5AVFA

The ligand binding domain of mlp37 with taurine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
244
structure length
244
Chain Sequence
GPLGSVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
total genus 77
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5avfA02
1XJ4A 1TS8A 3FC7A 3FG8A 4R70A 4WF0A 5HDDA 4GW9A 2PR6A 4BBVA 1F9IA 1V9ZA 3K3CA 3LI9A 2VV7A 4HP4A 1Y28A 1OJGA 3HJIA 3PHYA 3UB6A 1OT6A 2PHYA 1UWNX 4HY8A 2QJ7A 1P97A 3MFXA 5HD3A 3C2WA 5HDCA 4GS9B 4XT2B 4EQ1A 1T1BA 2A24B 2PDRA 4HJ4A 5TBMA 3IS2B 2QWSA 2VV8A 1OJ5A 4H6JA 5F5YA 4GS9A 3LI8A 4WLAA 2PR5A 4LPZA 3NOUC 4LRYC 1GSVA 2ZOIA 3BY9A 1LL8A 1T18A 3SW1A 1P0ZA 3NOTC 4I3IA 3NHQA 2YKHA 4NXBA 4XT2A 1OTBA 2YKFA 4HQAA 4PKYA 1LSWA 3CLOA 3IS2A 1GSWA 3UB8A 5G4ZA 1S1YA 3LIEA 4HNBA 5KIZA 3A0VA 1DP8A 2QHKA 2Z6DA 2BASA 1S67L 2VV6A 2QJ5A 3NJAA 1XFNA 4DJ2A 3IBRA 1DRMA 1X0OA 4MN5A 4EEPA 2OWJA 2L0WA 4I39A 2D02A 5IS1A 2JHEA 2P7JA 2KX6A 5DJTA 2V0WA 2V0UA 2VLGA 3E4QA 3F1PA 4GCZA 3RTYA 4KUKA 4PKYG 3UB9A 3HJKA 4E04A 2J80A 2EA9A 2OWHA 4I3AA 1D7EA 3D72A 4F3LA 2OOLA 4JGRA 3UE6A 3MJQA 1KOUA 2QKPA 1UGUA 2L4RA 1XJ3A 2JN7A 3T50A 4R3AA 1F98A 2W27A 4EERA 3UMEA 4NXGA 5IU1A 3VE3A 2PYPA 2VEAA 3H7WB 1OT9A 5HWTA 2V1BA 1DP9A 3OLOA 4NXFA 1JNUA 1T19A 5F6AA 5HD5A 3BY8A 2WKPA 5AVFA 2K7SA 3F1NB 5I5LA 3UMDA 4R38A 2PYRA 2WKQA 3LIDA 3MQQA 3NOPC 4WL9A 4HIAA 3MQOA 4WUJA 3F1NA 2GJ3A 1OTEA 3LICA 5DKKA 2CMNA 4HJ3A 4LLOB 2PD8A 1DP6A 1N9OA 4EETB 2HV1A 4B9OA 4JGPA 4EW7A 1ODVA 1WA9A 1T1CA 3MR0A 5J3WA 4R6LA 5DKLA 4BBTA 4EESA 4HP9A 2V9AA 3H82A 1S66L 1NWZA 2A24A 4LRZE 3VE4A 4MN6A 5G4YA 4HOIA 1TS7A 1LT0A 1TS6A 2KDKA 2Z6CA 4EEUA 3ZQ5A 1XJ6A 4L9FA 4HJ6A 1LSXA 2I9VA 3C8CA 2H28A 1OTAA 1OTIA 1D06A 4H6JB 4KUOA 2PD7A 3A0SA 3B33A 3EEHA 1VB6A 1OTDA 2D01A 2ZOHA 3ULFA 4JGQA 5DJUA 3K3DA 1N9NA 1S1ZA 3CAXA 4K08A 1XJ2A 1G28A 4RQ9A 4EXOA 1UWPX 1GSXA 3H82B 5AVEA 5HWVA 3A0RA 5J7EA 4JGOA 5A8BA 2V1AA 5HZHA 3G6OA 1T1AA 4L9EA 4KQDA 2WKRA 2INWA 3RH8B 3LIFA 3P7NA 1LSVA 2ZBBA 4I38A 5F69A 3E4PA 4F3LB 3H7WA 3UB7A 3F1OA 5TBMB 5HWWA 4L9GA 5J4EA 2B02A 5HSQA 4DJ3A 3F1PB 3GECA 2L1MA 2R78A 3F1OB 3LYXA 4M4XA 4NXEA 3ICYA 3H9WA 5F68A 1N9LA 4WN5A 3LIAA 1S4RA 3CWFA 1EW0A 1V9YA 3GDIA 3LIBA 4I5SA 3BWLA 1MZUA 3EWKA 4YWZA 4I3JA 3LUQA 4GHIB 4BBUA 1BYWA 3MXQA 4HH2A 1TS0A 2M1CA 4HHDA 1S4SA 5EFWA 3PYPA 4GHIA 4LRXC 5HDSA 3KX0X 2W0NA 3E4OA 4HI4A 3VOLA 4HH3A 1XFQA
chains in the Genus database with same CATH superfamily
4BMWA 3IH9A 4DDSA 1LI0A 3PHYA 1OT6A 2VZWA 3LR4A 2HP9A 3WS1A 1O07A 3BQAA 4LRYC 4E3OA 1MPLA 5CX7A 4HEFA 3ZYTA 2M7VA 3U2AA 4PKYA 5EVEA 2ZC6B 4JKTA 3LIEA 4OOMA 4UQIS 5U47A 2Z6DA 1K25A 2KLIA 4OP8A 3D3OA 4KUKA 3UB5P 3EQUA 2XRNA 2IWCA 4OQ0A 3B3XA 3RXXA 3LCEA 4WZ4A 5EPHA 4EW7A 1DY6A 2GNXA 4HP9A 3H82A 5CGWA 2A24A 1FILA 4LRZE 4XUXA 1TS7A 5DTKA 1G68A 4GOGA 1ZTUA 3RFBA 2Y55A 3B33A 3ULFA 3NY4A 3PR6A 1NJ4A 3Q07A 2Y91A 4IBRA 5BOHA 3BFCA 4DE3A 4KQDA 1ZHHB 4L0LA 4Q0HA 4L9GA 2WAEA 2R78A 2EWWA 3ICYA 5GLCA 4YNRA 2EX9A 1JWPA 3NULA 4JF6A 4ZJ1A 1W79A 3LIBA 3IX3A 3E98A 5AQAA 4ZRRA 3ISGA 3SZTA 4FTXA 4WF0A 2PR6A 4RX2A 4CQHA 1Y28A 2WUQA 2JCHA 4MBHA 5A90A 3ZVWA 1T1BA 3GTCA 5EM0A 1W8YA 3VV4A 2J3TD 3S7OA 3NOUC 3LGOA 1RGYA 3O3VA 4XT2A 3EEAA 4OOLA 2UV0E 2WGWA 4MEZA 3MSHA 5DFXA 1L3LA 2FFYA 3HLGA 3MZFA 4MN7A 5DJTA 3QNCA 4DDYA 2XGNA 4I3AA 5HAQA 4JGRA 3UE6A 2J8YA 2QKPA 3MKEA 4DRTA 3HL9A 1EI5A 4N1XA 4NXGA 5HAPA 2BLSA 1BSGA 1IEMA 4YINA 3JVVA 3VP3A 2K7SA 4X53A 2VKSA 3PXPA 2WGIA 1DJCA 1HTZA 1MWRA 1OTEA 3P01A 3O87A 3KYEA 4WYYA 1T1CA 5FQMA 2PU2A 2W3FA 3N6IA 4EEUA 4GJ4A 3W4PA 3ITBA 4GN2A 2H28A 3G2ZA 5DVAA 1JTDA 2DMWA 1GHPA 5DJUA 5FDHA 1S1ZA 4KZ3A 5AVEA 5J7EA 2A3UA 4UA7A 1T1AA 5IT5A 2XA7M 2EFXA 2P9VA 1LL9A 3H7WA 4E6WA 2H0YA 1IKIA 4E3LA 2E8IA 3H9WA 4WN5A 1S4RA 2JKTI 4CPKA 1I2SA 3IT9A 4YWZA 4I3JA 4X68A 4BJPA 2JKGA 4BBUA 1TS0A 3MQ0A 4HH3A 3FG8A 4MBFA 4GW9A 1V9ZA 4HP4A 2IWBA 4DMZA 4OLDA 4GS9B 5F5YA 4X56A 5HFOA 4D2OA 3LI8A 4O01A 1M40A 3ZNYA 3GR2A 3ZG5A 3N8SA 3NOTC 3WS0A 5FI2A 4G3KA 1GSWA 2WKEA 1L0GA 5L10A 2QHKA 3VP1A 2E8JA 2OWJA 2O0YA 3PBTA 2KX6A 4GZBA 3S7QA 2IWDA 3D72A 4F3LA 1KGGA 1UGUA 4IVIA 2PRFA 1EWZA 4X1MA 3SS4A 3EGDC 5I94A 3V5MA 4E3KA 1MBLA 4R38A 2Q9MA 4ARZA 2HV1A 3T4KA 3IH8A 2HZ5A 4GNUA 2RL3A 4KG5A 4NETA 4ETXA 3TW8A 4R1GA 2Z6CA 4L9FA 3JPUA 3OC2A 3C8CA 4CLCB 1PYYA 3EEHA 3C7UA 4R3BA 4PM7A 1MWTA 2XLNA 2O9BA 1XXMA 2OAP1 4O7DA 2OV5A 3OOVA 2HJEA 2XD1A 4P6BA 4FD8A 3ZG8B 2W1TB 2ZC5B 3TG9A 2C5WB 1KGFA 2EXBA 1N9BA 4OVDA 3PAEA 3WS5A 3LYXA 4Y2FA 1ACFA 3S4XA 1V9YA 1YLPA 1S4SA 2W0NA 1PIOA 3ZG0A 3FPVA 4WBGA 3KO6A 2I72A 5HARA 1UWNX 3OPLA 5HDCA 4XT2B 5KZHA 4PM8A 1XX2A 1RGZA 4GS9A 4DE1A 1H8YA 1YM1A 1L0DA 1BT5A 3RXWA 1FCOA 3JVUA 2XF3A 2Y4AA 4MNRA 2O99A 2KOIA 3LR5A 2V2FF 3HUNA 4R23A 4JXGA 2XA7S 5FASA 2ZQ7A 1VM1A 2L4RA 5F83A 4NXFA 2XD5A 2Y2IA 2PYRA 1HVBA 2WKQA 3NOPC 5DF9A 1KE4A 2GJ3A 4NKPA 2G2WA 2GZAA 2Q0OA 4GDBA 4A5RA 3ITAA 3IXGA 1P9WA 4MN6A 3HLWA 2H10A 3FKWA 1PWCA 3Q7VB 1C3BA 2FZ0A 3VP4A 2X01A 3OBFA 3CITA 4JGQA 1W63Q 2V1ZA 4X1LA 3L7HA 4QPRA 4FCFA 2V1AA 2Y2QA 4K0XA 5A93A 