4YFMA

Class a beta-lactamase from mycobacterium abscessus
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
MAPDELASLEKDFGGRIGVYALDTGSGDTVGHRADERFLMCSTVKTFIVSAILRRRLSEPGLLDQRIQYTQSDVLEWAPITSQHVSTGMTVSELCDATLRYSDNTGANLLITQLGGPKETEKFVRSLGDNVTRMDRTEVQLNIPDGDLDTSTPQQLVANLRRLVLDEGLDSRGRDLLTDWLKRNTTGDQSIRAAVPAGWTVADKTGGGFKGETNDIAVIWPPGRAPIVMAVLTVPEDPTSTKGKPTIAAATRIVLRAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Hydrolysis of Clavulanate by Mycobacterium tuberculosis beta-Lactamase BlaC Harboring a Canonical SDN Motif.
pubmed doi rcsb
source organism Mycobacterium abscessus
total genus 91
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4yfmA00
3UDFA 5GLDA 1RP5A 2XK1A 5FQ9A 5FQJA 2XR0A 3MZFA 2EFXA 5CEDA 2Y2KA 1ONHA 3SH8A 3V50A 5EECA 3ZG8B 1ZKJA 4DXCA 2HDRA 3VFFA 3PAEA 2XH9A 3VP4A 3O86A 1W79A 4KQOA 4BLMA 4K91A 2UWXA 5BOHA 3E2LA 2G2WA 2JC7A 4KZAA 2JCHA 1H5XA 4E3MA 1IKGA 3OPHA 4GDBA 5HL1A 1BULA 1K38A 3FYZA 3IQAA 1YMSA 4IVIA 1PI4A 2HDQA 3NI9A 5CXWA 4B4XA 1IKIA 1PW8A 3LO7A 2XFTA 1MWRA 3SH7A 3MFDA 3OCLA 3BEBA 3PBNA 4WEKA 3ZVWA 4S2NC 4HBUA 3A3DA 2EX8A 5CTMA 1I2WA 2V2FF 4E6XA 1MWSA 2Y55A 4N92A 3A3FA 3VOZA 1JTGA 4MBKA 5A90A 3N8SA 1XX2A 3SS3A 1K55A 1AXBA 2HPBA 3LY4A 1SDEA 4JLFA 2OLUA 4ZJ2A 1W8YA 4PM5A 3G31A 3GQZA 5AQBA 3FWLA 4BJPA 2ZQ7A 5AQ9A 1K4EA 1XA7A 3DWKA 4NETA 5DF9A 2J8YA 2ZMAA 1CEGA 1GHIA 1K57C 3IH8A 1WYBA 3NC8A 1DJCA 2J9OA 4E3NA 2G2UA 3AGEA 3ZVTA 4ZTKA 3N4IA 4MLLA 1MY8A 3BFDA 2H0YA 5M1AA 3ZNTA 4N1XA 5EVIC 1MWUA 1FR6A 1BLSA 4K0WA 2EX6A 3IXGA 4JXWA 4QY5A 4OP5A 5U47A 4UA9A 5FSRA 1YLJA 4N1HA 4S2LA 5M18A 4FCFA 2QPNA 1BLCA 3ZDJA 4Y0TA 2EXBA 1KDWA 5AQ7A 4CJNA 1DJAA 2WKEA 4R23A 5EOEA 2EX9A 2I72A 2P9VB 4DXBA 2WGIA 4OQIA 4B4ZA 3BFEA 1ZG6A 4KQQA 1Y54A 1K54C 4D2OA 1JWZA 2IWDA 3GRJA 2H10A 5CEBA 2RL3A 3MXSA 1MXOA 4X53A 4BENA 3GV9A 4QHCA 4X6TA 4E3LA 1RGZA 5TFQA 3G2ZA 4OQGA 4YINA 1BT5A 1NJ4A 4WMCA 3O3VA 5FAPA 1JTDA 2QZ6A 1FQGA 5JYPA 4JXVA 3ZNYA 1NZUA 2WZZA 5JYOA 4C3QA 4OH0A 3V3RA 1I5QA 3IHBA 3GSGA 2HDSA 4DRTA 3WRZA 3EQVA 3Q7VA 1LLBA 5DF8A 2WKHA 1DJBA 1PW1A 4EWFA 1FCOA 2BG1A 1GCEA 2ZQCA 3UDXA 2Y2JA 1CEFA 4XUZA 3HREA 4KZ7A 3WS4A 3Q1FA 4GN2A 3G30A 3VP2A 3P09A 3IF5A 5HFOA 3UO9A 3NCKA 1W7FA 5FAQA 3MZDA 1YLPA 4LV1A 1XGJA 2ZLYA 3IT9A 1PZOA 2ZM8A 1HTZA 1PIOA 4E3JA 3N8RA 2WKIA 1L0FA 1TDLA 3BM6A 2WYXA 4X55A 5GLCA 4BL2A 1IYPA 3WS2A 1E3UA 1IEMA 1QMFA 2IWCA 2XGNA 5CHMA 5FATA 3W4QA 3WS1A 3HUMA 3S1YA 4OQ0A 3VP3A 3VP1A 3C7VA 2GDNA 4ZJ1A 3TOIA 3ZGAB 2BLSA 2ZC4B 1Z6FA 3G32A 2QMIA 3DWZA 4PM9A 5DTKA 4UHUA 5FI7A 4C75A 3HLBA 5EPHA 1S6RA 3PBRA 4HESA 5EOOA 3S4XA 2Y2LA 3NDGA 4P87A 1LL9A 3DW0A 3PTEA 2FFYA 5A92A 1FCNA 2X71A 2Q9NA 4WZ5C 1PYYA 3GR2A 5HX9A 5FQIA 3P98A 2E8IA 4GNUA 4FD8A 4L0LA 4S2NA 3D4FA 5FAOA 4OLGA 5D3OA 2Y2MA 4KZ5A 2IWBA 2A3UA 3AGFA 3IXHA 2C5WB 1FR1A 4K0XA 4P6BA 3UE0A 4LV3A 2XFSA 1O07A 3IF6C 3UPNA 1JWPA 1K56D 4HBTA 1ES4A 1GHMA 1RCJA 3CZDA 2WADA 1YT4A 2Y2HA 2Y2IA 3C4PA 4C6YA 1I2SA 2DNSA 3SH9A 1MPLA 1KVMA 1K57A 1GA9A 4EBPA 1NRFA 1XGIA 1PI5A 3NIAA 2OSUA 2WGWB 1L2SA 5EVIB 3HLEA 1YLYA 4BD0A 4GB7A 1IYSA 2Z2LB 3CG5A 4OPYA 1M6KA 3SS5A 3UPOA 4CPKA 1QMEA 4IVKA 3N8LA 4LCLA 3VMAA 3QHYA 4Y0UA 3WS0A 5TGFA 3VSLA 1LL5A 3QNBA 4EUZA 2CC1A 3Q7ZA 4ZAMA 3MBZA 2HDUA 2HP5A 3IWOA 4BL3A 5DTTA 4X56A 3UPPA 2ZD8A 1FSWA 3UE3A 4XXRA 4JPMA 1E3UD 4IBXA 3MXRA 4FSFA 3ZG7B 3ZG5A 1N4OA 1W5DA 4JKTA 5GHYA 2XLNA 5TR7A 5KSHA 3V39A 1Q2QA 5EUAA 3C4OA 2Y91A 4UAAA 3PBTA 2X01A 2XEPA 3A3EA 3C7UA 4ID4A 4YFMA 4WBGA 2RCXA 2P9VA 4S2KA 1N9BA 4S2OA 5GLBA 1K6RA 4S2JA 4QB8A 4S2MA 4FH4A 1WYCA 3CJMA 1FSYA 4RX2A 3W4PA 4EV4A 4OPZA 1NZOA 5FI2A 3GMWA 4UA7A 2ZQ9A 4M3KA 3UDIA 3TG9A 1IYOA 3PBQA 4KG5A 4LCMA 3FKVA 3OPLA 2P74A 1ES5A 4KZ8A 4X68A 1TVFA 4OOMA 3ZFZA 3W8KA 4GDNA 5FI6A 4A5RA 4U0TA 2WAEA 3RXWA 3BRMA 2Y2QA 1XP4A 1SHVA 3BLMA 2Y4AA 5KZHA 5AQAA 3ZCZA 4OONA 3LCEA 3MKFA 5CTNA 1KGEA 4ZJ3A 4H8RA 2Y2PA 4XUXA 1LI0A 1W8QA 4JF6A 1GHPA 4R0QA 2X02A 3G4PA 3NDEA 4KENB 1C3BA 3FV7A 4OP8A 4P0MA 3UE1A 4DE0A 4WM9A 3LEZA 1EWZA 1L0EA 3HUOA 5GLAA 1BLHA 3OZHA 2XDMA 1CI9A 2ZQ8A 3VFHA 4OOLA 4R1GA 1NY0A 3ISGA 2HP6A 3Q82A 4S2IA 2ZQDA 5CHJA 5HAPA 4KZ4A 4KG2A 1ERMA 5DVAA 3GTCA 5CRFA 1H8YA 4KZ3A 3WRTA 4WEJA 3HVFA 3S22A 2WGVA 4WZ5A 3QNCA 4HEFA 1JVJA 2WZXA 5FQKA 2VGJA 1NYMA 4JXSA 4OKPA 5KMWA 3IH9A 4OVDA 5A91A 2Y2NA 1PWGA 4ZDXA 1WE4A 3DTMA 3IF6B 4GZBA 1ERQA 1KE3A 4R3JA 5FQQA 2ZM0A 1MKIA 3OPPA 3JYIA 1SDNA 5L2FA 3M2KA 3E2KA 2Y2OA 3N7WA 3UY6A 4E3IA 5FQMA 5F1GA 4Q8IA 4DKIA 3ZG9B 1K4FA 2B5RA 4NK3A 5E43A 4MNRA 5CHUA 1G6AA 3WWXA 2OLVA 3C5AA 3MKEA 1ESUA 3BFGA 3IXDA 1L0GA 4EBNA 1PWDA 5EVLA 3I7JA 5FASA 3VP0A 3A3IA 4U3TA 3A3JA 1PZPA 1OMEA 4UA6A 1K25A 4WMCD 1SCWA 1HZOA 1ALQA 1KGFA 1GA0A 3FZCA 1NXYA 4RA7A 1VM1A 1CI8A 4MBFA 5CECA 2ZC6B 5E2HA 1YQSA 4JXGA 3VOYA 4R4SA 5E2EA 4MBHA 1LI9A 4N9KA 1S0WA 1ONGA 4LV0A 1J9MA 1XXMA 1BTLA 1KDSA 2WGWA 4GD8A 5EVIA 5DF7A 3BLSA 1YM1A 4IEDA 4PM8A 3O88A 3HLCA 4EQIA 4R4RA 3Q81A 1PWCA 4IBRA 3TSGA 3N6IA 1G68A 2H5SA 4DE2A 2DCFA 4FH2A 1ESIA 4KZBA 2V1ZA 5G18A 5HAIA 5J8XA 2JE5A 4KZ6A 4PMAA 4B88A 3OC2A 4X69A 2DRWA 2FFFB 1ZG4A 2WAFA 4Z9QA 4BQMA 4DF6A 4KG6A 1ES2A 3PBSA 4OLDA 1K54A 3ITBA 3UNWA 3MZEA 5GHZA 3NY4A 1TDGA 1E4DA 3EQUA 4OQHA 3M6BA 3HLDA 3M6HA 1K55C 4OPQA 5FA7A 2A49A 3G34A 3ZG0A 4F94A 1DY6A 4GKUA 2XQZA 1FCMA 1YLZA 4PM6A 4Y7PA 3WS5A 4DE3A 4E3OA 1XA1A 1XPBA 1E25A 1MWTA 4GD6A 1KVLA 3SS4A 2PU2A 1BZAA 2VGKA 2HP9A 3UN7A 2XD1A 4GOGA 3GVBA 4JF4A 3IWQA 1NYYA 4O7DA 2XF3A 3RJUA 3O87A 5FDHA 4QY6A 3PAGA 5I94A 5HARA 5GHXA 3M2JA 3SOIA 3ZHHA 1BUEA 3FKWA 2Q9MA 1KE0A 4WYYA 2EXAA 2JBFA 5HW3A 4QJGA 4E3KA 4PPRA 4DE1A 3B3XA 5DTSA 2OV5A 1BLPA 1YLWA 2V20A 1FOFA 1JWVA 3HLWA 4JF5A 5CGSA 1MBLA 4QU3A 5KSCA 1K6SA 2J9PA 2ZJ9A 5E2GA 5CGWA 1M40A 4JBFA 4Y0OA 4KZ9A 1K56A 2ZC7A 3Q07A 5E2FA 2R9WA 4E6WA 3PBOA 2C6WB 4OPRA 4EBLA 3CMZA 4R3BA 4RX3A 3BFCA 3IWIA 5IHVA 2J7VA 3G35A 1O7EA 3Q7VB 1RGYA 3W4OA 1L0DA 1SKFA 5F83A 3BECA 5CERA 1H8ZA 3HL9A 5M19A 5CGXA 3BFFA 4S2PA 2EFUA 3VSKA 3NBLA 4LV2A 3ITAA 4OOYA 4RYEA 1CK3A 1LHYA 1IYQA 4P85A 4WZ4A 5EVID 5F82A 3V5MA 4RVAA 1HVBA 1VQQA 3LY3A 3V3SA 1EROA 1KGGA 1TEMA 2XD5A 4MEZA 2WUQA 2WK0A 5A93A 1HD8A 5HAQA 1IELA 2Y2GA 2R9XA 1ES3A 3BYDA 3OPRA 1BSGA 1Q2PA 5F1FA 3RXXA 1KE4A 1U60A 2Z2MB 4LENA 4BD1A 4ZBEA 4DDSA 1XKZA 1ZC2A 5EE8A 3IXBA 2EX2A 4N9LA 4WELA 2PBYA 3IHAA 3HBRA 3IF6A 3OCNA 4PM7A 3HUNA 4QD4A 4KQRA 5GL9A 2ZC3B 2ZM2A 2ZQAA 1EI5A 3AGDA 2ZC5B 4U0XA 1YMXA 1YLTA 2H0TA 2Y59A 3G2YA 4DDYA 2PU4A 3HLFA 3HLGA
chains in the Genus database with same CATH superfamily
