5AVFA

The ligand binding domain of mlp37 with taurine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
244
structure length
244
Chain Sequence
b'GPLGSVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 77
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5avfA02
3KX0X 1N9OA 2V0WA 1S1YA 1OJ5A 1DP9A 4WUJA 1P97A 3H9WA 4HHDA 1S1ZA 1S66L 2P7JA 3BY8A 2PR5A 4HNBA 3LIDA 3UMEA 3D72A 1N9NA 2JHEA 4HP4A 4I3JA 4K08A 2I9VA 5F69A 2VV6A 3BY9A 4WF0A 1S4SA 2K7SA 4HY8A 2ZOIA 3LICA 4YWZA 2OOLA 2QJ7A 5G4ZA 2GJ3A 1UWPX 4JGPA 4L9EA 2V9AA 3ULFA 3NOUC 2W0NA 4NXBA 3EEHA 4EEPA 2ZOHA 4HJ3A 3CWFA 5J3WA 3MFXA 2QWSA 4EESA 5HZHA 2J80A 3C8CA 5HWVA 4HJ4A 3EWKA 4R3AA 5I5LA 5J4EA 3LYXA 2YKHA 3PHYA 4I39A 5KIZA 4E04A 3H7WA 4HJ6A 2QJ5A 1GSXA 1XJ4A 4I3IA 3H7WB 1OJGA 4H6JA 5HDSA 3GDIA 1T1AA 4LLOB 4H6JB 4LRXC 3LI9A 2L0WA 1LT0A 5DJUA 5DJTA 2V1BA 4KQDA 3MR0A 3LI8A 4MN5A 3HJKA 4NXEA 5J7EA 3FC7A 4R38A 4XT2A 2PD8A 2WKPA 4XT2B 4PKYA 3A0RA 4EERA 4HI4A 4GHIA 2D01A 1ODVA 2VV8A 4GHIB 5IS1A 3MJQA 3A0VA 1V9ZA 1T18A 2QHKA 3B33A 1OT6A 4HQAA 3G6OA 1UWNX 2Z6CA 3P7NA 5DKKA 2PHYA 4JGQA 1LL8A 1TS8A 4EW7A 1Y28A 3ZQ5A 1WA9A 4RQ9A 3PYPA 2HV1A 1D06A 2VEAA 3E4OA 3NJAA 4JGRA 3MQQA 3CLOA 3HJIA 1OT9A 3IS2A 3IS2B 1DP6A 2EA9A 4MN6A 4HH3A 1OTIA 1EW0A 2KX6A 3RH8B 3E4QA 1F98A 5HWTA 5DKLA 5F68A 4L9GA 3NOPC 2BASA 4EETB 4DJ3A 3GECA 1N9LA 3MQOA 4GCZA 3K3DA 4I38A 2VLGA 1XJ3A 4DJ2A 2QKPA 3T50A 2L1MA 3LIFA 2OWHA 3F1NA 5EFWA 3F1NB 5F5YA 1TS0A 1X0OA 1T1CA 2PR6A 4LRYC 4KUOA 1XJ6A 4WLAA 3VE3A 4EEUA 2H28A 3NOTC 1F9IA 4NXFA 5HDCA 1XJ2A 4HIAA 3UB7A 1BYWA 2PYPA 4BBVA 4PKYG 1OTBA 4GW9A 5HWWA 1S4RA 4HOIA 4NXGA 3UMDA 1GSWA 4F3LA 4HP9A 4WL9A 4I3AA 4F3LB 5HD3A 2W27A 4LPZA 2JN7A 3ICYA 4M4XA 1XFQA 2VV7A 2OWJA 2ZBBA 1DP8A 5AVEA 3F1OA 4WN5A 4B9OA 3MXQA 3F1OB 2PD7A 1G28A 2YKFA 3LUQA 1UGUA 5HDDA 2B02A 4JGOA 1LSVA 2R78A 4BBTA 1LSWA 1S67L 1OTAA 4L9FA 3FG8A 3UE6A 2M1CA 1OTEA 5A8BA 3F1PA 3VOLA 3NHQA 4EXOA 3F1PB 5F6AA 1KOUA 3OLOA 1JNUA 1NWZA 2WKRA 5TBMA 4R6LA 2V0UA 2CMNA 1TS6A 5TBMB 5HD5A 3RTYA 5HSQA 4BBUA 3A0SA 1TS7A 3C2WA 3UB6A 1XFNA 1D7EA 4GS9A 2PYRA 1P0ZA 3UB9A 4GS9B 1GSVA 5G4YA 1T19A 3SW1A 2INWA 3LIBA 2L4RA 3BWLA 1T1BA 3LIAA 4I5SA 2Z6DA 3H82A 3LIEA 3UB8A 4EQ1A 2PDRA 4LRZE 2V1AA 3H82B 2A24A 1VB6A 2A24B 4R70A 1V9YA 5IU1A 2D02A 4HH2A 1DRMA 1LSXA 2WKQA 3CAXA 1OTDA 3VE4A 3IBRA 3K3CA 5AVFA 4KUKA 2KDKA 1MZUA 3E4PA
chains in the Genus database with same CATH superfamily
1GHPA 5EVIA 1GA0A 1L2SA 3VP3A 2ZQ9A 3MZEA 3EQVA 4EU0A 4WZ4A 1S1ZA 4EBLA 4WMCA 3HLWA 1Z6FA 1RP5A 3VP1A 5EE8A 3OZHA 2DCFA 3OPPA 2O9CA 4XXRA 1YQSA 3UDXA 3FWLA 1NZOA 3O3VA 2Z2LB 5L2FA 4K08A 2I9VA 2K7SA 4HY8A 3SOIA 3IF5A 4KZ7A 3MZDA 3LICA 3OOVA 4YWZA 5FEFA 2PBYA 2OOLA 4G3KA 1MWRA 4RA7A 1GHIA 2GJ3A 1UWPX 3CJMA 3ZG9B 1JVJA 4OPQA 4B93A 2V9AA 4OH0A 3G32A 4KZ8A 5FAQA 4NXBA 1GHMA 3EEHA 5KMWA 2JKRM 5FI6A 4FCFA 3KYQA 5J3WA 2QWSA 3HREA 1IYSA 4P85A 3C8CA 5HWVA 5GLBA 3UE0A 1MPLA 2XD1A 1CK3A 3HUOA 1O7EA 3MBZA 4UA6A 5KIZA 5JYOA 1Q2QA 4JXWA 1K0KA 5CX7A 1XJ4A 4FUWA 2Y2QA 4I3IA 2XFTA 4Y5FA 5C5KA 4K91A 1K25A 2ZD8A 4H6JA 3HLGA 1XP4A 4AFIA 1LT0A 3S22A 