5AVFA

The ligand binding domain of mlp37 with taurine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
244
structure length
244
Chain Sequence
GPLGSVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 77
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5avfA02
2QWSA 1LT0A 2B02A 3A0SA 1TS8A 4L9EA 4R6LA 4HQAA 4WF0A 1G28A 1P0ZA 4NXBA 2V0UA 1OTDA 2VV7A 4GS9A 3H82A 2OOLA 3UB6A 5EFWA 3BWLA 2D01A 4JGPA 4M4XA 3GDIA 3ULFA 4B9OA 2OWJA 4GHIB 1F98A 3FC7A 4JGOA 4PKYG 4EXOA 1JNUA 5G4ZA 2WKQA 4HP9A 2JN7A 3EEHA 1UWNX 2EA9A 2D02A 3RTYA 3E4QA 1LSXA 2V0WA 3IBRA 2V1AA 5F6AA 2YKFA 4EEUA 4MN6A 3CWFA 3EWKA 2YKHA 2INWA 2PR5A 4DJ2A 4HH2A 3ICYA 3UMEA 4LRZE 4WUJA 5DKKA 4HOIA 4YWZA 4KUOA 3A0RA 1S1ZA 1T1AA 1T1BA 4HI4A 1OJ5A 4R38A 3ZQ5A 2K7SA 3RH8B 1OTIA 4F3LB 4XT2A 1EW0A 2Z6CA 4EESA 4RQ9A 4MN5A 3F1OA 5I5LA 2JHEA 4HHDA 1DP9A 2A24B 3LIAA 5DJTA 2PDRA 3BY9A 5DJUA 5J4EA 3B33A 4F3LA 3LUQA 1OT9A 1LL8A 4LPZA 2PR6A 4WL9A 2BASA 2QHKA 4EERA 2L4RA 4EQ1A 4HJ4A 4BBUA 2M1CA 2A24A 4HJ6A 1GSVA 3NOTC 3IS2B 5J7EA 3C8CA 3VE4A 1T19A 1TS0A 4HP4A 3K3DA 3NJAA 5TBMB 2WKRA 1S4RA 2HV1A 5F68A 3HJKA 4DJ3A 2L0WA 3MQQA 3VOLA 2V1BA 1XJ2A 3IS2A 3FG8A 5HD3A 4GW9A 4WN5A 3PHYA 3H7WB 3LIBA 5AVFA 4E04A 3D72A 2W0NA 2ZOIA 3VE3A 4L9FA 4LLOB 4EETB 4HY8A 1S1YA 5HWVA 3LIEA 4GHIA 2ZOHA 4KQDA 3OLOA 2VV6A 5HSQA 1N9LA 3MR0A 3UB8A 4I5SA 3LICA 3H7WA 3C2WA 3UB7A 2V9AA 1XJ3A 5HD5A 1OTBA 4GCZA 1N9NA 4K08A 1ODVA 3BY8A 5F5YA 4L9GA 4I38A 5HDSA 4KUKA 2QJ5A 5HWTA 3P7NA 2L1MA 1KOUA 2VLGA 2PYRA 4I3AA 4LRYC 3CAXA 4I3JA 4NXGA 1GSWA 2WKPA 5IS1A 3NHQA 1S67L 4R3AA 3MJQA 3SW1A 1LSVA 5HDCA 2KX6A 1BYWA 1S66L 1D06A 4JGRA 4WLAA 3NOPC 2QJ7A 4HH3A 1OTAA 5KIZA 4EW7A 3LI9A 3MQOA 3LIFA 1XJ6A 3H82B 4I3IA 3H9WA 3G6OA 5AVEA 4NXEA 1VB6A 5DKLA 3MXQA 1NWZA 2PHYA 4R70A 2W27A 5J3WA 2ZBBA 3CLOA 3E4OA 1T1CA 2VEAA 1GSXA 3LI8A 3LYXA 5TBMA 3HJIA 4PKYA 4HJ3A 1MZUA 3UMDA 2KDKA 5IU1A 3KX0X 5HZHA 2CMNA 3E4PA 1XFNA 1F9IA 4BBTA 5HDDA 1UGUA 4LRXC 3F1PB 4HNBA 3PYPA 1DP8A 2P7JA 1OTEA 3NOUC 2VV8A 3A0VA 1T18A 1OJGA 3K3CA 1XJ4A 3F1PA 1Y28A 1TS7A 1V9YA 4XT2B 1WA9A 2J80A 2PD7A 3UE6A 2I9VA 4I39A 1XFQA 3F1OB 1V9ZA 4HIAA 3MFXA 2R78A 1OT6A 4JGQA 3LIDA 5HWWA 2GJ3A 2PYPA 4H6JB 1P97A 3F1NB 1TS6A 1DP6A 3UB9A 4NXFA 2H28A 3GECA 5F69A 5A8BA 2Z6DA 4EEPA 2PD8A 1S4SA 1DRMA 1N9OA 4BBVA 2OWHA 5G4YA 4H6JA 1D7EA 3F1NA 1UWPX 3T50A 2QKPA 4GS9B 1LSWA 1X0OA
chains in the Genus database with same CATH superfamily
2QWSA 3E98A 2B02A 3A0SA 3RXWA 3VP1A 3N8SA 4AFIA 4P6BA 4PM5A 1STZA 4M3KA 2E8IA 5HPFA 4CLCE 4Q0IA 1SDEA 3CI6A 5J8XA 1F5MA 4OP8A 1PYYA 3H82A 3T1XA 1DY6A 2J3TC 3ZFZA 2UWXA 3HLDA 5GHYA 4M4XA 4JGPA 4O8GA 3GDIA 4R4SA 4B9OA 3ZG7B 4E3KA 3MZDA 1TDLA 3MKEA 3G2ZA 3S22A 4X69A 3BQAA 3P01A 2GDNA 4JXGA 1JVJA 1BSGA 4MBFA 4MDZA 1NY0A 3G2YA 3E4QA 3NDEA 2JE5A 3IBRA 3VFFA 5FDSA 4NETA 1XA1A 5F6AA 2YKFA 3W4OA 3HLFA 4D60A 5AQ9A 3GV9A 2FFYA 4HH2A 5E2GA 1J9MA 1XGJA 1YAXA 5DKKA 4MN7A 4HOIA 4YWZA 3A0RA 1T1AA 1T1BA 2W3EA 3D3OA 5TJJA 4WMCD 2BG1A 1OJ5A 3PAEA 2A3UA 4OOYA 1MWSA 4MBHA 2Z6CA 4EESA 3F1OA 3WRTA 1NLYA 1K0KA 4CLCD 4HHDA 5HAPA 4R4RA 3BY9A 1ES4A 5DJUA 3B33A 3K2NA 2ZQAA 2P9VA 3LUQA 1OT9A 3IT9A 3IWIA 3QNCA 3HLEA 1ZG6A 3C38A 2HZ5A 2BASA 3CMZA 2L4RA 3ZGAB 2XDMA 1O07A 4BBUA 1GHIA 2A24A 3S7OA 4HJ6A 3QP6A 4P85A 3NOTC 1PI5A 5HX9A 3C8CA 1H8ZA 4DMZA 2JKRI 1T19A 4HP4A 4G3KA 4YINA 4C6YA 5HW3A 5TBMB 2Z2LB 2WKRA 4Y5FA 1XA7A 2XQZA 3JYIA 2G2WA 4JLFA 4PM9A 5F68A 2OV5A 3HLCA 3OC2A 3UPPA 3PBQA 1FCNA 4BL2A 1L0EA 5GL9A 5FI2A 2V1BA 3FG8A 5HD3A 4GW9A 4HBTA 3VOYA 1FSWA 4IJGA 4CQHA 2H5SA 1BLPA 4HY8A 3LR3A 4BENA 2H10A 2WGIA 4BD0A 4JXWA 5TFQA 5CEDA 4KQDA 4FTXA 4F94A 5A92A 3UB8A 4ZRRA 3C30A 2WK0A 4UA9A 2DMWA 1W8YA 4Q0HA 1Y4OA 2V9AA 4PM8A 4U3TA 1CI9A 3B3XA 4LV2A 1OTBA 1PI4A 1GA0A 1SHVA 5KMWA 1AWIA 1N9NA 4GJ4A 4RX3A 5CGSA 1BLCA 4K08A 1ODVA 5FEFA 5FAOA 5F5YA 1JTDA 4L9GA 4JPMA 4I38A 4ARZB 4KUKA 3IWQA 2OAP1 5EVIA 4ETZA 4OQ0A 2HDQA 1I5QA 3TW8A 4Y17A 4G3VA 5CGXA 3M2KA 1EI5A 4N9KA 5IS1A 4KG2A 2XROA 2XR0A 2PRFA 3B47A 5FSRA 4OP5A 4WELA 4ZDXA 1ESUA 2Y2OA 1LSVA 5HDCA 3GMWA 3HLGA 3NOPC 4N1HA 1IYOA 1I2SA 2XGNA 3T1QB 3ZHHA 2P74A 1VEUA 3IX8A 4G3WA 4RYEA 1IKGA 1L0FA 4HBUA 1XKZA 2IWDA 1VB6A 2H0TA 1NWZA 3NCKA 1SKOA 3Q7ZA 4XUZA 5J3WA 2P04A 1H0MA 1DJCA 2ZD8A 3CLOA 4KQRA 4JXSA 1T1CA 4KZ3A 1RGZA 2A2LA 5TBMA 4RA7A 4HJ3A 4ZBEA 1FR1A 3HLWA 5IU1A 4KENB 4QPRA 1LL9A 4GDNA 4JF5A 3DTKA 2EFXA 4ME4A 1XFNA 3N8RA 3SS5A 1F9IA 3PXPA 1YMXA 1ZC2A 1UGUA 2O9CA 4OLGA 3ZDJA 1FCOA 3EQUA 3PYPA 3TSGA 2P7JA 4NG2A 3O5YA 5JYPA 3CPTB 2BTFP 2VJWA 3IF6A 3K3CA 1Q2QA 4BLMA 4GLQA 1Y28A 3FKWA 3Q7VA 3IXBA 2I9VA 4I39A 1MPLA 4JGQA 3LIDA 5HWWA 4E6XA 4Z1WA 1IEMA 1PW1A 3ZG0A 1TS6A 1H5XA 3KYEA 2HDSA 2W3GA 2WGWB 3UDFA 2EX8A 2H28A 3DBAA 1IFQA 2ZLYA 2Z6DA 5A8BA 2OLUA 2PD8A 4FOFA 4IVKA 1NJ4A 4Y3IA 4Q8IA 2OWHA 3CJMA 3O88A 5D3OA 2B18A 4H6JA 1RCJA 3BFGA 2XK1A 3W8KA 3G30A 2QKPA 4GB7A 3BRMA 3SH9A 5FA7A 4JBFA 1LSWA 2XRNA 2Y59A 1LT0A 3UE1A 1JWVA 4R1GA 3R4KA 1W8QA 4WF0A 1G28A 2EXBA 4KZ8A 2V0UA 4P87A 3T4KA 5M1AA 1CEGA 1DJBA 2DCFA 4GS9A 2OOLA 2O9AA 