y28A 2NUPC 3T4LA 4YNRA 2PYRA 4R38A 5G4YA 4EXOA 4WELA 5F6AA 3NOPC 3DBAA 5G4ZA 3MFXA 1OPXA 1W63Q 3OCNA 4Y2FA 3UB9A 1OTDA 2INWA 2VV7A 5C5KA 4I38A 4HQAA 4IUHA 1UGUA 1MC0A 1H8MA 3F1OB 4AFIA 4PAUA 1OTAA 5DF9A 4B93A 2V1AA 2OOLA 3F1NA 4HHDA 3R7WB 1IOUA 4RQ9A 4WF0A 2JKTM 4QPRA 1TS0A 2O9CA 4KQDA 3BJNA 4WN5A 4R3AA 4KQOA 5L8MA 4L9FA 2K7SA 2A24A 4UQIM 2W1TB 1S4SA 5IT5A 3PHYA 2BASA 4HOIA 4KUOA 3LR0A 2WKQA 1TS7A 3BQ8A 3F1PB 3LICA 4MMNA 4IHQA 3IS2B 4HP4A 2HV1A 3ULFA 2W27A 5J3WA 2KOIA 3MQ0A 3LI9A 5HSQA 1T19A 4FOFA 3H7WB 4B9OA 3B47A 2PDRA 3VV4A 2PHYA 4CQHA 3HJIA 3T50A 3H82A 2Z6CA 5DKLA 2VA0A 2J80A 1OJGA 3CAXA 4EW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0U A;  3VOL A;  2QWS A;  3LI8 A;  2QKP A;  5AVF A;  4DJ3 A;  2VV6 A;  4L9E A;  2KX6 A;  4BBU A;  2QJ5 A;  1MZU A;  3PYP A;  5KIZ A;  3EWK A;  5HZH A;  2YKF A;  2L4R A;  4BBT A;  1VB6 A;  1XJ4 A;  4HNB A;  2QHK A;  1V9Z A;  2R78 A;  4WLA A;  4XT2 A;  2PR6 A;  4DJ2 A;  3ICY A;  1N9N A;  4NXB A;  1GSW A;  1S1Z A;  1S1Y A;  4PKY G;  1TS8 A;  3RH8 B;  4EQ1 A;  4HIA A;  3RTY A;  3OLO A;  1P0Z A;  3BY8 A;  2M1C A;  1T1B A;  5TBM A;  4MN6 A;  1BYW A;  1UWN X;  3A0R A;  4MN5 A;  3MJQ A;  2PR5 A;  2VLG A;  3F1P A;  3VE4 A;  1OT6 A;  1DP6 A;  3H9W A;  3IS2 A;  4JGP A;  4EEU A;  1XJ3 A;  1G28 A;  5IS1 A;  2P7J A;  2KDK A;  5HD5 A;  1OTI A;  3EEH A;  4HJ4 A;  2V1B A;  1GSX A;  2ZOI A;  4HJ3 A;  5HWT A;  3H7W A;  1S4R A;  4BBV A;  4GHI B;  3E4O A;  3E4Q A;  3LYX A;  1OTE A;  1LSW A;  4GS9 B;  1T1A A;  4LRX C;  1OT9 A;  5DJU A;  3GDI A;  1N9O A;  3ZQ5 A;  2L0W A;  5DKK A;  2VV8 A;  4F3L B;  1NWZ A;  1WA9 A;  3B33 A;  3IBR A;  3BWL A;  5HDD A;  5A8B A;  5F68 A;  2V0W A;  5HDC A;  3F1N B;  2PYP A;  4LLO B;  2W0N A;  3HJK A;  4LPZ A;  3P7N A;  1XJ2 A;  4GCZ A;  3NOT C;  4NXG A;  3UB6 A;  5IU1 A;  1X0O A;  4KUK A;  1DRM A;  1S67 L;  4L9G A;  4EES A;  1LSX A;  1OJ5 A;  4PKY A;  3G6O A;  4HH3 A;  2QJ7 A;  2JHE A;  2CMN A;  3LIA A;  1T1C A;  3UB8 A;  4E04 A;  4I39 A;  4R70 A;  3MQO A;  4H6J B;  4JGR A;  1LL8 A;  3C8C A;  5I5L A;  5HDS A;  1UWP X;  2I9V A;  4I3A A;  4R6L A;  2JN7 A;  1OTB A;  4HJ6 A;  1EW0 A;  2ZBB A;  3KX0 X;  2PD8 A;  4EER A;  1V9Y A;  1XFQ A;  3CLO A;  2Z6D A;  4M4X A;  3F1O A;  1N9L A;  3LIE A;  4HH2 A;  2OWJ A;  2H28 A;  2YKH A;  4I3I A;  3UE6 A;  4GHI A;  1D7E A;  4LRY C;  4GS9 A;  2D01 A;  5F69 A;  3LIF A;  1XFN A;  3FC7 A;  4GW9 A;  5HD3 A;  5F5Y A;  4XT2 B;  1S66 L;  4I3J A;  4F3L A;  5DJT A;  3CWF A;  2EA9 A;  3K3C A;  1T18 A;  4LRZ E;  3GEC A;  1LSV A;  1DP9 A;  4NXE A;  5HWV A;  1D06 A;  3LUQ A;  3C2W A;  4K08 A;  5TBM B;  3UB7 A;  3D72 A;  2V9A A;  4JGO A;  3A0S A;  2WKP A;  3BY9 A;  2PD7 A;  4WUJ A;  3FG8 A;  2A24 B;  5J4E A;  4HP9 A;  4NXF A;  5HWW A;  4H6J A;  4EEP A;  5AVE A;  1F9I A;  1JNU A;  2GJ3 A;  1LT0 A;  1DP8 A;  3SW1 A;  4EET B;  1P97 A;  2OWH A;  2B02 A;  2D02 A;  1TS6 A;  4HI4 A;  3H82 B;  3UME A;  1GSV A;  3K3D A;  3E4P A;  4HY8 A;  4WL9 A;  5EFW A;  3A0V A;  1ODV A;  4JGQ A;  2L1M A;  3MQQ A;  3NHQ A;  2WKR