4YFMA

Class a beta-lactamase from mycobacterium abscessus
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
MAPDELASLEKDFGGRIGVYALDTGSGDTVGHRADERFLMCSTVKTFIVSAILRRRLSEPGLLDQRIQYTQSDVLEWAPITSQHVSTGMTVSELCDATLRYSDNTGANLLITQLGGPKETEKFVRSLGDNVTRMDRTEVQLNIPDGDLDTSTPQQLVANLRRLVLDEGLDSRGRDLLTDWLKRNTTGDQSIRAAVPAGWTVADKTGGGFKGETNDIAVIWPPGRAPIVMAVLTVPEDPTSTKGKPTIAAATRIVLRAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrolysis of Clavulanate by Mycobacterium tuberculosis beta-Lactamase BlaC Harboring a Canonical SDN Motif.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 91
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4yfmA00
1H5XA 2XEPA 3FKWA 4OP5A 3SS5A 2RCXA 2ZQAA 5TR7A 1WE4A 3Q81A 1KVLA 5HARA 1BULA 3C7UA 3ZG9B 4DE2A 4MBHA 4BLMA 1PWCA 1BLHA 2Y2LA 1K6SA 3MBZA 3OCLA 3Q7ZA 3BLSA 4R4SA 2Y55A 1MPLA 1RCJA 5EOEA 4D2OA 4WZ5C 1DJBA 2ZD8A 2Y91A 4LV2A 1GHMA 1XGJA 2QZ6A 3Q1FA 5CEDA 2EX6A 3W4OA 2XD5A 4X68A 1DJAA 5FQIA 1S0WA 2HDQA 2XH9A 2GDNA 2QPNA 4RA7A 3ZFZA 4R1GA 4PM5A 4GNUA 1QMFA 4YFMA 5GLCA 3PBOA 3GMWA 1BLPA 3SH7A 3IXGA 3CMZA 2VGJA 3PBNA 3A3JA 1KGFA 1NZUA 5DTKA 3IXBA 2HDRA 1NY0A 4OOYA 1K56D 5GLBA 1K56A 4DE3A 2Y2GA 3BM6A 3P09A 4P85A 5GL9A 3BFGA 3ZGAB 3D4FA 3WS1A 5FDHA 1ZKJA 2EFUA 5CGWA 3E2LA 1XA7A 3C7VA 4M3KA 3TG9A 1NXYA 3GSGA 4OPZA 3WRTA 2X02A 2XLNA 2J7VA 5KMWA 1J9MA 1MY8A 4PM7A 4DDSA 3JYIA 5CXWA 1IELA 1W79A 3M2JA 4WELA 3HLGA 5A90A 1BLSA 4KZBA 4OQIA 3FWLA 4UA6A 4KZ6A 3TSGA 4A5RA 4EBPA 2WGVA 4OH0A 4CPKA 1BUEA 2ZQDA 1XXMA 1YLZA 3MZEA 3EQUA 3G35A 4KG2A 3SOIA 1ES2A 5CGXA 2XGNA 3VOZA 2HP9A 1NYYA 4JF4A 1KDSA 4P0MA 1HTZA 1SHVA 4P6BA 1PWDA 1FSYA 5HL1A 4LV1A 3HLDA 4WMCA 1GCEA 2QMIA 5U47A 1EWZA 5FI7A 1RP5A 5F83A 1MWUA 3ZG8B 3OPPA 4BENA 3RJUA 4JXWA 4KG6A 4E3LA 1FCOA 3O88A 3PAGA 2J9PA 4CJNA 2Y2IA 2ZM2A 5FQKA 2Y2QA 1JTDA 2ZJ9A 3NC8A 5E2EA 1W5DA 4FH2A 5DTTA 4NK3A 4R0QA 3VOYA 5CHMA 4MBFA 4EUZA 1ESIA 2DRWA 5HW3A 3UO9A 2P74A 4RVAA 5E2GA 4KG5A 1CI8A 1JWVA 4KZ7A 1K25A 3IHBA 4PM8A 2HPBA 3C5AA 5M1AA 2JBFA 4S2PA 3LCEA 2WKEA 1FQGA 3IF6A 3G31A 3IF6B 3S22A 3OC2A 3AGFA 4H8RA 5FQQA 4IBXA 3O3VA 4E3MA 4IEDA 2E8IA 2OSUA 1KGGA 4Y0OA 1ONGA 2ZM8A 3MFDA 2G2WA 1E3UA 3BRMA 3VSKA 5DTSA 3HVFA 4EWFA 3Q7VB 1FR1A 5GHXA 2WUQA 3UY6A 3N7WA 4EBLA 2B5RA 3S1YA 4C6YA 4WZ4A 1K54C 3HUMA 4JF5A 4OQ0A 3VP3A 4Y0UA 4U3TA 4OLGA 1XA1A 3VSLA 5FATA 4ZAMA 4DF6A 1FCNA 3PAEA 3PBTA 4HBUA 1K54A 2Y2MA 3NDGA 3GR2A 4GDNA 5E43A 3MZFA 1PW1A 1YLYA 4HESA 3W8KA 4QJGA 4E3KA 2Z2LB 1LI9A 3LEZA 3GRJA 5A91A 3BYDA 4GOGA 2XF3A 4PPRA 1K55A 3WS4A 4DRTA 1Q2PA 3V5MA 4DE0A 5EVLA 5A93A 3UPOA 3ZCZA 3IWQA 1YLPA 4OVDA 2EXBA 3M2KA 1ERQA 4KZ8A 4GDBA 5FQMA 4X56A 3ZVWA 1H8YA 3HLCA 2ZMAA 1HVBA 2PU4A 5KZHA 3N6IA 5EVID 4B4ZA 4DE1A 4S2OA 3FYZA 2XK1A 3MXRA 1IYSA 4LV0A 5FQJA 3G32A 1YMSA 5DF7A 4N92A 4DKIA 3A3EA 1DY6A 4HEFA 2EX9A 3HUOA 4WM9A 4WYYA 3SH9A 1N9BA 5EVIB 4X6TA 2H0YA 3C4PA 1SDEA 4MEZA 5FQ9A 2XFTA 2P9VA 3OPHA 4ID4A 2DCFA 4KQOA 3ZNTA 3G34A 4OONA 5CTNA 1G68A 3DTMA 1K57C 3ITAA 4Q8IA 1IYQA 4ZJ1A 1TVFA 5GLDA 4B4XA 1SKFA 3IH9A 4FH4A 5IHVA 3VFHA 3UPNA 4E3NA 4Z9QA 1ONHA 3OCNA 3O86A 5JYOA 3IWOA 3ZVTA 2C5WB 4XXRA 4S2LA 1L0GA 1YM1A 2WAEA 1W8YA 5FSRA 4DXBA 3ZHHA 3MZDA 4O7DA 1NZOA 4K0XA 3IXHA 2A3UA 4IBRA 1BLCA 3E2KA 3WS5A 4MNRA 5E2FA 4BJPA 2V1ZA 3MXSA 3A3IA 1SCWA 5KSHA 1VM1A 4B88A 1O7EA 3P98A 3TOIA 2XDMA 3ZNYA 5I94A 5DF8A 5TFQA 4OQGA 5CGSA 5GHZA 2Y2PA 1RGYA 3DW0A 1PI4A 3Q82A 1YT4A 4KZ3A 5AQ7A 3N8RA 5HAPA 4UA7A 1ES3A 4OPQA 1N4OA 3HBRA 1KE4A 3SH8A 2A49A 4OKPA 3ZDJA 4QD4A 4Y7PA 2HP5A 5M18A 1ESUA 2H5SA 4P87A 4R23A 2XFSA 4E6WA 1EROA 3V39A 5DF9A 3A3FA 5GHYA 2IWDA 1L0FA 4FCFA 3I7JA 1YMXA 1Q2QA 5M19A 3W4QA 4OPRA 3W4PA 1MWSA 5TGFA 5BOHA 4ZBEA 4BL2A 3GV9A 1WYCA 4WEJA 3QNCA 3V50A 4S2KA 5FAPA 1C3BA 2ZC7A 1EI5A 3G30A 1M6KA 4OLDA 4E3IA 3LY3A 3HL9A 4QU3A 4YINA 5L2FA 1PZPA 3N8SA 2WKHA 3GVBA 5JYPA 2Q9NA 4BL3A 5CERA 3V3RA 3Q7VA 4BD1A 2RL3A 3BFFA 4S2IA 2ZQ8A 1JTGA 2JCHA 1ZG6A 3G2ZA 4PMAA 2Y2JA 4R3BA 1MXOA 3IT9A 1K6RA 2Y59A 1BTLA 2ZLYA 2Z2MB 3IF5A 2IWCA 4HBTA 5AQAA 4E3JA 4FD8A 4E6XA 3UDIA 4NETA 4X69A 4OOMA 1I2WA 3MKEA 1JVJA 3NY4A 4XUZA 4GD8A 5G18A 3M6HA 3GQZA 1CEGA 1VQQA 4WMCD 5GLAA 3ZG5A 1QMEA 1G6AA 1GHIA 3CZDA 3M6BA 1O07A 1K4FA 3UE3A 1ZG4A 1L0EA 1LL9A 2X01A 2BLSA 4E3OA 1LHYA 4C75A 4KZ5A 4LCMA 4N1XA 1YLJA 3NDEA 3LY4A 3IH8A 1ES4A 3HLBA 4ZJ2A 3UDXA 2FFFB 4QY5A 3SS4A 4GN2A 3AGDA 4WEKA 2I72A 2Y2NA 3WS0A 1GA9A 2WGWB 4KZ9A 1M40A 2OLVA 5A92A 2IWBA 1S6RA 3NCKA 3QNBA 3VP2A 1K4EA 2G2UA 1KDWA 4N9KA 4JKTA 4UA9A 2ZC6B 4RYEA 2EFXA 1BT5A 4GB7A 3O87A 3OZHA 1PYYA 1WYBA 3UE0A 4QY6A 2WGIA 4WZ5A 2V2FF 3HLEA 3MKFA 1YLWA 3AGEA 5HX9A 4KZ4A 1RGZA 2ZQ7A 2HP6A 3BFEA 3G2YA 1XPBA 2V20A 1CEFA 1KGEA 1NJ4A 3C4OA 3WS2A 5FASA 5CHUA 1BSGA 1PI5A 2R9XA 3RXWA 1K38A 3IF6C 5CRFA 5D3OA 3BECA 3NBLA 4JF6A 1YLTA 4U0TA 2WK0A 2JC7A 4IVIA 3PBRA 3BFCA 2HDSA 1I2SA 4XUXA 1K55C 5EOOA 4ZJ3A 1E3UD 1FR6A 2H0TA 2HDUA 5F82A 3WWXA 2X71A 2CC1A 1I5QA 4S2NC 1KVMA 3FKVA 3VP4A 4ZDXA 2J9OA 3BFDA 2JE5A 4R3JA 5E2HA 4U0XA 1IKIA 3PTEA 4FSFA 1U60A 2R9WA 2WYXA 4EV4A 1CI9A 3V3SA 1MWTA 1JWPA 3FV7A 4UAAA 2ZC5B 3A3DA 2Y4AA 1NYMA 3QHYA 4QB8A 5DVAA 5HAQA 4IVKA 3HUNA 3IQAA 1TDGA 4MBKA 1BZAA 5EVIC 5FAQA 3ITBA 3NIAA 1W8QA 2PU2A 1HD8A 1K57A 2ZC4B 3DWKA 1PIOA 2H10A 2WAFA 4N1HA 4ZTKA 4OQHA 1SDNA 2P9VB 3G4PA 4OPYA 4KQQA 4DXCA 5EECA 5EVIA 5J8XA 1LL5A 3VP0A 3LO7A 2ZM0A 1ALQA 3GTCA 1XGIA 4BD0A 5FAOA 4GD6A 4KENB 1DJCA 3VFFA 5AQ9A 4RX3A 1H8ZA 1KE3A 3CG5A 3PBSA 2WZZA 5FI6A 5HFOA 3HREA 1GHPA 2OV5A 1IYPA 2WKIA 2XR0A 4F94A 1FOFA 3NI9A 4JXSA 2WGWA 5EE8A 4LV3A 3N8LA 1Y54A 3Q07A 4GKUA 5KSCA 3BEBA 5AQBA 1YQSA 1HZOA 3IWIA 1CK3A 5FI2A 3ZG0A 5HAIA 3DWZA 1KE0A 1E4DA 3UPPA 2XQZA 2EXAA 3OPRA 2EX2A 1W7FA 1XKZA 4JXGA 2J8YA 3UNWA 3OPLA 3VMAA 3RXXA 2DNSA 4JXVA 4BQMA 5CEBA 2Y2HA 2Y2KA 1LLBA 3SS3A 1IEMA 1Z6FA 1ERMA 1JWZA 4QHCA 4L0LA 5EPHA 5EUAA 3VP1A 1E25A 2ZQCA 3WRZA 1FSWA 2ZC3B 4KZAA 3FZCA 1MWRA 3B3XA 3HLWA 4WBGA 3ISGA 1LI0A 1IYOA 2WADA 1PWGA 3EQVA 1AXBA 3UN7A 4R4RA 4EBNA 1PZOA 2Y2OA 4GZBA 4KQRA 4S2NA 2FFYA 1TEMA 4UHUA 4S2JA 1PW8A 4JLFA 2XD1A 1MBLA 5F1GA 4S2MA 4LCLA 3PBQA 2PBYA 1OMEA 4DDYA 4K91A 2BG1A 2VGKA 1L0DA 4RX2A 1NRFA 2UWXA 3S4XA 4JBFA 5CHJA 3ZG7B 4OP8A 1TDLA 3HLFA 4OOLA 3CJMA 1MKIA 3BLMA 1ZC2A 4K0WA 4PM6A 2C6WB 5F1FA 5CTMA 1GA0A 3N4IA 4MLLA 4PM9A 4X53A 1IKGA 4X55A 4Y0TA 4LENA 2ZQ9A 3IHAA 4N9LA 1FCMA 3IXDA 4EQIA 1ES5A 1L2SA 2OLUA 2WZXA 5FA7A 3UDFA 2EX8A 3UE1A 5CECA 1XP4A 4C3QA 4JPMA 2Q9MA 1XX2A
chains in the Genus database with same CATH superfamily