4F3LB 2VGLM 1U60A 1ESIA 4D60A 4Q0IA 2VX8A 1PFLA 4RYEA 4FH2A 4OONA 3TRCA 5CECA 4WMCA 4IEDA 4BL2A 5EVLA 4BBTA 3KX0X 1QMEA 5G4YA 3VOLA 1WYBA 1JWVA 3U4LP 1KGEA 2ZD8A 1KVLA 4S2LA 2XEPA 2FFFB 3ZFZA 3OCLA 1NLYA 4II7A 2R9WA 2HDSA 3C5AA 1T18A 1XPBA 3CPTA 4EQIA 2HDQA 1OTBA 2Y2GA 4ZJ3A 4ETZA 5TGFA 4X55A 2PU4A 1XP4A 5D3OA 4MN5A 1ZG4A 1YLJA 2V0WA 4KQRA 1K0KA 3HJKA 5FQJA 2J3TC 4Z1WA 3CJMA 1CI8A 1Y54A 4X25A 3VP0A 4QY6A 4QY5A 1H0MA 4Q8IA 2NUTC 2UWXA 3Q82A 4Y0OA 3IWQA 3T4LA 3HLFA 3DWZA 1KDWA 2K2NA 1SHVA 2JE5A 3CI6A 3SOIA 5GLBA 3BYDA 4CLCA 2P08A 3Q1FA 4RVAA 1MKIA 1PWGA 1TF1A 1FR6A 1OTAA 4KUOA 3CUEC 2QPNA 1WE4A 3DTKA 3HCYA 1SCWA 5A92A 4S2KA 1XA1A 3IXDA 4MMNA 3F1OA 1CI9A 5M18A 1L0EA 2L1MA 3F1OB 2ACGA 2FH5A 1ONHA 2NUPC 4ZTKA 4N1HA 4B88A 1BLCA 1E25A 4QJGA 3A3DA 3O88A 3NECA 4QB8A 1F9IA 2X02A 4IUHA 2QZ6A 3QP4A 2G2UA 1XGIA 3BY9A 4KENB 1LL8A 1N4OA 2HJ9C 4PAUA 1DP8A 3QHYA 5CGXA 3NJAA 3C4OA 1NY0A 2JHEA 2J9OA 3G4PA 1K55C 2ZQCA 2J80A 4KZ6A 1D7EA 4G3VA 3MJQA 2PAVP 3H7WB 1OT9A 2Z2LB 2MJ6A 3UMDA 4LV3A 5FDSA 3LICA 3UDFA 1OMEA 2DCFA 2CC1A 3K2NA 4R3JA 4H8RA 3T4OA 2WKHA 1IYOA 3T4SA 3I7JA 4GD6A 3LR3A 3KSHA 3ZVTA 3SS3A 3A0SA 4FUWA 4MCWA 2D01A 1F5MA 1E4DA 4ZAMA 2EX2A 4EXOA 1CQAA 3H82B 5KSHA 5DTTA 4GKUA 5CERA 1K55A 3ZNTA 3PBQA 4JF5A 1YLYA 5C5KA 5L07A 2OAQ1 5EOOA 1L2SA 1K4FA 5F68A 3LIAA 4UEYA 5M19A 1W7FA 1S6RA 3IXHA 3KSGA 3BRMA 3IHAA 2ZQ9A 1FSYA 3IWIA 3HJIA 1VEUB 3MXSA 4Y3IA 5TBMA 4U0TA 1SDNA 3LY4A 1H3QA 2PBDP 2ZOIA 4KQQA 4I3IA 2YKHA 4NXBA 1XKZA 4KZ8A 5GLAA 1PNEA 1SDEA 2Y2JA 1S67L 2OLVA 1DRMA 2ZQAA 4U3TA 2P04A 3OCNA 3BLMA 1I2WA 5CRFA 4E04A 3QP1A 4UAAA 5EOEA 1G5UA 3T50A 4NG2A 1YLWA 2C6WB 1DP9A 3OLOA 1JNUA 5HD5A 1H5XA 1DJBA 1K56A 2O9AA 3LR0A 1S0WA 5HX9A 4LCMA 4OKPA 5FAPA 2WKIA 5FAOA 1DJAA 5FQIA 4P6ZS 2XR0A 3VE4A 5CHMA 3NC8A 2KDKA 3C7VA 2EWVA 1D06A 1VB6A 3BECA 4S2NC 3MS6A 5CEBA 4S2IA 4L9EA 2JKTM 3P7NA 5F69A 2B18A 5J4EA 4PPRA 4MLLA 1ES5A 4EUVA 4E3JA 1IYSA 4HH2A 2M1CA 1XFQA 4BBVA 1GHIA 4OOYA 2W1TA 3NBLA 3UE0A 5CXWA 5E2EA 2XDMA 4DE2A 4WLAA 2JKFA 3NCKA 4LPZA 5TJJA 2V8CA 1P9RA 2W3HA 1HLUP 3W4QA 4QU3A 5HAIA 3EOIA 3UB8A 1YKDA 5G4ZA 1NRJA 3DTMA 2WGVA 3GQZA 3P09A 4KZAA 1KVMA 5GL9A 3VOZA 3SH9A 3UMEA 3MZDA 1K57A 3A3IA 3BY8A 4X6TA 1K56D 4HIAA 3G2YA 3Q81A 1MY8A 4GDNA 4LLOB 1NRFA 3AGDA 3IXBA 1G6OA 3MMHA 2W1RA 4IJGA 1NWZA 4Y13A 1LT0A 3DBAA 1ZC2A 1XJ6A 5TFQA 2OLUA 3MKFA 1FOFA 5EUAA 3K3DA 4M3KA 3IF6A 1I5QA 3DW0A 1NYMA 4Q0JA 1YMSA 3WRZA 2ZQ8A 5HL1A 4LCLA 3MF0A 4NEED 5JYOA 1PZPA 3HUOA 4GB7A 4BD1A 5HL6A 4LRXC 5GHXA 3E4OA 1PRQA 3FC7A 1W63M 2M7UA 4ID4A 4E3IA 2PHYA 1P97A 3C2WA 3S7NA 4HJ4A 3IS2B 3QP5A 2A2LA 1K57C 4EUZA 3M2JA 1BULA 2ZC7A 4HBTA 3OPRA 2O9CA 5FEFA 4ARZB 3CHWP 4OP5A 5CHJA 3F1PA 1BLPA 2W3GA 4EERA 4R3AA 2W27A 2Y59A 3O86A 2WKPA 4UA6A 5AVFA 5I5LA 3TJZC 2GDNA 5HPIA 3O5YA 4WUJA 5FEGA 5DKKA 2CMNA 4JXWA 5FQKA 1LHYA 2HGVA 3MR0A 1F2KA 2W3EA 4EBNA 3NDEA 3TOIA 4KZ7A 5L8MA 2XSSA 2I9VA 2ZM2A 3V67A 2WZXA 4B4ZA 1W5DA 2PD7A 5AQ7A 4OPQA 4WEJA 2ZOHA 4PM9A 2ZL1B 1XJ2A 1NYYA 1GSXA 4O0PA 3V3RA 2WKRA 2INWA 3RH8B 2VGJA 4S2NA 2HDRA 4BLMA 2BTFP 1EW0A 4I5SA 5L2FA 2V8FA 1MXOA 2R9XA 3MXQA 1KE0A 4PM6A 3T1RA 3V3SA 4GHIA 2ZMVA 3NI9A 5HPFA 1TS8A 4PMAA 3LI9A 2ZJ9A 1SKOA 4P0MA 3UE1A 2PDRA 1YQSA 2VV8A 4H6JA 1XA7A 4PM5A 1PI4A 3SW1A 5E43A 3G35A 2Y2PA 1BLHA 3LEQA 2BASA 1JTGA 1XFNA 3IBRA 3FWLA 4EEPA 2Y79A 2L0WA 3FYZA 1ALQA 4U0XA 1Y4OA 3ZCZA 2Z2MB 4IHQA 2VJWA 1W8QA 4BWIA 3AGFA 3QP8A 5F6AA 4YFMA 3F1NB 1FR1A 4KQOA 4OQIA 2PD8A 5EECA 4EETB 4B4XA 2B5RA 3UY6A 4R6LA 1D1JA 3VFFA 4XXRA 1H8ZA 1OTIA 1Q2PA 4OH0A 4EU0A 1O7EA 3E0YA 1E3UA 4AFIA 3VP2A 3GVBA 3VSLA 4KZ9A 2Y2KA 3N7WA 3LIFA 1LSVA 3UB7A 3WS2A 4P87A 4M4XA 5EVIC 3GDIA 1CK3A 2EXAA 4O8GA 4JLFA 5AJGA 1BYWA 4JBFA 1PW1A 5EVID 5HDDA 3K3CA 2LB5A 3CUEA 1PI5A 1LL5A 2ZC4B 4R4SA 4EQ1A 1VEUA 4IVKA 2PBYA 3IQAA 3BFGA 1VETA 5DFYA 4KG2A 1P0ZA 2GX5A 3IS2A 2ZM0A 3A0VA 4KZ4A 2VV6A 3HBRA 1ES3A 2PT7A 2D02A 5CGSA 3UB9A 3E2KA 4HESA 4WZ5A 2OWHA 2EA9A 2VGKA 1KOUA 1STZA 2JN7A 5IU1A 5LBRA 5G18A 2Y2NA 1ESUA 3MQQA 4QWOA 3LIDA 4P6ZM 3T4JA 4CLCD 5HW3A 2IA2A 5DF7A 4HJ3A 4DKIA 4JGPA 4C3QA 4BQMA 5DKLA 1YPRA 3VSKA 2H5SA 4DXBA 3DAVA 2Y2LA 4HJ6A 3PBRA 2XH9A 4HBUA 5DTSA 3M2KA 1E3UD 3CAXA 4P85A 2Y2MA 1XGJA 4C6YA 3IWOA 2QYBA 3G32A 3G6OA 1FIKA 4Y17A 1VETB 4Y5FA 3W2ZA 2ZBBA 5TR7A 1TD5A 1NLZA 3QNBA 3T4TA 3EQVA 3CWFA 3UPPA 3NIAA 2P9VB 3EGXC 3PYPA 5GHYA 3V39A 3PBOA 4CLCC 2VV7A 3ZGAB 2WGWB 4ZJ2A 4HY8A 4LV1A 1GA9A 1MWSA 4LV0A 3KSIA 1Z09A 3TSGA 4JPMA 2XROA 2YKFA 1LSWA 3CLOA 5KIZA 4HNBA 2QJ5A 2Y8HA 1YLTA 1X0OA 4I39A 2ZL1A 5EV0A 3E4QA 4C75A 1TDGA 1XJ3A 2HDUA 3C30A 1G6AA 3UPNA 4LGWA 3GRJA 1KDSA 4LENA 3IHBA 1YSPA 1IYQA 2ZMAA 3A3EA 1K6SA 1ERMA 1ODVA 1GA0A 1ONGA 4NK3A 5J3WA 4EESA 4JXVA 4EBPA 4S2MA 5CHUA 3CZDA 3C38A 3MZEA 2OSUA 1YSQA 1FCNA 1KE3A 4H6JB 4N9KA 1SKOB 4K08A 1HZOA 2X71A 3BW6A 4PHTA 1UWPX 5HWVA 1RP5A 1NZUA 5A8BA 2JC7A 3W4OA 3BM6A 4S2JA 5HWWA 4DJ3A 1IYPA 1YLZA 1BUEA 2W3DA 2HP5A 3KYQA 1WYCA 3EWKA 4ME4A 3LUQA 1CEFA 3B42A 3G34A 4GHIB 3IBJA 3HVFA 4DF6A 4DE0A 4ESPA 1YMXA 3SH7A 3CG5A 4IUKA 