1T19A

Early intermediate ie2 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t19A00
2PR6A 4RQ9A 3UMDA 2VV7A 3VE3A 4GS9B 4DJ2A 3NHQA 3T50A 2YKHA 4EQ1A 2INWA 1OT6A 4HH3A 4YWZA 5J4EA 1LT0A 5AVEA 4GS9A 3LIEA 4I39A 1MZUA 3LIDA 2OWHA 4F3LB 2VEAA 1XFQA 4NXGA 4XT2A 5A8BA 2L1MA 2PYPA 4EW7A 1Y28A 1S4RA 5HD5A 4WN5A 2ZBBA 3MQOA 3PHYA 4WL9A 1WA9A 2W0NA 3H9WA 1P97A 3A0VA 4R3AA 3A0RA 1T1CA 4WLAA 3CAXA 3D72A 4EESA 4I3IA 5TBMA 1LL8A 2QJ5A 5TBMB 2PD8A 1XFNA 3FG8A 2B02A 1TS0A 3LI9A 2P7JA 4H6JB 1N9NA 4I3JA 5IU1A 1ODVA 2PD7A 5HD3A 4B9OA 5HWWA 4K08A 4I38A 3UB6A 3RH8B 4LRZE 3K3DA 4NXEA 4JGQA 5J7EA 3LYXA 4GCZA 1NWZA 3LUQA 2A24B 1TS8A 1OJ5A 3F1NA 4I3AA 1BYWA 3ICYA 4M4XA 1OTDA 5F5YA 3LI8A 1T19A 3F1NB 4HIAA 5DKLA 2PHYA 2Z6CA 4R38A 1OTBA 2QKPA 1KOUA 3CWFA 4HQAA 5HWTA 2PR5A 2CMNA 3NOPC 3P7NA 1DRMA 3C8CA 3RTYA 2BASA 4JGOA 3UB8A 4F3LA 3H82B 4MN6A 5DKKA 3GECA 4BBTA 2VLGA 5G4YA 4NXBA 1D7EA 1UWNX 1OJGA 3EEHA 3F1PB 3PYPA 2J80A 2V1AA 1UGUA 2V1BA 2GJ3A 1OTIA 1T18A 3MXQA 1V9ZA 4GHIB 3GDIA 3LICA 3VE4A 2VV6A 2HV1A 1TS6A 4JGPA 3SW1A 5F6AA 3G6OA 4HOIA 4E04A 2W27A 4L9EA 4DJ3A 1XJ2A 5G4ZA 5HZHA 4L9GA 3ZQ5A 3HJIA 1GSVA 2I9VA 4EERA 3VOLA 3BY9A 3NOUC 2H28A 2ZOIA 4LRXC 4H6JA 4LRYC 4WUJA 5EFWA 3LIFA 3ULFA 3MFXA 3BWLA 3E4QA 4BBUA 1EW0A 1XJ4A 4HJ3A 3MR0A 4R70A 2VV8A 3KX0X 3OLOA 2JN7A 4EEPA 5I5LA 2YKFA 2A24A 1S66L 3F1OB 3BY8A 4GW9A 4WF0A 4HP9A 4HJ6A 1T1AA 4PKYA 3K3CA 2PDRA 1D06A 1GSXA 5DJTA 4HH2A 2K7SA 5HDDA 5HDCA 1LSXA 3UE6A 3IS2B 2V9AA 2OWJA 5F69A 2L0WA 1F98A 1DP8A 4MN5A 1V9YA 4EXOA 3H82A 3B33A 2L4RA 3F1PA 2ZOHA 4R6LA 3HJKA 2V0UA 1JNUA 2JHEA 4KUOA 5DJUA 4HP4A 3A0SA 3E4OA 4GHIA 2Z6DA 3EWKA 4BBVA 3UMEA 4L9FA 4HJ4A 3FC7A 2OOLA 1S67L 5HWVA 5KIZA 5F68A 1DP9A 4XT2B 4HNBA 5J3WA 1OT9A 2QJ7A 3CLOA 3MJQA 4LLOB 4JGRA 2WKRA 1XJ6A 2WKQA 3MQQA 1TS7A 2EA9A 1XJ3A 5AVFA 3E4PA 4NXFA 1N9OA 1S4SA 3LIAA 1S1YA 1T1BA 4EEUA 1N9LA 3UB7A 2KDKA 4LPZA 3IBRA 3F1OA 1UWPX 3H7WA 1S1ZA 4HHDA 1OTEA 2KX6A 3H7WB 2WKPA 1P0ZA 2V0WA 1GSWA 2M1CA 3NJAA 5IS1A 3C2WA 5HDSA 4I5SA 2R78A 2PYRA 4KQDA 4PKYG 3IS2A 2QHKA 2D01A 1VB6A 1X0OA 1LSVA 3LIBA 4HY8A 1F9IA 5HSQA 2D02A 1G28A 4HI4A 1DP6A 1LSWA 4KUKA 4EETB 2QWSA 1OTAA 3NOTC 3UB9A
chains in the Genus database with same CATH superfamily
4DDYA 5CTNA 3V5MA 4FUWA 3ZVWA 4DN0A 4GS9B 3FKWA 1E25A 3NCKA 3QP2A 1YLJA 4NETA 1FIKA 1ES5A 1W5DA 2YKHA 2CC1A 4EQ1A 3P09A 3OPHA 4IHQA 5LBRA 4HH3A 5J4EA 1LT0A 2BTFP 1ONHA 2FFYA 1MPLA 4NXGA 4GN2A 3T4QA 3S1YA 1IYPA 2PYPA 1ESUA 4UA9A 2Z2MB 5F82A 4O7DA 3SH7A 1BT5A 3N8LA 1YLYA 3H9WA 2XGNA 4O01A 3A0RA 4X55A 4R3BA 3D72A 1KE3A 1ZKJA 5HFOA 5HL1A 2B5RA 3LR0A 1W8QA 4QPRA 3P98A 4AFIA 1CEGA 1XFNA 2WYXA 3W8KA 1TS0A 1SHVA 4OP5A 3LI9A 2ZQAA 4IBXA 4QB8A 3ZVTA 5L07A 2RL3A 2PD7A 1F5MA 1YLTA 4K08A 4JXSA 3IHAA 3K3DA 2JE5A 1LI9A 2IWCA 2J8YA 5A93A 3PBSA 1Y54A 1NWZA 3LUQA 3TE8A 2XEPA 2Y8HA 2Q9MA 4X1MA 4QU3A 3UPOA 1TS8A 3F1NA 4E3MA 4M4XA 5F5YA 5FAOA 1ES4A 3EOIA 1K55C 5GLAA 1GCEA 3BRMA 2C6WB 1HD8A 5FQ9A 1YAXA 4B93A 4K0XA 3UE0A 3VSKA 4EV4A 1KOUA 3MS6A 2HDRA 3IWQA 4HQAA 2WKEA 1TEMA 2PR5A 3MXSA 2CMNA 2DRWA 3BQAA 2XD5A 2ZD8A 2BASA 3T1QB 4JGOA 2WKHA 3BFFA 3WRTA 2P74A 5A90A 3S7OA 3GECA 4BBTA 3C5AA 1FQGA 1GHIA 1OJGA 5L2FA 4IVKA 4OKPA 3RJUA 3GTCA 5CTMA 2ZQ8A 1OTIA 3ITAA 3VP0A 4GLQA 3UE1A 3ZNTA 4OH0A 1H3QA 4GNUA 5DTSA 4MBHA 5A92A 3VE4A 3D9YA 3C4OA 4YINA 2HV1A 2JKFA 5GHYA 2W27A 3LY3A 2Y91A 4X1LA 5HZHA 4GDNA 4DDSA 3PAGA 3HJIA 3T4SA 2H28A 2WGWA 1H8MA 4E3OA 3VP3A 4E3JA 4IJGA 4OQGA 2IWDA 2Y4AA 1EW0A 4RYEA 3ZG0A 5IT5A 2E8IA 3CHWP 3A3JA 3KSGA 5L09A 1NRJA 3HUOA 1SKOB 1XXMA 5L10A 2ZQ7A 1JWVA 4ID4A 1NXYA 4WYYA 2A24A 1S66L 3F1OB 1O7EA 1PIOA 4WF0A 5EM0A 5E2FA 4MBFA 1T1AA 1VQQA 4PKYA 1LL5A 1GHPA 2XFSA 1GSXA 3G4PA 4QY6A 3PXPA 2K7SA 5HDDA 3GQZA 3PAEA 5GHZA 3IS2B 2O9AA 1YMSA 3GSGA 2HDSA 4GD8A 4KZ5A 5HPIA 1DP8A 1V9YA 3VP2A 3L7HA 3Q81A 1CK3A 5M19A 1PI4A 5A91A 2BLSA 2L4RA 2ZOHA 1ALQA 1G5UA 1K4FA 5DTTA 2JHEA 4KUOA 1PI5A 4HP4A 3WS4A 4GHIA 4E3NA 1LLBA 4BBVA 4K91A 3VV4A 3UMEA 4HJ4A 4HEFA 4P0MA 3KSFA 2V8CA 4FD8A 3NULA 3NECA 5HWVA 2O99A 1IYOA 1PZOA 1PWDA 1K25A 5HW3A 1I5QA 5J3WA 1OT9A 2XQZA 4LV2A 3T4KA 2WGIA 2J3TC 4MN7A 4LLOB 5FI2A 4JGRA 2WUQA 1G6OA 2J9PA 1XJ6A 4P85A 1TS7A 1S6RA 2EA9A 4P87A 4WEJA 1Y4OA 3HCYA 2Y2JA 4C6YA 3RFBA 3UB7A 1KDWA 1G6AA 3U4LP 4LCLA 1IEMA 3GMWA 1ES3A 1G68A 1YKDA 1BLSA 3SS5A 4N92A 4Q0HA 4X68A 1P9RA 3PBOA 2W1RA 5IS1A 3PBNA 1K54A 4KZ9A 4GB7A 2R78A 3A3DA 2PYRA 4PKYG 2Q0OA 1I2WA 5EM1A 3C7UA 4Y0OA 2D01A 2P9VB 1ES2A 1ZC2A 4S2OA 3VSLA 4OOYA 1X0OA 1LSVA 1C3BA 3LIBA 4S2LA 4OPRA 3ZG7B 1CI9A 1QMEA 2OAQ1 2H10A 4PM6A 1VHMA 1LSWA 2JKGA 1OTAA 1KE4A 1EROA 3UB9A 4ZJ2A 2PR6A 1PFLA 2VV7A 1LHYA 3OC2A 2IWBA 1FILA 4II7A 3NHQA 3T50A 2R9XA 1KGEA 2KOIA 2INWA 1OT6A 2IA2A 4S2IA 4LV0A 4JLFA 4KZ4A 1CJFA 1I2SA 4GKUA 2ZQCA 3BQ8A 1MZUA 3LIDA 2OWHA 2VEAA 5CECA 1XFQA 2HJEA 1K4EA 5GLCA 1ZTUA 2L1MA 4ME4A 5HAPA 2OLVA 1FCOA 4Z9QA 1ZG4A 3TJZC 5HD5A 1YMXA 5IHVA 3BM6A 3PHYA 4X25A 2W0NA 4OQ0A 4B4XA 5HARA 1L0GA 4R3AA 1T1CA 2HP9A 5TBMA 4R0QA 1ZG6A 1LL8A 2QJ5A 