3BWLA 2D01A 1E3UA 4Z9QA 3DWZA 4ETXA 3OZHA 1WYBA 4BMWA 1SCWA 4PKYG 4EXOA 4X55A 3KSHA 4OONA 1YLYA 2DNSA 3O87A 3EEHA 3ZVWA 1UWNX 3G31A 1GHMA 4IBRA 3RTYA 5EOOA 3ZVTA 4WYYA 4YFMA 3FV7A 1PWCA 3VFHA 4LCLA 2B5RA 4EBNA 2Y2QA 3SOIA 3BECA 4EEUA 5FQIA 3OPLA 2WADA 2YKHA 2PR5A 4DJ2A 3T1SA 2O99A 3IH9A 4XXRA 2Y2NA 2NUPC 5DF7A 2HF6A 1YSPA 3M2JA 2ZJ9A 1W63M 4B4XA 3HVFA 4R38A 3R7WA 4ZAMA 3ZNYA 1H3QA 3ZQ5A 2K7SA 3RH8B 2P9VB 4HESA 3WS5A 1EW0A 3S7NA 4BJPA 2EX6A 3LEZA 2HP6A 1ZKJA 2XA7S 5I5LA 5CRFA 2JHEA 1SDNA 1K4FA 1LHYA 5CTNA 3UPNA 2JKGA 2A24B 3A3IA 4OKPA 1ESIA 3EQVA 3GVBA 5J4EA 2ZL1A 5JYOA 4QB8A 1BLHA 3IQAA 2V2FF 1FILA 1OMEA 4F3LA 1K54C 1LL8A 3HREA 1MWRA 2EWVA 5DTSA 5GHXA 2LB9A 3OPHA 3IX3A 1K57C 3BEBA 3CITA 5AQAA 1VQQA 4OPYA 2PBDP 3S1YA 2XH9A 3Q82A 4K0WA 1YT4A 3L7HA 1TS0A 4A5RA 3PBNA 3MZFA 4QWOA 1AXBA 3NIAA 3SS3A 4LCMA 3NJAA 3G35A 1BT5A 2BLSA 2Z2MB 3BQ8A 2PT7A 4X1LA 3MQQA 3V3SA 1BTLA 3IS2A 4S2KA 3PHYA 3LIBA 3VE3A 4LLOB 2Y2GA 2Y4AA 4E3OA 1YM1A 2FH5A 3QP5A 3FKVA 4U0XA 3V50A 2XFTA 1MKIA 3W2ZA 4OPZA 5HSQA 4EWFA 4GNUA 1FOFA 3LICA 4YOFA 3H7WA 1QMFA 5EVLA 3UB7A 3SZTA 4ZJ1A 1XJ3A 3ZNTA 5HD5A 3L9KA 5EVIB 1JTGA 1K56A 1MWUA 4DN0A 2W3FA 1KGGA 3GRJA 2FFFB 4FSFA 3TRCA 3CHWP 5F1GA 4Y0OA 1CQAA 3P7NA 2L1MA 2M7UA 1KOUA 1FR6A 4I3AA 4MBKA 2LB5A 4LRYC 5TR7A 2CC1A 4ZJ2A 3N8LA 5DFYA 4NXGA 3CZDA 1XXMA 3UDXA 1VEUB 3M6HA 3QNBA 3MJQA 3WS1A 3SW1A 2Y2MA 4PMAA 3PTEA 2KX6A 1BYWA 1S66L 3T4OA 3DAVA 4EV4A 3MSHA 4WEKA 1K38A 1PW8A 1SKOB 3BYDA 4EU0A 3LI9A 4P6ZS 3UY6A 3FPVA 3LIFA 1BULA 1XJ6A 1N9BA 5DTKA 3BJNA 4E6WA 3SH8A 2PHYA 3G32A 2QZ6A 4LFUA 2ZMAA 3N7WA 1BLSA 2WUQA 4E3IA 1P9RA 3FPWA 4S2PA 2ZBBA 2W3HA 1HLUP 5BOHA 1CK3A 1MC0A 2EX9A 2PU2A 5EVID 1XP4A 3HJIA 1KDWA 3N4IA 3UMDA 2A49A 1KVLA 3BM6A 3U2AA 4CLCA 5HPIA 2XA7M 1YLWA 2HJEA 2E8JA 4BWIA 2PBYA 5KSHA 3IF6B 5MC7A 4IUKA 4LRXC 2JCHA 3Q7VB 4O7DA 1IYQA 3QP2A 1Z6FA 5A93A 1CJFA 3LY3A 1TVFA 5FAQA 5U47A 1FCMA 1VETA 3NOUC 3OCNA 4DRTA 1ERMA 1VHMA 5HL1A 2ZMFA 5KZHA 1YLJA 4IUHA 3C7UA 1OJGA 1XJ4A 4GZBA 5CTMA 3V67A 3ZG9B 2V8CA 1TS7A 3HUOA 1V9YA 3ZG8B 2J80A 1E4DA 2PD7A 5CHUA 3UE6A 4ID4A 1XFQA 1V9ZA 2P08A 4R3JA 2X02A 4OOLA 1MXOA 2W3DA 2R78A 4MCWA 1OT6A 3PBTA 4DE0A 2GJ3A 1PRQA 4KZBA 4H6JB 4PM6A 2Y2KA 4GOGA 5A90A 2R9XA 5I94A 2KOIA 2GZAA 3VP0A 4UEYA 3UB9A 2WKHA 4DKIA 1ALQA 2Q9NA 2JC7A 3GECA 3WS2A 1KE3A 5AQ7A 4EEPA 1L0DA 4QY5A 1N9OA 3EGXC 3KSFA 4EBPA 3F1NA 4OPQA 2VZWA 4XUXA 5EUAA 1LL5A 4OQIA 4DXBA 4DE3A 4QD4A 4GS9B 4WBGA 2O9BA 4H8RA 1X0OA 1YLPA 5L8MA 3VOZA 1TS8A 4UHUA 2JKTI 3P98A 2X71A 1KGEA 3RXXA 3WRZA 1P0ZA 3SS4A 3GR2A 3JVUA 5HFOA 1K25A 2G2UA 1H8YA 3UB6A 5EFWA 3HUMA 1TD5A 4CPKA 5EVIC 2B95A 3ULFA 1G6AA 2ZC7A 2HP5A 3QP4A 3FC7A 5TGFA 4JGOA 1DJAA 1ACFA 1JNUA 4KZ5A 4HP9A 2JN7A 4N1XA 4RX2A 1MWTA 2EA9A 1XPBA 3NC8A 3OPPA 3T4QA 1TEMA 5HAQA 2WAFA 2K31A 2J7VA 1TDGA 5AJGA 4ZJ3A 4NKPA 3UO9A 4JF6A 2IA2A 3WWXA 2W1RA 5L10A 4WZ4A 3R7WB 1M40A 3CWFA 3EWKA 3LR5A 5E2FA 2INWA 4UQIS 3ICYA 3UDIA 4P6ZM 4WUJA 3WS4A 3BFEA 4ESPA 1E25A 4OOMA 5CEBA 5CXWA 3IXGA 2ZL1B 1PZOA 3PR6A 1J3WA 4B4ZA 4OQGA 3T1RA 3MBZA 1E3UD 4F3LB 1RP5A 4ZTKA 3ZG5A 5EM1A 4UA7A 5GHZA 2HJ9C 3HUNA 5M18A 5CHMA 1DP9A 3LIAA 5DJTA 2PDRA 4KG5A 4S2NA 2J8YA 1CEFA 2QMIA 1HTZA 4C75A 5DF8A 2JKRM 5FL3A 2PR6A 3BW6A 3WS0A 4X25A 5DVAA 2JBFA 3IS2B 2M7VA 3D9YA 5J7EA 3IF6C 3VE4A 3LO7A 1MY8A 3K3DA 3KYQA 4PPRA 4P0MA 1S4RA 1NZUA 2HV1A 1NYYA 2ZC4B 1GCEA 1SKFA 3HJKA 4OVDA 4DJ3A 2HPBA 2UV0E 3CUEA 4Y7PA 1XJ2A 4KZ7A 4FD8A 1WE4A 3T4TA 3E2KA 1YQSA 3H7WB 5AVFA 4E04A 1K6SA 3NDGA 4EETB 2I72A 1EWZA 1IOUA 5HWVA 1L2SA 3EOIA 3LIEA 1ES5A 2EXAA 5CX7A 2VV6A 2Y79A 5F82A 1N9LA 2ZM0A 3MR0A 2J9OA 3OOVA 4S2NC 4OQHA 4E3JA 4I5SA 1K6RA 2Y55A 2ZMVA 4II7A 3RJUA 1ERQA 1M6KA 5L09A 3S7PA 5L07A 5E2HA 3VSLA 4S2JA 1LI0A 4GCZA 2VGLS 4DE1A 1PIOA 1G5UA 2RL3A 3IHAA 3C4PA 3ISGA 3LGOA 5HDSA 3UB5P 3ITBA 4GKUA 5HWTA 3MXSA 4KQOA 3SH7A 2Y2PA 4Y2FA 3VP2A 4KZAA 1KGFA 1O7EA 1GSWA 3OPRA 2WYXA 3MF0A 2WKPA 2HDUA 3NHQA 2PAVP 3JPUA 1S67L 1YLTA 4R3AA 5EV0A 3GTCA 1L3LA 1S0WA 2XD1A 4WLAA 3IXHA 4JF4A 4HH3A 1OTAA 3B42A 4EW7A 3C4OA 4KZ4A 3G4PA 3MQOA 4QJGA 1HD8A 2XLNA 5EOEA 1NRJA 3A3FA 4I3IA 3W4QA 1H8MA 5M19A 3G6OA 4BD1A 5AVEA 1K56D 4DXCA 5FDHA 1HVBA 4UQIM 3LFVA 1WYCA 3NBLA 1W63Q 2WKIA 3M6BA 4CLCB 5GLBA 2W27A 4QHCA 3ZYTA 1TF1A 3FYZA 4E3NA 4LV3A 3LR4A 3E4OA 2AVXA 2VEAA 1N4OA 2WAEA 1Q2PA 1YSQA 3LI8A 3LYXA 1KVMA 5GLCA 2K2NA 3V39A 4DDYA 1NZOA 1VETB 4LV0A 2VA0A 4X68A 3KX0X 5HZHA 2CMNA 3O86A 4IHQA 3OCLA 2ZQ7A 4BBTA 5HDDA 3KSGA 4S2OA 4FH4A 3GQZA 1BZAA 2J9PA 3E0YA 1BUEA 4PAUA 4OH0A 3HL9A 1DP8A 3PBOA 3U4LP 2ZM2A 3FZCA 4B88A 2Y2LA 2VV8A 5HARA 1T18A 3VP3A 4MMNA 4X53A 3F1PA 1LI9A 4XT2B 2H0YA 1WA9A 3IWOA 5L2FA 1YLZA 4PM7A 4HIAA 1ES3A 3MFXA 1MBLA 5FQJA 1VM1A 2PYPA 2ZC3B 3F1NB 5C5KA 1HZOA 1DP6A 1KE4A 4NXFA 5F69A 2W1TA 3V5MA 1YKDA 3N6IA 4CJNA 1YMSA 1DRMA 4BQMA 5HAIA 3AGEA 3P09A 1ES2A 4FCFA 1D7EA 2HDRA 3BLMA 3T50A 1RGYA 4LENA 2VKSA 2ZM8A 2R9WA 3MKFA 3MMHA 4FH2A 3NY4A 3EGDC 3ITAA 5FASA 1FQGA 4L9EA 4R6LA 3NULA 4HQAA 2GX5A 1IYSA 5FQMA 4NXBA 1OTDA 4GD6A 2XSSA 5CERA 3S7QA 