4MN5A 4DE2A 5L8MA 3HJKA 3SH7A 3FC7A 4YINA 3S4XA 4XT2B 5GLCA 4HESA 4E3JA 4QY5A 4IEDA 4HBUA 4PKYA 3N8SA 2HP6A 2LB5A 2WAFA 4HI4A 4GHIB 2H0YA 4CLCD 3S1YA 4MLLA 5CERA 4R23A 4X1LA 2QHKA 1LL9A 3B33A 1OT6A 3G6OA 5FI7A 3C30A 3Q82A 5A93A 4BD0A 1TS8A 2HP5A 1QMFA 2A49A 5L07A 4LFUA 3O5YA 5HAPA 3BECA 4MBKA 2IWBA 2RL3A 2KLIA 3MF0A 3E4OA 1FIKA 2BTFP 3AGDA 3NY4A 2WKIA 4RYEA 2W1TB 3MQQA 3JVVA 2XR0A 5FAPA 4EUVA 3Q1FA 2QYBA 3DAVA 2WADA 2EA9A 3EGDC 4WELA 1EW0A 1ES2A 5TGFA 2KX6A 4MEZA 2J9OA 1ESUA 2ZC7A 4C3QA 2Y55A 4L9GA 4X69A 3NOPC 4KQQA 1WYCA 1XA7A 1N9LA 2ZQCA 1VHMA 4GZBA 2EX2A 4B4ZA 2A3UA 3MQOA 4BQMA 4IHQA 3K3DA 1PWGA 1IYQA 3HLFA 4OQ0A 4Y0UA 3PAEA 2VLGA 5M1AA 4WZ5A 2VGJA 3IXHA 1E4DA 1W79A 1M40A 2QKPA 4KZ6A 3LIFA 3IF6A 1KGGA 2P08A 1MWTA 1QMEA 5EM0A 3F1NA 4DF6A 4MN7A 4BD1A 2J3TC 4EWFA 1T1CA 2PR6A 2IA2A 1FR6A 4KUOA 5AJGA 2XFSA 2ZM0A 4GJ4A 1MXOA 5FASA 4WLAA 2Q0OA 3LR3A 4PHTA 5F1GA 3CPTB 3ZCZA 4DE0A 4GDBA 2VGLS 4Y13A 1E25A 5BOHA 1ZG4A 4JBFA 3ISGA 1S6RA 1M6KA 3VMAA 3T4OA 4UA7A 3T4QA 4L0LA 4BBVA 4E6WA 1XGIA 5HWWA 4Q8IA 1S4RA 2FH5A 4JPMA 3EGXC 1IEMA 2GDNA 1FCMA 1Q2PA 3BFCA 3UMDA 5HX9A 4WL9A 4F3LB 1SKOA 2W27A 4LPZA 3HLCA 2Y2PA 3LR4A 2BG1A 2OWJA 5FL3A 2ACGA 1KDSA 3F1OB 3V39A 3PTEA 3HUNA 1UGUA 2J3WA 3DTKA 3LGOA 4O7DA 5HDDA 4JGOA 3PBSA 2R78A 3HL9A 3UY6A 5DFXA 1ZTUA 3T1RA 1ZG6A 2P74A 3UE6A 5MC7A 2M1CA 4P6ZS 3E98A 3HLDA 2C6WB 4WYYA 4IBXA 4MDZA 2XGNA 3OLOA 2J9PA 4S2NA 4A5RA 3FV7A 3BJNA 1NWZA 2WKRA 3PBQA 5TBMA 2V0UA 3D9YA 3R4KA 3RTYA 4BBUA 5A90A 2C5WB 3B42A 3C2WA 5CECA 3UB6A 3B3XA 1KE4A 4DE1A 4ZAMA 3ZNTA 4GS9A 1AXBA 4LV2A 3UO9A 2NUTC 3GV9A 4GKUA 5G4YA 1T19A 3O86A 2XLNA 3BWLA 3UPOA 3QP8A 1TDLA 4N92A 3HUMA 3LIAA 4I5SA 1IELA 4GD6A 3KSIA 3QP1A 4EQ1A 4FTXA 5G18A 2WKEA 4KENB 4MNRA 2HP9A 2D02A 4HH2A 3ZG7B 1FILA 1DRMA 4BWIA 4OP5A 1G68A 3LEQA 3EOIA 5D3OA 3CUEC 1N9OA 3TJZC 1ONHA 4X25A 1OJ5A 1PW8A 2Y2JA 5EVIB 1H8MA 2ZC6B 4DN0A 4O8GA 2Q9MA 1S0WA 2ZQAA 5AQ7A 4QPRA 4PM6A 1YAXA 2Z2MB 3FPVA 3MSHA 1YLWA 1OPXA 3N4IA 5L09A 3M2JA 1K38A 4X56A 3KYZA 1N9NA 3A3DA 4WM9A 2LB9A 3VV4A 4XUZA 5F69A 1WE4A 4S2KA 5EVIC 4WF0A 4B4XA 1K55A 1ZKJA 3DWZA 2HF6A 3MZFA 1G5UA 3MXSA 2QJ7A 2JBFA 5FA7A 3LFVA 3N7WA 3IBJA 4O0PA 4QY6A 3ULFA 4S2OA 3S7PA 4RX3A 1CI9A 2QPNA 2JKTM 5FEGA 5HL1A 5HW3A 4GOGA 5E2EA 3B47A 3G30A 2QZ6A 5HZHA 3WS2A 2VGKA 4HJ4A 3WRTA 5DFYA 5FQMA 1LHYA 4E04A 2X02A 2QJ5A 1GSXA 1CF0A 5GLDA 1CEFA 2HDSA 4DKIA 3CZDA 3C4OA 5FQIA 1T1AA 2B5RA 4H6JB 1MBLA 4LRXC 1P9RA 2L0WA 1NLZA 3PAGA 5DJUA 3LR0A 2HJ9C 1MWUA 5DJTA 5IHVA 2WAEA 4XUXA 3LI8A 2WGWA 2O0YA 5U47A 5J7EA 3CHWP 3PR6A 3ZYTA 1E3UD 2VGLM 3CI6A 3BYDA 2V1ZA 1OMEA 1NYMA 4X6TA 3UE3A 2D01A 1IOUA 3BQ8A 5IS1A 3MJQA 3A0VA 1I2WA 3T1QB 1V9ZA 4U0XA 1T18A 2E8JA 4DXBA 1XA1A 3P7NA 4JGQA 3U2AA 1ZC2A 2R9WA 1LI0A 5EVLA 1DY6A 1WA9A 3S7QA 4FH2A 4RQ9A 2HV1A 1D06A 1MWSA 3SH9A 2X71A 2EXBA 4X53A 3NJAA 1K4FA 1ONGA 2OAP1 1F2KA 4QHCA 4GD8A 3DTIA 1FOFA 1XX2A 3N6IA 1OT9A 4KG5A 3IS2A 3QP5A 2MJ6A 1DP6A 4HH3A 3T4KA 1E3UA 2WZZA 5DTKA 4P6ZM 5HWTA 3IX4A 1VEUA 1I5QA 3NDEA 5DKLA 4N1HA 2Y2IA 3M2KA 3OBFA 5DVAA 4N9LA 5FDSA 5HFOA 1SDEA 2WGVA 4DJ3A 4KQOA 3UB5P 