A;  1KOU A;  1XJ6 A;  4I5S A;  1F98 A;  3VE3 A;  4YWZ A;  5J7E A;  2VEA A;  3NOU C;  3NJA A;  3MXQ A;  3LIB A;  3MR0 A;  2ZOH A;  3UMD A;  3LID A;  1Y28 A;  2PYR A;  4R38 A;  5G4Y A;  4EXO A;  5F6A A;  3NOP C;  5G4Z A;  3MFX A;  3UB9 A;  1OTD A;  2INW A;  2VV7 A;  4I38 A;  4HQA A;  1UGU A;  3F1O B;  1OTA A;  2V1A A;  2OOL A;  3F1N A;  4HHD A;  4RQ9 A;  4WF0 A;  1TS0 A;  4KQD A;  4WN5 A;  4R3A A;  4L9F A;  2K7S A;  2A24 A;  1S4S A;  3PHY A;  2BAS A;  4HOI A;  4KUO A;  2WKQ A;  1TS7 A;  3F1P B;  3LIC A;  3IS2 B;  4HP4 A;  2HV1 A;  3ULF A;  2W27 A;  5J3W A;  3LI9 A;  5HSQ A;  1T19 A;  3H7W B;  4B9O A;  2PDR A;  2PHY A;  3HJI A;  3T50 A;  3H82 A;  2Z6C A;  5DKL A;  2J80 A;  1OJG A;  3CAX A;  4EW7 A; 
#chains in the Genus database with same CATH topology
 3O87 A;  5CTM A;  4DE1 A;  5CX7 A;  3LI8 A;  1FSW A;  2VGL S;  2WZX A;  2M7U A;  1PZP A;  4DJ3 A;  4BWI A;  1TF1 A;  5TR7 A;  2GZA A;  2VV6 A;  3HCY A;  4EQI A;  4OQG A;  1K6S A;  4OPQ A;  1MBL A;  1MZU A;  5HAQ A;  4N9K A;  1VEU A;  1W8Y A;  2L4R A;  1H0M A;  4YOF A;  4U3T A;  3DAV A;  4CLC E;  2A49 A;  3BFC A;  1TDG A;  2HJ9 C;  1U60 A;  1NY0 A;  2MJ6 A;  2XRN A;  2Y2G A;  2WAF A;  4XT2 A;  3G4P A;  4E3J A;  4BEN A;  1ZTU A;  3ICY A;  2Y2Q A;  1S1Z A;  2Y2L A;  4R4R A;  1KE0 A;  3RH8 B;  4G3K A;  2EWV A;  4HIA A;  3ZDJ A;  3IH8 A;  3KYE A;  2Y2J A;  5TBM A;  1T1B A;  3G30 A;  4MN5 A;  3MJQ A;  2Q9N A;  4S2I A;  3H9W A;  4ESP A;  4JGP A;  4GOG A;  2WGV A;  1OTI A;  3HL9 A;  4CLC B;  4HJ4 A;  1GSX A;  3GRJ A;  4JF6 A;  4HJ3 A;  2RCX A;  1YSP A;  3E4Q A;  5EVI D;  2XRO A;  4LRX C;  3NBL A;  5FQJ A;  1OT9 A;  4O8G A;  4S2N A;  1KE4 A;  4DF6 A;  1IYS A;  3OPR A;  2VV8 A;  3ZNY A;  4DRT A;  1CF0 A;  1K57 C;  2XFT A;  3IBR A;  5HDD A;  5A8B A;  3G31 A;  4ETZ A;  3ZVT A;  2DRW A;  5F68 A;  5GLB A;  4DE3 A;  2V0W A;  4Y0U A;  1GA9 A;  4GDN A;  4KZ6 A;  3U2A A;  4R4S A;  2W0N A;  3C38 A;  1XJ2 A;  4S2J A;  1NLY A;  3FPV A;  4GCZ A;  3ZG5 A;  3NOT C;  3O3V A;  5FAQ A;  3NI9 A;  3UB6 A;  3LR3 A;  3EOI A;  4PM5 A;  4E3O A;  3FZC A;  4OOY A;  5CER A;  4Q0I A;  1NJ4 A;  4EES A;  1LSX A;  4OVD A;  3JPU A;  3LO7 A;  2JHE A;  4UHU A;  3G2Z A;  3UB8 A;  2K31 A;  3HUN A;  4R70 A;  3HLC A;  4H6J B;  3MSH A;  1W79 A;  4R0Q A;  1DY6 A;  5I5L A;  3NCK A;  3TOI A;  1PW1 A;  1Q2Q A;  5M1A A;  1N9B A;  1K54 C;  1KGG A;  2ZBB A;  3KX0 X;  4EER A;  1XXM A;  2J9O A;  3F1O A;  3LIE A;  3E2L A;  2Y2K A;  3L7H A;  2P04 A;  4HBT A;  4I3I A;  1F5M A;  4Q0H A;  4N9L A;  1KDW A;  4YIN A;  4O0P A;  2FH5 A;  2H5S A;  1D7E A;  3PBR A;  1SDE A;  3DWK A;  3QP8 A;  4NK3 A;  2JKT I;  1H8Y A;  2ZL1 B;  3HLW A;  3S7P A;  4XT2 B;  1XGJ A;  2PU4 A;  2G7U A;  3UDI A;  2W3D A;  3D3O A;  4F3L A;  2V1Z A;  2PRF A;  3K3C A;  2QZ6 A;  1T18 A;  1WYC A;  3ZFZ A;  1H8Z A;  1DP9 A;  3HRE A;  1ESU A;  3LUQ A;  5FQI A;  4X6T A;  4LV2 A;  1NLZ A;  1FCO A;  4OOM A;  2XDM A;  4BJP A;  4FH4 A;  3G34 A;  5TBM B;  1VET B;  4OON A;  5EOO A;  4N1H A;  3D72 A;  3IH9 A;  3BY9 A;  4CLC C;  