2VV7A 4WMCA 2ZQCA 5EVEA 1ONGA 2JKFA 2VGLM 2IWCA 1NLZA 3LR0A 1OPXA 4KG6A 2OWJA 4GHIB 5IHVA 1F98A 4BL3A 2EFUA 2QPNA 3D4FA 3C7VA 4Y13A 3VSKA 3I7JA 1Z09A 2KLIA 2HGVA 4UAAA 4HEFA 5G4ZA 2WKQA 4JKTA 1FSYA 1LLBA 4O0PA 2D02A 3TJZC 1LSXA 3IXDA 3QP8A 2V0WA 2OLVA 2V1AA 2WGVA 1KE0A 4Y0TA 3DW0A 3W4PA 3HLBA 3VV4A 4MNRA 3BFDA 3DWKA 4N92A 3NECA 4MN6A 2C6WB 1L0GA 4OPRA 3UMEA 1ONHA 4LRZE 3MQ0A 4X56A 3IBJA 4GN2A 4KUOA 1S1ZA 1U60A 2VGJA 2G7UA 5EM0A 2Q9MA 4GD8A 2EX2A 4HI4A 4MLLA 3UE0A 1ZHHB 1OTIA 2ZQ8A 1FIKA 3UPOA 4XT2A 2Y2JA 3UE3A 4IVIA 5DTTA 1MKMA 4S2LA 4EQIA 3LY4A 4MN5A 4RQ9A 4K0XA 4U0TA 5E43A 3DTIA 4RVAA 4CLCC 1XX2A 3KSIA 3PAGA 2WZXA 4KZ9A 3TG9A 3TE8A 1EROA 4WEJA 4LPZA 4WL9A 2QHKA 1ZTUA 5A91A 4EERA 4EQ1A 2RCXA 4HJ4A 2M1CA 3BLSA 1IELA 4L0LA 4R3BA 1GSVA 4DF6A 4QY6A 1W79A 4Y0UA 2DRWA 2EWWA 3NI9A 3RFBA 4Y15A 5FATA 4S2MA 2O0YA 3HCYA 2L0WA 1XGIA 3VOLA 4EUVA 5LBRA 4WN5A 4YNRA 3HBRA 1PZPA 3MS6A 5FI6A 3D72A 2W0NA 2ZOIA 1PWDA 4L9FA 3QP1A 3MZEA 1S1YA 1I2WA 4DE2A 2V1ZA 4GHIA 1NYMA 1W7FA 4D2OA 3IHBA 2ZOHA 3DTEA 3OLOA 1JWPA 5IT5A 1G6OA 1NXYA 4E3LA 3PBSA 3C2WA 3T4LA 5GLDA 3S4XA 3V3RA 4KQQA 2ZQDA 3Q07A 1PWGA 4Q0JA 1K4EA 5GLAA 5FQQA 4OLDA 3A3DA 5DFXA 4E3MA 3BY8A 1CF0A 1S6RA 5CHJA 5FQKA 1QMEA 2OSUA 2QJ5A 1G68A 3OBFA 2VLGA 2Y2HA 2PYRA 2IWBA 3CAXA 4N9LA 4I3JA 2ZC5B 2VK3A 5HL6A 4QU3A 1SZVA 3O3VA 5AQBA 5K5BA 4X1MA 1CI8A 3CG5A 4O01A 4ARZA 3IF5A 3FWLA 2WKEA 4GDBA 1Y54A 1D06A 4JGRA 2HP9A 4B93A 3DTMA 2J3WA 1JWZA 1IKIA 2QJ7A 3A3EA 4NK3A 1GA9A 5KIZA 5FI7A 5FAPA 1IYPA 3BFCA 1PFLA 3GSGA 4C3QA 3IH8A 3A3JA 3H82B 4PHTA 1PNEA 5FQ9A 3VP4A 3H9WA 3T4JA 3LCEA 3LEQA 4NXEA 2V20A 5DKLA 3MXQA 1D1JA 2ACGA 4R70A 2QYBA 4EBLA 2J3TD 4IBXA 1GSXA 2MJ6A 4WZ5A 1KDSA 5EPHA 4PKYA 3ZCZA 1MZUA 1K55A 2Y2IA 2KDKA 3QHYA 5G18A 2FZ0A 3E4PA 3IX4A 3EEAA 2GNXA 4S2IA 2XEPA 2VGKA 4R0QA 2C5WB 4UA6A 3F1PB 4HNBA 1K54A 2ZQ9A 3MFDA 1P9WA 1OTEA 3AGFA 1A0KA 1YPRA 3A0VA 5KSCA 2VX8A 3G34A 1K57A 2V8FA 3UNWA 3MXRA 5F1FA 3UN7A 3Q81A 3AGDA 4LGWA 3BFFA 4LV1A 4WM9A 3C5AA 4DDSA 2W1TB 3JVVA 3F1OB 3CPTA 2ZC6B 4NEED 3T4SA 5EE8A 1F2KA 2X01A 3E2LA 5DF9A 3CUEC 4MEZA 4IEDA 3VMAA 5FEGA 2XF3A 3TOIA 2OAQ1 3T12B 4FUWA 1P97A 4K91A 4KZ6A 1C3BA 4JXVA 2Q0OA 1NRFA 1GHPA 2WZZA 4EUZA 4WZ5C 2Y91A 3KYZA 2XD5A 5CGWA 1ZG4A 2PU4A 1K55C 1S4SA 4BBVA 4X6TA 5G4YA 5CECA 2JKTM 2Y8HA 3Q1FA 5F83A 2NUTC 1UWPX 5E2EA 4R23A 2WGWA 2XFSA 1W5DA 3PBRA 5EECA 3KO6A
chains in the Genus database with same CATH topology
2QWSA 3E98A 1LT0A 2B02A 3A0SA 4AFIA 1STZA 3EGDC 5L8MA 1TS8A 4L9EA 4R6LA 3R4KA 2JKTI 1LSWA 4HQAA 4WF0A 2GX5A 5HPFA 1G28A 1P0ZA 4NXBA 2V0UA 4CLCE 4Q0IA 1OTDA 2XSSA 3CI6A 3T4KA 3JVUA 1F5MA 3S7QA 2VV7A 4GS9A 2VGLM 3H82A 2OOLA 3UB6A 2J3TC 5EFWA 1TD5A 1NLZA 2O9AA 3BWLA 3LR0A 2D01A 4JGPA 4M4XA 4O8GA 1OPXA 3GDIA 3ULFA 4B9OA 2OWJA 4GHIB 1F98A 3FC7A 4ETXA 4JGOA 4BMWA 4PKYG 4EXOA 1JNUA 2KLIA 2HGVA 3BQAA 3KSHA 5G4ZA 2WKQA 3P01A 2JN7A 4HP9A 3EEHA 1UWNX 2EA9A 4O0PA 2D02A 4MDZA 3TJZC 3RTYA 3E4QA 3T4QA 1LSXA 2V0WA 3IBRA 2K31A 2V1AA 5F6AA 5AJGA 2YKFA 4NKPA 3VV4A 2IA2A 4EEUA 2W1RA 4MN6A 3R7WB 3CWFA 3EWKA 3LR5A 2YKHA 2INWA 2PR5A 4DJ2A 4HH2A 4UQIS 3ICYA 3UMEA 2O99A 4P6ZM 4LRZE 4WUJA 1YAXA 3MQ0A 5DKKA 4MN7A 2NUPC 4OOMA 4HOIA 3IBJA 2HF6A 4YWZA 4KUOA 3A0RA 1S1ZA 2G7UA 1T1AA 1T1BA 1YSPA 2W3EA 3D3OA 5TJJA 4HI4A 1OJ5A 1W63M 4R38A 3R7WA 1H3QA 3PR6A 3ZQ5A 1ZHHB 2K7SA 3RH8B 1OTIA 4F3LB 4XT2A 1EW0A 3S7NA 2Z6CA 3UE3A 4EESA 4BJPA 1MKMA 4RQ9A 4MN5A 3F1OA 2XA7S 1NLYA 5I5LA 2JHEA 2HJ9C 4CLCD 4CLCC 4HHDA 1DP9A 2A24B 3KSIA 3LIAA 5DJTA 2PDRA 3BY9A 3EQVA 5DJUA 5J4EA 3B33A 3K2NA 4F3LA 3LUQA 1OT9A 3TE8A 2JKRM 1LL8A 5FL3A 4WEJA 4LPZA 2EWVA 2PR6A 3BW6A 3C38A 4WL9A 2BASA 2QHKA 1ZTUA 4EERA 2L4RA 2LB9A 4EQ1A 4HJ4A 3CITA 4BBUA 2M1CA 2A24A 3S7OA 4HJ6A 4L0LA 1GSVA 3NOTC 3IS2B 2M7VA 5J7EA 3C8CA 4DMZA 3VE4A 2JKRI 1T19A 1TS0A 4HP4A 3PBNA 4G3KA 3K3DA 3KYQA 3NJAA 5TBMB 2EWWA 2WKRA 3RFBA 1S4RA 4Y5FA 2HV1A 5F68A 3OC2A 3BQ8A 2PT7A 3HJKA 4DJ3A 2O0YA 3PBQA 3HCYA 2L0WA 3MQQA 3CUEA 3VOLA 4EUVA 2V1BA 1XJ2A 3IS2A 3FG8A 5HD3A 5LBRA 4GW9A 3T4TA 4WN5A 4YNRA 3PHYA 4IJGA 3H7WB 3LIBA 5AVFA 4E04A 4CQHA 3D72A 2W0NA 2ZOIA 3VE3A 4L9FA 4LLOB 4EETB 4HY8A 1S1YA 1IOUA 5HWVA 2FH5A 3EOIA 3LR3A 3LIEA 4GHIA 3W2ZA 2ZOHA 5CX7A 4KQDA 3OLOA 5IT5A 2VV6A 2Y79A 5HSQA 1G6OA 1N9LA 3MR0A 3OOVA 3UB8A 4I5SA 3LICA 4YOFA 4ZRRA 3H7WA 3C30A 3PBSA 2DMWA 2ZMVA 3C2WA 4II7A 3UB7A 4Q0HA 3T4LA 2V9AA 1XJ3A 5HD5A 3S7PA 4Q0JA 1OTBA 4DN0A 4GCZA 2W3FA 1N9NA 4GJ4A 5DFXA 2VGLS 4K08A 1ODVA 3BY8A 5F5YA 4L9GA 4FSFA 3TRCA 4I38A 5HDSA 4ARZB 4KUKA 2QJ5A 2OAP1 3P7NA 3OBFA 2L1MA 5HWTA 2M7UA 4ETZA 1KOUA 2VLGA 2PYRA 4I3AA 2LB5A 4LRYC 4KQOA 3TW8A 4G3VA 3CAXA 4Y2FA 4I3JA 5DFYA 4NXGA 1GSWA 3MF0A 5HL6A 2WKPA 5IS1A 2XROA 3NHQA 3B47A 5K5BA 4WELA 1S67L 4R3AA 3MJQA 3SW1A 1LSVA 4O01A 5HDCA 4ARZA 2KX6A 1BYWA 1S66L 3T4OA 1D06A 4JGRA 4WLAA 4B93A 2J3WA 4WEKA 3NOPC 2QJ7A 4HH3A 1OTAA 3B42A 5KIZA 4EU0A 4EW7A 3LI9A 4P6ZS 3MQOA 3FPVA 3LIFA 4G3WA 1XJ6A 3H82B 4PHTA 1NRJA 4I3IA 3H9WA 1H8MA 3T4JA 3G6OA 5AVEA 4NXEA 1VB6A 5DKLA 3MXQA 3BJNA 4UQIM 1NWZA 