4LGWA 3GECA 4LV3A 4GCZA 5KSHA 1YSQA 4LENA 1NRFA 1L3LA 1ES3A 1XJ3A 3ZNYA 3GSGA 3T50A 4LCLA 3D4FA 2OWHA 1H5XA 2PU4A 2Y79A 3V3RA 3VFHA 4ID4A 1BSGA 3IF6B 4H8RA 2G2WA 3ZFZA 1H8ZA 3F1NB 2EX8A 5F5YA 3LR5A 1HTZA 3C7VA 4LRYC 2HDRA 1EROA 3VOYA 5AQ9A 2G7UA 1DJAA 1BT5A 1C3BA 4NETA 3FZCA 3VE3A 4Q0HA 3T4LA 1RGYA 2VZWA 3O87A 4WZ5C 3KSGA 5HPFA 1SCWA 3NECA 5FQKA 1YLYA 2X01A 3RXWA 5HL6A 4KG6A 3IF6C 3ITAA 5JYPA 5A92A 4NXFA 1PI4A 1XJ2A 1H3QA 3KSHA 4QU3A 2V2FF 1JTDA 3Q7VA 2PYPA 2FFFB 4PKYG 1OTBA 4GW9A 3WS4A 1TEMA 4NXGA 3O88A 1GSWA 1IKIA 4HP9A 3BM6A 3QP2A 2Y2GA 5TR7A 3V67A 3VSLA 1SKOB 2VV7A 2W3EA 4Q0IA 4RX2A 1K57A 4B9OA 4Y7PA 3TW8A 3IWQA 4FH4A 1K6RA 4BL3A 3RJUA 1LSVA 4BBTA 3V3SA 2WZXA 1CQAA 3IWIA 4CLCA 2W3HA 1OTEA 3F1PA 1GCEA 4PM5A 1W8QA 3C7UA 4EXOA 1VQQA 1XXMA 2HDUA 1EWZA 1BULA 4R6LA 2V8CA 3G31A 2H10A 5TBMB 3OPRA 5HSQA 1BUEA 2ZM2A 1TS7A 1PIOA 4ZJ1A 1XFNA 3NIAA 3DBAA 2PBDP 1TDGA 1N9BA 4OOYA 4KZ4A 5DF7A 3BLMA 1YLJA 3UB9A 4DRTA 4S2MA 4GS9B 4Y15A 4ZTKA 2INWA 2ZL1A 4K0XA 4EV4A 4S2NC 3LIBA 2L4RA 3PBNA 2DMWA 2ZM8A 2Z6DA 2VJWA 3UB8A 4PAUA 2PDRA 2V1AA 1RCJA 2UWXA 2A24A 2ZQ8A 2J7VA 1J9MA 5IU1A 2Y2NA 1FR1A 5CTMA 1FCNA 5GL9A 5M18A 2O99A 4LV0A 2O9AA 3U4LP 3KX0X 4OVDA 1S1YA 4YNRA 2ZC3B 1DP9A 4N9KA 1K4EA 1SHVA 3A3FA 1P97A 4E3KA 3H9WA 2J3TD 4KG2A 3HLEA 2Y2OA 4OPYA 2P7JA 3BY8A 3WS0A 5GLAA 2ZJ9A 1LI9A 2PR5A 4HNBA 2GX5A 4IVKA 4DMZA 3LIDA 1FSYA 4NKPA 2WYXA 4HP4A 4I3JA 2W3DA 2DRWA 3VSKA 3V5MA 3BFDA 2VV6A 3BY9A 3K2NA 1S4SA 1BZAA 2ZOIA 4NK3A 2Y2HA 2PAVP 4JXGA 5CHUA 4UQIS 1YM1A 4OKPA 3ZG8B 3PBRA 3EQUA 4JGPA 1GA9A 1JTGA 3NOUC 1W8YA 3GR2A 3IH9A 3HVFA 3UDFA 1RGZA 2ZQDA 3CWFA 3NBLA 3MFXA 2J80A 4IUHA 4R3AA 1K55C 1IKGA 5J4EA 3GMWA 4DXCA 4ESPA 3LYXA 2YKHA 3PHYA 1L0FA 4DDYA 3Q81A 2KOIA 2I72A 3H7WA 4HJ6A 2FZ0A 2WUQA 4IJGA 2XK1A 4ZRRA 4Y3IA 5CXWA 3C38A 4ME4A 3W4OA 3IHBA 2XROA 3DTMA 4LLOB 4E3NA 5FQJA 3TOIA 4MBFA 4KQDA 1G6AA 4OLDA 4NG2A 1YT4A 2BLSA 4NXEA 2WGWB 1BLPA 2WKPA 2HJEA 1ERMA 3ZVWA 1BTLA 4U3TA 3KSFA 1LLBA 4ZBEA 3BEBA 1A0KA 5EM1A 4UA9A 5EPHA 2E8IA 3G35A 3GRJA 4QD4A 4UAAA 1ODVA 4KZ5A 4KZ9A 3MS6A 5AQBA 4Z1WA 4NEED 4HQAA 1J3WA 1SKFA 3IXGA 2PU2A 1PWCA 2PT7A 3ZQ5A 3SS5A 5E2GA 4X55A 3PYPA 2VEAA 1PNEA 5K5BA 1PYYA 2NUPC 3TSGA 3OPHA 3NULA 5HAIA 4YOFA 2OLVA 1W5DA 1AWIA 4KZAA 2XA7S 5CGWA 3NI9A 3HJIA 5M19A 2ZQ7A 3ZVTA 2O9BA 4EBNA 4DDSA 4BLMA 3IS2B 1K56D 1OTIA 1ACFA 4WEJA 4MMNA 3E4QA 1BLCA 2AVXA 1WYBA 2RCXA 5EOEA 3GTCA 1VETA 3FYZA 5F68A 3IXDA 3MKEA 1NRJA 3MXRA 5F1FA 3P98A 2P9VA 3RXXA 4OOMA 1YPRA 4WEKA 4JXSA 3PXPA 3CITA 5EVID 3JPUA 2OSUA 1YLPA 4DJ2A 3SS4A 4C75A 3G4PA 1XPBA 2H5SA 2EXAA 4PM7A 2L1MA 4FSFA 4WMCD 1ESIA 4HBTA 5EUAA 4CJNA 2ZMVA 4ZDXA 5EFWA 1K54A 2WKHA 3G34A 4PM9A 1X0OA 4Y2FA 2JKRI 5F82A 3M6HA 1K56A 2HDQA 5I94A 3HCYA 1XJ6A 1PI5A 4EQIA 2K31A 4B88A 4ETXA 4JXVA 3WWXA 2H28A 4G3WA 5DF8A 3NOTC 3LY4A 4MCWA 5DTTA 4BJPA 5CGXA 4ARZA 3BFEA 1YMSA 3JYIA 4PPRA 2Y8HA 4C6YA 4U0TA 1ERQA 1KVLA 2EX9A 5AQAA 3Q7VB 3A3IA 1N4OA 3AGFA 3G2YA 1L0GA 3T12B 4GN2A 3A3JA 2W1RA 4I3AA 5HD3A 3UPPA 2JN7A 1ZHHB 5A91A 2EWVA 3IT9A 5FQQA 3NDGA 2ZBBA 1DP8A 1LL5A 4OQHA 4R3JA 5CHMA 3MXQA 