5AVFA

The ligand binding domain of mlp37 with taurine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
244
structure length
244
Chain Sequence
GPLGSVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
total genus 77
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5avfA02
4M4XA 4I39A 5AVFA 3UMDA 1TS0A 1XFQA 3LIDA 3ICYA 2WKPA 2ZOHA 3MJQA 3E4OA 3F1OA 5G4YA 2EA9A 4HJ3A 1UWPX 4DJ2A 2ZOIA 4LRXC 2H28A 3H7WA 4BBUA 4I3IA 3F1NA 3LYXA 3MXQA 4HI4A 3UB6A 4GS9B 4E04A 3FG8A 3H82B 5HSQA 4JGRA 5HWVA 4HP4A 2CMNA 2INWA 1UWNX 3LIFA 2PHYA 4WL9A 1N9LA 3KX0X 3A0SA 2J80A 1LSWA 3E4QA 2KX6A 1V9YA 2V9AA 3BY9A 3PYPA 4JGPA 2VLGA 1GSXA 3G6OA 2PD7A 5DKKA 1OT9A 4MN5A 4L9GA 1T1AA 4NXGA 3K3CA 5HWTA 5HZHA 3P7NA 4WUJA 1OJGA 1D7EA 1XJ3A 4HNBA 1XJ6A 1ODVA 3MFXA 1N9OA 4EXOA 5HDDA 4KUKA 4HIAA 4I38A 1OTEA 3C8CA 2HV1A 3F1PA 3IS2A 2YKHA 1EW0A 1T1BA 1S1YA 4L9FA 4H6JA 1WA9A 4HQAA 4I3JA 3ZQ5A 3FC7A 4WLAA 2D01A 3OLOA 4BBVA 1V9ZA 5A8BA 4KQDA 4GHIA 4LPZA 2JN7A 1XJ4A 3EWKA 2PD8A 2QWSA 5G4ZA 1OTBA 2R78A 4PKYG 4NXEA 5IU1A 5HDSA 4EETB 2KDKA 3CAXA 4HJ6A 1MZUA 2YKFA 4F3LB 2VEAA 4R6LA 4HHDA 3LIAA 4LRYC 4I5SA 3NHQA 2PR6A 2GJ3A 3LI8A 4XT2B 3VOLA 1JNUA 2OWJA 4EEUA 3RTYA 1TS8A 4JGQA 3T50A 3H9WA 2BASA 4R38A 1TS6A 4GS9A 4L9EA 1X0OA 1P0ZA 3VE4A 3H82A 3UB7A 3NOPC 5KIZA 1OTAA 4LRZE 4WF0A 3HJKA 2VV7A 4R70A 4MN6A 4R3AA 2V1BA 4EESA 5IS1A 1S1ZA 5DKLA 3LI9A 1OTIA 5DJUA 1F9IA 5AVEA 4JGOA 3LIEA 1S4RA 3MQOA 4BBTA 3A0VA 4HH2A 2OOLA 2B02A 1P97A 3GDIA 1LSXA 2P7JA 1DRMA 2V0UA 1T18A 1GSVA 3PHYA 5EFWA 2D02A 1LT0A 2L4RA 2A24B 2VV8A 5TBMB 1D06A 3UB8A 1UGUA 1DP6A 2OWHA 5J4EA 1OJ5A 4HY8A 3LUQA 4DJ3A 3C2WA 3UB9A 1S67L 3SW1A 3LIBA 1OTDA 4EEPA 4NXBA 3LICA 3MQQA 4HOIA 2VV6A 2L1MA 3E4PA 1NWZA 3HJIA 2QHKA 4LLOB 1F98A 5F68A 3A0RA 4F3LA 4I3AA 2QKPA 1KOUA 3MR0A 3F1OB 1T1CA 3CWFA 4GW9A 4XT2A 3NJAA 1S66L 5J3WA 1LSVA 3H7WB 3UE6A 4NXFA 3F1NB 5HD3A 4KUOA 2PR5A 3CLOA 1Y28A 5F6AA 2W0NA 1BYWA 4EERA 3B33A 4HH3A 2PYPA 2V0WA 4EQ1A 2WKQA 2V1AA 1N9NA 1LL8A 3RH8B 2I9VA 3K3DA 1DP8A 4HJ4A 1XFNA 2QJ5A 2PYRA 2L0WA 4K08A 1XJ2A 2Z6DA 4EW7A 4GCZA 2Z6CA 3NOUC 4PKYA 4HP9A 4B9OA 2W27A 2K7SA 1GSWA 3BY8A 5DJTA 4WN5A 4RQ9A 5HD5A 1DP9A 2JHEA 5F5YA 2QJ7A 5I5LA 1S4SA 2A24A 3IBRA 1OT6A 1TS7A 1VB6A 4YWZA 2WKRA 5TBMA 3VE3A 3NOTC 3BWLA 3GECA 5F69A 2ZBBA 5HDCA 5HWWA 3F1PB 3IS2B 3EEHA 4H6JB 3UMEA 3D72A 3ULFA 1T19A 5J7EA 2PDRA 2M1CA 4GHIB 1G28A
chains in the Genus database with same CATH superfamily
1WYCA 3UN7A 1TS0A 2J3TD 4HESA 4P0MA 5GLBA 3SS3A 1BLSA 4ZAMA 4Q0IA 4Y7PA 1XXMA 3MJQA 2ZC5B 5G4YA 3BFCA 4EBLA 1UWPX 4DJ2A 1HVBA 3IF6A 5FAQA 3OPLA 4EV4A 2W1TA 5HX9A 4II7A 3H7WA 3UE1A 3LYXA 1CI8A 4HI4A 4GS9B 4X53A 2ZQ8A 3Q7VA 4E04A 5J8XA 4JGRA 2CMNA 3D4FA 5HFOA 4UA7A 2ZMAA 3KSGA 3LIFA 4QJGA 1YKDA 1GHPA 2Y4AA 4FH2A 3VP3A 4O0PA 2J80A 3CITA 4WYYA 4Y0TA 1FCMA 1V9YA 3BY9A 4QY6A 4O01A 3EGDC 4JGPA 3PBTA 3L9KA 3LCEA 3PR6A 3W4PA 2XLNA 2PD7A 1I5QA 4B93A 2C6WB 2ZQAA 1OT9A 1T1AA 4KZ6A 3T4SA 5EVLA 2H10A 4NXGA 5EVID 1K6RA 4QHCA 4IJGA 1FR1A 1ES2A 4JXSA 3O5YA 3IXDA 1VHMA 3VOZA 4OPYA 3TW8A 4BWIA 2WZXA 4LV3A 1ZHHB 5HDDA 5KZHA 3B47A 5DF8A 3CG5A 4I38A 3HUNA 4QD4A 2J3TC 3ZNYA 1ERMA 2Q9NA 4K0XA 5CECA 2ZC3B 4MBKA 4L9FA 5JYOA 1WA9A 3T4TA 4NEED 4HQAA 1Z09A 3EOIA 5CRFA 4R4RA 4Y0OA 4R3BA 4BBVA 1GCEA 4EWFA 4DXCA 1V9ZA 5A8BA 1Y54A 1CQAA 2O9BA 3FKVA 5CHMA 2JN7A 5HL1A 1XJ4A 2QWSA 2A2LA 4YFMA 1NXYA 3SS5A 5HDSA 1O7EA 4HJ6A 4ZJ2A 4BLMA 4E3OA 3QNBA 4F3LB 2VEAA 3D9YA 5A91A 3QP5A 4LV1A 3QP8A 4P6BA 4MBFA 4PM9A 2OAP1 4XT2B 1NJ4A 1JNUA 2ZQ9A 3CMZA 5F1GA 3GSGA 3LO7A 3H9WA 4OOYA 4R38A 1VEUB 4X1MA 4L9EA 3LEQA 2FZ0A 1FOFA 1MKMA 4P85A 3C4OA 1OTAA 5M1AA 3OCLA 4R70A 4R3AA 1SKOA 4ARZA 5EVIC 2Y2IA 4E3MA 4MEZA 1S1ZA 4N9LA 4Q0JA 1PW8A 4IVKA 2VGKA 1F9IA 5FEFA 3IQAA 3LIEA 1I2WA 3U4LP 3A3DA 4BBTA 3A0VA 4X55A 2OOLA 4H8RA 4HH2A 5EUAA 3BFDA 4HEFA 2B02A 2P08A 3TG9A 2BLSA 3LGOA 4P6ZM 3UE0A 1W63Q 3SH7A 3ZVWA 5IHVA 5DFYA 5EFWA 3DTIA 3UDXA 1BT5A 5CHUA 1CF0A 2JKRM 2L4RA 4CJNA 2A24B 2C5WB 2WZZA 3UB8A 2J8YA 3S1YA 1PWGA 4R23A 2H5SA 2A49A 1G5UA 4UAAA 1LI9A 1SDNA 3LUQA 3LR4A 5DTKA 3PAGA 4ZTKA 4LENA 1K25A 3W2ZA 3HLDA 3HLGA 1OTDA 2L1MA 2CC1A 3WRTA 2QPNA 2X02A 3ZHHA 3T12B 4HBUA 1CEGA 2ZC4B 2R9WA 5D3OA 5E43A 2QKPA 2W3DA 1F5MA 3M6HA 3CWFA 5EV0A 3VV4A 1PFLA 3NJAA 4QY5A 2GZAA 1S66L 3NBLA 3IF6B 1PRQA 2W1TB 3H7WB 5HAQA 4NG2A 2X71A 2PR5A 5E2HA 3C7VA 1W8QA 2W0NA 1BYWA 1RGYA 4MLLA 1XA1A 3Q7VB 3GR2A 1TF1A 4E3KA 2V0WA 3O3VA 2V1AA 4FD8A 3KO6A 1XPBA 1FCNA 2ZQCA 1K4EA 5HARA 4HJ4A 1MWUA 1JWZA 2B95A 3Q7ZA 4K08A 5E2EA 5E2GA 2K2NA 1ZTUA 3RFBA 2Z6CA 4JXGA 1ESUA 1Q2PA 3WS5A 3S22A 3HLEA 5EVIB 1Q2QA 3MKEA 4Y3IA 1W7FA 4KG6A 4WN5A 3KSIA 4RQ9A 5HD5A 1TEMA 1K54A 3ZDJA 3QP1A 2JHEA 4OLGA 5EPHA 3A3EA 1TS7A 1VB6A 2Y2GA 4JXVA 1E3UA 5TBMA 1E3UD 4CLCE 4OKPA 1PNEA 4IVIA 1BLCA 1JWPA 5I94A 1Z6FA 1MWRA 2OLVA 3D72A 1CK3A 5KSHA 1JVJA 3DAVA 3O88A 2M1CA 3G32A 2IA2A 3G34A 1G28A 1PZPA 5TFQA 5AVFA 1YSQA 4BD0A 3UMDA 1K0KA 1K38A 1JTDA 4KZ3A 5F83A 4PM7A 3LIDA 4KZ7A 5A90A 5FQJA 3TSGA 2EA9A 3TRCA 2Y55A 2HDUA 1DY6A 3T1XA 4O7DA 1F2KA 