2XEPA 3SS5A 1BULA 4DE2A 3W2ZA 2JKTM 4R4SA 4D2OA 1DJBA 3B47A 1GHMA 2QZ6A 5CEDA 4RA7A 2VV8A 1OPXA 5CX7A 1DP9A 1IOUA 2ZL1A 1OTIA 3K3CA 3SH7A 3IXGA 1EW0A 5DTKA 3IXBA 2HDRA 1NY0A 4OOYA 2HV1A 2NUTC 2GNXA 2M7VA 2X02A 2J7VA 3NHQA 1MY8A 1UWNX 4DDSA 1W79A 4WELA 1N9OA 1BLSA 4OQIA 3FPVA 3LR4A 2WGVA 4OH0A 2ZQDA 4KG2A 3G35A 3C30A 2XGNA 3VOZA 1NYYA 4M4XA 3T4LA 4LV1A 3HLDA 1GCEA 1EWZA 3LIDA 1MWUA 4HQAA 3KSHA 1TS7A 5EFWA 4X25A 2ZM2A 3NC8A 5DTTA 4NK3A 3JVUA 5CHMA 3FG8A 4CQHA 4RVAA 5E2GA 4KG5A 1CI8A 4PM8A 3IHBA 2JBFA 1TS6A 3G31A 3D9YA 4H8RA 4IBXA 2W27A 1KGGA 1ONGA 3HVFA 3JVVA 1K54C 4Y17A 3VSLA 2VGLS 5FATA 3QP8A 1TD5A 3QP6A 4DJ3A 4E3KA 4EERA 3P7NA 4DRTA 1Q2PA 3V5MA 2YKFA 5AVFA 2K2NA 4OVDA 4HHDA 1NRJA 4Y5FA 4X56A 1H8YA 2Z6CA 3HLCA 2DMWA 4B4ZA 1W63M 3FYZA 4LRZE 4R38A 5F6AA 1N9BA 2V8CA 4X6TA 1SDEA 3LR0A 4OONA 1P97A 5CTNA 1G68A 4JGQA 4PKYG 1TVFA 4I3JA 1ONHA 3O86A 3NJAA 3LIEA 2W3DA 1YM1A 4DXBA 4O7DA 4Y3IA 1H3QA 2J3TC 4BJPA 3MXSA 2O9AA 1O7EA 2XDMA 5I94A 5TFQA 5HDSA 3S7NA 1PI4A 2ZOHA 4JGPA 5AQ7A 4UA7A 1V9YA 3LIBA 2V1AA 4GLQA 1ACFA 5M18A 4E6WA 2JKTI 5DF9A 2WKQA 4FCFA 1L0FA 3BQAA 1Q2QA 3TJZC 3CLOA 3V50A 4LRXC 1H0MA 2ZC7A 1M6KA 1G5UA 4QU3A 5L2FA 1PZPA 3GVBA 4BL3A 4L9FA 5CERA 3V3RA 2RL3A 3BFFA 1JTGA 1ZG6A 3KSFA 2ZLYA 4FD8A 4E6XA 1VETB 4X69A 3M6HA 1DRMA 5GLAA 3ZG5A 3M6BA 1O07A 1ZG4A 1LL9A 1LHYA 4C75A 4R6LA 4EQ1A 3NDEA 3IH8A 4QY5A 4PKYA 4R3AA 3MSHA 1M40A 5A92A 1S6RA 2PAVP 2ZC6B 4HH2A 3OZHA 1PYYA 1MZUA 1WYBA 2WGIA 5HX9A 3HLEA 3PR6A 4GS9A 1XJ4A 3OLOA 1G6OA 1NJ4A 3C4OA 2P08A 4B93A 4DN0A 2WK0A 4IVIA 2V0WA 2HDSA 1I2SA 1K55C 4ZJ3A 1FR6A 3VP4A 4ZDXA 2O9CA 1GSXA 2JE5A 4EESA 1U60A 2R9WA 2WYXA 1CI9A 4UQIS 3FV7A 3QHYA 1NYMA 2IA2A 1BZAA 5FAQA 1N9LA 3NIAA 1W8QA 1PIOA 2H10A 4OPYA 3KO6A 5EVIA 5J8XA 1ALQA 4BD0A 4R70A 4KENB 1OTEA 4RX3A 3CG5A 3PBSA 2WZZA 5FI6A 1GHPA 3KYZA 2JKGA 2A24B 1FOFA 3BEBA 1HZOA 3IWIA 2VLGA 3OOVA 4I3AA 1KE0A 4HOIA 3UNWA 3OPLA 2JHEA 2Y2HA 5I5LA 4ESPA 2Y2KA 1LLBA 4L0LA 3HCYA 2ZQCA 1FSWA 2H28A 4KZAA 3F1PB 3B3XA 4WN5A 3BJNA 3UN7A 4R4RA 3F1OA 3A0SA 1PZOA 2Y2OA 2VV6A 4GZBA 3LIAA 4IHQA 1D1JA 2XD1A 3MQOA 2KOIA 1OMEA 2VGKA 3PYPA 2UWXA 4HI4A 4JBFA 4ETZA 3KSGA 3HLFA 5L07A 3BLMA 5HDDA 3JPUA 2C6WB 4PM9A 1IKGA 2OWHA 4ARZA 2ZQ9A 4N9LA 1YKDA 1L2SA 2OLUA 5FA7A 3UDFA 1VETA 3UDXA 1H5XA 3IS2A 5TR7A 5HARA 3Q81A 4NXEA 2Y2LA 2O9BA 1RCJA 2QJ5A 5EOEA 1XGJA 2EX6A 2XD5A 5FQIA 1S0WA 4B9OA 5GLCA 1LT0A 3CMZA 3A3JA 1KGFA 4DE3A 5GLBA 2PD7A 3BM6A 1ZKJA 3E2LA 4M3KA 5KMWA 4OPZA 3GSGA 2XLNA 4PM7A 4HJ6A 4EXOA 3M2JA 5FDSA 1CJFA 2ZBBA 1XJ6A 3MF0A 4G3KA 1BUEA 3BY8A 3TE8A 1VEUA 3VOLA 5CGXA 2HP9A 2A24A 1KDSA 1LSVA 1HTZA 4P0MA 5L10A 5HL1A 2QMIA 3ZG8B 4YNRA 4JXWA 2PHYA 4K08A 2ZJ9A 3UB7A 5E2EA 1W5DA 2O99A 3NOUC 2HJEA 3VOYA 4Z1WA 3UB6A 4EUZA 2DRWA 3F1NA 3UO9A 4IJGA 1OT9A 5KIZA 1JWVA 1K25A 3IF6B 3S22A 3B33A 1NLYA 4IEDA 2E8IA 3T1QB 2ZM8A 3MFDA 2W0NA 4EWFA 3Q7VB 2B5RA 2QYBA 4C6YA 3CUEA 3HUMA 4JF5A 4Y0UA 4U3TA 1SKOA 2JN7A 4DF6A 1FCNA 3PBTA 4HBUA 2OAP1 2Y2MA 4F3LB 5E43A 3V67A 4QJGA 3LEZA 5F5YA 3WS4A 3EGXC 1NWZA 4IUHA 1ERQA 4GDBA 3LI8A 2ZMAA 2O0YA 1HVBA 5KZHA 4DE1A 1IYSA 5FQJA 1YMSA 3A0VA 4DKIA 4AFIA 3A3EA 3HUOA 4WYYA 5EVIB 2H0YA 5FQ9A 3LEQA 2P9VA 4KUOA 4IUKA 4ID4A 3S7PA 3O5YA 3DTMA 4ETXA 3ITAA 4Q8IA 1IYQA 1TS0A 5IHVA 3VFHA 4Z9QA 3IWOA 5HWTA 2C5WB 4XXRA 3T12B 1L0GA 1W8YA 3ZHHA 1TS8A 4IBRA 2XA7M 4II7A 3MQ0A 2WKPA 2V1ZA 3RH8B 4BMWA 1VM1A 2KX6A 3P98A 3ZNYA 4G3WA 2L0WA 5DF8A 4OQGA 2PYPA 3DW0A 3NECA 3Q82A 3EEAA 3N8RA 1GSVA 4OPQA 5DKLA 3HBRA 3T4QA 1KE4A 3ZDJA 4Y7PA 2HP5A 3QP2A 4P87A 1EROA 1YMXA 5M19A 2ZL1B 1H8MA 5C5KA 3UB5P 4KQDA 3T4KA 3QNCA 4S2KA 4E3IA 1C3BA 4OLDA 3LY3A 4MN6A 2JKRM 3HL9A 4BD1A 4PMAA 2Y8HA 3T4OA 1MXOA 3IT9A 2Y59A 5DFYA 1BTLA 4HBTA 2IWCA 4WLAA 2GX5A 2HGVA 3UDIA 5FEFA 3EWKA 1XFQA 1CEGA 3G6OA 2VGLM 1K4FA 2X01A 4E3OA 4UQIM 3RTYA 1YLJA 3LGOA 1ES4A 3HLBA 3EGDC 2I72A 3WS0A 1GA9A 3VV4A 5AVEA 3R4KA 3MR0A 3VP2A 1MC0A 4JKTA 4ME4A 4I38A 2EFXA 2VEAA 3F1PA 5EVEA 2WKRA 1YLWA 3AGEA 4KZ4A 1RGZA 2ZQ7A 5HPFA 5F68A 3G2YA 1K38A 3H7WB 5D3OA 4JF6A 1OTDA 1YLTA 3L7HA 4U0TA 4DMZA 1X0OA 1YSQA 4WF0A 3VE4A 3RFBA 1AWIA 2H0TA 2HDUA 5F82A 3WWXA 3CHWP 4S2NC 1I5QA 2E8JA 3LR3A 4R3JA 4U0XA 1IKIA 3PTEA 1JWPA 3LYXA 4QB8A 5HAQA 3HUNA 1TDGA 4MBKA 5IT5A 1XFNA 1HD8A 5TJJA 2ZOIA 3DWKA 2WAFA 2QJ7A 4DXCA 1LL5A 4JGRA 3LO7A 2ZM0A 4FOFA 4D60A 3GTCA 1XGIA 3FC7A 4GD6A 1DJCA 3VFFA 4EEPA 1H8ZA 5HFOA 2OV5A 1IYPA 4F94A 4BBTA 2WGWA 3Q07A 4HJ4A 5FI2A 3DWZA 3KYQA 1D06A 2EX2A 3KSIA 4JXGA 2XRNA 2BASA 1OJ5A 3RXXA 2DNSA 4XT2B 3BW6A 3FPWA 1ERMA 3WRZA 2ZC3B 1MWRA 4Y15A 3CPTA 1IYOA 1PWGA 2WADA 2ACGA 2J3WA 4I39A 1T1BA 4S2NA 3PHYA 2V1BA 2PRFA 4UHUA 1PW8A 1S1YA 1PNEA 2Z6DA 2FH5A 3NOTC 5CHJA 4OP8A 1MKIA 2M7UA 3R7WB 4PM6A 5F1FA 4HP9A 3N4IA 4KUKA 4X53A 4RQ9A 4LENA 3HJKA 3IXDA 4EQIA 1N9NA 4CLCE 5CECA 1FIKA 4C3QA 4JPMA 2Q9MA 4O01A 1S4RA 2BTFP 3FKWA 4OP5A 2RCXA 1GSWA 3T1RA 3EEHA 4BLMA 1BLHA 2W1TB 1ZTUA 1K6SA 2W1TA 3MBZA 3Q7ZA 3BLSA 4Y2FA 4WZ5C 2VZWA 3KX0X 3W4OA 1V9ZA 1Y4OA 1DJAA 2GDNA 4CLCD 4R1GA 4YFMA 1BLPA 2JKFA 2VGJA 1NZUA 1K56D 2OAQ1 5GL9A 2EFUA 3C7VA 1NXYA 3ULFA 1ZHHB 3HLGA 1YPRA 4DJ2A 2PDRA 1S4SA 4KZ6A 4EBPA 1XXMA 1YLZA 1ES2A 5HD3A 1L3LA 1SHVA 1ODVA 1PWDA 4P6BA 1F5MA 4WMCA 5U47A 5FI7A 5F83A 2I9VA 3RJUA 3T4SA 4WUJA 4KG6A 4E3LA 3O88A 3PAGA 2Y2IA 1JTDA 1YSPA 2AVXA 4I5SA 2INWA 2P04A 1ESIA 2YKHA 5HW3A 3TW8A 1KOUA 3CPTB 2HPBA 2ZMFA 4S2PA 2VK3A 3AGFA 3O3VA 4GHIB 4Y0OA 1XJ2A 2FZ0A 3BRMA 5DTSA 1FR1A 2WUQA 4WZ4A 3VP3A 4P6ZM 1XA1A 5LBRA 4LPZA 3LI9A 4ZAMA 5HL6A 3PAEA 1K54A 3NDGA 3GR2A 4GDNA 3W8KA 3MZFA 1PW1A 1YLYA 2XA7S 2Z2LB 1LI9A 3GRJA 3BYDA 3LICA 3S7QA 1K55A 1CQAA 5EVLA 3UPOA 3ZCZA 3LFVA 3IWQA 1YLPA 3M2KA 2QWSA 2VJWA 2W3GA 3B42A 2PU4A 3U4LP 3N6IA 4S2OA 1T19A 3G32A 5DF7A 4N92A 3TRCA 3F1OB 1DY6A 4HEFA 2EX9A 4P6ZS 4MEZA 2XFTA 2KLIA 2QHKA 2DCFA 4KQOA 3BWLA 1K57C 1P9WA 5GLDA 1SKFA 4EU0A 3MJQA 3UPNA 4E3NA 3OCNA 5HSQA 4F3LA 2PYRA 2J3TD 2WAEA 4EW7A 3IXHA 2D02A 2A3UA 1BLCA 3E2KA 4MN7A 2VKSA 5E2FA 3A3IA 4GCZA 5K5BA 2L1MA 5CGSA 1RGYA 3E0YA 3EOIA 2VX8A 4KZ3A 1T18A 5IS1A 1ES3A 1N4OA 2VV7A 3SH8A 4OKPA 2GZAA 1S67L 4QD4A 2Y79A 2EA9A 3CI6A 4R23A 4WL9A 3V39A 3A3FA 5GHYA 2IWDA 3U2AA 3I7JA 4FUWA 3W4QA 4OPRA 5HWWA 5BOHA 1MWSA 4O0PA 3CAXA 1WYCA 3ZQ5A 2EWWA 1EI5A 3G30A 3SW1A 1K0KA 2HF6A 1XJ3A 4YINA 2WKHA 2MJ6A 4S2IA 2Y2JA 4R3BA 1CF0A 2Z2MB 3IF5A 5AQAA 4E3JA 4Q0IA 3S7OA 4OOMA 3IBJA 1JVJA 5G18A 3CUEC 1LSXA 3GQZA 1VQQA 4WMCD 1QMEA 1GHIA 3CZDA 1L0EA 4X1MA 2LB9A 1PRQA 3LY4A 4UEYA 5G4ZA 4WEKA 2Y2NA 2K7SA 3BY9A 2WGWB 1FILA 2IWBA 3QNBA 1K4EA 2G2UA 1KDWA 4N9KA 4O8GA 4RYEA 3O87A 3E98A 2L4RA 4LRYC 2V2FF 3MKFA 4YOFA 1P9RA 2HP6A 3BFEA 1XPBA 4CLCB 5CHUA 1BSGA 1PI5A 3RXWA 3T1XA 4EEUA 5CRFA 3IF6C 3PBRA 3BFCA 3MFXA 1T1AA 2X71A 3FKVA 2J9OA 3BFDA 4FSFA 4X1LA 4ARZB 4EV4A 3V3SA 4UAAA 3OBFA 2HZ5A 2ZC5B 5DVAA 3IQAA 5EVIC 5DJTA 3GECA 4OQHA 1SDNA 5EECA 3UMDA 3D72A 5F69A 4QPRA 5AQ9A 2KDKA 5DKKA 2HJ9C 1LSWA 2XR0A 3NI9A 4JXSA 1DP8A 3N8LA 4GKUA 5KSCA 5AQBA 2V0UA 1CK3A 3ZG0A 3UPPA 2XQZA 1W7FA 2J8YA 3R7WA 5HDCA 4JXVA 4BQMA 5CEBA 2GJ3A 5MC7A 1VB6A 3SS3A 1Z6FA 5EUAA 2Q0OA 3VP1A 1E25A 2XSSA 4H6JA 1LI0A 3CITA 3E4QA 1MKMA 4EBNA 4KQRA 2FFYA 1TEMA 4S2JA 5HD5A 5J7EA 1MBLA 4NG2A 4LCLA 3PBQA 2XROA 2PBYA 4DDYA 4K91A 2BG1A 