2AVXA 4E3IA 4QJGA 2PD8A 2PRFA 4S2NA 1K57A 4NEED 2B02A 4MNRA 2A3UA 1K38A 4PMAA 2WGWB 3IF6B 2P7JA 2W1TA 5DF9A 1ODVA 3BFDA 4DXCA 3KYEA 4PPRA 5AQ7A 2PU4A 3UDFA 3BLMA 4MDZA 1A0KA 1VETB 4Y0TA 2VA0A 1CEFA 2A24B 1OJ5A 3MF0A 4I3AA 3IX8A 2X01A 1OTDA 3LI8A 3HBRA 4KZAA 4O0PA 2Z6CA 2Y2PA 3WWXA 2GZAA 3OCNA 1OTBA 5CXWA 5DFXA 3OOVA 1WYBA 3LGOA 2P08A 3CWFA 5GHXA 2M7UA 2W3DA 4S2MA 4ETXA 5G18A 3GV9A 4RVAA 3QP1A 4OPZA 2Y79A 3UB8A 2O9BA 2HZ5A 5DKKA 2UWXA 2ACGA 5G4YA 3UPNA 2FH5A 2W3GA 3PYPA 2V1AA 4MLLA 1UGUA 4S2JA 3QP6A 5FQKA 3RXXA 2GJ3A 3MXQA 3ISGA 2VX8A 4GHIB 3GDIA 5CGXA 3ITBA 1HVBA 1TS6A 2XDMA 4JGPA 3O87A 4U3TA 4QD4A 3A3IA 1HTZA 4CLCA 4D60A 1IKGA 4LENA 4L9EA 1YLPA 2W3EA 1SDNA 3GR2A 2FFFB 4L9GA 3ZQ5A 4JF5A 1GSVA 2I9VA 3UDIA 4EBNA 4R1GA 1GA0A 3QHYA 4EQIA 3AGEA 3R7WA 1XKZA 3E4QA 3W2ZA 4BBUA 1IYSA 3LO7A 3E2KA 1XJ4A 3ZDJA 1PRQA 2HJ9C 3LY4A 5EVIA 3Q7VA 4GOGA 4R70A 2XA7S 5HL6A 5CEDA 4BQMA 5I5LA 4KG5A 3HREA 5FQQA 4GW9A 4R23A 3EQVA 4HP9A 3IF6C 3OPRA 4HJ6A 3S7QA 2RCXA 4UQIS 1P9WA 2HDQA 5E2HA 5DJTA 3HLEA 3HUNA 4HH2A 4YFMA 3WS2A 4E3KA 1TF1A 1DJBA 3U2AA 4ARZB 4B4ZA 3T4TA 3CZDA 1BLHA 5EVEA 1D1JA 5FAQA 1F98A 2JBFA 3OCLA 2VJWA 4MN5A 4Y0UA 2UV0E 3H82A 4CLCE 4Q0JA 4WEKA 5FDHA 4G3KA 5CRFA 2XRNA 1MWSA 3LR5A 3F1PA 3CJMA 4E6WA 3DAVA 4R6LA 3NBLA 1M40A 4OQIA 5DJUA 2Y59A 3EWKA 5J8XA 3V3SA 2XA7M 1NZOA 1WE4A 1SZVA 1WYCA 3R4KA 5HPFA 2XSSA 3KYZA 5M18A 2WAEA 1MWTA 3LEQA 2Y55A 5CEBA 4UHUA 4Z1WA 2GNXA 4FH2A 1DP9A 3CPTA 3UO9A 3MMHA 3O88A 3IT9A 4UQIM 3CLOA 3JPUA 5HAQA 5AQ9A 3N6IA 1VM1A 3SS3A 4EBLA 3MQQA 1XJ3A 1YSQA 3T4LA 4NXFA 2C5WB 3DW0A 2EXBA 3D3OA 3B42A 4EEUA 3LR3A 3IH9A 1RCJA 2PAVP 1NLYA 3DTKA 4UA6A 4U0TA 4LPZA 3S7PA 1SCWA 3ZCZA 3UY6A 3V50A 1IELA 4DF6A 3H7WA 4BJPA 1K55A 4MMNA 3DWZA 2X71A 4OQHA 3T12B 2Y2IA 3G35A 3AGDA 1P0ZA 3O86A 3CUEC 4XUXA 3TW8A 1L0EA 5FDSA 3C4PA 3QP8A 2J3WA 4H8RA 5HDSA 3PBRA 1XA7A 1ERQA 2QHKA 3VFHA 4BLMA 1YLWA 4HY8A 1F9IA 2OV5A 1ESIA 4KQQA 4HI4A 1HLUP 3MSHA 3PBQA 3BLSA 5KSCA 4EETB 1RGZA 2XR0A 4GS9A 3G30A 3TG9A 2DNSA 1CF0A 4RQ9A 4WELA 3VE3A 4BENA 4DJ2A 2R9WA 3KSHA 2JKRI 3LR4A 5FEFA 1KVMA 3HLBA 4EBPA 3MZDA 4DKIA 4G3WA 5AVEA 3GVBA 3Q07A 4X56A 2PT7A 3M6HA 3IWIA 4I39A 3PBTA 3WRZA 3OZHA 4ZBEA 4XT2A 1M6KA 2EFXA 1KE0A 2K31A 3MXRA 2Y2QA 2P04A 4MEZA 1S4RA 1W79A 2JKRM 4PM7A 3ZFZA 1YT4A 1PWCA 3GRJA 2ZL1A 5FA7A 1P97A 2HGVA 3A0VA 1XGJA 4WLAA 4IBRA 3CAXA 3IXDA 3TSGA 1BLCA 4I3IA 4JF6A 2HP5A 4JXGA 4CLCB 1YSPA 4R4RA 4JXVA 5I94A 3Q82A 1J9MA 3E2LA 2ZJ9A 2NUPC 3G2ZA 3C38A 2DCFA 4Y2FA 4N9LA 4RX2A 5IU1A 1IYQA 3R7WB 5F1GA 3I7JA 3JYIA 5JYPA 4WZ5C 1IKIA 4B9OA 5HWWA 4JXWA 1PWGA 2W3FA 5EVIB 5FI7A 2Q9NA 3Q7VB 2K2NA 4JGQA 4NXEA 4CLCD 5J7EA 3JVVA 3LYXA 1ERMA 3V39A 2J9OA 2VZWA 4GCZA 5F83A 1E3UA 4MBKA 1NRFA 1H0MA 1BSGA 1BTLA 3BJNA 1K6RA 1AWIA 1Q2PA 4ESPA 1MWRA 2XK1A 4IUKA 4EWFA 3F1NB 3VP4A 4HIAA 3S7NA 4DMZA 2PHYA 5D3OA 5AQBA 4ZDXA 2QKPA 4BL3A 5KZHA 5EVID 4M3KA 3FKVA 4C75A 5CGSA 2LB5A 2V8FA 1DRMA 3V67A 2EWWA 2E8JA 3C8CA 3RTYA 3LEZA 1MKIA 3BW6A 1STZA 4F3LA 3H82B 3S22A 3T1SA 4NK3A 3UE3A 5CGWA 1D7EA 3EGXC 5DVAA 1SKFA 4FOFA 4DE1A 3F1PB 4G3VA 3DWKA 4FH4A 2EWVA 3G32A 3QP4A 1T18A 5FL3A 4WMCA 3SH9A 1J3WA 3ZGAB 2XD1A 5AJGA 4DXBA 2VV6A 2EX8A 4D2OA 1K0KA 4ETZA 5U47A 4DE3A 5F6AA 4OOMA 2QMIA 1BLPA 4X69A 4KG6A 1Z6FA 2ZMAA 3AGFA 3PTEA 3MZFA 3B47A 3VOLA 5KMWA 3BY9A 3NOUC 4LRXC 4H6JA 5EFWA 3LIFA 3ULFA 4DE2A 5CERA 3BFGA 3IXGA 3MKFA 3EGDC 2H5SA 3G34A 4DRTA 3MR0A 4CLCC 3BYDA 2VV8A 4XUZA 3N8SA 2PBDP 3KX0X 3EQUA 1PW1A 3P01A 3OLOA 2JN7A 4EEPA 2XROA 5GLBA 2V20A 4Y15A 2A49A 2Y2OA 1LL9A 1TD5A 3BY8A 2W3HA 2NUTC 3HL9A 3OPLA 4FTXA 1DJAA 1SDEA 4UA7A 3ZNYA 1D06A 4EUZA 5HDCA 1RP5A 5L8MA 3T4JA 5AQAA 4KZ6A 5EVIC 3UE6A 3W4OA 2VGLS 1PYYA 2V9AA 2EX6A 4L0LA 5F69A 3VMAA 2L0WA 3UNWA 1FOFA 2V2FF 2Y2KA 4JBFA 3NI9A 4Q0IA 2HF6A 3N7WA 3WS0A 4HBUA 2J7VA 3S4XA 1XPBA 1MBLA 4OLDA 1K6SA 3HJKA 2V0UA 5TJJA 4F94A 2V1ZA 2DMWA 5CX7A 5JYOA 1XP4A 4L9FA 1TDGA 3PR6A 3FC7A 2OOLA 1S67L 1L3LA 1DJCA 2ZM0A 1W63M 1IFQA 1NYYA 4HESA 2PU2A 3T1XA 3G31A 3HUMA 1OPXA 2XH9A 5EE8A 1W7FA 3ZHHA 4XT2B 1H8YA 4LV1A 4HNBA 4WZ4A 3SOIA 4YOFA 3BFCA 4ZTKA 5E43A 2XLNA 1OMEA 2WKRA 4BL2A 2ZL1B 3E0YA 3E98A 2WKQA 1VEUA 4KZ7A 2VGLM 3N8RA 3DTEA 3B3XA 1NY0A 4CPKA 1H5XA 3IQAA 3E4PA 4C3QA 5FQJA 5C5KA 4E6XA 3LIAA 4BMWA 2Z2LB 3G2YA 2Y2HA 2KDKA 2A2LA 3DBAA 5MC7A 4IEDA 3O3VA 2ZC4B 5EPHA 4ZJ3A 1RGYA 4NG2A 1S1ZA 4X53A 4KQOA 1N4OA 1OTEA 4RA7A 1FR6A 2WKPA 3CI6A 3HLFA 5FEGA 1KDSA 5E2GA 2M1CA 3NJAA 4LCMA 3C2WA 3Q7ZA 3CITA 2P9VA 4I5SA 4XXRA 2QYBA 2QZ6A 1YM1A 4R4SA 1BUEA 4CJNA 1L2SA 4BD1A 3NY4A 4ZJ1A 1HZOA 3HLCA 5HSQA 3Q1FA 5FQMA 1DP6A 3MKEA 3NDEA 2H0YA 1YPRA 3HLGA 4KUKA 1XGIA 3NOTC 4PM5A 2EX2A 3IX4A 3FPVA 3C30A 1AXBA 3UMDA 2O9CA 1K56A 3HVFA 4N1XA 1JTGA 2H0TA 5EUAA 5FATA 5EOEA 1JWZA 4OONA 1EI5A 2FZ0A 4P6ZS 1TDLA 3QNCA 2BG1A 2G2WA 1E3UD 4YWZA 1L0FA 3WS5A 3FYZA 1XA1A 3LIEA 3UPPA 4Q8IA 4KZ3A 4KZBA 3IX3A 4F3LB 5F1FA 1DY6A 4Y5FA 1XX2A 5KSHA 1FR1A 1GHMA 4GZBA 3FPWA 4UAAA 1PZPA 3M2JA 5A8BA 5EVLA 5TR7A 3ZG9B 4EW7A 1Y28A 4UEYA 3DTMA 2ZC7A 4WN5A 