2HJEA 4LRXC 2Y2OA 3NIAA 2Y2NA 4BBUA 5GLCA 3MXQA 1EWZA 2O99A 1SZVA 3CI6A 3Q81A 4PHTA 5FL3A 3M2JA 4Y15A 1IFQA 3S7PA 1MPLA 4S2NC 3VSKA 5HSQA 2J7VA 5FI2A 3NI9A 1FSYA 1VETA 1ACFA 4ZJ3A 4IBXA 5CEBA 4LCMA 1UWNX 1TD5A 3BFGA 1PI4A 3KX0X 3NY4A 1SKOB 3MSHA 4ARZB 2JBFA 4E6WA 2H0YA 1LSWA 1P9WA 4D60A 3E4QA 1IYPA 1P9RA 3HLWA 3WS4A 2PRFA 1XKZA 3PYPA 2HP9A 3WWXA 2VLGA 3UDFA 1IYQA 3G6OA 3UPOA 1Y4OA 2V2FF 3CUEC 2Y8HA 1MC0A 4L9GA 3ZG8B 5C5KA 2XFSA 2WKEA 4XUZA 2XGNA 4OQIA 3K2NA 3UPNA 2ZC6B 3C4PA 3S4XA 4FSFA 3T1QB 4OP8A 2ZLYA 1M40A 3IHBA 5HZHA 1G68A 5L07A 2EWWA 3B3XA 4PMAA 4X25A 1STZA 5GHZA 1H8ZA 3PTEA 3VMAA 2UV0E 4JXWA 2OLUA 4BL3A 2RCXA 1E4DA 2O9AA 4HIAA 1HLUP 5GL9A 1YLTA 4FTXA 4CQHA 2E8IA 3F1PA 3IS2A 1YLWA 1T1BA 3AGFA 1S1YA 1ESIA 5TR7A 2QMIA 3CZDA 3ZQ5A 1LLBA 4JF6A 4WLAA 4OONA 3KYQA 2W1RA 1JWVA 4GHIA 2BG1A 2NUTC 4Q8IA 5FQIA 4MBHA 2R78A 2JKGA 3OCNA 5HPIA 5IU1A 2KDKA 2R9XA 4KQOA 2YKFA 3ZFZA 3VOYA 3HUMA 5CX7A 3S7QA 3LIAA 2Y2MA 3DW0A 2ZL1A 4P6ZS 1HD8A 2VK3A 4KENB 3VOLA 4GNUA 1KDWA 5LBRA 4EEUA 3IF5A 4OPQA 4BQMA 4EBPA 3N8LA 4JGQA 3LR0A 1E25A 1IYSA 2WKIA 4UA6A 2NUPC 2Y59A 3ZG5A 1P0ZA 3UB7A 3NOPC 5KIZA 4OVDA 3NC8A 1JTGA 4LRZE 1CJFA 2EFUA 2VV7A 4MN6A 3BQAA 4OQHA 2J9OA 3JYIA 5DKLA 3BFFA 3LI9A 1XGIA 1OTIA 1YMXA 2G7UA 5DJUA 3V39A 3G30A 5AVEA 4JGOA 1S4RA 2XD5A 3MQOA 2HDQA 3IT9A 2XR0A 3OC2A 1FQGA 1P97A 2W3HA 4GN2A 2FFFB 4C6YA 2HPBA 1PWCA 1YLZA 3QP2A 1K56A 2V0UA 4IUKA 1FIKA 3N8RA 2P74A 3T1RA 2UWXA 1H8MA 2WADA 4MN7A 4OOLA 2J9PA 1ONGA 5TBMB 4EQIA 4G3VA 2OWHA 5J4EA 1OJ5A 4BL2A 4JLFA 2WYXA 4DJ3A 5CGSA 3C2WA 3UB9A 1S67L 2X01A 1L2SA 3SW1A 4X1LA 3IH8A 4FCFA 3IF6C 5CTMA 4NXBA 5CHJA 4HOIA 5CERA 3OPPA 1NWZA 2QHKA 3A3JA 4OQ0A 3T4QA 4R0QA 1IELA 5L8MA 3W8KA 3KYEA 3A0RA 4GLQA 3Q07A 1KOUA 3FWLA 3GMWA 1SKFA 2HJ9C 4OLDA 4YINA 1NLYA 4GW9A 3EEAA 4D2OA 5FI7A 3C30A 4LCLA 3MXSA 3UE6A 2JKTI 1GA9A 5EECA 2JC7A 3PAEA 4KUOA 3CLOA 5EM0A 2IWBA 1K55A 2ZM8A 2H0TA 4WM9A 3B33A 4OPZA 4S2OA 2Q0OA 3G2YA 2A3UA 5G18A 2G2UA 1L0DA 2WKQA 2FH5A 1N9NA 3BYDA 4LFUA 2Z2MB 1ES3A 3K3DA 1MBLA 2Y79A 4CLCA 1XFNA 1K57A 5FQ9A 2PYRA 2L0WA 1BULA 2HDRA 1IKGA 2ZD8A 3NOUC 5DTSA 4QB8A 3BEBA 2W27A 1PWDA 4GOGA 3BY8A 1ZG4A 2E8JA 3MBZA 2HP5A 1DP9A 1PIOA 5I5LA 3V3RA 3RXXA 5DFXA 3LY4A 3TE8A 3GECA 2XK1A 5F69A 5FASA 2WGWA 2GX5A 3NDGA 5HWWA 3F1PB 1RP5A 3IS2B 1WYBA 3SH9A 1G6OA 5CGXA 3HLBA 1ES5A 3HVFA 1ALQA 5J7EA 2PDRA 5M19A 3L7HA 5GHYA 4FUWA 1K4FA 4GHIB 1NZOA 3ZCZA 4I39A 1PI5A 5GLDA 1EI5A 1DJAA 1XFQA 1S0WA 3UDIA 3R7WA 2ZM2A 3E4OA 3F1OA 1NYMA 4HJ3A 1BSGA 3MMHA 2IWDA 3M6BA 1J3WA 2ZL1B 3RJUA 2H28A 5CTNA 1TDLA 1LL5A 4I3IA 3F1NA 2P9VA 3AGEA 1YQSA 3MZDA 4NETA 3PBOA 2GNXA 3FG8A 4ME4A 4DE0A 4HP4A 2INWA 4DXBA 1XGJA 4OPRA 2PHYA 4KZBA 1N9LA 3BRMA 3A0SA 4DN0A 5E2FA 3V50A 4KZ5A 2KX6A 2V9AA 2ACGA 4Y13A 3CPTA 1GSXA 4MCWA 1OPXA 2O0YA 1SHVA 2ZMFA 2JCHA 4E3LA 3BQ8A 2Q9MA 5FQQA 4UEYA 2B18A 4A5RA 5HWTA 3D3OA 4B4XA 3OZHA 3P7NA 4WUJA 1OJGA 3OPRA 2M7VA 3C7UA 1D7EA 1RGZA 2W3FA 2V1ZA 3BECA 3EQVA 4EBNA 1HTZA 4DE2A 5JYPA 5EM1A 1N9BA 1ODVA 4MMNA 3ITAA 3E2KA 5TGFA 4Y17A 1CI9A 1N4OA 4NKPA 3GTCA 2PBDP 5DVAA 4GD6A 1WE4A 2HV1A 4F94A 3WS0A 1LL9A 4H6JA 5KMWA 3HLFA 1J9MA 4UA9A 3G35A 2D01A 3OLOA 3G2ZA 3JVUA 4WZ5A 4KQDA 4LPZA 3EQUA 3EWKA 2PD8A 1OTBA 4PKYG 3FYZA 3CAXA 1ZG6A 1MZUA 1YLJA 5FAOA 3T1SA 4R6LA 3DTMA 3W4OA 2PR6A 4P87A 2XF3A 3T4LA 3ZYTA 1XA7A 3RTYA 5DF9A 1TS8A 2PT7A 3GRJA 4ZBEA 4DDYA 2BASA 4ID4A 1TS6A 4S2MA 4GD8A 3VE4A 3H82A 1PZOA 4DMZA 3IXHA 3DTKA 1U60A 1H8YA 4WF0A 4S2KA 5FATA 2MJ6A 2PBYA 1FSWA 3VP0A 4EESA 3BW6A 2ZQDA 1K54C 5IS1A 2EX8A 4FOFA 3VSLA 3IXGA 4FH4A 2RL3A 2LB5A 2JKRI 5FI6A 4WEKA 4M3KA 3GDIA 1LSXA 1TVFA 4CPKA 5EVEA 1KE0A 1O07A 3U2AA 1TDGA 1DRMA 2OV5A 4PM5A 3P01A 2EWVA 3PHYA 1KGEA 2D02A 1LT0A 2DNSA 3MFDA 3NDEA 4JPMA 2VV8A 3DWZA 3G4PA 5FDSA 1D06A 2VJWA 1UGUA 4KZ9A 3HREA 2WGWB 4ETXA 4HY8A 3TOIA 2HF6A 4RYEA 5CGWA 2QZ6A 4IUHA 5L10A 2PAVP 1G6AA 3VFFA 3MQQA 3WRZA 2VV6A 3WS2A 2BTFP 3ITBA 5FEGA 4E3IA 4LGWA 2HDSA 2W3EA 3E4PA 3HJIA 4LLOB 4DF6A 1F98A 3ZG0A 3A3IA 3B42A 3DWKA 3VP4A 5AQAA 3IXBA 2XROA 2VGLM 4UHUA 3MZFA 3R7WB 3MR0A 3F1OB 1GHIA 2XA7M 4OH0A 3SZTA 2EFXA 4N92A 1LHYA 3BFEA 5J3WA 1LSVA 2XFTA 1K6SA 4NXFA 3F1NB 1XX2A 1ONHA 3O86A 1MY8A 1BZAA 2P9VB 1A0KA 1NRFA 5F6AA 2EXAA 3HCYA 5EOOA 3A3FA 4HH3A 4K0WA 3W4QA 3N6IA 4PAUA 2WUQA 3I7JA 1YT4A 1NYYA 3PXPA 5AQ7A 3PBSA 3T4JA 2I9VA 4KQQA 1DP8A 1KE4A 5HAIA 2FFYA 1L3LA 3NCKA 2AVXA 2W3GA 4HBTA 4YNRA 3IH9A 1H3QA 3CPTB 2B5RA 4GJ4A 4HP9A 1K56D 4BMWA 3TJZC 5AJGA 5AQBA 4MNRA 2K7SA 2Z2LB 4RVAA 3S7NA 1YLYA 3IHAA 2Y2JA 5DJTA 3LR3A 5EVIA 3IX3A 1H5XA 2KOIA 3IWOA 3UE3A 3NULA 1BLHA 4RA7A 4KG2A 4Q0HA 1S4SA 3VP1A 2XSSA 4YWZA 2WKRA 3HLCA 3JPUA 2PU2A 4S2PA 3FZCA 3BWLA 4GDNA 2XD1A 2Y2LA 2ZBBA 1BLPA 1FILA 1QMFA 3HUOA 4H6JB 4Y2FA 3ULFA 1T19A 3UB5P 2XEPA 1MKIA 4X69A 2XQZA 4RX2A 3Q1FA 4M4XA 2OAQ1 4K91A 4ZJ1A 4GKUA 1YM1A 3E2LA 3IX4A 3ICYA 4JF4A 2WKPA 3FPWA 2ZOHA 2OSUA 3IBJA 4JF5A 1C3BA 4PM8A 1MXOA 1BUEA 3RXWA 3AGDA 1W63M 2ZOIA 3VP2A 2ZJ9A 4MDZA 1ZC2A 5CXWA 3UB6A 3KSFA 2HZ5A 4C3QA 4LV0A 3FKWA 1VETB 2ZM0A 2LB9A 