1K54A 5HD3A 2BG1A 3VFHA 3OPHA 4GLQA 3BFFA 1OJ5A 3LEZA 1LLBA 1GSVA 1A0KA 5M1AA 1AWIA 1VHMA 1S1YA 4CLCE 3HREA 2A49A 1ES2A 1FSWA 3VMAA 2P7JA 4ZDXA 2VLGA 4GCZA 5EE8A 5FA7A 3PTEA 5DF8A 5EM1A 4WZ5C 2ZLYA 2PYPA 2V1BA 3S1YA 1K38A 2WAFA 4OQGA 5IHVA 4BENA 3MXRA 3BLSA 5FAQA 4S2OA 5E2FA 3SH8A 4B9OA 1BZAA 3BFDA 4QHCA 5AQ9A 3B47A 2XFSA 1L0FA 3MFDA 5F1FA 4UHUA 5J8XA 3HLEA 2B95A 4DN0A 4QD4A 4YOFA 1N9NA 2ZC3B 3UPOA 4CJNA 1ZG6A 4Y0UA 3IX4A 4RX3A 4K91A 3FZCA 3GECA 1VQQA 2XFTA 1N9LA 4XUZA 4Y7PA 3T1XA 3CPTB 1ES4A 4Y15A 5EFWA 1XJ4A 4R70A 3OPPA 3UN7A 5JYPA 3FV7A 2EX8A 4OPYA 3DWKA 5A91A 5E2GA 2PR5A 4E3MA 1YAXA 3BFEA 2ZMFA 1BLSA 4KG6A 4BL3A 1SKFA 2QMIA 5FI7A 1Z6FA 1PW8A 2HF6A 2JKRI 4PKYG 2K31A 3MBZA 4JXSA 2DRWA 4IBXA 3VE3A 3Q7VA 1BTLA 4WL9A 1GHMA 2VA0A 3F1NA 4WEKA 1JWZA 4N92A 1N9OA 3SS5A 5CTNA 1WA9A 2JBFA 3G30A 4G3WA 3G31A 5FL3A 4FH4A 4HOIA 1TS6A 3ZG9B 1GCEA 4KZBA 3ZHHA 1Q2QA 1TDLA 1OTDA 5F1GA 4RQ9A 1OPXA 2HPBA 4OPRA 3P98A 4R4RA 3Q7ZA 3T12B 2EX6A 4LFUA 5EVIB 3FPWA 3E4PA 3W8KA 3AGEA 1IOUA 3F1PB 5K5BA 3TE8A 4Z9QA 3BWLA 1MZUA 4OLGA 3GMWA 1MWUA 3RJUA 3HLBA 2VGLS 4KZ5A 1SZVA 5MC7A 1FCMA 2AVXA 1AXBA 5CEDA 5KSCA 1OJGA 3FKVA 3HLDA 3M6BA 2QWSA 3D9YA 1PWDA 1JVJA 2DNSA 4WM9A 3NHQA 2WYXA 4HQAA 3M6HA 5FQ9A 3E2LA 5CTMA 2ZM8A 5FSRA 4DJ2A 3IF6B 5IS1A 3UO9A 2LB9A 2V0UA 3RTYA 1YT4A 2RCXA 3UE3A 3CMZA 3UNWA 3KYZA 2VEAA 3LO7A 3ZDJA 1T19A 3BEBA 1H8MA 3MQOA 1CJFA 4OQHA 4OPZA 4UA9A 1M6KA 2V9AA 5KMWA 1S66L 4BD0A 5AQBA 3WRTA 3ZQ5A 5L09A 1LSXA 1K54C 3BQ8A 3JYIA 5FQQA 1EROA 3R4KA 1ERQA 1LI9A 2J9PA 3IX8A 1G28A 4S2PA 3C4PA 2WZZA 2J3WA 4JGOA 2H0TA 3S22A 4Y0TA 4LV2A 4X69A 4I38A 3S7PA 4FSFA 5TBMB 4DXCA 4NXEA 2P74A 2Q9NA 2VK3A 3DTIA 1J9MA 1PZOA 1QMFA 5F82A 1CEGA 3N4IA 4EWFA 4B93A 3WWXA 1MKMA 4E3NA 5FATA 3GV9A 5E2HA 2WK0A 3UB6A 3PAGA 2QJ7A 3MFXA 2A24B 3NDGA 3R7WA 3IF5A 1FQGA 4K0WA 3R7WB 3UDXA 3LY3A 2XQZA 1CF0A 2Y2HA 4JF4A 3D4FA 3DTEA 3WS4A 1J3WA 3T4QA 3V50A 3ZG7B 1K4EA 3KSFA 1IKGA 1IFQA 2OOLA 3GSGA 4N9LA 3A3FA 3LFVA 3IF6C 1F98A 2Y2OA 3QP6A 5HWTA 3PBNA 3HLCA 4MDZA 1HD8A 2EFUA 3QP2A 3T1QB 4F94A 2XK1A 5GHZA 2ZQDA 1DP6A 1IELA 1TVFA 1NXYA 4EV4A 3BJNA 5FI6A 3A3JA 4MBKA 5GLDA 2V20A 4FOFA 3HUMA 1K6RA 3PBSA 3UDIA 2G7UA 3A0RA 4UQIM 5HZHA 4EBLA 1MC0A 4R0QA 2B02A 5HSQA 2WADA 3OZHA 3N8LA 1ZKJA 2JKRM 4E6XA 1TEMA 4GD8A 5EVIA 1NZOA 3L9KA 3N8RA 2J7VA 4RA7A 4WMCD 1RCJA 4WELA 3VOYA 3T1SA 4ZBEA 4HHDA 5HDSA 2HP6A 4HI4A
chains in the Genus database with same CATH topology
3FC7A 4BMWA 4IUKA 1W63M 2M7UA 3PHYA 1OT6A 2PHYA 2VZWA 3LR4A 5HD3A 1P97A 3C2WA 3S7NA 4GLQA 3OCLA 1NLYA 4HJ4A 3IS2B 4II7A 1OJ5A 3BQAA 4LRYC 1GSVA 2A2LA 1T18A 5CX7A 3ZYTA 2M7VA 3U2AA 1OTBA 4PKYA 1VHMA 1S1YA 3LIEA 4OOMA 4UQIS 4ETZA 4CLCE 2O9CA 2Z6DA 2KLIA 4MN5A 4ARZB 2P7JA 3D3OA 2V0WA 2VLGA 3F1PA 4GCZA 4KUKA 3HJKA 2J3TC 4Z1WA 2W3GA 4EERA 4R3AA 2W27A 2PYPA 3EQUA 2NUTC 2XRNA 2V1BA 3T4LA 2WKPA 5AVFA 5I5LA 3TJZC 5HPIA 3O5YA 4WUJA 5DKKA 2CMNA 2K2NA 4B9OA 4EW7A 2HGVA 3MR0A 4BBTA 2GNXA 3CI6A 3B47A 4HP9A 4CLCA 2P08A 2W3EA 3H82A 2A24A 4LRZE 5G4YA 1TS7A 5L8MA 1TF1A 2XSSA 2I9VA 3V67A 1OTAA 1ZTUA 3RFBA 4KUOA 2PD7A 3CUEC 3B33A 4DN0A 4WEJA 2ZOHA 3ULFA 4YOFA 3HCYA 1N9NA 1XJ2A 3PR6A 1GSXA 4O0PA 4KQDA 2WKRA 2INWA 3RH8B 1ZHHB 4L0LA 4MMNA 3F1OA 4Q0HA 4L9GA 3GECA 2L1MA 2R78A 3F1OB 2EWWA 3ICYA 1N9LA 4YNRA 2FH5A 1EW0A 4I5SA 3LIBA 2NUPC 3MXQA 3E98A 5EFWA 4GHIA 2ZMVA 4ZRRA 5HPFA 1XJ4A 1TS8A 4WF0A 4R70A 2PR6A 1F9IA 3LI9A 4CQHA 1Y28A 4IUHA 1T1BA 2PDRA 2VV8A 4H6JA 3VV4A 2J3TD 2PR5A 3S7OA 3NOUC 3BY9A 1LL8A 1YAXA 3SW1A 4XT2A 3EEAA 4OOLA 2ZMFA 2HJ9C 4PAUA 1DP8A 2BASA 3NJAA 1XFNA 2HF6A 3IBRA 2JKRI 4EEPA 5DFXA 2Y79A 2L0WA 2JHEA 4MN7A 5DJTA 4PKYG 2J80A 4I3AA 1D7EA 4JGRA 2K31A 4G3VA 3UE6A 3MJQA 2QKPA 4IHQA 2VJWA 4NXGA 3VE3A 4BWIA 3H7WB 1OT9A 3JVVA 5F6AA 2MJ6A 2K7SA 3F1NB 3UMDA 2VKSA 4WL9A 3PXPA 2VA0A 3F1NA 4KQOA 4WEKA 3LICA 1OTEA 3P01A 2PD8A 3K2NA 1N9OA 4EETB 3T4OA 1WA9A 1T1CA 4R6LA 2W3FA 4G3WA 3T4SA 5FL3A 4HOIA 1TS6A 4EEUA 4GJ4A 3LR3A 3KSHA 2H28A 1OTIA 4EU0A 3E0YA 3A0SA 4MCWA 2DMWA 1OTDA 2D01A 1F5MA 4AFIA 5DJUA 1S1ZA 4RQ9A 1OPXA 4EXOA 3H82B 5AVEA 5KSHA 5J7EA 3PBQA 1T1AA 5IT5A 2XA7M 3LIFA 1LSVA 3FPWA 3E4PA 3H7WA 3UB7A 5C5KA 1IOUA 2OAQ1 3F1PB 4M4XA 3H9WA 5K5BA 5F68A 3TE8A 4WN5A 3LIAA 1S4RA 3GDIA 4UEYA 2JKTI 3BWLA 1MZUA 4YWZA 4I3JA 4BJPA 4O8GA 2VGLS 1BYWA 5AJGA 4BBUA 1TS0A 3KSGA 5MC7A 3MQ0A 4HH3A 5HDDA 3FG8A 4GW9A 1V9ZA 3K3CA 4HP4A 2LB5A 3CUEA 4DMZA 1OJGA 3HJIA 4Y3IA 4EQ1A 4GS9B 5TBMA 2QWSA 5F5YA 3LI8A 5DFYA 4O01A 1H3QA 2ZOIA 1P0ZA 3NOTC 4I3IA 3NHQA 2YKHA 4NXBA 2GX5A 4HQAA 4G3KA 3IS2A 1GSWA 3A0VA 2QHKA 1S67L 2VV6A 4DJ2A 1DRMA 2P04A 3OCNA 2OWJA 2PT7A 2D02A 2O0YA 5IS1A 3PBTA 2KX6A 2LB9A 2V0UA 3RTYA 3UB9A 4E04A 3S7QA 2OWHA 2EA9A 3UE3A 3D72A 4F3LA 1KOUA 3KYZA 1UGUA 3T50A 1STZA 2JN7A 5IU1A 5LBRA 3EGDC 2VEAA 1DP9A 3OLOA 1JNUA 1T19A 5HD5A 1H8MA 4R38A 3MQQA 4CLCD 3LIDA 4P6ZM 2O9AA 3T4JA 3MQOA 2IA2A 3LR0A 4ARZA 4HJ3A 2HV1A 3T4KA 4JGPA 5DKLA 2V9AA 4P6ZS 1S66L 3VE4A 4ETXA 3TW8A 2KDKA 2Z6CA 3ZQ5A 4L9FA 4HJ6A 3OC2A 1LSXA 3PBRA 3BQ8A 3C8CA 2EWVA 1D06A 4CLCB 