2ZBBA 3MQOA 2LB9A 3HLWA 4WL9A 2XFTA 2OLUA 4A5RA 1WA9A 5FAPA 2ZM8A 3C7VA 4E3LA 4JPMA 4EESA 3M2KA 1MC0A 3VFFA 3IHBA 4PM9A 3WS1A 3A3FA 5GLDA 2ZQDA 1E4DA 5TBMB 4CQHA 2GDNA 1L0DA 3FG8A 2J3TD 3IF6A 1JTDA 4KG2A 4QWOA 5TFQA 2EFUA 1CI8A 4OP8A 5HX9A 4EUVA 2MJ6A 1MXOA 3CG5A 4H6JB 3NC8A 3M6BA 4EU0A 4WMCD 1N9NA 4I3JA 1JWPA 3RXWA 2W1TB 5HD3A 3HLDA 2JKTI 2Y2LA 1QMFA 4I38A 4P6ZM 3UB6A 4LFUA 3RH8B 4R3JA 4LRZE 3KO6A 1VETA 5FSRA 4PAUA 4JF4A 5E2EA 3ZYTA 1NZUA 4OPYA 5TGFA 2Y2MA 4WM9A 1BYWA 3ICYA 1BULA 1MWUA 2Y2GA 2WZXA 3O5YA 1T19A 5DKLA 4N1HA 3JVUA 1BZAA 4R38A 2JKTM 2O0YA 4Y3IA 4O8GA 5HWTA 1K54C 1W8YA 3NOPC 3P7NA 1KGFA 1Z09A 4DE0A 3V3RA 1LI0A 1F2KA 4KZ8A 1H8ZA 3ZG5A 4MN6A 2VLGA 3UDXA 2ZLYA 5FI6A 4NXBA 1UWNX 4S2KA 3MFDA 3EEHA 1NLZA 5EECA 2J80A 2VK3A 2VKSA 2WADA 5GL9A 2V1BA 1YQSA 1V9ZA 3K2NA 1N9BA 1U60A 4KENB 4U0XA 3MZEA 3LICA 1EWZA 2WZZA 3OPPA 2XF3A 4HBTA 2WAFA 3UN7A 3SW1A 4X6TA 3G6OA 3LFVA 4HOIA 4E04A 1KGGA 5EOOA 4ZAMA 4DJ3A 1XJ2A 2G7UA 1NJ4A 5G4ZA 2ZMVA 1ZHHB 3BECA 1IOUA 4EERA 3IH8A 2ZOIA 4LRYC 4WUJA 5CHJA 3CUEA 2EXAA 3MFXA 3BWLA 4P6BA 3T4OA 3FWLA 4YNRA 1VEUB 1YLZA 5M1AA 3IBJA 4LV3A 4Y13A 4B88A 4HJ3A 1FCNA 4BD0A 3T1RA 3VOYA 4PHTA 4OVDA 2X02A 5HAIA 4GD6A 3IF5A 5DF8A 2YKFA 1ONGA 4FCFA 1PNEA 1W63Q 4S2NC 1K57C 3QNBA 1FCMA 5BOHA 2G2UA 3K3CA 4MCWA 2PDRA 2ZC5B 2OSUA 4ARZA 1TVFA 5CHUA 4JKTA 1LSXA 2KLIA 3OBFA 4RX3A 1S0WA 2JC7A 5EV0A 2OWJA 2WKIA 5FQIA 3MQ0A 2M7VA 5DFYA 3IXBA 2I72A 4KQRA 4EXOA 4OOLA 3SH8A 3BFEA 2HDUA 3IWOA 2JCHA 3B33A 5FASA 2WK0A 3MBZA 3EEAA 3DTIA 3IXHA 3W4PA 1JNUA 1KVLA 4K0WA 3A0SA 1PW8A 5CHMA 3QP5A 2WGVA 3E4OA 2Z6DA 2EX9A 3NIAA 4NKPA 3L9KA 4GDBA 3FZCA 3SZTA 5DF7A 5KIZA 2ZM2A 5F68A 1FSWA 3CMZA 4IUHA 1CQAA 3FV7A 1O07A 4PM8A 1MKMA 2ZMFA 2QJ7A 3CPTB 1K56D 3TOIA 3MJQA 4BWIA 3UB5P 4N9KA 4WBGA 4OLGA 4WZ5A 3KYQA 3TRCA 2B95A 5AVFA 3KSIA 3A3EA 3BEBA 3N4IA 1N9OA 1S4SA 1S1YA 4QHCA 1T1BA 4QY5A 1SKOA 4OPQA 2ZQ9A 1N9LA 2VGKA 2HPBA 2PBYA 3IBRA 3F1OA 2ZC6B 1UWPX 2B18A 4Y17A 4FSFA 1MY8A 1NYMA 3SS4A 4HHDA 4GJ4A 2KX6A 4LGWA 3H7WB 2HP6A 1FSYA 2V0WA 4Y7PA 1GSWA 2OAP1 2ZC3B 2QPNA 5DTKA 3D4FA 3ZG8B 4KQDA 3IS2A 2Y2NA 3LCEA 1JVJA 1VB6A 4S2PA 3W4QA 2GX5A 1GA9A 4ZRRA 3VOZA 2D02A 1Q2QA 1G28A 3VP1A 2VGJA 1ACFA 5K5BA 3NDGA 2QWSA 4IVIA
chains in the Genus database with same CATH topology
3FPVA 2PR6A 4RQ9A 3C30A 3UMDA 2VV7A 4WELA 3VE3A 4DN0A 4GS9B 2O9CA 3OC2A 3KSHA 4DJ2A 2JKRI 3LR4A 4II7A 3NHQA 3T50A 2YKHA 4EQ1A 2KOIA 2INWA 2FZ0A 4P6ZS 4IHQA 5LBRA 1OT6A 2IA2A 4HH3A 4G3WA 4YWZA 5J4EA 1LT0A 5AVEA 2PT7A 3LIEA 3BQ8A 4I39A 1MZUA 3PBTA 3LIDA 2OWHA 4F3LB 5KSHA 4Y5FA 2VEAA 1XFQA 2HJEA 3FPWA 4NXGA 4XT2A 3T4QA 5A8BA 1ZTUA 2L1MA 2PYPA 4ME4A 2K31A 4EW7A 1Y28A 4UEYA 2P04A 1S4RA 5HD5A 3TJZC 4WN5A 2ZBBA 2JKRM 3MQOA 2LB9A 3PHYA 4WL9A 1WA9A 2W0NA 3H9WA 1P97A 2HGVA 3A0VA 4O01A 4R3AA 3A0RA 1T1CA 4WLAA 3CAXA 3D72A 4EESA 4I3IA 5TBMA 1MC0A 4CLCB 1LL8A 1YSPA 2QJ5A 3LR0A 5TBMB 4CQHA 4QPRA 2PD8A 4AFIA 1XFNA 3FG8A 2J3TD 4NEED 2B02A 2NUPC 4EUVA 3C38A 1TS0A 2MJ6A 3LI9A 4Y2FA 2P7JA 2W1TA 4H6JB 4EU0A 1N9NA 4I3JA 5DF9A 5IU1A 1ODVA 3R7WB 2PD7A 1F5MA 2W1TB 5HD3A 4B9OA 5HWWA 2JKTI 4K08A 4I38A 4P6ZM 3UB6A 3RH8B 4LRZE 2W3FA 3K3DA 3KO6A 4NXEA 2K2NA 4JGQA 4CLCD 5J7EA 3JVVA 3LYXA 3PBSA 4GCZA 2VZWA 1NWZA 4MDZA 4PAUA 3LUQA 3TE8A 2Y8HA 3ZYTA 2VA0A 3BJNA 2A24B 1TS8A 1OJ5A 3MF0A 3F1NA 4I3AA 1BYWA 3ICYA 4M4XA 4IUKA 1OTDA 5F5YA 3LI8A 3O5YA 1T19A 3EOIA 3F1NB 4HIAA 5DKLA 4O0PA 3JVUA 3S7NA 1YAXA 4DMZA 2PHYA 2Z6CA 4B93A 4R38A 2GZAA 2JKTM 2O0YA 3OCNA 4Y3IA 1OTBA 4O8GA 5DFXA 3OOVA 2QKPA 1KOUA 2P08A 3CWFA 4HQAA 2M7UA 2W3DA 5HWTA 4ETXA 2PR5A 2CMNA 2LB5A 3NOPC 3BQAA 1DRMA 3P7NA 2EWWA 3V67A 3C8CA 3RTYA 2BASA 3BW6A 2Y79A 4JGOA 1STZA 3UB8A 4F3LA 3H82B 2O9BA 4MN6A 3S7OA 5DKKA 3GECA 4BBTA 2VLGA 5G4YA 3UE3A 4NXBA 1D7EA 2FH5A 1UWNX 1OJGA 2W3GA 3EGXC 4FOFA 3EEHA 1NLZA 3F1PB 3PYPA 2J80A 2V1AA 4G3VA 2VKSA 2EWVA 1UGUA 2V1BA 2GJ3A 1OTIA 1T18A 4GLQA 3MXQA 1H3QA 1V9ZA 3K2NA 5FL3A 2VX8A 4GHIB 3GDIA 5AJGA 3LICA 3VE4A 2VV6A 2HV1A 4ETZA 1TS6A 4JGPA 3SW1A 5F6AA 4OOMA 3G6OA 3LFVA 4HOIA 4E04A 4CLCA 2W27A 4L9EA 4DJ3A 1XJ2A 2W3EA 2G7UA 5G4ZA 5HZHA 2ZMVA 1ZHHB 4L9GA 3ZQ5A 3HJIA 1GSVA 3T4SA 2I9VA 1IOUA 4EERA 3B47A 3VOLA 3BY9A 3NOUC 2H28A 1H8MA 2ZOIA 4LRXC 4H6JA 4LRYC 4WUJA 5EFWA 3LIFA 3CUEA 3ULFA 4IJGA 3MFXA 3BWLA 3R7WA 3T4OA 3E4QA 3UB9A 4YNRA 3W2ZA 4BBUA 1EW0A 3IBJA 3EGDC 5IT5A 1XJ4A 3KSGA 2HJ9C 4HJ3A 1NRJA 3MR0A 4CLCC 4R70A 2VV8A 2XA7S 4PHTA 3KX0X 5HL6A 3EQUA 3P01A 3OLOA 2JN7A 4EEPA 2XROA 5I5LA 2YKFA 2A24A 1S66L 3F1OB 1TD5A 3BY8A 4GW9A 2W3HA 1W63Q 3EQVA 4WF0A 2NUTC 4HP9A 4HJ6A 3S7QA 1P9WA 1T1AA 4PKYA 4UQIS 4MCWA 3K3CA 2PDRA 1D06A 1GSXA 4ARZA 5DJTA 3PXPA 4HH2A 2K7SA 5HDDA 5HDCA 1TF1A 5L8MA 3T4JA 3U2AA 1LSXA 4ARZB 3UE6A 2KLIA 2VGLS 3OBFA 3IS2B 2O9AA 2V9AA 2OWJA 3T4TA 4L0LA 5F69A 5HPIA 2L0WA 3MQ0A 1F98A 2M7VA 1DP8A 3OCLA 5DFYA 2VJWA 4MN5A 1V9YA 4EXOA 3H82A 4OOLA 4CLCE 4Q0JA 4Q0IA 4WEKA 4G3KA 2HF6A 3B33A 2XRNA 3LR5A 2L4RA 3F1PA 2ZOHA 3EEAA 4R6LA 3HJKA 2V0UA 1JNUA 2JHEA 4KUOA 5TJJA 5DJUA 