1I2SA 3NECA 3H82B 4UQIM 2DCFA 1NY0A 5HWVA 5A93A 4JKTA 4GZBA 4WBGA 4WL9A 1L0EA 4WMCA 4EUZA 4R4SA 3UO9A 4CLCD 2ZQ7A 4WMCD 3UNWA 3MF0A 4N1HA 4DRTA 3BLMA 3QHYA 1ZKJA 3T4KA 4Y0UA 5KSCA 1KDSA 3LEZA 4U0XA 1NRJA 3PBQA 1AWIA 2HP6A 1L0FA 5DKKA 3SS4A 3ZNTA 4MN5A 4WEJA 1MWSA 2EX2A 3K3CA 4XXRA 3T4OA 5BOHA 2G2WA 2PU4A 1XJ3A 1IYOA 1PYYA 4HNBA 4Z1WA 3EGXC 1L0GA 4ETZA 1XJ6A 2Y2HA 4Y5FA 3N4IA 4DKIA 3MFXA 1N9OA 4EXOA 1YAXA 5U47A 2XRNA 4KUKA 5A92A 5FQMA 4BD1A 1OTEA 3C8CA 3MKFA 4XUXA 1FCOA 1EW0A 2YKHA 1W5DA 3MQ0A 2WAEA 4I3JA 4L0LA 2IWCA 3FC7A 3N8SA 2ZC7A 3PBNA 3V67A 4RX3A 4S2LA 5F1FA 3BM6A 5M18A 5G4ZA 5EE8A 2M7UA 3E98A 3P09A 4N9KA 1K55C 3IWIA 1W8YA 5EOEA 4NXEA 1W79A 1KVLA 4EETB 1OMEA 3DTEA 5FAPA 1VQQA 2DMWA 5HAPA 4HHDA 4N1XA 4LRYC 4I5SA 2JE5A 3NHQA 1YSPA 2HGVA 4QU3A 2GJ3A 3LI8A 3VFHA 4IBRA 2ZMVA 4LV2A 3SH8A 3OOVA 4CLCC 1GA0A 2OWJA 2Y91A 1K57C 1EROA 5MC7A 4PPRA 3WS1A 2V20A 3KYZA 4ZRRA 3T50A 4AFIA 2WAFA 4GS9A 1KGFA 1X0OA 2Y2PA 3V5MA 1M6KA 3Q82A 4QWOA 1KE3A 4R3JA 3HJKA 2DRWA 3MZEA 5AQ9A 3ZVTA 5DTTA 2V8FA 1NLZA 2V1BA 1IOUA 3MS6A 5CEDA 3QP6A 3JVVA 4E3JA 1GHMA 3GQZA 2VGJA 3DBAA 5GLAA 3O87A 1D1JA 4KZ8A 2GDNA 1YPRA 4GB7A 4IHQA 2P7JA 4S2NA 3GV9A 2I72A 1KGGA 5L2FA 1T18A 4ESPA 2VGLS 3LFVA 1GSVA 1IEMA 2XA7S 1DJCA 2KLIA 3P98A 4KQRA 2VZWA 3IWQA 5HW3A 2Y2QA 4KG5A 3ZG7B 2XH9A 4PM6A 3G31A 5DF7A 4DE3A 4OP5A 3ZGAB 1PW1A 2WK0A 3IX8A 3OBFA 3CUEA 5FQKA 1DP6A 5GHXA 4KZAA 5FDHA 3MXRA 3S7OA 3FPVA 2V8CA 2EX9A 2VX8A 3LIBA 4OOMA 3UPPA 4EEPA 2XDMA 3LICA 3C38A 2WGIA 4R1GA 1SDEA 1RCJA 1XP4A 4BENA 3ISGA 1ES4A 3HL9A 4DDSA 2VA0A 1MWTA 5TJJA 3HBRA 5FSRA 5F68A 3GVBA 4F3LA 4I3AA 4IEDA 2P04A 1BTLA 3QP4A 3BLSA 4C75A 1QMEA 4G3WA 1T1CA 4QPRA 4XT2A 1ERQA 4E3NA 4WZ4A 4EU0A 3M2KA 4X56A 4X68A 2VKSA 1IKIA 1VEUA 5HD3A 4Z9QA 4YOFA 3LR5A 1Y28A 4JBFA 3N7WA 4EERA 4GDBA 2PYPA 2WKHA 5HPFA 4KZ4A 2QYBA 4EQ1A 1NZUA 4U3TA 2J3WA 2Y2KA 3LY3A 1LL8A 3RH8B 4CLCB 3OPHA 3UY6A 4OQGA 1DJBA 4X6TA 4G3KA 2JKTM 2QJ5A 4O8GA 5IT5A 3C5AA 1XJ2A 2Z6DA 1YLPA 4EW7A 4NK3A 4GCZA 1HZOA 4PKYA 2O9CA 5HL6A 1SCWA 1LI0A 4B9OA 3E0YA 3V3SA 2WGVA 1GSWA 5FA7A 3R4KA 2K31A 2EX6A 4EUVA 4B88A 3CHWP 1VM1A 1KVMA 3KSHA 4S2JA 3CJMA 4WZ5C 5F5YA 4DE1A 2QJ7A 3BJNA 5K5BA 1CEFA 3ZG9B 1FR6A 2A24A 1OT6A 3IBRA 3SOIA 5F82A 3VE3A 3NOTC 3PBRA 4E6XA 5HDCA 5L09A 3EEHA 4UQIS 4BJPA 3UMEA 4ZDXA 1AXBA 4U0TA 1H0MA 3QNCA 4S2IA 1YMSA 2EXBA 3FV7A 4B4ZA 4WELA 2JKFA 1S6RA
chains in the Genus database with same CATH topology
4M4XA 2OAQ1 4I39A 5AVFA 1YSQA 3UMDA 1TS0A 2J3TD 1XFQA 3LIDA 4Q0IA 3ICYA 2WKPA 3FPWA 3R7WA 2ZOHA 3MJQA 3E4OA 3IBJA 3F1OA 5G4YA 2EA9A 3TRCA 4HJ3A 3MMHA 1W63M 1UWPX 4DJ2A 2ZOIA 2HJEA 4LRXC 2H28A 2W1TA 4II7A 3H7WA 4BBUA 4MDZA 4I3IA 3F1NA 3LYXA 3MXQA 4HI4A 3UB6A 3KSFA 2O99A 3CI6A 4GS9B 4PHTA 5FL3A 3PBOA 2GNXA 2LB9A 1IFQA 3FG8A 4ME4A 3S7PA 3H82B 4E04A 4UQIM 5HSQA 4JGRA 5HWVA 4HP4A 2CMNA 2INWA 1UWNX 1TD5A 3KSGA 3LIFA 2PHYA 4WL9A 1YKDA 1N9LA 3KX0X 4ARZB 4O0PA 3A0SA 4CLCD 2J80A 4DN0A 3CITA 1LSWA 1P9WA 3E4QA 2KX6A 3MF0A 1V9YA 2V9AA 3BY9A 1P9RA 4O01A 3EGDC 3PYPA 4JGPA 3T4KA 3PBTA 2VLGA 3PR6A 1GSXA 3G6OA 1NRJA 3PBQA 4MCWA 2PD7A 4GHIB 1OPXA 2O0YA 2ZMFA 4B93A 5DKKA 1OT9A 4MN5A 3CUEC 2Y8HA 1MC0A 1T1AA 4L9GA 4WEJA 3BQ8A 5C5KA 3T4SA 3K2NA 4NXGA 3K3CA 4FSFA 4UEYA 2B18A 3T4OA 5HWTA 3D3OA 5HZHA 3P7NA 2EWWA 4WUJA 1OJGA 2M7VA 1D7EA 1XJ3A 4IJGA 1STZA 2W3FA 3EQVA 4HNBA 3O5YA 3EGXC 4Z1WA 4ETZA 1XJ6A 4Y5FA 1VHMA 1ODVA 4MMNA 3TW8A 4BWIA 3MFXA 1N9OA 4EXOA 1YAXA 5HDDA 1ZHHB 2XRNA 4KUKA 2O9AA 3B47A 4NKPA 4HIAA 4I38A 1OTEA 3C8CA 2HV1A 2J3TC 4CQHA 3F1PA 3IS2A 2YKHA 1EW0A 1T1BA 1S1YA 4L9FA 4H6JA 3MQ0A 1WA9A 3T4TA 4NEED 4HQAA 3EOIA 4I3JA 4L0LA 3ZQ5A 3FC7A 4WLAA 2D01A 3OLOA 3PBNA 4BBVA 3KYQA 2W1RA 1V9ZA 3V67A 5A8BA 3JVUA 4KQDA 4GHIA 4LPZA 2O9BA 2NUTC 2JN7A 3EQUA 1XJ4A 3EWKA 2PD8A 2QWSA 2A2LA 5G4ZA 1OTBA 2M7UA 3E98A 2R78A 4PKYG 3OCNA 4NXEA 5HPIA 5IU1A 5HDSA 4EETB 2KDKA 3CAXA 4HJ6A 4KQOA 1MZUA 2YKFA 2DMWA 4F3LB 2VEAA 4R6LA 5CX7A 4HHDA 3S7QA 3LIAA 4LRYC 4I5SA 3NHQA 2PR6A 1YSPA 2HGVA 2GJ3A 3LI8A 4P6ZS 2ZMVA 2OAP1 4XT2B 3VOLA 1JNUA 3OOVA 3T4LA 3ZYTA 2OWJA 4CLCC 5LBRA 4EEUA 3RTYA 5DF9A 5MC7A 1TS8A 2PT7A 3KYZA 4JGQA 4ZRRA 3LR0A 3H9WA 3T50A 2BASA 4AFIA 4R38A 1TS6A 4GS9A 4L9EA 1X0OA 2NUPC 1P0ZA 2FZ0A 3VE4A 3H82A 3UB7A 3NOPC 4DMZA 5KIZA 1MKMA 1OTAA 4LRZE 4WF0A 3HJKA 2MJ6A 2VV7A 3OCLA 4R70A 4MN6A 3BQAA 4R3AA 1NLZA 4ARZA 2V1BA 1IOUA 4EESA 3BW6A 5IS1A 3JVVA 1S1ZA 4FOFA 5DKLA 4Q0JA 3LI9A 1OTIA 2G7UA 5DJUA 1F9IA 5AVEA 4JGOA 3LIEA 3DBAA 2LB5A 1S4RA 2JKRI 3MQOA 4BBTA 3A0VA 4HH2A 2OOLA 3OC2A 4WEKA 2B02A 1P97A 3GDIA 1LSXA 4IHQA 2W3HA 2P08A 2P7JA 3U2AA 1DRMA 2V0UA 1T18A 4IUKA 4P6ZM 1W63Q 2VGLS 3LFVA 1GSVA 5DFYA 3P01A 2XA7S 2EWVA 2KLIA 3PHYA 5EFWA 2VZWA 2D02A 1H8MA 1LT0A 2JKRM 2L4RA 4MN7A 2A24B 4OOLA 2VV8A 5TBMB 4G3VA 1D06A 2VJWA 1UGUA 3UB8A 3OBFA 3CUEA 1DP6A 2OWHA 3S7OA 5J4EA 1OJ5A 4ETXA 3FPVA 4HY8A 2HF6A 3LUQA 3LR4A 4DJ3A 3C2WA 3UB9A 1S67L 3SW1A 3W2ZA 2VX8A 3LIBA 4OOMA 1OTDA 4IUHA 4EEPA 4NXBA 3LICA 3MQQA 4HOIA 2VV6A 2L1MA 3C38A 2W3EA 3E4PA 1NWZA 3HJIA 2QHKA 