3EEHA 1VB6A 3R4KA 3CAXA 1G28A 2O9BA 2OAP1 3OOVA 2HJEA 2J3WA 4JGOA 2QYBA 3G6OA 4L9EA 2W1TB 2JKTM 3P7NA 4Y5FA 3W2ZA 2ZBBA 4I38A 5F69A 3S7PA 1TD5A 4FSFA 5TBMB 2B18A 5J4EA 1NLZA 4NXEA 3LYXA 4Y2FA 3T4TA 3EQVA 3CWFA 4EUVA 1V9YA 4B93A 4HH2A 2M1CA 1S4SA 1MKMA 3EGXC 3PYPA 2W0NA 3PBOA 1XFQA 4CLCC 3FPVA 3KO6A 4BBVA 2VV7A 2W1TA 3UB6A 1UWNX 4HY8A 2QJ7A 3MFXA 5HDCA 4XT2B 2A24B 3KSIA 4GS9A 3R7WA 4WLAA 4LPZA 5TJJA 3R7WB 1P9RA 2W3HA 3EOIA 3JVUA 2YKFA 2XROA 1LSWA 3CLOA 3UB8A 1YKDA 5G4ZA 1NRJA 5KIZA 2O99A 4HNBA 2KOIA 2QJ5A 3LR5A 2Y8HA 1X0OA 4I39A 3T4QA 2XA7S 3E4QA 3KSFA 1IFQA 2OOLA 2L4RA 3LFVA 1XJ3A 3C30A 1F98A 3UMEA 5HWTA 3PBNA 4NXFA 4MDZA 3BY8A 2PYRA 2WKQA 3NOPC 4HIAA 5DF9A 1YSPA 2GJ3A 4LLOB 4NKPA 1DP6A 2GZAA 1G6OA 1ODVA 3MMHA 2W1RA 5J3WA 3BJNA 4EESA 4IJGA 1NWZA 1P9WA 4MN6A 1LT0A 3C38A 3DBAA 1XJ6A 1YSQA 4H6JB 4FOFA 2FZ0A 3OBFA 3CITA 4JGQA 3PBSA 1W63Q 3K3DA 4K08A 3BW6A 4PHTA 2G7UA 1UWPX 4QPRA 5HWVA 3A0RA 4UQIM 5A8BA 2V1AA 5HZHA 4Q0JA 4F3LB 1MC0A 5HWWA 2VGLM 2B02A 5HSQA 4DJ3A 2JKRM 2W3DA 4Q0IA 2VX8A 3KYQA 3MF0A 4NEED 3EWKA 3TRCA 4ME4A 3LUQA 4WELA 3B42A 4GHIB 3IBJA 4HHDA 5HL6A 4LRXC 5HDSA 3KX0X 3E4OA 4HI4A 3VOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ4 A;  1TS8 A;  3FC7 A;  3FG8 A;  4R70 A;  4WF0 A;  5HDD A;  4GW9 A;  2PR6 A;  4BBV A;  1F9I A;  1V9Z A;  3K3C A;  3LI9 A;  2VV7 A;  4HP4 A;  1Y28 A;  1OJG A;  3HJI A;  3PHY A;  3UB6 A;  1OT6 A;  2PHY A;  1UWN X;  4HY8 A;  2QJ7 A;  1P97 A;  3MFX A;  5HD3 A;  3C2W A;  5HDC A;  4GS9 B;  4XT2 B;  4EQ1 A;  1T1B A;  2A24 B;  2PDR A;  4HJ4 A;  5TBM A;  3IS2 B;  2QWS A;  2VV8 A;  1OJ5 A;  4H6J A;  5F5Y A;  4GS9 A;  3LI8 A;  4WLA A;  2PR5 A;  4LPZ A;  3NOU C;  4LRY C;  1GSV A;  2ZOI A;  3BY9 A;  1LL8 A;  1T18 A;  3SW1 A;  1P0Z A;  3NOT C;  4I3I A;  3NHQ A;  2YKH A;  4NXB A;  4XT2 A;  1OTB A;  2YKF A;  4HQA A;  4PKY A;  1LSW A;  3CLO A;  3IS2 A;  1GSW A;  3UB8 A;  5G4Z A;  1S1Y A;  3LIE A;  4HNB A;  5KIZ A;  3A0V A;  1DP8 A;  2QHK A;  2Z6D A;  2BAS A;  1S67 L;  2VV6 A;  2QJ5 A;  3NJA A;  1XFN A;  4DJ2 A;  3IBR A;  1DRM A;  1X0O A;  4MN5 A;  4EEP A;  2OWJ A;  2L0W A;  4I39 A;  2D02 A;  5IS1 A;  2JHE A;  2P7J A;  2KX6 A;  5DJT A;  2V0W A;  2V0U A;  2VLG A;  3E4Q A;  3F1P A;  4GCZ A;  3RTY A;  4KUK A;  4PKY G;  3UB9 A;  3HJK A;  4E04 A;  2J80 A;  2EA9 A;  2OWH A;  4I3A A;  1D7E A;  3D72 A;  4F3L A;  2OOL A;  4JGR A;  3UE6 A;  3MJQ A;  1KOU A;  2QKP A;  1UGU A;  2L4R A;  1XJ3 A;  2JN7 A;  3T50 A;  4R3A A;  1F98 A;  2W27 A;  4EER A;  3UME A;  4NXG A;  5IU1 A;  3VE3 A;  2PYP A;  2VEA A;  3H7W B;  1OT9 A;  5HWT A;  2V1B A;  1DP9 A;  3OLO A;  4NXF A;  1JNU A;  1T19 A;  5F6A A;  5HD5 A;  3BY8 A;  2WKP A;  5AVF A;  2K7S A;  3F1N B;  5I5L A;  3UMD A;  4R38 A;  2PYR A;  2WKQ A;  3LID A;  3MQQ A;  3NOP C;  4WL9 A;  4HIA A;  3MQO A;  4WUJ A;  3F1N A;  2GJ3 A;  1OTE A;  3LIC A;  5DKK A;  2CMN A;  4HJ3 A;  4LLO B;  2PD8 A;  1DP6 A;  1N9O A;  4EET B;  2HV1 A;  4B9O A;  4JGP A;  4EW7 A;  1ODV A;  1WA9 A;  1T1C A;  3MR0 A;  5J3W A;  4R6L A;  5DKL A;  4BBT A;  4EES A;  4HP9 A;  2V9A A;  3H82 A;  1S66 L;  1NWZ A;  2A24 A;  4LRZ E;  3VE4 A;  4MN6 A;  5G4Y A;  4HOI A;  1TS7 A;  1LT0 A;  1TS6 A;  2KDK A;  2Z6C A;  4EEU A;  3ZQ5 A;  1XJ6 A;  4L9F A;  4HJ6 A;  1LSX A;  2I9V A;  3C8C A;  2H28 A;  1OTA A;  1OTI A;  1D06 A;  4H6J B;  4KUO A;  2PD7 A;  3A0S A;  3B33 A;  3EEH A;  1VB6 A;  1OTD A;  2D01 A;  2ZOH A;  3ULF A;  4JGQ A;  5DJU A;  3K3D A;  1N9N A;  1S1Z A;  3CAX A;  4K08 A;  1XJ2 A;  1G28 A;  4RQ9 A;  4EXO A;  1UWP X;  1GSX A;  3H82 B;  5AVE A;  5HWV A;  3A0R A;  5J7E A;  4JGO A;  5A8B A;  2V1A A;  5HZH A;  3G6O A;  1T1A A;  4L9E A;  4KQD A;  2WKR A;  2INW A;  3RH8 B;  3LIF A;  3P7N A;  1LSV A;  2ZBB A;  4I38 A;  5F69 A;  3E4P A;  4F3L B;  3H7W A;  3UB7 A;  3F1O A;  5TBM B;  5HWW A;  4L9G A;  5J4E A;  2B02 A;  5HSQ A;  4DJ3 A;  3F1P B;  3GEC A;  2L1M A;  2R78 A;  3F1O B;  3LYX A;  4M4X A;  4NXE A;  3ICY A;  3H9W A;  5F68 A;  1N9L A;  4WN5 A;  3LIA A;  1S4R A;  3CWF A;  1EW0 A;  1V9Y A;  3GDI A;  3LIB A;  4I5S A;  3BWL A;  1MZU A;  3EWK A;  4YWZ A;  4I3J A;  3LUQ A;  4GHI B;  4BBU A;  1BYW A;  3MXQ A;  4HH2 A;  1TS0 A;  2M1C A;  4HHD A;  1S4S A;  5EFW A;  3PYP A;  4GHI A;  4LRX C;  5HDS A;  3KX0 X;  2W0N A;  3E4O A;  4HI4 A;  3VOL A;  4HH3 A;  1XFQ A; 
#chains in the Genus database with same CATH topology