5GLDA 3MF0A 3H9WA 1IOUA 2ACGA 2Y2KA 4B93A 3V50A 3KX0X 5EECA 2HDRA 2XH9A 3O86A 3EGXC 4KQOA 4K91A 2UWXA 5BOHA 2Q0OA 4KZAA 2VGLM 5DKLA 3BWLA 4NXBA 3VV4A 1KOUA 1YMSA 3JVVA 5CXWA 3TE8A 3LO7A 3K3DA 3PBNA 4WEKA 3A3DA 4PHTA 4E6XA 3LIEA 3A3FA 1K55A 1IFQA 2OLUA 5AQBA 3D72A 3DWKA 1K57C 3IH8A 1WYBA 3NC8A 2HZ5A 2G2UA 3AGEA 4ZTKA 1MY8A 5M1AA 4N1XA 1W63M 1F9IA 4LGWA 2QKPA 2ZMFA 4OP5A 3NECA 4S2LA 1EW0A 4Y0TA 1KDWA 2YKHA 2WKEA 3MQQA 2EX9A 2P9VB 3R7WB 3BFEA 1N9NA 2UV0E 1LSWA 3KSHA 2IWDA 5CEBA 2RL3A 3MXSA 1F2KA 1RGZA 4OQGA 5FAPA 1JTDA 3E4QA 5JYOA 3KSFA 4OH0A 3GSGA 3TRCA 1NLYA 3K3CA 3Q7VA 3WRZA 1PW1A 2WKQA 1CF0A 4M4XA 3UDXA 2VV7A 3TW8A 4KZ7A 3WS4A 3VP2A 3IF5A 2GZAA 3NCKA 1XGJA 2ZLYA 1ZTUA 1PZOA 1Y28A 3MSHA 3BM6A 1XFQA 1P9RA 5FATA 3F1OB 2GDNA 3TOIA 2BLSA 4Y2FA 1Z6FA 4LRXC 2QMIA 4PM9A 1Y4OA 5EPHA 2Y2LA 4NXFA 3DW0A 3F1NB 3CITA 2X71A 3L7HA 2E8IA 4L0LA 4GCZA 4OLGA 4P6BA 2A3UA 4HI4A 3UE0A 1YPRA 1JWPA 1K56D 3IS2A 1ES4A 1RCJA 2M1CA 2O99A 3CUEA 3UB8A 3SZTA 1MPLA 1K57A 5C5KA 2JKRM 4P6ZS 3HLEA 2Z2LB 3KYEA 4I38A 4LCLA 3SW1A 3CWFA 5TGFA 3VSLA 2NUTC 3Q7ZA 5KIZA 2PD7A 3MBZA 2INWA 3IWOA 3T4SA 4HQAA 3MQOA 1FSWA 1E3UD 2IA2A 3MXRA 4FSFA 4JKTA 3IX3A 1Q2QA 3C4OA 1TS7A 4UAAA 3EWKA 4ID4A 2P9VA 4S2KA 3R7WA 1N9BA 4S2OA 5GLBA 4EETB 4QB8A 5AVEA 3CJMA 1FSYA 4KUOA 3GMWA 1VEUB 3UDIA 1F5MA 4KQDA 1ES5A 4GDNA 4IUKA 3ULFA 3O5YA 1KGEA 4I3IA 4XUXA 1LI0A 4BBUA 1W8QA 2W27A 4KENB 4CLCD 4OP8A 4DE0A 1EWZA 1L0EA 3HUOA 4D60A 4R38A 3EGDC 1T1AA 1UWPX 1CI9A 5DJUA 4PKYG 3MS6A 2HP6A 5CHJA 5DKKA 2J3TD 3F1OA 5CRFA 4KZ3A 4R3AA 4WEJA 3U4LP 3FG8A 1NYMA 5KMWA 1PWGA 4R3JA 3IF6B 5FQQA 2NUPC 1ERQA 4EEUA 3CPTA 1G5UA 1MKIA 3OPPA 3F1NA 5FQMA 2ZBBA 1K4FA 3P7NA 3WWXA 5F68A 2VKSA 5EVLA 3A3JA 1SCWA 1KGFA 3FZCA 4RA7A 1VM1A 3LIAA 5CECA 4R4SA 1XFNA 4N9KA 1S0WA 1J9MA 1XXMA 2BTFP 4GD8A 4CLCB 3IX8A 1ESIA 2W3FA 2WKRA 5G18A 4EESA 2Y8HA 2JE5A 4KZ6A 4B88A 4X1LA 4X69A 2DRWA 4FOFA 4Z9QA 4DF6A 4CLCC 3A0SA 3RTYA 3MZEA 4Q0IA 3NY4A 5HZHA 4OQHA 3HLDA 3M6HA 4OPQA 3G34A 3WS5A 4DJ2A 1E25A 1MWTA 2J3TC 4IJGA 3SS4A 2HP9A 1OJGA 4O7DA 1S4SA 4QY6A 4B9OA 3PAGA 2Q9MA 1VEUA 4QJGA 4PPRA 2OV5A 1YLWA 2V20A 3HLWA 5KSCA 2XRNA 4XT2B 2HJ9C 5E2GA 2FH5A 2XSSA 1K56A 3BFCA 3CAXA 3IWIA 5IHVA 2EWWA 3NOUC 5G4YA 3B47A 1H8ZA 4E04A 2GNXA 2J80A 4OOYA 5EVID 5CX7A 3V5MA 4ESPA 1P97A 1HVBA 1VQQA 4AFIA 3V3SA 1STZA 2WK0A 2KDKA 2Y2GA 1BSGA 5F1FA 2K2NA 4LENA 3KSIA 4BD1A 2GX5A 4P6ZM 1H8MA 1XKZA 1ZC2A 1OPXA 3IF6A 2ZQAA 1EI5A 2A24B 4DDYA 2H0TA 2Y59A 3G2YA 3HLFA 5HD3A 2QWSA 3UDFA 1RP5A 5FQJA 3MZFA 5CEDA 3SH8A 3LI8A 1W63Q 3VFFA 3VP4A 3LIDA 2G2WA 2W3DA 1IKGA 4GDBA 1XJ2A 3LYXA 1K38A 5HDSA 4YWZA 3IX4A 4IVIA 3MJQA 4B4XA 2PAVP 1UGUA 3MFDA 3OCLA 4I3JA 4L9EA 4CLCA 3FPWA 2Y55A 4N92A 3VOZA 5A90A 3LY4A 3JPUA 4PM5A 3GQZA 3FWLA 2ZQ7A 4K08A 5L8MA 5AQ9A 3UMDA 1CEGA 3ZVTA 2HGVA 1OTAA 4MLLA 4X25A 3BFDA 4O01A 5EVIC 1MWUA 4K0WA 5IT5A 2MJ6A 4QY5A 5U47A 5M18A 2QPNA 3ZDJA 2EXBA 4R23A 5EOEA 2Z6CA 4DXBA 4OQIA 1ZG6A 1K54C 4G3VA 1JWZA 3GRJA 2H10A 1MXOA 4XT2A 5TFQA 4YINA 3O3VA 5JYPA 4JXVA 3ZNYA 3HCYA 3V3RA 1I5QA 1DJBA 4KUKA 3PYPA 2XA7S 1CEFA 5LBRA 3EEAA 4XUZA 4HP4A 4GN2A 3H7WA 3G30A 2W3HA 3P09A 4ZRRA 3UO9A 1W7FA 3PXPA 4NKPA 1HTZA 3N8RA 3KO6A 1L0FA 4X1MA 2PR5A 4BBTA 3T4KA 3WS2A 5FEFA 1IEMA 2XGNA 1VETB 3WS1A 1UWNX 4OQ0A 4L9GA 3VP1A 3C7VA 5EFWA 4HJ4A 3S7PA 2ZC4B 3DWZA 4YNRA 3NOPC 5EM0A 3HLBA 4EQ1A 1S6RA 3PBRA 4HESA 2A24A 1AWIA 3S4XA 4GS9B 4FUWA 3QP5A 3P98A 5FAOA 5D3OA 2E8JA 4KZ5A 2IWBA 4K0XA 4FTXA 3IS2B 4DN0A 4LV3A 1VHMA 5HSQA 4C6YA 3CZDA 4YOFA 1LSVA 1BYWA 2VEAA 4LRYC 2WGWB 1L2SA 4GB7A 5FEGA 3CG5A 3A0VA 4CPKA 1QMEA 1LL8A 4NXGA 3N8LA 3VMAA 2J3WA 2P08A 2OOLA 2V0UA 3DTIA 2W0NA 4EUZA 2CC1A 2HDUA 1PRQA 5DTTA 2AVXA 2OWJA 2V8FA 4X56A 1OJ5A 2ZD8A 3UE3A 1N4OA 4Y17A 2HV1A 3VE4A 2Y91A 5G4ZA 1TD5A 1CJFA 2B18A 1XJ3A 4FH4A 4RX2A 2P7JA 4GHIB 4WF0A 4UA7A 3UB7A 1IYOA 4KG5A 2QJ5A 4LCMA 3T12B 3FKVA 4QWOA 5IU1A 4KZ8A 4X68A 4OOMA 3W8KA 5FI6A 2QJ7A 3F1PA 3BRMA 1XP4A 4ME4A 4ZJ3A 4H8RA 2GJ3A 4R0QA 3DTEA 3NDEA 1C3BA 1BLHA 3OZHA 2XDMA 4HP9A 3DBAA 3VFHA 1OTEA 4OOLA 3ISGA 2ZQDA 5HAPA 4KZ4A 4KG2A 1ERMA 1VETA 2CMNA 2OAQ1 4HY8A 3HVFA 3S22A 2WGVA 2VK3A 4NXEA 2VGJA 4JXSA 1XJ4A 5EM1A 3CPTB 5F6AA 2Y2NA 5A91A 3DTMA 1KE3A 2ZM0A 4GS9A 3JYIA 4E3IA 5F1GA 1P0ZA 2R78A 2B5RA 4MNRA 5DFYA 2FZ0A 2OLVA 1S1ZA 1PWDA 3VP0A 4U3TA 4UA6A 1K25A 2Z6DA 1ALQA 1NXYA 1CI8A 4MN6A 3HJIA 2DMWA 2Y79A 2PHYA 2WGWA 4PM8A 3HLCA 4EQIA 1J3WA 4O8GA 3N6IA 3B42A 4Y5FA 2DCFA 4FH2A 2V9AA 4H6JB 5HPIA 2FFFB 2HJEA 2WAFA 5AVFA 3PBSA 5GHZA 4HH3A 5A8BA 1TDGA 2XA7M 3C8CA 5FA7A 2KOIA 2A49A 1DY6A 1FCMA 1YLZA 4DE3A 1XPBA 4GD6A 4I5SA 2PU2A 1BZAA 1LSXA 5HWTA 2XD1A 2D01A 2O9AA 2LB9A 3MQ0A 3E4OA 3IWQA 1NYYA 4HH2A 2XF3A 5GHXA 3QP6A 4GHIA 3FKWA 4WYYA 5FDSA 4ETXA 2JBFA 4DE1A 3T1XA 3B3XA 3D9YA 5HPFA 1FOFA 3OBFA 2J9PA 4Y0OA 3LICA 3KYQA 2ZC7A 5E2FA 4E6WA 2I9VA 3PBOA 4OPRA 5J7EA 2J7VA 3G35A 3W4OA 1L0DA 1SKFA 5F83A 3BECA 5M19A 3HL9A 3BQAA 2EFUA 3ITAA 4UQIS 1CK3A 4P85A 4WZ4A 2V0WA 5F82A 4RVAA 3LY3A 4L9FA 1TS8A 2PT7A 1TEMA 2G7UA 2XD5A 4MEZA 1HD8A 1IELA 4Y15A 3RXXA 2L4RA 4DMZA 1U60A 2Z2MB 1SKOA 2EX2A 4N9LA 3NOTC 2VA0A 2WKPA 2QHKA 3BQ8A 5HWWA 4DJ3A 3OCNA 3HUNA 4QD4A 2O0YA 2ZM2A 3AGDA 4U0XA 2ZC5B 3A0RA 2PU4A 2XR0A 1ONHA 4HJ6A 4DXCA 4Z1WA 4BLMA 1Z09A 3E2LA 2JC7A 2JCHA 1H5XA 4E3MA 3L9KA 3FYZA 3S7OA 2HDQA 3T4JA 1PW8A 1MWRA 3SH7A 2KLIA 3BEBA 5EV0A 4HBUA 3R4KA 2JKTM 4G3WA 1F98A 1I2WA 4NG2A 1MWSA 4CLCE 3N8SA 1XX2A 3SS3A 2HPBA 1AXBA 4JLFA 4ZJ2A 1SDEA 3EEHA 3G31A 3QP1A 3T50A 4LFUA 4H6JA 1K4EA 1MC0A 4NETA 2J8YA 3D3OA 4E3NA 3CI6A 1HLUP 2HF6A 3N4IA 5K5BA 2H0YA 3ZNTA 1FR6A 1BLSA 1N9LA 3FC7A 3IXGA 4JXWA 3CLOA 4UA9A 5FSRA 4N1HA 5HL6A 4FCFA 1BLCA 5AQ7A 3TJZC 3BY8A 1OTBA 2I72A 1Y54A 4D2OA 2B95A 3E0YA 4X53A 4BENA 4QHCA 1L3LA 4E3LA 1S1YA 3G2ZA 3ZQ5A 2QZ6A 1FQGA 1NZUA 4C3QA 2YKFA 1H3QA 2ZOHA 3EQVA 1LLBA 5DF8A 4JGRA 4EWFA 1FCOA 3LUQA 3MFXA 1NWZA 3H7WB 2ZQCA 2Y2JA 3Q1FA 4HIAA 4JGQA 5FAQA 3MZDA 1YLPA 5HDDA 4MDZA 2V1BA 4E3JA 1TDLA 2WYXA 4X55A 1V9ZA 1E3UA 4BBVA 1PFLA 1QMFA 2IWCA 3P01A 5CHMA 3HUMA 3S1YA 3VP3A 4ZJ1A 1ODVA 3ZGAB 3G32A 5FI7A 3UB5P 4II7A 2W1RA 5EOOA 4P87A 3PTEA 4WL9A 1FCNA 3LR0A 2Q9NA 4WZ5C 1PYYA 3W2ZA 3MR0A 3T4LA 4PKYA 1MKMA 2Y2MA 3T4TA 3AGFA 1ZHHB 5J3WA 1GHMA 1FILA 1YT4A 2Y2HA 2OAP1 1I2SA 3SH9A 3U2AA 1FIKA 1XGIA 1PI5A 3NIAA 2OSUA 5EVIB 1YLYA 4BD0A 1IYSA 4OPYA 1M6KA 4ZAMA 4BL3A 5F69A 3UPPA 4XXRA 4JPMA 3ZG7B 3ZG5A 1W5DA 4UQIM 5GHYA 5TR7A 4LRZE 2PD8A 3V39A 2X01A 3PBTA 2XEPA 3C7UA 4YFMA 4WBGA 1K6RA 4S2JA 3T1QB 4GJ4A 4OPZA 1NZOA 5FI2A 5I5LA 2ZQ9A 4M3KA 3C30A 2XROA 3F1PB 3ZFZA 4A5RA 4U0TA 2WAEA 3RXWA 1T18A 2Y2QA 5KZHA 5AQAA 1A0KA 3E98A 3UE6A 4JF6A 1NLZA 1T1CA 2X02A 3G4PA 3FV7A 1OTIA 1YSPA 3LR4A 2ZQ8A 4R1GA 4HJ3A 1NRJA 4S2IA 5DVAA 3GTCA 3LR5A 1H8YA 3C38A 3WRTA 3BY9A 2B02A 4WZ5A 3LIFA 1JVJA 5TBMB 2WZXA 5FQKA 4OKPA 4ETZA 3IH9A 3DTKA 4ZDXA 4GZBA 1SDNA 5L2FA 5L10A 1P9WA 2Y2OA 3UY6A 4DKIA 3ZG9B 4NK3A 5E43A 5CHUA 3RH8B 1ESUA 3T4QA 3IXDA 1L0GA 1JNUA 3A3IA 3DAVA 1PZPA 1OMEA 4WMCD 4QPRA 5J4EA 1GA0A 1YQSA 4JXGA 3VOYA 5E2EA 1LI9A 4LV0A 2PBDP 5EVIA 2A2LA 5DF7A 3BLSA 3LI9A 2PYRA 3Q81A 1PWCA 3TSGA 3MMHA 1G68A 4RQ9A 4DE2A 1WA9A 4KZBA 2VX8A 5J8XA 2V8CA 4Q0JA 4PAUA 1ZG4A 3CUEC 1K54A 3UNWA 5IS1A 1E4DA 1T1BA 