4HP4A 3A0SA 3E4OA 4GHIA 2Z6DA 3EWKA 2DMWA 5CX7A 4BBVA 3VV4A 4NKPA 3UMEA 2XA7M 4L9FA 3PR6A 3FC7A 4HJ4A 2OOLA 1S67L 3KSFA 5HWVA 1W63M 1IFQA 3R4KA 2XSSA 3KYZA 5HPFA 5KIZA 2O99A 5F68A 1OPXA 4Z1WA 2GNXA 4IUHA 1DP9A 4XT2B 4HNBA 5J3WA 3MMHA 1OT9A 1MKMA 2ZMFA 2QJ7A 4UQIM 3T4KA 2J3TC 3CLOA 3MJQA 4MN7A 4YOFA 4BWIA 4LLOB 4JGRA 3KYQA 2WKRA 1G6OA 3E0YA 3E98A 1XJ6A 2WKQA 3MQQA 1TS7A 3TRCA 2VGLM 2EA9A 1XJ3A 1YSQA 3T4LA 5AVFA 3KSIA 3E4PA 4NXFA 4WEJA 3HCYA 1N9OA 1S4SA 5C5KA 3LIAA 1S1YA 3D3OA 4BMWA 1T1BA 3B42A 4EEUA 3LR3A 3RFBA 1N9LA 3UB7A 1NLYA 2KDKA 2A2LA 3DBAA 4LPZA 3S7PA 5MC7A 3IBRA 3F1OA 1UWPX 2B18A 4FSFA 3H7WA 1YKDA 4BJPA 1S1ZA 4MMNA 4HHDA 4KQOA 1OTEA 4GJ4A 2KX6A 3H7WB 2WKPA 3CI6A 1P0ZA 4Q0HA 2V0WA 3CUEC 1P9RA 3PBOA 1GSWA 2OAP1 3TW8A 2M1CA 3NJAA 2W1RA 5IS1A 2J3WA 3PBNA 3C2WA 5HDSA 3CITA 3PBRA 2R78A 4I5SA 2QYBA 2PYRA 4KQDA 4PKYG 3IS2A 2QHKA 2D01A 1VB6A 2GX5A 1X0OA 1LSVA 3LIBA 4HY8A 4ZRRA 1F9IA 5HSQA 2D02A 1G28A 4HI4A 2OAQ1 3PBQA 5K5BA 1DP6A 1VHMA 1LSWA 4KUKA 4EETB 2QWSA 1OTAA 3NOTC 4GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR6 A;  4RQ9 A;  3UMD A;  2VV7 A;  3VE3 A;  4GS9 B;  4DJ2 A;  3NHQ A;  3T50 A;  2YKH A;  4EQ1 A;  2INW A;  1OT6 A;  4HH3 A;  4YWZ A;  5J4E A;  1LT0 A;  5AVE A;  4GS9 A;  3LIE A;  4I39 A;  1MZU A;  3LID A;  2OWH A;  4F3L B;  2VEA A;  1XFQ A;  4NXG A;  4XT2 A;  5A8B A;  2L1M A;  2PYP A;  4EW7 A;  1Y28 A;  1S4R A;  5HD5 A;  4WN5 A;  2ZBB A;  3MQO A;  3PHY A;  4WL9 A;  1WA9 A;  2W0N A;  3H9W A;  1P97 A;  3A0V A;  4R3A A;  3A0R A;  1T1C A;  4WLA A;  3CAX A;  3D72 A;  4EES A;  4I3I A;  5TBM A;  1LL8 A;  2QJ5 A;  5TBM B;  2PD8 A;  1XFN A;  3FG8 A;  2B02 A;  1TS0 A;  3LI9 A;  2P7J A;  4H6J B;  1N9N A;  4I3J A;  5IU1 A;  1ODV A;  2PD7 A;  5HD3 A;  4B9O A;  5HWW A;  4K08 A;  4I38 A;  3UB6 A;  3RH8 B;  4LRZ E;  3K3D A;  4NXE A;  4JGQ A;  5J7E A;  3LYX A;  4GCZ A;  1NWZ A;  3LUQ A;  2A24 B;  1TS8 A;  1OJ5 A;  3F1N A;  4I3A A;  1BYW A;  3ICY A;  4M4X A;  1OTD A;  5F5Y A;  3LI8 A;  1T19 A;  3F1N B;  4HIA A;  5DKL A;  2PHY A;  2Z6C A;  4R38 A;  1OTB A;  2QKP A;  1KOU A;  3CWF A;  4HQA A;  5HWT A;  2PR5 A;  2CMN A;  3NOP C;  3P7N A;  1DRM A;  3C8C A;  3RTY A;  2BAS A;  4JGO A;  3UB8 A;  4F3L A;  3H82 B;  4MN6 A;  5DKK A;  3GEC A;  4BBT A;  2VLG A;  5G4Y A;  4NXB A;  1D7E A;  1UWN X;  1OJG A;  3EEH A;  3F1P B;  3PYP A;  2J80 A;  2V1A A;  1UGU A;  2V1B A;  2GJ3 A;  1OTI A;  1T18 A;  3MXQ A;  1V9Z A;  4GHI B;  3GDI A;  3LIC A;  3VE4 A;  2VV6 A;  2HV1 A;  1TS6 A;  4JGP A;  3SW1 A;  5F6A A;  3G6O A;  4HOI A;  4E04 A;  2W27 A;  4L9E A;  4DJ3 A;  1XJ2 A;  5G4Z A;  5HZH A;  4L9G A;  3ZQ5 A;  3HJI A;  1GSV A;  2I9V A;  4EER A;  3VOL A;  3BY9 A;  3NOU C;  2H28 A;  2ZOI A;  4LRX C;  4H6J A;  4LRY C;  4WUJ A;  5EFW A;  3LIF A;  3ULF A;  3MFX A;  3BWL A;  3E4Q A;  4BBU A;  1EW0 A;  1XJ4 A;  4HJ3 A;  3MR0 A;  4R70 A;  2VV8 A;  3KX0 X;  3OLO A;  2JN7 A;  4EEP A;  5I5L A;  2YKF A;  2A24 A;  1S66 L;  3F1O B;  3BY8 A;  4GW9 A;  4WF0 A;  4HP9 A;  4HJ6 A;  1T1A A;  4PKY A;  3K3C A;  2PDR A;  1D06 A;  1GSX A;  5DJT A;  4HH2 A;  2K7S A;  5HDD A;  5HDC A;  1LSX A;  3UE6 A;  3IS2 B;  2V9A A;  2OWJ A;  5F69 A;  2L0W A;  1F98 A;  1DP8 A;  4MN5 A;  1V9Y A;  4EXO A;  3H82 A;  3B33 A;  2L4R A;  3F1P A;  2ZOH A;  4R6L A;  3HJK A;  2V0U A;  1JNU A;  2JHE A;  4KUO A;  5DJU A;  4HP4 A;  3A0S A;  3E4O A;  4GHI A;  2Z6D A;  3EWK A;  4BBV A;  3UME A;  4L9F A;  4HJ4 A;  3FC7 A;  2OOL A;  1S67 L;  5HWV A;  5KIZ A;  5F68 A;  1DP9 A;  4XT2 B;  4HNB A;  5J3W A;  1OT9 A;  2QJ7 A;  3CLO A;  3MJQ A;  4LLO B;  4JGR A;  2WKR A;  1XJ6 A;  2WKQ A;  3MQQ A;  1TS7 A;  2EA9 A;  1XJ3 A;  5AVF A;  3E4P A;  4NXF A;  1N9O A;  1S4S A;  3LIA A;  1S1Y A;  1T1B A;  4EEU A;  1N9L A;  3UB7 A;  2KDK A;  4LPZ A;  3IBR A;  3F1O A;  1UWP X;  3H7W A;  1S1Z A;  4HHD A;  1OTE A;  2KX6 A;  3H7W B;  2WKP A;  1P0Z A;  2V0W A;  1GSW A;  2M1C A;  3NJA A;  5IS1 A;  3C2W A;  5HDS A;  4I5S A;  2R78 A;  2PYR A;  4KQD A;  4PKY G;  3IS2 A;  2QHK A;  2D01 A;  1VB6 A;  1X0O A;  1LSV A;  3LIB A;  4HY8 A;  1F9I A;  5HSQ A;  2D02 A;  1G28 A;  4HI4 A;  1DP6 A;  1LSW A;  4KUK A;  4EET B;  2QWS A;  1OTA A;  3NOT C;  3UB9 A; 
#chains in the Genus database with same CATH topology
