1T19A

Early intermediate ie2 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t19A00
4GHIB 3T50A 3LIAA 3OLOA 3NOPC 1EW0A 1D7EA 4E04A 3LIFA 4H6JB 4EXOA 3UB8A 3FC7A 4EETB 4WUJA 4R38A 3D72A 4I38A 3CLOA 3ZQ5A 3LIDA 3UB7A 3VOLA 1WA9A 2L4RA 3CAXA 3A0VA 1LSVA 3LIBA 2WKPA 1OJGA 4B9OA 1XJ4A 3CWFA 4DJ3A 1F9IA 3F1NA 2KX6A 4R70A 4I3AA 3MJQA 2Z6DA 3UMEA 1KOUA 3A0SA 1UWPX 3HJKA 4HH2A 3K3CA 5F69A 2V0WA 3E4OA 2D01A 2ZOIA 3BWLA 3F1PB 4L9FA 1ODVA 4JGOA 2B02A 2A24A 4HJ6A 1TS6A 4YWZA 1XJ3A 1NWZA 2QJ7A 1OTAA 3EWKA 1BYWA 1DP8A 3RH8B 3MR0A 4R3AA 2PD8A 4LPZA 4PKYG 2OOLA 1UGUA 2WKRA 1VB6A 1S1ZA 3NOTC 5HWVA 2JN7A 1LSXA 4F3LA 4WLAA 3GECA 3MQOA 2M1CA 5DKKA 2BASA 3C8CA 5DJTA 1TS0A 2R78A 1S67L 2ZBBA 2GJ3A 1G28A 4EEPA 5J7EA 4M4XA 4I3IA 3KX0X 5F5YA 4K08A 5DJUA 4HH3A 1GSXA 4XT2A 2VV8A 2V0UA 1XJ2A 3H82A 4GS9B 4KUKA 3LI9A 2K7SA 3NOUC 4HJ3A 3UMDA 3ICYA 3RTYA 1LL8A 3F1NB 2W0NA 5I5LA 3VE4A 3H7WA 3VE3A 3G6OA 4LRXC 5HD3A 1OT6A 2PR6A 1GSWA 4R6LA 4GCZA 5AVEA 4H6JA 5G4YA 1S4SA 4LRZE 3PHYA 3F1OA 2ZOHA 3UB6A 3IBRA 3B33A 1DP9A 2PD7A 2JHEA 1OTEA 2Z6CA 4HNBA 1UWNX 4NXGA 4HHDA 3LIEA 2YKHA 4BBUA 1OT9A 4L9GA 1OTIA 4LRYC 4KUOA 4F3LB 1XFNA 2QKPA 3IS2B 2W27A 3FG8A 1S1YA 4JGPA 3LI8A 3EEHA 4HY8A 3NHQA 2WKQA 5HWWA 1XJ6A 2L0WA 3C2WA 3F1PA 1V9ZA 2V9AA 2L1MA 4BBTA 4MN5A 3H82B 3A0RA 2P7JA 4KQDA 1Y28A 4HI4A 4WF0A 2D02A 4MN6A 4HOIA 3UB9A 2QHKA 4GW9A 4RQ9A 5AVFA 4EEUA 3K3DA 5HZHA 1GSVA 3HJIA 1T19A 4I39A 1N9NA 3PYPA 5IS1A 1S66L 2YKFA 4I3JA 5HDSA 3E4PA 3LICA 1P0ZA 5TBMA 2PYRA 5J3WA 2HV1A 1DRMA 5KIZA 5HSQA 5F68A 3F1OB 1OTBA 5A8BA 4GHIA 3LYXA 3ULFA 2A24B 2H28A 1T1CA 2VLGA 4GS9A 5HWTA 5J4EA 4JGQA 1MZUA 5HDCA 2V1BA 4WL9A 1JNUA 4DJ2A 1N9LA 5HDDA 4HJ4A 1N9OA 3GDIA 4NXEA 3SW1A 2OWJA 2INWA 2PDRA 1T1AA 3MQQA 4BBVA 4EQ1A 4EERA 1DP6A 3LUQA 4HQAA 5F6AA 1T1BA 1F98A 3UE6A 2KDKA 4HP9A 1LSWA 1X0OA 3E4QA 5IU1A 3P7NA 5G4ZA 1TS7A 1OJ5A 3H9WA 2V1AA 4EW7A 2PYPA 4NXBA 4XT2B 5EFWA 2VV7A 4EESA 1LT0A 2EA9A 2PHYA 2QWSA 2CMNA 3BY9A 4HP4A 2VEAA 1T18A 4HIAA 3BY8A 1P97A 4PKYA 5DKLA 4I5SA 1S4RA 2OWHA 1XFQA 4LLOB 2I9VA 1D06A 5HD5A 3IS2A 4WN5A 2VV6A 3NJAA 1OTDA 4NXFA 3MFXA 2QJ5A 1V9YA 3H7WB 4JGRA 5TBMB 4L9EA 2J80A 3MXQA 2PR5A 1TS8A
chains in the Genus database with same CATH superfamily
3T50A 4EQIA 3Q7VA 3NOPC 1VHMA 3P01A 3EGDC 3Q81A 3UNWA 1CI9A 3BFGA 3IWQA 4B93A 3C7VA 2Y2KA 3GTCA 2EX9A 3UB8A 1C3BA 4Z1WA 1ONGA 3DW0A 1FILA 3NC8A 4PAUA 1ES5A 2L4RA 2VX8A 2J7VA 5U47A 3ITAA 3OPPA 3B47A 1LI0A 2VA0A 1OJGA 1F2KA 4B9OA 3UE3A 4DJ3A 2HJ9C 3GMWA 4G3KA 3NI9A 4UA6A 3S22A 3MJQA 1VEUA 5L07A 5AQ7A 2JKTM 4S2IA 2EFUA 2ZQ9A 3BWLA 3IF6B 2W1RA 4LV0A 2BLSA 4HJ6A 1TS6A 2V8CA 2ZMAA 1HVBA 1SHVA 4XUXA 1XJ3A 3HLBA 1CK3A 4Y0TA 1Y4OA 3RJUA 1WE4A 3LR4A 2Z2LB 2V20A 1GA9A 1ES4A 1TDLA 4O0PA 5L09A 3S7PA 1ZKJA 2HDUA 2B5RA 1GCEA 1DY6A 4GZBA 5JYOA 1PZOA 2PD8A 4E6WA 2OOLA 1YT4A 4DN0A 5FQJA 2VJWA 2ZMVA 3WS0A 4F3LA 3RFBA 3SH9A 5DKKA 2R78A 5EM0A 1ERMA 2WZZA 5EE8A 2GJ3A 3FV7A 3EGXC 1G28A 2HDQA 5CTNA 1I2WA 4GJ4A 2OAQ1 5CXWA 5F5YA 2J3TC 4OPRA 3G4PA 5E43A 4X1LA 2WK0A 3UDXA 2V0UA 2Y2HA 2JC7A 4LFUA 1L2SA 1PI5A 5M18A 4RX2A 4WYYA 4P6ZS 3DBAA 4GD8A 2FZ0A 4QHCA 4G3WA 4S2JA 3ICYA 2WADA 4Q0IA 1LL8A 1PW8A 3EQUA 1YKDA 5A92A 3VE4A 4S2MA 1TDGA 4DMZA 1OT6A 3T1RA 2FH5A 2EX8A 3CG5A 1NLYA 4OQ0A 2W3DA 1MKIA 4S2OA 4N1HA 2W3FA 4ZJ2A 4ZRRA 1I5QA 1PNEA 2Y2PA 3IX4A 2I72A 4Y5FA 4H6JA 5CERA 3HLEA 3PHYA 1DJCA 2PU2A 3BEBA 5FDHA 5FL3A 1GA0A 2DMWA 3OPHA 2HPBA 3UB6A 4R3JA 1BZAA 2PD7A 2JHEA 3ITBA 3BFFA 2E8JA 1KE4A 1UWNX 3WS1A 4A5RA 4GDBA 2YKHA 1ONHA 5CX7A 1OTIA 5G18A 4F3LB 4O01A 1XFNA 3IS2B 4NKPA 3D9YA 3GR2A 3LR3A 4DXBA 4QJGA 4MDZA 2ZM0A 4P85A 1NYMA 3EEHA 2WKQA 3BYDA 3VMAA 2EWWA 1LLBA 4ZBEA 4O7DA 2WZXA 4MLLA 4X68A 4KZ6A 3EOIA 5K5BA 2V9AA 4MN5A 1K57A 3A0RA 3PBSA 3VFHA 1Y28A 1ES2A 2PU4A 4OKPA 4HI4A 2ZQCA 1PI4A 2UWXA 3R4KA 4RQ9A 2QPNA 3JYIA 5DTTA 1BLPA 4D60A 2LB9A 2Y2MA 4WMCA 3WRZA 5L2FA 1VQQA 3N8RA 4XUZA 2RL3A 3C38A 1L3LA 3OCLA 3VP0A 4IVIA 2W1TB 2OLUA 3DTMA 5HW3A 3LICA 4GNUA 1P9RA 3R7WA 5FI2A 2PYRA 2O9CA 4ETZA 2QZ6A 1BLHA 5HPFA 3C4OA 5F68A 5FAPA 3Q82A 2A3UA 5HAPA 5HFOA 3OBFA 2HDSA 5TR7A 2ZC6B 4GHIA 3ULFA 5AQBA 2A24B 2H28A 3HBRA 3HREA 4GB7A 3LO7A 2M7VA 4RVAA 4FUWA 5J4EA 3VFFA 5FASA 2XROA 5J8XA 1G5UA 3G2ZA 4WL9A 1JNUA 3ZGAB 3QP1A 1K4EA 3MKFA 4HJ4A 2ZL1B 4XXRA 4KZAA 3MQQA 4ESPA 1H0MA 4N1XA 2XA7S 3VOZA 1DP6A 4B4ZA 4OONA 3WRTA 5D3OA 3BQAA 4HQAA 2BTFP 4GLQA 1F98A 3UE6A 1ZC2A 2XR0A 4HP9A 1LSWA 1ZHHB 3VP2A 5CHMA 3ISGA 5G4ZA 1TS7A 1M40A 3FKWA 4N92A 2Y2OA 4P0MA 1K57C 2H0TA 1MPLA 1HTZA 1WYCA 1H8ZA 2A2LA 5GHZA 2QYBA 3QNCA 4ID4A 1NYYA 1EROA 2W3HA 4IBRA 2NUPC 2ZC3B 3C30A 2VEAA 1T18A 1E25A 3UY6A 4PKYA 2UV0E 4WELA 3VOYA 4NG2A 5DVAA 4BD1A 4CLCB 4YNRA 3CUEA 4RA7A 3E2LA 2WAFA 1OTDA 2H10A 4NXFA 3R7WB 3H7WB 2G2UA 2J80A 4ETXA 2R9WA 2AVXA 1YM1A 3T4OA 3IXBA 4GHIB 1FR1A 2ZJ9A 3LIAA 1BLSA 3PTEA 1EW0A 5EVID 4GDNA 3ZFZA 2X01A 5KMWA 4X56A 4KG2A 3WS2A 3BJNA 1RCJA 3DWZA 4I38A 2RCXA 3CLOA 2Y2QA 1E3UD 3ZQ5A 3RXWA 1VM1A 1U60A 3CAXA 2J9OA 1LSVA 3ZDJA 4E3LA 2P9VA 4E3KA 