3SS3A 1NZUA 3SZTA 3S7OA 4UQIM 3LUQA 5EVEA 5FI2A 4EBPA 2Y91A 1P9WA 3L7HA 2ZC5B 1NJ4A 3ZDJA 3VFFA 1LSWA 3R7WA 5IT5A 3WRZA 1OTAA 4OLGA 4L9FA 3FG8A 4JF4A 2PRFA 5A8BA 4OOLA 1F5MA 3N8RA 3NHQA 3I7JA 4CLCB 3F1PB 4JF6A 3BFGA 3CMZA 2M7UA 1K57C 4DE3A 1KVMA 1YSPA 5HD5A 3PBTA 3M6BA 5DTSA 3OCLA 4CQHA 3JVUA 3LEZA 2EFXA 3FPWA 3ITBA 3BLSA 3BRMA 5F83A 4IUKA 2PYRA 4CLCC 1GSVA 2ZLYA 4UEYA 4ZJ3A 1YKDA 3FKVA 3SW1A 5CGSA 3T1SA 4G3VA 1L0EA 3Q7ZA 3MQ0A 1NLYA 2ZL1B 3QP4A 5EV0A 1Y4OA 3H82A 3LIEA 4LRZE 4OQIA 4E3IA 1I2SA 3GQZA 4X68A 2A24B 4E3MA 3VP4A 2XF3A 2Y4AA 3DWKA 2P04A 4PM8A 1LSXA 5E43A 1OTDA 1FSWA 3IBRA 5AVFA 4KUKA 2KDKA 1MZUA 2GZAA 3E4PA 2CC1A 2HGVA 2V0WA 2QMIA 2WK0A 4QB8A 4WUJA 1HLUP 4E6XA 2HPBA 3OCNA 1XGJA 4HHDA 1BLHA 1CI8A 1S66L 1YLZA 2EWWA 2V20A 1KGFA 2DNSA 3UMEA 3D72A 3DW0A 3NCKA 3VP0A 2XRNA 4OP8A 2JHEA 4IVIA 2XA7M 4BMWA 2Y2KA 5GHXA 5HAQA 2OAQ1 4QJGA 3E2LA 3QP6A 3T4TA 3IX3A 2EX6A 4IBRA 4Y0OA 1NY0A 1SDNA 1FQGA 5G4ZA 1MC0A 4L9EA 3TRCA 4X1MA 2W0NA 1Z09A 4EEPA 1NXYA 2ZOHA 3MMHA 4HJ3A 1O07A 5HPIA 5FATA 4D2OA 5FQ9A 4EESA 3WS5A 4R4SA 4BL2A 1IYOA 1KE0A 3EWKA 5I5LA 3ZG0A 5L10A 4UHUA 5FAOA 1PRQA 1SZVA 4HEFA 4I39A 3C4PA 1EI5A 4CPKA 2HZ5A 1XKZA 3H7WB 4JKTA 2JKGA 1OJGA 4FOFA 5HDSA 3GDIA 4GNUA 3LI9A 3HBRA 3E2KA 2V1BA 2G2UA 2VKSA 1KE3A 1PFLA 3MR0A 2UV0E 4EUZA 2Q9NA 3TE8A 4N1XA 3HLBA 4M3KA 4R38A 4XT2A 3NC8A 2PD8A 5KZHA 1K6SA 5TJJA 1JWVA 5FDHA 1TVFA 3A0RA 1ALQA 3UNWA 4EERA 3BQAA 4GHIA 4S2PA 1ES5A 3T4JA 2VV8A 2Y2MA 3MKFA 3A3EA 3LY3A 5LBRA 3IH8A 4ETZA 1NYYA 3AGEA 1UWNX 1CJFA 2Z6CA 2ZMAA 2OV5A 5DKKA 2PHYA 1LL8A 4EW7A 3IHAA 4JLFA 3UE1A 3N8LA 3S7NA 1Y28A 3W4QA 4Z9QA 2W3FA 3UDIA 4O01A 2XH9A 2IWCA 4BENA 2V8FA 2A2LA 3P09A 2JCHA 2IWDA 2W1TA 4P6BA 4OPRA 4JGRA 2XD5A 3VOZA 2VX8A 4LV1A 3CLOA 3TG9A 3G2ZA 2H0TA 4MN6A 4S2IA 1W63M 3OPLA 3QNCA 2Y2LA 4LCMA 3RH8B 1JWPA 1F98A 1CEGA 5CEDA 5DF9A 3W2ZA 2J8YA 3T4SA 3V50A 1VETB 2BASA 2W3GA 1HZOA 4EETB 2R9XA 4Q0JA 5FSRA 2P9VB 1MKMA 2VK3A 3W4PA 1PZPA 4F94A 3WS1A 4S2JA 4I38A 4E3LA 1KDWA 3P01A 3CG5A 4P87A 4RVAA 2GNXA 1JWZA 2M7VA 1DJBA 3KO6A 4GDNA 2JE5A 4PMAA 1BLSA 2XQZA 3LO7A 4E3OA 3EEAA 1TS0A 5CTNA 1W7FA 2JKTI 3ZHHA 1MKIA 4OQGA 1YLTA 1PW1A 5TFQA 3UN7A 4R1GA 4KZBA 3CPTA 4D60A 4EEUA 4OONA 1F9IA 4K0WA 2VA0A 4OPZA 1ES4A 3GVBA 3Q07A 4ARZB 5HDCA 4HIAA 5KSCA 3UB7A 1K54C 2B18A 4WBGA 4YFMA 1BYWA 4CLCE 3IX8A 4FD8A 2K2NA 1W63Q 1Y54A 4HOIA 2WGIA 4R4RA 2Y59A 3IQAA 2OLUA 4Y17A 4F3LA 3D3OA 4KQRA 3ICYA 4R3BA 4M4XA 1H0MA 1XFQA 1KGEA 3DTEA 3OC2A 2FFYA 3UPNA 5HARA 2B95A 5GHZA 1PWDA 3ZG5A 1VM1A 5AVEA 3F1OA 4WN5A 4MBHA 2PD7A 1G28A 2YKFA 5EECA 5E2HA 1DJCA 4GLQA 1D1JA 5CRFA 2B02A 5GHYA 3LCEA 3IWOA 5CEBA 3VP2A 1S67L 3IXBA 1VEUB 3R7WB 1HVBA 4GB7A 5CHJA 1TD5A 3VOLA 5F6AA 1KOUA 3W8KA 1HD8A 3BFFA 1JNUA 2CMNA 3L9KA 1TS6A 3A0SA 3T1XA 1U60A 2XEPA 3SH8A 4S2LA 5EOOA 3ZGAB 1MY8A 1STZA 4ZJ2A 1FCOA 1D7EA 5E2FA 3RFBA 1YMXA 1P0ZA 3C5AA 3KYEA 5J8XA 3QNBA 3BW6A 2XDMA 1PZOA 3CUEA 2ZMFA 1G6OA 1IYPA 2JC7A 3MFDA 4KZ3A 1T1BA 1L0DA 2JKFA 2ZC4B 4JF5A 2XSSA 3H82B 3QHYA 4QWOA 2EFUA 3FKWA 1IFQA 1VB6A 3E0YA 1TF1A 4R70A 3PBOA 1V9YA 4P0MA 2WKQA 4R0QA 3CAXA 3VE4A 3K3CA 4II7A 4Y0TA 1H8YA