5A8BA 1NRFA 4CLCC 3S4XA 3ZG7B 1TDLA 1JNUA 3CJMA 5CTMA 4MLLA 1BYWA 1G28A 3IHAA 1ES5A 3UE1A 2WZXA 2PT7A 2PR6A 5A93A 1XX2A 2ZQAA 3ZG9B 1WE4A 1KVLA 3C7UA 4MBHA 1PWCA 2OWJA 3OCLA 3IX3A 2Y55A 2V8FA 1MPLA 2ZD8A 4LV2A 2Y91A 3IX8A 3Q1FA 4YWZA 3UMEA 5L09A 4X68A 3ZFZA 2HDQA 2XH9A 2QPNA 4PM5A 4GNUA 1QMFA 3IX4A 3PBOA 3GMWA 3IBRA 3PBNA 3DTIA 3LUQA 1K56A 2Y2GA 4HY8A 4EETB 3P09A 4P85A 2VA0A 3BFGA 3ZGAB 3D4FA 3WS1A 5HZHA 5FDHA 5CGWA 1XA7A 3TG9A 3WRTA 1F98A 1J9MA 3QP4A 4CLCA 3JYIA 5CXWA 1IELA 5A90A 4KZBA 3FWLA 4UA6A 3TSGA 4A5RA 4CPKA 3LIFA 1F9IA 4NXGA 1VEUB 3MZEA 3EQUA 3SOIA 1OT6A 3P01A 4JF4A 1FSYA 4NKPA 5EM0A 1RP5A 3QP1A 3OPPA 4BENA 4HNBA 4BBUA 1FCOA 2J9PA 4CJNA 3UB9A 5FQKA 2Y2QA 3L9KA 2R78A 4FH2A 4BWIA 4R0QA 1OJGA 4MBFA 4FTXA 3HJIA 2P74A 4MCWA 4KZ7A 1J3WA 3C5AA 5M1AA 3LCEA 1FQGA 2WKEA 3IF6A 3OC2A 5FQQA 1YAXA 4E3MA 2OSUA 3VSKA 2G2WA 1E3UA 5GHXA 3UY6A 4EBLA 3N7WA 4L9GA 3S1YA 5HPIA 1PFLA 3C2WA 4OQ0A 1A0KA 4OLGA 2OOLA 3CWFA 4H6JB 5HWVA 1TF1A 4HESA 4XT2A 4LGWA 5A91A 4GOGA 2XF3A 4PPRA 2P7JA 2B95A 3GDIA 4DE0A 2ZMVA 2EXBA 2UV0E 4KZ8A 5FQMA 3ZVWA 4HIAA 4L9EA 4NXBA 5EVID 2M1CA 2XK1A 3MXRA 4LV0A 4JGOA 3A0RA 2NUPC 4WM9A 3SH9A 5IU1A 3C4PA 5TBMB 3OPHA 3ZNTA 3G34A 4ZJ1A 4B4XA 3IH9A 4FH4A 2J80A 4Q0HA 5JYOA 4Q0JA 3ZVTA 4MMNA 3NOPC 4S2LA 5FSRA 3MZDA 1NZOA 4K0XA 3T50A 2D01A 3MXQA 3WS5A 4MNRA 5AJGA 1SCWA 5KSHA 3D3OA 4B88A 3TOIA 3T4JA 3KYEA 5GHZA 3DTEA 4QWOA 2Y2PA 4ZRRA 4MDZA 1YT4A 4EUVA 5HAPA 4I3IA 2K31A 2A49A 1SZVA 2B02A 5L8MA 1ESUA 2H5SA 1Y28A 2XFSA 4PAUA 5J4EA 2W1RA 3NULA 2LB5A 3W4PA 5TGFA 4ZBEA 3VE3A 4BL2A 3GV9A 4MN5A 4WEJA 3ZYTA 3DTKA 5FAPA 4LLOB 2G7UA 3N8SA 5JYPA 2Q9NA 3Q7VA 3H7WA 2ZQ8A 2JCHA 4HJ3A 3G2ZA 4GHIA 1K6RA 3UB8A 4NXFA 4GS9B 4NETA 1VHMA 1I2WA 3MKEA 3NY4A 4XUZA 4GD8A 2W3HA 1IFQA 3C38A 3C8CA 3MMHA 1G6AA 4GJ4A 1UGUA 5DFXA 3UE3A 1UWPX 5FL3A 4PHTA 2BLSA 4HP4A 4KZ5A 4LCMA 2EWVA 4N1XA 4G3VA 3BQ8A 3MQQA 4ZJ2A 2FFFB 3SS4A 4GN2A 3AGDA 2CMNA 4KZ9A 2OLVA 3NCKA 5EM1A 4LFUA 3H9WA 4UA9A 3K2NA 1OTAA 1BT5A 4GB7A 1Z09A 3UE0A 1D7EA 4QY6A 4WZ5A 5DJUA 2V20A 1CEFA 1KGEA 3WS2A 5FASA 2R9XA 3BECA 3NBLA 3LR5A 2JC7A 3QP5A 1DP6A 4XUXA 5EOOA 1E3UD 2JKRI 4GW9A 2CC1A 1KVMA 2W3EA 5E2HA 2PBDP 1P0ZA 1MWTA 3T1SA 3A3DA 3E4OA 2Y4AA 1STZA 4IVKA 1LL8A 3E4PA 3ITBA 2PU2A 1K57A 2ZC4B 4N1HA 4ZTKA 3T4TA 1OTBA 2P9VB 3G4PA 4HH3A 3UE6A 4KQQA 3VP0A 4Y13A 3DAVA 3F1NB 5FAOA 3H82B 1KE3A 3HREA 2WKIA 1W63Q 5EV0A 4NEED 5EE8A 4LV3A 1Y54A 1YQSA 5HAIA 1E4DA 2EXAA 2PR5A 2V9AA 3OPRA 1WA9A 1XKZA 1NLZA 2B18A 3VMAA 4BBVA 1IEMA 1JWZA 3IS2B 4QHCA 5EPHA 3FZCA 3HLWA 3SZTA 4WBGA 5TBMA 1HLUP 3ISGA 5FEGA 3MS6A 3EQVA 1AXBA 2PD8A 3PXPA 1S66L 1S1ZA 3H82A 4JLFA 5F1GA 4S2MA 2W3FA 5G4YA 5J3WA 3K3DA 1L0DA 4RX2A 2QKPA 4OOLA 4K0WA 1ZC2A 2A2LA 4E04A 1GA0A 4X55A 4Y0TA 1FCMA 3ICYA 1T1CA 2EX8A 3DBAA 1F2KA 1XP4A 1SKOB
chains in the Genus database with same CATH topology
1H5XA 2XEPA 3FKWA 4OP5A 3SS5A 2RCXA 2ZQAA 5TR7A 1WE4A 3Q81A 1KVLA 5HARA 1BULA 3C7UA 3ZG9B 4DE2A 4MBHA 4BLMA 1PWCA 1BLHA 2Y2LA 1K6SA 3MBZA 3OCLA 3Q7ZA 3BLSA 4R4SA 2Y55A 1MPLA 1RCJA 5EOEA 4D2OA 4WZ5C 1DJBA 2ZD8A 2Y91A 4LV2A 1GHMA 1XGJA 2QZ6A 3Q1FA 5CEDA 2EX6A 3W4OA 2XD5A 4X68A 1DJAA 5FQIA 1S0WA 2HDQA 2XH9A 2GDNA 2QPNA 4RA7A 3ZFZA 4R1GA 4PM5A 4GNUA 1QMFA 4YFMA 5GLCA 3PBOA 3GMWA 1BLPA 3SH7A 3IXGA 3CMZA 2VGJA 3PBNA 3A3JA 1KGFA 1NZUA 5DTKA 3IXBA 2HDRA 1NY0A 4OOYA 1K56D 5GLBA 1K56A 4DE3A 2Y2GA 3BM6A 3P09A 4P85A 5GL9A 3BFGA 3ZGAB 3D4FA 3WS1A 5FDHA 1ZKJA 2EFUA 5CGWA 3E2LA 1XA7A 3C7VA 4M3KA 3TG9A 1NXYA 3GSGA 4OPZA 3WRTA 2X02A 2XLNA 2J7VA 5KMWA 1J9MA 1MY8A 4PM7A 4DDSA 3JYIA 5CXWA 1IELA 1W79A 3M2JA 4WELA 3HLGA 5A90A 1BLSA 4KZBA 4OQIA 3FWLA 4UA6A 4KZ6A 3TSGA 4A5RA 4EBPA 2WGVA 4OH0A 4CPKA 1BUEA 2ZQDA 1XXMA 1YLZA 3MZEA 3EQUA 3G35A 4KG2A 3SOIA 1ES2A 5CGXA 2XGNA 3VOZA 2HP9A 1NYYA 4JF4A 1KDSA 4P0MA 1HTZA 1SHVA 4P6BA 1PWDA 1FSYA 5HL1A 4LV1A 3HLDA 4WMCA 1GCEA 2QMIA 5U47A 1EWZA 5FI7A 1RP5A 5F83A 1MWUA 3ZG8B 3OPPA 4BENA 3RJUA 4JXWA 4KG6A 4E3LA 1FCOA 3O88A 3PAGA 2J9PA 4CJNA 2Y2IA 2ZM2A 5FQKA 2Y2QA 1JTDA 2ZJ9A 3NC8A 5E2EA 1W5DA 4FH2A 5DTTA 4NK3A 4R0QA 3VOYA 5CHMA 4MBFA 4EUZA 1ESIA 2DRWA 5HW3A 3UO9A 2P74A 4RVAA 5E2GA 4KG5A 1CI8A 1JWVA 4KZ7A 1K25A 3IHBA 4PM8A 2HPBA 3C5AA 5M1AA 2JBFA 4S2PA 3LCEA 2WKEA 1FQGA 3IF6A 3G31A 3IF6B 3S22A 3OC2A 3AGFA 4H8RA 5FQQA 4IBXA 3O3VA 4E3MA 4IEDA 2E8IA 2OSUA 1KGGA 4Y0OA 1ONGA 2ZM8A 3MFDA 2G2WA 1E3UA 3BRMA 3VSKA 5DTSA 3HVFA 4EWFA 3Q7VB 1FR1A 5GHXA 2WUQA 3UY6A 3N7WA 4EBLA 2B5RA 3S1YA 4C6YA 4WZ4A 1K54C 3HUMA 4JF5A 4OQ0A 3VP3A 4Y0UA 4U3TA 4OLGA 1XA1A 3VSLA 5FATA 4ZAMA 4DF6A 1FCNA 3PAEA 3PBTA 4HBUA 1K54A 2Y2MA 3NDGA 3GR2A 4GDNA 5E43A 3MZFA 1PW1A 1YLYA 4HESA 3W8KA 4QJGA 4E3KA 2Z2LB 1LI9A 3LEZA 3GRJA 5A91A 3BYDA 4GOGA 2XF3A 4PPRA 1K55A 3WS4A 4DRTA 1Q2PA 3V5MA 4DE0A 5EVLA 5A93A 3UPOA 3ZCZA 3IWQA 1YLPA 4OVDA 2EXBA 3M2KA 1ERQA 4KZ8A 4GDBA 5FQMA 4X56A 3ZVWA 1H8YA 3HLCA 2ZMAA 1HVBA 2PU4A 5KZHA 3N6IA 5EVID 4B4ZA 4DE1A 4S2OA 3FYZA 2XK1A 3MXRA 1IYSA 4LV0A 5FQJA 3G32A 1YMSA 5DF7A 4N92A 4DKIA 3A3EA 1DY6A 4HEFA 2EX9A 3HUOA 4WM9A 4WYYA 3SH9A 1N9BA 5EVIB 4X6TA 2H0YA 3C4PA 1SDEA 4MEZA 5FQ9A 2XFTA 2P9VA 3OPHA 4ID4A 2DCFA 4KQOA 3ZNTA 3G34A 4OONA 5CTNA 1G68A 3DTMA 1K57C 3ITAA 4Q8IA 1IYQA 4ZJ1A 1TVFA 5GLDA 4B4XA 1SKFA 3IH9A 4FH4A 5IHVA 3VFHA 3UPNA 4E3NA 4Z9QA 1ONHA 3OCNA 3O86A 5JYOA 3IWOA 3ZVTA 2C5WB 4XXRA 4S2LA 1L0GA 1YM1A 2WAEA 1W8YA 5FSRA 4DXBA 3ZHHA 3MZDA 4O7DA 1NZOA 4K0XA 3IXHA 2A3UA 4IBRA 1BLCA 3E2KA 3WS5A 4MNRA 5E2FA 4BJPA 2V1ZA 3MXSA 3A3IA 1SCWA 5KSHA 1VM1A 4B88A 1O7EA 3P98A 3TOIA 2XDMA 3ZNYA 5I94A 5DF8A 5TFQA 4OQGA 5CGSA 5GHZA 2Y2PA 1RGYA 3DW0A 1PI4A 3Q82A 1YT4A 4KZ3A 5AQ7A 3N8RA 5HAPA 4UA7A 1ES3A 4OPQA 1N4OA 3HBRA 1KE4A 3SH8A 2A49A 4OKPA 3ZDJA 4QD4A 4Y7PA 2HP5A 5M18A 1ESUA 2H5SA 4P87A 4R23A 2XFSA 4E6WA 1EROA 3V39A 5DF9A 3A3FA 5GHYA 2IWDA 1L0FA 4FCFA 3I7JA 1YMXA 1Q2QA 5M19A 3W4QA 4OPRA 3W4PA 1MWSA 5TGFA 5BOHA 4ZBEA 4BL2A 3GV9A 1WYCA 4WEJA 3QNCA 3V50A 4S2KA 5FAPA 1C3BA 2ZC7A 1EI5A 3G30A 1M6KA 4OLDA 4E3IA 3LY3A 3HL9A 4QU3A 4YINA 5L2FA 1PZPA 3N8SA 2WKHA 3GVBA 5JYPA 2Q9NA 4BL3A 5CERA 3V3RA 3Q7VA 4BD1A 2RL3A 3BFFA 4S2IA 2ZQ8A 1JTGA 2JCHA 1ZG6A 3G2ZA 4PMAA 2Y2JA 4R3BA 1MXOA 3IT9A 1K6RA 2Y59A 1BTLA 2ZLYA 2Z2MB 3IF5A 2IWCA 4HBTA 5AQAA 4E3JA 4FD8A 4E6XA 3UDIA 4NETA 4X69A 4OOMA 1I2WA 3MKEA 1JVJA 3NY4A 4XUZA 4GD8A 5G18A 3M6HA 3GQZA 1CEGA 1VQQA 4WMCD 5GLAA 3ZG5A 1QMEA 1G6AA 1GHIA 3CZDA 3M6BA 1O07A 1K4FA 3UE3A 1ZG4A 1L0EA 1LL9A 2X01A 2BLSA 4E3OA 1LHYA 4C75A 4KZ5A 4LCMA 4N1XA 1YLJA 3NDEA 3LY4A 3IH8A 1ES4A 3HLBA 4ZJ2A 3UDXA 2FFFB 4QY5A 3SS4A 4GN2A 3AGDA 4WEKA 2I72A 2Y2NA 3WS0A 1GA9A 2WGWB 4KZ9A 1M40A 2OLVA 5A92A 2IWBA 1S6RA 3NCKA 3QNBA 3VP2A 1K4EA 2G2UA 1KDWA 4N9KA 4JKTA 4UA9A 2ZC6B 4RYEA 2EFXA 1BT5A 4GB7A 3O87A 3OZHA 1PYYA 1WYBA 3UE0A 4QY6A 2WGIA 4WZ5A 2V2FF 3HLEA 3MKFA 1YLWA 3AGEA 5HX9A 4KZ4A 1RGZA 2ZQ7A 2HP6A 3BFEA 3G2YA 1XPBA 2V20A 1CEFA 