4JF5A 1F9IA 3F1NA 1IOUA 3CPTA 4I3AA 4S2LA 1W7FA 4RX3A 1PW1A 2Z6DA 2HP9A 3A0SA 4NETA 4MCWA 3HJKA 4HH2A 3K3CA 2V0WA 5FI7A 4GN2A 3E4OA 5GLDA 3UN7A 3CITA 3F1PB 3CMZA 3S7NA 1N9BA 3CZDA 2WKEA 4DE1A 4G3VA 3N8LA 5TGFA 3DAVA 1K56A 1G6AA 4OLGA 4RYEA 3P09A 1NWZA 2QJ7A 3BLMA 2XDMA 3OZHA 3WS4A 3EWKA 2IA2A 4R3AA 3CUEC 1MY8A 4WBGA 4LPZA 1UGUA 4JXSA 3P98A 5HWVA 5DF8A 2JN7A 1ESIA 4DDSA 4X55A 4DF6A 2M1CA 2BASA 1W8YA 4YOFA 4WEJA 3DTKA 5MC7A 1XA7A 2ZBBA 5GL9A 4JXWA 3VV4A 1HLUP 4BL3A 1SKFA 2Q0OA 5DJUA 3FYZA 4YINA 4LV2A 1MBLA 4K0WA 4OQGA 1OMEA 2XH9A 1H3QA 1XP4A 1YSQA 1JTGA 2P9VB 1JVJA 1J9MA 4HJ3A 2X02A 3RTYA 3OPRA 5FI6A 4E3MA 2J8YA 3F1NB 3T1QB 1PWGA 4QB8A 1NRJA 2W0NA 4OPQA 5EV0A 1NJ4A 3QP8A 1KDWA 4ARZA 3T12B 3G35A 3IXGA 5GHXA 5TJJA 2XRNA 2JKTI 4GCZA 3LEQA 5HARA 3K2NA 4EWFA 3MZDA 2OAP1 5G4YA 3OC2A 4UAAA 5CHUA 2ZOHA 4LCLA 3IBRA 3M2KA 2O99A 1NXYA 3PBQA 4KG6A 5HPIA 3ZG9B 1OTEA 4FOFA 4NXGA 4OOYA 3E2KA 3NY4A 3Q7ZA 3T4SA 1KGFA 4Y15A 3BM6A 3IH9A 1G6OA 4EUVA 4ZJ3A 1YLYA 4Y3IA 1S1YA 4UQIM 3LI8A 3T4JA 4X6TA 3NIAA 4HY8A 1XXMA 1MWTA 1MWSA 3PBRA 2XQZA 1XJ6A 3O87A 4EBPA 4KQQA 2ZLYA 4OOLA 1V9ZA 3Q7VB 4OPZA 2Y2GA 2L1MA 4HBTA 2P08A 3U2AA 2EX6A 3G2YA 5CEDA 2P7JA 4KQDA 2NUTC 2VGLS 1XPBA 5FQQA 2EXBA 4GOGA 5E2HA 3T1SA 4HOIA 3UB9A 1VETA 3NCKA 3O3VA 4ZJ1A 5FQIA 3KYEA 4H8RA 5HZHA 3BW6A 3A3DA 1YPRA 1I2SA 3BRMA 1CI8A 4ARZB 4C6YA 3IH8A 5IS1A 3A3EA 3VP3A 3OPLA 4OOMA 4I3JA 5HDSA 1FCOA 2G7UA 1VEUB 3UPOA 3NULA 5FAOA 3T1XA 3N6IA 3TRCA 5AQAA 4PM5A 2K31A 2WAEA 1S6RA 1K54A 4PM7A 4S2NA 4C3QA 4CLCE 1CF0A 2VLGA 4GS9A 4WZ5A 4N9LA 3KSGA 4HEFA 4C75A 4E3OA 4IHQA 4S2PA 1CEFA 2O9AA 2V1BA 5HDDA 3MSHA 5BOHA 1N9OA 3GDIA 4NXEA 3SW1A 4BMWA 2INWA 3KO6A 3QP6A 2JKFA 4CQHA 3AGDA 3LR5A 1IYSA 1K38A 1TF1A 1QMFA 3LY4A 5M1AA 2H5SA 3BQ8A 3PXPA 1AXBA 3N8SA 3NECA 1T1BA 5CRFA 2Y2JA 3GSGA 3SS5A 4Z9QA 3E98A 2ZQ8A 1TVFA 3P7NA 1OJ5A 2V1AA 3EEAA 2XF3A 2VV7A 4EESA 4R23A 2VKSA 1YLZA 3MMHA 2EA9A 5AJGA 4HIAA 3BY8A 1P97A 5HX9A 5CECA 1PZPA 4B88A 3FPVA 4JXVA 1XFQA 4LLOB 3MZFA 3HLDA 2I9VA 1D06A 2B95A 3A3FA 5HD5A 4R4SA 2Q9MA 4BLMA 2QJ5A 2XSSA 1V9YA 4KZ7A 4L9EA 4CLCD 1IFQA 3FKVA 3IBJA 3CI6A 1K54C 3OLOA 4S2NC 1Z09A 1D7EA 4E04A 3LIFA 4BL2A 4H6JB 4EXOA 1YLWA 3GQZA 4LV3A 3FC7A 2ZQDA 4WUJA 5GLCA 3D72A 2J3WA 2JCHA 5IT5A 2R9XA 4K0XA 2PRFA 5GLAA 3V39A 5HAIA 3UB7A 1SCWA 3VOLA 3MFDA 2GX5A 3MXSA 1KE3A 3A0VA 2WKPA 4KQOA 2PBYA 1M6KA 4PM6A 1XJ4A 3CWFA 3MQ0A 3RXXA 2KX6A 4R70A 1F5MA 1YLJA 4DE0A 1GHPA 1K55A 5AQ9A 3UMEA 3LFVA 3PBNA 3S4XA 1K25A 2ZOIA 3LEZA 3DTEA 5HL1A 1ODVA 4JGOA 1GHIA 5F83A 3AGFA 5CTMA 2G2WA 4EBLA 3FPWA 3HUMA 2EFXA 3GVBA 3N7WA 4BENA 2KLIA 4BWIA 1ZTUA 1BYWA 1DP8A 4DXCA 1O7EA 4E6XA 3L9KA 3S7QA 5EVLA 2XFSA 2ACGA 1CJFA 4S2KA 1S1ZA 1LSXA 1LL5A 2ZQ7A 3TSGA 2JKRM 1AWIA 4WLAA 3MQOA 1ERQA 3UDIA 5DJTA 3IHAA 4EEPA 4U3TA 4BD0A 4I3IA 3KX0X 4K08A 5DF9A 4HH3A 2XFTA 1GSXA 4XT2A 4P87A 4OVDA 3VP4A 1FIKA 1XJ2A 1EI5A 1Z6FA 1PWCA 3NDGA 4R0QA 5F1FA 4FD8A 2ZD8A 3BECA 2EWVA 3LI9A 2K7SA 1ESUA 4WEKA 3NOUC 3D3OA 5DF7A 1P9WA 5FDSA 3IT9A 1NZUA 1L0EA 1BT5A 3C5AA 5KSCA 1IYOA 4R1GA 1LHYA 1RP5A 3VSLA 4FH2A 5L8MA 5EVIA 1JWZA 4KZ9A 5HD3A 1K55C 1FOFA 1IYQA 4Q8IA 3MKEA 2Y59A 3KSIA 3M6HA 2PR6A 4P6BA 4R6LA 5FQ9A 5F82A 4X69A 4JF4A 4LV1A 5AVEA 1YSPA 4BJPA 4NK3A 4GKUA 1E3UA 4LRZE 2FFFB 1YLTA 3LGOA 3F1OA 3TE8A 5EUAA 2Y4AA 4UA9A 3B33A 4DE2A 1DP9A 1KVLA 5CHJA 2Z6CA 4HNBA 4HHDA 4HESA 1BLCA 1OT9A 3HLGA 4L9GA 4LRYC 2FFYA 1RGYA 4MBFA 4KG5A 4E3IA 2H0YA 3FG8A 5JYPA 1MWUA 3IX3A 2DNSA 3T4QA 3IXHA 3NHQA 3QP2A 5HWWA 2JE5A 3FWLA 3C2WA 3IF6A 1ALQA 2P04A 1YMXA 5M19A 5CEBA 4BBTA 4MEZA 2ZC5B 4Y7PA 3IQAA 4WM9A 2OSUA 1WYBA 2PBDP 4KZ3A 5FAQA 4CJNA 3BFDA 2CC1A 1KDSA 4KQRA 3DWKA 4B4XA 5A90A 5AVFA 4EEUA 2J3TD 5EOOA 5CGXA 2Y91A 3FZCA 1GSVA 3HJIA 1KVMA 3UDFA 2M7UA 1T19A 4I39A 1KGGA 2Y2LA 2WGIA 5EVIB 2W3GA 3PYPA 1DJBA 4F94A 2XEPA 4R4RA 4MBHA 5EVIC 4Y0OA 1S66L 2PAVP 2YKFA 5E2GA 3SZTA 3CPTB 3BLSA 4O8GA 3CHWP 1YAXA 1SDNA 4U0XA 4OH0A 3C7UA 5LBRA 1S0WA 1FR6A 3JPUA 5DTSA 5TBMA 1TEMA 5A91A 1EWZA 5HL6A 2HV1A 5J3WA 1DRMA 5KIZA 3V3RA 4JPMA 1IEMA 3F1OB 4IVKA 4ZTKA 3UO9A 4QPRA 3WS5A 5HWTA 2ZM2A 3PAGA 2JKGA 3EQVA 1D1JA 2KOIA 3U4LP 2EXAA 4JXGA 3TJZC 2ZC7A 4II7A 4DJ2A 5CGWA 3G30A 3BFEA 5EOEA 4EQ1A 4KZ4A 3B42A 4OLDA 5EECA 3T4LA 5FEFA 1NLZA 1TD5A 3ZG8B 4IUHA 4GD6A 3TG9A 3T4KA 3W4PA 3CJMA 4IEDA 4U0TA 3IF6C 3W4OA 2KDKA 2IWDA 4MN7A 1HZOA 2HGVA 3E4QA 4EV4A 2XLNA 1LL9A 3H9WA 2HJEA 1ACFA 2PYPA 3IF5A 3VP1A 2Y8HA 2PHYA 4X25A 3HUNA 1H5XA 3VSKA 2CMNA 3BY9A 4DRTA 4LCMA 2HP6A 2WYXA 5DKLA 4I5SA 2C5WB 1S4RA 1MXOA 3HCYA 3IS2A 1JTDA 4JF6A 1H8YA 3TW8A 2Y2NA 5TBMB 5A93A 3MXQA 5TFQA 2PR5A 1W79A 3GRJA 1K4FA 2XA7M 1TS8A 5C5KA 3PAEA 5F1GA 3ZG0A 2ZC4B 4KZ5A 1Q2QA 4JKTA 4EETB 2GNXA 3W4QA 4OP8A 1A0KA 4R38A 2B18A 3L7HA 3PR6A 3MBZA 3WWXA 3LIDA 4Y13A 1WA9A 4N9KA 1PWDA 2LB5A 4JBFA 4CPKA 5FA7A 3LIBA 1PRQA 5GHYA 3G31A 3HLFA 2QMIA 4NEED 3UB5P 3I7JA 2W1TA 4UA7A 2O0YA 3W2ZA 2PT7A 4PMAA 2VGKA 1KOUA 1XA1A 2WUQA 1UWPX 1IKIA 4IUKA 4YFMA 5F69A 4OPYA 3D4FA 2VZWA 1STZA 2D01A 3M2JA 4ZDXA 