2PHYA 3LFVA 1W63Q 4CLCB 4R70A 2W27A 2QYBA 5J3WA 1P9RA 2P04A 3FPWA 3ZYTA 1TF1A 2ZBBA 3CLOA 2W3HA 3LR4A 1MC0A 3E4OA 1T1CA 2J3TD 2VEAA 1GSXA 1YSQA 3LI8A 2A2LA 3LYXA 2MJ6A 5TBMA 3HJIA 2K2NA 4PKYA 4HJ3A 1MZUA 2VA0A 3UMDA 2KDKA 5IU1A 3KX0X 5HZHA 4QPRA 3U2AA 4CLCA 5HPIA 2FZ0A 2CMNA 2XA7M 3E4PA 4ME4A 1XFNA 2HJEA 3EEAA 4IHQA 3OCLA 2GNXA 1F9IA 3PXPA 4BBTA 5HDDA 3KSGA 4BWIA 5KSHA 1UGUA 2O9CA 3E0YA 4IUKA 5MC7A 4LRXC 3F1PB 4HNBA 4PAUA 3EQUA 3PYPA 1DP8A 3PBOA 2P7JA 1P9WA 1OTEA 3O5YA 3NOUC 2VV8A 3OCNA 1VHMA 3A0VA 2VX8A 1T18A 2ZMFA 2VJWA 4IUHA 1OJGA 3K3CA 1XJ4A 4MMNA 4GLQA 3V67A 3F1PA 1Y28A 1TS7A 1V9YA 4XT2B 1WA9A 2J80A 2PD7A 3UE6A 2W1TB 3JVVA 2I9VA 4I39A 1XFQA 3F1OB 1V9ZA 2P08A 4NEED 3T4SA 4HIAA 4OOLA 3MFXA 2W3DA 2R78A 3CUEC 4MCWA 1OT6A 4JGQA 5DF9A 3LIDA 3PBTA 5HWWA 2GJ3A 4Z1WA 2OAQ1 2PYPA 4H6JB 1P97A 3F1NB 5C5KA 1TS6A 2KOIA 2GZAA 1DP6A 4UEYA 3UB9A 4NXFA 2W3GA 2H28A 3GECA 5F69A 2W1TA 3KYZA 1YKDA 3DBAA 1IFQA 5A8BA 2Z6DA 4EEPA 2PD8A 4FOFA 1S4SA 1DRMA 1N9OA 4BBVA 4Y3IA 3EGXC 3KSFA 2OWHA 5G4YA 2JKTM 2Y8HA 2B18A 4H6JA 1D7EA 3F1NA 2NUTC 2VZWA 1UWPX 3T50A 2QKPA 2VKSA 4GS9B 2O9BA 3PBRA 3KO6A 1X0OA 2XRNA 3MMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWS A;  1LT0 A;  2B02 A;  3A0S A;  1TS8 A;  4L9E A;  4R6L A;  4HQA A;  4WF0 A;  1G28 A;  1P0Z A;  4NXB A;  2V0U A;  1OTD A;  2VV7 A;  4GS9 A;  3H82 A;  2OOL A;  3UB6 A;  5EFW A;  3BWL A;  2D01 A;  4JGP A;  4M4X A;  3GDI A;  3ULF A;  4B9O A;  2OWJ A;  4GHI B;  1F98 A;  3FC7 A;  4JGO A;  4PKY G;  4EXO A;  1JNU A;  5G4Z A;  2WKQ A;  4HP9 A;  2JN7 A;  3EEH A;  1UWN X;  2EA9 A;  2D02 A;  3RTY A;  3E4Q A;  1LSX A;  2V0W A;  3IBR A;  2V1A A;  5F6A A;  2YKF A;  4EEU A;  4MN6 A;  3CWF A;  3EWK A;  2YKH A;  2INW A;  2PR5 A;  4DJ2 A;  4HH2 A;  3ICY A;  3UME A;  4LRZ E;  4WUJ A;  5DKK A;  4HOI A;  4YWZ A;  4KUO A;  3A0R A;  1S1Z A;  1T1A A;  1T1B A;  4HI4 A;  1OJ5 A;  4R38 A;  3ZQ5 A;  2K7S A;  3RH8 B;  1OTI A;  4F3L B;  4XT2 A;  1EW0 A;  2Z6C A;  4EES A;  4RQ9 A;  4MN5 A;  3F1O A;  5I5L A;  2JHE A;  4HHD A;  1DP9 A;  2A24 B;  3LIA A;  5DJT A;  2PDR A;  3BY9 A;  5DJU A;  5J4E A;  3B33 A;  4F3L A;  3LUQ A;  1OT9 A;  1LL8 A;  4LPZ A;  2PR6 A;  4WL9 A;  2BAS A;  2QHK A;  4EER A;  2L4R A;  4EQ1 A;  4HJ4 A;  4BBU A;  2M1C A;  2A24 A;  4HJ6 A;  1GSV A;  3NOT C;  3IS2 B;  5J7E A;  3C8C A;  3VE4 A;  1T19 A;  1TS0 A;  4HP4 A;  3K3D A;  3NJA A;  5TBM B;  2WKR A;  1S4R A;  2HV1 A;  5F68 A;  3HJK A;  4DJ3 A;  2L0W A;  3MQQ A;  3VOL A;  2V1B A;  1XJ2 A;  3IS2 A;  3FG8 A;  5HD3 A;  4GW9 A;  4WN5 A;  3PHY A;  3H7W B;  3LIB A;  5AVF A;  4E04 A;  3D72 A;  2W0N A;  2ZOI A;  3VE3 A;  4L9F A;  4LLO B;  4EET B;  4HY8 A;  1S1Y A;  5HWV A;  3LIE A;  4GHI A;  2ZOH A;  4KQD A;  3OLO A;  2VV6 A;  5HSQ A;  1N9L A;  3MR0 A;  3UB8 A;  4I5S A;  3LIC A;  3H7W A;  3C2W A;  3UB7 A;  2V9A A;  1XJ3 A;  5HD5 A;  1OTB A;  4GCZ A;  1N9N A;  4K08 A;  1ODV A;  3BY8 A;  5F5Y A;  4L9G A;  4I38 A;  5HDS A;  4KUK A;  2QJ5 A;  5HWT A;  3P7N A;  2L1M A;  1KOU A;  2VLG A;  2PYR A;  4I3A A;  4LRY C;  3CAX A;  4I3J A;  4NXG A;  1GSW A;  2WKP A;  5IS1 A;  3NHQ A;  1S67 L;  4R3A A;  3MJQ A;  3SW1 A;  1LSV A;  5HDC A;  2KX6 A;  1BYW A;  1S66 L;  1D06 A;  4JGR A;  4WLA A;  3NOP C;  2QJ7 A;  4HH3 A;  1OTA A;  5KIZ A;  4EW7 A;  3LI9 A;  3MQO A;  3LIF A;  1XJ6 A;  3H82 B;  4I3I A;  3H9W A;  3G6O A;  5AVE A;  4NXE A;  1VB6 A;  5DKL A;  3MXQ A;  1NWZ A;  2PHY A;  4R70 A;  2W27 A;  5J3W A;  2ZBB A;  3CLO A;  3E4O A;  1T1C A;  2VEA A;  1GSX A;  3LI8 A;  3LYX A;  5TBM A;  3HJI A;  4PKY A;  4HJ3 A;  1MZU A;  3UMD A;  2KDK A;  5IU1 A;  3KX0 X;  5HZH A;  2CMN A;  3E4P A;  1XFN A;  1F9I A;  4BBT A;  5HDD A;  1UGU A;  4LRX C;  3F1P B;  4HNB A;  3PYP A;  1DP8 A;  2P7J A;  1OTE A;  3NOU C;  2VV8 A;  3A0V A;  1T18 A;  1OJG A;  3K3C A;  1XJ4 A;  3F1P A;  1Y28 A;  1TS7 A;  1V9Y A;  4XT2 B;  1WA9 A;  2J80 A;  2PD7 A;  3UE6 A;  2I9V A;  4I39 A;  1XFQ A;  3F1O B;  1V9Z A;  4HIA A;  3MFX A;  2R78 A;  1OT6 A;  4JGQ A;  3LID A;  5HWW A;  2GJ3 A;  2PYP A;  4H6J B;  1P97 A;  3F1N B;  1TS6 A;  1DP6 A;  3UB9 A;  4NXF A;  2H28 A;  3GEC A;  5F69 A;  5A8B A;  2Z6D A;  4EEP A;  2PD8 A;  1S4S A;  1DRM A;  1N9O A;  4BBV A;  2OWH A;  5G4Y A;  4H6J A;  1D7E A;  3F1N A;  1UWP X;  3T50 A;  2QKP A;  4GS9 B;  1LSW A;  1X0O A; 
#chains in the Genus database with same CATH topology