1KGEA 1NJ4A 3C4OA 3WS2A 5FASA 5CHUA 1BSGA 1PI5A 2R9XA 3RXWA 1K38A 3IF6C 5CRFA 5D3OA 3BECA 3NBLA 4JF6A 1YLTA 4U0TA 2WK0A 2JC7A 4IVIA 3PBRA 3BFCA 2HDSA 1I2SA 4XUXA 1K55C 5EOOA 4ZJ3A 1E3UD 1FR6A 2H0TA 2HDUA 5F82A 3WWXA 2X71A 2CC1A 1I5QA 4S2NC 1KVMA 3FKVA 3VP4A 4ZDXA 2J9OA 3BFDA 2JE5A 4R3JA 5E2HA 4U0XA 1IKIA 3PTEA 4FSFA 1U60A 2R9WA 2WYXA 4EV4A 1CI9A 3V3SA 1MWTA 1JWPA 3FV7A 4UAAA 2ZC5B 3A3DA 2Y4AA 1NYMA 3QHYA 4QB8A 5DVAA 5HAQA 4IVKA 3HUNA 3IQAA 1TDGA 4MBKA 1BZAA 5EVIC 5FAQA 3ITBA 3NIAA 1W8QA 2PU2A 1HD8A 1K57A 2ZC4B 3DWKA 1PIOA 2H10A 2WAFA 4N1HA 4ZTKA 4OQHA 1SDNA 2P9VB 3G4PA 4OPYA 4KQQA 4DXCA 5EECA 5EVIA 5J8XA 1LL5A 3VP0A 3LO7A 2ZM0A 1ALQA 3GTCA 1XGIA 4BD0A 5FAOA 4GD6A 4KENB 1DJCA 3VFFA 5AQ9A 4RX3A 1H8ZA 1KE3A 3CG5A 3PBSA 2WZZA 5FI6A 5HFOA 3HREA 1GHPA 2OV5A 1IYPA 2WKIA 2XR0A 4F94A 1FOFA 3NI9A 4JXSA 2WGWA 5EE8A 4LV3A 3N8LA 1Y54A 3Q07A 4GKUA 5KSCA 3BEBA 5AQBA 1YQSA 1HZOA 3IWIA 1CK3A 5FI2A 3ZG0A 5HAIA 3DWZA 1KE0A 1E4DA 3UPPA 2XQZA 2EXAA 3OPRA 2EX2A 1W7FA 1XKZA 4JXGA 2J8YA 3UNWA 3OPLA 3VMAA 3RXXA 2DNSA 4JXVA 4BQMA 5CEBA 2Y2HA 2Y2KA 1LLBA 3SS3A 1IEMA 1Z6FA 1ERMA 1JWZA 4QHCA 4L0LA 5EPHA 5EUAA 3VP1A 1E25A 2ZQCA 3WRZA 1FSWA 2ZC3B 4KZAA 3FZCA 1MWRA 3B3XA 3HLWA 4WBGA 3ISGA 1LI0A 1IYOA 2WADA 1PWGA 3EQVA 1AXBA 3UN7A 4R4RA 4EBNA 1PZOA 2Y2OA 4GZBA 4KQRA 4S2NA 2FFYA 1TEMA 4UHUA 4S2JA 1PW8A 4JLFA 2XD1A 1MBLA 5F1GA 4S2MA 4LCLA 3PBQA 2PBYA 1OMEA 4DDYA 4K91A 2BG1A 2VGKA 1L0DA 4RX2A 1NRFA 2UWXA 3S4XA 4JBFA 5CHJA 3ZG7B 4OP8A 1TDLA 3HLFA 4OOLA 3CJMA 1MKIA 3BLMA 1ZC2A 4K0WA 4PM6A 2C6WB 5F1FA 5CTMA 1GA0A 3N4IA 4MLLA 4PM9A 4X53A 1IKGA 4X55A 4Y0TA 4LENA 2ZQ9A 3IHAA 4N9LA 1FCMA 3IXDA 4EQIA 1ES5A 1L2SA 2OLUA 2WZXA 5FA7A 3UDFA 2EX8A 3UE1A 5CECA 1XP4A 4C3QA 4JPMA 2Q9MA 1XX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5X A;  2XEP A;  3FKW A;  4OP5 A;  3SS5 A;  2RCX A;  2ZQA A;  5TR7 A;  1WE4 A;  3Q81 A;  1KVL A;  5HAR A;  1BUL A;  3C7U A;  3ZG9 B;  4DE2 A;  4MBH A;  4BLM A;  1PWC A;  1BLH A;  2Y2L A;  1K6S A;  3MBZ A;  3OCL A;  3Q7Z A;  3BLS A;  4R4S A;  2Y55 A;  1MPL A;  1RCJ A;  5EOE A;  4D2O A;  4WZ5 C;  1DJB A;  2ZD8 A;  2Y91 A;  4LV2 A;  1GHM A;  1XGJ A;  2QZ6 A;  3Q1F A;  5CED A;  2EX6 A;  3W4O A;  2XD5 A;  4X68 A;  1DJA A;  5FQI A;  1S0W A;  2HDQ A;  2XH9 A;  2GDN A;  2QPN A;  4RA7 A;  3ZFZ A;  4R1G A;  4PM5 A;  4GNU A;  1QMF A;  4YFM A;  5GLC A;  3PBO A;  3GMW A;  1BLP A;  3SH7 A;  3IXG A;  3CMZ A;  2VGJ A;  3PBN A;  3A3J A;  1KGF A;  1NZU A;  5DTK A;  3IXB A;  2HDR A;  1NY0 A;  4OOY A;  1K56 D;  5GLB A;  1K56 A;  4DE3 A;  2Y2G A;  3BM6 A;  3P09 A;  4P85 A;  5GL9 A;  3BFG A;  3ZGA B;  3D4F A;  3WS1 A;  5FDH A;  1ZKJ A;  2EFU A;  5CGW A;  3E2L A;  1XA7 A;  3C7V A;  4M3K A;  3TG9 A;  1NXY A;  3GSG A;  4OPZ A;  3WRT A;  2X02 A;  2XLN A;  2J7V A;  5KMW A;  1J9M A;  1MY8 A;  4PM7 A;  4DDS A;  3JYI A;  5CXW A;  1IEL A;  1W79 A;  3M2J A;  4WEL A;  3HLG A;  5A90 A;  1BLS A;  4KZB A;  4OQI A;  3FWL A;  4UA6 A;  4KZ6 A;  3TSG A;  4A5R A;  4EBP A;  2WGV A;  4OH0 A;  4CPK A;  1BUE A;  2ZQD A;  1XXM A;  1YLZ A;  3MZE A;  3EQU A;  3G35 A;  4KG2 A;  3SOI A;  1ES2 A;  5CGX A;  2XGN A;  3VOZ A;  2HP9 A;  1NYY A;  4JF4 A;  1KDS A;  4P0M A;  1HTZ A;  1SHV A;  4P6B A;  1PWD A;  1FSY A;  5HL1 A;  4LV1 A;  3HLD A;  4WMC A;  1GCE A;  2QMI A;  5U47 A;  1EWZ A;  5FI7 A;  1RP5 A;  5F83 A;  1MWU A;  3ZG8 B;  3OPP A;  4BEN A;  3RJU A;  4JXW A;  4KG6 A;  4E3L A;  1FCO A;  3O88 A;  3PAG A;  2J9P A;  4CJN A;  2Y2I A;  2ZM2 A;  5FQK A;  2Y2Q A;  1JTD A;  2ZJ9 A;  3NC8 A;  5E2E A;  1W5D A;  4FH2 A;  5DTT A;  4NK3 A;  4R0Q A;  3VOY A;  5CHM A;  4MBF A;  4EUZ A;  1ESI A;  2DRW A;  5HW3 A;  3UO9 A;  2P74 A;  4RVA A;  5E2G A;  4KG5 A;  1CI8 A;  1JWV A;  4KZ7 A;  1K25 A;  3IHB A;  4PM8 A;  2HPB A;  3C5A A;  5M1A A;  2JBF A;  4S2P A;  3LCE A;  2WKE A;  1FQG A;  3IF6 A;  3G31 A;  3IF6 B;  3S22 A;  3OC2 A;  3AGF A;  4H8R A;  5FQQ A;  4IBX A;  3O3V A;  4E3M A;  4IED A;  2E8I A;  2OSU A;  1KGG A;  4Y0O A;  1ONG A;  2ZM8 A;  3MFD A;  2G2W A;  1E3U A;  3BRM A;  3VSK A;  5DTS A;  3HVF A;  4EWF A;  3Q7V B;  1FR1 A;  5GHX A;  2WUQ A;  3UY6 A;  3N7W A;  4EBL A;  2B5R A;  3S1Y A;  4C6Y A;  4WZ4 A;  1K54 C;  3HUM A;  4JF5 A;  4OQ0 A;  3VP3 A;  4Y0U A;  4U3T A;  4OLG A;  1XA1 A;  3VSL A;  5FAT A;  4ZAM A;  4DF6 A;  1FCN A;  3PAE A;  3PBT A;  4HBU A;  1K54 A;  2Y2M A;  3NDG A;  3GR2 A;  4GDN A;  5E43 A;  3MZF A;  1PW1 A;  1YLY A;  4HES A;  3W8K A;  4QJG A;  4E3K A;  2Z2L B;  1LI9 A;  3LEZ A;  3GRJ A;  5A91 A;  3BYD A;  4GOG A;  2XF3 A;  4PPR A;  1K55 A;  3WS4 A;  4DRT A;  1Q2P A;  3V5M A;  4DE0 A;  5EVL A;  5A93 A;  3UPO A;  3ZCZ A;  3IWQ A;  1YLP A;  4OVD A;  2EXB A;  3M2K A;  1ERQ A;  4KZ8 A;  4GDB A;  5FQM A;  4X56 A;  3ZVW A;  1H8Y A;  3HLC A;  2ZMA A;  1HVB A;  2PU4 A;  5KZH A;  3N6I A;  5EVI D;  4B4Z A;  4DE1 A;  4S2O A;  3FYZ A;  2XK1 A;  3MXR A;  1IYS A;  4LV0 A;  5FQJ A;  3G32 A;  1YMS A;  5DF7 A;  4N92 A;  4DKI A;  3A3E A;  1DY6 A;  4HEF A;  2EX9 A;  3HUO A;  4WM9 A;  4WYY A;  3SH9 A;  1N9B A;  5EVI B;  4X6T A;  2H0Y A;  3C4P A;  1SDE A;  4MEZ A;  5FQ9 A;  2XFT A;  2P9V A;  3OPH A;  4ID4 A;  2DCF A;  4KQO A;  3ZNT A;  3G34 A;  4OON A;  5CTN A;  1G68 A;  3DTM A;  1K57 C;  3ITA A;  4Q8I A;  1IYQ A;  4ZJ1 A;  1TVF A;  5GLD A;  4B4X A;  1SKF A;  3IH9 A;  4FH4 A;  5IHV A;  3VFH A;  3UPN A;  4E3N A;  4Z9Q A;  1ONH A;  3OCN A;  3O86 A;  5JYO A;  3IWO A;  3ZVT A;  2C5W B;  4XXR A;  4S2L A;  1L0G A;  1YM1 A;  2WAE A;  1W8Y A;  5FSR A;  4DXB A;  3ZHH A;  3MZD A;  4O7D A;  1NZO A;  4K0X A;  3IXH A;  2A3U A;  4IBR A;  1BLC A;  3E2K A;  3WS5 A;  4MNR A;  5E2F A;  4BJP A;  2V1Z A;  3MXS A;  3A3I A;  1SCW A;  5KSH A;  1VM1 A;  4B88 A;  1O7E A;  3P98 A;  3TOI A;  2XDM A;  3ZNY A;  5I94 A;  5DF8 A;  5TFQ A;  4OQG A;  5CGS A;  5GHZ A;  2Y2P A;  1RGY A;  3DW0 A;  1PI4 A;  3Q82 A;  1YT4 A;  4KZ3 A;  5AQ7 A;  3N8R A;  5HAP A;  4UA7 A;  1ES3 A;  4OPQ A;  1N4O A;  3HBR A;  1KE4 A;  3SH8 A;  2A49 A;  4OKP A;  3ZDJ A;  4QD4 A;  4Y7P A;  2HP5 A;  5M18 A;  1ESU A;  2H5S A;  4P87 A;  4R23 A;  2XFS A;  4E6W A;  1ERO A;  3V39 A;  5DF9 A;  3A3F A;  5GHY A;  2IWD A;  1L0F A;  4FCF A;  3I7J A;  1YMX A;  1Q2Q A;  5M19 A;  3W4Q A;  4OPR A;  3W4P A;  1MWS A;  5TGF A;  5BOH A;  4ZBE A;  4BL2 A;  3GV9 A;  1WYC A;  4WEJ A;  3QNC A;  3V50 A;  4S2K A;  5FAP A;  1C3B A;  2ZC7 A;  1EI5 A;  3G30 A;  1M6K A;  4OLD A;  4E3I A;  3LY3 A;  3HL9 A;  4QU3 A;  4YIN A;  5L2F A;  1PZP A;  3N8S A;  2WKH A;  3GVB A;  5JYP A;  2Q9N A;  4BL3 A;  5CER A;  3V3R A;  3Q7V A;  4BD1 A;  2RL3 A;  3BFF A;  4S2I A;  2ZQ8 A;  1JTG A;  2JCH A;  1ZG6 A;  3G2Z A;  4PMA A;  2Y2J A;  4R3B A;  1MXO A;  3IT9 A;  1K6R A;  2Y59 A;  1BTL A;  2ZLY A;  2Z2M B;  3IF5 A;  2IWC A;  4HBT A;  5AQA A;  4E3J A;  4FD8 A;  4E6X