chains in the Genus database with same CATH topology
3CUEC 3KX0X 1N9OA 2HGVA 3TJZC 2V0WA 1S1YA 1OJ5A 4YNRA 1DP9A 4WUJA 1H8MA 1P97A 3H9WA 3OCNA 2J3TD 4DN0A 3EQVA 4HHDA 4EU0A 4O8GA 1S1ZA 1S66L 2P7JA 3BY8A 2PR5A 4QPRA 2EWWA 1YAXA 4HNBA 2GX5A 3FPVA 4DMZA 3LIDA 2O9CA 3UMEA 3D72A 1OPXA 4NKPA 2XRNA 3KYZA 1N9NA 2JHEA 4HP4A 4I3JA 2XA7M 4BMWA 2W3DA 3VV4A 2LB9A 4K08A 2I9VA 2OAQ1 5F69A 2VV6A 3BY9A 3K2NA 4WF0A 1S4SA 2K7SA 4HY8A 2ZOIA 3LICA 3OOVA 3T4TA 2HF6A 4YWZA 4UQIS 2OOLA 4G3KA 2QJ7A 3PBRA 3EQUA 5G4ZA 2GJ3A 1UWPX 3LFVA 4JGPA 1MC0A 3IBJA 4O0PA 4L9EA 3TRCA 4B93A 2V9AA 3ULFA 3NOUC 3S7PA 2W0NA 4NXBA 3EEHA 4EEPA 2JKRM 2JKTM 2ZOHA 3MMHA 4HJ3A 5HPIA 3KYQA 3CWFA 3B47A 5J3WA 3MFXA 2QWSA 4EESA 5HZHA 2J80A 4IUHA 3C8CA 5HWVA 4HJ4A 3EWKA 4R3AA 5DFYA 5I5LA 5J4EA 3LYXA 2YKHA 3PHYA 4I39A 5KIZA 2KOIA 4E04A 3H7WA 4HJ6A 2FZ0A 2QJ5A 1GSXA 1XJ4A 5CX7A 4I3IA 3H7WB 4Y5FA 5C5KA 4IJGA 4ZRRA 1OJGA 4Y3IA 3C38A 4ME4A 4FOFA 4H6JA 5HDSA 2XROA 3GDIA 1T1AA 4LLOB 4H6JB 3LI9A 4LRXC 1P9RA 2L0WA 1NLZA 4AFIA 1LT0A 5DJUA 3LR0A 2HJ9C 5DJTA 2V1BA 4KQDA 2VKSA 3MR0A 3LI8A 4MN5A 5L8MA 3TE8A 3HJKA 4NXEA 2O0YA 5J7EA 3FC7A 4R38A 4XT2A 2PD8A 3PR6A 2WKPA 5TJJA 2HJEA 4XT2B 3ZYTA 2VGLM 4PKYA 3KSFA 3CI6A 2LB5A 3A0RA 4EERA 3BQAA 4HI4A 4GHIA 3UE3A 2D01A 3T4JA 1IOUA 1ODVA 2VV8A 3BQ8A 4GHIB 5IS1A 3MJQA 4CLCD 3A0VA 1V9ZA 5LBRA 4Z1WA 4NEED 4ETZA 1T18A 2QHKA 3B33A 1OT6A 4HQAA 3G6OA 3C30A 1UWNX 2Z6CA 3P7NA 5DKKA 2PHYA 4JGQA 3U2AA 1LL8A 1TS8A 4EW7A 2PT7A 3S7NA 1Y28A 2W3FA 4O01A 3ZQ5A 1WA9A 3S7QA 4RQ9A 3PYPA 3O5YA 2HV1A 2A2LA 1D06A 2VEAA 5K5BA 2KLIA 3MF0A 2NUPC 3E4OA 4YOFA 2W1TA 3NJAA 4JGRA 2OAP1 2W1TB 2XA7S 2VX8A 3MQQA 3CLOA 3JVVA 3HJIA 1OT9A 4EUVA 3IS2A 2MJ6A 2O9BA 2QYBA 3IS2B 1DP6A 2EA9A 4MN6A 4HH3A 3EGDC 4WELA 1W63M 3T4KA 1OTIA 1EW0A 4WEJA 2KX6A 3RH8B 4MMNA 3E4QA 4P6ZM 1F98A 5HWTA 5DF9A 5DKLA 3OBFA 3W2ZA 5F68A 3T4SA 4L9GA 3NOPC 1NRJA 2BASA 2W3GA 4EETB 4DJ3A 4KQOA 4Q0JA 3GECA 1N9LA 4OOMA 1VHMA 1MKMA 4WEKA 3MQOA 4GCZA 4IHQA 3K3DA 3PXPA 5KSHA 1YSQA 3CITA 4I38A 2VLGA 3P01A 1XJ3A 4DJ2A 2GNXA 2M7VA 2QKPA 3T50A 2L1MA 4FSFA 3KO6A 2OWHA 3LIFA 2Y79A 2ZMVA 2P08A 3F1NA 5EFWA 4MN7A 3EEAA 3F1NB 2J3TC 5F5YA 1TS0A 3LR5A 1X0OA 4Y2FA 1T1CA 2PR6A 2JKTI 2JKRI 2IA2A 4LRYC 4KUOA 5AJGA 2G7UA 3HCYA 1XJ6A 4GJ4A 2K31A 4ETXA 4WLAA 3LR3A 3VE3A 4Q0HA 3T4LA 2VZWA 4PHTA 3KSGA 5HPFA 4EEUA 2H28A 4G3WA 3NOTC 2VGLS 4MCWA 1F9IA 5HL6A 2VA0A 4BJPA 4ARZA 4NXFA 3T4OA 4ARZB 2Y8HA 5HDCA 1XJ2A 4HIAA 3UB7A 1H3QA 2B18A 3KSHA 3T4QA 1BYWA 4CLCE 2PYPA 4L0LA 4BBVA 2K2NA 1W63Q 4PKYG 1OTBA 4GW9A 5HWWA 1S4RA 4HOIA 2FH5A 3EGXC 4NXGA 3UMDA 1GSWA 4F3LA 4HP9A 2W1RA 3D3OA 4WL9A 4I3AA 4F3LB 5HD3A 2W27A 4LPZA 2JN7A 3ICYA 1ZHHB 3V67A 4M4XA 2EWVA 1XFQA 2VV7A 3LR4A 2W3EA 2OWJA 3OC2A 4Q0IA 2ZBBA 1DP8A 5FL3A 5AVEA 3F1OA 4WN5A 4B9OA 3TW8A 3MXQA 3F1OB 2PD7A 1G28A 3S7OA 2YKFA 4UQIM 3LUQA 1UGUA 4GLQA 2J3WA 1P9WA 5HDDA 2B02A 4JGOA 3PBSA 1LSVA 2R78A 4BBTA 1LSWA 3R7WA 5IT5A 1S67L 5DFXA 1OTAA 1ZTUA 3R7WB 4L9FA 3FG8A 3UE6A 5MC7A 2M1CA 4P6ZS 3E98A 4CLCA 2W3HA 1OTEA 5A8BA 3F1PA 4OOLA 1TD5A 3VOLA 1F5MA 3NHQA 4CLCB 