2HPB A;  3BW6 A;  3V3S A;  4WZ5 A;  5EM0 A;  3SZT A;  1CK3 A;  3VP1 A;  3MF0 A;  4C75 A;  3UE1 A;  3UE3 A;  4RX3 A;  3GVB A;  3LR5 A;  5JYO A;  2XEP A;  2XFS A;  4JXS A;  2B95 A;  4KZB A;  3BFE A;  4Y3I A;  4D60 A;  5GLC A;  2HDR A;  1SCW A;  1F9I A;  4HEF A;  3BFG A;  3OCL A;  2ZMA A;  5FQM A;  2GJ3 A;  3T4T A;  5EE8 A;  3NEC A;  2Y8H A;  3M2J A;  1TS6 A;  3H82 B;  4Z1W A;  3UME A;  3ZVW A;  3FWL A;  4YFM A;  3V5M A;  4HY8 A;  4WL9 A;  1PW8 A;  1YAX A;  3S7N A;  5DTK A;  1XKZ A;  2EXB A;  1W5D A;  4HBU A;  2P08 A;  2OAP 1;  5LBR A;  4R3J A;  2HDQ A;  4MDZ A;  2WKI A;  4KEN B;  3TE8 A;  4F94 A;  3GR2 A;  4I5S A;  4WYY A;  2EFU A;  3WS1 A;  3JYI A;  2XD5 A;  2Y2M A;  4ID4 A;  4E6W A;  4PHT A;  3UN7 A;  4EUV A;  1W63 M;  2ZOH A;  4BQM A;  2QPN A;  3OPH A;  2NUP C;  3IWQ A;  1ALQ A;  4EXO A;  5F6A A;  4EUZ A;  3DTI A;  1YPR A;  5G4Z A;  2EX2 A;  1SHV A;  4R1G A;  5F1G A;  4ZJ3 A;  4HQA A;  3SS5 A;  3F1O B;  3F1N A;  1ZG6 A;  3QP4 A;  1GHI A;  5A91 A;  3MS6 A;  3IX8 A;  4WN5 A;  3BJN A;  5FEF A;  2BTF P;  4K0X A;  3G2Y A;  4XXR A;  1S4S A;  4M3K A;  4OLD A;  3PHY A;  1LHY A;  2BAS A;  2Q9M A;  3LR0 A;  3ITB A;  4S2M A;  3IS2 B;  4JF4 A;  1FOF A;  2HV1 A;  2XLN A;  5GLD A;  2VGJ A;  2WUQ A;  5J3W A;  3DTM A;  4B4Z A;  3LI9 A;  3AGD A;  3B47 A;  2X71 A;  2PHY A;  5CEC A;  2E8I A;  3UB5 P;  2Z6C A;  3VMA A;  2VA0 A;  1OJG A;  1K4E A;  3WRZ A;  2ZM0 A;  5CEB A;  3CAX A;  2XK1 A;  5I94 A;  4FTX A;  2OAQ 1;  4R23 A;  4OKP A;  2ZQ8 A;  3BRM A;  3IXG A;  3PBQ A;  5AVF A;  1TDL A;  2XQZ A;  3MBZ A;  3VSK A;  2GX5 A;  4L9E A;  1CI8 A;  2QJ5 A;  3PYP A;  3G32 A;  3O5Y A;  5KIZ A;  5DF7 A;  3N7W A;  3BEC A;  1STZ A;  5EUA A;  3E98 A;  3EWK A;  5HZH A;  3TG9 A;  3MXS A;  4II7 A;  3ZYT A;  3IF6 A;  2IWD A;  1V9Z A;  2EFX A;  4ETX A;  1GCE A;  1OME A;  4CLC D;  4DMZ A;  4ZRR A;  2VX8 A;  3IHB A;  4KQR A;  3K2N A;  2P9V A;  3UPN A;  1GSW A;  4PKY G;  3CI6 A;  3TW8 A;  1PI5 A;  4WMC D;  1TS8 A;  1G6A A;  3LEZ A;  4XUZ A;  4JBF A;  2W3E A;  3U4L P;  3RTY A;  3OLO A;  2ZMF A;  4WZ4 A;  2ZQ7 A;  1ZG4 A;  1P0Z A;  4MEZ A;  3S22 A;  3HLE A;  1GA0 A;  3RXW A;  5JYP A;  1CEG A;  4MN6 A;  3A0R A;  1BLP A;  4EBL A;  2VLG A;  1E3U D;  3F1P A;  3EGD C;  3VE4 A;  1DP6 A;  3AGE A;  1RGZ A;  2KLI A;  3ZG8 B;  2VGK A;  4EEU A;  3A3E A;  2W3F A;  3EEH A;  4S2O A;  2V1B A;  5HPF A;  3W4Q A;  4WEJ A;  1J3W A;  1AWI A;  1S4R A;  5AQ7 A;  4GHI B;  4BBV A;  4EBN A;  3QP1 A;  1OTE A;  4GS9 B;  1PRQ A;  3CUE A;  4PM6 A;  1QME A;  1T1A A;  2R9W A;  2ACG A;  5DF8 A;  3BYD A;  4KG6 A;  3EQU A;  2H0T A;  3O86 A;  1N9O A;  4X56 A;  1XA7 A;  4Q0J A;  3BFF A;  1ZKJ A;  3V50 A;  4QB8 A;  2L0W A;  4Y7P A;  4IVI A;  1FIL A;  3CG5 A;  3KYQ A;  1ES3 A;  3QP6 A;  4KZ7 A;  1NWZ A;  3TSG A;  2OLV A;  2PBY A;  3BWL A;  5FL3 A;  4EU0 A;  4C6Y A;  2E8J A;  4WBG A;  5HDC A;  3F1N B;  4LLO B;  3HJK A;  1LL9 A;  3IBJ A;  3KSG A;  1CEF A;  2JKF A;  1Z09 A;  4KUK A;  3IX4 A;  2UWX A;  1TD5 A;  4FUW A;  4OOL A;  4L9G A;  3Q7V A;  1BSG A;  