 4DDY A;  5CTN A;  3V5M A;  4FUW A;  3ZVW A;  4DN0 A;  4GS9 B;  3FKW A;  1E25 A;  3NCK A;  3QP2 A;  1YLJ A;  4NET A;  1FIK A;  1ES5 A;  1W5D A;  2YKH A;  2CC1 A;  4EQ1 A;  3P09 A;  3OPH A;  4IHQ A;  5LBR A;  4HH3 A;  5J4E A;  1LT0 A;  2BTF P;  1ONH A;  2FFY A;  1MPL A;  4NXG A;  4GN2 A;  3T4Q A;  3S1Y A;  1IYP A;  2PYP A;  1ESU A;  4UA9 A;  2Z2M B;  5F82 A;  4O7D A;  3SH7 A;  1BT5 A;  3N8L A;  1YLY A;  3H9W A;  2XGN A;  4O01 A;  3A0R A;  4X55 A;  4R3B A;  3D72 A;  1KE3 A;  1ZKJ A;  5HFO A;  5HL1 A;  2B5R A;  3LR0 A;  1W8Q A;  4QPR A;  3P98 A;  4AFI A;  1CEG A;  1XFN A;  2WYX A;  3W8K A;  1TS0 A;  1SHV A;  4OP5 A;  3LI9 A;  2ZQA A;  4IBX A;  4QB8 A;  3ZVT A;  5L07 A;  2RL3 A;  2PD7 A;  1F5M A;  1YLT A;  4K08 A;  4JXS A;  3IHA A;  3K3D A;  2JE5 A;  1LI9 A;  2IWC A;  2J8Y A;  5A93 A;  3PBS A;  1Y54 A;  1NWZ A;  3LUQ A;  3TE8 A;  2XEP A;  2Y8H A;  2Q9M A;  4X1M A;  4QU3 A;  3UPO A;  1TS8 A;  3F1N A;  4E3M A;  4M4X A;  5F5Y A;  5FAO A;  1ES4 A;  3EOI A;  1K55 C;  5GLA A;  1GCE A;  3BRM A;  2C6W B;  1HD8 A;  5FQ9 A;  1YAX A;  4B93 A;  4K0X A;  3UE0 A;  3VSK A;  4EV4 A;  1KOU A;  3MS6 A;  2HDR A;  3IWQ A;  4HQA A;  2WKE A;  1TEM A;  2PR5 A;  3MXS A;  2CMN A;  2DRW A;  3BQA A;  2XD5 A;  2ZD8 A;  2BAS A;  3T1Q B;  4JGO A;  2WKH A;  3BFF A;  3WRT A;  2P74 A;  5A90 A;  3S7O A;  3GEC A;  4BBT A;  3C5A A;  1FQG A;  1GHI A;  1OJG A;  5L2F A;  4IVK A;  4OKP A;  3RJU A;  3GTC A;  5CTM A;  2ZQ8 A;  1OTI A;  3ITA A;  3VP0 A;  4GLQ A;  3UE1 A;  3ZNT A;  4OH0 A;  1H3Q A;  4GNU A;  5DTS A;  4MBH A;  5A92 A;  3VE4 A;  3D9Y A;  3C4O A;  4YIN A;  2HV1 A;  2JKF A;  5GHY A;  2W27 A;  3LY3 A;  2Y91 A;  4X1L A;  5HZH A;  4GDN A;  4DDS A;  3PAG A;  3HJI A;  3T4S A;  2H28 A;  2WGW A;  1H8M A;  4E3O A;  3VP3 A;  4E3J A;  4IJG A;  4OQG A;  2IWD A;  2Y4A A;  1EW0 A;  4RYE A;  3ZG0 A;  5IT5 A;  2E8I A;  3CHW P;  3A3J A;  3KSG A;  5L09 A;  1NRJ A;  3HUO A;  1SKO B;  1XXM A;  5L10 A;  2ZQ7 A;  1JWV A;  4ID4 A;  1NXY A;  4WYY A;  2A24 A;  1S66 L;  3F1O B;  1O7E A;  1PIO A;  4WF0 A;  5EM0 A;  5E2F A;  4MBF A;  1T1A A;  1VQQ A;  4PKY A;  1LL5 A;  1GHP A;  2XFS A;  1GSX A;  3G4P A;  4QY6 A;  3PXP A;  2K7S A;  5HDD A;  3GQZ A;  3PAE A;  5GHZ A;  3IS2 B;  2O9A A;  1YMS A;  3GSG A;  2HDS A;  4GD8 A;  4KZ5 A;  5HPI A;  1DP8 A;  1V9Y A;  3VP2 A;  3L7H A;  3Q81 A;  1CK3 A;  5M19 A;  1PI4 A;  5A91 A;  2BLS A;  2L4R A;  2ZOH A;  1ALQ A;  1G5U A;  1K4F A;  5DTT A;  2JHE A;  4KUO A;  1PI5 A;  4HP4 A;  3WS4 A;  4GHI A;  4E3N A;  1LLB A;  4BBV A;  4K91 A;  3VV4 A;  3UME A;  4HJ4 A;  4HEF A;  4P0M A;  3KSF A;  2V8C A;  4FD8 A;  3NUL A;  3NEC A;  5HWV A;  2O99 A;  1IYO A;  1PZO A;  1PWD A;  1K25 A;  5HW3 A;  1I5Q A;  5J3W A;  1OT9 A;  2XQZ A;  4LV2 A;  3T4K A;  2WGI A;  2J3T C;  4MN7 A;  4LLO B;  5FI2 A;  4JGR A;  2WUQ A;  1G6O A;  2J9P A;  1XJ6 A;  4P85 A;  1TS7 A;  1S6R A;  2EA9 A;  4P87 A;  4WEJ A;  1Y4O A;  3HCY A;  2Y2J A;  4C6Y A;  3RFB A;  3UB7 A;  1KDW A;  1G6A A;  3U4L P;  4LCL A;  1IEM A;  3GMW A;  1ES3 A;  1G68 A;  1YKD A;  1BLS A;  3SS5 A;  4N92 A;  4Q0H A;  4X68 A;  1P9R A;  3PBO A;  2W1R A;  5IS1 A;  3PBN A;  1K54 A;  4KZ9 A;  4GB7 A;  2R78 A;  3A3D A;  2PYR A;  4PKY G;  2Q0O A;  1I2W A;  5EM1 A;  3C7U A;  4Y0O A;  2D01 A;  2P9V B;  1ES2 A;  1ZC2 A;  4S2O A;  3VSL A;  4OOY A;  1X0O A;  1LSV A;  1C3B A;  3LIB A;  4S2L A;  4OPR A;  3ZG7 B;  1CI9 A;  1QME A;  2OAQ 1;  2H10 A;  4PM6 A;  1VHM A;  1LSW A;  2JKG A;  1OTA A;  1KE4 A;  1ERO A;  3UB9 A;  4ZJ2 A;  2PR6 A;  1PFL A;  2VV7 A;  1LHY A;  3OC2 A;  2IWB A;  1FIL A;  4II7 A;  3NHQ A;  3T50 A;  2R9X A;  1KGE A;  2KOI A;  2INW A;  1OT6 A;  2IA2 A;  4S2I A;  4LV0 A;  4JLF A;  4KZ4 A;  1CJF A;  1I2S A;  4GKU A;  2ZQC A;  3BQ8 A;  1MZU A;  3LID A;  2OWH A;  2VEA A;  5CEC A;  1XFQ A;  2HJE A;  1K4E A;  5GLC A;  1ZTU A;  2L1M A;  4ME4 A;  5HAP A;  2OLV A;  1FCO A;  4Z9Q A;  1ZG4 A;  3TJZ C;  5HD5 A;  1YMX A;  5IHV A;  3BM6 A;  3PHY A;  4X25 A;  2W0N A;  4OQ0 A;  4B4X A;  5HAR A;  1L0G A;  4R3A A;  1T1C A;  2HP9 A;  5TBM A;  4R0Q A;  1ZG6 A;  1LL8 A;  2QJ5 A;  2AVX A;  4E3I A;  4QJG A;  2PD8 A;  2PRF A;  4S2N A;  1K57 A;  4NEE D;  2B02 A;  4MNR A;  2A3U A;  1K38 A;  4PMA A;  2WGW B;  3IF6 B;  2P7J A;  2W1T A;  5DF9 A;  1ODV A;  3BFD A;  4DXC A;  3KYE A;  4PPR A;  5AQ7 A;  2PU4 A;  3UDF A;  3BLM A;  4MDZ A;  1A0K A;  1VET B;  4Y0T A;  2VA0 A;  1CEF A;  2A24 B;  1OJ5 A;  3MF0 A;  4I3A A;  3IX8 A;  2X01 A;  1OTD A;  3LI8 A;  3HBR A;  4KZA A;  4O0P A;  2Z6C A;  2Y2P A;  3WWX A;  2GZA A;  3OCN A;  1OTB A;  5CXW A;  5DFX A;  3OOV A;  1WYB A;  3LGO A;  2P08 A;  3CWF A;  5GHX A;  2M7U A;  2W3D A;  4S2M A;  4ETX A;  5G18 A;  3GV9 A;  4RVA A;  3QP1 A;  4OPZ A;  2Y79 A;  3UB8 A;  2O9B A;  2HZ5 A;  5DKK A;  2UWX A;  2ACG A;  5G4Y A;  3UPN A;  2FH5 A;  2W3G A;  3PYP A;  2V1A A;  4MLL A;  1UGU A;  4S2J A;  3QP6 A;  5FQK A;  3RXX A;  2GJ3 A;  3MXQ A;  3ISG A;  2VX8 A;  4GHI B;  3GDI A;  5CGX A;  3ITB A;  1HVB A;  1TS6 A;  2XDM A;  4JGP A;  3O87 A;  4U3T A;  4QD4 A;  3A3I A;  1HTZ A;  4CLC A;  4D60 A;  1IKG A;  4LEN A;  4L9E A;  1YLP A;  2W3E A;  1SDN A;  3GR2 A;  2FFF B;  4L9G A;  3ZQ5 A;  4JF5 A;  1GSV A;  2I9V A;  3UDI A;  4EBN A;  4R1G A;  1GA0 A;  3QHY A;  4EQI A;  3AGE A;  3R7W A;  1XKZ A;  3E4Q A;  3W2Z A;  4BBU A;  1IYS A;  3LO7 A;  3E2K A;  1XJ4 A;  3ZDJ A;  1PRQ A;  2HJ9 C;  3LY4 A;  5EVI A;  3Q7V A;  4GOG A;  4R70 A;  2XA7 S;  5HL6 A;  5CED A;  4BQM A;  5I5L A;  4KG5 A;  3HRE A;  5FQQ A;  4GW9 A;  4R23 A;  3EQV A;  4HP9 A;  3IF6 C;  3OPR A;  4HJ6 A;  3S7Q A;  2RCX A;  4UQI S;  1P9W A;  2HDQ A;  5E2H A;  5DJT A;  3HLE A;  3HUN A;  4HH2 A;  4YFM