A;  3UDI A;  4NET A;  4X69 A;  4OOM A;  1I2W A;  3MKE A;  1JVJ A;  3NY4 A;  4XUZ A;  4GD8 A;  5G18 A;  3M6H A;  3GQZ A;  1CEG A;  1VQQ A;  4WMC D;  5GLA A;  3ZG5 A;  1QME A;  1G6A A;  1GHI A;  3CZD A;  3M6B A;  1O07 A;  1K4F A;  3UE3 A;  1ZG4 A;  1L0E A;  1LL9 A;  2X01 A;  2BLS A;  4E3O A;  1LHY A;  4C75 A;  4KZ5 A;  4LCM A;  4N1X A;  1YLJ A;  3NDE A;  3LY4 A;  3IH8 A;  1ES4 A;  3HLB A;  4ZJ2 A;  3UDX A;  2FFF B;  4QY5 A;  3SS4 A;  4GN2 A;  3AGD A;  4WEK A;  2I72 A;  2Y2N A;  3WS0 A;  1GA9 A;  2WGW B;  4KZ9 A;  1M40 A;  2OLV A;  5A92 A;  2IWB A;  1S6R A;  3NCK A;  3QNB A;  3VP2 A;  1K4E A;  2G2U A;  1KDW A;  4N9K A;  4JKT A;  4UA9 A;  2ZC6 B;  4RYE A;  2EFX A;  1BT5 A;  4GB7 A;  3O87 A;  3OZH A;  1PYY A;  1WYB A;  3UE0 A;  4QY6 A;  2WGI A;  4WZ5 A;  2V2F F;  3HLE A;  3MKF A;  1YLW A;  3AGE A;  5HX9 A;  4KZ4 A;  1RGZ A;  2ZQ7 A;  2HP6 A;  3BFE A;  3G2Y A;  1XPB A;  2V20 A;  1CEF A;  1KGE A;  1NJ4 A;  3C4O A;  3WS2 A;  5FAS A;  5CHU A;  1BSG A;  1PI5 A;  2R9X A;  3RXW A;  1K38 A;  3IF6 C;  5CRF A;  5D3O A;  3BEC A;  3NBL A;  4JF6 A;  1YLT A;  4U0T A;  2WK0 A;  2JC7 A;  4IVI A;  3PBR A;  3BFC A;  2HDS A;  1I2S A;  4XUX A;  1K55 C;  5EOO A;  4ZJ3 A;  1E3U D;  1FR6 A;  2H0T A;  2HDU A;  5F82 A;  3WWX A;  2X71 A;  2CC1 A;  1I5Q A;  4S2N C;  1KVM A;  3FKV A;  3VP4 A;  4ZDX A;  2J9O A;  3BFD A;  2JE5 A;  4R3J A;  5E2H A;  4U0X A;  1IKI A;  3PTE A;  4FSF A;  1U60 A;  2R9W A;  2WYX A;  4EV4 A;  1CI9 A;  3V3S A;  1MWT A;  1JWP A;  3FV7 A;  4UAA A;  2ZC5 B;  3A3D A;  2Y4A A;  1NYM A;  3QHY A;  4QB8 A;  5DVA A;  5HAQ A;  4IVK A;  3HUN A;  3IQA A;  1TDG A;  4MBK A;  1BZA A;  5EVI C;  5FAQ A;  3ITB A;  3NIA A;  1W8Q A;  2PU2 A;  1HD8 A;  1K57 A;  2ZC4 B;  3DWK A;  1PIO A;  2H10 A;  2WAF A;  4N1H A;  4ZTK A;  4OQH A;  1SDN A;  2P9V B;  3G4P A;  4OPY A;  4KQQ A;  4DXC A;  5EEC A;  5EVI A;  5J8X A;  1LL5 A;  3VP0 A;  3LO7 A;  2ZM0 A;  1ALQ A;  3GTC A;  1XGI A;  4BD0 A;  5FAO A;  4GD6 A;  4KEN B;  1DJC A;  3VFF A;  5AQ9 A;  4RX3 A;  1H8Z A;  1KE3 A;  3CG5 A;  3PBS A;  2WZZ A;  5FI6 A;  5HFO A;  3HRE A;  1GHP A;  2OV5 A;  1IYP A;  2WKI A;  2XR0 A;  4F94 A;  1FOF A;  3NI9 A;  4JXS A;  2WGW A;  5EE8 A;  4LV3 A;  3N8L A;  1Y54 A;  3Q07 A;  4GKU A;  5KSC A;  3BEB A;  5AQB A;  1YQS A;  1HZO A;  3IWI A;  1CK3 A;  5FI2 A;  3ZG0 A;  5HAI A;  3DWZ A;  1KE0 A;  1E4D A;  3UPP A;  2XQZ A;  2EXA A;  3OPR A;  2EX2 A;  1W7F A;  1XKZ A;  4JXG A;  2J8Y A;  3UNW A;  3OPL A;  3VMA A;  3RXX A;  2DNS A;  4JXV A;  4BQM A;  5CEB A;  2Y2H A;  2Y2K A;  1LLB A;  3SS3 A;  1IEM A;  1Z6F A;  1ERM A;  1JWZ A;  4QHC A;  4L0L A;  5EPH A;  5EUA A;  3VP1 A;  1E25 A;  2ZQC A;  3WRZ A;  1FSW A;  2ZC3 B;  4KZA A;  3FZC A;  1MWR A;  3B3X A;  3HLW A;  4WBG A;  3ISG A;  1LI0 A;  1IYO A;  2WAD A;  1PWG A;  3EQV A;  1AXB A;  3UN7 A;  4R4R A;  4EBN A;  1PZO A;  2Y2O A;  4GZB A;  4KQR A;  4S2N A;  2FFY A;  1TEM A;  4UHU A;  4S2J A;  1PW8 A;  4JLF A;  2XD1 A;  1MBL A;  5F1G A;  4S2M A;  4LCL A;  3PBQ A;  2PBY A;  1OME A;  4DDY A;  4K91 A;  2BG1 A;  2VGK A;  1L0D A;  4RX2 A;  1NRF A;  2UWX A;  3S4X A;  4JBF A;  5CHJ A;  3ZG7 B;  4OP8 A;  1TDL A;  3HLF A;  4OOL A;  3CJM A;  1MKI A;  3BLM A;  1ZC2 A;  4K0W A;  4PM6 A;  2C6W B;  5F1F A;  5CTM A;  1GA0 A;  3N4I A;  4MLL A;  4PM9 A;  4X53 A;  1IKG A;  4X55 A;  4Y0T A;  4LEN A;  2ZQ9 A;  3IHA A;  4N9L A;  1FCM A;  3IXD A;  4EQI A;  1ES5 A;  1L2S A;  2OLU A;  2WZX A;  5FA7 A;  3UDF A;  2EX8 A;  3UE1 A;  5CEC A;  1XP4 A;  4C3Q A;  4JPM A;  2Q9M A;  1XX2 A; 
#chains in the Genus database with same CATH topology
 2XEP A;  3SS5 A;  1BUL A;  4DE2 A;  3W2Z A;  2JKT M;  4R4S A;  4D2O A;  1DJB A;  3B47 A;  1GHM A;  2QZ6 A;  5CED A;  4RA7 A;  2VV8 A;  1OPX A;  5CX7 A;  1DP9 A;  1IOU A;  2ZL1 A;  1OTI A;  3K3C A;  3SH7 A;  3IXG A;  1EW0 A;  5DTK A;  3IXB A;  2HDR A;  1NY0 A;  4OOY A;  2HV1 A;  2NUT C;  2GNX A;  2M7V A;  2X02 A;  2J7V A;  3NHQ A;  1MY8 A;  1UWN X;  4DDS A;  1W79 A;  4WEL A;  1N9O A;  1BLS A;  4OQI A;  3FPV A;  3LR4 A;  2WGV A;  4OH0 A;  2ZQD A;  4KG2 A;  3G35 A;  3C30 A;  2XGN A;  3VOZ A;  1NYY A;  4M4X A;  3T4L A;  4LV1 A;  3HLD A;  1GCE A;  1EWZ A;  3LID A;  1MWU A;  4HQA A;  3KSH A;  1TS7 A;  5EFW A;  4X25 A;  2ZM2 A;  3NC8 A;  5DTT A;  4NK3 A;  3JVU A;  5CHM A;  3FG8 A;  4CQH A;  4RVA A;  5E2G A;  4KG5 A;  1CI8 A;  4PM8 A;  3IHB A;  2JBF A;  1TS6 A;  3G31 A;  3D9Y A;  4H8R A;  4IBX A;  2W27 A;  1KGG A;  1ONG A;  3HVF A;  3JVV A;  1K54 C;  4Y17 A;  3VSL A;  2VGL S;  5FAT A;  3QP8 A;  1TD5 A;  3QP6 A;  4DJ3 A;  4E3K A;  4EER A;  3P7N A;  4DRT A;  1Q2P A;  3V5M A;  2YKF A;  5AVF A;  2K2N A;  4OVD A;  4HHD A;  1NRJ A;  4Y5F A;  4X56 A;  1H8Y A;  2Z6C A;  3HLC A;  2DMW A;  4B4Z A;  1W63 M;  3FYZ A;  4LRZ E;  4R38 A;  5F6A A;  1N9B A;  2V8C A;  4X6T A;  1SDE A;  3LR0 A;  4OON A;  1P97 A;  5CTN A;  1G68 A;  4JGQ A;  4PKY G;  1TVF A;  4I3J A;  1ONH A;  3O86 A;  3NJA A;  3LIE A;  2W3D A;  1YM1 A;  4DXB A;  4O7D A;  4Y3I A;  1H3Q A;  2J3T C;  4BJP A;  3MXS A;  2O9A A;  1O7E A;  2XDM A;  5I94 A;  5TFQ A;  5HDS A;  3S7N A;  1PI4 A;  2ZOH A;  4JGP A;  5AQ7 A;  4UA7 A;  1V9Y A;  3LIB A;  2V1A A;  4GLQ A;  1ACF A;  5M18 A;  4E6W A;  2JKT I;  5DF9 A;  2WKQ A;  4FCF A;  1L0F A;  3BQA A;  1Q2Q A;  3TJZ C;  3CLO A;  3V50 A;  4LRX C;  1H0M A;  2ZC7 A;  1M6K A;  1G5U A;  4QU3 A;  5L2F A;  1PZP A;  3GVB A;  4BL3 A;  4L9F A;  5CER A;  3V3R A;  2RL3 A;  3BFF A;  1JTG A;  1ZG6 A;  3KSF A;  2ZLY A;  4FD8 A;  4E6X A;  1VET B;  4X69 A;  3M6H A;  1DRM A;  5GLA A;  3ZG5 A;  3M6B A;  1O07 A;  1ZG4 A;  1LL9 A;  1LHY A;  4C75 A;  4R6L A;  4EQ1 A;  3NDE A;  3IH8 A;  4QY5 A;  4PKY A;  4R3A A;  3MSH A;  1M40 A;  5A92 A;  1S6R A;  2PAV P;  2ZC6 B;  4HH2 A;  3OZH A;  1PYY A;  1MZU A;  1WYB A;  2WGI A;  5HX9 A;  3HLE A;  3PR6 A;  4GS9 A;  1XJ4 A;  3OLO A;  1G6O A;  1NJ4 A;  3C4O A;  2P08 A;  4B93 A;  4DN0 A;  2WK0 A;  4IVI A;  2V0W A;  2HDS A;  1I2S A;  1K55 C;  4ZJ3 A;  1FR6 A;  3VP4 A;  4ZDX A;  2O9C A;  1GSX A;  2JE5 A;  4EES A;  1U60 A;  2R9W A;  2WYX A;  1CI9 A;  4UQI S;  3FV7 A;  3QHY A;  1NYM A;  2IA2 A;  1BZA A;  5FAQ A;  1N9L A;  3NIA A;  1W8Q A;  1PIO A;  2H10 A;  4OPY A;  3KO6 A;  5EVI A;  5J8X A;  1ALQ A;  4BD0 A;  4R70 A;  4KEN B;  1OTE A;  4RX3 A;  3CG5 A;  3PBS A;  2WZZ A;  5FI6 A;  1GHP A;  3KYZ A;  2JKG A;  2A24 B;  1FOF A;  3BEB A;  1HZO A;  3IWI A;  2VLG A;  3OOV A;  4I3A A;  1KE0 A;  4HOI A;  3UNW A;  3OPL A;  2JHE A;  2Y2H A;  5I5L A;  4ESP A;  2Y2K A;  1LLB A;  4L0L A;  3HCY A;  2ZQC A;  1FSW A;  2H28 A;  4KZA A;  3F1P B;  3B3X A;  4WN5 A;  3BJN A;  3UN7 A;  4R4R A;  3F1O A;  3A0S A;  1PZO A;  2Y2O A;  2VV6 A;  4GZB A;  3LIA A;  4IHQ A;  1D1J A;  2XD1 A;  3MQO A;  2KOI A;  1OME A;  2VGK A;  3PYP A;  2UWX