1OJ5 A;  2PT7 A;  3LY4 A;  5CED A;  2Y55 A;  2QJ7 A;  1IFQ A;  2V8C A;  4WEK A;  3WS0 A;  1IKI A;  3ZG7 B;  1FCN A;  1BTL A;  3MQO A;  4JGR A;  1LL8 A;  1K6R A;  2K2N A;  4GJ4 A;  3C8C A;  1RCJ A;  1YLJ A;  5GHZ A;  5F82 A;  1YT4 A;  2P74 A;  3GTC A;  3W4P A;  2X02 A;  4IVK A;  4C3Q A;  1PZO A;  2WKH A;  2XD1 A;  4LV1 A;  2ZC7 A;  3MXR A;  3WS2 A;  4Y0O A;  2HP9 A;  4R6L A;  3VP3 A;  2J8Y A;  3MZF A;  2XA7 S;  4MNR A;  1O07 A;  1XFQ A;  3CLO A;  2Z6D A;  3HLF A;  2OWJ A;  2H28 A;  3R7W A;  2EX8 A;  4OPY A;  3UE6 A;  3HUO A;  4LRY C;  3RXX A;  1VQQ A;  5GLA A;  1XFN A;  5HD3 A;  4UAA A;  5D3O A;  3RJU A;  2OSU A;  1S66 L;  3BQA A;  5MC7 A;  4I3J A;  5DJT A;  3CWF A;  4GKU A;  2P9V B;  3MZE A;  3A3J A;  1N4O A;  5FQ9 A;  4LRZ E;  5HPI A;  1D06 A;  3C2W A;  3T12 B;  4K08 A;  2GDN A;  1FQG A;  3PBN A;  3QNC A;  1Y4O A;  3T4J A;  5EVI A;  2ZC6 B;  2V9A A;  4IUK A;  3A0S A;  2ZM2 A;  2WKP A;  5L07 A;  1DJC A;  4RA7 A;  4NG2 A;  4E3L A;  3IHA A;  5GL9 A;  4WUJ A;  4QU3 A;  4OPZ A;  2J9P A;  3IT9 A;  5J4E A;  3NUL A;  4HP9 A;  3PXP A;  1KGE A;  1Z6F A;  4NXF A;  3VFH A;  4EEP A;  2J3T C;  1JTD A;  4GZB A;  1FIK A;  4P6Z S;  2Y79 A;  4LFU A;  4E6X A;  4QY6 A;  4GB7 A;  3HVF A;  2JKR M;  2B02 A;  5TJJ A;  2WZZ A;  4K0W A;  5FA7 A;  3E4P A;  4ARZ A;  3BLM A;  4E3M A;  1SDN A;  2ZMV A;  2L1M A;  3D9Y A;  1YQS A;  4ZJ1 A;  1YLY A;  4X55 A;  1KOU A;  5FAT A;  5FI2 A;  1PYY A;  4QJG A;  1JWV A;  1P9W A;  1PI4 A;  4R3B A;  5M18 A;  3A3D A;  2G2W A;  4UQI S;  1H3Q A;  3Q7V B;  4UEY A;  4Y17 A;  1HTZ A;  1VEU B;  4LCM A;  2C5W B;  3OC2 A;  2VEA A;  3NJA A;  5FQQ A;  1L0E A;  3MXQ A;  1G5U A;  5AQA A;  3MR0 A;  4QD4 A;  1YSQ A;  2PAV P;  3C4O A;  1D1J A;  4N92 A;  4R38 A;  5HL1 A;  4RX2 A;  4WEL A;  1Q2P A;  5FEG A;  2WGW A;  3AGF A;  3NOP C;  4LV0 A;  3DBA A;  1ES2 A;  1OPX A;  1A0K A;  1W63 Q;  5AQ9 A;  1F2K A;  4JF5 A;  4Y2F A;  1OTD A;  2INW A;  1JWP A;  1UGU A;  2WYX A;  4KZ8 A;  1H8M A;  3FYZ A;  2JBF A;  1M40 A;  1BT5 A;  1OTA A;  1TEM A;  2IWC A;  2V1A A;  2OOL A;  4HHD A;  3HLD A;  3WS4 A;  4OQI A;  1S0W A;  4DE0 A;  3R7W B;  1IOU A;  4WF0 A;  1KGF A;  2O9C A;  4OP8 A;  3FKV A;  2A24 A;  3VOY A;  4D2O A;  5E2F A;  2WKQ A;  1TS7 A;  4KG5 A;  2V2F F;  1AXB A;  5HAR A;  4IHQ A;  1KVL A;  4FH2 A;  3IXH A;  3QP2 A;  2Y4A A;  2KOI A;  1I2W A;  4P0M A;  3UPP A;  1O7E A;  3UPO A;  4KZ3 A;  3VV4 A;  5DKL A;  3CJM A;  4DKI A;  5F83 A;  1BZA A;  1XX2 A;  2QWS A;  1YM1 A;  2Y2O A;  2DNS A;  4DN0 A;  3C5A A;  2CC1 A;  4HES A;  2W3G A;  4BBU A;  4ZBE A;  3V39 A;  4NET A;  3TRC A;  3NY4 A;  3PBO A;  1YLP A;  3UY6 A;  3ZG0 A;  1RGY A;  3CIT A;  1C3B A;  4BBT A;  1VHM A;  3D4F A;  1VB6 A;  3WRT A;  5EOE A;  1NZO A;  4MLL A;  5CGX A;  5HX9 A;  1IEL A;  3B3X A;  4NEE D;  4MBK A;  1PWC A;  5CHM A;  2PR6 A;  5FDS A;  4NXB A;  1S1Y A;  4CPK A;  2VGL M;  3HLG A;  3UO9 A;  3MKF A;  1LI0 A;  4EQ1 A;  5KMW A;  1K57 A;  2J3T D;  1MWR A;  2WGI A;  1W7F A;  2XSS A;  3ITA A;  3S7Q A;  2W1T A;  3Q07 A;  1FCM A;  