2VA0A 4LLOB 5TJJA 3T4QA 1F98A 5F68A 5L8MA 3A0RA 3B42A 4F3LA 4I3AA 2QKPA 4GLQA 2P04A 2XROA 1KOUA 2VGLM 3R7WB 2W3DA 3MR0A 3F1OB 2XA7M 2HJ9C 4G3WA 1F5MA 1T1CA 3CWFA 4QPRA 3VV4A 1NLYA 4GW9A 4XT2A 3EEAA 3NJAA 2GZAA 3C30A 1S66L 5J3WA 2W1TB 4EU0A 1LSVA 3H7WB 3UE6A 4NXFA 2JKTI 2VKSA 3F1NB 5HD3A 4KUOA 2PR5A 4YOFA 3CLOA 3LR5A 1Y28A 5F6AA 2W0NA 1BYWA 3HCYA 4EERA 3B33A 4HH3A 1TF1A 2PYPA 5HPFA 2V0WA 2QYBA 2WKQA 4EQ1A 2FH5A 2J3WA 4PAUA 2V1AA 1N9NA 3KO6A 3PXPA 1LL8A 3RH8B 4CLCB 3PBSA 3T4JA 2I9VA 3K3DA 1DP8A 2Y79A 4HJ4A 4CLCA 1XFNA 4G3KA 2JKTM 2QJ5A 4O8GA 2PYRA 2L0WA 2W3GA 5IT5A 4K08A 4YNRA 1XJ2A 2Z6DA 4EW7A 1H3QA 4GCZA 2K2NA 1ZTUA 3RFBA 2Z6CA 3NOUC 4PKYA 2O9CA 4GJ4A 5HL6A 4HP9A 4BMWA 4B9OA 3TJZC 3E0YA 5AJGA 2W27A 2K7SA 1GSWA 3BY8A 3R4KA 2K31A 3S7NA 4Y3IA 5DJTA 3LR3A 4WN5A 3KSIA 4RQ9A 5HD5A 4EUVA 3KSHA 1DP9A 2KOIA 2JHEA 3UE3A 5F5YA 2QJ7A 5I5LA 3BJNA 5K5BA 4Q0HA 1S4SA 2A24A 3IBRA 1OT6A 1TS7A 1VB6A 2XSSA 4YWZA 2WKRA 5DFXA 5TBMA 4CLCE 3VE3A 3NOTC 3PBRA 3BWLA 3GECA 3TE8A 5F69A 2ZBBA 2GX5A 5HDCA 5HWWA 3F1PB 3IS2B 3EEHA 4UQIS 4BJPA 4H6JB 3UMEA 1G6OA 3D72A 4Y2FA 3ULFA 1T19A 5KSHA 5J7EA 2PDRA 2M1CA 4WELA 2IA2A 1G28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4X A;  4I39 A;  5AVF A;  3UMD A;  1TS0 A;  1XFQ A;  3LID A;  3ICY A;  2WKP A;  2ZOH A;  3MJQ A;  3E4O A;  3F1O A;  5G4Y A;  2EA9 A;  4HJ3 A;  1UWP X;  4DJ2 A;  2ZOI A;  4LRX C;  2H28 A;  3H7W A;  4BBU A;  4I3I A;  3F1N A;  3LYX A;  3MXQ A;  4HI4 A;  3UB6 A;  4GS9 B;  4E04 A;  3FG8 A;  3H82 B;  5HSQ A;  4JGR A;  5HWV A;  4HP4 A;  2CMN A;  2INW A;  1UWN X;  3LIF A;  2PHY A;  4WL9 A;  1N9L A;  3KX0 X;  3A0S A;  2J80 A;  1LSW A;  3E4Q A;  2KX6 A;  1V9Y A;  2V9A A;  3BY9 A;  3PYP A;  4JGP A;  2VLG A;  1GSX A;  3G6O A;  2PD7 A;  5DKK A;  1OT9 A;  4MN5 A;  4L9G A;  1T1A A;  4NXG A;  3K3C A;  5HWT A;  5HZH A;  3P7N A;  4WUJ A;  1OJG A;  1D7E A;  1XJ3 A;  4HNB A;  1XJ6 A;  1ODV A;  3MFX A;  1N9O A;  4EXO A;  5HDD A;  4KUK A;  4HIA A;  4I38 A;  1OTE A;  3C8C A;  2HV1 A;  3F1P A;  3IS2 A;  2YKH A;  1EW0 A;  1T1B A;  1S1Y A;  4L9F A;  4H6J A;  1WA9 A;  4HQA A;  4I3J A;  3ZQ5 A;  3FC7 A;  4WLA A;  2D01 A;  3OLO A;  4BBV A;  1V9Z A;  5A8B A;  4KQD A;  4GHI A;  4LPZ A;  2JN7 A;  1XJ4 A;  3EWK A;  2PD8 A;  2QWS A;  5G4Z A;  1OTB A;  2R78 A;  4PKY G;  4NXE A;  5IU1 A;  5HDS A;  4EET B;  2KDK A;  3CAX A;  4HJ6 A;  1MZU A;  2YKF A;  4F3L B;  2VEA A;  4R6L A;  4HHD A;  3LIA A;  4LRY C;  4I5S A;  3NHQ A;  2PR6 A;  2GJ3 A;  3LI8 A;  4XT2 B;  3VOL A;  1JNU A;  2OWJ A;  4EEU A;  3RTY A;  1TS8 A;  4JGQ A;  3T50 A;  3H9W A;  2BAS A;  4R38 A;  1TS6 A;  4GS9 A;  4L9E A;  1X0O A;  1P0Z A;  3VE4 A;  3H82 A;  3UB7 A;  3NOP C;  5KIZ A;  1OTA A;  4LRZ E;  4WF0 A;  3HJK A;  2VV7 A;  4R70 A;  4MN6 A;  4R3A A;  2V1B A;  4EES A;  5IS1 A;  1S1Z A;  5DKL A;  3LI9 A;  1OTI A;  5DJU A;  1F9I A;  5AVE A;  4JGO A;  3LIE A;  1S4R A;  3MQO A;  4BBT A;  3A0V A;  4HH2 A;  2OOL A;  2B02 A;  1P97 A;  3GDI A;  1LSX A;  2P7J A;  1DRM A;  2V0U A;  1T18 A;  1GSV A;  3PHY A;  5EFW A;  2D02 A;  1LT0 A;  2L4R A;  2A24 B;  2VV8 A;  5TBM B;  1D06 A;  3UB8 A;  1UGU A;  1DP6 A;  2OWH A;  5J4E A;  1OJ5 A;  4HY8 A;  3LUQ A;  4DJ3 A;  3C2W A;  3UB9 A;  1S67 L;  3SW1 A;  3LIB A;  1OTD A;  4EEP A;  4NXB A;  3LIC A;  3MQQ A;  4HOI A;  2VV6 A;  2L1M A;  3E4P A;  1NWZ A;  3HJI A;  2QHK A;  4LLO B;  1F98 A;  5F68 A;  3A0R A;  4F3L A;  4I3A A;  2QKP A;  1KOU A;  3MR0 A;  3F1O B;  1T1C A;  3CWF A;  4GW9 A;  4XT2 A;  3NJA A;  1S66 L;  5J3W A;  1LSV A;  3H7W B;  3UE6 A;  4NXF A;  3F1N B;  5HD3 A;  4KUO A;  2PR5 A;  3CLO A;  1Y28 A;  5F6A A;  2W0N A;  1BYW A;  4EER A;  3B33 A;  4HH3 A;  2PYP A;  2V0W A;  4EQ1 A;  2WKQ A;  2V1A A;  1N9N A;  1LL8 A;  3RH8 B;  2I9V A;  3K3D A;  1DP8 A;  4HJ4 A;  1XFN A;  2QJ5 A;  2PYR A;  2L0W A;  4K08 A;  1XJ2 A;  2Z6D A;  4EW7 A;  4GCZ A;  2Z6C A;  3NOU C;  4PKY A;  4HP9 A;  4B9O A;  2W27 A;  2K7S A;  1GSW A;  3BY8 A;  5DJT A;  4WN5 A;  4RQ9 A;  5HD5 A;  1DP9 A;  2JHE A;  5F5Y A;  2QJ7 A;  5I5L A;  1S4S A;  2A24 A;  3IBR A;  1OT6 A;  1TS7 A;  1VB6 A;  4YWZ A;  2WKR A;  5TBM A;  3VE3 A;  3NOT C;  3BWL A;  3GEC A;  5F69 A;  2ZBB A;  5HDC A;  5HWW A;  3F1P B;  3IS2 B;  3EEH A;  4H6J B;  3UME A;  3D72 A;  3ULF A;  1T19 A;  5J7E A;  2PDR A;  2M1C A;  4GHI B;  1G28 A; 
#chains in the Genus database with same CATH topology