A;  4HI4 A;  4JBF A;  4ETZ A;  3KSG A;  3HLF A;  5L07 A;  3BLM A;  5HDD A;  3JPU A;  2C6W B;  4PM9 A;  1IKG A;  2OWH A;  4ARZ A;  2ZQ9 A;  4N9L A;  1YKD A;  1L2S A;  2OLU A;  5FA7 A;  3UDF A;  1VET A;  3UDX A;  1H5X A;  3IS2 A;  5TR7 A;  5HAR A;  3Q81 A;  4NXE A;  2Y2L A;  2O9B A;  1RCJ A;  2QJ5 A;  5EOE A;  1XGJ A;  2EX6 A;  2XD5 A;  5FQI A;  1S0W A;  4B9O A;  5GLC A;  1LT0 A;  3CMZ A;  3A3J A;  1KGF A;  4DE3 A;  5GLB A;  2PD7 A;  3BM6 A;  1ZKJ A;  3E2L A;  4M3K A;  5KMW A;  4OPZ A;  3GSG A;  2XLN A;  4PM7 A;  4HJ6 A;  4EXO A;  3M2J A;  5FDS A;  1CJF A;  2ZBB A;  1XJ6 A;  3MF0 A;  4G3K A;  1BUE A;  3BY8 A;  3TE8 A;  1VEU A;  3VOL A;  5CGX A;  2HP9 A;  2A24 A;  1KDS A;  1LSV A;  1HTZ A;  4P0M A;  5L10 A;  5HL1 A;  2QMI A;  3ZG8 B;  4YNR A;  4JXW A;  2PHY A;  4K08 A;  2ZJ9 A;  3UB7 A;  5E2E A;  1W5D A;  2O99 A;  3NOU C;  2HJE A;  3VOY A;  4Z1W A;  3UB6 A;  4EUZ A;  2DRW A;  3F1N A;  3UO9 A;  4IJG A;  1OT9 A;  5KIZ A;  1JWV A;  1K25 A;  3IF6 B;  3S22 A;  3B33 A;  1NLY A;  4IED A;  2E8I A;  3T1Q B;  2ZM8 A;  3MFD A;  2W0N A;  4EWF A;  3Q7V B;  2B5R A;  2QYB A;  4C6Y A;  3CUE A;  3HUM A;  4JF5 A;  4Y0U A;  4U3T A;  1SKO A;  2JN7 A;  4DF6 A;  1FCN A;  3PBT A;  4HBU A;  2OAP 1;  2Y2M A;  4F3L B;  5E43 A;  3V67 A;  4QJG A;  3LEZ A;  5F5Y A;  3WS4 A;  3EGX C;  1NWZ A;  4IUH A;  1ERQ A;  4GDB A;  3LI8 A;  2ZMA A;  2O0Y A;  1HVB A;  5KZH A;  4DE1 A;  1IYS A;  5FQJ A;  1YMS A;  3A0V A;  4DKI A;  4AFI A;  3A3E A;  3HUO A;  4WYY A;  5EVI B;  2H0Y A;  5FQ9 A;  3LEQ A;  2P9V A;  4KUO A;  4IUK A;  4ID4 A;  3S7P A;  3O5Y A;  3DTM A;  4ETX A;  3ITA A;  4Q8I A;  1IYQ A;  1TS0 A;  5IHV A;  3VFH A;  4Z9Q A;  3IWO A;  5HWT A;  2C5W B;  4XXR A;  3T12 B;  1L0G A;  1W8Y A;  3ZHH A;  1TS8 A;  4IBR A;  2XA7 M;  4II7 A;  3MQ0 A;  2WKP A;  2V1Z A;  3RH8 B;  4BMW A;  1VM1 A;  2KX6 A;  3P98 A;  3ZNY A;  4G3W A;  2L0W A;  5DF8 A;  4OQG A;  2PYP A;  3DW0 A;  3NEC A;  3Q82 A;  3EEA A;  3N8R A;  1GSV A;  4OPQ A;  5DKL A;  3HBR A;  3T4Q A;  1KE4 A;  3ZDJ A;  4Y7P A;  2HP5 A;  3QP2 A;  4P87 A;  1ERO A;  1YMX A;  5M19 A;  2ZL1 B;  1H8M A;  5C5K A;  3UB5 P;  4KQD A;  3T4K A;  3QNC A;  4S2K A;  4E3I A;  1C3B A;  4OLD A;  3LY3 A;  4MN6 A;  2JKR M;  3HL9 A;  4BD1 A;  4PMA A;  2Y8H A;  3T4O A;  1MXO A;  3IT9 A;  2Y59 A;  5DFY A;  1BTL A;  4HBT A;  2IWC A;  4WLA A;  2GX5 A;  2HGV A;  3UDI A;  5FEF A;  3EWK A;  1XFQ A;  1CEG A;  3G6O A;  2VGL M;  1K4F A;  2X01 A;  4E3O A;  4UQI M;  3RTY A;  1YLJ A;  3LGO A;  1ES4 A;  3HLB A;  3EGD C;  2I72 A;  3WS0 A;  1GA9 A;  3VV4 A;  5AVE A;  3R4K A;  3MR0 A;  3VP2 A;  1MC0 A;  4JKT A;  4ME4 A;  4I38 A;  2EFX A;  2VEA A;  3F1P A;  5EVE A;  2WKR A;  1YLW A;  3AGE A;  4KZ4 A;  1RGZ A;  2ZQ7 A;  5HPF A;  5F68 A;  3G2Y A;  1K38 A;  3H7W B;  5D3O A;  4JF6 A;  1OTD A;  1YLT A;  3L7H A;  4U0T A;  4DMZ A;  1X0O A;  1YSQ A;  4WF0 A;  3VE4 A;  3RFB A;  1AWI A;  2H0T A;  2HDU A;  5F82 A;  3WWX A;  3CHW P;  4S2N C;  1I5Q A;  2E8J A;  3LR3 A;  4R3J A;  4U0X A;  1IKI A;  3PTE A;  1JWP A;  3LYX A;  4QB8 A;  5HAQ A;  3HUN A;  1TDG A;  4MBK A;  5IT5 A;  1XFN A;  1HD8 A;  5TJJ A;  2ZOI A;  3DWK A;  2WAF A;  2QJ7 A;  4DXC A;  1LL5 A;  4JGR A;  3LO7 A;  2ZM0 A;  4FOF A;  4D60 A;  3GTC A;  1XGI A;  3FC7 A;  4GD6 A;  1DJC A;  3VFF A;  4EEP A;  1H8Z A;  5HFO A;  2OV5 A;  1IYP A;  4F94 A;  4BBT A;  2WGW A;  3Q07 A;  4HJ4 A;  5FI2 A;  3DWZ A;  3KYQ A;  1D06 A;  2EX2 A;  3KSI A;  4JXG A;  2XRN A;  2BAS A;  1OJ5 A;  3RXX A;  2DNS A;  4XT2 B;  3BW6 A;  3FPW A;  1ERM A;  3WRZ A;  2ZC3 B;  1MWR A;  4Y15 A;  3CPT A;  1IYO A;  1PWG A;  2WAD A;  2ACG A;  2J3W A;  4I39 A;  1T1B A;  4S2N A;  3PHY A;  2V1B A;  2PRF A;  4UHU A;  1PW8 A;  1S1Y A;  1PNE A;  2Z6D A;  2FH5 A;  3NOT C;  5CHJ A;  4OP8 A;  1MKI A;  2M7U A;  3R7W B;  4PM6 A;  5F1F A;  4HP9 A;  3N4I A;  4KUK A;  4X53 A;  4RQ9 A;  4LEN A;  3HJK A;  3IXD A;  4EQI A;  1N9N A;  4CLC E;  5CEC A;  1FIK A;  4C3Q A;  4JPM A;  2Q9M A;  4O01 A;  1S4R A;  2BTF P;  3FKW A;  4OP5 A;  2RCX A;  1GSW A;  3T1R A;  3EEH A;  4BLM A;  1BLH A;  2W1T B;  1ZTU A;  1K6S A;  2W1T A;  3MBZ A;  3Q7Z A;  3BLS A;  4Y2F A;  4WZ5 C;  2VZW A;  3KX0 X;  3W4O A;  1V9Z A;  1Y4O A;  1DJA A;  2GDN A;  4CLC D;  4R1G A;  4YFM A;  1BLP A;  2JKF A;  2VGJ A;  1NZU A;  1K56 D;  2OAQ 1;  5GL9 A;  2EFU A;  3C7V A;  1NXY A;  3ULF A;  1ZHH B;  3HLG A;  1YPR A;  4DJ2 A;  2PDR A;  1S4S A;  4KZ6 A;  4EBP A;  1XXM A;  1YLZ A;  1ES2 A;  5HD3 A;  1L3L A;  1SHV A;  1ODV A;  1PWD A;  4P6B A;  1F5M A;  4WMC A;  5U47 A;  5FI7 A;  5F83 A;  2I9V A;  3RJU A;  3T4S A;  4WUJ A;  4KG6 A;  4E3L A;  3O88 A;  3PAG A;  2Y2I A;  1JTD A;  1YSP A;  2AVX A;  4I5S A;  2INW A;  2P04 A;  1ESI A;  2YKH A;  5HW3 A;  3TW8 A;  1KOU A;  3CPT B;  2HPB A;  2ZMF A;  4S2P A;  2VK3 A;  3AGF A;  3O3V A;  4GHI B;  4Y0O A;  1XJ2 A;  2FZ0 A;  3BRM A;  5DTS A;  1FR1 A;  2WUQ A;  4WZ4 A;  3VP3 A;  4P6Z M;  1XA1 A;  5LBR A;  4LPZ A;  3LI9 A;  4ZAM A;  5HL6 A;  3PAE A;  1K54 A;  3NDG A;  3GR2 A;  4GDN A;  3W8K A;  3MZF A;  1PW1 A;  1YLY A;  2XA7 S;  2Z2L B;  1LI9 A;  3GRJ A;  3BYD A;  3LIC A;  3S7Q A;  1K55 A;  1CQA A;  5EVL A;  3UPO A;  3ZCZ A;  3LFV A;  3IWQ A;  1YLP A;  3M2K A;  2QWS A;  2VJW A;  2W3G A;  3B42 A;  2PU4 A;  3U4L P;  3N6I A;  4S2O A;  1T19 A;  3G32 A;  5DF7 A;  4N92 A;  3TRC A;  3F1O B;  1DY6 A;  4HEF A;  2EX9 A;  4P6Z S;  4MEZ A;  2XFT A;  2KLI A;  2QHK A;  2DCF A;  4KQO A;  3BWL A;  1K57 C;  1P9W A;  5GLD A;  1SKF A;  4EU0 A;  3MJQ A;  3UPN A;  4E3N A;  3OCN A;  5HSQ A;  4F3L A;  2PYR A;  2J3T D;  2WAE A;  4EW7 A;  3IXH A;  2D02 A;  2A3U A;  1BLC A;  3E2K A;  4MN7 A;  2VKS A;  5E2F A;  3A3I A;  4GCZ A;  5K5B A;  2L1M A;  5CGS A;  1RGY A;  3E0Y A;  3EOI A;  2VX8 A;  4KZ3 A;  1T18 A;  5IS1 A;  1ES3 A;  1N4O A;  2VV7 A;  3SH8 A;  4OKP A;  2GZA A;  1S67 L;  4QD4 A;  2Y79 A;  2EA9 A;  3CI6 A;  4R23 A;  4WL9 A;  3V39 A;  3A3F A;  5GHY A;  2IWD A;  3U2A A;  3I7J A;  4FUW A;  3W4Q A;  4OPR A;  5HWW A;  5BOH A;  1MWS A;  4O0P A;  3CAX A;  1WYC A;  3ZQ5 A;  2EWW A;  1EI5 A;  3G30 A;  3SW1 A;  1K0K A;  2HF6 A;  1XJ3 A;  4YIN A;  2WKH A;  2MJ6 A;  4S2I A;  2Y2J A;  4R3B A;  1CF0 A;  2Z2M B;  3IF5 A;  5AQA A;  4E3J A;  4Q0I A;  3S7O A;  4OOM A;  3IBJ A;  1JVJ A;  5G18 A;  3CUE C;  1LSX A;  3GQZ A;  1VQQ A;  4WMC D;  1QME A;  1GHI A;  3CZD A;  1L0E A;  4X1M A;  2LB9 A;  1PRQ A;  3LY4 A;  4UEY A;  5G4Z A;  4WEK A;  2Y2N A;  2K7S A;  3BY9 A;  2WGW B;  1FIL A;  2IWB A;  3QNB A;  1K4E A;  2G2U A;  1KDW A;  4N9K A;  4O8G A;  4RYE A;  3O87 A;  3E98 A;  2L4R A;  4LRY C;  2V2F F;  3MKF A;  4YOF A;  1P9R A;  2HP6 A;  3BFE A;  1XPB A;  4CLC B;  5CHU A;  1BSG A;  1PI5 A;  3RXW A;  3T1X A;  4EEU A;  5CRF A;  3IF6 C;  3PBR A;  3BFC A;  3MFX A;  1T1A A;  2X71 A;  