3M6BA 1S67L 4GKUA 1OT9A 2XQZA 4PM6A 4Y7PA 4E3OA 1KVLA 3NHQA 4MN5A 2D02A 4GOGA 3GVBA 4IHQA 4JGPA 3RJUA 3O87A 5FDHA 3M2JA 3SOIA 1BUEA 1KE0A 2PYPA 3UMEA 4E3KA 5HWVA 5CGSA 1YKDA 3BW6A 1MBLA 4QU3A 1K6SA 5CGWA 1M40A 3Q07A 2W3GA 2C6WB 4EUVA 1LT0A 3CMZA 4RX3A 1O7EA 3EOIA 5CERA 5CGXA 3OOVA 3HJKA 2BASA 4LV2A 4EU0A 2ZL1B 2W1TB 1ACFA 1EROA 1KGGA 1TS6A 5HAQA 2EA9A 3OPRA 1ES3A 1V9YA 4I39A 1Q2PA 3NJAA 1SKOB 5TBMA 5EE8A 4WELA 3IHAA 3T1RA 4KQRA 1YLTA 3ICYA 2XK1A 1DP6A 5FQ9A 1CQAA 5HD5A 2EFXA 2VZWA 3ZG8B 1ZKJA 3PAEA 1W79A 1XJ6A 2M7VA 3OPHA 5HL1A 1H0MA 1BULA 2O9BA 3IQAA 1PI4A 3NI9A 1IKIA 2XFTA 1TS0A 3ZVWA 4S2NC 2EX8A 3BJNA 5CTMA 1S4RA 2V2FF 1JTGA 4MBKA 1W8YA 4F3LB 4BJPA 1XA7A 5DF9A 2JKFA 2ZMAA 1GHIA 1DJCA 2J9OA 4MMNA 3KSGA 1VB6A 2EX6A 1YLJA 1X0OA 4GLQA 4CJNA 1DJAA 3B33A 2WGIA 4B4ZA 4KQQA 1GSXA 3H82B 1N9OA 3GV9A 4X6TA 4JGOA 1BT5A 1NJ4A 4WMCA 3UB6A 2WZZA 4EEPA 2VJWA 3IHBA 1YAXA 2HDSA 2K7SA 4DRTA 3C2WA 2WKHA 2BG1A 1GCEA 3JVUA 2LB5A 2JN7A 3HREA 4BWIA 2ZL1A 5HFOA 3S7NA 2W1TA 4LV1A 1SZVA 5DFXA 3IT9A 2ZM8A 1PIOA 2WKIA 5GLCA 4BL2A 1IYPA 4HHDA 3W4QA 2ZOIA 3RFBA 3NULA 2OWHA 5DTKA 4UHUA 2KX6A 1GSWA 3QP8A 4C75A 4WN5A 2PR6A 3V67A 4I3AA 4O0PA 3LFVA 2O9CA 3NDGA 1LL9A 2FFYA 5A92A 2EWVA 3GR2A 5HX9A 5FQIA 4GNUA 4ARZB 4FD8A 2K31A 4S2NA 3D4FA 5DJTA 4LLOB 3IXHA 2C5WB 1FR1A 1OTDA 2XFSA 4EXOA 1O07A 3IF6C 3UPNA 5TJJA 4HBTA 1DRMA 3OLOA 2WADA 1S66L 2Y2IA 3C4PA 2DNSA 3FPVA 3QP4A 1D7EA 1KVMA 1GA9A 4EBPA 1NRFA 4LPZA 3VOLA 3UPOA 3SS5A 4F3LA 4IVKA 3QHYA 4Y0UA 3CHWP 3WS0A 1LL5A 3QNBA 2HP5A 5MC7A 2L0WA 3PHYA 2VGLS 4IBXA 2L1MA 2V1AA 2XLNA 5KSHA 1MZUA 5EUAA 3A3EA 3KYZA 2RCXA 4MCWA 4S2MA 1WYCA 3W4PA 4R6LA 4EV4A 3H82A 4WUJA 2VLGA 4MN7A 3LEQA 4UEYA 3TG9A 3ZYTA 3PBQA 5FL3A 3OPLA 2P74A 1TVFA 2JKRI 5HDCA 1SHVA 3BLMA 2Y4AA 2QYBA 3ZCZA 1T19A 4OONA 3LCEA 3MKFA 5CTNA 2PDRA 2Y2PA 1GHPA 4P0MA 2VV8A 3UE1A 4WM9A 3LEZA 5GLAA 2JKGA 2VV6A 1NY0A 3Q82A 4Y13A 3GDIA 4Y3IA 3QNCA 4HEFA 4NEED 3QP2A 2H28A 4OVDA 1DP9A 3LIBA 1PNEA 1WE4A 5L07A 1G28A 3M2KA 3E2KA 4Q8IA 3N7WA 1OT6A 4HOIA 4ARZA 1G6AA 3C5AA 3MKEA 3BFGA 4EBNA 3I7JA 5FASA 1HZOA 3LR3A 3PR6A 4Q0HA 2PRFA 4MBFA 2ZC6B 5E2HA 3MXQA 1GSVA 4MBHA 3S7QA 1ONGA 1K0KA 1BTLA 1KDSA 1D1JA 4R70A 4IEDA 1YM1A 3O88A 4R4RA 4IBRA 2M7UA 2H5SA 2V1ZA 3LGOA 5HAIA 3T4OA 4PMAA 3OC2A 4BQMA 4KG6A 1ES2A 5EVEA 4OLDA 3K2NA 3ITBA 3T1SA 2W3EA 3EQUA 5AJGA 4EW7A 1K55C 4HNBA 3ZG0A 4F94A 1G6OA 2ZMVA 1XA1A 2VGKA 3UN7A 4BMWA 4JF4A 3G6OA 3IBRA 2JHEA 5I94A 1TF1A 5HARA 3ZHHA 1DP8A 2EXAA 5HW3A 3GECA 5F5YA 5DTSA 1BLPA 1JWVA 1D06A 4JF5A 2ZJ9A 4JBFA 4KZ9A 4CQHA 2R9WA 3E4PA 4EBLA 4R3BA 3UB9A 4EERA 2JKTI 3Q7VB 2P04A 1RGYA 3IBJA 3BFFA 4S2PA 3VSKA 3NBLA 5L09A 3VE3A 4RYEA 4GW9A 1LHYA 1IYQA 5A93A 2WUQA 2R9XA 3BYDA 4IUHA 1KE4A 4WLAA 4DDSA 4ZBEA 3IXBA 2PBYA 3HBRA 4PM7A 5GL9A 2ZC3B 4G3KA 1YSQA 1YMXA 3HLGA
chains in the Genus database with same CATH topology
3UDFA 5GLDA 1RP5A 2XK1A 5FQ9A 5FQJA 2XR0A 3MZFA 2EFXA 5CEDA 2Y2KA 1ONHA 3SH8A 3V50A 5EECA 3ZG8B 1ZKJA 4DXCA 2HDRA 3VFFA 3PAEA 2XH9A 3VP4A 3O86A 1W79A 4KQOA 4BLMA 4K91A 2UWXA 5BOHA 3E2LA 2G2WA 2JC7A 4KZAA 2JCHA 1H5XA 4E3MA 1IKGA 3OPHA 4GDBA 5HL1A 1BULA 1K38A 3FYZA 3IQAA 1YMSA 4IVIA 1PI4A 2HDQA 3NI9A 5CXWA 4B4XA 1IKIA 1PW8A 3LO7A 2XFTA 1MWRA 3SH7A 3MFDA 3OCLA 3BEBA 3PBNA 4WEKA 3ZVWA 4S2NC 4HBUA 3A3DA 2EX8A 5CTMA 1I2WA 2V2FF 4E6XA 1MWSA 2Y55A 4N92A 3A3FA 3VOZA 1JTGA 4MBKA 5A90A 3N8SA 1XX2A 3SS3A 1K55A 1AXBA 2HPBA 3LY4A 1SDEA 4JLFA 2OLUA 4ZJ2A 1W8YA 4PM5A 3G31A 3GQZA 5AQBA 3FWLA 4BJPA 2ZQ7A 5AQ9A 1K4EA 1XA7A 3DWKA 4NETA 5DF9A 2J8YA 2ZMAA 1CEGA 1GHIA 1K57C 3IH8A 1WYBA 3NC8A 1DJCA 2J9OA 4E3NA 2G2UA 3AGEA 3ZVTA 4ZTKA 3N4IA 4MLLA 1MY8A 3BFDA 2H0YA 5M1AA 3ZNTA 4N1XA 5EVIC 1MWUA 1FR6A 1BLSA 4K0WA 2EX6A 3IXGA 4JXWA 4QY5A 4OP5A 5U47A 4UA9A 5FSRA 1YLJA 4N1HA 4S2LA 5M18A 4FCFA 2QPNA 1BLCA 3ZDJA 4Y0TA 2EXBA 1KDWA 5AQ7A 4CJNA 1DJAA 2WKEA 4R23A 5EOEA 2EX9A 2I72A 2P9VB 4DXBA 2WGIA 4OQIA 4B4ZA 3BFEA 1ZG6A 4KQQA 1Y54A 1K54C 4D2OA 1JWZA 2IWDA 3GRJA 2H10A 5CEBA 2RL3A 3MXSA 1MXOA 4X53A 4BENA 3GV9A 4QHCA 4X6TA 4E3LA 1RGZA 5TFQA 3G2ZA 4OQGA 4YINA 1BT5A 1NJ4A 4WMCA 3O3VA 5FAPA 1JTDA 2QZ6A 1FQGA 5JYPA 4JXVA 3ZNYA 1NZUA 2WZZA 5JYOA 4C3QA 4OH0A 3V3RA 1I5QA 3IHBA 3GSGA 2HDSA 4DRTA 3WRZA 3EQVA 3Q7VA 1LLBA 5DF8A 2WKHA 1DJBA 1PW1A 4EWFA 1FCOA 2BG1A 1GCEA 2ZQCA 3UDXA 2Y2JA 1CEFA 4XUZA 3HREA 4KZ7A 3WS4A 3Q1FA 4GN2A 3G30A 3VP2A 3P09A 3IF5A 5HFOA 3UO9A 3NCKA 1W7FA 5FAQA 3MZDA 1YLPA 4LV1A 1XGJA 2ZLYA 3IT9A 1PZOA 2ZM8A 1HTZA 1PIOA 4E3JA 3N8RA 2WKIA 1L0FA 1TDLA 3BM6A 2WYXA 4X55A 5GLCA 4BL2A 1IYPA 3WS2A 1E3UA 1IEMA 1QMFA 2IWCA 2XGNA 5CHMA 5FATA 3W4QA 3WS1A 3HUMA 3S1YA 4OQ0A 3VP3A 3VP1A 3C7VA 2GDNA 4ZJ1A 3TOIA 3ZGAB 2BLSA 2ZC4B 1Z6FA 3G32A 2QMIA 3DWZA 4PM9A 5DTKA 4UHUA 5FI7A 4C75A 3HLBA 5EPHA 1S6RA 3PBRA 4HESA 5EOOA 3S4XA 2Y2LA 3NDGA 4P87A 1LL9A 3DW0A 3PTEA 2FFYA 5A92A 1FCNA 2X71A 2Q9NA 4WZ5C 1PYYA 3GR2A 5HX9A 5FQIA 3P98A 2E8IA 4GNUA 4FD8A 4L0LA 4S2NA 3D4FA 5FAOA 4OLGA 5D3OA 2Y2MA 4KZ5A 2IWBA 2A3UA 3AGFA 3IXHA 2C5WB 1FR1A 4K0XA 4P6BA 3UE0A 4LV3A 2XFSA 1O07A 3IF6C 3UPNA 1JWPA 1K56D 4HBTA 1ES4A 1GHMA 1RCJA 3CZDA 2WADA 1YT4A 2Y2HA 2Y2IA 3C4PA 4C6YA 1I2SA 2DNSA 3SH9A 1MPLA 1KVMA 1K57A 1GA9A 4EBPA 1NRFA 1XGIA 1PI5A 3NIAA 2OSUA 2WGWB 1L2SA 5EVIB 3HLEA 1YLYA 4BD0A 4GB7A 1IYSA 2Z2LB 3CG5A 4OPYA 1M6KA 3SS5A 3UPOA 4CPKA 1QMEA 4IVKA 3N8LA 4LCLA 3VMAA 3QHYA 4Y0UA 3WS0A 5TGFA 3VSLA 1LL5A 3QNBA 4EUZA 2CC1A 3Q7ZA 4ZAMA 3MBZA 2HDUA 2HP5A 3IWOA 4BL3A 5DTTA 4X56A 3UPPA 2ZD8A 1FSWA 3UE3A 4XXRA 4JPMA 1E3UD 4IBXA 3MXRA 4FSFA 3ZG7B 3ZG5A 1N4OA 1W5DA 4JKTA 5GHYA 2XLNA 5TR7A 5KSHA 3V39A 1Q2QA 5EUAA 3C4OA 2Y91A 4UAAA 3PBTA 2X01A 2XEPA 3A3EA 3C7UA 4ID4A 4YFMA 4WBGA 2RCXA 2P9VA 4S2KA 1N9BA 4S2OA 5GLBA 1K6RA 4S2JA 4QB8A 4S2MA 4FH4A 1WYCA 3CJMA 1FSYA 4RX2A 3W4PA 4EV4A 4OPZA 1NZOA 5FI2A 3GMWA 4UA7A 2ZQ9A 4M3KA 3UDIA 3TG9A 1IYOA 3PBQA 4KG5A 4LCMA 3FKVA 3OPLA 2P74A 1ES5A 4KZ8A 4X68A 1TVFA 4OOMA 3ZFZA 3W8KA 4GDNA 5FI6A 4A5RA 4U0TA 2WAEA 3RXWA 3BRMA 2Y2QA 1XP4A 1SHVA 3BLMA 2Y4AA 5KZHA 5AQAA 3ZCZA 4OONA 3LCEA 3MKFA 5CTNA 1KGEA 4ZJ3A 4H8RA 2Y2PA 4XUXA 1LI0A 1W8QA 4JF6A 1GHPA 4R0QA 2X02A 3G4PA 3NDEA 4KENB 1C3BA 3FV7A 4OP8A 4P0MA 3UE1A 4DE0A 4WM9A 3LEZA 1EWZA 1L0EA 3HUOA 5GLAA 1BLHA 3OZHA 2XDMA 1CI9A 2ZQ8A 3VFHA 4OOLA 4R1GA 1NY0A 3ISGA 2HP6A 3Q82A 4S2IA 2ZQDA 5CHJA 5HAPA 4KZ4A 4KG2A 1ERMA 5DVAA 3GTCA 5CRFA 1H8YA 4KZ3A 3WRTA 4WEJA 3HVFA 3S22A 2WGVA 4WZ5A 3QNCA 4HEFA 1JVJA 2WZXA 5FQKA 2VGJA 1NYMA 4JXSA 4OKPA 5KMWA 3IH9A 4OVDA 5A91A 2Y2NA 1PWGA 4ZDXA 1WE4A 3DTMA 3IF6B 4GZBA 1ERQA 1KE3A 4R3JA 5FQQA 2ZM0A 1MKIA 3OPPA 3JYIA 1SDNA 5L2FA 3M2KA 3E2KA 2Y2OA 3N7WA 3UY6A 4E3IA 5FQMA 5F1GA 4Q8IA 4DKIA 3ZG9B 1K4FA 2B5RA 4NK3A 5E43A 4MNRA 5CHUA 1G6AA 3WWXA 2OLVA 3C5AA 3MKEA 1ESUA 3BFGA 3IXDA 1L0GA 4EBNA 1PWDA 5EVLA 3I7JA 5FASA 3VP0A 3A3IA 4U3TA 3A3JA 1PZPA 1OMEA 4UA6A 1K25A 4WMCD 1SCWA 1HZOA 1ALQA 