A;  3WS2 A;  4E3K A;  1TF1 A;  1DJB A;  3U2A A;  4ARZ B;  4B4Z A;  3T4T A;  3CZD A;  1BLH A;  5EVE A;  1D1J A;  5FAQ A;  1F98 A;  2JBF A;  3OCL A;  2VJW A;  4MN5 A;  4Y0U A;  2UV0 E;  3H82 A;  4CLC E;  4Q0J A;  4WEK A;  5FDH A;  4G3K A;  5CRF A;  2XRN A;  1MWS A;  3LR5 A;  3F1P A;  3CJM A;  4E6W A;  3DAV A;  4R6L A;  3NBL A;  1M40 A;  4OQI A;  5DJU A;  2Y59 A;  3EWK A;  5J8X A;  3V3S A;  2XA7 M;  1NZO A;  1WE4 A;  1SZV A;  1WYC A;  3R4K A;  5HPF A;  2XSS A;  3KYZ A;  5M18 A;  2WAE A;  1MWT A;  3LEQ A;  2Y55 A;  5CEB A;  4UHU A;  4Z1W A;  2GNX A;  4FH2 A;  1DP9 A;  3CPT A;  3UO9 A;  3MMH A;  3O88 A;  3IT9 A;  4UQI M;  3CLO A;  3JPU A;  5HAQ A;  5AQ9 A;  3N6I A;  1VM1 A;  3SS3 A;  4EBL A;  3MQQ A;  1XJ3 A;  1YSQ A;  3T4L A;  4NXF A;  2C5W B;  3DW0 A;  2EXB A;  3D3O A;  3B42 A;  4EEU A;  3LR3 A;  3IH9 A;  1RCJ A;  2PAV P;  1NLY A;  3DTK A;  4UA6 A;  4U0T A;  4LPZ A;  3S7P A;  1SCW A;  3ZCZ A;  3UY6 A;  3V50 A;  1IEL A;  4DF6 A;  3H7W A;  4BJP A;  1K55 A;  4MMN A;  3DWZ A;  2X71 A;  4OQH A;  3T12 B;  2Y2I A;  3G35 A;  3AGD A;  1P0Z A;  3O86 A;  3CUE C;  4XUX A;  3TW8 A;  1L0E A;  5FDS A;  3C4P A;  3QP8 A;  2J3W A;  4H8R A;  5HDS A;  3PBR A;  1XA7 A;  1ERQ A;  2QHK A;  3VFH A;  4BLM A;  1YLW A;  4HY8 A;  1F9I A;  2OV5 A;  1ESI A;  4KQQ A;  4HI4 A;  1HLU P;  3MSH A;  3PBQ A;  3BLS A;  5KSC A;  4EET B;  1RGZ A;  2XR0 A;  4GS9 A;  3G30 A;  3TG9 A;  2DNS A;  1CF0 A;  4RQ9 A;  4WEL A;  3VE3 A;  4BEN A;  4DJ2 A;  2R9W A;  3KSH A;  2JKR I;  3LR4 A;  5FEF A;  1KVM A;  3HLB A;  4EBP A;  3MZD A;  4DKI A;  4G3W A;  5AVE A;  3GVB A;  3Q07 A;  4X56 A;  2PT7 A;  3M6H A;  3IWI A;  4I39 A;  3PBT A;  3WRZ A;  3OZH A;  4ZBE A;  4XT2 A;  1M6K A;  2EFX A;  1KE0 A;  2K31 A;  3MXR A;  2Y2Q A;  2P04 A;  4MEZ A;  1S4R A;  1W79 A;  2JKR M;  4PM7 A;  3ZFZ A;  1YT4 A;  1PWC A;  3GRJ A;  2ZL1 A;  5FA7 A;  1P97 A;  2HGV A;  3A0V A;  1XGJ A;  4WLA A;  4IBR A;  3CAX A;  3IXD A;  3TSG A;  1BLC A;  4I3I A;  4JF6 A;  2HP5 A;  4JXG A;  4CLC B;  1YSP A;  4R4R A;  4JXV A;  5I94 A;  3Q82 A;  1J9M A;  3E2L A;  2ZJ9 A;  2NUP C;  3G2Z A;  3C38 A;  2DCF A;  4Y2F A;  4N9L A;  4RX2 A;  5IU1 A;  1IYQ A;  3R7W B;  5F1G A;  3I7J A;  3JYI A;  5JYP A;  4WZ5 C;  1IKI A;  4B9O A;  5HWW A;  4JXW A;  1PWG A;  2W3F A;  5EVI B;  5FI7 A;  2Q9N A;  3Q7V B;  2K2N A;  4JGQ A;  4NXE A;  4CLC D;  5J7E A;  3JVV A;  3LYX A;  1ERM A;  3V39 A;  2J9O A;  2VZW A;  4GCZ A;  5F83 A;  1E3U A;  4MBK A;  1NRF A;  1H0M A;  1BSG A;  1BTL A;  3BJN A;  1K6R A;  1AWI A;  1Q2P A;  4ESP A;  1MWR A;  2XK1 A;  4IUK A;  4EWF A;  3F1N B;  3VP4 A;  4HIA A;  3S7N A;  4DMZ A;  2PHY A;  5D3O A;  5AQB A;  4ZDX A;  2QKP A;  4BL3 A;  5KZH A;  5EVI D;  4M3K A;  3FKV A;  4C75 A;  5CGS A;  2LB5 A;  2V8F A;  1DRM A;  3V67 A;  2EWW A;  2E8J A;  3C8C A;  3RTY A;  3LEZ A;  1MKI A;  3BW6 A;  1STZ A;  4F3L A;  3H82 B;  3S22 A;  3T1S A;  4NK3 A;  3UE3 A;  5CGW A;  1D7E A;  3EGX C;  5DVA A;  1SKF A;  4FOF A;  4DE1 A;  3F1P B;  4G3V A;  3DWK A;  4FH4 A;  2EWV A;  3G32 A;  3QP4 A;  1T18 A;  5FL3 A;  4WMC A;  3SH9 A;  1J3W A;  3ZGA B;  2XD1 A;  5AJG A;  4DXB A;  2VV6 A;  2EX8 A;  4D2O A;  1K0K A;  4ETZ A;  5U47 A;  4DE3 A;  5F6A A;  4OOM A;  2QMI A;  1BLP A;  4X69 A;  4KG6 A;  1Z6F A;  2ZMA A;  3AGF A;  3PTE A;  3MZF A;  3B47 A;  3VOL A;  5KMW A;  3BY9 A;  3NOU C;  4LRX C;  4H6J A;  5EFW A;  3LIF A;  3ULF A;  4DE2 A;  5CER A;  3BFG A;  3IXG A;  3MKF A;  3EGD C;  2H5S A;  3G34 A;  4DRT A;  3MR0 A;  4CLC C;  3BYD A;  2VV8 A;  4XUZ A;  3N8S A;  2PBD P;  3KX0 X;  3EQU A;  1PW1 A;  3P01 A;  3OLO A;  2JN7 A;  4EEP A;  2XRO A;  5GLB A;  2V20 A;  4Y15 A;  2A49 A;  2Y2O A;  1LL9 A;  1TD5 A;  3BY8 A;  2W3H A;  2NUT C;  3HL9 A;  3OPL A;  4FTX A;  1DJA A;  1SDE A;  4UA7 A;  3ZNY A;  1D06 A;  4EUZ A;  5HDC A;  1RP5 A;  5L8M A;  3T4J A;  5AQA A;  4KZ6 A;  5EVI C;  3UE6 A;  3W4O A;  2VGL S;  1PYY A;  2V9A A;  2EX6 A;  4L0L A;  5F69 A;  3VMA A;  2L0W A;  3UNW A;  1FOF A;  2V2F F;  2Y2K A;  4JBF A;  3NI9 A;  4Q0I A;  2HF6 A;  3N7W A;  3WS0 A;  4HBU A;  2J7V A;  3S4X A;  1XPB A;  1MBL A;  4OLD A;  1K6S A;  3HJK A;  2V0U A;  5TJJ A;  4F94 A;  2V1Z A;  2DMW A;  5CX7 A;  5JYO A;  1XP4 A;  4L9F A;  1TDG A;  3PR6 A;  3FC7 A;  2OOL A;  1S67 L;  1L3L A;  1DJC A;  2ZM0 A;  1W63 M;  1IFQ A;  1NYY A;  4HES A;  2PU2 A;  3T1X A;  3G31 A;  3HUM A;  1OPX A;  2XH9 A;  5EE8 A;  1W7F A;  3ZHH A;  4XT2 B;  1H8Y A;  4LV1 A;  4HNB A;  4WZ4 A;  3SOI A;  4YOF A;  3BFC A;  4ZTK A;  5E43 A;  2XLN A;  1OME A;  2WKR A;  4BL2 A;  2ZL1 B;  3E0Y A;  3E98 A;  2WKQ A;  1VEU A;  4KZ7 A;  2VGL M;  3N8R A;  3DTE A;  3B3X A;  1NY0 A;  4CPK A;  1H5X A;  3IQA A;  3E4P A;  4C3Q A;  5FQJ A;  5C5K A;  4E6X A;  3LIA A;  4BMW A;  2Z2L B;  3G2Y A;  2Y2H A;  2KDK A;  2A2L A;  3DBA A;  5MC7 A;  4IED A;  3O3V A;  2ZC4 B;  5EPH A;  4ZJ3 A;  1RGY A;  4NG2 A;  1S1Z A;  4X53 A;  4KQO A;  1N4O A;  1OTE A;  4RA7 A;  1FR6 A;  2WKP A;  3CI6 A;  