4Y5F A;  1SKO A;  2PR5 A;  1K25 A;  1TVF A;  4FD8 A;  3SOI A;  1XJ3 A;  1G28 A;  1PIO A;  2P7J A;  2KDK A;  5HD5 A;  2VZW A;  2ZC5 B;  2HP5 A;  4ME4 A;  5HWT A;  3H7W A;  4CJN A;  3E4O A;  1FSY A;  3W8K A;  2ZC4 B;  4LGW A;  1NRJ A;  5DJU A;  3IF5 A;  4B88 A;  2NUT C;  5HFO A;  2Y2P A;  4F3L B;  2A3U A;  1MWU A;  1EI5 A;  3B33 A;  1K54 A;  2Y91 A;  4BD0 A;  5M19 A;  2JC7 A;  4GLQ A;  4LPZ A;  1CQA A;  3HLB A;  3I7J A;  2JKR I;  4NXG A;  5J8X A;  2JKG A;  3SH9 A;  2HZ5 A;  4OH0 A;  4KZ9 A;  2O0Y A;  4BL2 A;  1CJF A;  3GMW A;  1DRM A;  1S67 L;  2HDU A;  1P9R A;  4PKY A;  3G6O A;  5CHJ A;  1HZO A;  2ZM8 A;  4IJG A;  4S2K A;  2J3W A;  2V20 A;  2VKS A;  2CMN A;  3LIA A;  1K55 A;  4E04 A;  4I39 A;  4QHC A;  3W2Z A;  3LY3 A;  4UA6 A;  2W1R A;  2HGV A;  4S2N C;  3HBR A;  3OBF A;  5TGF A;  1PWG A;  2LB9 A;  5HDS A;  3WWX A;  3IWI A;  3P09 A;  1UWP X;  2JCH A;  1BUE A;  1YLZ A;  3N8S A;  1OTB A;  5EVI C;  5KSH A;  4NKP A;  2DCF A;  2PD8 A;  2HJE A;  4WM9 A;  3MZD A;  3KO6 A;  5CGS A;  1LI9 A;  4PMA A;  2XF3 A;  4M4X A;  3KSH A;  1N9L A;  3KYZ A;  4HH2 A;  2EWW A;  4OQH A;  4A5R A;  3DTE A;  4CLC A;  1MY8 A;  4DXB A;  2DMW A;  2ZQA A;  2R9X A;  4KQQ A;  1BLC A;  3M6H A;  1G6O A;  4IED A;  4WMC A;  1K56 D;  1IKG A;  4GW9 A;  1PFL A;  5EPH A;  4P6B A;  3ZG9 B;  5DTS A;  3T4O A;  5EEC A;  5E2E A;  1FR1 A;  4KZ4 A;  5F1F A;  4L0L A;  1E3U A;  4U0X A;  1LSV A;  3IXB A;  5HL6 A;  1GHP A;  4NXE A;  4P85 A;  2H10 A;  1XA1 A;  5A93 A;  3S1Y A;  3T4S A;  3GV9 A;  3FKW A;  3UB7 A;  3S4X A;  3VP4 A;  1SKO B;  1MWT A;  4JGO A;  3VOZ A;  3BEB A;  3PAE A;  1JWZ A;  3FG8 A;  4JXG A;  2O99 A;  3CMZ A;  3C30 A;  3C4P A;  5HWW A;  4H6J A;  3PBT A;  3QHY A;  1ONH A;  2ZD8 A;  3A3I A;  5AVE A;  3Q1F A;  2WK0 A;  3P01 A;  3E2K A;  3EGX C;  2OV5 A;  3PTE A;  1L3L A;  4EET B;  3JVU A;  4JKT A;  2GNX A;  3CPT A;  3MFD A;  2WKE A;  3DTK A;  4HI4 A;  3S7O A;  3DW0 A;  3K3D A;  3T1R A;  1I2S A;  4QY5 A;  3Q81 A;  4U0T A;  3LCE A;  4Q8I A;  4S2P A;  3LEQ A;  3VP2 A;  2IWB A;  3BLS A;  1XJ6 A;  1XP4 A;  4X25 A;  4QWO A;  4WZ5 C;  1F98 A;  2LB5 A;  2FZ0 A;  3HUM A;  4FSF A;  2ZL1 A;  1XPB A;  3IWO A;  4YWZ A;  5J7E A;  5DFX A;  1L0G A;  3T4K A;  3IF6 B;  3LID A;  1K0K A;  1VM1 A;  5A90 A;  1MWS A;  2B5R A;  2PYR A;  5G4Y A;  5G18 A;  1K4F A;  3UNW A;  3MFX A;  3OCN A;  1VET A;  3C7U A;  2VV7 A;  3SS4 A;  1NXY A;  4I38 A;  4BD1 A;  5DF9 A;  2ZJ9 A;  1ONG A;  4Y0T A;  4JLF A;  4X1L A;  5FQK A;  2PU2 A;  2FFF B;  1MKI A;  4L9F A;  2RL3 A;  4JXW A;  4HOI A;  4KUO A;  3QNB A;  4IBX A;  3F1P B;  3LIC A;  4ZJ2 A;  3NC8 A;  4PM9 A;  5CTN A;  5E2H A;  5TFQ A;  3ULF A;  1BLH A;  2FFY A;  2QMI A;  2W27 A;  4RYE A;  5HSQ A;  3ZCZ A;  1T19 A;  3G35 A;  4ZTK A;  4X68 A;  3NDG A;  3H82 A;  4EW7 A;  5DTT A;  2V0U A;  3VOL A;  5CHU A;  2QKP A;  2JE5 A;  4B4X A;  4X1M A;  2EX9 A;  2KX6 A;  3N8L A;  1G68 A;  2OLU A;  4BMW A;  3M6B A;  5FAS A;  5IHV A;  4H8R A;  2H0Y A;  5AJG A;  2AVX A;  1ES4 A;  2YKF A;  3B42 A;  1XJ4 A;  1IYQ A;  