 2QWS A;  3E98 A;  2B02 A;  3A0S A;  3RXW A;  3VP1 A;  3N8S A;  4AFI A;  4P6B A;  4PM5 A;  1STZ A;  4M3K A;  2E8I A;  5HPF A;  4CLC E;  4Q0I A;  1SDE A;  3CI6 A;  5J8X A;  1F5M A;  4OP8 A;  1PYY A;  3H82 A;  3T1X A;  1DY6 A;  2J3T C;  3ZFZ A;  2UWX A;  3HLD A;  5GHY A;  4M4X A;  4JGP A;  4O8G A;  3GDI A;  4R4S A;  4B9O A;  3ZG7 B;  4E3K A;  3MZD A;  1TDL A;  3MKE A;  3G2Z A;  3S22 A;  4X69 A;  3BQA A;  3P01 A;  2GDN A;  4JXG A;  1JVJ A;  1BSG A;  4MBF A;  4MDZ A;  1NY0 A;  3G2Y A;  3E4Q A;  3NDE A;  2JE5 A;  3IBR A;  3VFF A;  5FDS A;  4NET A;  1XA1 A;  5F6A A;  2YKF A;  3W4O A;  3HLF A;  4D60 A;  5AQ9 A;  3GV9 A;  2FFY A;  4HH2 A;  5E2G A;  1J9M A;  1XGJ A;  1YAX A;  5DKK A;  4MN7 A;  4HOI A;  4YWZ A;  3A0R A;  1T1A A;  1T1B A;  2W3E A;  3D3O A;  5TJJ A;  4WMC D;  2BG1 A;  1OJ5 A;  3PAE A;  2A3U A;  4OOY A;  1MWS A;  4MBH A;  2Z6C A;  4EES A;  3F1O A;  3WRT A;  1NLY A;  1K0K A;  4CLC D;  4HHD A;  5HAP A;  4R4R A;  3BY9 A;  1ES4 A;  5DJU A;  3B33 A;  3K2N A;  2ZQA A;  2P9V A;  3LUQ A;  1OT9 A;  3IT9 A;  3IWI A;  3QNC A;  3HLE A;  1ZG6 A;  3C38 A;  2HZ5 A;  2BAS A;  3CMZ A;  2L4R A;  3ZGA B;  2XDM A;  1O07 A;  4BBU A;  1GHI A;  2A24 A;  3S7O A;  4HJ6 A;  3QP6 A;  4P85 A;  3NOT C;  1PI5 A;  5HX9 A;  3C8C A;  1H8Z A;  4DMZ A;  2JKR I;  1T19 A;  4HP4 A;  4G3K A;  4YIN A;  4C6Y A;  5HW3 A;  5TBM B;  2Z2L B;  2WKR A;  4Y5F A;  1XA7 A;  2XQZ A;  3JYI A;  2G2W A;  4JLF A;  4PM9 A;  5F68 A;  2OV5 A;  3HLC A;  3OC2 A;  3UPP A;  3PBQ A;  1FCN A;  4BL2 A;  1L0E A;  5GL9 A;  5FI2 A;  2V1B A;  3FG8 A;  5HD3 A;  4GW9 A;  4HBT A;  3VOY A;  1FSW A;  4IJG A;  4CQH A;  2H5S A;  1BLP A;  4HY8 A;  3LR3 A;  4BEN A;  2H10 A;  2WGI A;  4BD0 A;  4JXW A;  5TFQ A;  5CED A;  4KQD A;  4FTX A;  4F94 A;  5A92 A;  3UB8 A;  4ZRR A;  3C30 A;  2WK0 A;  4UA9 A;  2DMW A;  1W8Y A;  4Q0H A;  1Y4O A;  2V9A A;  4PM8 A;  4U3T A;  1CI9 A;  3B3X A;  4LV2 A;  1OTB A;  1PI4 A;  1GA0 A;  1SHV A;  5KMW A;  1AWI A;  1N9N A;  4GJ4 A;  4RX3 A;  5CGS A;  1BLC A;  4K08 A;  1ODV A;  5FEF A;  5FAO A;  5F5Y A;  1JTD A;  4L9G A;  4JPM A;  4I38 A;  4ARZ B;  4KUK A;  3IWQ A;  2OAP 1;  5EVI A;  4ETZ A;  4OQ0 A;  2HDQ A;  1I5Q A;  3TW8 A;  4Y17 A;  4G3V A;  5CGX A;  3M2K A;  1EI5 A;  4N9K A;  5IS1 A;  4KG2 A;  2XRO A;  2XR0 A;  2PRF A;  3B47 A;  5FSR A;  4OP5 A;  4WEL A;  4ZDX A;  1ESU A;  2Y2O A;  1LSV A;  5HDC A;  3GMW A;  3HLG A;  3NOP C;  4N1H A;  1IYO A;  1I2S A;  2XGN A;  3T1Q B;  3ZHH A;  2P74 A;  1VEU A;  3IX8 A;  4G3W A;  4RYE A;  1IKG A;  1L0F A;  4HBU A;  1XKZ A;  2IWD A;  1VB6 A;  2H0T A;  1NWZ A;  3NCK A;  1SKO A;  3Q7Z A;  4XUZ A;  5J3W A;  2P04 A;  1H0M A;  1DJC A;  2ZD8 A;  3CLO A;  4KQR A;  4JXS A;  1T1C A;  4KZ3 A;  1RGZ A;  2A2L A;  5TBM A;  4RA7 A;  4HJ3 A;  4ZBE A;  1FR1 A;  3HLW A;  5IU1 A;  4KEN B;  4QPR A;  1LL9 A;  4GDN A;  4JF5 A;  3DTK A;  2EFX A;  4ME4 A;  1XFN A;  3N8R A;  3SS5 A;  1F9I A;  3PXP A;  1YMX A;  1ZC2 A;  1UGU A;  2O9C A;  4OLG A;  3ZDJ A;  1FCO A;  3EQU A;  3PYP A;  3TSG A;  2P7J A;  4NG2 A;  3O5Y A;  5JYP A;  3CPT B;  2BTF P;  2VJW A;  3IF6 A;  3K3C A;  1Q2Q A;  4BLM A;  4GLQ A;  1Y28 A;  3FKW A;  3Q7V A;  3IXB A;  2I9V A;  4I39 A;  1MPL A;  4JGQ A;  3LID A;  5HWW A;  4E6X A;  4Z1W A;  1IEM A;  1PW1 A;  3ZG0 A;  1TS6 A;  1H5X A;  3KYE A;  2HDS A;  2W3G A;  2WGW B;  3UDF A;  2EX8 A;  2H28 A;  3DBA A;  1IFQ A;  2ZLY A;  2Z6D A;  5A8B A;  2OLU A;  2PD8 A;  4FOF A;  4IVK A;  1NJ4 A;  4Y3I A;  4Q8I A;  2OWH A;  3CJM A;  3O88 A;  5D3O A;  2B18 A;  4H6J A;  1RCJ A;  3BFG A;  2XK1 A;  3W8K A;  3G30 A;  2QKP A;  4GB7 A;  3BRM A;  3SH9 A;  5FA7 A;  4JBF A;  1LSW A;  2XRN A;  2Y59 A;  1LT0 A;  3UE1 A;  1JWV A;  4R1G A;  3R4K A;  1W8Q A;  4WF0 A;  1G28 A;  2EXB A;  4KZ8 A;  2V0U A;  4P87 A;  3T4K A;  5M1A A;  1CEG A;  1DJB A;  2DCF A;  4GS9 A;  2OOL A;  2O9A A;  3BWL A;  2D01 A;  1E3U A;  4Z9Q A;  3DWZ A;  4ETX A;  3OZH A;  1WYB A;  4BMW A;  1SCW A;  4PKY G;  4EXO A;  4X55 A;  3KSH A;  4OON A;  1YLY A;  2DNS A;  3O87 A;  3EEH A;  3ZVW A;  1UWN X;  3G31 A;  1GHM A;  4IBR A;  3RTY A;  5EOO A;  3ZVT A;  4WYY A;  4YFM A;  3FV7 A;  1PWC A;  3VFH A;  4LCL A;  2B5R A;  4EBN A;  2Y2Q A;  3SOI A;  3BEC A;  4EEU A;  5FQI A;  3OPL A;  2WAD A;  2YKH A;  2PR5 A;  4DJ2 A;  3T1S A;  2O99 A;  3IH9 A;  4XXR A;  2Y2N A;  2NUP C;  5DF7 A;  2HF6 A;  1YSP A;  3M2J A;  2ZJ9 A;  1W63 M;  4B4X A;  3HVF A;  4R38 A;  3R7W A;  4ZAM A;  3ZNY A;  1H3Q A;  3ZQ5 A;  2K7S A;  3RH8 B;  2P9V B;  4HES A;  3WS5 A;  1EW0 A;  3S7N A;  4BJP A;  2EX6 A;  3LEZ A;  2HP6 A;  1ZKJ A;  2XA7 S;  5I5L A;  5CRF A;  2JHE A;  1SDN A;  1K4F A;  1LHY A;  5CTN A;  3UPN A;  2JKG A;  2A24 B;  3A3I A;  4OKP A;  1ESI A;  3EQV A;  3GVB A;  5J4E A;  2ZL1 A;  5JYO A;  4QB8 A;  1BLH A;  3IQA A;  2V2F F;  1FIL A;  1OME A;  4F3L A;  1K54 C;  1LL8 A;  3HRE A;  1MWR A;  2EWV A;  5DTS A;  5GHX A;  2LB9 A;  3OPH A;  3IX3 A;  1K57 C;  3BEB A;  3CIT A;  5AQA A;  1VQQ A;  4OPY A;  2PBD P;  3S1Y A;  2XH9 A;  3Q82 A;  4K0W A;  1YT4 A;  3L7H A;  1TS0 A;  4A5R A;  3PBN A;  3MZF A;  4QWO A;  1AXB A;  3NIA A;  3SS3 A;  4LCM A;  3NJA A;  3G35 A;  1BT5 A;  2BLS A;  2Z2M B;  3BQ8 A;  2PT7 A;  4X1L A;  3MQQ A;  3V3S A;  1BTL A;  3IS2 A;  4S2K A;  3PHY A;  3LIB A;  3VE3 A;  4LLO B;  2Y2G A;  2Y4A A;  4E3O A;  1YM1 A;  2FH5 A;  3QP5 A;  3FKV A;  4U0X A;  3V50 A;  2XFT A;  1MKI A;  3W2Z A;  4OPZ A;  5HSQ A;  4EWF A;  4GNU A;  1FOF A;  3LIC A;  4YOF A;  3H7W A;  1QMF A;  5EVL A;  3UB7 A;  3SZT A;  4ZJ1 A;  1XJ3 A;  3ZNT A;  5HD5 A;  3L9K A;  5EVI B;  1JTG A;  1K56 A;  1MWU A;  4DN0 A;  