 1WYC A;  3UN7 A;  1TS0 A;  2J3T D;  4HES A;  4P0M A;  5GLB A;  3SS3 A;  1BLS A;  4ZAM A;  4Q0I A;  4Y7P A;  1XXM A;  3MJQ A;  2ZC5 B;  5G4Y A;  3BFC A;  4EBL A;  1UWP X;  4DJ2 A;  1HVB A;  3IF6 A;  5FAQ A;  3OPL A;  4EV4 A;  2W1T A;  5HX9 A;  4II7 A;  3H7W A;  3UE1 A;  3LYX A;  1CI8 A;  4HI4 A;  4GS9 B;  4X53 A;  2ZQ8 A;  3Q7V A;  4E04 A;  5J8X A;  4JGR A;  2CMN A;  3D4F A;  5HFO A;  4UA7 A;  2ZMA A;  3KSG A;  3LIF A;  4QJG A;  1YKD A;  1GHP A;  2Y4A A;  4FH2 A;  3VP3 A;  4O0P A;  2J80 A;  3CIT A;  4WYY A;  4Y0T A;  1FCM A;  1V9Y A;  3BY9 A;  4QY6 A;  4O01 A;  3EGD C;  4JGP A;  3PBT A;  3L9K A;  3LCE A;  3PR6 A;  3W4P A;  2XLN A;  2PD7 A;  1I5Q A;  4B93 A;  2C6W B;  2ZQA A;  1OT9 A;  1T1A A;  4KZ6 A;  3T4S A;  5EVL A;  2H10 A;  4NXG A;  5EVI D;  1K6R A;  4QHC A;  4IJG A;  1FR1 A;  1ES2 A;  4JXS A;  3O5Y A;  3IXD A;  1VHM A;  3VOZ A;  4OPY A;  3TW8 A;  4BWI A;  2WZX A;  4LV3 A;  1ZHH B;  5HDD A;  5KZH A;  3B47 A;  5DF8 A;  3CG5 A;  4I38 A;  3HUN A;  4QD4 A;  2J3T C;  3ZNY A;  1ERM A;  2Q9N A;  4K0X A;  5CEC A;  2ZC3 B;  4MBK A;  4L9F A;  5JYO A;  1WA9 A;  3T4T A;  4NEE D;  4HQA A;  1Z09 A;  3EOI A;  5CRF A;  4R4R A;  4Y0O A;  4R3B A;  4BBV A;  1GCE A;  4EWF A;  4DXC A;  1V9Z A;  5A8B A;  1Y54 A;  1CQA A;  2O9B A;  3FKV A;  5CHM A;  2JN7 A;  5HL1 A;  1XJ4 A;  2QWS A;  2A2L A;  4YFM A;  1NXY A;  3SS5 A;  5HDS A;  1O7E A;  4HJ6 A;  4ZJ2 A;  4BLM A;  4E3O A;  3QNB A;  4F3L B;  2VEA A;  3D9Y A;  5A91 A;  3QP5 A;  4LV1 A;  3QP8 A;  4P6B A;  4MBF A;  4PM9 A;  2OAP 1;  4XT2 B;  1NJ4 A;  1JNU A;  2ZQ9 A;  3CMZ A;  5F1G A;  3GSG A;  3LO7 A;  3H9W A;  4OOY A;  4R38 A;  1VEU B;  4X1M A;  4L9E A;  3LEQ A;  2FZ0 A;  1FOF A;  1MKM A;  4P85 A;  3C4O A;  1OTA A;  5M1A A;  3OCL A;  4R70 A;  4R3A A;  1SKO A;  4ARZ A;  5EVI C;  2Y2I A;  4E3M A;  4MEZ A;  1S1Z A;  4N9L A;  4Q0J A;  1PW8 A;  4IVK A;  2VGK A;  1F9I A;  5FEF A;  3IQA A;  3LIE A;  1I2W A;  3U4L P;  3A3D A;  4BBT A;  3A0V A;  4X55 A;  2OOL A;  4H8R A;  4HH2 A;  5EUA A;  3BFD A;  4HEF A;  2B02 A;  2P08 A;  3TG9 A;  2BLS A;  3LGO A;  4P6Z M;  3UE0 A;  1W63 Q;  3SH7 A;  3ZVW A;  5IHV A;  5DFY A;  5EFW A;  3DTI A;  3UDX A;  1BT5 A;  5CHU A;  1CF0 A;  2JKR M;  2L4R A;  4CJN A;  2A24 B;  2C5W B;  2WZZ A;  3UB8 A;  2J8Y A;  3S1Y A;  1PWG A;  4R23 A;  2H5S A;  2A49 A;  1G5U A;  4UAA A;  1LI9 A;  1SDN A;  3LUQ A;  3LR4 A;  5DTK A;  3PAG A;  4ZTK A;  4LEN A;  1K25 A;  3W2Z A;  3HLD A;  3HLG A;  1OTD A;  2L1M A;  2CC1 A;  3WRT A;  2QPN A;  2X02 A;  3ZHH A;  3T12 B;  4HBU A;  1CEG A;  2ZC4 B;  2R9W A;  5D3O A;  5E43 A;  2QKP A;  2W3D A;  1F5M A;  3M6H A;  3CWF A;  5EV0 A;  3VV4 A;  1PFL A;  3NJA A;  4QY5 A;  2GZA A;  1S66 L;  3NBL A;  3IF6 B;  1PRQ A;  2W1T B;  3H7W B;  5HAQ A;  4NG2 A;  2X71 A;  2PR5 A;  5E2H A;  3C7V A;  1W8Q A;  2W0N A;  1BYW A;  1RGY A;  4MLL A;  1XA1 A;  3Q7V B;  3GR2 A;  1TF1 A;  4E3K A;  2V0W A;  3O3V A;  2V1A A;  4FD8 A;  3KO6 A;  1XPB A;  1FCN A;  2ZQC A;  1K4E A;  5HAR A;  4HJ4 A;  1MWU A;  1JWZ A;  2B95 A;  3Q7Z A;  4K08 A;  5E2E A;  5E2G A;  2K2N A;  1ZTU A;  3RFB A;  2Z6C A;  4JXG A;  1ESU A;  1Q2P A;  3WS5 A;  3S22 A;  3HLE A;  5EVI B;  1Q2Q A;  3MKE A;  4Y3I A;  1W7F A;  4KG6 A;  4WN5 A;  3KSI A;  4RQ9 A;  5HD5 A;  1TEM A;  1K54 A;  3ZDJ A;  3QP1 A;  2JHE A;  4OLG A;  5EPH A;  3A3E A;  1TS7 A;  1VB6 A;  2Y2G A;  4JXV A;  1E3U A;  5TBM A;  1E3U D;  4CLC E;  4OKP A;  1PNE A;  4IVI A;  1BLC A;  1JWP A;  5I94 A;  1Z6F A;  1MWR A;  2OLV A;  3D72 A;  1CK3 A;  5KSH A;  1JVJ A;  3DAV A;  3O88 A;  2M1C A;  3G32 A;  2IA2 A;  3G34 A;  1G28 A;  1PZP A;  5TFQ A;  5AVF A;  1YSQ A;  4BD0 A;  3UMD A;  1K0K A;  1K38 A;  1JTD A;  4KZ3 A;  5F83 A;  4PM7 A;  3LID A;  4KZ7 A;  5A90 A;  5FQJ A;  3TSG A;  2EA9 A;  3TRC A;  2Y55 A;  2HDU A;  1DY6 A;  3T1X A;  4O7D A;  1F2K A;  2HJE A;  4LRX C;  2Y2O A;  3NIA A;  2Y2N A;  4BBU A;  5GLC A;  3MXQ A;  1EWZ A;  2O99 A;  1SZV A;  3CI6 A;  3Q81 A;  4PHT A;  5FL3 A;  3M2J A;  4Y15 A;  1IFQ A;  3S7P A;  1MPL A;  4S2N C;  3VSK A;  5HSQ A;  2J7V A;  5FI2 A;  3NI9 A;  1FSY A;  1VET A;  1ACF A;  4ZJ3 A;  4IBX A;  5CEB A;  4LCM A;  1UWN X;  1TD5 A;  3BFG A;  1PI4 A;  3KX0 X;  3NY4 A;  1SKO B;  3MSH A;  4ARZ B;  2JBF A;  4E6W A;  2H0Y A;  1LSW A;  1P9W A;  4D60 A;  3E4Q A;  1IYP A;  1P9R A;  3HLW A;  3WS4 A;  2PRF A;  1XKZ A;  3PYP A;  2HP9 A;  3WWX A;  2VLG A;  3UDF A;  1IYQ A;  3G6O A;  3UPO A;  1Y4O A;  2V2F F;  3CUE C;  2Y8H A;  1MC0 A;  4L9G A;  3ZG8 B;  5C5K A;  2XFS A;  2WKE A;  4XUZ A;  2XGN A;  4OQI A;  3K2N A;  3UPN A;  2ZC6 B;  3C4P A;  3S4X A;  4FSF A;  3T1Q B;  4OP8 A;  2ZLY A;  1M40 A;  3IHB A;  5HZH A;  1G68 A;  5L07 A;  2EWW A;  3B3X A;  4PMA A;  4X25 A;  1STZ A;  5GHZ A;  1H8Z A;  3PTE A;  3VMA A;  2UV0 E;  4JXW A;  2OLU A;  4BL3 A;  2RCX A;  1E4D A;  2O9A A;  4HIA A;  1HLU P;  5GL9 A;  1YLT A;  4FTX A;  4CQH A;  2E8I A;  3F1P A;  3IS2 A;  1YLW A;  1T1B A;  3AGF A;  1S1Y A;  1ESI A;  5TR7 A;  2QMI A;  3CZD A;  3ZQ5 A;  1LLB A;  4JF6 A;  4WLA A;  4OON A;  3KYQ A;  2W1R A;  1JWV A;  4GHI A;  2BG1 A;  2NUT C;  4Q8I A;  5FQI A;  4MBH A;  2R78 A;  2JKG A;  3OCN A;  5HPI A;  5IU1 A;  2KDK A;  2R9X A;  4KQO A;  2YKF A;  3ZFZ A;  3VOY A;  3HUM A;  5CX7 A;  3S7Q A;  3LIA A;  2Y2M A;  3DW0 A;  2ZL1 A;  4P6Z S;  1HD8 A;  2VK3 A;  4KEN B;  3VOL A;  4GNU A;  1KDW A;  5LBR A;  4EEU A;  3IF5 A;  4OPQ A;  4BQM A;  4EBP A;  3N8L A;  4JGQ A;  3LR0 A;  1E25 A;  1IYS A;  2WKI A;  4UA6 A;  2NUP C;  2Y59 A;  3ZG5 A;  1P0Z A;  3UB7 A;  3NOP C;  5KIZ A;  4OVD A;  3NC8 A;  1JTG A;  4LRZ E;  1CJF A;  2EFU