1KGFA 1GA0A 3FZCA 1NXYA 4RA7A 1VM1A 1CI8A 4MBFA 5CECA 2ZC6B 5E2HA 1YQSA 4JXGA 3VOYA 4R4SA 5E2EA 4MBHA 1LI9A 4N9KA 1S0WA 1ONGA 4LV0A 1J9MA 1XXMA 1BTLA 1KDSA 2WGWA 4GD8A 5EVIA 5DF7A 3BLSA 1YM1A 4IEDA 4PM8A 3O88A 3HLCA 4EQIA 4R4RA 3Q81A 1PWCA 4IBRA 3TSGA 3N6IA 1G68A 2H5SA 4DE2A 2DCFA 4FH2A 1ESIA 4KZBA 2V1ZA 5G18A 5HAIA 5J8XA 2JE5A 4KZ6A 4PMAA 4B88A 3OC2A 4X69A 2DRWA 2FFFB 1ZG4A 2WAFA 4Z9QA 4BQMA 4DF6A 4KG6A 1ES2A 3PBSA 4OLDA 1K54A 3ITBA 3UNWA 3MZEA 5GHZA 3NY4A 1TDGA 1E4DA 3EQUA 4OQHA 3M6BA 3HLDA 3M6HA 1K55C 4OPQA 5FA7A 2A49A 3G34A 3ZG0A 4F94A 1DY6A 4GKUA 2XQZA 1FCMA 1YLZA 4PM6A 4Y7PA 3WS5A 4DE3A 4E3OA 1XA1A 1XPBA 1E25A 1MWTA 4GD6A 1KVLA 3SS4A 2PU2A 1BZAA 2VGKA 2HP9A 3UN7A 2XD1A 4GOGA 3GVBA 4JF4A 3IWQA 1NYYA 4O7DA 2XF3A 3RJUA 3O87A 5FDHA 4QY6A 3PAGA 5I94A 5HARA 5GHXA 3M2JA 3SOIA 3ZHHA 1BUEA 3FKWA 2Q9MA 1KE0A 4WYYA 2EXAA 2JBFA 5HW3A 4QJGA 4E3KA 4PPRA 4DE1A 3B3XA 5DTSA 2OV5A 1BLPA 1YLWA 2V20A 1FOFA 1JWVA 3HLWA 4JF5A 5CGSA 1MBLA 4QU3A 5KSCA 1K6SA 2J9PA 2ZJ9A 5E2GA 5CGWA 1M40A 4JBFA 4Y0OA 4KZ9A 1K56A 2ZC7A 3Q07A 5E2FA 2R9WA 4E6WA 3PBOA 2C6WB 4OPRA 4EBLA 3CMZA 4R3BA 4RX3A 3BFCA 3IWIA 5IHVA 2J7VA 3G35A 1O7EA 3Q7VB 1RGYA 3W4OA 1L0DA 1SKFA 5F83A 3BECA 5CERA 1H8ZA 3HL9A 5M19A 5CGXA 3BFFA 4S2PA 2EFUA 3VSKA 3NBLA 4LV2A 3ITAA 4OOYA 4RYEA 1CK3A 1LHYA 1IYQA 4P85A 4WZ4A 5EVID 5F82A 3V5MA 4RVAA 1HVBA 1VQQA 3LY3A 3V3SA 1EROA 1KGGA 1TEMA 2XD5A 4MEZA 2WUQA 2WK0A 5A93A 1HD8A 5HAQA 1IELA 2Y2GA 2R9XA 1ES3A 3BYDA 3OPRA 1BSGA 1Q2PA 5F1FA 3RXXA 1KE4A 1U60A 2Z2MB 4LENA 4BD1A 4ZBEA 4DDSA 1XKZA 1ZC2A 5EE8A 3IXBA 2EX2A 4N9LA 4WELA 2PBYA 3IHAA 3HBRA 3IF6A 3OCNA 4PM7A 3HUNA 4QD4A 4KQRA 5GL9A 2ZC3B 2ZM2A 2ZQAA 1EI5A 3AGDA 2ZC5B 4U0XA 1YMXA 1YLTA 2H0TA 2Y59A 3G2YA 4DDYA 2PU4A 3HLFA 3HLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDF A;  5GLD A;  1RP5 A;  2XK1 A;  5FQ9 A;  5FQJ A;  2XR0 A;  3MZF A;  2EFX A;  5CED A;  2Y2K A;  1ONH A;  3SH8 A;  3V50 A;  5EEC A;  3ZG8 B;  1ZKJ A;  4DXC A;  2HDR A;  3VFF A;  3PAE A;  2XH9 A;  3VP4 A;  3O86 A;  1W79 A;  4KQO A;  4BLM A;  4K91 A;  2UWX A;  5BOH A;  3E2L A;  2G2W A;  2JC7 A;  4KZA A;  2JCH A;  1H5X A;  4E3M A;  1IKG A;  3OPH A;  4GDB A;  5HL1 A;  1BUL A;  1K38 A;  3FYZ A;  3IQA A;  1YMS A;  4IVI A;  1PI4 A;  2HDQ A;  3NI9 A;  5CXW A;  4B4X A;  1IKI A;  1PW8 A;  3LO7 A;  2XFT A;  1MWR A;  3SH7 A;  3MFD A;  3OCL A;  3BEB A;  3PBN A;  4WEK A;  3ZVW A;  4S2N C;  4HBU A;  3A3D A;  2EX8 A;  5CTM A;  1I2W A;  2V2F F;  4E6X A;  1MWS A;  2Y55 A;  4N92 A;  3A3F A;  3VOZ A;  1JTG A;  4MBK A;  5A90 A;  3N8S A;  1XX2 A;  3SS3 A;  1K55 A;  1AXB A;  2HPB A;  3LY4 A;  1SDE A;  4JLF A;  2OLU A;  4ZJ2 A;  1W8Y A;  4PM5 A;  3G31 A;  3GQZ A;  5AQB A;  3FWL A;  4BJP A;  2ZQ7 A;  5AQ9 A;  1K4E A;  1XA7 A;  3DWK A;  4NET A;  5DF9 A;  2J8Y A;  2ZMA A;  1CEG A;  1GHI A;  1K57 C;  3IH8 A;  1WYB A;  3NC8 A;  1DJC A;  2J9O A;  4E3N A;  2G2U A;  3AGE A;  3ZVT A;  4ZTK A;  3N4I A;  4MLL A;  1MY8 A;  3BFD A;  2H0Y A;  5M1A A;  3ZNT A;  4N1X A;  5EVI C;  1MWU A;  1FR6 A;  1BLS A;  4K0W A;  2EX6 A;  3IXG A;  4JXW A;  4QY5 A;  4OP5 A;  5U47 A;  4UA9 A;  5FSR A;  1YLJ A;  4N1H A;  4S2L A;  5M18 A;  4FCF A;  2QPN A;  1BLC A;  3ZDJ A;  4Y0T A;  2EXB A;  1KDW A;  5AQ7 A;  4CJN A;  1DJA A;  2WKE A;  4R23 A;  5EOE A;  2EX9 A;  2I72 A;  2P9V B;  4DXB A;  2WGI A;  4OQI A;  4B4Z A;  3BFE A;  1ZG6 A;  4KQQ A;  1Y54 A;  1K54 C;  4D2O A;  1JWZ A;  2IWD A;  3GRJ A;  2H10 A;  5CEB A;  2RL3 A;  3MXS A;  1MXO A;  4X53 A;  4BEN A;  3GV9 A;  4QHC A;  4X6T A;  4E3L A;  1RGZ A;  5TFQ A;  3G2Z A;  4OQG A;  4YIN A;  1BT5 A;  1NJ4 A;  4WMC A;  3O3V A;  5FAP A;  1JTD A;  2QZ6 A;  1FQG A;  5JYP A;  4JXV A;  3ZNY A;  1NZU A;  2WZZ A;  5JYO A;  4C3Q A;  4OH0 A;  3V3R A;  1I5Q A;  3IHB A;  3GSG A;  2HDS A;  4DRT A;  3WRZ A;  3EQV A;  3Q7V A;  1LLB A;  5DF8 A;  2WKH A;  1DJB A;  1PW1 A;  4EWF A;  1FCO A;  2BG1 A;  1GCE A;  2ZQC A;  3UDX A;  2Y2J A;  1CEF A;  4XUZ A;  3HRE A;  4KZ7 A;  3WS4 A;  3Q1F A;  4GN2 A;  3G30 A;  3VP2 A;  3P09 A;  3IF5 A;  5HFO A;  3UO9 A;  3NCK A;  1W7F A;  5FAQ A;  3MZD A;  1YLP A;  4LV1 A;  1XGJ A;  2ZLY A;  3IT9 A;  1PZO A;  2ZM8 A;  1HTZ A;  1PIO A;  4E3J A;  3N8R A;  2WKI A;  1L0F A;  1TDL A;  3BM6 A;  2WYX A;  4X55 A;  5GLC A;  4BL2 A;  1IYP A;  3WS2 A;  1E3U A;  1IEM A;  1QMF A;  2IWC A;  2XGN A;  5CHM A;  5FAT A;  3W4Q A;  3WS1 A;  3HUM A;  3S1Y A;  4OQ0 A;  3VP3 A;  3VP1 A;  3C7V A;  2GDN A;  4ZJ1 A;  3TOI A;  3ZGA B;  2BLS A;  2ZC4 B;  1Z6F A;  3G32 A;  2QMI A;  3DWZ A;  4PM9 A;  5DTK A;  4UHU A;  5FI7 A;  4C75 A;  3HLB A;  5EPH A;  1S6R A;  3PBR A;  4HES A;  5EOO A;  3S4X A;  2Y2L A;  3NDG A;  4P87 A;  1LL9 A;  3DW0 A;  3PTE A;  2FFY A;  5A92 A;  1FCN A;  2X71 A;  2Q9N A;  4WZ5 C;  1PYY A;  3GR2 A;  5HX9 A;  5FQI A;  3P98 A;  2E8I A;  4GNU A;  4FD8 A;  4L0L A;  4S2N A;  3D4F A;  5FAO A;  4OLG A;  5D3O A;  2Y2M A;  4KZ5 A;  2IWB A;  2A3U A;  3AGF A;  3IXH A;  2C5W B;  1FR1 A;  4K0X A;  4P6B A;  3UE0 A;  4LV3 A;  2XFS A;  1O07 A;  3IF6 C;  3UPN A;  1JWP A;  1K56 D;  4HBT A;  1ES4 A;  1GHM A;  1RCJ A;  3CZD A;  2WAD A;  1YT4 A;  2Y2H A;  2Y2I A;  3C4P A;  4C6Y A;  1I2S A;  2DNS A;  3SH9 A;  1MPL A;  1KVM A;  1K57 A;  1GA9 A;  4EBP A;  1NRF A;  1XGI A;  1PI5 A;  3NIA A;  2OSU A;  2WGW B;  1L2S A;  5EVI B;  3HLE A;  1YLY A;  4BD0 A;  4GB7 A;  1IYS A;  2Z2L B;  3CG5 A;  4OPY A;  1M6K A;  3SS5 A;  3UPO A;  4CPK A;  1QME A;  4IVK A;  3N8L A;  4LCL A;  3VMA A;  3QHY A;  4Y0U A;  3WS0 A;  5TGF A;  3VSL A;  1LL5 A;  3QNB A;  4EUZ A;  2CC1 A;  3Q7Z A;  4ZAM A;  3MBZ A;  2HDU A;  2HP5 A;  3IWO A;  4BL3 A;  5DTT A;  4X56 A;  3UPP A;  2ZD8 A;  1FSW A;  3UE3 A;  4XXR A;  4JPM A;  1E3U D;  4IBX A;  3MXR A;  4FSF A;  3ZG7 B;  3ZG5 A;  1N4O A;  1W5D A;  4JKT A;  5GHY A;  2XLN A;  5TR7 A;  5KSH A;  3V39 A;  1Q2Q A;  5EUA A;  3C4O A;  2Y91 A;  4UAA A;  3PBT A;  2X01 A;  2XEP A;  3A3E A;  3C7U A;  4ID4 A;  4YFM A;  4WBG A;  2RCX A;  2P9V A;  4S2K A;  1N9B A;  4S2O A;  5GLB A;  1K6R A;  4S2J A;  4QB8 A;  4S2M A;  4FH4 A;  1WYC A;  3CJM A;  1FSY A;  4RX2 A;  3W4P A;  4EV4 A;  4OPZ A;  1NZO A;  5FI2 A;  3GMW A;  4UA7 A;  2ZQ9 A;  4M3K A;  3UDI A;  3TG9 A;  1IYO A;  3PBQ A;  4KG5 A;  4LCM A;  3FKV A;  3OPL A;  2P74 A;  1ES5 A;  4KZ8 A;  4X68 A;  1TVF A;  4OOM A;  3ZFZ A;  3W8K A;  4GDN A;  5FI6 A;  4A5R A;  4U0T A;  2WAE A;  3RXW A;  3BRM A;  2Y2Q A;  1XP4 A;  1SHV A;  3BLM A;  2Y4A A;  5KZH A;  5AQA A;  3ZCZ A;  4OON A;  3LCE A;  3MKF A;  5CTN A;  1KGE A;  4ZJ3 A;  4H8R A;  2Y2P A;  4XUX A;  1LI0 A;  1W8Q A;  4JF6 A;  1GHP A;  4R0Q A;  2X02 A;  3G4P A;  3NDE A;  4KEN B;  1C3B A;  3FV7 A;  4OP8 A;  4P0M A;  3UE1 A;  4DE0 A;  4WM9 A;  3LEZ A;  1EWZ A;  1L0E A;  3HUO A;  5GLA A;  1BLH A;  3OZH A;  2XDM A;  1CI9 A;  2ZQ8 