4EXOA 3F1PB 5F6AA 1KOUA 2M7UA 4MDZA 3OLOA 3BJNA 1JNUA 1NWZA 2WKRA 3PBQA 1YSPA 4R6LA 5TBMA 2V0UA 2CMNA 1TS6A 3R4KA 5HD5A 5TBMB 3PBTA 3RTYA 5HSQA 4BBUA 3A0SA 3OCLA 1TS7A 4CQHA 3B42A 3C2WA 3JVUA 3UB6A 1XFNA 3FPWA 3DBAA 1STZA 1D7EA 3RFBA 4GS9A 4IUKA 2PYRA 4CLCC 1P0ZA 3UB9A 2NUTC 1GSVA 4GS9B 4UEYA 5G4YA 3BW6A 1YKDA 1T19A 3SW1A 3CUEA 2INWA 4G3VA 2ZMFA 3MQ0A 3LIBA 1G6OA 2L4RA 1NLYA 3BWLA 3PBNA 1T1BA 3LIAA 2DMWA 4I5SA 2Z6DA 3H82A 2VJWA 3KSIA 3LIEA 3UB8A 4EQ1A 4PAUA 2PDRA 4LRZE 2XSSA 2V1AA 3H82B 2A24A 1IFQA 1VB6A 3E0YA 1TF1A 2A24B 4R70A 3PBOA 1V9YA 5IU1A 2D02A 4HH2A 2P04A 1DRMA 1LSXA 2WKQA 4BWIA 3CAXA 1OTDA 3IBRA 3K3CA 3VE4A 2O99A 5AVFA 4KUKA 2KDKA 3EOIA 4II7A 1MZUA 2GZAA 3E4PA 2O9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KX0 X;  1N9O A;  2V0W A;  1S1Y A;  1OJ5 A;  1DP9 A;  4WUJ A;  1P97 A;  3H9W A;  4HHD A;  1S1Z A;  1S66 L;  2P7J A;  3BY8 A;  2PR5 A;  4HNB A;  3LID A;  3UME A;  3D72 A;  1N9N A;  2JHE A;  4HP4 A;  4I3J A;  4K08 A;  2I9V A;  5F69 A;  2VV6 A;  3BY9 A;  4WF0 A;  1S4S A;  2K7S A;  4HY8 A;  2ZOI A;  3LIC A;  4YWZ A;  2OOL A;  2QJ7 A;  5G4Z A;  2GJ3 A;  1UWP X;  4JGP A;  4L9E A;  2V9A A;  3ULF A;  3NOU C;  2W0N A;  4NXB A;  3EEH A;  4EEP A;  2ZOH A;  4HJ3 A;  3CWF A;  5J3W A;  3MFX A;  2QWS A;  4EES A;  5HZH A;  2J80 A;  3C8C A;  5HWV A;  4HJ4 A;  3EWK A;  4R3A A;  5I5L A;  5J4E A;  3LYX A;  2YKH A;  3PHY A;  4I39 A;  5KIZ A;  4E04 A;  3H7W A;  4HJ6 A;  2QJ5 A;  1GSX A;  1XJ4 A;  4I3I A;  3H7W B;  1OJG A;  4H6J A;  5HDS A;  3GDI A;  1T1A A;  4LLO B;  4H6J B;  4LRX C;  3LI9 A;  2L0W A;  1LT0 A;  5DJU A;  5DJT A;  2V1B A;  4KQD A;  3MR0 A;  3LI8 A;  4MN5 A;  3HJK A;  4NXE A;  5J7E A;  3FC7 A;  4R38 A;  4XT2 A;  2PD8 A;  2WKP A;  4XT2 B;  4PKY A;  3A0R A;  4EER A;  4HI4 A;  4GHI A;  2D01 A;  1ODV A;  2VV8 A;  4GHI B;  5IS1 A;  3MJQ A;  3A0V A;  1V9Z A;  1T18 A;  2QHK A;  3B33 A;  1OT6 A;  4HQA A;  3G6O A;  1UWN X;  2Z6C A;  3P7N A;  5DKK A;  2PHY A;  4JGQ A;  1LL8 A;  1TS8 A;  4EW7 A;  1Y28 A;  3ZQ5 A;  1WA9 A;  4RQ9 A;  3PYP A;  2HV1 A;  1D06 A;  2VEA A;  3E4O A;  3NJA A;  4JGR A;  3MQQ A;  3CLO A;  3HJI A;  1OT9 A;  3IS2 A;  3IS2 B;  1DP6 A;  2EA9 A;  4MN6 A;  4HH3 A;  1OTI A;  1EW0 A;  2KX6 A;  3RH8 B;  3E4Q A;  1F98 A;  5HWT A;  5DKL A;  5F68 A;  4L9G A;  3NOP C;  2BAS A;  4EET B;  4DJ3 A;  3GEC A;  1N9L A;  3MQO A;  4GCZ A;  3K3D A;  4I38 A;  2VLG A;  1XJ3 A;  4DJ2 A;  2QKP A;  3T50 A;  2L1M A;  3LIF A;  2OWH A;  3F1N A;  5EFW A;  3F1N B;  5F5Y A;  1TS0 A;  1X0O A;  1T1C A;  2PR6 A;  4LRY C;  4KUO A;  1XJ6 A;  4WLA A;  3VE3 A;  4EEU A;  2H28 A;  3NOT C;  1F9I A;  4NXF A;  5HDC A;  1XJ2 A;  4HIA A;  3UB7 A;  1BYW A;  2PYP A;  4BBV A;  4PKY G;  1OTB A;  4GW9 A;  5HWW A;  1S4R A;  4HOI A;  4NXG A;  3UMD A;  1GSW A;  4F3L A;  4HP9 A;  4WL9 A;  4I3A A;  4F3L B;  5HD3 A;  2W27 A;  4LPZ A;  2JN7 A;  3ICY A;  4M4X A;  1XFQ A;  2VV7 A;  2OWJ A;  2ZBB A;  1DP8 A;  5AVE A;  3F1O A;  4WN5 A;  4B9O A;  3MXQ A;  3F1O B;  2PD7 A;  1G28 A;  2YKF A;  3LUQ A;  1UGU A;  5HDD A;  2B02 A;  4JGO A;  1LSV