A;  2VV7 A;  4MN6 A;  3BQA A;  4OQH A;  2J9O A;  3JYI A;  5DKL A;  3BFF A;  3LI9 A;  1XGI A;  1OTI A;  1YMX A;  2G7U A;  5DJU A;  3V39 A;  3G30 A;  5AVE A;  4JGO A;  1S4R A;  2XD5 A;  3MQO A;  2HDQ A;  3IT9 A;  2XR0 A;  3OC2 A;  1FQG A;  1P97 A;  2W3H A;  4GN2 A;  2FFF B;  4C6Y A;  2HPB A;  1PWC A;  1YLZ A;  3QP2 A;  1K56 A;  2V0U A;  4IUK A;  1FIK A;  3N8R A;  2P74 A;  3T1R A;  2UWX A;  1H8M A;  2WAD A;  4MN7 A;  4OOL A;  2J9P A;  1ONG A;  5TBM B;  4EQI A;  4G3V A;  2OWH A;  5J4E A;  1OJ5 A;  4BL2 A;  4JLF A;  2WYX A;  4DJ3 A;  5CGS A;  3C2W A;  3UB9 A;  1S67 L;  2X01 A;  1L2S A;  3SW1 A;  4X1L A;  3IH8 A;  4FCF A;  3IF6 C;  5CTM A;  4NXB A;  5CHJ A;  4HOI A;  5CER A;  3OPP A;  1NWZ A;  2QHK A;  3A3J A;  4OQ0 A;  3T4Q A;  4R0Q A;  1IEL A;  5L8M A;  3W8K A;  3KYE A;  3A0R A;  4GLQ A;  3Q07 A;  1KOU A;  3FWL A;  3GMW A;  1SKF A;  2HJ9 C;  4OLD A;  4YIN A;  1NLY A;  4GW9 A;  3EEA A;  4D2O A;  5FI7 A;  3C30 A;  4LCL A;  3MXS A;  3UE6 A;  2JKT I;  1GA9 A;  5EEC A;  2JC7 A;  3PAE A;  4KUO A;  3CLO A;  5EM0 A;  2IWB A;  1K55 A;  2ZM8 A;  2H0T A;  4WM9 A;  3B33 A;  4OPZ A;  4S2O A;  2Q0O A;  3G2Y A;  2A3U A;  5G18 A;  2G2U A;  1L0D A;  2WKQ A;  2FH5 A;  1N9N A;  3BYD A;  4LFU A;  2Z2M B;  1ES3 A;  3K3D A;  1MBL A;  2Y79 A;  4CLC A;  1XFN A;  1K57 A;  5FQ9 A;  2PYR A;  2L0W A;  1BUL A;  2HDR A;  1IKG A;  2ZD8 A;  3NOU C;  5DTS A;  4QB8 A;  3BEB A;  2W27 A;  1PWD A;  4GOG A;  3BY8 A;  1ZG4 A;  2E8J A;  3MBZ A;  2HP5 A;  1DP9 A;  1PIO A;  5I5L A;  3V3R A;  3RXX A;  5DFX A;  3LY4 A;  3TE8 A;  3GEC A;  2XK1 A;  5F69 A;  5FAS A;  2WGW A;  2GX5 A;  3NDG A;  5HWW A;  3F1P B;  1RP5 A;  3IS2 B;  1WYB A;  3SH9 A;  1G6O A;  5CGX A;  3HLB A;  1ES5 A;  3HVF A;  1ALQ A;  5J7E A;  2PDR A;  5M19 A;  3L7H A;  5GHY A;  4FUW A;  1K4F A;  4GHI B;  1NZO A;  3ZCZ A;  4I39 A;  1PI5 A;  5GLD A;  1EI5 A;  1DJA A;  1XFQ A;  1S0W A;  3UDI A;  3R7W A;  2ZM2 A;  3E4O A;  3F1O A;  1NYM A;  4HJ3 A;  1BSG A;  3MMH A;  2IWD A;  3M6B A;  1J3W A;  2ZL1 B;  3RJU A;  2H28 A;  5CTN A;  1TDL A;  1LL5 A;  4I3I A;  3F1N A;  2P9V A;  3AGE A;  1YQS A;  3MZD A;  4NET A;  3PBO A;  2GNX A;  3FG8 A;  4ME4 A;  4DE0 A;  4HP4 A;  2INW A;  4DXB A;  1XGJ A;  4OPR A;  2PHY A;  4KZB A;  1N9L A;  3BRM A;  3A0S A;  4DN0 A;  5E2F A;  3V50 A;  4KZ5 A;  2KX6 A;  2V9A A;  2ACG A;  4Y13 A;  3CPT A;  1GSX A;  4MCW A;  1OPX A;  2O0Y A;  1SHV A;  2ZMF A;  2JCH A;  4E3L A;  3BQ8 A;  2Q9M A;  5FQQ A;  4UEY A;  2B18 A;  4A5R A;  5HWT A;  3D3O A;  4B4X A;  3OZH A;  3P7N A;  4WUJ A;  1OJG A;  3OPR A;  2M7V A;  3C7U A;  1D7E A;  1RGZ A;  2W3F A;  2V1Z A;  3BEC A;  3EQV A;  4EBN A;  1HTZ A;  4DE2 A;  5JYP A;  5EM1 A;  1N9B A;  1ODV A;  4MMN A;  3ITA A;  3E2K A;  5TGF A;  4Y17 A;  1CI9 A;  1N4O A;  4NKP A;  3GTC A;  2PBD P;  5DVA A;  4GD6 A;  1WE4 A;  2HV1 A;  4F94 A;  3WS0 A;  1LL9 A;  4H6J A;  5KMW A;  3HLF A;  1J9M A;  4UA9 A;  3G35 A;  2D01 A;  3OLO A;  3G2Z A;  3JVU A;  4WZ5 A;  4KQD A;  4LPZ A;  3EQU A;  3EWK A;  2PD8 A;  1OTB A;  4PKY G;  3FYZ A;  3CAX A;  1ZG6 A;  1MZU A;  1YLJ A;  5FAO A;  3T1S A;  4R6L A;  3DTM A;  3W4O A;  2PR6 A;  4P87 A;  2XF3 A;  3T4L A;  3ZYT A;  1XA7 A;  3RTY A;  5DF9 A;  1TS8 A;  2PT7 A;  3GRJ A;  4ZBE A;  4DDY A;  2BAS A;  4ID4 A;  1TS6 A;  4S2M A;  4GD8 A;  3VE4 A;  3H82 A;  1PZO A;  4DMZ A;  3IXH A;  3DTK A;  1U60 A;  1H8Y A;  4WF0 A;  4S2K A;  5FAT A;  2MJ6 A;  2PBY A;  1FSW A;  3VP0 A;  4EES A;  3BW6 A;  2ZQD A;  1K54 C;  5IS1 A;  2EX8 A;  4FOF A;  3VSL A;  3IXG A;  4FH4 A;  2RL3 A;  2LB5 A;  2JKR I;  5FI6 A;  4WEK A;  4M3K A;  3GDI A;  1LSX A;  1TVF A;  4CPK A;  5EVE A;  1KE0 A;  1O07 A;  3U2A A;  1TDG A;  1DRM A;  2OV5 A;  4PM5 A;  3P01 A;  2EWV A;  3PHY A;  1KGE A;  2D02 A;  1LT0 A;  2DNS A;  3MFD A;  3NDE A;  4JPM A;  2VV8 A;  3DWZ A;  3G4P A;  5FDS A;  1D06 A;  2VJW A;  1UGU A;  4KZ9 A;  3HRE A;  2WGW B;  4ETX A;  4HY8 A;  3TOI A;  2HF6 A;  4RYE A;  5CGW A;  2QZ6 A;  4IUH A;  5L10 A;  2PAV P;  1G6A A;  3VFF A;  3MQQ A;  3WRZ A;  2VV6 A;  3WS2 A;  2BTF P;  3ITB A;  5FEG A;  4E3I A;  4LGW A;  2HDS A;  2W3E A;  3E4P A;  3HJI A;  4LLO B;  4DF6 A;  1F98 A;  3ZG0 A;  3A3I A;  3B42 A;  3DWK A;  3VP4 A;  5AQA A;  3IXB A;  2XRO A;  2VGL M;  4UHU A;  3MZF A;  3R7W B;  3MR0 A;  3F1O B;  1GHI A;  2XA7 M;  4OH0 A;  3SZT A;  2EFX A;  4N92 A;  1LHY A;  3BFE A;  5J3W A;  1LSV A;  2XFT A;  1K6S A;  4NXF A;  3F1N B;  1XX2 A;  1ONH A;  3O86 A;  1MY8 A;  1BZA A;  2P9V B;  1A0K A;  1NRF A;  5F6A A;  2EXA A;  3HCY A;  5EOO A;  3A3F A;  4HH3 A;  4K0W A;  3W4Q A;  3N6I A;  4PAU A;  2WUQ A;  3I7J A;  1YT4 A;  1NYY A;  3PXP A;  5AQ7 A;  3PBS A;  3T4J A;  2I9V A;  4KQQ A;  1DP8 A;  1KE4 A;  5HAI A;  2FFY A;  1L3L A;  3NCK A;  2AVX A;  2W3G A;  4HBT A;  4YNR A;  3IH9 A;  1H3Q A;  3CPT B;  2B5R A;  4GJ4 A;  4HP9 A;  1K56 D;  4BMW A;  3TJZ C;  5AJG A;  5AQB A;  4MNR A;  2K7S A;  2Z2L B;  4RVA A;  3S7N A;  1YLY A;  3IHA A;  2Y2J A;  5DJT A;  3LR3 A;  5EVI