A;  3VFH A;  4OOL A;  4R1G A;  1NY0 A;  3ISG A;  2HP6 A;  3Q82 A;  4S2I A;  2ZQD A;  5CHJ A;  5HAP A;  4KZ4 A;  4KG2 A;  1ERM A;  5DVA A;  3GTC A;  5CRF A;  1H8Y A;  4KZ3 A;  3WRT A;  4WEJ A;  3HVF A;  3S22 A;  2WGV A;  4WZ5 A;  3QNC A;  4HEF A;  1JVJ A;  2WZX A;  5FQK A;  2VGJ A;  1NYM A;  4JXS A;  4OKP A;  5KMW A;  3IH9 A;  4OVD A;  5A91 A;  2Y2N A;  1PWG A;  4ZDX A;  1WE4 A;  3DTM A;  3IF6 B;  4GZB A;  1ERQ A;  1KE3 A;  4R3J A;  5FQQ A;  2ZM0 A;  1MKI A;  3OPP A;  3JYI A;  1SDN A;  5L2F A;  3M2K A;  3E2K A;  2Y2O A;  3N7W A;  3UY6 A;  4E3I A;  5FQM A;  5F1G A;  4Q8I A;  4DKI A;  3ZG9 B;  1K4F A;  2B5R A;  4NK3 A;  5E43 A;  4MNR A;  5CHU A;  1G6A A;  3WWX A;  2OLV A;  3C5A A;  3MKE A;  1ESU A;  3BFG A;  3IXD A;  1L0G A;  4EBN A;  1PWD A;  5EVL A;  3I7J A;  5FAS A;  3VP0 A;  3A3I A;  4U3T A;  3A3J A;  1PZP A;  1OME A;  4UA6 A;  1K25 A;  4WMC D;  1SCW A;  1HZO A;  1ALQ A;  1KGF A;  1GA0 A;  3FZC A;  1NXY A;  4RA7 A;  1VM1 A;  1CI8 A;  4MBF A;  5CEC A;  2ZC6 B;  5E2H A;  1YQS A;  4JXG A;  3VOY A;  4R4S A;  5E2E A;  4MBH A;  1LI9 A;  4N9K A;  1S0W A;  1ONG A;  4LV0 A;  1J9M A;  1XXM A;  1BTL A;  1KDS A;  2WGW A;  4GD8 A;  5EVI A;  5DF7 A;  3BLS A;  1YM1 A;  4IED A;  4PM8 A;  3O88 A;  3HLC A;  4EQI A;  4R4R A;  3Q81 A;  1PWC A;  4IBR A;  3TSG A;  3N6I A;  1G68 A;  2H5S A;  4DE2 A;  2DCF A;  4FH2 A;  1ESI A;  4KZB A;  2V1Z A;  5G18 A;  5HAI A;  5J8X A;  2JE5 A;  4KZ6 A;  4PMA A;  4B88 A;  3OC2 A;  4X69 A;  2DRW A;  2FFF B;  1ZG4 A;  2WAF A;  4Z9Q A;  4BQM A;  4DF6 A;  4KG6 A;  1ES2 A;  3PBS A;  4OLD A;  1K54 A;  3ITB A;  3UNW A;  3MZE A;  5GHZ A;  3NY4 A;  1TDG A;  1E4D A;  3EQU A;  4OQH A;  3M6B A;  3HLD A;  3M6H A;  1K55 C;  4OPQ A;  5FA7 A;  2A49 A;  3G34 A;  3ZG0 A;  4F94 A;  1DY6 A;  4GKU A;  2XQZ A;  1FCM A;  1YLZ A;  4PM6 A;  4Y7P A;  3WS5 A;  4DE3 A;  4E3O A;  1XA1 A;  1XPB A;  1E25 A;  1MWT A;  4GD6 A;  1KVL A;  3SS4 A;  2PU2 A;  1BZA A;  2VGK A;  2HP9 A;  3UN7 A;  2XD1 A;  4GOG A;  3GVB A;  4JF4 A;  3IWQ A;  1NYY A;  4O7D A;  2XF3 A;  3RJU A;  3O87 A;  5FDH A;  4QY6 A;  3PAG A;  5I94 A;  5HAR A;  5GHX A;  3M2J A;  3SOI A;  3ZHH A;  1BUE A;  3FKW A;  2Q9M A;  1KE0 A;  4WYY A;  2EXA A;  2JBF A;  5HW3 A;  4QJG A;  4E3K A;  4PPR A;  4DE1 A;  3B3X A;  5DTS A;  2OV5 A;  1BLP A;  1YLW A;  2V20 A;  1FOF A;  1JWV A;  3HLW A;  4JF5 A;  5CGS A;  1MBL A;  4QU3 A;  5KSC A;  1K6S A;  2J9P A;  2ZJ9 A;  5E2G A;  5CGW A;  1M40 A;  4JBF A;  4Y0O A;  4KZ9 A;  1K56 A;  2ZC7 A;  3Q07 A;  5E2F A;  2R9W A;  4E6W A;  3PBO A;  2C6W B;  4OPR A;  4EBL A;  3CMZ A;  4R3B A;  4RX3 A;  3BFC A;  3IWI A;  5IHV A;  2J7V A;  3G35 A;  1O7E A;  3Q7V B;  1RGY A;  3W4O A;  1L0D A;  1SKF A;  5F83 A;  3BEC A;  5CER A;  1H8Z A;  3HL9 A;  5M19 A;  5CGX A;  3BFF A;  4S2P A;  2EFU A;  3VSK A;  3NBL A;  4LV2 A;  3ITA A;  4OOY A;  4RYE A;  1CK3 A;  1LHY A;  1IYQ A;  4P85 A;  4WZ4 A;  5EVI D;  5F82 A;  3V5M A;  4RVA A;  1HVB A;  1VQQ A;  3LY3 A;  3V3S A;  1ERO A;  1KGG A;  1TEM A;  2XD5 A;  4MEZ A;  2WUQ A;  2WK0 A;  5A93 A;  1HD8 A;  5HAQ A;  1IEL A;  2Y2G A;  2R9X A;  1ES3 A;  3BYD A;  3OPR A;  1BSG A;  1Q2P A;  5F1F A;  3RXX A;  1KE4 A;  1U60 A;  2Z2M B;  4LEN A;  4BD1 A;  4ZBE A;  4DDS A;  1XKZ A;  1ZC2 A;  5EE8 A;  3IXB A;  2EX2 A;  4N9L A;  4WEL A;  2PBY A;  3IHA A;  3HBR A;  3IF6 A;  3OCN A;  4PM7 A;  3HUN A;  4QD4 A;  4KQR A;  5GL9 A;  2ZC3 B;  2ZM2 A;  2ZQA A;  1EI5 A;  3AGD A;  2ZC5 B;  4U0X A;  1YMX A;  1YLT A;  2H0T A;  2Y59 A;  3G2Y A;  4DDY A;  2PU4 A;  3HLF A;  3HLG A; 
#chains in the Genus database with same CATH topology
 5GLD A;  3MF0 A;  3H9W A;  1IOU A;  2ACG A;  2Y2K A;  4B93 A;  3V50 A;  3KX0 X;  5EEC A;  2HDR A;  2XH9 A;  3O86 A;  3EGX C;  4KQO A;  4K91 A;  2UWX A;  5BOH A;  2Q0O A;  4KZA A;  2VGL M;  5DKL A;  3BWL A;  4NXB A;  3VV4 A;  1KOU A;  1YMS A;  3JVV A;  5CXW A;  3TE8 A;  3LO7 A;  3K3D A;  3PBN A;  4WEK A;  3A3D A;  4PHT A;  4E6X A;  3LIE A;  3A3F A;  1K55 A;  1IFQ A;  2OLU A;  5AQB A;  3D72 A;  3DWK A;  1K57 C;  3IH8 A;  1WYB A;  3NC8 A;  2HZ5 A;  2G2U A;  3AGE A;  4ZTK A;  1MY8 A;  5M1A A;  4N1X A;  1W63 M;  1F9I A;  4LGW A;  2QKP A;  2ZMF A;  4OP5 A;  3NEC A;  4S2L A;  1EW0 A;  4Y0T A;  1KDW A;  2YKH A;  2WKE A;  3MQQ A;  2EX9 A;  2P9V B;  3R7W B;  3BFE A;  1N9N A;  2UV0 E;  1LSW A;  3KSH A;  2IWD A;  5CEB A;  2RL3 A;  3MXS A;  1F2K A;  1RGZ A;  4OQG A;  5FAP A;  1JTD A;  3E4Q A;  5JYO A;  3KSF A;  4OH0 A;  3GSG A;  3TRC A;  1NLY A;  3K3C A;  3Q7V A;  3WRZ A;  1PW1 A;  2WKQ A;  1CF0 A;  4M4X A;  3UDX A;  2VV7 A;  3TW8 A;  4KZ7 A;  3WS4 A;  3VP2 A;  3IF5 A;  2GZA A;  3NCK A;  1XGJ A;  2ZLY A;  1ZTU A;  1PZO A;  1Y28 A;  3MSH A;  3BM6 A;  1XFQ A;  1P9R A;  5FAT A;  3F1O B;  2GDN A;  3TOI A;  2BLS A;  4Y2F A;  1Z6F A;  4LRX C;  2QMI A;  4PM9 A;  1Y4O A;  5EPH A;  2Y2L A;  4NXF A;  3DW0 A;  3F1N B;  3CIT A;  2X71 A;  3L7H A;  2E8I A;  4L0L A;  4GCZ A;  4OLG A;  4P6B A;  2A3U A;  4HI4 A;  3UE0 A;  1YPR A;  1JWP A;  1K56 D;  3IS2 A;  1ES4 A;  1RCJ A;  2M1C A;  2O99 A;  3CUE A;  3UB8 A;  3SZT A;  1MPL A;  1K57 A;  5C5K A;  2JKR M;  4P6Z S;  3HLE A;  2Z2L B;  3KYE A;  4I38 A;  4LCL A;  3SW1 A;  3CWF A;  5TGF A;  3VSL A;  2NUT C;  3Q7Z A;  5KIZ A;  2PD7 A;  3MBZ A;  2INW A;  3IWO A;  3T4S A;  4HQA A;  3MQO A;  1FSW A;  1E3U D;  2IA2 A;  3MXR A;  4FSF A;  4JKT A;  3IX3 A;  1Q2Q A;  3C4O A;  1TS7 A;  4UAA A;  3EWK A;  4ID4 A;  2P9V A;  4S2K A;  3R7W A;  1N9B A;  4S2O A;  5GLB A;  4EET B;  4QB8 A;  5AVE A;  3CJM A;  1FSY A;  4KUO A;  3GMW A;  1VEU B;  3UDI A;  1F5M A;  4KQD A;  1ES5 A;  4GDN A;  4IUK A;  3ULF A;  3O5Y A;  1KGE A;  4I3I A;  4XUX A;  1LI0 A;  4BBU A;  1W8Q A;  2W27 A;  4KEN B;  4CLC D;  4OP8 A;  4DE0 A;  1EWZ A;  1L0E A;  3HUO A;  4D60 A;  4R38 A;  3EGD C;  1T1A A;  1UWP X;  1CI9 A;  5DJU A;  4PKY G;  3MS6 A;  2HP6 A;  5CHJ A;  5DKK A;  2J3T D;  3F1O A;  5CRF A;  4KZ3 A;  4R3A A;  4WEJ A;  3U4L P;  3FG8 A;  1NYM A;  5KMW A;  1PWG A;  4R3J A;  3IF6 B;  5FQQ A;  2NUP C;  1ERQ A;  4EEU A;  3CPT A;  1G5U A;  1MKI A;  3OPP A;  3F1N A;  5FQM A;  2ZBB A;  1K4F A;  3P7N A;  3WWX A;  5F68 A;  2VKS A;  5EVL A;  3A3J A;  1SCW A;  1KGF A;  3FZC A;  4RA7 A;  1VM1 A;  3LIA A;  5CEC A;  4R4S A;  1XFN A;  4N9K A;  1S0W A;  1J9M A;  1XXM A;  2BTF P;  4GD8 A;  4CLC B;  3IX8 A;  1ESI A;  2W3F A;  2WKR A;  5G18 A;  4EES A;  2Y8H A;  2JE5 A;  4KZ6 A;  4B88 A;  4X1L A;  4X69 A;  2DRW A;  4FOF A;  4Z9Q A;  4DF6 A;  4CLC C;  3A0S A;  3RTY A;  3MZE A;  4Q0I A;  3NY4 A;  5HZH A;  4OQH A;  3HLD A;  3M6H A;  4OPQ A;  3G34 A;  3WS5 A;  4DJ2 A;  1E25 A;  1MWT A;  2J3T C;  4IJG A;  3SS4 A;  2HP9 A;  1OJG A;  4O7D A;  1S4S A;  4QY6 A;  4B9O A;  3PAG A;  2Q9M A;  1VEU A;  4QJG A;  4PPR A;  2OV5 A;  1YLW A;  2V20 A;  