3HLF A;  5FEG A;  1KDS A;  5E2G A;  2M1C A;  3NJA A;  4LCM A;  3C2W A;  3Q7Z A;  3CIT A;  2P9V A;  4I5S A;  4XXR A;  2QYB A;  2QZ6 A;  1YM1 A;  4R4S A;  1BUE A;  4CJN A;  1L2S A;  4BD1 A;  3NY4 A;  4ZJ1 A;  1HZO A;  3HLC A;  5HSQ A;  3Q1F A;  5FQM A;  1DP6 A;  3MKE A;  3NDE A;  2H0Y A;  1YPR A;  3HLG A;  4KUK A;  1XGI A;  3NOT C;  4PM5 A;  2EX2 A;  3IX4 A;  3FPV A;  3C30 A;  1AXB A;  3UMD A;  2O9C A;  1K56 A;  3HVF A;  4N1X A;  1JTG A;  2H0T A;  5EUA A;  5FAT A;  5EOE A;  1JWZ A;  4OON A;  1EI5 A;  2FZ0 A;  4P6Z S;  1TDL A;  3QNC A;  2BG1 A;  2G2W A;  1E3U D;  4YWZ A;  1L0F A;  3WS5 A;  3FYZ A;  1XA1 A;  3LIE A;  3UPP A;  4Q8I A;  4KZ3 A;  4KZB A;  3IX3 A;  4F3L B;  5F1F A;  1DY6 A;  4Y5F A;  1XX2 A;  5KSH A;  1FR1 A;  1GHM A;  4GZB A;  3FPW A;  4UAA A;  1PZP A;  3M2J A;  5A8B A;  5EVL A;  5TR7 A;  3ZG9 B;  4EW7 A;  1Y28 A;  4UEY A;  3DTM A;  2ZC7 A;  4WN5 A;  2ZBB A;  3MQO A;  2LB9 A;  3HLW A;  4WL9 A;  2XFT A;  2OLU A;  4A5R A;  1WA9 A;  5FAP A;  2ZM8 A;  3C7V A;  4E3L A;  4JPM A;  4EES A;  3M2K A;  1MC0 A;  3VFF A;  3IHB A;  4PM9 A;  3WS1 A;  3A3F A;  5GLD A;  2ZQD A;  1E4D A;  5TBM B;  4CQH A;  2GDN A;  1L0D A;  3FG8 A;  2J3T D;  3IF6 A;  1JTD A;  4KG2 A;  4QWO A;  5TFQ A;  2EFU A;  1CI8 A;  4OP8 A;  5HX9 A;  4EUV A;  2MJ6 A;  1MXO A;  3CG5 A;  4H6J B;  3NC8 A;  3M6B A;  4EU0 A;  4WMC D;  1N9N A;  4I3J A;  1JWP A;  3RXW A;  2W1T B;  5HD3 A;  3HLD A;  2JKT I;  2Y2L A;  1QMF A;  4I38 A;  4P6Z M;  3UB6 A;  4LFU A;  3RH8 B;  4R3J A;  4LRZ E;  3KO6 A;  1VET A;  5FSR A;  4PAU A;  4JF4 A;  5E2E A;  3ZYT A;  1NZU A;  4OPY A;  5TGF A;  2Y2M A;  4WM9 A;  1BYW A;  3ICY A;  1BUL A;  1MWU A;  2Y2G A;  2WZX A;  3O5Y A;  1T19 A;  5DKL A;  4N1H A;  3JVU A;  1BZA A;  4R38 A;  2JKT M;  2O0Y A;  4Y3I A;  4O8G A;  5HWT A;  1K54 C;  1W8Y A;  3NOP C;  3P7N A;  1KGF A;  1Z09 A;  4DE0 A;  3V3R A;  1LI0 A;  1F2K A;  4KZ8 A;  1H8Z A;  3ZG5 A;  4MN6 A;  2VLG A;  3UDX A;  2ZLY A;  5FI6 A;  4NXB A;  1UWN X;  4S2K A;  3MFD A;  3EEH A;  1NLZ A;  5EEC A;  2J80 A;  2VK3 A;  2VKS A;  2WAD A;  5GL9 A;  2V1B A;  1YQS A;  1V9Z A;  3K2N A;  1N9B A;  1U60 A;  4KEN B;  4U0X A;  3MZE A;  3LIC A;  1EWZ A;  2WZZ A;  3OPP A;  2XF3 A;  4HBT A;  2WAF A;  3UN7 A;  3SW1 A;  4X6T A;  3G6O A;  3LFV A;  4HOI A;  4E04 A;  1KGG A;  5EOO A;  4ZAM A;  4DJ3 A;  1XJ2 A;  2G7U A;  1NJ4 A;  5G4Z A;  2ZMV A;  1ZHH B;  3BEC A;  1IOU A;  4EER A;  3IH8 A;  2ZOI A;  4LRY C;  4WUJ A;  5CHJ A;  3CUE A;  2EXA A;  3MFX A;  3BWL A;  4P6B A;  3T4O A;  3FWL A;  4YNR A;  1VEU B;  1YLZ A;  5M1A A;  3IBJ A;  4LV3 A;  4Y13 A;  4B88 A;  4HJ3 A;  1FCN A;  4BD0 A;  3T1R A;  3VOY A;  4PHT A;  4OVD A;  2X02 A;  5HAI A;  4GD6 A;  3IF5 A;  5DF8 A;  2YKF A;  1ONG A;  4FCF A;  1PNE A;  1W63 Q;  4S2N C;  1K57 C;  3QNB A;  1FCM A;  5BOH A;  2G2U A;  3K3C A;  4MCW A;  2PDR A;  2ZC5 B;  2OSU A;  4ARZ A;  1TVF A;  5CHU A;  4JKT A;  1LSX A;  2KLI A;  3OBF A;  4RX3 A;  1S0W A;  2JC7 A;  5EV0 A;  2OWJ A;  2WKI A;  5FQI A;  3MQ0 A;  2M7V A;  5DFY A;  3IXB A;  2I72 A;  4KQR A;  4EXO A;  4OOL A;  3SH8 A;  3BFE A;  2HDU A;  3IWO A;  2JCH A;  3B33 A;  5FAS A;  2WK0 A;  3MBZ A;  3EEA A;  3DTI A;  3IXH A;  3W4P A;  1JNU A;  1KVL A;  4K0W A;  3A0S A;  1PW8 A;  5CHM A;  3QP5 A;  2WGV A;  3E4O A;  2Z6D A;  2EX9 A;  3NIA A;  4NKP A;  3L9K A;  4GDB A;  3FZC A;  3SZT A;  5DF7 A;  5KIZ A;  2ZM2 A;  5F68 A;  1FSW A;  3CMZ A;  4IUH A;  1CQA A;  3FV7 A;  1O07 A;  4PM8 A;  1MKM A;  2ZMF A;  2QJ7 A;  3CPT B;  1K56 D;  3TOI A;  3MJQ A;  4BWI A;  3UB5 P;  4N9K A;  4WBG A;  4OLG A;  4WZ5 A;  3KYQ A;  3TRC A;  2B95 A;  5AVF A;  3KSI A;  3A3E A;  3BEB A;  3N4I A;  1N9O A;  1S4S A;  1S1Y A;  4QHC A;  1T1B A;  4QY5 A;  1SKO A;  4OPQ A;  2ZQ9 A;  1N9L A;  2VGK A;  2HPB A;  2PBY A;  3IBR A;  3F1O A;  2ZC6 B;  1UWP X;  2B18 A;  4Y17 A;  4FSF A;  1MY8 A;  1NYM A;  3SS4 A;  4HHD A;  4GJ4 A;  2KX6 A;  4LGW A;  3H7W B;  2HP6 A;  1FSY A;  2V0W A;  4Y7P A;  1GSW A;  2OAP 1;  2ZC3 B;  2QPN A;  5DTK A;  3D4F A;  3ZG8 B;  4KQD A;  3IS2 A;  2Y2N A;  3LCE A;  1JVJ A;  1VB6 A;  4S2P A;  3W4Q A;  2GX5 A;  1GA9 A;  4ZRR A;  3VOZ A;  2D02 A;  1Q2Q A;  1G28 A;  3VP1 A;  2VGJ A;  1ACF A;  5K5B A;  3NDG A;  2QWS A;  4IVI A; 
#chains in the Genus database with same CATH homology