A;  3IX3 A;  1H5X A;  2KOI A;  3IWO A;  3UE3 A;  3NUL A;  1BLH A;  4RA7 A;  4KG2 A;  4Q0H A;  1S4S A;  3VP1 A;  2XSS A;  4YWZ A;  2WKR A;  3HLC A;  3JPU A;  2PU2 A;  4S2P A;  3FZC A;  3BWL A;  4GDN A;  2XD1 A;  2Y2L A;  2ZBB A;  1BLP A;  1FIL A;  1QMF A;  3HUO A;  4H6J B;  4Y2F A;  3ULF A;  1T19 A;  3UB5 P;  2XEP A;  1MKI A;  4X69 A;  2XQZ A;  4RX2 A;  3Q1F A;  4M4X A;  2OAQ 1;  4K91 A;  4ZJ1 A;  4GKU A;  1YM1 A;  3E2L A;  3IX4 A;  3ICY A;  4JF4 A;  2WKP A;  3FPW A;  2ZOH A;  2OSU A;  3IBJ A;  4JF5 A;  1C3B A;  4PM8 A;  1MXO A;  1BUE A;  3RXW A;  3AGD A;  1W63 M;  2ZOI A;  3VP2 A;  2ZJ9 A;  4MDZ A;  1ZC2 A;  5CXW A;  3UB6 A;  3KSF A;  2HZ5 A;  4C3Q A;  4LV0 A;  3FKW A;  1VET B;  2ZM0 A;  2LB9 A;  1I2S A;  3NEC A;  3H82 B;  4UQI M;  2DCF A;  1NY0 A;  5HWV A;  5A93 A;  4JKT A;  4GZB A;  4WBG A;  4WL9 A;  1L0E A;  4WMC A;  4EUZ A;  4R4S A;  3UO9 A;  4CLC D;  2ZQ7 A;  4WMC D;  3UNW A;  3MF0 A;  4N1H A;  4DRT A;  3BLM A;  3QHY A;  1ZKJ A;  3T4K A;  4Y0U A;  5KSC A;  1KDS A;  3LEZ A;  4U0X A;  1NRJ A;  3PBQ A;  1AWI A;  2HP6 A;  1L0F A;  5DKK A;  3SS4 A;  3ZNT A;  4MN5 A;  4WEJ A;  1MWS A;  2EX2 A;  3K3C A;  4XXR A;  3T4O A;  5BOH A;  2G2W A;  2PU4 A;  1XJ3 A;  1IYO A;  1PYY A;  4HNB A;  4Z1W A;  3EGX C;  1L0G A;  4ETZ A;  1XJ6 A;  2Y2H A;  4Y5F A;  3N4I A;  4DKI A;  3MFX A;  1N9O A;  4EXO A;  1YAX A;  5U47 A;  2XRN A;  4KUK A;  5A92 A;  5FQM A;  4BD1 A;  1OTE A;  3C8C A;  3MKF A;  4XUX A;  1FCO A;  1EW0 A;  2YKH A;  1W5D A;  3MQ0 A;  2WAE A;  4I3J A;  4L0L A;  2IWC A;  3FC7 A;  3N8S A;  2ZC7 A;  3PBN A;  3V67 A;  4RX3 A;  4S2L A;  5F1F A;  3BM6 A;  5M18 A;  5G4Z A;  5EE8 A;  2M7U A;  3E98 A;  3P09 A;  4N9K A;  1K55 C;  3IWI A;  1W8Y A;  5EOE A;  4NXE A;  1W79 A;  1KVL A;  4EET B;  1OME A;  3DTE A;  5FAP A;  1VQQ A;  2DMW A;  5HAP A;  4HHD A;  4N1X A;  4LRY C;  4I5S A;  2JE5 A;  3NHQ A;  1YSP A;  2HGV A;  4QU3 A;  2GJ3 A;  3LI8 A;  3VFH A;  4IBR A;  2ZMV A;  4LV2 A;  3SH8 A;  3OOV A;  4CLC C;  1GA0 A;  2OWJ A;  2Y91 A;  1K57 C;  1ERO A;  5MC7 A;  4PPR A;  3WS1 A;  2V20 A;  3KYZ A;  4ZRR A;  3T50 A;  4AFI A;  2WAF A;  4GS9 A;  1KGF A;  1X0O A;  2Y2P A;  3V5M A;  1M6K A;  3Q82 A;  4QWO A;  1KE3 A;  4R3J A;  3HJK A;  2DRW A;  3MZE A;  5AQ9 A;  3ZVT A;  5DTT A;  2V8F A;  1NLZ A;  2V1B A;  1IOU A;  3MS6 A;  5CED A;  3QP6 A;  3JVV A;  4E3J A;  1GHM A;  3GQZ A;  2VGJ A;  3DBA A;  5GLA A;  3O87 A;  1D1J A;  4KZ8 A;  2GDN A;  1YPR A;  4GB7 A;  4IHQ A;  2P7J A;  4S2N A;  3GV9 A;  2I72 A;  1KGG A;  5L2F A;  1T18 A;  4ESP A;  2VGL S;  3LFV A;  1GSV A;  1IEM A;  2XA7 S;  1DJC A;  2KLI A;  3P98 A;  4KQR A;  2VZW A;  3IWQ A;  5HW3 A;  2Y2Q A;  4KG5 A;  3ZG7 B;  2XH9 A;  4PM6 A;  3G31 A;  5DF7 A;  4DE3 A;  4OP5 A;  3ZGA B;  1PW1 A;  2WK0 A;  3IX8 A;  3OBF A;  3CUE A;  5FQK A;  1DP6 A;  5GHX A;  4KZA A;  5FDH A;  3MXR A;  3S7O A;  3FPV A;  2V8C A;  2EX9 A;  2VX8 A;  3LIB A;  4OOM A;  3UPP A;  4EEP A;  2XDM A;  3LIC A;  3C38 A;  2WGI A;  4R1G A;  1SDE A;  1RCJ A;  1XP4 A;  4BEN A;  3ISG A;  1ES4 A;  3HL9 A;  4DDS A;  2VA0 A;  1MWT A;  5TJJ A;  3HBR A;  5FSR A;  5F68 A;  3GVB A;  4F3L A;  4I3A A;  4IED A;  2P04 A;  1BTL A;  3QP4 A;  3BLS A;  4C75 A;  1QME A;  4G3W A;  1T1C A;  4QPR A;  4XT2 A;  1ERQ A;  4E3N A;  4WZ4 A;  4EU0 A;  3M2K A;  4X56 A;  4X68 A;  2VKS A;  1IKI A;  1VEU A;  5HD3 A;  4Z9Q A;  4YOF A;  3LR5 A;  1Y28 A;  4JBF A;  3N7W A;  4EER A;  4GDB A;  2PYP A;  2WKH A;  5HPF A;  4KZ4 A;  2QYB A;  4EQ1 A;  1NZU A;  4U3T A;  2J3W A;  2Y2K A;  3LY3 A;  1LL8 A;  3RH8 B;  4CLC B;  3OPH A;  3UY6 A;  4OQG A;  1DJB A;  4X6T A;  4G3K A;  2JKT M;  2QJ5 A;  4O8G A;  5IT5 A;  3C5A A;  1XJ2 A;  2Z6D A;  1YLP A;  4EW7 A;  4NK3 A;  4GCZ A;  1HZO A;  4PKY A;  2O9C A;  5HL6 A;  1SCW A;  1LI0 A;  4B9O A;  3E0Y A;  3V3S A;  2WGV A;  1GSW A;  5FA7 A;  3R4K A;  2K31 A;  2EX6 A;  4EUV A;  4B88 A;  3CHW P;  1VM1 A;  1KVM A;  3KSH A;  4S2J A;  3CJM A;  4WZ5 C;  5F5Y A;  4DE1 A;  2QJ7 A;  3BJN A;  5K5B A;  1CEF A;  3ZG9 B;  1FR6 A;  2A24 A;  1OT6 A;  3IBR A;  3SOI A;  5F82 A;  3VE3 A;  3NOT C;  3PBR A;  4E6X A;  5HDC A;  5L09 A;  3EEH A;  4UQI S;  4BJP A;  3UME A;  4ZDX A;  1AXB A;  4U0T A;  1H0M A;  3QNC A;  4S2I A;  1YMS A;  2EXB A;  3FV7 A;  4B4Z A;  4WEL A;  2JKF A;  1S6R A; 
#chains in the Genus database with same CATH homology