3HLW A;  5KSC A;  2XRN A;  4XT2 B;  2HJ9 C;  5E2G A;  2FH5 A;  2XSS A;  1K56 A;  3BFC A;  3CAX A;  3IWI A;  5IHV A;  2EWW A;  3NOU C;  5G4Y A;  3B47 A;  1H8Z A;  4E04 A;  2GNX A;  2J80 A;  4OOY A;  5EVI D;  5CX7 A;  3V5M A;  4ESP A;  1P97 A;  1HVB A;  1VQQ A;  4AFI A;  3V3S A;  1STZ A;  2WK0 A;  2KDK A;  2Y2G A;  1BSG A;  5F1F A;  2K2N A;  4LEN A;  3KSI A;  4BD1 A;  2GX5 A;  4P6Z M;  1H8M A;  1XKZ A;  1ZC2 A;  1OPX A;  3IF6 A;  2ZQA A;  1EI5 A;  2A24 B;  4DDY A;  2H0T A;  2Y59 A;  3G2Y A;  3HLF A;  5HD3 A;  2QWS A;  3UDF A;  1RP5 A;  5FQJ A;  3MZF A;  5CED A;  3SH8 A;  3LI8 A;  1W63 Q;  3VFF A;  3VP4 A;  3LID A;  2G2W A;  2W3D A;  1IKG A;  4GDB A;  1XJ2 A;  3LYX A;  1K38 A;  5HDS A;  4YWZ A;  3IX4 A;  4IVI A;  3MJQ A;  4B4X A;  2PAV P;  1UGU A;  3MFD A;  3OCL A;  4I3J A;  4L9E A;  4CLC A;  3FPW A;  2Y55 A;  4N92 A;  3VOZ A;  5A90 A;  3LY4 A;  3JPU A;  4PM5 A;  3GQZ A;  3FWL A;  2ZQ7 A;  4K08 A;  5L8M A;  5AQ9 A;  3UMD A;  1CEG A;  3ZVT A;  2HGV A;  1OTA A;  4MLL A;  4X25 A;  3BFD A;  4O01 A;  5EVI C;  1MWU A;  4K0W A;  5IT5 A;  2MJ6 A;  4QY5 A;  5U47 A;  5M18 A;  2QPN A;  3ZDJ A;  2EXB A;  4R23 A;  5EOE A;  2Z6C A;  4DXB A;  4OQI A;  1ZG6 A;  1K54 C;  4G3V A;  1JWZ A;  3GRJ A;  2H10 A;  1MXO A;  4XT2 A;  5TFQ A;  4YIN A;  3O3V A;  5JYP A;  4JXV A;  3ZNY A;  3HCY A;  3V3R A;  1I5Q A;  1DJB A;  4KUK A;  3PYP A;  2XA7 S;  1CEF A;  5LBR A;  3EEA A;  4XUZ A;  4HP4 A;  4GN2 A;  3H7W A;  3G30 A;  2W3H A;  3P09 A;  4ZRR A;  3UO9 A;  1W7F A;  3PXP A;  4NKP A;  1HTZ A;  3N8R A;  3KO6 A;  1L0F A;  4X1M A;  2PR5 A;  4BBT A;  3T4K A;  3WS2 A;  5FEF A;  1IEM A;  2XGN A;  1VET B;  3WS1 A;  1UWN X;  4OQ0 A;  4L9G A;  3VP1 A;  3C7V A;  5EFW A;  4HJ4 A;  3S7P A;  2ZC4 B;  3DWZ A;  4YNR A;  3NOP C;  5EM0 A;  3HLB A;  4EQ1 A;  1S6R A;  3PBR A;  4HES A;  2A24 A;  1AWI A;  3S4X A;  4GS9 B;  4FUW A;  3QP5 A;  3P98 A;  5FAO A;  5D3O A;  2E8J A;  4KZ5 A;  2IWB A;  4K0X A;  4FTX A;  3IS2 B;  4DN0 A;  4LV3 A;  1VHM A;  5HSQ A;  4C6Y A;  3CZD A;  4YOF A;  1LSV A;  1BYW A;  2VEA A;  4LRY C;  2WGW B;  1L2S A;  4GB7 A;  5FEG A;  3CG5 A;  3A0V A;  4CPK A;  1QME A;  1LL8 A;  4NXG A;  3N8L A;  3VMA A;  2J3W A;  2P08 A;  2OOL A;  2V0U A;  3DTI A;  2W0N A;  4EUZ A;  2CC1 A;  2HDU A;  1PRQ A;  5DTT A;  2AVX A;  2OWJ A;  2V8F A;  4X56 A;  1OJ5 A;  2ZD8 A;  3UE3 A;  1N4O A;  4Y17 A;  2HV1 A;  3VE4 A;  2Y91 A;  5G4Z A;  1TD5 A;  1CJF A;  2B18 A;  1XJ3 A;  4FH4 A;  4RX2 A;  2P7J A;  4GHI B;  4WF0 A;  4UA7 A;  3UB7 A;  1IYO A;  4KG5 A;  2QJ5 A;  4LCM A;  3T12 B;  3FKV A;  4QWO A;  5IU1 A;  4KZ8 A;  4X68 A;  4OOM A;  3W8K A;  5FI6 A;  2QJ7 A;  3F1P A;  3BRM A;  1XP4 A;  4ME4 A;  4ZJ3 A;  4H8R A;  2GJ3 A;  4R0Q A;  3DTE A;  3NDE A;  1C3B A;  1BLH A;  3OZH A;  2XDM A;  4HP9 A;  3DBA A;  3VFH A;  1OTE A;  4OOL A;  3ISG A;  2ZQD A;  5HAP A;  4KZ4 A;  4KG2 A;  1ERM A;  1VET A;  2CMN A;  2OAQ 1;  4HY8 A;  3HVF A;  3S22 A;  2WGV A;  2VK3 A;  4NXE A;  2VGJ A;  4JXS A;  1XJ4 A;  5EM1 A;  3CPT B;  5F6A A;  2Y2N A;  5A91 A;  3DTM A;  1KE3 A;  2ZM0 A;  4GS9 A;  3JYI A;  4E3I A;  5F1G A;  1P0Z A;  2R78 A;  2B5R A;  4MNR A;  5DFY A;  2FZ0 A;  2OLV A;  1S1Z A;  1PWD A;  3VP0 A;  4U3T A;  4UA6 A;  1K25 A;  2Z6D A;  1ALQ A;  1NXY A;  1CI8 A;  4MN6 A;  3HJI A;  2DMW A;  2Y79 A;  2PHY A;  2WGW A;  4PM8 A;  3HLC A;  4EQI A;  1J3W A;  4O8G A;  3N6I A;  3B42 A;  4Y5F A;  2DCF A;  4FH2 A;  2V9A A;  4H6J B;  5HPI A;  2FFF B;  2HJE A;  2WAF A;  5AVF A;  3PBS A;  5GHZ A;  4HH3 A;  5A8B A;  1TDG A;  2XA7 M;  3C8C A;  5FA7 A;  2KOI A;  2A49 A;  1DY6 A;  1FCM A;  1YLZ A;  4DE3 A;  1XPB A;  4GD6 A;  4I5S A;  2PU2 A;  1BZA A;  1LSX A;  5HWT A;  2XD1 A;  2D01 A;  2O9A A;  2LB9 A;  3MQ0 A;  3E4O A;  3IWQ A;  1NYY A;  4HH2 A;  2XF3 A;  5GHX A;  3QP6 A;  4GHI A;  3FKW A;  4WYY A;  5FDS A;  4ETX A;  2JBF A;  4DE1 A;  3T1X A;  3B3X A;  3D9Y A;  5HPF A;  1FOF A;  3OBF A;  2J9P A;  4Y0O A;  3LIC A;  3KYQ A;  2ZC7 A;  5E2F A;  4E6W A;  2I9V A;  3PBO A;  4OPR A;  5J7E A;  2J7V A;  3G35 A;  3W4O A;  1L0D A;  1SKF A;  5F83 A;  3BEC A;  5M19 A;  3HL9 A;  3BQA A;  2EFU A;  3ITA A;  4UQI S;  1CK3 A;  4P85 A;  4WZ4 A;  2V0W A;  5F82 A;  4RVA A;  3LY3 A;  4L9F A;  1TS8 A;  2PT7 A;  1TEM A;  2G7U A;  2XD5 A;  4MEZ A;  1HD8 A;  1IEL A;  4Y15 A;  3RXX A;  2L4R A;  4DMZ A;  1U60 A;  2Z2M B;  1SKO A;  2EX2 A;  4N9L A;  3NOT C;  2VA0 A;  2WKP A;  2QHK A;  3BQ8 A;  5HWW A;  4DJ3 A;  3OCN A;  3HUN A;  4QD4 A;  2O0Y A;  2ZM2 A;  3AGD A;  4U0X A;  2ZC5 B;  3A0R A;  2PU4 A;  2XR0 A;  1ONH A;  4HJ6 A;  4DXC A;  4Z1W A;  4BLM A;  1Z09 A;  3E2L A;  2JC7 A;  2JCH A;  1H5X A;  4E3M A;  3L9K A;  3FYZ A;  3S7O A;  2HDQ A;  3T4J A;  1PW8 A;  1MWR A;  3SH7 A;  2KLI A;  3BEB A;  5EV0 A;  4HBU A;  3R4K A;  2JKT M;  4G3W A;  1F98 A;  1I2W A;  4NG2 A;  1MWS A;  4CLC E;  3N8S A;  1XX2 A;  3SS3 A;  2HPB A;  1AXB A;  4JLF A;  4ZJ2 A;  1SDE A;  3EEH A;  3G31 A;  3QP1 A;  3T50 A;  4LFU A;  4H6J A;  1K4E A;  1MC0 A;  4NET A;  2J8Y A;  3D3O A;  4E3N A;  3CI6 A;  1HLU P;  2HF6 A;  3N4I A;  5K5B A;  2H0Y A;  3ZNT A;  1FR6 A;  1BLS A;  1N9L A;  3FC7 A;  3IXG A;  4JXW A;  3CLO A;  4UA9 A;  5FSR A;  4N1H A;  5HL6 A;  4FCF A;  1BLC A;  5AQ7 A;  3TJZ C;  3BY8 A;  1OTB A;  2I72 A;  1Y54 A;  4D2O A;  2B95 A;  3E0Y A;  4X53 A;  4BEN A;  4QHC A;  1L3L A;  4E3L A;  1S1Y A;  3G2Z A;  3ZQ5 A;  2QZ6 A;  1FQG A;  1NZU A;  4C3Q A;  2YKF A;  1H3Q A;  2ZOH A;  3EQV A;  1LLB A;  5DF8 A;  4JGR A;  4EWF A;  1FCO A;  3LUQ A;  3MFX A;  1NWZ A;  3H7W B;  2ZQC A;  2Y2J A;  3Q1F A;  4HIA A;  4JGQ A;  5FAQ A;  3MZD A;  1YLP A;  5HDD A;  4MDZ A;  2V1B A;  4E3J A;  1TDL A;  2WYX A;  4X55 A;  1V9Z A;  1E3U A;  4BBV A;  1PFL A;  1QMF A;  2IWC A;  3P01 A;  5CHM A;  3HUM A;  3S1Y A;  3VP3 A;  4ZJ1 A;  1ODV A;  3ZGA B;  3G32 A;  5FI7 A;  3UB5 P;  4II7 A;  2W1R A;  5EOO A;  4P87 A;  3PTE A;  4WL9 A;  1FCN A;  3LR0 A;  2Q9N A;  4WZ5 C;  1PYY A;  3W2Z A;  3MR0 A;  3T4L A;  4PKY A;  1MKM A;  2Y2M A;  3T4T A;  3AGF A;  1ZHH B;  5J3W A;  1GHM A;  1FIL A;  1YT4 A;  2Y2H A;  2OAP 1;  1I2S A;  3SH9 A;  3U2A A;  1FIK A;  1XGI A;  1PI5 A;  3NIA A;  2OSU A;  5EVI B;  1YLY A;  4BD0 A;  1IYS A;  4OPY A;  1M6K A;  4ZAM A;  4BL3 A;  5F69 A;  3UPP A;  4XXR A;  4JPM A;  3ZG7 B;  3ZG5 A;  1W5D A;  4UQI M;  5GHY A;  5TR7 A;  4LRZ E;  2PD8 A;  3V39 A;  2X01 A;  3PBT A;  2XEP A;  3C7U A;  4YFM A;  4WBG A;  1K6R A;  4S2J A;  3T1Q B;  4GJ4 A;  4OPZ A;  1NZO A;  5FI2 A;  5I5L A;  2ZQ9 A;  4M3K A;  3C30 A;  2XRO A;  3F1P B;  3ZFZ A;  4A5R A;  4U0T A;  2WAE A;  3RXW A;  1T18 A;  2Y2Q A;  5KZH A;  5AQA A;  1A0K A;  3E98 A;  3UE6 A;  4JF6 A;  1NLZ A;  1T1C A;  2X02 A;  3G4P A;  3FV7 A;  1OTI A;  1YSP A;  3LR4 A;  2ZQ8 A;  4R1G A;  4HJ3 A;  1NRJ A;  4S2I A;  5DVA