2WAD A;  4HNB A;  2A2L A;  1IYP A;  2QHK A;  3N8R A;  3Q7Z A;  2R78 A;  4ZAM A;  4WLA A;  1ACF A;  1YKD A;  5L2F A;  4E3K A;  1NZU A;  4DJ2 A;  2V8F A;  4K91 A;  1N9N A;  4KZA A;  1LL5 A;  4GD6 A;  3CPT B;  1ERO A;  4BLM A;  1NYY A;  1HD8 A;  2O9B A;  4EWF A;  4XUX A;  3BY8 A;  4MBF A;  2M1C A;  5GHX A;  3L9K A;  3PR6 A;  1BYW A;  1UWN X;  1EWZ A;  5KSC A;  2Y59 A;  1OT6 A;  1JTG A;  1ERQ A;  1L0D A;  3IS2 A;  4IBR A;  1MPL A;  4GD8 A;  5IS1 A;  2EX6 A;  1K55 C;  2Y2H A;  4DE2 A;  1SZV A;  1PWD A;  2ZOI A;  4DXC A;  1IYO A;  3IF6 C;  2Z2L B;  2PBD P;  4OPR A;  3LYX A;  5CXW A;  1LSW A;  2QYB A;  1ERM A;  3GDI A;  2W3H A;  3ZQ5 A;  4X69 A;  1DJA A;  1NYM A;  5DKK A;  3IX3 A;  3CHW P;  1RP5 A;  4N1X A;  1WA9 A;  3RFB A;  3M2K A;  4FCF A;  1I5Q A;  3EQV A;  1S6R A;  4OQ0 A;  4E3I A;  5FI7 A;  3ZGA B;  4PM7 A;  3LR4 A;  2PYP A;  1YMS A;  2ZLY A;  4X53 A;  3MMH A;  4Z9Q A;  5HAI A;  3P7N A;  5E43 A;  3FPW A;  5FDH A;  3R4K A;  3LFV A;  5FAO A;  2BLS A;  3IXD A;  2EXA A;  4MCW A;  5EVI B;  5IU1 A;  1X0O A;  2X01 A;  2ZQD A;  3VP0 A;  1WE4 A;  1FR6 A;  4EV4 A;  4HH3 A;  3EEA A;  4P87 A;  4GNU A;  3OOV A;  4MN7 A;  2Z2M B;  4OP5 A;  3CUE C;  1T1C A;  1GHM A;  1MXO A;  1J9M A;  4KZ5 A;  4Y13 A;  1CI9 A;  3BM6 A;  5U47 A;  1NRF A;  2I9V A;  4I3A A;  2JN7 A;  2Y2I A;  4JXV A;  4HJ6 A;  1YMX A;  1EW0 A;  5KZH A;  3LGO A;  2ZQ9 A;  4GDB A;  3JVV A;  1Y54 A;  1V9Y A;  5DVA A;  1HLU P;  3A3F A;  1ZHH B;  2YKH A;  3E0Y A;  4ARZ B;  4PPR A;  3ISG A;  4G3V A;  3UE0 A;  2XR0 A;  4GHI A;  3N4I A;  3C7V A;  5EVE A;  4G3W A;  2I72 A;  3FV7 A;  4GS9 A;  2D01 A;  1IEM A;  5F69 A;  3LIF A;  3FC7 A;  3KSI A;  2IA2 A;  3ZNT A;  5F5Y A;  1KE3 A;  3TJZ C;  4EBP A;  5GHY A;  2XH9 A;  3ZHH A;  4OLG A;  2EA9 A;  4MBH A;  1MKM A;  2C6W B;  3GEC A;  2XA7 M;  5EM1 A;  5HWV A;  5E2G A;  3GQZ A;  3SH8 A;  4DDS A;  1DJB A;  2G2U A;  4DDY A;  2WGW B;  1H5X A;  2UV0 E;  1XGI A;  2ZC3 B;  2M7V A;  1M6K A;  5L10 A;  3V3R A;  3W4O A;  4Y15 A;  4UA7 A;  2ZQC A;  2PD7 A;  1L0F A;  2A24 B;  3NIA A;  1E25 A;  4O01 A;  3MKE A;  1K38 A;  2HP6 A;  4LCL A;  1YLT A;  4E3N A;  1HVB A;  3OZH A;  1JNU A;  5EV0 A;  1SKF A;  2HF6 A;  2O9A A;  1LT0 A;  4LEN A;  1DP8 A;  3SS3 A;  3SW1 A;  1P97 A;  1ES5 A;  2OWH A;  5HAP A;  3GSG A;  2D02 A;  2WAE A;  5HW3 A;  1GSV A;  3V67 A;  1ESI A;  3T1Q B;  5CRF A;  4GN2 A;  4UA9 A;  5K5B A;  5EFW A;  3A0V A;  1BUL A;  3IQA A;  1ODV A;  3T4Q A;  1WYB A;  4JGQ A;  3KSF A;  5FAP A;  3MQQ A;  3NHQ A;  3UDX A;  2VK3 A;  3WS5 A;  2B18 A;  2WKR A;  3T1S A;  3SH7 A;  2Y2N A;  4JPM A;  1L2S A;  3VSL A;  3VE3 A;  5CGW A;  3OPL A;  1LLB A;  4KG2 A;  2VJW A;  3PBS A;  5DFY A;  3QP5 A;  3P98 A;  3NOU C;  1E4D A;  3N6I A;  3LIB A;  5L09 A;  3UMD A;  3Q82 A;  2XGN A;  4P6Z M;  1Y28 A;  5FSR A;  3T4L A;  3BFD A;  4YNR A;  1KVM A;  3T1X A;  1JVJ A;  1ZC2 A;  4RVA A;  3CZD A;  3UB9 A;  5C5K A;  4IUH A;  1MC0 A;  4AFI A;  4PAU A;  1K56 A;  4B93 A;  1KDS A;  1BLS A;  3OPP A;  4RQ9 A;  1YLW A;  2JKT M;  4QPR A;  1TS0 A;  3UDF A;  4KQD A;  4BL3 A;  4R3A A;  4KQO A;  5L8M A;  4O7D A;  2K7S A;  4UQI M;  2W1T B;  3VFF A;  5IT5 A;  2Q0O A;  5FI6 A;  4S2L A;  3BQ8 A;  3PAG A;  1PNE A;  4MMN A;  1QMF A;  4HP4 A;  2BG1 A;  4PM8 A;  3O88 A;  4LV3 A;  3MQ0 A;  5BOH A;  5AQB A;  2HDS A;  4FOF A;  3H7W B;  4B9O A;  5A92 A;  1W8Q A;  2PDR A;  4CQH A;  3HJI A;  3T50 A;  3DWZ A;  5EVL A;  3NDE A;  2J80 A;  4ZDX A;  2J7V A; 