 4BMW A;  3IH9 A;  4DDS A;  1LI0 A;  3PHY A;  1OT6 A;  2VZW A;  3LR4 A;  2HP9 A;  3WS1 A;  1O07 A;  3BQA A;  4LRY C;  4E3O A;  1MPL A;  5CX7 A;  4HEF A;  3ZYT A;  2M7V A;  3U2A A;  4PKY A;  5EVE A;  2ZC6 B;  4JKT A;  3LIE A;  4OOM A;  4UQI S;  5U47 A;  2Z6D A;  1K25 A;  2KLI A;  4OP8 A;  3D3O A;  4KUK A;  3UB5 P;  3EQU A;  2XRN A;  2IWC A;  4OQ0 A;  3B3X A;  3RXX A;  3LCE A;  4WZ4 A;  5EPH A;  4EW7 A;  1DY6 A;  2GNX A;  4HP9 A;  3H82 A;  5CGW A;  2A24 A;  1FIL A;  4LRZ E;  4XUX A;  1TS7 A;  5DTK A;  1G68 A;  4GOG A;  1ZTU A;  3RFB A;  2Y55 A;  3B33 A;  3ULF A;  3NY4 A;  3PR6 A;  1NJ4 A;  3Q07 A;  2Y91 A;  4IBR A;  5BOH A;  3BFC A;  4DE3 A;  4KQD A;  1ZHH B;  4L0L A;  4Q0H A;  4L9G A;  2WAE A;  2R78 A;  2EWW A;  3ICY A;  5GLC A;  4YNR A;  2EX9 A;  1JWP A;  3NUL A;  4JF6 A;  4ZJ1 A;  1W79 A;  3LIB A;  3IX3 A;  3E98 A;  5AQA A;  4ZRR A;  3ISG A;  3SZT A;  4FTX A;  4WF0 A;  2PR6 A;  4RX2 A;  4CQH A;  1Y28 A;  2WUQ A;  2JCH A;  4MBH A;  5A90 A;  3ZVW A;  1T1B A;  3GTC A;  5EM0 A;  1W8Y A;  3VV4 A;  2J3T D;  3S7O A;  3NOU C;  3LGO A;  1RGY A;  3O3V A;  4XT2 A;  3EEA A;  4OOL A;  2UV0 E;  2WGW A;  4MEZ A;  3MSH A;  5DFX A;  1L3L A;  2FFY A;  3HLG A;  3MZF A;  4MN7 A;  5DJT A;  3QNC A;  4DDY A;  2XGN A;  4I3A A;  5HAQ A;  4JGR A;  3UE6 A;  2J8Y A;  2QKP A;  3MKE A;  4DRT A;  3HL9 A;  1EI5 A;  4N1X A;  4NXG A;  5HAP A;  2BLS A;  1BSG A;  1IEM A;  4YIN A;  3JVV A;  3VP3 A;  2K7S A;  4X53 A;  2VKS A;  3PXP A;  2WGI A;  1DJC A;  1HTZ A;  1MWR A;  1OTE A;  3P01 A;  3O87 A;  3KYE A;  4WYY A;  1T1C A;  5FQM A;  2PU2 A;  2W3F A;  3N6I A;  4EEU A;  4GJ4 A;  3W4P A;  3ITB A;  4GN2 A;  2H28 A;  3G2Z A;  5DVA A;  1JTD A;  2DMW A;  1GHP A;  5DJU A;  5FDH A;  1S1Z A;  4KZ3 A;  5AVE A;  5J7E A;  2A3U A;  4UA7 A;  1T1A A;  5IT5 A;  2XA7 M;  2EFX A;  2P9V A;  1LL9 A;  3H7W A;  4E6W A;  2H0Y A;  1IKI A;  4E3L A;  2E8I A;  3H9W A;  4WN5 A;  1S4R A;  2JKT I;  4CPK A;  1I2S A;  3IT9 A;  4YWZ A;  4I3J A;  4X68 A;  4BJP A;  2JKG A;  4BBU A;  1TS0 A;  3MQ0 A;  4HH3 A;  3FG8 A;  4MBF A;  4GW9 A;  1V9Z A;  4HP4 A;  2IWB A;  4DMZ A;  4OLD A;  4GS9 B;  5F5Y A;  4X56 A;  5HFO A;  4D2O A;  3LI8 A;  4O01 A;  1M40 A;  3ZNY A;  3GR2 A;  3ZG5 A;  3N8S A;  3NOT C;  3WS0 A;  5FI2 A;  4G3K A;  1GSW A;  2WKE A;  1L0G A;  5L10 A;  2QHK A;  3VP1 A;  2E8J A;  2OWJ A;  2O0Y A;  3PBT A;  2KX6 A;  4GZB A;  3S7Q A;  2IWD A;  3D72 A;  4F3L A;  1KGG A;  1UGU A;  4IVI A;  2PRF A;  1EWZ A;  4X1M A;  3SS4 A;  3EGD C;  5I94 A;  3V5M A;  4E3K A;  1MBL A;  4R38 A;  2Q9M A;  4ARZ A;  2HV1 A;  3T4K A;  3IH8 A;  2HZ5 A;  4GNU A;  2RL3 A;  4KG5 A;  4NET A;  4ETX A;  3TW8 A;  4R1G A;  2Z6C A;  4L9F A;  3JPU A;  3OC2 A;  3C8C A;  4CLC B;  1PYY A;  3EEH A;  3C7U A;  4R3B A;  4PM7 A;  1MWT A;  2XLN A;  2O9B A;  1XXM A;  2OAP 1;  4O7D A;  2OV5 A;  3OOV A;  2HJE A;  2XD1 A;  4P6B A;  4FD8 A;  3ZG8 B;  2W1T B;  2ZC5 B;  3TG9 A;  2C5W B;  1KGF A;  2EXB A;  1N9B A;  4OVD A;  3PAE A;  3WS5 A;  3LYX A;  4Y2F A;  1ACF A;  3S4X A;  1V9Y A;  1YLP A;  1S4S A;  2W0N A;  1PIO A;  3ZG0 A;  3FPV A;  4WBG A;  3KO6 A;  2I72 A;  5HAR A;  1UWN X;  3OPL A;  5HDC A;  4XT2 B;  5KZH A;  4PM8 A;  1XX2 A;  1RGZ A;  4GS9 A;  4DE1 A;  1H8Y A;  1YM1 A;  1L0D A;  1BT5 A;  3RXW A;  1FCO A;  3JVU A;  2XF3 A;  2Y4A A;  4MNR A;  2O99 A;  2KOI A;  3LR5 A;  2V2F F;  3HUN A;  4R23 A;  4JXG A;  2XA7 S;  5FAS A;  2ZQ7 A;  1VM1 A;  2L4R A;  5F83 A;  4NXF A;  2XD5 A;  2Y2I A;  2PYR A;  1HVB A;  2WKQ A;  3NOP C;  5DF9 A;  1KE4 A;  2GJ3 A;  4NKP A;  2G2W A;  2GZA A;  2Q0O A;  4GDB A;  4A5R A;  3ITA A;  3IXG A;  1P9W A;  4MN6 A;  3HLW A;  2H10 A;  3FKW A;  1PWC A;  3Q7V B;  1C3B A;  2FZ0 A;  3VP4 A;  2X01 A;  3OBF A;  3CIT A;  4JGQ A;  1W63 Q;  2V1Z A;  4X1L A;  3L7H A;  4QPR A;  4FCF A;  2V1A A;  2Y2Q A;  4K0X A;  5A93 A;  4F3L B;  2VGL M;  1U60 A;  1ESI A;  4D60 A;  4Q0I A;  2VX8 A;  1PFL A;  4RYE A;  4FH2 A;  4OON A;  3TRC A;  5CEC A;  4WMC A;  4IED A;  4BL2 A;  5EVL A;  4BBT A;  3KX0 X;  1QME A;  5G4Y A;  3VOL A;  1WYB A;  1JWV A;  3U4L P;  1KGE A;  2ZD8 A;  1KVL A;  4S2L A;  2XEP A;  2FFF B;  3ZFZ A;  3OCL A;  1NLY A;  4II7 A;  2R9W A;  2HDS A;  3C5A A;  1T18 A;  1XPB A;  3CPT A;  4EQI A;  2HDQ A;  1OTB A;  2Y2G A;  4ZJ3 A;  4ETZ A;  5TGF A;  4X55 A;  2PU4 A;  1XP4 A;  5D3O A;  4MN5 A;  1ZG4 A;  1YLJ A;  2V0W A;  4KQR A;  1K0K A;  3HJK A;  5FQJ A;  2J3T C;  4Z1W A;  3CJM A;  1CI8 A;  1Y54 A;  4X25 A;  3VP0 A;  4QY6 A;  4QY5 A;  1H0M A;  4Q8I A;  2NUT C;  2UWX A;  3Q82 A;  4Y0O A;  3IWQ A;  3T4L A;  3HLF A;  3DWZ A;  1KDW A;  2K2N A;  1SHV A;  2JE5 A;  3CI6 A;  3SOI A;  5GLB A;  3BYD A;  4CLC A;  2P08 A;  3Q1F A;  4RVA A;  1MKI A;  1PWG A;  1TF1 A;  1FR6 A;  1OTA A;  4KUO A;  3CUE C;  2QPN A;  1WE4 A;  3DTK A;  3HCY A;  1SCW A;  5A92 A;  4S2K A;  1XA1 A;  3IXD A;  4MMN A;  3F1O A;  1CI9 A;  5M18 A;  1L0E A;  2L1M A;  3F1O B;  2ACG A;  2FH5 A;  1ONH A;  2NUP C;  4ZTK A;  4N1H A;  4B88 A;  1BLC A;  1E25 A;  4QJG A;  3A3D A;  3O88 A;  3NEC A;  4QB8 A;  1F9I A;  2X02 A;  4IUH A;  2QZ6 A;  3QP4 A;  2G2U A;  1XGI A;  3BY9 A;  4KEN B;  1LL8 A;  1N4O A;  2HJ9 C;  4PAU A;  1DP8 A;  3QHY A;  5CGX A;  3NJA A;  3C4O A;  1NY0 A;  2JHE A;  2J9O A;  3G4P A;  1K55 C;  2ZQC A;  2J80 A;  4KZ6 A;  1D7E A;  4G3V A;  3MJQ A;  2PAV P;  3H7W B;  1OT9 A;  2Z2L B;  2MJ6 A;  3UMD A;  4LV3 A;  5FDS A;  3LIC A;  3UDF A;  1OME A;  2DCF A;  2CC1 A;  3K2N A;  4R3J A;  4H8R A;  3T4O A;  2WKH A;  1IYO A;  3T4S A;  3I7J A;  4GD6 A;  3LR3 A;  3KSH A;  3ZVT A;  3SS3 A;  3A0S A;  4FUW A;  4MCW A;  2D01 A;  1F5M