A;  3GTC A;  3LR5 A;  1H8Y A;  3C38 A;  3WRT A;  3BY9 A;  2B02 A;  4WZ5 A;  3LIF A;  1JVJ A;  5TBM B;  2WZX A;  5FQK A;  4OKP A;  4ETZ A;  3IH9 A;  3DTK A;  4ZDX A;  4GZB A;  1SDN A;  5L2F A;  5L10 A;  1P9W A;  2Y2O A;  3UY6 A;  4DKI A;  3ZG9 B;  4NK3 A;  5E43 A;  5CHU A;  3RH8 B;  1ESU A;  3T4Q A;  3IXD A;  1L0G A;  1JNU A;  3A3I A;  3DAV A;  1PZP A;  1OME A;  4WMC D;  4QPR A;  5J4E A;  1GA0 A;  1YQS A;  4JXG A;  3VOY A;  5E2E A;  1LI9 A;  4LV0 A;  2PBD P;  5EVI A;  2A2L A;  5DF7 A;  3BLS A;  3LI9 A;  2PYR A;  3Q81 A;  1PWC A;  3TSG A;  3MMH A;  1G68 A;  4RQ9 A;  4DE2 A;  1WA9 A;  4KZB A;  2VX8 A;  5J8X A;  2V8C A;  4Q0J A;  4PAU A;  1ZG4 A;  3CUE C;  1K54 A;  3UNW A;  5IS1 A;  1E4D A;  1T1B A;  3M6B A;  1S67 L;  4GKU A;  1OT9 A;  2XQZ A;  4PM6 A;  4Y7P A;  4E3O A;  1KVL A;  3NHQ A;  4MN5 A;  2D02 A;  4GOG A;  3GVB A;  4IHQ A;  4JGP A;  3RJU A;  3O87 A;  5FDH A;  3M2J A;  3SOI A;  1BUE A;  1KE0 A;  2PYP A;  3UME A;  4E3K A;  5HWV A;  5CGS A;  1YKD A;  3BW6 A;  1MBL A;  4QU3 A;  1K6S A;  5CGW A;  1M40 A;  3Q07 A;  2W3G A;  2C6W B;  4EUV A;  1LT0 A;  3CMZ A;  4RX3 A;  1O7E A;  3EOI A;  5CER A;  5CGX A;  3OOV A;  3HJK A;  2BAS A;  4LV2 A;  4EU0 A;  2ZL1 B;  2W1T B;  1ACF A;  1ERO A;  1KGG A;  1TS6 A;  5HAQ A;  2EA9 A;  3OPR A;  1ES3 A;  1V9Y A;  4I39 A;  1Q2P A;  3NJA A;  1SKO B;  5TBM A;  5EE8 A;  4WEL A;  3IHA A;  3T1R A;  4KQR A;  1YLT A;  3ICY A;  2XK1 A;  1DP6 A;  5FQ9 A;  1CQA A;  5HD5 A;  2EFX A;  2VZW A;  3ZG8 B;  1ZKJ A;  3PAE A;  1W79 A;  1XJ6 A;  2M7V A;  3OPH A;  5HL1 A;  1H0M A;  1BUL A;  2O9B A;  3IQA A;  1PI4 A;  3NI9 A;  1IKI A;  2XFT A;  1TS0 A;  3ZVW A;  4S2N C;  2EX8 A;  3BJN A;  5CTM A;  1S4R A;  2V2F F;  1JTG A;  4MBK A;  1W8Y A;  4F3L B;  4BJP A;  1XA7 A;  5DF9 A;  2JKF A;  2ZMA A;  1GHI A;  1DJC A;  2J9O A;  4MMN A;  3KSG A;  1VB6 A;  2EX6 A;  1YLJ A;  1X0O A;  4GLQ A;  4CJN A;  1DJA A;  3B33 A;  2WGI A;  4B4Z A;  4KQQ A;  1GSX A;  3H82 B;  1N9O A;  3GV9 A;  4X6T A;  4JGO A;  1BT5 A;  1NJ4 A;  4WMC A;  3UB6 A;  2WZZ A;  4EEP A;  2VJW A;  3IHB A;  1YAX A;  2HDS A;  2K7S A;  4DRT A;  3C2W A;  2WKH A;  2BG1 A;  1GCE A;  3JVU A;  2LB5 A;  2JN7 A;  3HRE A;  4BWI A;  2ZL1 A;  5HFO A;  3S7N A;  2W1T A;  4LV1 A;  1SZV A;  5DFX A;  3IT9 A;  2ZM8 A;  1PIO A;  2WKI A;  5GLC A;  4BL2 A;  1IYP A;  4HHD A;  3W4Q A;  2ZOI A;  3RFB A;  3NUL A;  2OWH A;  5DTK A;  4UHU A;  2KX6 A;  1GSW A;  3QP8 A;  4C75 A;  4WN5 A;  2PR6 A;  3V67 A;  4I3A A;  4O0P A;  3LFV A;  2O9C A;  3NDG A;  1LL9 A;  2FFY A;  5A92 A;  2EWV A;  3GR2 A;  5HX9 A;  5FQI A;  4GNU A;  4ARZ B;  4FD8 A;  2K31 A;  4S2N A;  3D4F A;  5DJT A;  4LLO B;  3IXH A;  2C5W B;  1FR1 A;  1OTD A;  2XFS A;  4EXO A;  1O07 A;  3IF6 C;  3UPN A;  5TJJ A;  4HBT A;  1DRM A;  3OLO A;  2WAD A;  1S66 L;  2Y2I A;  3C4P A;  2DNS A;  3FPV A;  3QP4 A;  1D7E A;  1KVM A;  1GA9 A;  4EBP A;  1NRF A;  4LPZ A;  3VOL A;  3UPO A;  3SS5 A;  4F3L A;  4IVK A;  3QHY A;  4Y0U A;  3CHW P;  3WS0 A;  1LL5 A;  3QNB A;  2HP5 A;  5MC7 A;  2L0W A;  3PHY A;  2VGL S;  4IBX A;  2L1M A;  2V1A A;  2XLN A;  5KSH A;  1MZU A;  5EUA A;  3A3E A;  3KYZ A;  2RCX A;  4MCW A;  4S2M A;  1WYC A;  3W4P A;  4R6L A;  4EV4 A;  3H82 A;  4WUJ A;  2VLG A;  4MN7 A;  3LEQ A;  4UEY A;  3TG9 A;  3ZYT A;  3PBQ A;  5FL3 A;  3OPL A;  2P74 A;  1TVF A;  2JKR I;  5HDC A;  1SHV A;  3BLM A;  2Y4A A;  2QYB A;  3ZCZ A;  1T19 A;  4OON A;  3LCE A;  3MKF A;  5CTN A;  2PDR A;  2Y2P A;  1GHP A;  4P0M A;  2VV8 A;  3UE1 A;  4WM9 A;  3LEZ A;  5GLA A;  2JKG A;  2VV6 A;  1NY0 A;  3Q82 A;  4Y13 A;  3GDI A;  4Y3I A;  3QNC A;  4HEF A;  4NEE D;  3QP2 A;  2H28 A;  4OVD A;  1DP9 A;  3LIB A;  1PNE A;  1WE4 A;  5L07 A;  1G28 A;  3M2K A;  3E2K A;  4Q8I A;  3N7W A;  1OT6 A;  4HOI A;  4ARZ A;  1G6A A;  3C5A A;  3MKE A;  3BFG A;  4EBN A;  3I7J A;  5FAS A;  1HZO A;  3LR3 A;  3PR6 A;  4Q0H A;  2PRF A;  4MBF A;  2ZC6 B;  5E2H A;  3MXQ A;  1GSV A;  4MBH A;  3S7Q A;  1ONG A;  1K0K A;  1BTL A;  1KDS A;  1D1J A;  4R70 A;  4IED A;  1YM1 A;  3O88 A;  4R4R A;  4IBR A;  2M7U A;  2H5S A;  2V1Z A;  3LGO A;  5HAI A;  3T4O A;  4PMA A;  3OC2 A;  4BQM A;  4KG6 A;  1ES2 A;  5EVE A;  4OLD A;  3K2N A;  3ITB A;  3T1S A;  2W3E A;  3EQU A;  5AJG A;  4EW7 A;  1K55 C;  4HNB A;  3ZG0 A;  4F94 A;  1G6O A;  2ZMV A;  1XA1 A;  2VGK A;  3UN7 A;  4BMW A;  4JF4 A;  3G6O A;  3IBR A;  2JHE A;  5I94 A;  1TF1 A;  5HAR A;  3ZHH A;  1DP8 A;  2EXA A;  5HW3 A;  3GEC A;  5F5Y A;  5DTS A;  1BLP A;  1JWV A;  1D06 A;  4JF5 A;  2ZJ9 A;  4JBF A;  4KZ9 A;  4CQH A;  2R9W A;  3E4P A;  4EBL A;  4R3B A;  3UB9 A;  4EER A;  2JKT I;  3Q7V B;  2P04 A;  1RGY A;  3IBJ A;  3BFF A;  4S2P A;  3VSK A;  3NBL A;  5L09 A;  3VE3 A;  4RYE A;  4GW9 A;  1LHY A;  1IYQ A;  5A93 A;  2WUQ A;  2R9X A;  3BYD A;  4IUH A;  1KE4 A;  4WLA A;  4DDS A;  4ZBE A;  3IXB A;  2PBY A;  3HBR A;  4PM7 A;  5GL9 A;  2ZC3 B;  4G3K A;  1YSQ A;  1YMX A;  3HLG A; 
#chains in the Genus database with same CATH homology
 3UDF A;  5GLD A;  1RP5 A;  2XK1 A;  5FQ9 A;  5FQJ A;  2XR0 A;  3MZF A;  2EFX A;  5CED A;  2Y2K A;  1ONH A;  3SH8 A;  3V50 A;  5EEC A;  3ZG8 B;  1ZKJ A;  4DXC A;  2HDR A;  3VFF A;  3PAE A;  2XH9 A;  3VP4 A;  3O86 A;  1W79 A;  4KQO A;  4BLM A;  4K91 A;  2UWX A;  5BOH A;  3E2L A;  2G2W A;  2JC7 A;  4KZA A;  2JCH A;  1H5X A;  4E3M A;  1IKG A;  3OPH A;  4GDB A;  5HL1 A;  1BUL A;  1K38 A;  3FYZ A;  3IQA A;  1YMS A;  4IVI A;  1PI4 A;  2HDQ A;  3NI9 A;  5CXW A;  4B4X A;  1IKI A;  1PW8 A;  3LO7 A;  2XFT A;  1MWR A;  3SH7 A;  3MFD A;  3OCL A;  3BEB A;  3PBN A;  4WEK A;  3ZVW A;  4S2N C;  4HBU A;  3A3D A;  2EX8 A;  5CTM A;  1I2W A;  2V2F F;  4E6X A;  1MWS A;  2Y55 A;  4N92 A;  3A3F A;  3VOZ A;  1JTG A;  4MBK A;  5A90 A;  3N8S A;  1XX2 A;  3SS3 A;  1K55 A;  1AXB A;  2HPB A;  3LY4 A;  1SDE A;  4JLF A;  2OLU A;  4ZJ2 A;  1W8Y A;  4PM5 A;  3G31 A;  3GQZ A;  5AQB A;  3FWL A;  4BJP A;  2ZQ7 A;  5AQ9 A;  1K4E A;  1XA7 A;  3DWK A;  4NET A;  5DF9 A;  2J8Y A;  2ZMA A;  1CEG A;  1GHI A;  1K57 C;  3IH8 A;  1WYB A;  3NC8 A;  1DJC A;  2J9O A;  4E3N A;  2G2U A;  3AGE A;  3ZVT A;  4ZTK A;  3N4I A;  4MLL A;  1MY8 A;  3BFD A;  2H0Y A;  5M1A A;  3ZNT A;  4N1X A;  5EVI C;  1MWU A;  1FR6 A;  1BLS A;  4K0W A;  2EX6 A;  3IXG A;  4JXW A;  4QY5 A;  4OP5 A;  5U47 A;  4UA9 A;  5FSR A;  1YLJ A;  4N1H A;  4S2L A;  5M18 A;  4FCF A;  2QPN A;  1BLC A;  3ZDJ A;  4Y0T A;  2EXB A;  1KDW A;  5AQ7 A;  4CJN A;  1DJA A;  2WKE A;  4R23 A;  5EOE A;  2EX9 A;  2I72 A;  2P9V B;  4DXB A;  2WGI A;  4OQI A;  4B4Z A;  3BFE A;  1ZG6 A;  4KQQ A;  1Y54 A;  1K54 C;  4D2O A;  1JWZ A;  2IWD A;  3GRJ A;  2H10 A;  5CEB A;  2RL3 A;  3MXS A;  1MXO A;  4X53 A;  4BEN A;  3GV9 A;  4QHC A;  4X6T A;  4E3L A;  1RGZ A;  5TFQ A;  3G2Z A;  4OQG A;  4YIN A;  1BT5 A;  1NJ4 A;  