3IX8A 4KZBA 4L9FA 2DRWA 4DE3A 2B02A 3HLCA 4KZ8A 2A24A 1K6RA 3QHYA 2HP5A 3HUOA 4Y17A 4YWZA 2K2NA 3A3JA 5FSRA 3M6BA 4PPRA 3QP5A 2E8IA 2OV5A 1OTAA 1VETB 3Q1FA 1BUEA 4M3KA 4FH4A 3RH8B 4IBXA 3MR0A 3B3XA 2ZL1A 3UE1A 3LCEA 3V50A 2W3EA 4PKYG 1XGIA 2WKRA 1VB6A 2Z2MB 5KSHA 3NOTC 1KGEA 4WMCD 3GECA 5DFYA 1NZOA 5EM1A 4WZ4A 3O88A 3C8CA 1TS0A 2EX2A 1ZG4A 4Q0HA 4IJGA 4ME4A 1S67L 2Y55A 4PM8A 2GDNA 5J7EA 4M4XA 4HBUA 4BQMA 5E2FA 1FSWA 3QP4A 2XGNA 4L0LA 1K0KA 5EVEA 1O07A 2VV8A 1IKGA 3ZG5A 3A3IA 3H82A 4GS9B 3ZVWA 3O86A 4KUKA 3UE0A 3LY3A 1W63M 3ZNTA 3O5YA 3TOIA 2WGWA 4WZ5C 2Y2IA 3UMDA 4CLCA 4QD4A 3ZNYA 4FCFA 5E2EA 5I5LA 2J9PA 4UQIS 1K6SA 3H7WA 3VE3A 3C4PA 1G68A 3G6OA 1PIOA 4LRXC 1MWRA 1SDEA 4K91A 3ZHHA 1BSGA 3Q07A 2A49A 2WGVA 4D2OA 1GSWA 1ZG6A 3HVFA 4ZAMA 5IHVA 3IHBA 3G32A 3ZYTA 1XX2A 2ZQAA 3V5MA 1S4SA 3MF0A 3SS4A 1BTLA 3AGEA 5FEGA 3OCNA 3ZVTA 3KYQA 4LGWA 3S7OA 2XD5A 5FQMA 1CEGA 4EU0A 4E3JA 1FQGA 2HDRA 3KSFA 4LENA 2P74A 1XKZA 3LIEA 4BBUA 4OQHA 1L0DA 1RGZA 1MC0A 4JLFA 4KUOA 3LR0A 2QKPA 2W27A 2JKRI 1YMSA 4OQIA 1GHMA 4X53A 1W8QA 1J3WA 4JGPA 2X71A 4OP5A 3V3SA 1HD8A 1IELA 2O9BA 4Y2FA 1YQSA 2WKHA 2L0WA 3F1PA 1MKMA 4MMNA 3SH7A 4MBKA 1Q2PA 1FCMA 3H82B 1W5DA 1YLPA 4WF0A 4FTXA 2WGWB 2D02A 4MN6A 1IYPA 2VGJA 2QHKA 4GW9A 3PBOA 4KENB 2MJ6A 4MNRA 1KE0A 3K3DA 4AFIA 1NRFA 4CLCC 5DFXA 5FQKA 3V67A 1LI9A 1N9NA 2V1ZA 2Y79A 3QNBA 1FSYA 5FATA 1PFLA 2Q9NA 3BFCA 4DKIA 1DJAA 4Q0JA 3NBLA 3E4PA 1P0ZA 3DTIA 3SH8A 4E3NA 2ZMFA 1SKOA 2DCFA 5HSQA 4UHUA 3ZCZA 5HAQA 2XD1A 4PHTA 2VK3A 1OTBA 2WKIA 4R3BA 5A8BA 3LYXA 1SZVA 1T1CA 4X1MA 3OOVA 1NY0A 4FSFA 1N4OA 1L0GA 3UPPA 4EBNA 2IWCA 3IWOA 2C6WB 2VGLM 3KYZA 3HLWA 3S1YA 1E4DA 4JGQA 1MZUA 2XK1A 4QY5A 5HDCA 4DDYA 5KZHA 3E0YA 1N9LA 3JVVA 4Y0UA 4PM9A 3IWIA 1K56D 3SOIA 2JBFA 2OWJA 2PDRA 1T1AA 5EPHA 3G34A 4BBVA 4EERA 2HZ5A 4QY6A 4P6ZM 1QMEA 2ZM8A 2BG1A 1PYYA 2V8FA 3LUQA 3MZEA 5F6AA 3NDEA 3T4TA 3MS6A 5L10A 1X0OA 3PBTA 3ZG7B 3KSHA 1ES3A 1FCNA 5GLBA 5IU1A 1OPXA 2HF6A 4EW7A 4QWOA 1XGJA 5DTKA 1JWPA 4NXBA 4XT2B 5EFWA 1H8MA 2IWBA 1W63Q 3SS3A 1LT0A 3N4IA 2GZAA 2QWSA 4UEYA 3MXRA 1Y54A 4HP4A 3JVUA 2OLVA 4EUZA 2OWHA 1L0FA 1CQAA 4WN5A 2VV6A 3NJAA 5I94A 3MFXA 4JGRA 2V2FF 3IXDA 3UPNA 1SKOB 3GV9A 4QU3A 3HL9A 1BULA 1JWVA 3W8KA 5CGSA
chains in the Genus database with same CATH topology
3T4OA 4GHIB 3CI6A 3T50A 3LIAA 3OLOA 3NOPC 1VHMA 3P01A 3EGDC 1EW0A 1D7EA 4E04A 3LIFA 4B93A 4H6JB 4EXOA 3UB8A 3BJNA 3FC7A 4EETB 2GNXA 4Z1WA 4WUJA 4R38A 2B18A 3D72A 2J3WA 4I38A 5IT5A 3PR6A 3CLOA 3ZQ5A 3LIDA 3UB7A 3VOLA 4PAUA 2GX5A 1WA9A 2L4RA 2VX8A 3CAXA 2LB5A 3A0VA 1LSVA 3LIBA 2WKPA 4KQOA 3B47A 2VA0A 1OJGA 4B9OA 1XJ4A 3CWFA 3MQ0A 3UE3A 4NEED 4DJ3A 2HJ9C 1F9IA 4G3KA 3F1NA 2W1TA 2KX6A 1IOUA 4R70A 4I3AA 2O0YA 3W2ZA 1F5MA 3MJQA 2PT7A 2Z6DA 3UMEA 1KOUA 3A0SA 1UWPX 3LFVA 4IUKA 4MCWA 3HJKA 3PBNA 4HH2A 3K3CA 5F69A 2V0WA 3E4OA 2VZWA 2JKTM 1STZA 2D01A 3CITA 2ZOIA 3BWLA 3F1PB 2W1RA 3S7NA 4L9FA 1ODVA 4JGOA 4G3VA 2B02A 2A24A 4HJ6A 1TS6A 4YWZA 1XJ3A 2K2NA 3FPWA 1NWZA 2QJ7A 3LR4A 2KLIA 4O0PA 4BWIA 3S7PA 1OTAA 1ZTUA 3EWKA 1BYWA 2IA2A 1DP8A 3RH8B 3MR0A 4R3AA 3CUEC 2PD8A 2W3EA 3S7QA 2OOLA 4LPZA 4PKYG 1UGUA 2WKRA 1VB6A 1S1ZA 5KSHA 3NOTC 5HWVA 4DN0A 2JN7A 1LSXA 2VJWA 2JKRM 2ZMVA 4F3LA 4WLAA 3GECA 3MQOA 5DFYA 3RFBA 2M1CA 5DKKA 2BASA 3C8CA 5DJTA 4YOFA 1TS0A 2R78A 4WEJA 4Q0HA 5MC7A 4IJGA 4ME4A 1S67L 2ZBBA 2GJ3A 3EGXC 1G28A 4EEPA 5J7EA 3VV4A 4GJ4A 4M4XA 4I3IA 2OAQ1 3KX0X 5F5YA 4K08A 5DJUA 2J3TC 5DF9A 4HH3A 1GSXA 4XT2A 4L0LA 2VV8A 2V0UA 1XJ2A 1H3QA 3H82A 4GS9B 2EWVA 1YSQA 4KUKA 3LI9A 4P6ZS 2K7SA 3DBAA 4WEKA 1W63M 2FZ0A 4G3WA 3NOUC 3O5YA 4HJ3A 3D3OA 3UMDA 3ICYA 3RTYA 4CLCA 1P9WA 4Q0IA 1LL8A 3F1NB 1NRJA 2W0NA 3EQUA 5I5LA 1YKDA 3VE4A 4UQIS 3H7WA 4ARZA 3VE3A 5L8MA 3G6OA 4DMZA 4LRXC 5HD3A 1OT6A 2FH5A 5TJJA 2XRNA 1NLYA 2W3DA 3KSIA 2W3FA 2JKTI 2PR6A 4ZRRA 1GSWA 4R6LA 4GCZA 3K2NA 3ZYTA 4Y5FA 5AVEA 4H6JA 1YSPA 2OAP1 4BJPA 5G4YA 1S4SA 3MF0A 4LRZE 3PHYA 3OC2A 5FL3A 2DMWA 3F1OA 2ZOHA 3TE8A 3UB6A 3IBRA 3OCNA 3B33A 2O99A 3KYQA 3PBQA 5HPIA 3S7OA 1DP9A 2PD7A 2JHEA 1OTEA 4EU0A 4FOFA 2Z6CA 3KSFA 4HNBA 1UWNX 4NXGA 4HHDA 3LIEA 2YKHA 4BBUA 1OT9A 5CX7A 4L9GA 3T4SA 1OTIA 4LRYC 1MC0A 4KUOA 4F3LB 3LR0A 4O01A 1XFNA 2QKPA 3IS2B 4NKPA 2W27A 1G6OA 3FG8A 2JKRI 4EUVA 3LR3A 4Y3IA 1S1YA 4MDZA 4JGPA 3T4QA 4UQIM 3LI8A 3T4JA 3EEHA 4HY8A 3NHQA 2WKQA 3PBRA 2EWWA 5HWWA 2O9BA 1XJ6A 4Y2FA 2L0WA 3C2WA 3F1PA 4OOLA 1MKMA 1V9ZA 2P04A 3EOIA 4MMNA 5K5BA 2V9AA 2L1MA 4BBTA 2P08A 4MN5A 3U2AA 3H82B 3A0RA 3PBSA 2P7JA 4KQDA 1Y28A 2NUTC 2VGLS 4HI4A 4WF0A 2D02A 4MN6A 4HOIA 3UB9A 2QHKA 4GW9A 3R4KA 3PBOA 4RQ9A 5AVFA 4EEUA 2MJ6A 3K3DA 4AFIA 4CLCC 2J3TD 5DFXA 5HZHA 1GSVA 3HJIA 2LB9A 3V67A 3BW6A 2M7UA 1T19A 4I39A 4ARZB 1N9NA 2Y79A 2W3GA 3PYPA 3C38A 3OCLA 5IS1A 1S66L 2W1TB 2YKFA 4OOMA 4Q0JA 4I3JA 5HDSA 4O8GA 1YAXA 3E4PA 2G7UA 3LICA 5LBRA 1P0ZA 1P9RA 3R7WA 5TBMA 3TRCA 2PYRA 2O9CA 4ETZA 5HL6A 5J3WA 2HV1A 2ZMFA 2K31A 5HPFA 1DRMA 5KIZA 5HSQA 5F68A 4PHTA 3F1OB 3OBFA 1OTBA 4CLCE 5A8BA 4GHIA 3LYXA 3ULFA 2A24B 2H28A 