A;  2R78 A;  4BBT A;  1LSW A;  1S67 L;  1OTA A;  4L9F A;  3FG8 A;  3UE6 A;  2M1C A;  1OTE A;  5A8B A;  3F1P A;  3VOL A;  3NHQ A;  4EXO A;  3F1P B;  5F6A A;  1KOU A;  3OLO A;  1JNU A;  1NWZ A;  2WKR A;  5TBM A;  4R6L A;  2V0U A;  2CMN A;  1TS6 A;  5TBM B;  5HD5 A;  3RTY A;  5HSQ A;  4BBU A;  3A0S A;  1TS7 A;  3C2W A;  3UB6 A;  1XFN A;  1D7E A;  4GS9 A;  2PYR A;  1P0Z A;  3UB9 A;  4GS9 B;  1GSV A;  5G4Y A;  1T19 A;  3SW1 A;  2INW A;  3LIB A;  2L4R A;  3BWL A;  1T1B A;  3LIA A;  4I5S A;  2Z6D A;  3H82 A;  3LIE A;  3UB8 A;  4EQ1 A;  2PDR A;  4LRZ E;  2V1A A;  3H82 B;  2A24 A;  1VB6 A;  2A24 B;  4R70 A;  1V9Y A;  5IU1 A;  2D02 A;  4HH2 A;  1DRM A;  1LSX A;  2WKQ A;  3CAX A;  1OTD A;  3VE4 A;  3IBR A;  3K3C A;  5AVF A;  4KUK A;  2KDK A;  1MZU A;  3E4P A; 
#chains in the Genus database with same CATH topology
 1GHP A;  5EVI A;  1GA0 A;  1L2S A;  3VP3 A;  2ZQ9 A;  3MZE A;  3EQV A;  4EU0 A;  4WZ4 A;  1S1Z A;  4EBL A;  4WMC A;  3HLW A;  1Z6F A;  1RP5 A;  3VP1 A;  5EE8 A;  3OZH A;  2DCF A;  3OPP A;  2O9C A;  4XXR A;  1YQS A;  3UDX A;  3FWL A;  1NZO A;  3O3V A;  2Z2L B;  5L2F A;  4K08 A;  2I9V A;  2K7S A;  4HY8 A;  3SOI A;  3IF5 A;  4KZ7 A;  3MZD A;  3LIC A;  3OOV A;  4YWZ A;  5FEF A;  2PBY A;  2OOL A;  4G3K A;  1MWR A;  4RA7 A;  1GHI A;  2GJ3 A;  1UWP X;  3CJM A;  3ZG9 B;  1JVJ A;  4OPQ A;  4B93 A;  2V9A A;  4OH0 A;  3G32 A;  4KZ8 A;  5FAQ A;  4NXB A;  1GHM A;  3EEH A;  5KMW A;  2JKR M;  5FI6 A;  4FCF A;  3KYQ A;  5J3W A;  2QWS A;  3HRE A;  1IYS A;  4P85 A;  3C8C A;  5HWV A;  5GLB A;  3UE0 A;  1MPL A;  2XD1 A;  1CK3 A;  3HUO A;  1O7E A;  3MBZ A;  4UA6 A;  5KIZ A;  5JYO A;  1Q2Q A;  4JXW A;  1K0K A;  5CX7 A;  1XJ4 A;  4FUW A;  2Y2Q A;  4I3I A;  2XFT A;  4Y5F A;  5C5K A;  4K91 A;  1K25 A;  2ZD8 A;  4H6J A;  3HLG A;  1XP4 A;  4AFI A;  1LT0 A;  3S22 A;  4MN5 A;  4DE2 A;  5L8M A;  3HJK A;  3SH7 A;  3FC7 A;  4YIN A;  3S4X A;  4XT2 B;  5GLC A;  4HES A;  4E3J A;  4QY5 A;  4IED A;  4HBU A;  4PKY A;  3N8S A;  2HP6 A;  2LB5 A;  2WAF A;  4HI4 A;  4GHI B;  2H0Y A;  4CLC D;  3S1Y A;  4MLL A;  5CER A;  4R23 A;  4X1L A;  2QHK A;  1LL9 A;  3B33 A;  1OT6 A;  3G6O A;  5FI7 A;  3C30 A;  3Q82 A;  5A93 A;  4BD0 A;  1TS8 A;  2HP5 A;  1QMF A;  2A49 A;  5L07 A;  4LFU A;  3O5Y A;  5HAP A;  3BEC A;  4MBK A;  2IWB A;  2RL3 A;  2KLI A;  3MF0 A;  3E4O A;  1FIK A;  2BTF P;  3AGD A;  3NY4 A;  2WKI A;  4RYE A;  2W1T B;  3MQQ A;  3JVV A;  2XR0 A;  5FAP A;  4EUV A;  3Q1F A;  2QYB A;  3DAV A;  2WAD A;  2EA9 A;  3EGD C;  4WEL A;  1EW0 A;  1ES2 A;  5TGF A;  2KX6 A;  4MEZ A;  2J9O A;  1ESU A;  2ZC7 A;  4C3Q A;  2Y55 A;  4L9G A;  4X69 A;  3NOP C;  4KQQ A;  1WYC A;  1XA7 A;  1N9L A;  2ZQC A;  1VHM A;  4GZB A;  2EX2 A;  4B4Z A;  2A3U A;  3MQO A;  4BQM A;  4IHQ A;  3K3D A;  1PWG A;  1IYQ A;  3HLF A;  4OQ0 A;  4Y0U A;  3PAE A;  2VLG A;  5M1A A;  4WZ5 A;  2VGJ A;  3IXH A;  1E4D A;  1W79 A;  1M40 A;  2QKP A;  4KZ6 A;  3LIF A;  3IF6 A;  1KGG A;  2P08 A;  1MWT A;  1QME A;  5EM0 A;  3F1N A;  4DF6 A;  4MN7 A;  4BD1 A;  2J3T C;  4EWF A;  1T1C A;  2PR6 A;  2IA2 