 4M4X A;  2OAQ 1;  4I39 A;  5AVF A;  1YSQ A;  3UMD A;  1TS0 A;  2J3T D;  1XFQ A;  3LID A;  4Q0I A;  3ICY A;  2WKP A;  3FPW A;  3R7W A;  2ZOH A;  3MJQ A;  3E4O A;  3IBJ A;  3F1O A;  5G4Y A;  2EA9 A;  3TRC A;  4HJ3 A;  3MMH A;  1W63 M;  1UWP X;  4DJ2 A;  2ZOI A;  2HJE A;  4LRX C;  2H28 A;  2W1T A;  4II7 A;  3H7W A;  4BBU A;  4MDZ A;  4I3I A;  3F1N A;  3LYX A;  3MXQ A;  4HI4 A;  3UB6 A;  3KSF A;  2O99 A;  3CI6 A;  4GS9 B;  4PHT A;  5FL3 A;  3PBO A;  2GNX A;  2LB9 A;  1IFQ A;  3FG8 A;  4ME4 A;  3S7P A;  3H82 B;  4E04 A;  4UQI M;  5HSQ A;  4JGR A;  5HWV A;  4HP4 A;  2CMN A;  2INW A;  1UWN X;  1TD5 A;  3KSG A;  3LIF A;  2PHY A;  4WL9 A;  1YKD A;  1N9L A;  3KX0 X;  4ARZ B;  4O0P A;  3A0S A;  4CLC D;  2J80 A;  4DN0 A;  3CIT A;  1LSW A;  1P9W A;  3E4Q A;  2KX6 A;  3MF0 A;  1V9Y A;  2V9A A;  3BY9 A;  1P9R A;  4O01 A;  3EGD C;  3PYP A;  4JGP A;  3T4K A;  3PBT A;  2VLG A;  3PR6 A;  1GSX A;  3G6O A;  1NRJ A;  3PBQ A;  4MCW A;  2PD7 A;  4GHI B;  1OPX A;  2O0Y A;  2ZMF A;  4B93 A;  5DKK A;  1OT9 A;  4MN5 A;  3CUE C;  2Y8H A;  1MC0 A;  1T1A A;  4L9G A;  4WEJ A;  3BQ8 A;  5C5K A;  3T4S A;  3K2N A;  4NXG A;  3K3C A;  4FSF A;  4UEY A;  2B18 A;  3T4O A;  5HWT A;  3D3O A;  5HZH A;  3P7N A;  2EWW A;  4WUJ A;  1OJG A;  2M7V A;  1D7E A;  1XJ3 A;  4IJG A;  1STZ A;  2W3F A;  3EQV A;  4HNB A;  3O5Y A;  3EGX C;  4Z1W A;  4ETZ A;  1XJ6 A;  4Y5F A;  1VHM A;  1ODV A;  4MMN A;  3TW8 A;  4BWI A;  3MFX A;  1N9O A;  4EXO A;  1YAX A;  5HDD A;  1ZHH B;  2XRN A;  4KUK A;  2O9A A;  3B47 A;  4NKP A;  4HIA A;  4I38 A;  1OTE A;  3C8C A;  2HV1 A;  2J3T C;  4CQH A;  3F1P A;  3IS2 A;  2YKH A;  1EW0 A;  1T1B A;  1S1Y A;  4L9F A;  4H6J A;  3MQ0 A;  1WA9 A;  3T4T A;  4NEE D;  4HQA A;  3EOI A;  4I3J A;  4L0L A;  3ZQ5 A;  3FC7 A;  4WLA A;  2D01 A;  3OLO A;  3PBN A;  4BBV A;  3KYQ A;  2W1R A;  1V9Z A;  3V67 A;  5A8B A;  3JVU A;  4KQD A;  4GHI A;  4LPZ A;  2O9B A;  2NUT C;  2JN7 A;  3EQU A;  1XJ4 A;  3EWK A;  2PD8 A;  2QWS A;  2A2L A;  5G4Z A;  1OTB A;  2M7U A;  3E98 A;  2R78 A;  4PKY G;  3OCN A;  4NXE A;  5HPI A;  5IU1 A;  5HDS A;  4EET B;  2KDK A;  3CAX A;  4HJ6 A;  4KQO A;  1MZU A;  2YKF A;  2DMW A;  4F3L B;  2VEA A;  4R6L A;  5CX7 A;  4HHD A;  3S7Q A;  3LIA A;  4LRY C;  4I5S A;  3NHQ A;  2PR6 A;  1YSP A;  2HGV A;  2GJ3 A;  3LI8 A;  4P6Z S;  2ZMV A;  2OAP 1;  4XT2 B;  3VOL A;  1JNU A;  3OOV A;  3T4L A;  3ZYT A;  2OWJ A;  4CLC C;  5LBR A;  4EEU A;  3RTY A;  5DF9 A;  5MC7 A;  1TS8 A;  2PT7 A;  3KYZ A;  4JGQ A;  4ZRR A;  3LR0 A;  3H9W A;  3T50 A;  2BAS A;  4AFI A;  4R38 A;  1TS6 A;  4GS9 A;  4L9E A;  1X0O A;  2NUP C;  1P0Z A;  2FZ0 A;  3VE4 A;  3H82 A;  3UB7 A;  3NOP C;  4DMZ A;  5KIZ A;  1MKM A;  1OTA A;  4LRZ E;  4WF0 A;  3HJK A;  2MJ6 A;  2VV7 A;  3OCL A;  4R70 A;  4MN6 A;  3BQA A;  4R3A A;  1NLZ A;  4ARZ A;  2V1B A;  1IOU A;  4EES A;  3BW6 A;  5IS1 A;  3JVV A;  1S1Z A;  4FOF A;  5DKL A;  4Q0J A;  3LI9 A;  1OTI A;  2G7U A;  5DJU A;  1F9I A;  5AVE A;  4JGO A;  3LIE A;  3DBA A;  2LB5 A;  1S4R A;  2JKR I;  3MQO A;  4BBT A;  3A0V A;  4HH2 A;  2OOL A;  3OC2 A;  4WEK A;  2B02 A;  1P97 A;  3GDI A;  1LSX A;  4IHQ A;  2W3H A;  2P08 A;  2P7J A;  3U2A A;  1DRM A;  2V0U A;  1T18 A;  4IUK A;  4P6Z M;  1W63 Q;  2VGL S;  3LFV A;  1GSV A;  5DFY A;  3P01 A;  2XA7 S;  2EWV A;  2KLI A;  3PHY A;  5EFW A;  2VZW A;  2D02 A;  1H8M A;  1LT0 A;  2JKR M;  2L4R A;  4MN7 A;  2A24 B;  4OOL A;  2VV8 A;  5TBM B;  4G3V A;  1D06 A;  2VJW A;  1UGU A;  3UB8 A;  3OBF A;  3CUE A;  1DP6 A;  2OWH A;  3S7O A;  5J4E A;  1OJ5 A;  4ETX A;  3FPV A;  4HY8 A;  2HF6 A;  3LUQ A;  3LR4 A;  4DJ3 A;  3C2W A;  3UB9 A;  1S67 L;  3SW1 A;  3W2Z A;  2VX8 A;  3LIB A;  4OOM A;  1OTD A;  4IUH A;  4EEP A;  4NXB A;  3LIC A;  3MQQ A;  4HOI A;  2VV6 A;  2L1M A;  3C38 A;  2W3E A;  3E4P A;  1NWZ A;  3HJI A;  2QHK A;  2VA0 A;  4LLO B;  5TJJ A;  3T4Q A;  1F98 A;  5F68 A;  5L8M A;  3A0R A;  3B42 A;  4F3L A;  4I3A A;  2QKP A;  4GLQ A;  2P04 A;  2XRO A;  1KOU A;  2VGL M;  3R7W B;  2W3D A;  3MR0 A;  3F1O B;  2XA7 M;  2HJ9 C;  4G3W A;  1F5M A;  1T1C A;  3CWF A;  4QPR A;  3VV4 A;  1NLY A;  4GW9 A;  4XT2 A;  3EEA A;  3NJA A;  2GZA A;  3C30 A;  1S66 L;  5J3W A;  2W1T B;  4EU0 A;  1LSV A;  3H7W B;  3UE6 A;  4NXF A;  2JKT I;  2VKS A;  3F1N B;  5HD3 A;  4KUO A;  2PR5 A;  4YOF A;  3CLO A;  3LR5 A;  1Y28 A;  5F6A A;  2W0N A;  1BYW A;  3HCY A;  4EER A;  3B33 A;  4HH3 A;  1TF1 A;  2PYP A;  5HPF A;  2V0W A;  2QYB A;  2WKQ A;  4EQ1 A;  2FH5 A;  2J3W A;  4PAU A;  2V1A A;  1N9N A;  3KO6 A;  3PXP A;  1LL8 A;  3RH8 B;  4CLC B;  3PBS A;  3T4J A;  2I9V A;  3K3D A;  1DP8 A;  2Y79 A;  4HJ4 A;  4CLC A;  1XFN A;  4G3K A;  2JKT M;  2QJ5 A;  4O8G A;  2PYR A;  2L0W A;  2W3G A;  5IT5 A;  4K08 A;  4YNR A;  1XJ2 A;  2Z6D A;  4EW7 A;  1H3Q A;  4GCZ A;  2K2N A;  1ZTU A;  3RFB A;  2Z6C A;  3NOU C;  4PKY A;  2O9C A;  4GJ4 A;  5HL6 A;  4HP9 A;  4BMW A;  4B9O A;  3TJZ C;  3E0Y A;  5AJG A;  2W27 A;  2K7S A;  1GSW A;  3BY8 A;  3R4K A;  2K31 A;  3S7N A;  4Y3I A;  5DJT A;  3LR3 A;  4WN5 A;  3KSI A;  4RQ9 A;  5HD5 A;  4EUV A;  3KSH A;  1DP9 A;  2KOI A;  2JHE A;  3UE3 A;  5F5Y A;  2QJ7 A;  5I5L A;  3BJN A;  5K5B A;  4Q0H A;  1S4S A;  2A24 A;  3IBR A;  1OT6 A;  1TS7 A;  1VB6 A;  2XSS A;  4YWZ A;  2WKR A;  5DFX A;  5TBM A;  4CLC E;  3VE3 A;  3NOT C;  3PBR A;  3BWL A;  3GEC A;  3TE8 A;  5F69 A;  2ZBB A;  2GX5 A;  5HDC A;  5HWW A;  3F1P B;  3IS2 B;  3EEH A;  4UQI S;  4BJP A;  4H6J B;  3UME A;  1G6O A;  3D72 A;  4Y2F A;  3ULF A;  1T19 A;  5KSH A;  5J7E A;  2PDR A;  2M1C A;  4WEL A;  2IA2 A;  1G28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...