4WMC A;  3O3V A;  5FAP A;  1JTD A;  2QZ6 A;  1FQG A;  5JYP A;  4JXV A;  3ZNY A;  1NZU A;  2WZZ A;  5JYO A;  4C3Q A;  4OH0 A;  3V3R A;  1I5Q A;  3IHB A;  3GSG A;  2HDS A;  4DRT A;  3WRZ A;  3EQV A;  3Q7V A;  1LLB A;  5DF8 A;  2WKH A;  1DJB A;  1PW1 A;  4EWF A;  1FCO A;  2BG1 A;  1GCE A;  2ZQC A;  3UDX A;  2Y2J A;  1CEF A;  4XUZ A;  3HRE A;  4KZ7 A;  3WS4 A;  3Q1F A;  4GN2 A;  3G30 A;  3VP2 A;  3P09 A;  3IF5 A;  5HFO A;  3UO9 A;  3NCK A;  1W7F A;  5FAQ A;  3MZD A;  1YLP A;  4LV1 A;  1XGJ A;  2ZLY A;  3IT9 A;  1PZO A;  2ZM8 A;  1HTZ A;  1PIO A;  4E3J A;  3N8R A;  2WKI A;  1L0F A;  1TDL A;  3BM6 A;  2WYX A;  4X55 A;  5GLC A;  4BL2 A;  1IYP A;  3WS2 A;  1E3U A;  1IEM A;  1QMF A;  2IWC A;  2XGN A;  5CHM A;  5FAT A;  3W4Q A;  3WS1 A;  3HUM A;  3S1Y A;  4OQ0 A;  3VP3 A;  3VP1 A;  3C7V A;  2GDN A;  4ZJ1 A;  3TOI A;  3ZGA B;  2BLS A;  2ZC4 B;  1Z6F A;  3G32 A;  2QMI A;  3DWZ A;  4PM9 A;  5DTK A;  4UHU A;  5FI7 A;  4C75 A;  3HLB A;  5EPH A;  1S6R A;  3PBR A;  4HES A;  5EOO A;  3S4X A;  2Y2L A;  3NDG A;  4P87 A;  1LL9 A;  3DW0 A;  3PTE A;  2FFY A;  5A92 A;  1FCN A;  2X71 A;  2Q9N A;  4WZ5 C;  1PYY A;  3GR2 A;  5HX9 A;  5FQI A;  3P98 A;  2E8I A;  4GNU A;  4FD8 A;  4L0L A;  4S2N A;  3D4F A;  5FAO A;  4OLG A;  5D3O A;  2Y2M A;  4KZ5 A;  2IWB A;  2A3U A;  3AGF A;  3IXH A;  2C5W B;  1FR1 A;  4K0X A;  4P6B A;  3UE0 A;  4LV3 A;  2XFS A;  1O07 A;  3IF6 C;  3UPN A;  1JWP A;  1K56 D;  4HBT A;  1ES4 A;  1GHM A;  1RCJ A;  3CZD A;  2WAD A;  1YT4 A;  2Y2H A;  2Y2I A;  3C4P A;  4C6Y A;  1I2S A;  2DNS A;  3SH9 A;  1MPL A;  1KVM A;  1K57 A;  1GA9 A;  4EBP A;  1NRF A;  1XGI A;  1PI5 A;  3NIA A;  2OSU A;  2WGW B;  1L2S A;  5EVI B;  3HLE A;  1YLY A;  4BD0 A;  4GB7 A;  1IYS A;  2Z2L B;  3CG5 A;  4OPY A;  1M6K A;  3SS5 A;  3UPO A;  4CPK A;  1QME A;  4IVK A;  3N8L A;  4LCL A;  3VMA A;  3QHY A;  4Y0U A;  3WS0 A;  5TGF A;  3VSL A;  1LL5 A;  3QNB A;  4EUZ A;  2CC1 A;  3Q7Z A;  4ZAM A;  3MBZ A;  2HDU A;  2HP5 A;  3IWO A;  4BL3 A;  5DTT A;  4X56 A;  3UPP A;  2ZD8 A;  1FSW A;  3UE3 A;  4XXR A;  4JPM A;  1E3U D;  4IBX A;  3MXR A;  4FSF A;  3ZG7 B;  3ZG5 A;  1N4O A;  1W5D A;  4JKT A;  5GHY A;  2XLN A;  5TR7 A;  5KSH A;  3V39 A;  1Q2Q A;  5EUA A;  3C4O A;  2Y91 A;  4UAA A;  3PBT A;  2X01 A;  2XEP A;  3A3E A;  3C7U A;  4ID4 A;  4YFM A;  4WBG A;  2RCX A;  2P9V A;  4S2K A;  1N9B A;  4S2O A;  5GLB A;  1K6R A;  4S2J A;  4QB8 A;  4S2M A;  4FH4 A;  1WYC A;  3CJM A;  1FSY A;  4RX2 A;  3W4P A;  4EV4 A;  4OPZ A;  1NZO A;  5FI2 A;  3GMW A;  4UA7 A;  2ZQ9 A;  4M3K A;  3UDI A;  3TG9 A;  1IYO A;  3PBQ A;  4KG5 A;  4LCM A;  3FKV A;  3OPL A;  2P74 A;  1ES5 A;  4KZ8 A;  4X68 A;  1TVF A;  4OOM A;  3ZFZ A;  3W8K A;  4GDN A;  5FI6 A;  4A5R A;  4U0T A;  2WAE A;  3RXW A;  3BRM A;  2Y2Q A;  1XP4 A;  1SHV A;  3BLM A;  2Y4A A;  5KZH A;  5AQA A;  3ZCZ A;  4OON A;  3LCE A;  3MKF A;  5CTN A;  1KGE A;  4ZJ3 A;  4H8R A;  2Y2P A;  4XUX A;  1LI0 A;  1W8Q A;  4JF6 A;  1GHP A;  4R0Q A;  2X02 A;  3G4P A;  3NDE A;  4KEN B;  1C3B A;  3FV7 A;  4OP8 A;  4P0M A;  3UE1 A;  4DE0 A;  4WM9 A;  3LEZ A;  1EWZ A;  1L0E A;  3HUO A;  5GLA A;  1BLH A;  3OZH A;  2XDM A;  1CI9 A;  2ZQ8 A;  3VFH A;  4OOL A;  4R1G A;  1NY0 A;  3ISG A;  2HP6 A;  3Q82 A;  4S2I A;  2ZQD A;  5CHJ A;  5HAP A;  4KZ4 A;  4KG2 A;  1ERM A;  5DVA A;  3GTC A;  5CRF A;  1H8Y A;  4KZ3 A;  3WRT A;  4WEJ A;  3HVF A;  3S22 A;  2WGV A;  4WZ5 A;  3QNC A;  4HEF A;  1JVJ A;  2WZX A;  5FQK A;  2VGJ A;  1NYM A;  4JXS A;  4OKP A;  5KMW A;  3IH9 A;  4OVD A;  5A91 A;  2Y2N A;  1PWG A;  4ZDX A;  1WE4 A;  3DTM A;  3IF6 B;  4GZB A;  1ERQ A;  1KE3 A;  4R3J A;  5FQQ A;  2ZM0 A;  1MKI A;  3OPP A;  3JYI A;  1SDN A;  5L2F A;  3M2K A;  3E2K A;  2Y2O A;  3N7W A;  3UY6 A;  4E3I A;  5FQM A;  5F1G A;  4Q8I A;  4DKI A;  3ZG9 B;  1K4F A;  2B5R A;  4NK3 A;  5E43 A;  4MNR A;  5CHU A;  1G6A A;  3WWX A;  2OLV A;  3C5A A;  3MKE A;  1ESU A;  3BFG A;  3IXD A;  1L0G A;  4EBN A;  1PWD A;  5EVL A;  3I7J A;  5FAS A;  3VP0 A;  3A3I A;  4U3T A;  3A3J A;  1PZP A;  1OME A;  4UA6 A;  1K25 A;  4WMC D;  1SCW A;  1HZO A;  1ALQ A;  1KGF A;  1GA0 A;  3FZC A;  1NXY A;  4RA7 A;  1VM1 A;  1CI8 A;  4MBF A;  5CEC A;  2ZC6 B;  5E2H A;  1YQS A;  4JXG A;  3VOY A;  4R4S A;  5E2E A;  4MBH A;  1LI9 A;  4N9K A;  1S0W A;  1ONG A;  4LV0 A;  1J9M A;  1XXM A;  1BTL A;  1KDS A;  2WGW A;  4GD8 A;  5EVI A;  5DF7 A;  3BLS A;  1YM1 A;  4IED A;  4PM8 A;  3O88 A;  3HLC A;  4EQI A;  4R4R A;  3Q81 A;  1PWC A;  4IBR A;  3TSG A;  3N6I A;  1G68 A;  2H5S A;  4DE2 A;  2DCF A;  4FH2 A;  1ESI A;  4KZB A;  2V1Z A;  5G18 A;  5HAI A;  5J8X A;  2JE5 A;  4KZ6 A;  4PMA A;  4B88 A;  3OC2 A;  4X69 A;  2DRW A;  2FFF B;  1ZG4 A;  2WAF A;  4Z9Q A;  4BQM A;  4DF6 A;  4KG6 A;  1ES2 A;  3PBS A;  4OLD A;  1K54 A;  3ITB A;  3UNW A;  3MZE A;  5GHZ A;  3NY4 A;  1TDG A;  1E4D A;  3EQU A;  4OQH A;  3M6B A;  3HLD A;  3M6H A;  1K55 C;  4OPQ A;  5FA7 A;  2A49 A;  3G34 A;  3ZG0 A;  4F94 A;  1DY6 A;  4GKU A;  2XQZ A;  1FCM A;  1YLZ A;  4PM6 A;  4Y7P A;  3WS5 A;  4DE3 A;  4E3O A;  1XA1 A;  1XPB A;  1E25 A;  1MWT A;  4GD6 A;  1KVL A;  3SS4 A;  2PU2 A;  1BZA A;  2VGK A;  2HP9 A;  3UN7 A;  2XD1 A;  4GOG A;  3GVB A;  4JF4 A;  3IWQ A;  1NYY A;  4O7D A;  2XF3 A;  3RJU A;  3O87 A;  5FDH A;  4QY6 A;  3PAG A;  5I94 A;  5HAR A;  5GHX A;  3M2J A;  3SOI A;  3ZHH A;  1BUE A;  3FKW A;  2Q9M A;  1KE0 A;  4WYY A;  2EXA A;  2JBF A;  5HW3 A;  4QJG A;  4E3K A;  4PPR A;  4DE1 A;  3B3X A;  5DTS A;  2OV5 A;  1BLP A;  1YLW A;  2V20 A;  1FOF A;  1JWV A;  3HLW A;  4JF5 A;  5CGS A;  1MBL A;  4QU3 A;  5KSC A;  1K6S A;  2J9P A;  2ZJ9 A;  5E2G A;  5CGW A;  1M40 A;  4JBF A;  4Y0O A;  4KZ9 A;  1K56 A;  2ZC7 A;  3Q07 A;  5E2F A;  2R9W A;  4E6W A;  3PBO A;  2C6W B;  4OPR A;  4EBL A;  3CMZ A;  4R3B A;  4RX3 A;  3BFC A;  3IWI A;  5IHV A;  2J7V A;  3G35 A;  1O7E A;  3Q7V B;  1RGY A;  3W4O A;  1L0D A;  1SKF A;  5F83 A;  3BEC A;  5CER A;  1H8Z A;  3HL9 A;  5M19 A;  5CGX A;  3BFF A;  4S2P A;  2EFU A;  3VSK A;  3NBL A;  4LV2 A;  3ITA A;  4OOY A;  4RYE A;  1CK3 A;  1LHY A;  1IYQ A;  4P85 A;  4WZ4 A;  5EVI D;  5F82 A;  3V5M A;  4RVA A;  1HVB A;  1VQQ A;  3LY3 A;  3V3S A;  1ERO A;  1KGG A;  1TEM A;  2XD5 A;  4MEZ A;  2WUQ A;  2WK0 A;  5A93 A;  1HD8 A;  5HAQ A;  1IEL A;  2Y2G A;  2R9X A;  1ES3 A;  3BYD A;  3OPR A;  1BSG A;  1Q2P A;  5F1F A;  3RXX A;  1KE4 A;  1U60 A;  2Z2M B;  4LEN A;  4BD1 A;  4ZBE A;  4DDS A;  1XKZ A;  1ZC2 A;  5EE8 A;  3IXB A;  2EX2 A;  4N9L A;  4WEL A;  2PBY A;  3IHA A;  3HBR A;  3IF6 A;  3OCN A;  4PM7 A;  3HUN A;  4QD4 A;  4KQR A;  5GL9 A;  2ZC3 B;  2ZM2 A;  2ZQA A;  1EI5 A;  3AGD A;  2ZC5 B;  4U0X A;  1YMX A;  1YLT A;  2H0T A;  2Y59 A;  3G2Y A;  4DDY A;  2PU4 A;  3HLF A;  3HLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...