A;  1E4D A;  4ZAM A;  2EX2 A;  4EXO A;  1CQA A;  3H82 B;  5KSH A;  5DTT A;  4GKU A;  5CER A;  1K55 A;  3ZNT A;  3PBQ A;  4JF5 A;  1YLY A;  5C5K A;  5L07 A;  2OAQ 1;  5EOO A;  1L2S A;  1K4F A;  5F68 A;  3LIA A;  4UEY A;  5M19 A;  1W7F A;  1S6R A;  3IXH A;  3KSG A;  3BRM A;  3IHA A;  2ZQ9 A;  1FSY A;  3IWI A;  3HJI A;  1VEU B;  3MXS A;  4Y3I A;  5TBM A;  4U0T A;  1SDN A;  3LY4 A;  1H3Q A;  2PBD P;  2ZOI A;  4KQQ A;  4I3I A;  2YKH A;  4NXB A;  1XKZ A;  4KZ8 A;  5GLA A;  1PNE A;  1SDE A;  2Y2J A;  1S67 L;  2OLV A;  1DRM A;  2ZQA A;  4U3T A;  2P04 A;  3OCN A;  3BLM A;  1I2W A;  5CRF A;  4E04 A;  3QP1 A;  4UAA A;  5EOE A;  1G5U A;  3T50 A;  4NG2 A;  1YLW A;  2C6W B;  1DP9 A;  3OLO A;  1JNU A;  5HD5 A;  1H5X A;  1DJB A;  1K56 A;  2O9A A;  3LR0 A;  1S0W A;  5HX9 A;  4LCM A;  4OKP A;  5FAP A;  2WKI A;  5FAO A;  1DJA A;  5FQI A;  4P6Z S;  2XR0 A;  3VE4 A;  5CHM A;  3NC8 A;  2KDK A;  3C7V A;  2EWV A;  1D06 A;  1VB6 A;  3BEC A;  4S2N C;  3MS6 A;  5CEB A;  4S2I A;  4L9E A;  2JKT M;  3P7N A;  5F69 A;  2B18 A;  5J4E A;  4PPR A;  4MLL A;  1ES5 A;  4EUV A;  4E3J A;  1IYS A;  4HH2 A;  2M1C A;  1XFQ A;  4BBV A;  1GHI A;  4OOY A;  2W1T A;  3NBL A;  3UE0 A;  5CXW A;  5E2E A;  2XDM A;  4DE2 A;  4WLA A;  2JKF A;  3NCK A;  4LPZ A;  5TJJ A;  2V8C A;  1P9R A;  2W3H A;  1HLU P;  3W4Q A;  4QU3 A;  5HAI A;  3EOI A;  3UB8 A;  1YKD A;  5G4Z A;  1NRJ A;  3DTM A;  2WGV A;  3GQZ A;  3P09 A;  4KZA A;  1KVM A;  5GL9 A;  3VOZ A;  3SH9 A;  3UME A;  3MZD A;  1K57 A;  3A3I A;  3BY8 A;  4X6T A;  1K56 D;  4HIA A;  3G2Y A;  3Q81 A;  1MY8 A;  4GDN A;  4LLO B;  1NRF A;  3AGD A;  3IXB A;  1G6O A;  3MMH A;  2W1R A;  4IJG A;  1NWZ A;  4Y13 A;  1LT0 A;  3DBA A;  1ZC2 A;  1XJ6 A;  5TFQ A;  2OLU A;  3MKF A;  1FOF A;  5EUA A;  3K3D A;  4M3K A;  3IF6 A;  1I5Q A;  3DW0 A;  1NYM A;  4Q0J A;  1YMS A;  3WRZ A;  2ZQ8 A;  5HL1 A;  4LCL A;  3MF0 A;  4NEE D;  5JYO A;  1PZP A;  3HUO A;  4GB7 A;  4BD1 A;  5HL6 A;  4LRX C;  5GHX A;  3E4O A;  1PRQ A;  3FC7 A;  1W63 M;  2M7U A;  4ID4 A;  4E3I A;  2PHY A;  1P97 A;  3C2W A;  3S7N A;  4HJ4 A;  3IS2 B;  3QP5 A;  2A2L A;  1K57 C;  4EUZ A;  3M2J A;  1BUL A;  2ZC7 A;  4HBT A;  3OPR A;  2O9C A;  5FEF A;  4ARZ B;  3CHW P;  4OP5 A;  5CHJ A;  3F1P A;  1BLP A;  2W3G A;  4EER A;  4R3A A;  2W27 A;  2Y59 A;  3O86 A;  2WKP A;  4UA6 A;  5AVF A;  5I5L A;  3TJZ C;  2GDN A;  5HPI A;  3O5Y A;  4WUJ A;  5FEG A;  5DKK A;  2CMN A;  4JXW A;  5FQK A;  1LHY A;  2HGV A;  3MR0 A;  1F2K A;  2W3E A;  4EBN A;  3NDE A;  3TOI A;  4KZ7 A;  5L8M A;  2XSS A;  2I9V A;  2ZM2 A;  3V67 A;  2WZX A;  4B4Z A;  1W5D A;  2PD7 A;  5AQ7 A;  4OPQ A;  4WEJ A;  2ZOH A;  4PM9 A;  2ZL1 B;  1XJ2 A;  1NYY A;  1GSX A;  4O0P A;  3V3R A;  2WKR A;  2INW A;  3RH8 B;  2VGJ A;  4S2N A;  2HDR A;  4BLM A;  2BTF P;  1EW0 A;  4I5S A;  5L2F A;  2V8F A;  1MXO A;  2R9X A;  3MXQ A;  1KE0 A;  4PM6 A;  3T1R A;  3V3S A;  4GHI A;  2ZMV A;  3NI9 A;  5HPF A;  1TS8 A;  4PMA A;  3LI9 A;  2ZJ9 A;  1SKO A;  4P0M A;  3UE1 A;  2PDR A;  1YQS A;  2VV8 A;  4H6J A;  1XA7 A;  4PM5 A;  1PI4 A;  3SW1 A;  5E43 A;  3G35 A;  2Y2P A;  1BLH A;  3LEQ A;  2BAS A;  1JTG A;  1XFN A;  3IBR A;  3FWL A;  4EEP A;  2Y79 A;  2L0W A;  3FYZ A;  1ALQ A;  4U0X A;  1Y4O A;  3ZCZ A;  2Z2M B;  4IHQ A;  2VJW A;  1W8Q A;  4BWI A;  3AGF A;  3QP8 A;  5F6A A;  4YFM A;  3F1N B;  1FR1 A;  4KQO A;  4OQI A;  2PD8 A;  5EEC A;  4EET B;  4B4X A;  2B5R A;  3UY6 A;  4R6L A;  1D1J A;  3VFF A;  4XXR A;  1H8Z A;  1OTI A;  1Q2P A;  4OH0 A;  4EU0 A;  1O7E A;  3E0Y A;  1E3U A;  4AFI A;  3VP2 A;  3GVB A;  3VSL A;  4KZ9 A;  2Y2K A;  3N7W A;  3LIF A;  1LSV A;  3UB7 A;  3WS2 A;  4P87 A;  4M4X A;  5EVI C;  3GDI A;  1CK3 A;  2EXA A;  4O8G A;  4JLF A;  5AJG A;  1BYW A;  4JBF A;  1PW1 A;  5EVI D;  5HDD A;  3K3C A;  2LB5 A;  3CUE A;  1PI5 A;  1LL5 A;  2ZC4 B;  4R4S A;  4EQ1 A;  1VEU A;  4IVK A;  2PBY A;  3IQA A;  3BFG A;  1VET A;  5DFY A;  4KG2 A;  1P0Z A;  2GX5 A;  3IS2 A;  2ZM0 A;  3A0V A;  4KZ4 A;  2VV6 A;  3HBR A;  1ES3 A;  2PT7 A;  2D02 A;  5CGS A;  3UB9 A;  3E2K A;  4HES A;  4WZ5 A;  2OWH A;  2EA9 A;  2VGK A;  1KOU A;  1STZ A;  2JN7 A;  5IU1 A;  5LBR A;  5G18 A;  2Y2N A;  1ESU A;  3MQQ A;  4QWO A;  3LID A;  4P6Z M;  3T4J A;  4CLC D;  5HW3 A;  2IA2 A;  5DF7 A;  4HJ3 A;  4DKI A;  4JGP A;  4C3Q A;  4BQM A;  5DKL A;  1YPR A;  3VSK A;  2H5S A;  4DXB A;  3DAV A;  2Y2L A;  4HJ6 A;  3PBR A;  2XH9 A;  4HBU A;  5DTS A;  3M2K A;  1E3U D;  3CAX A;  4P85 A;  2Y2M A;  1XGJ A;  4C6Y A;  3IWO A;  2QYB A;  3G32 A;  3G6O A;  1FIK A;  4Y17 A;  1VET B;  4Y5F A;  3W2Z A;  2ZBB A;  5TR7 A;  1TD5 A;  1NLZ A;  3QNB A;  3T4T A;  3EQV A;  3CWF A;  3UPP A;  3NIA A;  2P9V B;  3EGX C;  3PYP A;  5GHY A;  3V39 A;  3PBO A;  4CLC C;  2VV7 A;  3ZGA B;  2WGW B;  4ZJ2 A;  4HY8 A;  4LV1 A;  1GA9 A;  1MWS A;  4LV0 A;  3KSI A;  1Z09 A;  3TSG A;  4JPM A;  2XRO A;  2YKF A;  1LSW A;  3CLO A;  5KIZ A;  4HNB A;  2QJ5 A;  2Y8H A;  1YLT A;  1X0O A;  4I39 A;  2ZL1 A;  5EV0 A;  3E4Q