1T1CA 2VLGA 3OOVA 4QPRA 4FSFA 4GS9A 5HWTA 2M7VA 3KSGA 3EQVA 4IHQA 2VGLM 2KOIA 3KYZA 5J4EA 4JGQA 1MZUA 5HDCA 2XROA 2O9AA 2V1BA 4WL9A 1JNUA 3TJZC 4DJ2A 3E0YA 1N9LA 3JVVA 4II7A 5HDDA 4HJ4A 1N9OA 3GDIA 4NXEA 3SW1A 4BMWA 2OWJA 2INWA 2PDRA 1T1AA 3KO6A 3MQQA 4BBVA 4EQ1A 4EERA 4CQHA 3B42A 3LR5A 3T4LA 1NLZA 1TD5A 1TF1A 4P6ZM 4IUHA 2XA7S 3T4KA 1DP6A 3BQAA 3BQ8A 3LUQA 3PXPA 4HQAA 5F6AA 4GLQA 1T1BA 1F98A 3UE6A 3T4TA 2KDKA 4HP9A 1LSWA 1X0OA 3PBTA 1ZHHB 4MN7A 3E98A 3KSHA 2HGVA 3E4QA 5IU1A 3P7NA 5G4ZA 1OPXA 1TS7A 1OJ5A 2HF6A 3H9WA 2V1AA 3EEAA 2HJEA 4EW7A 2PYPA 4NXBA 4XT2B 5EFWA 2VV7A 1H8MA 4EESA 2A2LA 1W63Q 2VKSA 2QYBA 3MMHA 1LT0A 2EA9A 2Y8HA 2PHYA 2W3HA 2GZAA 2NUPC 2QWSA 4UEYA 5AJGA 2CMNA 3BY9A 3C30A 4HP4A 2VEAA 1T18A 4HIAA 3BY8A 1P97A 4PKYA 4WELA 3JVUA 5DKLA 4I5SA 4CLCB 4YNRA 1S4RA 3FPVA 3CUEA 2OWHA 1XFQA 4LLOB 3HCYA 2I9VA 1D06A 5HD5A 3IS2A 4WN5A 2VV6A 3NJAA 1OTDA 3TW8A 4NXFA 3MFXA 2QJ5A 2XSSA 3R7WB 1V9YA 3H7WB 4JGRA 5TBMB 4L9EA 2J80A 4CLCD 3MXQA 4ETXA 2PR5A 1IFQA 2XA7M 3IBJA 1TS8A 5C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHI B;  3T50 A;  3LIA A;  3OLO A;  3NOP C;  1EW0 A;  1D7E A;  4E04 A;  3LIF A;  4H6J B;  4EXO A;  3UB8 A;  3FC7 A;  4EET B;  4WUJ A;  4R38 A;  3D72 A;  4I38 A;  3CLO A;  3ZQ5 A;  3LID A;  3UB7 A;  3VOL A;  1WA9 A;  2L4R A;  3CAX A;  3A0V A;  1LSV A;  3LIB A;  2WKP A;  1OJG A;  4B9O A;  1XJ4 A;  3CWF A;  4DJ3 A;  1F9I A;  3F1N A;  2KX6 A;  4R70 A;  4I3A A;  3MJQ A;  2Z6D A;  3UME A;  1KOU A;  3A0S A;  1UWP X;  3HJK A;  4HH2 A;  3K3C A;  5F69 A;  2V0W A;  3E4O A;  2D01 A;  2ZOI A;  3BWL A;  3F1P B;  4L9F A;  1ODV A;  4JGO A;  2B02 A;  2A24 A;  4HJ6 A;  1TS6 A;  4YWZ A;  1XJ3 A;  1NWZ A;  2QJ7 A;  1OTA A;  3EWK A;  1BYW A;  1DP8 A;  3RH8 B;  3MR0 A;  4R3A A;  2PD8 A;  4LPZ A;  4PKY G;  2OOL A;  1UGU A;  2WKR A;  1VB6 A;  1S1Z A;  3NOT C;  5HWV A;  2JN7 A;  1LSX A;  4F3L A;  4WLA A;  3GEC A;  3MQO A;  2M1C A;  5DKK A;  2BAS A;  3C8C A;  5DJT A;  1TS0 A;  2R78 A;  1S67 L;  2ZBB A;  2GJ3 A;  1G28 A;  4EEP A;  5J7E A;  4M4X A;  4I3I A;  3KX0 X;  5F5Y A;  4K08 A;  5DJU A;  4HH3 A;  1GSX A;  4XT2 A;  2VV8 A;  2V0U A;  1XJ2 A;  3H82 A;  4GS9 B;  4KUK A;  3LI9 A;  2K7S A;  3NOU C;  4HJ3 A;  3UMD A;  3ICY A;  3RTY A;  1LL8 A;  3F1N B;  2W0N A;  5I5L A;  3VE4 A;  3H7W A;  3VE3 A;  3G6O A;  4LRX C;  5HD3 A;  1OT6 A;  2PR6 A;  1GSW A;  4R6L A;  4GCZ A;  5AVE A;  4H6J A;  5G4Y A;  1S4S A;  4LRZ E;  3PHY A;  3F1O A;  2ZOH A;  3UB6 A;  3IBR A;  3B33 A;  1DP9 A;  2PD7 A;  2JHE A;  1OTE A;  2Z6C A;  4HNB A;  1UWN X;  4NXG A;  4HHD A;  3LIE A;  2YKH A;  4BBU A;  1OT9 A;  4L9G A;  1OTI A;  4LRY C;  4KUO A;  4F3L B;  1XFN A;  2QKP A;  3IS2 B;  2W27 A;  3FG8 A;  1S1Y A;  4JGP A;  3LI8 A;  3EEH A;  4HY8 A;  3NHQ A;  2WKQ A;  5HWW A;  1XJ6 A;  2L0W A;  3C2W A;  3F1P A;  1V9Z A;  2V9A A;  2L1M A;  4BBT A;  4MN5 A;  3H82 B;  3A0R A;  2P7J A;  4KQD A;  1Y28 A;  4HI4 A;  4WF0 A;  2D02 A;  4MN6 A;  4HOI A;  3UB9 A;  2QHK A;  4GW9 A;  4RQ9 A;  5AVF A;  4EEU A;  3K3D A;  5HZH A;  1GSV A;  3HJI A;  1T19 A;  4I39 A;  1N9N A;  3PYP A;  5IS1 A;  1S66 L;  2YKF A;  4I3J A;  5HDS A;  3E4P A;  3LIC A;  1P0Z A;  5TBM A;  2PYR A;  5J3W A;  2HV1 A;  1DRM A;  5KIZ A;  5HSQ A;  5F68 A;  3F1O B;  1OTB A;  5A8B A;  4GHI A;  3LYX A;  3ULF A;  2A24 B;  2H28 A;  1T1C A;  2VLG A;  4GS9 A;  5HWT A;  5J4E A;  4JGQ A;  1MZU A;  5HDC A;  2V1B A;  4WL9 A;  1JNU A;  4DJ2 A;  1N9L A;  5HDD A;  4HJ4 A;  1N9O A;  3GDI A;  4NXE A;  3SW1 A;  2OWJ A;  2INW A;  2PDR A;  1T1A A;  3MQQ A;  4BBV A;  4EQ1 A;  4EER A;  1DP6 A;  3LUQ A;  4HQA A;  5F6A A;  1T1B A;  1F98 A;  3UE6 A;  2KDK A;  4HP9 A;  1LSW A;  1X0O A;  3E4Q A;  5IU1 A;  3P7N A;  5G4Z A;  1TS7 A;  1OJ5 A;  3H9W A;  2V1A A;  4EW7 A;  2PYP A;  4NXB A;  4XT2 B;  5EFW A;  2VV7 A;  4EES A;  1LT0 A;  2EA9 A;  2PHY A;  2QWS A;  2CMN A;  3BY9 A;  4HP4 A;  2VEA A;  1T18 A;  4HIA A;  3BY8 A;  1P97 A;  4PKY A;  5DKL A;  4I5S A;  1S4R A;  2OWH A;  1XFQ A;  4LLO B;  2I9V A;  1D06 A;  5HD5 A;  3IS2 A;  4WN5 A;  2VV6 A;  3NJA A;  1OTD A;  4NXF A;  3MFX A;  2QJ5 A;  1V9Y A;  3H7W B;  4JGR A;  5TBM B;  4L9E A;  2J80 A;  3MXQ A;  2PR5 A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 3T50 A;  4EQI A;  3Q7V A;  3NOP C;  1VHM A;  3P01 A;  3EGD C;  3Q81 A;  3UNW A;  1CI9 A;  3BFG A;  3IWQ A;  4B93 A;  3C7V A;  2Y2K A;  3GTC A;  2EX9 A;  3UB8 A;  1C3B A;  4Z1W A;  1ONG A;  3DW0 A;  1FIL A;  3NC8 A;  4PAU A;  1ES5 A;  2L4R A;  2VX8 A;  2J7V A;  5U47 A;  3ITA A;  3OPP A;  3B47 A;  1LI0 A;  2VA0 A;  1OJG A;  1F2K A;  4B9O A;  3UE3 A;  4DJ3 A;  2HJ9 C;  3GMW A;  4G3K A;  3NI9 A;  4UA6 A;  3S22 A;  3MJQ A;  1VEU A;  5L07 A;  5AQ7 A;  2JKT M;  4S2I A;  2EFU A;  2ZQ9 A;  3BWL A;  3IF6 B;  2W1R A;  4LV0 A;  2BLS A;  4HJ6 A;  1TS6 A;  2V8C A;  2ZMA A;  1HVB A;  1SHV A;  4XUX A;  1XJ3 A;  3HLB A;  1CK3 A;  4Y0T A;  1Y4O A;  3RJU A;  1WE4 A;  3LR4 A;  2Z2L B;  2V20 A;  1GA9 A;  