2W3F A;  1KGG A;  3GRJ A;  2FFF B;  4FSF A;  3TRC A;  3CHW P;  5F1G A;  4Y0O A;  1CQA A;  3P7N A;  2L1M A;  2M7U A;  1KOU A;  1FR6 A;  4I3A A;  4MBK A;  2LB5 A;  4LRY C;  5TR7 A;  2CC1 A;  4ZJ2 A;  3N8L A;  5DFY A;  4NXG A;  3CZD A;  1XXM A;  3UDX A;  1VEU B;  3M6H A;  3QNB A;  3MJQ A;  3WS1 A;  3SW1 A;  2Y2M A;  4PMA A;  3PTE A;  2KX6 A;  1BYW A;  1S66 L;  3T4O A;  3DAV A;  4EV4 A;  3MSH A;  4WEK A;  1K38 A;  1PW8 A;  1SKO B;  3BYD A;  4EU0 A;  3LI9 A;  4P6Z S;  3UY6 A;  3FPV A;  3LIF A;  1BUL A;  1XJ6 A;  1N9B A;  5DTK A;  3BJN A;  4E6W A;  3SH8 A;  2PHY A;  3G32 A;  2QZ6 A;  4LFU A;  2ZMA A;  3N7W A;  1BLS A;  2WUQ A;  4E3I A;  1P9R A;  3FPW A;  4S2P A;  2ZBB A;  2W3H A;  1HLU P;  5BOH A;  1CK3 A;  1MC0 A;  2EX9 A;  2PU2 A;  5EVI D;  1XP4 A;  3HJI A;  1KDW A;  3N4I A;  3UMD A;  2A49 A;  1KVL A;  3BM6 A;  3U2A A;  4CLC A;  5HPI A;  2XA7 M;  1YLW A;  2HJE A;  2E8J A;  4BWI A;  2PBY A;  5KSH A;  3IF6 B;  5MC7 A;  4IUK A;  4LRX C;  2JCH A;  3Q7V B;  4O7D A;  1IYQ A;  3QP2 A;  1Z6F A;  5A93 A;  1CJF A;  3LY3 A;  1TVF A;  5FAQ A;  5U47 A;  1FCM A;  1VET A;  3NOU C;  3OCN A;  4DRT A;  1ERM A;  1VHM A;  5HL1 A;  2ZMF A;  5KZH A;  1YLJ A;  4IUH A;  3C7U A;  1OJG A;  1XJ4 A;  4GZB A;  5CTM A;  3V67 A;  3ZG9 B;  2V8C A;  1TS7 A;  3HUO A;  1V9Y A;  3ZG8 B;  2J80 A;  1E4D A;  2PD7 A;  5CHU A;  3UE6 A;  4ID4 A;  1XFQ A;  1V9Z A;  2P08 A;  4R3J A;  2X02 A;  4OOL A;  1MXO A;  2W3D A;  2R78 A;  4MCW A;  1OT6 A;  3PBT A;  4DE0 A;  2GJ3 A;  1PRQ A;  4KZB A;  4H6J B;  4PM6 A;  2Y2K A;  4GOG A;  5A90 A;  2R9X A;  5I94 A;  2KOI A;  2GZA A;  3VP0 A;  4UEY A;  3UB9 A;  2WKH A;  4DKI A;  1ALQ A;  2Q9N A;  2JC7 A;  3GEC A;  3WS2 A;  1KE3 A;  5AQ7 A;  4EEP A;  1L0D A;  4QY5 A;  1N9O A;  3EGX C;  3KSF A;  4EBP A;  3F1N A;  4OPQ A;  2VZW A;  4XUX A;  5EUA A;  1LL5 A;  4OQI A;  4DXB A;  4DE3 A;  4QD4 A;  4GS9 B;  4WBG A;  2O9B A;  4H8R A;  1X0O A;  1YLP A;  5L8M A;  3VOZ A;  1TS8 A;  4UHU A;  2JKT I;  3P98 A;  2X71 A;  1KGE A;  3RXX A;  3WRZ A;  1P0Z A;  3SS4 A;  3GR2 A;  3JVU A;  5HFO A;  1K25 A;  2G2U A;  1H8Y A;  3UB6 A;  5EFW A;  3HUM A;  1TD5 A;  4CPK A;  5EVI C;  2B95 A;  3ULF A;  1G6A A;  2ZC7 A;  2HP5 A;  3QP4 A;  3FC7 A;  5TGF A;  4JGO A;  1DJA A;  1ACF A;  1JNU A;  4KZ5 A;  4HP9 A;  2JN7 A;  4N1X A;  4RX2 A;  1MWT A;  2EA9 A;  1XPB A;  3NC8 A;  3OPP A;  3T4Q A;  1TEM A;  5HAQ A;  2WAF A;  2K31 A;  2J7V A;  1TDG A;  5AJG A;  4ZJ3 A;  4NKP A;  3UO9 A;  4JF6 A;  2IA2 A;  3WWX A;  2W1R A;  5L10 A;  4WZ4 A;  3R7W B;  1M40 A;  3CWF A;  3EWK A;  3LR5 A;  5E2F A;  2INW A;  4UQI S;  3ICY A;  3UDI A;  4P6Z M;  4WUJ A;  3WS4 A;  3BFE A;  4ESP A;  1E25 A;  4OOM A;  5CEB A;  5CXW A;  3IXG A;  2ZL1 B;  1PZO A;  3PR6 A;  1J3W A;  4B4Z A;  4OQG A;  3T1R A;  3MBZ A;  1E3U D;  4F3L B;  1RP5 A;  4ZTK A;  3ZG5 A;  5EM1 A;  4UA7 A;  5GHZ A;  2HJ9 C;  3HUN A;  5M18 A;  5CHM A;  1DP9 A;  3LIA A;  5DJT A;  2PDR A;  4KG5 A;  4S2N A;  2J8Y A;  1CEF A;  2QMI A;  1HTZ A;  4C75 A;  5DF8 A;  2JKR M;  5FL3 A;  2PR6 A;  3BW6 A;  3WS0 A;  4X25 A;  5DVA A;  2JBF A;  3IS2 B;  2M7V A;  3D9Y A;  5J7E A;  3IF6 C;  3VE4 A;  3LO7 A;  1MY8 A;  3K3D A;  3KYQ A;  4PPR A;  4P0M A;  1S4R A;  1NZU A;  2HV1 A;  1NYY A;  2ZC4 B;  1GCE A;  1SKF A;  3HJK A;  4OVD A;  4DJ3 A;  2HPB A;  2UV0 E;  3CUE A;  4Y7P A;  1XJ2 A;  4KZ7 A;  4FD8 A;  1WE4 A;  3T4T A;  3E2K A;  1YQS A;  3H7W B;  5AVF A;  4E04 A;  1K6S A;  3NDG A;  4EET B;  2I72 A;  1EWZ A;  1IOU A;  5HWV A;  1L2S A;  3EOI A;  3LIE A;  1ES5 A;  2EXA A;  5CX7 A;  2VV6 A;  2Y79 A;  5F82 A;  1N9L A;  2ZM0 A;  3MR0 A;  2J9O A;  3OOV A;  4S2N C;  4OQH A;  4E3J A;  4I5S A;  1K6R A;  2Y55 A;  2ZMV A;  4II7 A;  3RJU A;  1ERQ A;  1M6K A;  5L09 A;  3S7P A;  5L07 A;  5E2H A;  3VSL A;  4S2J A;  1LI0 A;  4GCZ A;  2VGL S;  4DE1 A;  1PIO A;  1G5U A;  2RL3 A;  3IHA A;  3C4P A;  3ISG A;  3LGO A;  5HDS A;  3UB5 P;  3ITB A;  4GKU A;  5HWT A;  3MXS A;  4KQO A;  3SH7 A;  2Y2P A;  4Y2F A;  3VP2 A;  4KZA A;  1KGF A;  1O7E A;  1GSW A;  3OPR A;  2WYX A;  3MF0 A;  2WKP A;  2HDU A;  3NHQ A;  2PAV P;  3JPU A;  1S67 L;  1YLT A;  4R3A A;  5EV0 A;  3GTC A;  1L3L A;  1S0W A;  2XD1 A;  4WLA A;  3IXH A;  4JF4 A;  4HH3 A;  1OTA A;  3B42 A;  4EW7 A;  3C4O A;  4KZ4 A;  3G4P A;  3MQO A;  4QJG A;  1HD8 A;  2XLN A;  5EOE A;  1NRJ A;  3A3F A;  4I3I A;  3W4Q A;  1H8M A;  5M19 A;  3G6O A;  4BD1 A;  5AVE A;  1K56 D;  4DXC A;  5FDH A;  1HVB A;  4UQI M;  3LFV A;  1WYC A;  3NBL A;  1W63 Q;  2WKI A;  3M6B A;  4CLC B;  5GLB A;  2W27 A;  4QHC A;  3ZYT A;  1TF1 A;  3FYZ A;  4E3N A;  4LV3 A;  3LR4 A;  3E4O A;  2AVX A;  2VEA A;  1N4O A;  2WAE A;  1Q2P A;  1YSQ A;  3LI8 A;  3LYX A;  1KVM A;  5GLC A;  2K2N A;  3V39 A;  4DDY A;  1NZO A;  1VET B;  4LV0 A;  2VA0 A;  4X68 A;  3KX0 X;  5HZH A;  2CMN A;  3O86 A;  4IHQ A;  3OCL A;  2ZQ7 A;  4BBT A;  5HDD A;  3KSG A;  4S2O A;  4FH4 A;  3GQZ A;  1BZA A;  2J9P A;  3E0Y A;  1BUE A;  4PAU A;  4OH0 A;  3HL9 A;  1DP8 A;  