#chains in the Genus database with same CATH homology
 2V0U A;  3VOL A;  2QWS A;  5CX7 A;  3LI8 A;  2OAQ 1;  2VGL S;  3PBQ A;  2QKP A;  5AVF A;  2M7U A;  4DJ3 A;  4DN0 A;  4BWI A;  1TF1 A;  2GZA A;  2VV6 A;  3HCY A;  2GX5 A;  4L9E A;  2KX6 A;  2W3G A;  4BBU A;  4BMW A;  2QJ5 A;  1MZU A;  3TRC A;  3PYP A;  3O5Y A;  5AJG A;  5KIZ A;  3PBO A;  1STZ A;  3E98 A;  3EWK A;  5HZH A;  2YKF A;  3CIT A;  2L4R A;  1VHM A;  4BBT A;  1VB6 A;  3B42 A;  4II7 A;  4YOF A;  3ZYT A;  1XJ4 A;  4CLC E;  4HNB A;  2A2L A;  2QHK A;  1V9Z A;  2HJ9 C;  2R78 A;  4ETX A;  2MJ6 A;  4WLA A;  4NEE D;  1YKD A;  2XRN A;  4CLC D;  4XT2 A;  4DMZ A;  4ZRR A;  2VX8 A;  2PR6 A;  4DJ2 A;  1ZTU A;  3ICY A;  1N9N A;  3K2N A;  4NXB A;  1GSW A;  1S1Z A;  1S1Y A;  4PKY G;  3CI6 A;  3TW8 A;  2O9B A;  2VGL M;  1TS8 A;  3RH8 B;  4G3K A;  2EWV A;  4EQ1 A;  2W3E A;  4HIA A;  3RTY A;  2J3T D;  3OLO A;  2ZMF A;  2XSS A;  1P0Z A;  3BY8 A;  3S7Q A;  2M1C A;  1T1B A;  5TBM A;  2W1T A;  4MN6 A;  3PR6 A;  1BYW A;  1UWN X;  3A0R A;  4MN5 A;  4Y5F A;  3MJQ A;  2PR5 A;  2VLG A;  3F1P A;  3EGD C;  3VE4 A;  1OT6 A;  1DP6 A;  3H9W A;  2KLI A;  3IS2 A;  4JGP A;  4EEU A;  1XJ3 A;  1G28 A;  5IS1 A;  2P7J A;  2KDK A;  5HD5 A;  1OTI A;  2W3F A;  3EEH A;  4CLC B;  4HJ4 A;  2V1B A;  2VZW A;  1GSX A;  5HPF A;  4WEJ A;  2ZOI A;  4HJ3 A;  4ME4 A;  5HWT A;  3H7W A;  1S4R A;  1YSP A;  4GHI B;  4BBV A;  3E4O A;  3E4Q A;  3LYX A;  1OTE A;  1LSW A;  4GS9 B;  3CUE A;  1T1A A;  2XRO A;  4LRX C;  2QYB A;  1OT9 A;  4O8G A;  3EQU A;  1NRJ A;  5DJU A;  3GDI A;  2W3H A;  1N9O A;  4Q0J A;  2NUT C;  3ZQ5 A;  2L0W A;  5DKK A;  2VV8 A;  3KYQ A;  4F3L B;  1NWZ A;  1WA9 A;  3B33 A;  3RFB A;  3IBR A;  3BWL A;  5FL3 A;  5HDD A;  5A8B A;  3EQV A;  4ETZ A;  4EU0 A;  5F68 A;  2V0W A;  3LR4 A;  5HDC A;  3F1N B;  2PYP A;  4GLQ A;  3U2A A;  4LLO B;  2W0N A;  3HJK A;  3C38 A;  3MMH A;  4LPZ A;  3P7N A;  1XJ2 A;  1NLY A;  3FPV A;  3FPW A;  4GCZ A;  3NOT C;  2JKR I;  4NXG A;  3R4K A;  3IBJ A;  3LFV A;  3LR3 A;  3UB6 A;  3KSG A;  3EOI A;  2O0Y A;  4MCW A;  5IU1 A;  1X0O A;  4KUK A;  1TD5 A;  4OOL A;  1DRM A;  4Q0I A;  1S67 L;  4L9G A;  4EES A;  1LSX A;  1OJ5 A;  2PT7 A;  1P9R A;  4PKY A;  3G6O A;  4HH3 A;  4IJG A;  3EEA A;  4MN7 A;  3OOV A;  2J3W A;  1IFQ A;  2JHE A;  2QJ7 A;  2VKS A;  4WEK A;  2CMN A;  3CUE C;  1T1C A;  2K31 A;  3LIA A;  3UB8 A;  4E04 A;  4I39 A;  4R70 A;  3W2Z A;  3MQO A;  2W1R A;  4H6J B;  2HGV A;  4JGR A;  1LL8 A;  2K2N A;  4GJ4 A;  3C8C A;  3OBF A;  5I5L A;  2LB9 A;  5HDS A;  1UWP X;  2I9V A;  4I3A A;  4R6L A;  2JN7 A;  1OTB A;  2XA7 S;  5KSH A;  4HJ6 