3FKV A;  2J9O A;  3BFD A;  4FSF A;  4X1L A;  4ARZ B;  4EV4 A;  3V3S A;  4UAA A;  3OBF A;  2HZ5 A;  2ZC5 B;  5DVA A;  3IQA A;  5EVI C;  5DJT A;  3GEC A;  4OQH A;  1SDN A;  5EEC A;  3UMD A;  3D72 A;  5F69 A;  4QPR A;  5AQ9 A;  2KDK A;  5DKK A;  2HJ9 C;  1LSW A;  2XR0 A;  3NI9 A;  4JXS A;  1DP8 A;  3N8L A;  4GKU A;  5KSC A;  5AQB A;  2V0U A;  1CK3 A;  3ZG0 A;  3UPP A;  2XQZ A;  1W7F A;  2J8Y A;  3R7W A;  5HDC A;  4JXV A;  4BQM A;  5CEB A;  2GJ3 A;  5MC7 A;  1VB6 A;  3SS3 A;  1Z6F A;  5EUA A;  2Q0O A;  3VP1 A;  1E25 A;  2XSS A;  4H6J A;  1LI0 A;  3CIT A;  3E4Q A;  1MKM A;  4EBN A;  4KQR A;  2FFY A;  1TEM A;  4S2J A;  5HD5 A;  5J7E A;  1MBL A;  4NG2 A;  4LCL A;  3PBQ A;  2XRO A;  2PBY A;  4DDY A;  4K91 A;  2BG1 A;  5A8B A;  1NRF A;  4CLC C;  3S4X A;  3ZG7 B;  1TDL A;  1JNU A;  3CJM A;  5CTM A;  4MLL A;  1BYW A;  1G28 A;  3IHA A;  1ES5 A;  3UE1 A;  2WZX A;  2PT7 A;  2PR6 A;  5A93 A;  1XX2 A;  2ZQA A;  3ZG9 B;  1WE4 A;  1KVL A;  3C7U A;  4MBH A;  1PWC A;  2OWJ A;  3OCL A;  3IX3 A;  2Y55 A;  2V8F A;  1MPL A;  2ZD8 A;  4LV2 A;  2Y91 A;  3IX8 A;  3Q1F A;  4YWZ A;  3UME A;  5L09 A;  4X68 A;  3ZFZ A;  2HDQ A;  2XH9 A;  2QPN A;  4PM5 A;  4GNU A;  1QMF A;  3IX4 A;  3PBO A;  3GMW A;  3IBR A;  3PBN A;  3DTI A;  3LUQ A;  1K56 A;  2Y2G A;  4HY8 A;  4EET B;  3P09 A;  4P85 A;  2VA0 A;  3BFG A;  3ZGA B;  3D4F A;  3WS1 A;  5HZH A;  5FDH A;  5CGW A;  1XA7 A;  3TG9 A;  3WRT A;  1F98 A;  1J9M A;  3QP4 A;  4CLC A;  3JYI A;  5CXW A;  1IEL A;  5A90 A;  4KZB A;  3FWL A;  4UA6 A;  3TSG A;  4A5R A;  4CPK A;  3LIF A;  1F9I A;  4NXG A;  1VEU B;  3MZE A;  3EQU A;  3SOI A;  1OT6 A;  3P01 A;  4JF4 A;  1FSY A;  4NKP A;  5EM0 A;  1RP5 A;  3QP1 A;  3OPP A;  4BEN A;  4HNB A;  4BBU A;  1FCO A;  2J9P A;  4CJN A;  3UB9 A;  5FQK A;  2Y2Q A;  3L9K A;  2R78 A;  4FH2 A;  4BWI A;  4R0Q A;  1OJG A;  4MBF A;  4FTX A;  3HJI A;  2P74 A;  4MCW A;  4KZ7 A;  1J3W A;  3C5A A;  5M1A A;  3LCE A;  1FQG A;  2WKE A;  3IF6 A;  3OC2 A;  5FQQ A;  1YAX A;  4E3M A;  2OSU A;  3VSK A;  2G2W A;  1E3U A;  5GHX A;  3UY6 A;  4EBL A;  3N7W A;  4L9G A;  3S1Y A;  5HPI A;  1PFL A;  3C2W A;  4OQ0 A;  1A0K A;  4OLG A;  2OOL A;  3CWF A;  4H6J B;  5HWV A;  1TF1 A;  4HES A;  4XT2 A;  4LGW A;  5A91 A;  4GOG A;  2XF3 A;  4PPR A;  2P7J A;  2B95 A;  3GDI A;  4DE0 A;  2ZMV A;  2EXB A;  2UV0 E;  4KZ8 A;  5FQM A;  3ZVW A;  4HIA A;  4L9E A;  4NXB A;  5EVI D;  2M1C A;  2XK1 A;  3MXR A;  4LV0 A;  4JGO A;  3A0R A;  2NUP C;  4WM9 A;  3SH9 A;  5IU1 A;  3C4P A;  5TBM B;  3OPH A;  3ZNT A;  3G34 A;  4ZJ1 A;  4B4X A;  3IH9 A;  4FH4 A;  2J80 A;  4Q0H A;  5JYO A;  4Q0J A;  3ZVT A;  4MMN A;  3NOP C;  4S2L A;  5FSR A;  3MZD A;  1NZO A;  4K0X A;  3T50 A;  2D01 A;  3MXQ A;  3WS5 A;  4MNR A;  5AJG A;  1SCW A;  5KSH A;  3D3O A;  4B88 A;  3TOI A;  3T4J A;  3KYE A;  5GHZ A;  3DTE A;  4QWO A;  2Y2P A;  4ZRR A;  4MDZ A;  1YT4 A;  4EUV A;  5HAP A;  4I3I A;  2K31 A;  2A49 A;  1SZV A;  2B02 A;  5L8M A;  1ESU A;  2H5S A;  1Y28 A;  2XFS A;  4PAU A;  5J4E A;  2W1R A;  3NUL A;  2LB5 A;  3W4P A;  5TGF A;  4ZBE A;  3VE3 A;  4BL2 A;  3GV9 A;  4MN5 A;  4WEJ A;  3ZYT A;  3DTK A;  5FAP A;  4LLO B;  2G7U A;  3N8S A;  5JYP A;  2Q9N A;  3Q7V A;  3H7W A;  2ZQ8 A;  2JCH A;  4HJ3 A;  3G2Z A;  4GHI A;  1K6R A;  3UB8 A;  4NXF A;  4GS9 B;  4NET A;  1VHM A;  1I2W A;  3MKE A;  3NY4 A;  4XUZ A;  4GD8 A;  2W3H A;  1IFQ A;  3C38 A;  3C8C A;  3MMH A;  1G6A A;  4GJ4 A;  1UGU A;  5DFX A;  3UE3 A;  1UWP X;  5FL3 A;  4PHT A;  2BLS A;  4HP4 A;  4KZ5 A;  4LCM A;  2EWV A;  4N1X A;  4G3V A;  3BQ8 A;  3MQQ A;  4ZJ2 A;  2FFF B;  3SS4 A;  4GN2 A;  3AGD A;  2CMN A;  4KZ9 A;  2OLV A;  3NCK A;  5EM1 A;  4LFU A;  3H9W A;  4UA9 A;  3K2N A;  1OTA A;  1BT5 A;  4GB7 A;  1Z09 A;  3UE0 A;  1D7E A;  4QY6 A;  4WZ5 A;  5DJU A;  2V20 A;  1CEF A;  1KGE A;  3WS2 A;  5FAS A;  2R9X A;  3BEC A;  3NBL A;  3LR5 A;  2JC7 A;  3QP5 A;  1DP6 A;  4XUX A;  5EOO A;  1E3U D;  2JKR I;  4GW9 A;  2CC1 A;  1KVM A;  2W3E A;  5E2H A;  2PBD P;  1P0Z A;  1MWT A;  3T1S A;  3A3D A;  3E4O A;  2Y4A A;  1STZ A;  4IVK A;  1LL8 A;  3E4P A;  3ITB A;  2PU2 A;  1K57 A;  2ZC4 B;  4N1H A;  4ZTK A;  3T4T A;  1OTB A;  2P9V B;  3G4P A;  4HH3 A;  3UE6 A;  4KQQ A;  3VP0 A;  4Y13 A;  3DAV A;  3F1N B;  5FAO A;  3H82 B;  1KE3 A;  3HRE A;  2WKI A;  1W63 Q;  5EV0 A;  4NEE D;  5EE8 A;  4LV3 A;  1Y54 A;  1YQS A;  5HAI A;  1E4D A;  2EXA A;  2PR5 A;  2V9A A;  3OPR A;  1WA9 A;  1XKZ A;  1NLZ A;  2B18 A;  3VMA A;  4BBV A;  1IEM A;  1JWZ A;  3IS2 B;  4QHC A;  5EPH A;  3FZC A;  3HLW A;  3SZT A;  4WBG A;  5TBM A;  1HLU P;  3ISG A;  5FEG A;  3MS6 A;  3EQV A;  1AXB A;  2PD8 A;  3PXP A;  1S66 L;  1S1Z A;  3H82 A;  4JLF A;  5F1G A;  4S2M A;  2W3F A;  5G4Y A;  5J3W A;  3K3D A;  1L0D A;  4RX2 A;  2QKP A;  4OOL A;  4K0W A;  1ZC2 A;  2A2L A;  4E04 A;  1GA0 A;  4X55 A;  4Y0T A;  1FCM A;  3ICY A;  1T1C A;  2EX8 A;  3DBA A;  1F2K A;  1XP4 A;  1SKO B; 
#chains in the Genus database with same CATH homology
 1H5X A;  2XEP A;  3FKW A;  4OP5 A;  3SS5 A;  2RCX A;  2ZQA A;  5TR7 A;  1WE4 A;  3Q81 A;  1KVL A;  5HAR A;  1BUL A;  3C7U A;  3ZG9 B;  4DE2 A;  4MBH A;  4BLM A;  1PWC A;  1BLH A;  2Y2L A;  1K6S A;  3MBZ A;  3OCL A;  3Q7Z A;  3BLS A;  4R4S A;  2Y55 A;  1MPL A;  1RCJ A;  5EOE A;  4D2O A;  4WZ5 C;  1DJB A;  2ZD8 A;  2Y91 A;  4LV2 A;  1GHM A;  1XGJ A;  2QZ6 A;  3Q1F A;  5CED A;  2EX6 A;  3W4O A;  2XD5 A;  4X68 A;  1DJA A;  5FQI A;  1S0W A;  2HDQ A;  2XH9 A;  2GDN A;  2QPN A;  4RA7 A;  3ZFZ A;  4R1G A;  4PM5 A;  4GNU A;  1QMF A;  4YFM A;  5GLC A;  3PBO A;  3GMW A;  1BLP A;  3SH7 A;  3IXG A;  3CMZ A;  2VGJ A;  3PBN A;  3A3J A;  1KGF A;  1NZU A;  5DTK A;  3IXB A;  2HDR A;  1NY0 A;  4OOY A;  1K56 D;  5GLB A;  1K56 A;  4DE3 A;  2Y2G A;  3BM6 A;  3P09 A;  4P85 A;  5GL9 A;  3BFG A;  3ZGA B;  3D4F A;  3WS1 A;  5FDH A;  1ZKJ A;  2EFU A;  5CGW A;  3E2L A;  1XA7 A;  3C7V A;  4M3K A;  3TG9 A;  1NXY A;  3GSG A;  4OPZ A;  3WRT A;  2X02 A;  2XLN A;  2J7V A;  5KMW A;  1J9M A;  1MY8 A;  4PM7 A;  4DDS A;  3JYI A;  5CXW A;  1IEL A;  1W79 A;  3M2J A;  4WEL A;  3HLG A;  5A90 A;  1BLS A;  4KZB A;  4OQI A;  3FWL A;  4UA6 A;  4KZ6 A;  3TSG A;  4A5R A;  4EBP A;  2WGV A;  4OH0 A;  4CPK A;  1BUE A;  2ZQD A;  1XXM A;  1YLZ A;  3MZE A;  3EQU A;  3G35 A;  4KG2 A;  3SOI A;  1ES2 A;  5CGX A;  2XGN A;  3VOZ A;  2HP9 A;  1NYY A;  4JF4 A;  1KDS A;  4P0M A;  1HTZ A;  1SHV A;  4P6B A;  1PWD A;  1FSY A;  5HL1 A;  4LV1 A;  3HLD A;  4WMC A;  1GCE A;  2QMI A;  5U47 A;  1EWZ A;  5FI7 A;  1RP5 A;  5F83 A;  1MWU A;  3ZG8 B;  3OPP A;  4BEN A;  3RJU A;  4JXW A;  4KG6 A;  4E3L A;  1FCO A;  3O88 A;  3PAG A;  2J9P A;  4CJN A;  2Y2I A;  2ZM2 A;  5FQK A;  2Y2Q A;  1JTD A;  2ZJ9 A;  3NC8 A;  5E2E A;  1W5D A;  4FH2 A;  5DTT A;  4NK3 A;  4R0Q A;  3VOY A;  