1ES4 A;  1TDL A;  4O0P A;  5L09 A;  3S7P A;  1ZKJ A;  2HDU A;  2B5R A;  1GCE A;  1DY6 A;  4GZB A;  5JYO A;  1PZO A;  2PD8 A;  4E6W A;  2OOL A;  1YT4 A;  4DN0 A;  5FQJ A;  2VJW A;  2ZMV A;  3WS0 A;  4F3L A;  3RFB A;  3SH9 A;  5DKK A;  2R78 A;  5EM0 A;  1ERM A;  2WZZ A;  5EE8 A;  2GJ3 A;  3FV7 A;  3EGX C;  1G28 A;  2HDQ A;  5CTN A;  1I2W A;  4GJ4 A;  2OAQ 1;  5CXW A;  5F5Y A;  2J3T C;  4OPR A;  3G4P A;  5E43 A;  4X1L A;  2WK0 A;  3UDX A;  2V0U A;  2Y2H A;  2JC7 A;  4LFU A;  1L2S A;  1PI5 A;  5M18 A;  4RX2 A;  4WYY A;  4P6Z S;  3DBA A;  4GD8 A;  2FZ0 A;  4QHC A;  4G3W A;  4S2J A;  3ICY A;  2WAD A;  4Q0I A;  1LL8 A;  1PW8 A;  3EQU A;  1YKD A;  5A92 A;  3VE4 A;  4S2M A;  1TDG A;  4DMZ A;  1OT6 A;  3T1R A;  2FH5 A;  2EX8 A;  3CG5 A;  1NLY A;  4OQ0 A;  2W3D A;  1MKI A;  4S2O A;  4N1H A;  2W3F A;  4ZJ2 A;  4ZRR A;  1I5Q A;  1PNE A;  2Y2P A;  3IX4 A;  2I72 A;  4Y5F A;  4H6J A;  5CER A;  3HLE A;  3PHY A;  1DJC A;  2PU2 A;  3BEB A;  5FDH A;  5FL3 A;  1GA0 A;  2DMW A;  3OPH A;  2HPB A;  3UB6 A;  4R3J A;  1BZA A;  2PD7 A;  2JHE A;  3ITB A;  3BFF A;  2E8J A;  1KE4 A;  1UWN X;  3WS1 A;  4A5R A;  4GDB A;  2YKH A;  1ONH A;  5CX7 A;  1OTI A;  5G18 A;  4F3L B;  4O01 A;  1XFN A;  3IS2 B;  4NKP A;  3D9Y A;  3GR2 A;  3LR3 A;  4DXB A;  4QJG A;  4MDZ A;  2ZM0 A;  4P85 A;  1NYM A;  3EEH A;  2WKQ A;  3BYD A;  3VMA A;  2EWW A;  1LLB A;  4ZBE A;  4O7D A;  2WZX A;  4MLL A;  4X68 A;  4KZ6 A;  3EOI A;  5K5B A;  2V9A A;  4MN5 A;  1K57 A;  3A0R A;  3PBS A;  3VFH A;  1Y28 A;  1ES2 A;  2PU4 A;  4OKP A;  4HI4 A;  2ZQC A;  1PI4 A;  2UWX A;  3R4K A;  4RQ9 A;  2QPN A;  3JYI A;  5DTT A;  1BLP A;  4D60 A;  2LB9 A;  2Y2M A;  4WMC A;  3WRZ A;  5L2F A;  1VQQ A;  3N8R A;  4XUZ A;  2RL3 A;  3C38 A;  1L3L A;  3OCL A;  3VP0 A;  4IVI A;  2W1T B;  2OLU A;  3DTM A;  5HW3 A;  3LIC A;  4GNU A;  1P9R A;  3R7W A;  5FI2 A;  2PYR A;  2O9C A;  4ETZ A;  2QZ6 A;  1BLH A;  5HPF A;  3C4O A;  5F68 A;  5FAP A;  3Q82 A;  2A3U A;  5HAP A;  5HFO A;  3OBF A;  2HDS A;  5TR7 A;  2ZC6 B;  4GHI A;  3ULF A;  5AQB A;  2A24 B;  2H28 A;  3HBR A;  3HRE A;  4GB7 A;  3LO7 A;  2M7V A;  4RVA A;  4FUW A;  5J4E A;  3VFF A;  5FAS A;  2XRO A;  5J8X A;  1G5U A;  3G2Z A;  4WL9 A;  1JNU A;  3ZGA B;  3QP1 A;  1K4E A;  3MKF A;  4HJ4 A;  2ZL1 B;  4XXR A;  4KZA A;  3MQQ A;  4ESP A;  1H0M A;  4N1X A;  2XA7 S;  3VOZ A;  1DP6 A;  4B4Z A;  4OON A;  3WRT A;  5D3O A;  3BQA A;  4HQA A;  2BTF P;  4GLQ A;  1F98 A;  3UE6 A;  1ZC2 A;  2XR0 A;  4HP9 A;  1LSW A;  1ZHH B;  3VP2 A;  5CHM A;  3ISG A;  5G4Z A;  1TS7 A;  1M40 A;  3FKW A;  4N92 A;  2Y2O A;  4P0M A;  1K57 C;  2H0T A;  1MPL A;  1HTZ A;  1WYC A;  1H8Z A;  2A2L A;  5GHZ A;  2QYB A;  3QNC A;  4ID4 A;  1NYY A;  1ERO A;  2W3H A;  4IBR A;  2NUP C;  2ZC3 B;  3C30 A;  2VEA A;  1T18 A;  1E25 A;  3UY6 A;  4PKY A;  2UV0 E;  4WEL A;  3VOY A;  4NG2 A;  5DVA A;  4BD1 A;  4CLC B;  4YNR A;  3CUE A;  4RA7 A;  3E2L A;  2WAF A;  1OTD A;  2H10 A;  4NXF A;  3R7W B;  3H7W B;  2G2U A;  2J80 A;  4ETX A;  2R9W A;  2AVX A;  1YM1 A;  3T4O A;  3IXB A;  4GHI B;  1FR1 A;  2ZJ9 A;  3LIA A;  1BLS A;  3PTE A;  1EW0 A;  5EVI D;  4GDN A;  3ZFZ A;  2X01 A;  5KMW A;  4X56 A;  4KG2 A;  3WS2 A;  3BJN A;  1RCJ A;  3DWZ A;  4I38 A;  2RCX A;  3CLO A;  2Y2Q A;  1E3U D;  3ZQ5 A;  3RXW A;  1VM1 A;  1U60 A;  3CAX A;  2J9O A;  1LSV A;  3ZDJ A;  4E3L A;  2P9V A;  4E3K A;  4JF5 A;  1F9I A;  3F1N A;  1IOU A;  3CPT A;  4I3A A;  4S2L A;  1W7F A;  4RX3 A;  1PW1 A;  2Z6D A;  2HP9 A;  3A0S A;  4NET A;  4MCW A;  3HJK A;  4HH2 A;  3K3C A;  2V0W A;  5FI7 A;  4GN2 A;  3E4O A;  5GLD A;  3UN7 A;  3CIT A;  3F1P B;  3CMZ A;  3S7N A;  1N9B A;  3CZD A;  2WKE A;  4DE1 A;  4G3V A;  3N8L A;  5TGF A;  3DAV A;  1K56 A;  1G6A A;  4OLG A;  4RYE A;  3P09 A;  1NWZ A;  2QJ7 A;  3BLM A;  2XDM A;  3OZH A;  3WS4 A;  3EWK A;  2IA2 A;  4R3A A;  3CUE C;  1MY8 A;  4WBG A;  4LPZ A;  1UGU A;  4JXS A;  3P98 A;  5HWV A;  5DF8 A;  2JN7 A;  1ESI A;  4DDS A;  4X55 A;  4DF6 A;  2M1C A;  2BAS A;  1W8Y A;  4YOF A;  4WEJ A;  3DTK A;  5MC7 A;  1XA7 A;  2ZBB A;  5GL9 A;  4JXW A;  3VV4 A;  1HLU P;  4BL3 A;  1SKF A;  2Q0O A;  5DJU A;  3FYZ A;  4YIN A;  4LV2 A;  1MBL A;  4K0W A;  4OQG A;  1OME A;  2XH9 A;  1H3Q A;  1XP4 A;  1YSQ A;  1JTG A;  2P9V B;  1JVJ A;  1J9M A;  4HJ3 A;  2X02 A;  3RTY A;  3OPR A;  5FI6 A;  4E3M A;  2J8Y A;  3F1N B;  3T1Q B;  1PWG A;  4QB8 A;  1NRJ A;  2W0N A;  4OPQ A;  5EV0 A;  1NJ4 A;  3QP8 A;  1KDW A;  4ARZ A;  3T12 B;  3G35 A;  3IXG A;  5GHX A;  5TJJ A;  2XRN A;  2JKT I;  4GCZ A;  3LEQ A;  5HAR A;  3K2N A;  4EWF A;  3MZD A;  2OAP 1;  5G4Y A;  3OC2 A;  4UAA A;  5CHU A;  2ZOH A;  4LCL A;  3IBR A;  3M2K A;  2O99 A;  1NXY A;  3PBQ A;  4KG6 A;  5HPI A;  3ZG9 B;  1OTE A;  4FOF A;  4NXG A;  4OOY A;  3E2K A;  3NY4 A;  3Q7Z A;  3T4S A;  1KGF A;  4Y15 A;  3BM6 A;  3IH9 A;  1G6O A;  4EUV A;  4ZJ3 A;  1YLY A;  4Y3I A;  1S1Y A;  4UQI M;  3LI8 A;  3T4J A;  4X6T A;  3NIA A;  4HY8 A;  1XXM A;  