A;  4C75 A;  1TDG A;  1XJ3 A;  2HDU A;  3C30 A;  1G6A A;  3UPN A;  4LGW A;  3GRJ A;  1KDS A;  4LEN A;  3IHB A;  1YSP A;  1IYQ A;  2ZMA A;  3A3E A;  1K6S A;  1ERM A;  1ODV A;  1GA0 A;  1ONG A;  4NK3 A;  5J3W A;  4EES A;  4JXV A;  4EBP A;  4S2M A;  5CHU A;  3CZD A;  3C38 A;  3MZE A;  2OSU A;  1YSQ A;  1FCN A;  1KE3 A;  4H6J B;  4N9K A;  1SKO B;  4K08 A;  1HZO A;  2X71 A;  3BW6 A;  4PHT A;  1UWP X;  5HWV A;  1RP5 A;  1NZU A;  5A8B A;  2JC7 A;  3W4O A;  3BM6 A;  4S2J A;  5HWW A;  4DJ3 A;  1IYP A;  1YLZ A;  1BUE A;  2W3D A;  2HP5 A;  3KYQ A;  1WYC A;  3EWK A;  4ME4 A;  3LUQ A;  1CEF A;  3B42 A;  3G34 A;  4GHI B;  3IBJ A;  3HVF A;  4DF6 A;  4DE0 A;  4ESP A;  1YMX A;  3SH7 A;  3CG5 A;  4IUK A;  1K54 A;  5HD3 A;  2BG1 A;  3VFH A;  3OPH A;  4GLQ A;  3BFF A;  1OJ5 A;  3LEZ A;  1LLB A;  1GSV A;  1A0K A;  5M1A A;  1AWI A;  1VHM A;  1S1Y A;  4CLC E;  3HRE A;  2A49 A;  1ES2 A;  1FSW A;  3VMA A;  2P7J A;  4ZDX A;  2VLG A;  4GCZ A;  5EE8 A;  5FA7 A;  3PTE A;  5DF8 A;  5EM1 A;  4WZ5 C;  2ZLY A;  2PYP A;  2V1B A;  3S1Y A;  1K38 A;  2WAF A;  4OQG A;  5IHV A;  4BEN A;  3MXR A;  3BLS A;  5FAQ A;  4S2O A;  5E2F A;  3SH8 A;  4B9O A;  1BZA A;  3BFD A;  4QHC A;  5AQ9 A;  3B47 A;  2XFS A;  1L0F A;  3MFD A;  5F1F A;  4UHU A;  5J8X A;  3HLE A;  2B95 A;  4DN0 A;  4QD4 A;  4YOF A;  1N9N A;  2ZC3 B;  3UPO A;  4CJN A;  1ZG6 A;  4Y0U A;  3IX4 A;  4RX3 A;  4K91 A;  3FZC A;  3GEC A;  1VQQ A;  2XFT A;  1N9L A;  4XUZ A;  4Y7P A;  3T1X A;  3CPT B;  1ES4 A;  4Y15 A;  5EFW A;  1XJ4 A;  4R70 A;  3OPP A;  3UN7 A;  5JYP A;  3FV7 A;  2EX8 A;  4OPY A;  3DWK A;  5A91 A;  5E2G A;  2PR5 A;  4E3M A;  1YAX A;  3BFE A;  2ZMF A;  1BLS A;  4KG6 A;  4BL3 A;  1SKF A;  2QMI A;  5FI7 A;  1Z6F A;  1PW8 A;  2HF6 A;  2JKR I;  4PKY G;  2K31 A;  3MBZ A;  4JXS A;  2DRW A;  4IBX A;  3VE3 A;  3Q7V A;  1BTL A;  4WL9 A;  1GHM A;  2VA0 A;  3F1N A;  4WEK A;  1JWZ A;  4N92 A;  1N9O A;  3SS5 A;  5CTN A;  1WA9 A;  2JBF A;  3G30 A;  4G3W A;  3G31 A;  5FL3 A;  4FH4 A;  4HOI A;  1TS6 A;  3ZG9 B;  1GCE A;  4KZB A;  3ZHH A;  1Q2Q A;  1TDL A;  1OTD A;  5F1G A;  4RQ9 A;  1OPX A;  2HPB A;  4OPR A;  3P98 A;  4R4R A;  3Q7Z A;  3T12 B;  2EX6 A;  4LFU A;  5EVI B;  3FPW A;  3E4P A;  3W8K A;  3AGE A;  1IOU A;  3F1P B;  5K5B A;  3TE8 A;  4Z9Q A;  3BWL A;  1MZU A;  4OLG A;  3GMW A;  1MWU A;  3RJU A;  3HLB A;  2VGL S;  4KZ5 A;  1SZV A;  5MC7 A;  1FCM A;  2AVX A;  1AXB A;  5CED A;  5KSC A;  1OJG A;  3FKV A;  3HLD A;  3M6B A;  2QWS A;  3D9Y A;  1PWD A;  1JVJ A;  2DNS A;  4WM9 A;  3NHQ A;  2WYX A;  4HQA A;  3M6H A;  5FQ9 A;  3E2L A;  5CTM A;  2ZM8 A;  5FSR A;  4DJ2 A;  3IF6 B;  5IS1 A;  3UO9 A;  2LB9 A;  2V0U A;  3RTY A;  1YT4 A;  2RCX A;  3UE3 A;  3CMZ A;  3UNW A;  3KYZ A;  2VEA A;  3LO7 A;  3ZDJ A;  1T19 A;  3BEB A;  1H8M A;  3MQO A;  1CJF A;  4OQH A;  4OPZ A;  4UA9 A;  1M6K A;  2V9A A;  5KMW A;  1S66 L;  4BD0 A;  5AQB A;  3WRT A;  3ZQ5 A;  5L09 A;  1LSX A;  1K54 C;  3BQ8 A;  3JYI A;  5FQQ A;  1ERO A;  3R4K A;  1ERQ A;  1LI9 A;  2J9P A;  3IX8 A;  1G28 A;  4S2P A;  3C4P A;  2WZZ A;  2J3W A;  4JGO A;  2H0T A;  3S22 A;  4Y0T A;  4LV2 A;  4X69 A;  4I38 A;  3S7P A;  4FSF A;  5TBM B;  4DXC A;  4NXE A;  2P74 A;  2Q9N A;  2VK3 A;  3DTI A;  1J9M A;  1PZO A;  1QMF A;  5F82 A;  1CEG A;  3N4I A;  4EWF A;  4B93 A;  3WWX A;  1MKM A;  4E3N A;  5FAT A;  3GV9 A;  5E2H A;  2WK0 A;  3UB6 A;  3PAG A;  2QJ7 A;  3MFX A;  2A24 B;  3NDG A;  3R7W A;  3IF5 A;  1FQG A;  4K0W A;  3R7W B;  3UDX A;  3LY3 A;  2XQZ A;  1CF0 A;  2Y2H A;  4JF4 A;  3D4F A;  3DTE A;  3WS4 A;  1J3W A;  3T4Q A;  3V50 A;  3ZG7 B;  1K4E A;  3KSF A;  1IKG A;  1IFQ A;  2OOL A;  3GSG A;  4N9L A;  3A3F A;  3LFV A;  3IF6 C;  1F98 A;  2Y2O A;  3QP6 A;  5HWT A;  3PBN A;  3HLC A;  4MDZ A;  1HD8 A;  2EFU A;  3QP2 A;  3T1Q B;  4F94 A;  2XK1 A;  5GHZ A;  2ZQD A;  1DP6 A;  1IEL A;  1TVF A;  1NXY A;  4EV4 A;  3BJN A;  5FI6 A;  3A3J A;  4MBK A;  5GLD A;  2V20 A;  4FOF A;  3HUM A;  1K6R A;  3PBS A;  3UDI A;  2G7U A;  3A0R A;  4UQI M;  5HZH A;  4EBL A;  1MC0 A;  4R0Q A;  2B02 A;  5HSQ A;  2WAD A;  3OZH A;  3N8L A;  1ZKJ A;  2JKR M;  4E6X A;  1TEM A;  4GD8 A;  5EVI A;  1NZO A;  3L9K A;  3N8R A;  2J7V A;  4RA7 A;  4WMC D;  1RCJ A;  4WEL A;  3VOY A;  3T1S A;  4ZBE A;  4HHD A;  5HDS A;  2HP6 A;  4HI4 A; 
#chains in the Genus database with same CATH homology