A;  4NKP A;  1EW0 A;  2ZBB A;  3KX0 X;  2PD8 A;  4EER A;  2HJE A;  3KO6 A;  3JVV A;  1V9Y A;  1XFQ A;  3CLO A;  2Z6D A;  4M4X A;  3F1O A;  3KSH A;  3LIE A;  1N9L A;  3KYZ A;  1ZHH B;  4HH2 A;  2OWJ A;  2EWW A;  2H28 A;  2YKH A;  3R7W A;  2P04 A;  3E0Y A;  4I3I A;  4ARZ B;  4CLC A;  1F5M A;  4Q0H A;  2DMW A;  4O0P A;  4G3V A;  2FH5 A;  3UE6 A;  4GHI A;  1D7E A;  3PBR A;  4LRY C;  4G3W A;  4GS9 A;  2D01 A;  5F69 A;  3LIF A;  1G6O A;  1XFN A;  3FC7 A;  3KSI A;  2IA2 A;  2JKT I;  4GW9 A;  5HD3 A;  3T4O A;  5F5Y A;  3S7P A;  4XT2 B;  3TJZ C;  2G7U A;  1S66 L;  3BQA A;  2W3D A;  5MC7 A;  3D3O A;  4I3J A;  5DJT A;  4F3L A;  3CWF A;  2EA9 A;  4L0L A;  3K3C A;  1T18 A;  4LRZ E;  1MKM A;  3GEC A;  5HPI A;  1LSV A;  1DP9 A;  2XA7 M;  5HL6 A;  4NXE A;  5HWV A;  1D06 A;  3LUQ A;  3C2W A;  4K08 A;  1NLZ A;  4OOM A;  4BJP A;  3T4S A;  5TBM B;  3PBN A;  3T4J A;  3UB7 A;  2M7V A;  3D72 A;  2V9A A;  4IUK A;  4JGO A;  3A0S A;  2WKP A;  3BY9 A;  4CLC C;  3BW6 A;  2PD7 A;  4WUJ A;  3FG8 A;  2O99 A;  3MF0 A;  2A24 B;  3UE3 A;  5J4E A;  3C30 A;  4HP9 A;  3PXP A;  3LR5 A;  4O01 A;  4NXF A;  5HWW A;  4H6J A;  3PBT A;  4Y3I A;  4EEP A;  2J3T C;  5AVE A;  1F9I A;  1JNU A;  2HF6 A;  2O9A A;  3OCL A;  3P01 A;  2GJ3 A;  1LT0 A;  3EGX C;  1DP8 A;  4P6Z S;  3SW1 A;  3T4T A;  4EET B;  2Y79 A;  3JVU A;  1P97 A;  2OWH A;  2GNX A;  2JKR M;  2B02 A;  2Y8H A;  2D02 A;  1TS6 A;  4HI4 A;  5TJJ A;  3S7O A;  3H82 B;  4Z1W A;  3UME A;  1GSV A;  3V67 A;  3K3D A;  3E4P A;  4HY8 A;  4WL9 A;  1YAX A;  3S7N A;  5K5B A;  5EFW A;  3A0V A;  4ARZ A;  1ODV A;  3T4Q A;  2P08 A;  2ZMV A;  4JGQ A;  3KSF A;  2L1M A;  2OAP 1;  5LBR A;  3MQQ A;  3NHQ A;  2B18 A;  2WKR A;  1KOU A;  4MDZ A;  1XJ6 A;  3TE8 A;  4I5S A;  1P9W A;  1F98 A;  2LB5 A;  2FZ0 A;  4FSF A;  4UQI S;  1H3Q A;  4UEY A;  3VE3 A;  2VJW A;  3PBS A;  4PHT A;  5DFY A;  3OC2 A;  4YWZ A;  5J7E A;  2VEA A;  3NOU C;  3NJA A;  5DFX A;  3MXQ A;  3LIB A;  1W63 M;  4EUV A;  3MR0 A;  2ZOH A;  3UMD A;  3T4K A;  1YSQ A;  3LID A;  4P6Z M;  1Y28 A;  2NUP C;  3T4L A;  4YNR A;  2PYR A;  4R38 A;  5G4Y A;  4EXO A;  4WEL A;  5F6A A;  3NOP C;  3DBA A;  5G4Z A;  3MFX A;  1OPX A;  1W63 Q;  3OCN A;  4Y2F A;  3UB9 A;  1OTD A;  2INW A;  2VV7 A;  5C5K A;  4I38 A;  4HQA A;  4IUH A;  1UGU A;  1MC0 A;  1H8M A;  3F1O B;  4AFI A;  4PAU A;  1OTA A;  5DF9 A;  4B93 A;  2V1A A;  2OOL A;  3F1N A;  4HHD A;  3R7W B;  1IOU A;  4RQ9 A;  4WF0 A;  2JKT M;  4QPR A;  1TS0 A;  2O9C A;  4KQD A;  3BJN A;  4WN5 A;  4R3A A;  4KQO A;  5L8M A;  4L9F A;  2K7S A;  2A24 A;  4UQI M;  2W1T B;  1S4S A;  5IT5 A;  3PHY A;  2BAS A;  4HOI A;  4KUO A;  3LR0 A;  2WKQ A;  1TS7 A;  3BQ8 A;  3F1P B;  3LIC A;  4MMN A;  4IHQ A;  3IS2 B;  4HP4 A;  2HV1 A;  3ULF A;  2W27 A;  5J3W A;  2KOI A;  3MQ0 A;  3LI9 A;  5HSQ A;  1T19 A;  4FOF A;  3H7W B;  4B9O A;  3B47 A;  2PDR A;  3VV4 A;  2PHY A;  4CQH A;  3HJI A;  3T50 A;  3H82 A;  2Z6C A;  5DKL A;  2VA0 A;  2J80 A;  1OJG A;  3CAX A;  4EW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...