1MWT A;  1MWS A;  3PBR A;  2XQZ A;  1XJ6 A;  3O87 A;  4EBP A;  4KQQ A;  2ZLY A;  4OOL A;  1V9Z A;  3Q7V B;  4OPZ A;  2Y2G A;  2L1M A;  4HBT A;  2P08 A;  3U2A A;  2EX6 A;  3G2Y A;  5CED A;  2P7J A;  4KQD A;  2NUT C;  2VGL S;  1XPB A;  5FQQ A;  2EXB A;  4GOG A;  5E2H A;  3T1S A;  4HOI A;  3UB9 A;  1VET A;  3NCK A;  3O3V A;  4ZJ1 A;  5FQI A;  3KYE A;  4H8R A;  5HZH A;  3BW6 A;  3A3D A;  1YPR A;  1I2S A;  3BRM A;  1CI8 A;  4ARZ B;  4C6Y A;  3IH8 A;  5IS1 A;  3A3E A;  3VP3 A;  3OPL A;  4OOM A;  4I3J A;  5HDS A;  1FCO A;  2G7U A;  1VEU B;  3UPO A;  3NUL A;  5FAO A;  3T1X A;  3N6I A;  3TRC A;  5AQA A;  4PM5 A;  2K31 A;  2WAE A;  1S6R A;  1K54 A;  4PM7 A;  4S2N A;  4C3Q A;  4CLC E;  1CF0 A;  2VLG A;  4GS9 A;  4WZ5 A;  4N9L A;  3KSG A;  4HEF A;  4C75 A;  4E3O A;  4IHQ A;  4S2P A;  1CEF A;  2O9A A;  2V1B A;  5HDD A;  3MSH A;  5BOH A;  1N9O A;  3GDI A;  4NXE A;  3SW1 A;  4BMW A;  2INW A;  3KO6 A;  3QP6 A;  2JKF A;  4CQH A;  3AGD A;  3LR5 A;  1IYS A;  1K38 A;  1TF1 A;  1QMF A;  3LY4 A;  5M1A A;  2H5S A;  3BQ8 A;  3PXP A;  1AXB A;  3N8S A;  3NEC A;  1T1B A;  5CRF A;  2Y2J A;  3GSG A;  3SS5 A;  4Z9Q A;  3E98 A;  2ZQ8 A;  1TVF A;  3P7N A;  1OJ5 A;  2V1A A;  3EEA A;  2XF3 A;  2VV7 A;  4EES A;  4R23 A;  2VKS A;  1YLZ A;  3MMH A;  2EA9 A;  5AJG A;  4HIA A;  3BY8 A;  1P97 A;  5HX9 A;  5CEC A;  1PZP A;  4B88 A;  3FPV A;  4JXV A;  1XFQ A;  4LLO B;  3MZF A;  3HLD A;  2I9V A;  1D06 A;  2B95 A;  3A3F A;  5HD5 A;  4R4S A;  2Q9M A;  4BLM A;  2QJ5 A;  2XSS A;  1V9Y A;  4KZ7 A;  4L9E A;  4CLC D;  1IFQ A;  3FKV A;  3IBJ A;  3CI6 A;  1K54 C;  3OLO A;  4S2N C;  1Z09 A;  1D7E A;  4E04 A;  3LIF A;  4BL2 A;  4H6J B;  4EXO A;  1YLW A;  3GQZ A;  4LV3 A;  3FC7 A;  2ZQD A;  4WUJ A;  5GLC A;  3D72 A;  2J3W A;  2JCH A;  5IT5 A;  2R9X A;  4K0X A;  2PRF A;  5GLA A;  3V39 A;  5HAI A;  3UB7 A;  1SCW A;  3VOL A;  3MFD A;  2GX5 A;  3MXS A;  1KE3 A;  3A0V A;  2WKP A;  4KQO A;  2PBY A;  1M6K A;  4PM6 A;  1XJ4 A;  3CWF A;  3MQ0 A;  3RXX A;  2KX6 A;  4R70 A;  1F5M A;  1YLJ A;  4DE0 A;  1GHP A;  1K55 A;  5AQ9 A;  3UME A;  3LFV A;  3PBN A;  3S4X A;  1K25 A;  2ZOI A;  3LEZ A;  3DTE A;  5HL1 A;  1ODV A;  4JGO A;  1GHI A;  5F83 A;  3AGF A;  5CTM A;  2G2W A;  4EBL A;  3FPW A;  3HUM A;  2EFX A;  3GVB A;  3N7W A;  4BEN A;  2KLI A;  4BWI A;  1ZTU A;  1BYW A;  1DP8 A;  4DXC A;  1O7E A;  4E6X A;  3L9K A;  3S7Q A;  5EVL A;  2XFS A;  2ACG A;  1CJF A;  4S2K A;  1S1Z A;  1LSX A;  1LL5 A;  2ZQ7 A;  3TSG A;  2JKR M;  1AWI A;  4WLA A;  3MQO A;  1ERQ A;  3UDI A;  5DJT A;  3IHA A;  4EEP A;  4U3T A;  4BD0 A;  4I3I A;  3KX0 X;  4K08 A;  5DF9 A;  4HH3 A;  2XFT A;  1GSX A;  4XT2 A;  4P87 A;  4OVD A;  3VP4 A;  1FIK A;  1XJ2 A;  1EI5 A;  1Z6F A;  1PWC A;  3NDG A;  4R0Q A;  5F1F A;  4FD8 A;  2ZD8 A;  3BEC A;  2EWV A;  3LI9 A;  2K7S A;  1ESU A;  4WEK A;  3NOU C;  3D3O A;  5DF7 A;  1P9W A;  5FDS A;  3IT9 A;  1NZU A;  1L0E A;  1BT5 A;  3C5A A;  5KSC A;  1IYO A;  4R1G A;  1LHY A;  1RP5 A;  3VSL A;  4FH2 A;  5L8M A;  5EVI A;  1JWZ A;  4KZ9 A;  5HD3 A;  1K55 C;  1FOF A;  1IYQ A;  4Q8I A;  3MKE A;  2Y59 A;  3KSI A;  3M6H A;  2PR6 A;  4P6B A;  4R6L A;  5FQ9 A;  5F82 A;  4X69 A;  4JF4 A;  4LV1 A;  5AVE A;  1YSP A;  4BJP A;  4NK3 A;  4GKU A;  1E3U A;  4LRZ E;  2FFF B;  1YLT A;  3LGO A;  3F1O A;  3TE8 A;  5EUA A;  2Y4A A;  4UA9 A;  3B33 A;  4DE2 A;  1DP9 A;  1KVL A;  5CHJ A;  2Z6C A;  4HNB A;  4HHD A;  4HES A;  1BLC A;  1OT9 A;  3HLG A;  4L9G A;  4LRY C;  2FFY A;  1RGY A;  4MBF A;  4KG5 A;  4E3I A;  2H0Y A;  3FG8 A;  5JYP A;  1MWU A;  3IX3 A;  2DNS A;  3T4Q A;  3IXH A;  3NHQ A;  3QP2 A;  5HWW A;  2JE5 A;  3FWL A;  3C2W A;  3IF6 A;  1ALQ A;  2P04 A;  1YMX A;  5M19 A;  5CEB A;  4BBT A;  4MEZ A;  2ZC5 B;  4Y7P A;  3IQA A;  4WM9 A;  2OSU A;  1WYB A;  2PBD P;  4KZ3 A;  5FAQ A;  4CJN A;  3BFD A;  2CC1 A;  1KDS A;  4KQR A;  3DWK A;  4B4X A;  5A90 A;  5AVF A;  4EEU A;  2J3T D;  5EOO A;  5CGX A;  2Y91 A;  3FZC A;  1GSV A;  3HJI A;  1KVM A;  3UDF A;  2M7U A;  1T19 A;  4I39 A;  1KGG A;  2Y2L A;  2WGI A;  5EVI B;  2W3G A;  3PYP A;  1DJB A;  4F94 A;  2XEP A;  4R4R A;  4MBH A;  5EVI C;  4Y0O A;  1S66 L;  2PAV P;  2YKF A;  5E2G A;  3SZT A;  3CPT B;  3BLS A;  4O8G A;  3CHW P;  1YAX A;  1SDN A;  4U0X A;  4OH0 A;  3C7U A;  5LBR A;  1S0W A;  1FR6 A;  3JPU A;  5DTS A;  5TBM A;  1TEM A;  5A91 A;  1EWZ A;  5HL6 A;  2HV1 A;  5J3W A;  1DRM A;  5KIZ A;  3V3R A;  4JPM A;  1IEM A;  3F1O B;  4IVK A;  4ZTK A;  3UO9 A;  4QPR A;  3WS5 A;  5HWT A;  2ZM2 A;  3PAG A;  2JKG A;  3EQV A;  1D1J A;  2KOI A;  3U4L P;  2EXA A;  4JXG A;  3TJZ C;  2ZC7 A;  4II7 A;  4DJ2 A;  5CGW A;  3G30 A;  3BFE A;  5EOE A;  4EQ1 A;  4KZ4 A;  3B42 A;  4OLD A;  5EEC A;  3T4L A;  5FEF A;  1NLZ A;  1TD5 A;  3ZG8 B;  4IUH A;  4GD6 A;  3TG9 A;  3T4K A;  3W4P A;  3CJM A;  4IED A;  4U0T A;  3IF6 C;  3W4O A;  2KDK A;  2IWD A;  4MN7 A;  1HZO A;  2HGV A;  3E4Q A;  4EV4 A;  2XLN A;  1LL9 A;  3H9W A;  2HJE A;  1ACF A;  