 3FPV A;  2PR6 A;  4RQ9 A;  3C30 A;  3UMD A;  2VV7 A;  4WEL A;  3VE3 A;  4DN0 A;  4GS9 B;  2O9C A;  3OC2 A;  3KSH A;  4DJ2 A;  2JKR I;  3LR4 A;  4II7 A;  3NHQ A;  3T50 A;  2YKH A;  4EQ1 A;  2KOI A;  2INW A;  2FZ0 A;  4P6Z S;  4IHQ A;  5LBR A;  1OT6 A;  2IA2 A;  4HH3 A;  4G3W A;  4YWZ A;  5J4E A;  1LT0 A;  5AVE A;  2PT7 A;  3LIE A;  3BQ8 A;  4I39 A;  1MZU A;  3PBT A;  3LID A;  2OWH A;  4F3L B;  5KSH A;  4Y5F A;  2VEA A;  1XFQ A;  2HJE A;  3FPW A;  4NXG A;  4XT2 A;  3T4Q A;  5A8B A;  1ZTU A;  2L1M A;  2PYP A;  4ME4 A;  2K31 A;  4EW7 A;  1Y28 A;  4UEY A;  2P04 A;  1S4R A;  5HD5 A;  3TJZ C;  4WN5 A;  2ZBB A;  2JKR M;  3MQO A;  2LB9 A;  3PHY A;  4WL9 A;  1WA9 A;  2W0N A;  3H9W A;  1P97 A;  2HGV A;  3A0V A;  4O01 A;  4R3A A;  3A0R A;  1T1C A;  4WLA A;  3CAX A;  3D72 A;  4EES A;  4I3I A;  5TBM A;  1MC0 A;  4CLC B;  1LL8 A;  1YSP A;  2QJ5 A;  3LR0 A;  5TBM B;  4CQH A;  4QPR A;  2PD8 A;  4AFI A;  1XFN A;  3FG8 A;  2J3T D;  4NEE D;  2B02 A;  2NUP C;  4EUV A;  3C38 A;  1TS0 A;  2MJ6 A;  3LI9 A;  4Y2F A;  2P7J A;  2W1T A;  4H6J B;  4EU0 A;  1N9N A;  4I3J A;  5DF9 A;  5IU1 A;  1ODV A;  3R7W B;  2PD7 A;  1F5M A;  2W1T B;  5HD3 A;  4B9O A;  5HWW A;  2JKT I;  4K08 A;  4I38 A;  4P6Z M;  3UB6 A;  3RH8 B;  4LRZ E;  2W3F A;  3K3D A;  3KO6 A;  4NXE A;  2K2N A;  4JGQ A;  4CLC D;  5J7E A;  3JVV A;  3LYX A;  3PBS A;  4GCZ A;  2VZW A;  1NWZ A;  4MDZ A;  4PAU A;  3LUQ A;  3TE8 A;  2Y8H A;  3ZYT A;  2VA0 A;  3BJN A;  2A24 B;  1TS8 A;  1OJ5 A;  3MF0 A;  3F1N A;  4I3A A;  1BYW A;  3ICY A;  4M4X A;  4IUK A;  1OTD A;  5F5Y A;  3LI8 A;  3O5Y A;  1T19 A;  3EOI A;  3F1N B;  4HIA A;  5DKL A;  4O0P A;  3JVU A;  3S7N A;  1YAX A;  4DMZ A;  2PHY A;  2Z6C A;  4B93 A;  4R38 A;  2GZA A;  2JKT M;  2O0Y A;  3OCN A;  4Y3I A;  1OTB A;  4O8G A;  5DFX A;  3OOV A;  2QKP A;  1KOU A;  2P08 A;  3CWF A;  4HQA A;  2M7U A;  2W3D A;  5HWT A;  4ETX A;  2PR5 A;  2CMN A;  2LB5 A;  3NOP C;  3BQA A;  1DRM A;  3P7N A;  2EWW A;  3V67 A;  3C8C A;  3RTY A;  2BAS A;  3BW6 A;  2Y79 A;  4JGO A;  1STZ A;  3UB8 A;  4F3L A;  3H82 B;  2O9B A;  4MN6 A;  3S7O A;  5DKK A;  3GEC A;  4BBT A;  2VLG A;  5G4Y A;  3UE3 A;  4NXB A;  1D7E A;  2FH5 A;  1UWN X;  1OJG A;  2W3G A;  3EGX C;  4FOF A;  3EEH A;  1NLZ A;  3F1P B;  3PYP A;  2J80 A;  2V1A A;  4G3V A;  2VKS A;  2EWV A;  1UGU A;  2V1B A;  2GJ3 A;  1OTI A;  1T18 A;  4GLQ A;  3MXQ A;  1H3Q A;  1V9Z A;  3K2N A;  5FL3 A;  2VX8 A;  4GHI B;  3GDI A;  5AJG A;  3LIC A;  3VE4 A;  2VV6 A;  2HV1 A;  4ETZ A;  1TS6 A;  4JGP A;  3SW1 A;  5F6A A;  4OOM A;  3G6O A;  3LFV A;  4HOI A;  4E04 A;  4CLC A;  2W27 A;  4L9E A;  4DJ3 A;  1XJ2 A;  2W3E A;  2G7U A;  5G4Z A;  5HZH A;  2ZMV A;  1ZHH B;  4L9G A;  3ZQ5 A;  3HJI A;  1GSV A;  3T4S A;  2I9V A;  1IOU A;  4EER A;  3B47 A;  3VOL A;  3BY9 A;  3NOU C;  2H28 A;  1H8M A;  2ZOI A;  4LRX C;  4H6J A;  4LRY C;  4WUJ A;  5EFW A;  3LIF A;  3CUE A;  3ULF A;  4IJG A;  3MFX A;  3BWL A;  3R7W A;  3T4O A;  3E4Q A;  3UB9 A;  4YNR A;  3W2Z A;  4BBU A;  1EW0 A;  3IBJ A;  3EGD C;  5IT5 A;  1XJ4 A;  3KSG A;  2HJ9 C;  4HJ3 A;  1NRJ A;  3MR0 A;  4CLC C;  4R70 A;  2VV8 A;  2XA7 S;  4PHT A;  3KX0 X;  5HL6 A;  3EQU A;  3P01 A;  3OLO A;  2JN7 A;  4EEP A;  2XRO A;  5I5L A;  2YKF A;  2A24 A;  1S66 L;  3F1O B;  1TD5 A;  3BY8 A;  4GW9 A;  2W3H A;  1W63 Q;  3EQV A;  4WF0 A;  2NUT C;  4HP9 A;  4HJ6 A;  3S7Q A;  1P9W A;  1T1A A;  4PKY A;  4UQI S;  4MCW A;  3K3C A;  2PDR A;  1D06 A;  1GSX A;  4ARZ A;  5DJT A;  3PXP A;  4HH2 A;  2K7S A;  5HDD A;  5HDC A;  1TF1 A;  5L8M A;  3T4J A;  3U2A A;  1LSX A;  4ARZ B;  3UE6 A;  2KLI A;  2VGL S;  3OBF A;  3IS2 B;  2O9A A;  2V9A A;  2OWJ A;  3T4T A;  4L0L A;  5F69 A;  5HPI A;  2L0W A;  3MQ0 A;  1F98 A;  2M7V A;  1DP8 A;  3OCL A;  5DFY A;  2VJW A;  4MN5 A;  1V9Y A;  4EXO A;  3H82 A;  4OOL A;  4CLC E;  4Q0J A;  4Q0I A;  4WEK A;  4G3K A;  2HF6 A;  3B33 A;  2XRN A;  3LR5 A;  2L4R A;  3F1P A;  2ZOH A;  3EEA A;  4R6L A;  3HJK A;  2V0U A;  1JNU A;  2JHE A;  4KUO A;  5TJJ A;  5DJU A;  4HP4 A;  3A0S A;  3E4O A;  4GHI A;  2Z6D A;  3EWK A;  2DMW A;  5CX7 A;  4BBV A;  3VV4 A;  4NKP A;  3UME A;  2XA7 M;  4L9F A;  3PR6 A;  3FC7 A;  4HJ4 A;  2OOL A;  1S67 L;  3KSF A;  5HWV A;  1W63 M;  1IFQ A;  3R4K A;  2XSS A;  3KYZ A;  5HPF A;  5KIZ A;  2O99 A;  5F68 A;  1OPX A;  4Z1W A;  2GNX A;  4IUH A;  1DP9 A;  4XT2 B;  4HNB A;  5J3W A;  3MMH A;  1OT9 A;  1MKM A;  2ZMF A;  2QJ7 A;  4UQI M;  3T4K A;  2J3T C;  3CLO A;  3MJQ A;  4MN7 A;  4YOF A;  4BWI A;  4LLO B;  4JGR A;  3KYQ A;  2WKR A;  1G6O A;  3E0Y A;  3E98 A;  1XJ6 A;  2WKQ A;  3MQQ A;  1TS7 A;  3TRC A;  2VGL M;  2EA9 A;  1XJ3 A;  1YSQ A;  3T4L A;  5AVF A;  3KSI A;  3E4P A;  4NXF A;  4WEJ A;  3HCY A;  1N9O A;  1S4S A;  5C5K A;  3LIA A;  1S1Y A;  3D3O A;  4BMW A;  1T1B A;  3B42 A;  4EEU A;  3LR3 A;  3RFB A;  1N9L A;  3UB7 A;  1NLY A;  2KDK A;  2A2L A;  3DBA A;  4LPZ A;  3S7P A;  5MC7 A;  3IBR A;  3F1O A;  1UWP X;  2B18 A;  4FSF A;  3H7W A;  1YKD A;  4BJP A;  1S1Z A;  4MMN A;  4HHD A;  4KQO A;  1OTE A;  4GJ4 A;  2KX6 A;  3H7W B;  2WKP A;  3CI6 A;  1P0Z A;  4Q0H A;  2V0W A;  3CUE C;  1P9R A;  3PBO A;  1GSW A;  2OAP 1;  3TW8 A;  2M1C A;  3NJA A;  2W1R A;  5IS1 A;  2J3W A;  3PBN A;  3C2W A;  5HDS A;  3CIT A;  3PBR A;  2R78 A;  4I5S A;  2QYB A;  2PYR A;  4KQD A;  4PKY G;  3IS2 A;  2QHK A;  2D01 A;  1VB6 A;  2GX5 A;  1X0O A;  1LSV A;  3LIB A;  4HY8 A;  4ZRR A;  1F9I A;  5HSQ A;  2D02 A;  1G28 A;  4HI4 A;  2OAQ 1;  3PBQ A;  5K5B A;  1DP6 A;  1VHM A;  1LSW A;  4KUK A;  4EET B;  2QWS A;  1OTA A;  3NOT C;  4GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...