3PBO A;  3U4L P;  2ZM2 A;  3FZC A;  4B88 A;  2Y2L A;  2VV8 A;  5HAR A;  1T18 A;  3VP3 A;  4MMN A;  4X53 A;  3F1P A;  1LI9 A;  4XT2 B;  2H0Y A;  1WA9 A;  3IWO A;  5L2F A;  1YLZ A;  4PM7 A;  4HIA A;  1ES3 A;  3MFX A;  1MBL A;  5FQJ A;  1VM1 A;  2PYP A;  2ZC3 B;  3F1N B;  5C5K A;  1HZO A;  1DP6 A;  1KE4 A;  4NXF A;  5F69 A;  2W1T A;  3V5M A;  1YKD A;  3N6I A;  4CJN A;  1YMS A;  1DRM A;  4BQM A;  5HAI A;  3AGE A;  3P09 A;  1ES2 A;  4FCF A;  1D7E A;  2HDR A;  3BLM A;  3T50 A;  1RGY A;  4LEN A;  2VKS A;  2ZM8 A;  2R9W A;  3MKF A;  3MMH A;  4FH2 A;  3NY4 A;  3EGD C;  3ITA A;  5FAS A;  1FQG A;  4L9E A;  4R6L A;  3NUL A;  4HQA A;  2GX5 A;  1IYS A;  5FQM A;  4NXB A;  1OTD A;  4GD6 A;  2XSS A;  5CER A;  3S7Q A;  2VV7 A;  4WMC A;  2ZQC A;  5EVE A;  1ONG A;  2JKF A;  2VGL M;  2IWC A;  1NLZ A;  3LR0 A;  1OPX A;  4KG6 A;  2OWJ A;  4GHI B;  5IHV A;  1F98 A;  4BL3 A;  2EFU A;  2QPN A;  3D4F A;  3C7V A;  4Y13 A;  3VSK A;  3I7J A;  1Z09 A;  2KLI A;  2HGV A;  4UAA A;  4HEF A;  5G4Z A;  2WKQ A;  4JKT A;  1FSY A;  1LLB A;  4O0P A;  2D02 A;  3TJZ C;  1LSX A;  3IXD A;  3QP8 A;  2V0W A;  2OLV A;  2V1A A;  2WGV A;  1KE0 A;  4Y0T A;  3DW0 A;  3W4P A;  3HLB A;  3VV4 A;  4MNR A;  3BFD A;  3DWK A;  4N92 A;  3NEC A;  4MN6 A;  2C6W B;  1L0G A;  4OPR A;  3UME A;  1ONH A;  4LRZ E;  3MQ0 A;  4X56 A;  3IBJ A;  4GN2 A;  4KUO A;  1S1Z A;  1U60 A;  2VGJ A;  2G7U A;  5EM0 A;  2Q9M A;  4GD8 A;  2EX2 A;  4HI4 A;  4MLL A;  3UE0 A;  1ZHH B;  1OTI A;  2ZQ8 A;  1FIK A;  3UPO A;  4XT2 A;  2Y2J A;  3UE3 A;  4IVI A;  5DTT A;  1MKM A;  4S2L A;  4EQI A;  3LY4 A;  4MN5 A;  4RQ9 A;  4K0X A;  4U0T A;  5E43 A;  3DTI A;  4RVA A;  4CLC C;  1XX2 A;  3KSI A;  3PAG A;  2WZX A;  4KZ9 A;  3TG9 A;  3TE8 A;  1ERO A;  4WEJ A;  4LPZ A;  4WL9 A;  2QHK A;  1ZTU A;  5A91 A;  4EER A;  4EQ1 A;  2RCX A;  4HJ4 A;  2M1C A;  3BLS A;  1IEL A;  4L0L A;  4R3B A;  1GSV A;  4DF6 A;  4QY6 A;  1W79 A;  4Y0U A;  2DRW A;  2EWW A;  3NI9 A;  3RFB A;  4Y15 A;  5FAT A;  4S2M A;  2O0Y A;  3HCY A;  2L0W A;  1XGI A;  3VOL A;  4EUV A;  5LBR A;  4WN5 A;  4YNR A;  3HBR A;  1PZP A;  3MS6 A;  5FI6 A;  3D72 A;  2W0N A;  2ZOI A;  1PWD A;  4L9F A;  3QP1 A;  3MZE A;  1S1Y A;  1I2W A;  4DE2 A;  2V1Z A;  4GHI A;  1NYM A;  1W7F A;  4D2O A;  3IHB A;  2ZOH A;  3DTE A;  3OLO A;  1JWP A;  5IT5 A;  1G6O A;  1NXY A;  4E3L A;  3PBS A;  3C2W A;  3T4L A;  5GLD A;  3S4X A;  3V3R A;  4KQQ A;  2ZQD A;  3Q07 A;  1PWG A;  4Q0J A;  1K4E A;  5GLA A;  5FQQ A;  4OLD A;  3A3D A;  5DFX A;  4E3M A;  3BY8 A;  1CF0 A;  1S6R A;  5CHJ A;  5FQK A;  1QME A;  2OSU A;  2QJ5 A;  1G68 A;  3OBF A;  2VLG A;  2Y2H A;  2PYR A;  2IWB A;  3CAX A;  4N9L A;  4I3J A;  2ZC5 B;  2VK3 A;  5HL6 A;  4QU3 A;  1SZV A;  3O3V A;  5AQB A;  5K5B A;  4X1M A;  1CI8 A;  3CG5 A;  4O01 A;  4ARZ A;  3IF5 A;  3FWL A;  2WKE A;  4GDB A;  1Y54 A;  1D06 A;  4JGR A;  2HP9 A;  4B93 A;  3DTM A;  2J3W A;  1JWZ A;  1IKI A;  2QJ7 A;  3A3E A;  4NK3 A;  1GA9 A;  5KIZ A;  5FI7 A;  5FAP A;  1IYP A;  3BFC A;  1PFL A;  3GSG A;  4C3Q A;  3IH8 A;  3A3J A;  3H82 B;  4PHT A;  1PNE A;  5FQ9 A;  3VP4 A;  3H9W A;  3T4J A;  3LCE A;  3LEQ A;  4NXE A;  2V20 A;  5DKL A;  3MXQ A;  1D1J A;  2ACG A;  4R70 A;  2QYB A;  4EBL A;  2J3T D;  4IBX A;  1GSX A;  2MJ6 A;  4WZ5 A;  1KDS A;  5EPH A;  4PKY A;  3ZCZ A;  1MZU A;  1K55 A;  2Y2I A;  2KDK A;  3QHY A;  5G18 A;  2FZ0 A;  3E4P A;  3IX4 A;  3EEA A;  2GNX A;  4S2I A;  2XEP A;  2VGK A;  4R0Q A;  2C5W B;  4UA6 A;  3F1P B;  4HNB A;  1K54 A;  2ZQ9 A;  3MFD A;  1P9W A;  1OTE A;  3AGF A;  1A0K A;  1YPR A;  3A0V A;  5KSC A;  2VX8 A;  3G34 A;  1K57 A;  2V8F A;  3UNW A;  3MXR A;  5F1F A;  3UN7 A;  3Q81 A;  3AGD A;  4LGW A;  3BFF A;  4LV1 A;  4WM9 A;  3C5A A;  4DDS A;  2W1T B;  3JVV A;  3F1O B;  3CPT A;  2ZC6 B;  4NEE D;  3T4S A;  5EE8 A;  1F2K A;  2X01 A;  3E2L A;  5DF9 A;  3CUE C;  4MEZ A;  4IED A;  3VMA A;  5FEG A;  2XF3 A;  3TOI A;  2OAQ 1;  3T12 B;  4FUW A;  1P97 A;  4K91 A;  4KZ6 A;  1C3B A;  4JXV A;  2Q0O A;  1NRF A;  1GHP A;  2WZZ A;  4EUZ A;  4WZ5 C;  2Y91 A;  3KYZ A;  2XD5 A;  5CGW A;  1ZG4 A;  2PU4 A;  1K55 C;  1S4S A;  4BBV A;  4X6T A;  5G4Y A;  5CEC A;  2JKT M;  2Y8H A;  3Q1F A;  5F83 A;  2NUT C;  1UWP X;  5E2E A;  4R23 A;  2WGW A;  2XFS A;  1W5D A;  3PBR A;  5EEC A;  3KO6 A; 
#chains in the Genus database with same CATH homology