2PYP A;  3IF5 A;  3VP1 A;  2Y8H A;  2PHY A;  4X25 A;  3HUN A;  1H5X A;  3VSK A;  2CMN A;  3BY9 A;  4DRT A;  4LCM A;  2HP6 A;  2WYX A;  5DKL A;  4I5S A;  2C5W B;  1S4R A;  1MXO A;  3HCY A;  3IS2 A;  1JTD A;  4JF6 A;  1H8Y A;  3TW8 A;  2Y2N A;  5TBM B;  5A93 A;  3MXQ A;  5TFQ A;  2PR5 A;  1W79 A;  3GRJ A;  1K4F A;  2XA7 M;  1TS8 A;  5C5K A;  3PAE A;  5F1G A;  3ZG0 A;  2ZC4 B;  4KZ5 A;  1Q2Q A;  4JKT A;  4EET B;  2GNX A;  3W4Q A;  4OP8 A;  1A0K A;  4R38 A;  2B18 A;  3L7H A;  3PR6 A;  3MBZ A;  3WWX A;  3LID A;  4Y13 A;  1WA9 A;  4N9K A;  1PWD A;  2LB5 A;  4JBF A;  4CPK A;  5FA7 A;  3LIB A;  1PRQ A;  5GHY A;  3G31 A;  3HLF A;  2QMI A;  4NEE D;  3UB5 P;  3I7J A;  2W1T A;  4UA7 A;  2O0Y A;  3W2Z A;  2PT7 A;  4PMA A;  2VGK A;  1KOU A;  1XA1 A;  2WUQ A;  1UWP X;  1IKI A;  4IUK A;  4YFM A;  5F69 A;  4OPY A;  3D4F A;  2VZW A;  1STZ A;  2D01 A;  3M2J A;  4ZDX A;  3IX8 A;  4KZB A;  4L9F A;  2DRW A;  4DE3 A;  2B02 A;  3HLC A;  4KZ8 A;  2A24 A;  1K6R A;  3QHY A;  2HP5 A;  3HUO A;  4Y17 A;  4YWZ A;  2K2N A;  3A3J A;  5FSR A;  3M6B A;  4PPR A;  3QP5 A;  2E8I A;  2OV5 A;  1OTA A;  1VET B;  3Q1F A;  1BUE A;  4M3K A;  4FH4 A;  3RH8 B;  4IBX A;  3MR0 A;  3B3X A;  2ZL1 A;  3UE1 A;  3LCE A;  3V50 A;  2W3E A;  4PKY G;  1XGI A;  2WKR A;  1VB6 A;  2Z2M B;  5KSH A;  3NOT C;  1KGE A;  4WMC D;  3GEC A;  5DFY A;  1NZO A;  5EM1 A;  4WZ4 A;  3O88 A;  3C8C A;  1TS0 A;  2EX2 A;  1ZG4 A;  4Q0H A;  4IJG A;  4ME4 A;  1S67 L;  2Y55 A;  4PM8 A;  2GDN A;  5J7E A;  4M4X A;  4HBU A;  4BQM A;  5E2F A;  1FSW A;  3QP4 A;  2XGN A;  4L0L A;  1K0K A;  5EVE A;  1O07 A;  2VV8 A;  1IKG A;  3ZG5 A;  3A3I A;  3H82 A;  4GS9 B;  3ZVW A;  3O86 A;  4KUK A;  3UE0 A;  3LY3 A;  1W63 M;  3ZNT A;  3O5Y A;  3TOI A;  2WGW A;  4WZ5 C;  2Y2I A;  3UMD A;  4CLC A;  4QD4 A;  3ZNY A;  4FCF A;  5E2E A;  5I5L A;  2J9P A;  4UQI S;  1K6S A;  3H7W A;  3VE3 A;  3C4P A;  1G68 A;  3G6O A;  1PIO A;  4LRX C;  1MWR A;  1SDE A;  4K91 A;  3ZHH A;  1BSG A;  3Q07 A;  2A49 A;  2WGV A;  4D2O A;  1GSW A;  1ZG6 A;  3HVF A;  4ZAM A;  5IHV A;  3IHB A;  3G32 A;  3ZYT A;  1XX2 A;  2ZQA A;  3V5M A;  1S4S A;  3MF0 A;  3SS4 A;  1BTL A;  3AGE A;  5FEG A;  3OCN A;  3ZVT A;  3KYQ A;  4LGW A;  3S7O A;  2XD5 A;  5FQM A;  1CEG A;  4EU0 A;  4E3J A;  1FQG A;  2HDR A;  3KSF A;  4LEN A;  2P74 A;  1XKZ A;  3LIE A;  4BBU A;  4OQH A;  1L0D A;  1RGZ A;  1MC0 A;  4JLF A;  4KUO A;  3LR0 A;  2QKP A;  2W27 A;  2JKR I;  1YMS A;  4OQI A;  1GHM A;  4X53 A;  1W8Q A;  1J3W A;  4JGP A;  2X71 A;  4OP5 A;  3V3S A;  1HD8 A;  1IEL A;  2O9B A;  4Y2F A;  1YQS A;  2WKH A;  2L0W A;  3F1P A;  1MKM A;  4MMN A;  3SH7 A;  4MBK A;  1Q2P A;  1FCM A;  3H82 B;  1W5D A;  1YLP A;  4WF0 A;  4FTX A;  2WGW B;  2D02 A;  4MN6 A;  1IYP A;  2VGJ A;  2QHK A;  4GW9 A;  3PBO A;  4KEN B;  2MJ6 A;  4MNR A;  1KE0 A;  3K3D A;  4AFI A;  1NRF A;  4CLC C;  5DFX A;  5FQK A;  3V67 A;  1LI9 A;  1N9N A;  2V1Z A;  2Y79 A;  3QNB A;  1FSY A;  5FAT A;  1PFL A;  2Q9N A;  3BFC A;  4DKI A;  1DJA A;  4Q0J A;  3NBL A;  3E4P A;  1P0Z A;  3DTI A;  3SH8 A;  4E3N A;  2ZMF A;  1SKO A;  2DCF A;  5HSQ A;  4UHU A;  3ZCZ A;  5HAQ A;  2XD1 A;  4PHT A;  2VK3 A;  1OTB A;  2WKI A;  4R3B A;  5A8B A;  3LYX A;  1SZV A;  1T1C A;  4X1M A;  3OOV A;  1NY0 A;  4FSF A;  1N4O A;  1L0G A;  3UPP A;  4EBN A;  2IWC A;  3IWO A;  2C6W B;  2VGL M;  3KYZ A;  3HLW A;  3S1Y A;  1E4D A;  4JGQ A;  1MZU A;  2XK1 A;  4QY5 A;  5HDC A;  4DDY A;  5KZH A;  3E0Y A;  1N9L A;  3JVV A;  4Y0U A;  4PM9 A;  3IWI A;  1K56 D;  3SOI A;  2JBF A;  2OWJ A;  2PDR A;  1T1A A;  5EPH A;  3G34 A;  4BBV A;  4EER A;  2HZ5 A;  4QY6 A;  4P6Z M;  1QME A;  2ZM8 A;  2BG1 A;  1PYY A;  2V8F A;  3LUQ A;  3MZE A;  5F6A A;  3NDE A;  3T4T A;  3MS6 A;  5L10 A;  1X0O A;  3PBT A;  3ZG7 B;  3KSH A;  1ES3 A;  1FCN A;  5GLB A;  5IU1 A;  1OPX A;  2HF6 A;  4EW7 A;  4QWO A;  1XGJ A;  5DTK A;  1JWP A;  4NXB A;  4XT2 B;  5EFW A;  1H8M A;  2IWB A;  1W63 Q;  3SS3 A;  1LT0 A;  3N4I A;  2GZA A;  2QWS A;  4UEY A;  3MXR A;  1Y54 A;  4HP4 A;  3JVU A;  2OLV A;  4EUZ A;  2OWH A;  1L0F A;  1CQA A;  4WN5 A;  2VV6 A;  3NJA A;  5I94 A;  3MFX A;  4JGR A;  2V2F F;  3IXD A;  3UPN A;  1SKO B;  3GV9 A;  4QU3 A;  3HL9 A;  1BUL A;  1JWV A;  3W8K A;  5CGS A; 
#chains in the Genus database with same CATH homology