5CHM A;  4MBF A;  4EUZ A;  1ESI A;  2DRW A;  5HW3 A;  3UO9 A;  2P74 A;  4RVA A;  5E2G A;  4KG5 A;  1CI8 A;  1JWV A;  4KZ7 A;  1K25 A;  3IHB A;  4PM8 A;  2HPB A;  3C5A A;  5M1A A;  2JBF A;  4S2P A;  3LCE A;  2WKE A;  1FQG A;  3IF6 A;  3G31 A;  3IF6 B;  3S22 A;  3OC2 A;  3AGF A;  4H8R A;  5FQQ A;  4IBX A;  3O3V A;  4E3M A;  4IED A;  2E8I A;  2OSU A;  1KGG A;  4Y0O A;  1ONG A;  2ZM8 A;  3MFD A;  2G2W A;  1E3U A;  3BRM A;  3VSK A;  5DTS A;  3HVF A;  4EWF A;  3Q7V B;  1FR1 A;  5GHX A;  2WUQ A;  3UY6 A;  3N7W A;  4EBL A;  2B5R A;  3S1Y A;  4C6Y A;  4WZ4 A;  1K54 C;  3HUM A;  4JF5 A;  4OQ0 A;  3VP3 A;  4Y0U A;  4U3T A;  4OLG A;  1XA1 A;  3VSL A;  5FAT A;  4ZAM A;  4DF6 A;  1FCN A;  3PAE A;  3PBT A;  4HBU A;  1K54 A;  2Y2M A;  3NDG A;  3GR2 A;  4GDN A;  5E43 A;  3MZF A;  1PW1 A;  1YLY A;  4HES A;  3W8K A;  4QJG A;  4E3K A;  2Z2L B;  1LI9 A;  3LEZ A;  3GRJ A;  5A91 A;  3BYD A;  4GOG A;  2XF3 A;  4PPR A;  1K55 A;  3WS4 A;  4DRT A;  1Q2P A;  3V5M A;  4DE0 A;  5EVL A;  5A93 A;  3UPO A;  3ZCZ A;  3IWQ A;  1YLP A;  4OVD A;  2EXB A;  3M2K A;  1ERQ A;  4KZ8 A;  4GDB A;  5FQM A;  4X56 A;  3ZVW A;  1H8Y A;  3HLC A;  2ZMA A;  1HVB A;  2PU4 A;  5KZH A;  3N6I A;  5EVI D;  4B4Z A;  4DE1 A;  4S2O A;  3FYZ A;  2XK1 A;  3MXR A;  1IYS A;  4LV0 A;  5FQJ A;  3G32 A;  1YMS A;  5DF7 A;  4N92 A;  4DKI A;  3A3E A;  1DY6 A;  4HEF A;  2EX9 A;  3HUO A;  4WM9 A;  4WYY A;  3SH9 A;  1N9B A;  5EVI B;  4X6T A;  2H0Y A;  3C4P A;  1SDE A;  4MEZ A;  5FQ9 A;  2XFT A;  2P9V A;  3OPH A;  4ID4 A;  2DCF A;  4KQO A;  3ZNT A;  3G34 A;  4OON A;  5CTN A;  1G68 A;  3DTM A;  1K57 C;  3ITA A;  4Q8I A;  1IYQ A;  4ZJ1 A;  1TVF A;  5GLD A;  4B4X A;  1SKF A;  3IH9 A;  4FH4 A;  5IHV A;  3VFH A;  3UPN A;  4E3N A;  4Z9Q A;  1ONH A;  3OCN A;  3O86 A;  5JYO A;  3IWO A;  3ZVT A;  2C5W B;  4XXR A;  4S2L A;  1L0G A;  1YM1 A;  2WAE A;  1W8Y A;  5FSR A;  4DXB A;  3ZHH A;  3MZD A;  4O7D A;  1NZO A;  4K0X A;  3IXH A;  2A3U A;  4IBR A;  1BLC A;  3E2K A;  3WS5 A;  4MNR A;  5E2F A;  4BJP A;  2V1Z A;  3MXS A;  3A3I A;  1SCW A;  5KSH A;  1VM1 A;  4B88 A;  1O7E A;  3P98 A;  3TOI A;  2XDM A;  3ZNY A;  5I94 A;  5DF8 A;  5TFQ A;  4OQG A;  5CGS A;  5GHZ A;  2Y2P A;  1RGY A;  3DW0 A;  1PI4 A;  3Q82 A;  1YT4 A;  4KZ3 A;  5AQ7 A;  3N8R A;  5HAP A;  4UA7 A;  1ES3 A;  4OPQ A;  1N4O A;  3HBR A;  1KE4 A;  3SH8 A;  2A49 A;  4OKP A;  3ZDJ A;  4QD4 A;  4Y7P A;  2HP5 A;  5M18 A;  1ESU A;  2H5S A;  4P87 A;  4R23 A;  2XFS A;  4E6W A;  1ERO A;  3V39 A;  5DF9 A;  3A3F A;  5GHY A;  2IWD A;  1L0F A;  4FCF A;  3I7J A;  1YMX A;  1Q2Q A;  5M19 A;  3W4Q A;  4OPR A;  3W4P A;  1MWS A;  5TGF A;  5BOH A;  4ZBE A;  4BL2 A;  3GV9 A;  1WYC A;  4WEJ A;  3QNC A;  3V50 A;  4S2K A;  5FAP A;  1C3B A;  2ZC7 A;  1EI5 A;  3G30 A;  1M6K A;  4OLD A;  4E3I A;  3LY3 A;  3HL9 A;  4QU3 A;  4YIN A;  5L2F A;  1PZP A;  3N8S A;  2WKH A;  3GVB A;  5JYP A;  2Q9N A;  4BL3 A;  5CER A;  3V3R A;  3Q7V A;  4BD1 A;  2RL3 A;  3BFF A;  4S2I A;  2ZQ8 A;  1JTG A;  2JCH A;  1ZG6 A;  3G2Z A;  4PMA A;  2Y2J A;  4R3B A;  1MXO A;  3IT9 A;  1K6R A;  2Y59 A;  1BTL A;  2ZLY A;  2Z2M B;  3IF5 A;  2IWC A;  4HBT A;  5AQA A;  4E3J A;  4FD8 A;  4E6X A;  3UDI A;  4NET A;  4X69 A;  4OOM A;  1I2W A;  3MKE A;  1JVJ A;  3NY4 A;  4XUZ A;  4GD8 A;  5G18 A;  3M6H A;  3GQZ A;  1CEG A;  1VQQ A;  4WMC D;  5GLA A;  3ZG5 A;  1QME A;  1G6A A;  1GHI A;  3CZD A;  3M6B A;  1O07 A;  1K4F A;  3UE3 A;  1ZG4 A;  1L0E A;  1LL9 A;  2X01 A;  2BLS A;  4E3O A;  1LHY A;  4C75 A;  4KZ5 A;  4LCM A;  4N1X A;  1YLJ A;  3NDE A;  3LY4 A;  3IH8 A;  1ES4 A;  3HLB A;  4ZJ2 A;  3UDX A;  2FFF B;  4QY5 A;  3SS4 A;  4GN2 A;  3AGD A;  4WEK A;  2I72 A;  2Y2N A;  3WS0 A;  1GA9 A;  2WGW B;  4KZ9 A;  1M40 A;  2OLV A;  5A92 A;  2IWB A;  1S6R A;  3NCK A;  3QNB A;  3VP2 A;  1K4E A;  2G2U A;  1KDW A;  4N9K A;  4JKT A;  4UA9 A;  2ZC6 B;  4RYE A;  2EFX A;  1BT5 A;  4GB7 A;  3O87 A;  3OZH A;  1PYY A;  1WYB A;  3UE0 A;  4QY6 A;  2WGI A;  4WZ5 A;  2V2F F;  3HLE A;  3MKF A;  1YLW A;  3AGE A;  5HX9 A;  4KZ4 A;  1RGZ A;  2ZQ7 A;  2HP6 A;  3BFE A;  3G2Y A;  1XPB A;  2V20 A;  1CEF A;  1KGE A;  1NJ4 A;  3C4O A;  3WS2 A;  5FAS A;  5CHU A;  1BSG A;  1PI5 A;  2R9X A;  3RXW A;  1K38 A;  3IF6 C;  5CRF A;  5D3O A;  3BEC A;  3NBL A;  4JF6 A;  1YLT A;  4U0T A;  2WK0 A;  2JC7 A;  4IVI A;  3PBR A;  3BFC A;  2HDS A;  1I2S A;  4XUX A;  1K55 C;  5EOO A;  4ZJ3 A;  1E3U D;  1FR6 A;  2H0T A;  2HDU A;  5F82 A;  3WWX A;  2X71 A;  2CC1 A;  1I5Q A;  4S2N C;  1KVM A;  3FKV A;  3VP4 A;  4ZDX A;  2J9O A;  3BFD A;  2JE5 A;  4R3J A;  5E2H A;  4U0X A;  1IKI A;  3PTE A;  4FSF A;  1U60 A;  2R9W A;  2WYX A;  4EV4 A;  1CI9 A;  3V3S A;  1MWT A;  1JWP A;  3FV7 A;  4UAA A;  2ZC5 B;  3A3D A;  2Y4A A;  1NYM A;  3QHY A;  4QB8 A;  5DVA A;  5HAQ A;  4IVK A;  3HUN A;  3IQA A;  1TDG A;  4MBK A;  1BZA A;  5EVI C;  5FAQ A;  3ITB A;  3NIA A;  1W8Q A;  2PU2 A;  1HD8 A;  1K57 A;  2ZC4 B;  3DWK A;  1PIO A;  2H10 A;  2WAF A;  4N1H A;  4ZTK A;  4OQH A;  1SDN A;  2P9V B;  3G4P A;  4OPY A;  4KQQ A;  4DXC A;  5EEC A;  5EVI A;  5J8X A;  1LL5 A;  3VP0 A;  3LO7 A;  2ZM0 A;  1ALQ A;  3GTC A;  1XGI A;  4BD0 A;  5FAO A;  4GD6 A;  4KEN B;  1DJC A;  3VFF A;  5AQ9 A;  4RX3 A;  1H8Z A;  1KE3 A;  3CG5 A;  3PBS A;  2WZZ A;  5FI6 A;  5HFO A;  3HRE A;  1GHP A;  2OV5 A;  1IYP A;  2WKI A;  2XR0 A;  4F94 A;  1FOF A;  3NI9 A;  4JXS A;  2WGW A;  5EE8 A;  4LV3 A;  3N8L A;  1Y54 A;  3Q07 A;  4GKU A;  5KSC A;  3BEB A;  5AQB A;  1YQS A;  1HZO A;  3IWI A;  1CK3 A;  5FI2 A;  3ZG0 A;  5HAI A;  3DWZ A;  1KE0 A;  1E4D A;  3UPP A;  2XQZ A;  2EXA A;  3OPR A;  2EX2 A;  1W7F A;  1XKZ A;  4JXG A;  2J8Y A;  3UNW A;  3OPL A;  3VMA A;  3RXX A;  2DNS A;  4JXV A;  4BQM A;  5CEB A;  2Y2H A;  2Y2K A;  1LLB A;  3SS3 A;  1IEM A;  1Z6F A;  1ERM A;  1JWZ A;  4QHC A;  4L0L A;  5EPH A;  5EUA A;  3VP1 A;  1E25 A;  2ZQC A;  3WRZ A;  1FSW A;  2ZC3 B;  4KZA A;  3FZC A;  1MWR A;  3B3X A;  3HLW A;  4WBG A;  3ISG A;  1LI0 A;  1IYO A;  2WAD A;  1PWG A;  3EQV A;  1AXB A;  3UN7 A;  4R4R A;  4EBN A;  1PZO A;  2Y2O A;  4GZB A;  4KQR A;  4S2N A;  2FFY A;  1TEM A;  4UHU A;  4S2J A;  1PW8 A;  4JLF A;  2XD1 A;  1MBL A;  5F1G A;  4S2M A;  4LCL A;  3PBQ A;  2PBY A;  1OME A;  4DDY A;  4K91 A;  2BG1 A;  2VGK A;  1L0D A;  4RX2 A;  1NRF A;  2UWX A;  3S4X A;  4JBF A;  5CHJ A;  3ZG7 B;  4OP8 A;  1TDL A;  3HLF A;  4OOL A;  3CJM A;  1MKI A;  3BLM A;  1ZC2 A;  4K0W A;  4PM6 A;  2C6W B;  5F1F A;  5CTM A;  1GA0 A;  3N4I A;  4MLL A;  4PM9 A;  4X53 A;  1IKG A;  4X55 A;  4Y0T A;  4LEN A;  2ZQ9 A;  3IHA A;  4N9L A;  1FCM A;  3IXD A;  4EQI A;  1ES5 A;  1L2S A;  2OLU A;  2WZX A;  5FA7 A;  3UDF A;  2EX8 A;  3UE1 A;  5CEC A;  1XP4 A;  4C3Q A;  4JPM A;  2Q9M A;  1XX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...