 2QWS A;  3E98 A;  1LT0 A;  2B02 A;  3A0S A;  4AFI A;  1STZ A;  3EGD C;  5L8M A;  1TS8 A;  4L9E A;  4R6L A;  3R4K A;  2JKT I;  1LSW A;  4HQA A;  4WF0 A;  2GX5 A;  5HPF A;  1G28 A;  1P0Z A;  4NXB A;  2V0U A;  4CLC E;  4Q0I A;  1OTD A;  2XSS A;  3CI6 A;  3T4K A;  3JVU A;  1F5M A;  3S7Q A;  2VV7 A;  4GS9 A;  2VGL M;  3H82 A;  2OOL A;  3UB6 A;  2J3T C;  5EFW A;  1TD5 A;  1NLZ A;  2O9A A;  3BWL A;  3LR0 A;  2D01 A;  4JGP A;  4M4X A;  4O8G A;  1OPX A;  3GDI A;  3ULF A;  4B9O A;  2OWJ A;  4GHI B;  1F98 A;  3FC7 A;  4ETX A;  4JGO A;  4BMW A;  4PKY G;  4EXO A;  1JNU A;  2KLI A;  2HGV A;  3BQA A;  3KSH A;  5G4Z A;  2WKQ A;  3P01 A;  2JN7 A;  4HP9 A;  3EEH A;  1UWN X;  2EA9 A;  4O0P A;  2D02 A;  4MDZ A;  3TJZ C;  3RTY A;  3E4Q A;  3T4Q A;  1LSX A;  2V0W A;  3IBR A;  2K31 A;  2V1A A;  5F6A A;  5AJG A;  2YKF A;  4NKP A;  3VV4 A;  2IA2 A;  4EEU A;  2W1R A;  4MN6 A;  3R7W B;  3CWF A;  3EWK A;  3LR5 A;  2YKH A;  2INW A;  2PR5 A;  4DJ2 A;  4HH2 A;  4UQI S;  3ICY A;  3UME A;  2O99 A;  4P6Z M;  4LRZ E;  4WUJ A;  1YAX A;  3MQ0 A;  5DKK A;  4MN7 A;  2NUP C;  4OOM A;  4HOI A;  3IBJ A;  2HF6 A;  4YWZ A;  4KUO A;  3A0R A;  1S1Z A;  2G7U A;  1T1A A;  1T1B A;  1YSP A;  2W3E A;  3D3O A;  5TJJ A;  4HI4 A;  1OJ5 A;  1W63 M;  4R38 A;  3R7W A;  1H3Q A;  3PR6 A;  3ZQ5 A;  1ZHH B;  2K7S A;  3RH8 B;  1OTI A;  4F3L B;  4XT2 A;  1EW0 A;  3S7N A;  2Z6C A;  3UE3 A;  4EES A;  4BJP A;  1MKM A;  4RQ9 A;  4MN5 A;  3F1O A;  2XA7 S;  1NLY A;  5I5L A;  2JHE A;  2HJ9 C;  4CLC D;  4CLC C;  4HHD A;  1DP9 A;  2A24 B;  3KSI A;  3LIA A;  5DJT A;  2PDR A;  3BY9 A;  3EQV A;  5DJU A;  5J4E A;  3B33 A;  3K2N A;  4F3L A;  3LUQ A;  1OT9 A;  3TE8 A;  2JKR M;  1LL8 A;  5FL3 A;  4WEJ A;  4LPZ A;  2EWV A;  2PR6 A;  3BW6 A;  3C38 A;  4WL9 A;  2BAS A;  2QHK A;  1ZTU A;  4EER A;  2L4R A;  2LB9 A;  4EQ1 A;  4HJ4 A;  3CIT A;  4BBU A;  2M1C A;  2A24 A;  3S7O A;  4HJ6 A;  4L0L A;  1GSV A;  3NOT C;  3IS2 B;  2M7V A;  5J7E A;  3C8C A;  4DMZ A;  3VE4 A;  2JKR I;  1T19 A;  1TS0 A;  4HP4 A;  3PBN A;  4G3K A;  3K3D A;  3KYQ A;  3NJA A;  5TBM B;  2EWW A;  2WKR A;  3RFB A;  1S4R A;  4Y5F A;  2HV1 A;  5F68 A;  3OC2 A;  3BQ8 A;  2PT7 A;  3HJK A;  4DJ3 A;  2O0Y A;  3PBQ A;  3HCY A;  2L0W A;  3MQQ A;  3CUE A;  3VOL A;  4EUV A;  2V1B A;  1XJ2 A;  3IS2 A;  3FG8 A;  5HD3 A;  5LBR A;  4GW9 A;  3T4T A;  4WN5 A;  4YNR A;  3PHY A;  4IJG A;  3H7W B;  3LIB A;  5AVF A;  4E04 A;  4CQH A;  3D72 A;  2W0N A;  2ZOI A;  3VE3 A;  4L9F A;  4LLO B;  4EET B;  4HY8 A;  1S1Y A;  1IOU A;  5HWV A;  2FH5 A;  3EOI A;  3LR3 A;  3LIE A;  4GHI A;  3W2Z A;  2ZOH A;  5CX7 A;  4KQD A;  3OLO A;  5IT5 A;  2VV6 A;  2Y79 A;  5HSQ A;  1G6O A;  1N9L A;  3MR0 A;  3OOV A;  3UB8 A;  4I5S A;  3LIC A;  4YOF A;  4ZRR A;  3H7W A;  3C30 A;  3PBS A;  2DMW A;  2ZMV A;  3C2W A;  4II7 A;  3UB7 A;  4Q0H A;  3T4L A;  2V9A A;  1XJ3 A;  5HD5 A;  3S7P A;  4Q0J A;  1OTB A;  4DN0 A;  4GCZ A;  2W3F A;  1N9N A;  4GJ4 A;  5DFX A;  2VGL S;  4K08 A;  1ODV A;  3BY8 A;  5F5Y A;  4L9G A;  4FSF A;  3TRC A;  4I38 A;  5HDS A;  4ARZ B;  4KUK A;  2QJ5 A;  2OAP 1;  3P7N A;  3OBF A;  2L1M A;  5HWT A;  2M7U A;  4ETZ A;  1KOU A;  2VLG A;  2PYR A;  4I3A A;  2LB5 A;  4LRY C;  4KQO A;  3TW8 A;  4G3V A;  3CAX A;  4Y2F A;  4I3J A;  5DFY A;  4NXG A;  1GSW A;  3MF0 A;  5HL6 A;  2WKP A;  5IS1 A;  2XRO A;  3NHQ A;  3B47 A;  5K5B A;  4WEL A;  1S67 L;  4R3A A;  3MJQ A;  3SW1 A;  1LSV A;  4O01 A;  5HDC A;  4ARZ A;  2KX6 A;  1BYW A;  1S66 L;  3T4O A;  1D06 A;  4JGR A;  4WLA A;  4B93 A;  2J3W A;  4WEK A;  3NOP C;  2QJ7 A;  4HH3 A;  1OTA A;  3B42 A;  5KIZ A;  4EU0 A;  4EW7 A;  3LI9 A;  4P6Z S;  3MQO A;  3FPV A;  3LIF A;  4G3W A;  1XJ6 A;  3H82 B;  4PHT A;  1NRJ A;  4I3I A;  3H9W A;  1H8M A;  3T4J A;  3G6O A;  5AVE A;  4NXE A;  1VB6 A;  5DKL A;  3MXQ A;  3BJN A;  4UQI M;  1NWZ A;  2PHY A;  3LFV A;  1W63 Q;  4CLC B;  4R70 A;  2W27 A;  2QYB A;  5J3W A;  1P9R A;  2P04 A;  3FPW A;  3ZYT A;  1TF1 A;  2ZBB A;  3CLO A;  2W3H A;  3LR4 A;  1MC0 A;  3E4O A;  1T1C A;  2J3T D;  2VEA A;  1GSX A;  1YSQ A;  3LI8 A;  2A2L A;  3LYX A;  2MJ6 A;  5TBM A;  3HJI A;  2K2N A;  4PKY A;  4HJ3 A;  1MZU A;  2VA0 A;  3UMD A;  2KDK A;  5IU1 A;  3KX0 X;  5HZH A;  4QPR A;  3U2A A;  4CLC A;  5HPI A;  2FZ0 A;  2CMN A;  2XA7 M;  3E4P A;  4ME4 A;  1XFN A;  2HJE A;  3EEA A;  4IHQ A;  3OCL A;  2GNX A;  1F9I A;  3PXP A;  4BBT A;  5HDD A;  3KSG A;  4BWI A;  5KSH A;  1UGU A;  2O9C A;  3E0Y A;  4IUK A;  5MC7 A;  4LRX C;  3F1P B;  4HNB A;  4PAU A;  3EQU A;  3PYP A;  1DP8 A;  3PBO A;  2P7J A;  1P9W A;  1OTE A;  3O5Y A;  3NOU C;  2VV8 A;  3OCN A;  1VHM A;  3A0V A;  2VX8 A;  1T18 A;  2ZMF A;  2VJW A;  4IUH A;  1OJG A;  3K3C A;  1XJ4 A;  4MMN A;  4GLQ A;  3V67 A;  3F1P A;  1Y28 A;  1TS7 A;  1V9Y A;  4XT2 B;  1WA9 A;  2J80 A;  2PD7 A;  3UE6 A;  2W1T B;  3JVV A;  2I9V A;  4I39 A;  1XFQ A;  3F1O B;  1V9Z A;  2P08 A;  4NEE D;  3T4S A;  4HIA A;  4OOL A;  3MFX A;  2W3D A;  2R78 A;  3CUE C;  4MCW A;  1OT6 A;  4JGQ A;  5DF9 A;  3LID A;  3PBT A;  5HWW A;  2GJ3 A;  4Z1W A;  2OAQ 1;  2PYP A;  4H6J B;  1P97 A;  3F1N B;  5C5K A;  1TS6 A;  2KOI A;  2GZA A;  1DP6 A;  4UEY A;  3UB9 A;  4NXF A;  2W3G A;  2H28 A;  3GEC A;  5F69 A;  2W1T A;  3KYZ A;  1YKD A;  3DBA A;  1IFQ A;  5A8B A;  2Z6D A;  4EEP A;  2PD8 A;  4FOF A;  1S4S A;  1DRM A;  1N9O A;  4BBV A;  4Y3I A;  3EGX C;  3KSF A;  2OWH A;  5G4Y A;  2JKT M;  2Y8H A;  2B18 A;  4H6J A;  1D7E A;  3F1N A;  2NUT C;  2VZW A;  1UWP X;  3T50 A;  2QKP A;  2VKS A;  4GS9 B;  2O9B A;  3PBR A;  3KO6 A;  1X0O A;  2XRN A;  3MMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...