 3T4O A;  4GHI B;  3CI6 A;  3T50 A;  3LIA A;  3OLO A;  3NOP C;  1VHM A;  3P01 A;  3EGD C;  1EW0 A;  1D7E A;  4E04 A;  3LIF A;  4B93 A;  4H6J B;  4EXO A;  3UB8 A;  3BJN A;  3FC7 A;  4EET B;  2GNX A;  4Z1W A;  4WUJ A;  4R38 A;  2B18 A;  3D72 A;  2J3W A;  4I38 A;  5IT5 A;  3PR6 A;  3CLO A;  3ZQ5 A;  3LID A;  3UB7 A;  3VOL A;  4PAU A;  2GX5 A;  1WA9 A;  2L4R A;  2VX8 A;  3CAX A;  2LB5 A;  3A0V A;  1LSV A;  3LIB A;  2WKP A;  4KQO A;  3B47 A;  2VA0 A;  1OJG A;  4B9O A;  1XJ4 A;  3CWF A;  3MQ0 A;  3UE3 A;  4NEE D;  4DJ3 A;  2HJ9 C;  1F9I A;  4G3K A;  3F1N A;  2W1T A;  2KX6 A;  1IOU A;  4R70 A;  4I3A A;  2O0Y A;  3W2Z A;  1F5M A;  3MJQ A;  2PT7 A;  2Z6D A;  3UME A;  1KOU A;  3A0S A;  1UWP X;  3LFV A;  4IUK A;  4MCW A;  3HJK A;  3PBN A;  4HH2 A;  3K3C A;  5F69 A;  2V0W A;  3E4O A;  2VZW A;  2JKT M;  1STZ A;  2D01 A;  3CIT A;  2ZOI A;  3BWL A;  3F1P B;  2W1R A;  3S7N A;  4L9F A;  1ODV A;  4JGO A;  4G3V A;  2B02 A;  2A24 A;  4HJ6 A;  1TS6 A;  4YWZ A;  1XJ3 A;  2K2N A;  3FPW A;  1NWZ A;  2QJ7 A;  3LR4 A;  2KLI A;  4O0P A;  4BWI A;  3S7P A;  1OTA A;  1ZTU A;  3EWK A;  1BYW A;  2IA2 A;  1DP8 A;  3RH8 B;  3MR0 A;  4R3A A;  3CUE C;  2PD8 A;  2W3E A;  3S7Q A;  2OOL A;  4LPZ A;  4PKY G;  1UGU A;  2WKR A;  1VB6 A;  1S1Z A;  5KSH A;  3NOT C;  5HWV A;  4DN0 A;  2JN7 A;  1LSX A;  2VJW A;  2JKR M;  2ZMV A;  4F3L A;  4WLA A;  3GEC A;  3MQO A;  5DFY A;  3RFB A;  2M1C A;  5DKK A;  2BAS A;  3C8C A;  5DJT A;  4YOF A;  1TS0 A;  2R78 A;  4WEJ A;  4Q0H A;  5MC7 A;  4IJG A;  4ME4 A;  1S67 L;  2ZBB A;  2GJ3 A;  3EGX C;  1G28 A;  4EEP A;  5J7E A;  3VV4 A;  4GJ4 A;  4M4X A;  4I3I A;  2OAQ 1;  3KX0 X;  5F5Y A;  4K08 A;  5DJU A;  2J3T C;  5DF9 A;  4HH3 A;  1GSX A;  4XT2 A;  4L0L A;  2VV8 A;  2V0U A;  1XJ2 A;  1H3Q A;  3H82 A;  4GS9 B;  2EWV A;  1YSQ A;  4KUK A;  3LI9 A;  4P6Z S;  2K7S A;  3DBA A;  4WEK A;  1W63 M;  2FZ0 A;  4G3W A;  3NOU C;  3O5Y A;  4HJ3 A;  3D3O A;  3UMD A;  3ICY A;  3RTY A;  4CLC A;  1P9W A;  4Q0I A;  1LL8 A;  3F1N B;  1NRJ A;  2W0N A;  3EQU A;  5I5L A;  1YKD A;  3VE4 A;  4UQI S;  3H7W A;  4ARZ A;  3VE3 A;  5L8M A;  3G6O A;  4DMZ A;  4LRX C;  5HD3 A;  1OT6 A;  2FH5 A;  5TJJ A;  2XRN A;  1NLY A;  2W3D A;  3KSI A;  2W3F A;  2JKT I;  2PR6 A;  4ZRR A;  1GSW A;  4R6L A;  4GCZ A;  3K2N A;  3ZYT A;  4Y5F A;  5AVE A;  4H6J A;  1YSP A;  2OAP 1;  4BJP A;  5G4Y A;  1S4S A;  3MF0 A;  4LRZ E;  3PHY A;  3OC2 A;  5FL3 A;  2DMW A;  3F1O A;  2ZOH A;  3TE8 A;  3UB6 A;  3IBR A;  3OCN A;  3B33 A;  2O99 A;  3KYQ A;  3PBQ A;  5HPI A;  3S7O A;  1DP9 A;  2PD7 A;  2JHE A;  1OTE A;  4EU0 A;  4FOF A;  2Z6C A;  3KSF A;  4HNB A;  1UWN X;  4NXG A;  4HHD A;  3LIE A;  2YKH A;  4BBU A;  1OT9 A;  5CX7 A;  4L9G A;  3T4S A;  1OTI A;  4LRY C;  1MC0 A;  4KUO A;  4F3L B;  3LR0 A;  4O01 A;  1XFN A;  2QKP A;  3IS2 B;  4NKP A;  2W27 A;  1G6O A;  3FG8 A;  2JKR I;  4EUV A;  3LR3 A;  4Y3I A;  1S1Y A;  4MDZ A;  4JGP A;  3T4Q A;  4UQI M;  3LI8 A;  3T4J A;  3EEH A;  4HY8 A;  3NHQ A;  2WKQ A;  3PBR A;  2EWW A;  5HWW A;  2O9B A;  1XJ6 A;  4Y2F A;  2L0W A;  3C2W A;  3F1P A;  4OOL A;  1MKM A;  1V9Z A;  2P04 A;  3EOI A;  4MMN A;  5K5B A;  2V9A A;  2L1M A;  4BBT A;  2P08 A;  4MN5 A;  3U2A A;  3H82 B;  3A0R A;  3PBS A;  2P7J A;  4KQD A;  1Y28 A;  2NUT C;  2VGL S;  4HI4 A;  4WF0 A;  2D02 A;  4MN6 A;  4HOI A;  3UB9 A;  2QHK A;  4GW9 A;  3R4K A;  3PBO A;  4RQ9 A;  5AVF A;  4EEU A;  2MJ6 A;  3K3D A;  4AFI A;  4CLC C;  2J3T D;  5DFX A;  5HZH A;  1GSV A;  3HJI A;  2LB9 A;  3V67 A;  3BW6 A;  2M7U A;  1T19 A;  4I39 A;  4ARZ B;  1N9N A;  2Y79 A;  2W3G A;  3PYP A;  3C38 A;  3OCL A;  5IS1 A;  1S66 L;  2W1T B;  2YKF A;  4OOM A;  4Q0J A;  4I3J A;  5HDS A;  4O8G A;  1YAX A;  3E4P A;  2G7U A;  3LIC A;  5LBR A;  1P0Z A;  1P9R A;  3R7W A;  5TBM A;  3TRC A;  2PYR A;  2O9C A;  4ETZ A;  5HL6 A;  5J3W A;  2HV1 A;  2ZMF A;  2K31 A;  5HPF A;  1DRM A;  5KIZ A;  5HSQ A;  5F68 A;  4PHT A;  3F1O B;  3OBF A;  1OTB A;  4CLC E;  5A8B A;  4GHI A;  3LYX A;  3ULF A;  2A24 B;  2H28 A;  1T1C A;  2VLG A;  3OOV A;  4QPR A;  4FSF A;  4GS9 A;  5HWT A;  2M7V A;  3KSG A;  3EQV A;  4IHQ A;  2VGL M;  2KOI A;  3KYZ A;  5J4E A;  4JGQ A;  1MZU A;  5HDC A;  2XRO A;  2O9A A;  2V1B A;  4WL9 A;  1JNU A;  3TJZ C;  4DJ2 A;  3E0Y A;  1N9L A;  3JVV A;  4II7 A;  5HDD A;  4HJ4 A;  1N9O A;  3GDI A;  4NXE A;  3SW1 A;  4BMW A;  2OWJ A;  2INW A;  2PDR A;  1T1A A;  3KO6 A;  3MQQ A;  4BBV A;  4EQ1 A;  4EER A;  4CQH A;  3B42 A;  3LR5 A;  3T4L A;  1NLZ A;  1TD5 A;  1TF1 A;  4P6Z M;  4IUH A;  2XA7 S;  3T4K A;  1DP6 A;  3BQA A;  3BQ8 A;  3LUQ A;  3PXP A;  4HQA A;  5F6A A;  4GLQ A;  1T1B A;  1F98 A;  3UE6 A;  3T4T A;  2KDK A;  4HP9 A;  1LSW A;  1X0O A;  3PBT A;  1ZHH B;  4MN7 A;  3E98 A;  3KSH A;  2HGV A;  3E4Q A;  5IU1 A;  3P7N A;  5G4Z A;  1OPX A;  1TS7 A;  1OJ5 A;  2HF6 A;  3H9W A;  2V1A A;  3EEA A;  2HJE A;  4EW7 A;  2PYP A;  4NXB A;  4XT2 B;  5EFW A;  2VV7 A;  1H8M A;  4EES A;  2A2L A;  1W63 Q;  2VKS A;  2QYB A;  3MMH A;  1LT0 A;  2EA9 A;  2Y8H A;  2PHY A;  2W3H A;  2GZA A;  2NUP C;  2QWS A;  4UEY A;  5AJG A;  2CMN A;  3BY9 A;  3C30 A;  4HP4 A;  2VEA A;  1T18 A;  4HIA A;  3BY8 A;  1P97 A;  4PKY A;  4WEL A;  3JVU A;  5DKL A;  4I5S A;  4CLC B;  4YNR A;  1S4R A;  3FPV A;  3CUE A;  2OWH A;  1XFQ A;  4LLO B;  3HCY A;  2I9V A;  1D06 A;  5HD5 A;  3IS2 A;  4WN5 A;  2VV6 A;  3NJA A;  1OTD A;  3TW8 A;  4NXF A;  3MFX A;  2QJ5 A;  2XSS A;  3R7W B;  1V9Y A;  3H7W B;  4JGR A;  5TBM B;  4L9E A;  2J80 A;  4CLC D;  3MXQ A;  4ETX A;  2PR5 A;  1IFQ A;  2XA7 M;  3IBJ A;  1TS8 A;  5C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...