 3FC7 A;  4BMW A;  4IUK A;  1W63 M;  2M7U A;  3PHY A;  1OT6 A;  2PHY A;  2VZW A;  3LR4 A;  5HD3 A;  1P97 A;  3C2W A;  3S7N A;  4GLQ A;  3OCL A;  1NLY A;  4HJ4 A;  3IS2 B;  4II7 A;  1OJ5 A;  3BQA A;  4LRY C;  1GSV A;  2A2L A;  1T18 A;  5CX7 A;  3ZYT A;  2M7V A;  3U2A A;  1OTB A;  4PKY A;  1VHM A;  1S1Y A;  3LIE A;  4OOM A;  4UQI S;  4ETZ A;  4CLC E;  2O9C A;  2Z6D A;  2KLI A;  4MN5 A;  4ARZ B;  2P7J A;  3D3O A;  2V0W A;  2VLG A;  3F1P A;  4GCZ A;  4KUK A;  3HJK A;  2J3T C;  4Z1W A;  2W3G A;  4EER A;  4R3A A;  2W27 A;  2PYP A;  3EQU A;  2NUT C;  2XRN A;  2V1B A;  3T4L A;  2WKP A;  5AVF A;  5I5L A;  3TJZ C;  5HPI A;  3O5Y A;  4WUJ A;  5DKK A;  2CMN A;  2K2N A;  4B9O A;  4EW7 A;  2HGV A;  3MR0 A;  4BBT A;  2GNX A;  3CI6 A;  3B47 A;  4HP9 A;  4CLC A;  2P08 A;  2W3E A;  3H82 A;  2A24 A;  4LRZ E;  5G4Y A;  1TS7 A;  5L8M A;  1TF1 A;  2XSS A;  2I9V A;  3V67 A;  1OTA A;  1ZTU A;  3RFB A;  4KUO A;  2PD7 A;  3CUE C;  3B33 A;  4DN0 A;  4WEJ A;  2ZOH A;  3ULF A;  4YOF A;  3HCY A;  1N9N A;  1XJ2 A;  3PR6 A;  1GSX A;  4O0P A;  4KQD A;  2WKR A;  2INW A;  3RH8 B;  1ZHH B;  4L0L A;  4MMN A;  3F1O A;  4Q0H A;  4L9G A;  3GEC A;  2L1M A;  2R78 A;  3F1O B;  2EWW A;  3ICY A;  1N9L A;  4YNR A;  2FH5 A;  1EW0 A;  4I5S A;  3LIB A;  2NUP C;  3MXQ A;  3E98 A;  5EFW A;  4GHI A;  2ZMV A;  4ZRR A;  5HPF A;  1XJ4 A;  1TS8 A;  4WF0 A;  4R70 A;  2PR6 A;  1F9I A;  3LI9 A;  4CQH A;  1Y28 A;  4IUH A;  1T1B A;  2PDR A;  2VV8 A;  4H6J A;  3VV4 A;  2J3T D;  2PR5 A;  3S7O A;  3NOU C;  3BY9 A;  1LL8 A;  1YAX A;  3SW1 A;  4XT2 A;  3EEA A;  4OOL A;  2ZMF A;  2HJ9 C;  4PAU A;  1DP8 A;  2BAS A;  3NJA A;  1XFN A;  2HF6 A;  3IBR A;  2JKR I;  4EEP A;  5DFX A;  2Y79 A;  2L0W A;  2JHE A;  4MN7 A;  5DJT A;  4PKY G;  2J80 A;  4I3A A;  1D7E A;  4JGR A;  2K31 A;  4G3V A;  3UE6 A;  3MJQ A;  2QKP A;  4IHQ A;  2VJW A;  4NXG A;  3VE3 A;  4BWI A;  3H7W B;  1OT9 A;  3JVV A;  5F6A A;  2MJ6 A;  2K7S A;  3F1N B;  3UMD A;  2VKS A;  4WL9 A;  3PXP A;  2VA0 A;  3F1N A;  4KQO A;  4WEK A;  3LIC A;  1OTE A;  3P01 A;  2PD8 A;  3K2N A;  1N9O A;  4EET B;  3T4O A;  1WA9 A;  1T1C A;  4R6L A;  2W3F A;  4G3W A;  3T4S A;  5FL3 A;  4HOI A;  1TS6 A;  4EEU A;  4GJ4 A;  3LR3 A;  3KSH A;  2H28 A;  1OTI A;  4EU0 A;  3E0Y A;  3A0S A;  4MCW A;  2DMW A;  1OTD A;  2D01 A;  1F5M A;  4AFI A;  5DJU A;  1S1Z A;  4RQ9 A;  1OPX A;  4EXO A;  3H82 B;  5AVE A;  5KSH A;  5J7E A;  3PBQ A;  1T1A A;  5IT5 A;  2XA7 M;  3LIF A;  1LSV A;  3FPW A;  3E4P A;  3H7W A;  3UB7 A;  5C5K A;  1IOU A;  2OAQ 1;  3F1P B;  4M4X A;  3H9W A;  5K5B A;  5F68 A;  3TE8 A;  4WN5 A;  3LIA A;  1S4R A;  3GDI A;  4UEY A;  2JKT I;  3BWL A;  1MZU A;  4YWZ A;  4I3J A;  4BJP A;  4O8G A;  2VGL S;  1BYW A;  5AJG A;  4BBU A;  1TS0 A;  3KSG A;  5MC7 A;  3MQ0 A;  4HH3 A;  5HDD A;  3FG8 A;  4GW9 A;  1V9Z A;  3K3C A;  4HP4 A;  2LB5 A;  3CUE A;  4DMZ A;  1OJG A;  3HJI A;  4Y3I A;  4EQ1 A;  4GS9 B;  5TBM A;  2QWS A;  5F5Y A;  3LI8 A;  5DFY A;  4O01 A;  1H3Q A;  2ZOI A;  1P0Z A;  3NOT C;  4I3I A;  3NHQ A;  2YKH A;  4NXB A;  2GX5 A;  4HQA A;  4G3K A;  3IS2 A;  1GSW A;  3A0V A;  2QHK A;  1S67 L;  2VV6 A;  4DJ2 A;  1DRM A;  2P04 A;  3OCN A;  2OWJ A;  2PT7 A;  2D02 A;  2O0Y A;  5IS1 A;  3PBT A;  2KX6 A;  2LB9 A;  2V0U A;  3RTY A;  3UB9 A;  4E04 A;  3S7Q A;  2OWH A;  2EA9 A;  3UE3 A;  3D72 A;  4F3L A;  1KOU A;  3KYZ A;  1UGU A;  3T50 A;  1STZ A;  2JN7 A;  5IU1 A;  5LBR A;  3EGD C;  2VEA A;  1DP9 A;  3OLO A;  1JNU A;  1T19 A;  5HD5 A;  1H8M A;  4R38 A;  3MQQ A;  4CLC D;  3LID A;  4P6Z M;  2O9A A;  3T4J A;  3MQO A;  2IA2 A;  3LR0 A;  4ARZ A;  4HJ3 A;  2HV1 A;  3T4K A;  4JGP A;  5DKL A;  2V9A A;  4P6Z S;  1S66 L;  3VE4 A;  4ETX A;  3TW8 A;  2KDK A;  2Z6C A;  3ZQ5 A;  4L9F A;  4HJ6 A;  3OC2 A;  1LSX A;  3PBR A;  3BQ8 A;  3C8C A;  2EWV A;  1D06 A;  4CLC B;  3EEH A;  1VB6 A;  3R4K A;  3CAX A;  1G28 A;  2O9B A;  2OAP 1;  3OOV A;  2HJE A;  2J3W A;  4JGO A;  2QYB A;  3G6O A;  4L9E A;  2W1T B;  2JKT M;  3P7N A;  4Y5F A;  3W2Z A;  2ZBB A;  4I38 A;  5F69 A;  3S7P A;  1TD5 A;  4FSF A;  5TBM B;  2B18 A;  5J4E A;  1NLZ A;  4NXE A;  3LYX A;  4Y2F A;  3T4T A;  3EQV A;  3CWF A;  4EUV A;  1V9Y A;  4B93 A;  4HH2 A;  2M1C A;  1S4S A;  1MKM A;  3EGX C;  3PYP A;  2W0N A;  3PBO A;  1XFQ A;  4CLC C;  3FPV A;  3KO6 A;  4BBV A;  2VV7 A;  2W1T A;  3UB6 A;  1UWN X;  4HY8 A;  2QJ7 A;  3MFX A;  5HDC A;  4XT2 B;  2A24 B;  3KSI A;  4GS9 A;  3R7W A;  4WLA A;  4LPZ A;  5TJJ A;  3R7W B;  1P9R A;  2W3H A;  3EOI A;  3JVU A;  2YKF A;  2XRO A;  1LSW A;  3CLO A;  3UB8 A;  1YKD A;  5G4Z A;  1NRJ A;  5KIZ A;  2O99 A;  4HNB A;  2KOI A;  2QJ5 A;  3LR5 A;  2Y8H A;  1X0O A;  4I39 A;  3T4Q A;  2XA7 S;  3E4Q A;  3KSF A;  1IFQ A;  2OOL A;  2L4R A;  3LFV A;  1XJ3 A;  3C30 A;  1F98 A;  3UME A;  5HWT A;  3PBN A;  4NXF A;  4MDZ A;  3BY8 A;  2PYR A;  2WKQ A;  3NOP C;  4HIA A;  5DF9 A;  1YSP A;  2GJ3 A;  4LLO B;  4NKP A;  1DP6 A;  2GZA A;  1G6O A;  1ODV A;  3MMH A;  2W1R A;  5J3W A;  3BJN A;  4EES A;  4IJG A;  1NWZ A;  1P9W A;  4MN6 A;  1LT0 A;  3C38 A;  3DBA A;  1XJ6 A;  1YSQ A;  4H6J B;  4FOF A;  2FZ0 A;  3OBF A;  3CIT A;  4JGQ A;  3PBS A;  1W63 Q;  3K3D A;  4K08 A;  3BW6 A;  4PHT A;  2G7U A;  1UWP X;  4QPR A;  5HWV A;  3A0R A;  4UQI M;  5A8B A;  2V1A A;  5HZH A;  4Q0J A;  4F3L B;  1MC0 A;  5HWW A;  2VGL M;  2B02 A;  5HSQ A;  4DJ3 A;  2JKR M;  2W3D A;  4Q0I A;  2VX8 A;  3KYQ A;  3MF0 A;  4NEE D;  3EWK A;  3TRC A;  4ME4 A;  3LUQ A;  4WEL A;  3B42 A;  4GHI B;  3IBJ A;  4HHD A;  5HL6 A;  4LRX C;  5HDS A;  3KX0 X;  3E4O A;  4HI4 A;  3VOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...