A;  1FR6 A;  4KUO A;  5AJG A;  2XFS A;  2ZM0 A;  4GJ4 A;  1MXO A;  5FAS A;  4WLA A;  2Q0O A;  3LR3 A;  4PHT A;  5F1G A;  3CPT B;  3ZCZ A;  4DE0 A;  4GDB A;  2VGL S;  4Y13 A;  1E25 A;  5BOH A;  1ZG4 A;  4JBF A;  3ISG A;  1S6R A;  1M6K A;  3VMA A;  3T4O A;  4UA7 A;  3T4Q A;  4L0L A;  4BBV A;  4E6W A;  1XGI A;  5HWW A;  4Q8I A;  1S4R A;  2FH5 A;  4JPM A;  3EGX C;  1IEM A;  2GDN A;  1FCM A;  1Q2P A;  3BFC A;  3UMD A;  5HX9 A;  4WL9 A;  4F3L B;  1SKO A;  2W27 A;  4LPZ A;  3HLC A;  2Y2P A;  3LR4 A;  2BG1 A;  2OWJ A;  5FL3 A;  2ACG A;  1KDS A;  3F1O B;  3V39 A;  3PTE A;  3HUN A;  1UGU A;  2J3W A;  3DTK A;  3LGO A;  4O7D A;  5HDD A;  4JGO A;  3PBS A;  2R78 A;  3HL9 A;  3UY6 A;  5DFX A;  1ZTU A;  3T1R A;  1ZG6 A;  2P74 A;  3UE6 A;  5MC7 A;  2M1C A;  4P6Z S;  3E98 A;  3HLD A;  2C6W B;  4WYY A;  4IBX A;  4MDZ A;  2XGN A;  3OLO A;  2J9P A;  4S2N A;  4A5R A;  3FV7 A;  3BJN A;  1NWZ A;  2WKR A;  3PBQ A;  5TBM A;  2V0U A;  3D9Y A;  3R4K A;  3RTY A;  4BBU A;  5A90 A;  2C5W B;  3B42 A;  3C2W A;  5CEC A;  3UB6 A;  3B3X A;  1KE4 A;  4DE1 A;  4ZAM A;  3ZNT A;  4GS9 A;  1AXB A;  4LV2 A;  3UO9 A;  2NUT C;  3GV9 A;  4GKU A;  5G4Y A;  1T19 A;  3O86 A;  2XLN A;  3BWL A;  3UPO A;  3QP8 A;  1TDL A;  4N92 A;  3HUM A;  3LIA A;  4I5S A;  1IEL A;  4GD6 A;  3KSI A;  3QP1 A;  4EQ1 A;  4FTX A;  5G18 A;  2WKE A;  4KEN B;  4MNR A;  2HP9 A;  2D02 A;  4HH2 A;  3ZG7 B;  1FIL A;  1DRM A;  4BWI A;  4OP5 A;  1G68 A;  3LEQ A;  3EOI A;  5D3O A;  3CUE C;  1N9O A;  3TJZ C;  1ONH A;  4X25 A;  1OJ5 A;  1PW8 A;  2Y2J A;  5EVI B;  1H8M A;  2ZC6 B;  4DN0 A;  4O8G A;  2Q9M A;  1S0W A;  2ZQA A;  5AQ7 A;  4QPR A;  4PM6 A;  1YAX A;  2Z2M B;  3FPV A;  3MSH A;  1YLW A;  1OPX A;  3N4I A;  5L09 A;  3M2J A;  1K38 A;  4X56 A;  3KYZ A;  1N9N A;  3A3D A;  4WM9 A;  2LB9 A;  3VV4 A;  4XUZ A;  5F69 A;  1WE4 A;  4S2K A;  5EVI C;  4WF0 A;  4B4X A;  1K55 A;  1ZKJ A;  3DWZ A;  2HF6 A;  3MZF A;  1G5U A;  3MXS A;  2QJ7 A;  2JBF A;  5FA7 A;  3LFV A;  3N7W A;  3IBJ A;  4O0P A;  4QY6 A;  3ULF A;  4S2O A;  3S7P A;  4RX3 A;  1CI9 A;  2QPN A;  2JKT M;  5FEG A;  5HL1 A;  5HW3 A;  4GOG A;  5E2E A;  3B47 A;  3G30 A;  2QZ6 A;  5HZH A;  3WS2 A;  2VGK A;  4HJ4 A;  3WRT A;  5DFY A;  5FQM A;  1LHY A;  4E04 A;  2X02 A;  2QJ5 A;  1GSX A;  1CF0 A;  5GLD A;  1CEF A;  2HDS A;  4DKI A;  3CZD A;  3C4O A;  5FQI A;  1T1A A;  2B5R A;  4H6J B;  1MBL A;  4LRX C;  1P9R A;  2L0W A;  1NLZ A;  3PAG A;  5DJU A;  3LR0 A;  2HJ9 C;  1MWU A;  5DJT A;  5IHV A;  2WAE A;  4XUX A;  3LI8 A;  2WGW A;  2O0Y A;  5U47 A;  5J7E A;  3CHW P;  3PR6 A;  3ZYT A;  1E3U D;  2VGL M;  3CI6 A;  3BYD A;  2V1Z A;  1OME A;  1NYM A;  4X6T A;  3UE3 A;  2D01 A;  1IOU A;  3BQ8 A;  5IS1 A;  3MJQ A;  3A0V A;  1I2W A;  3T1Q B;  1V9Z A;  4U0X A;  1T18 A;  2E8J A;  4DXB A;  1XA1 A;  3P7N A;  4JGQ A;  3U2A A;  1ZC2 A;  2R9W A;  1LI0 A;  5EVL A;  1DY6 A;  1WA9 A;  3S7Q A;  4FH2 A;  4RQ9 A;  2HV1 A;  1D06 A;  1MWS A;  3SH9 A;  2X71 A;  2EXB A;  4X53 A;  3NJA A;  1K4F A;  1ONG A;  2OAP 1;  1F2K A;  4QHC A;  4GD8 A;  3DTI A;  1FOF A;  1XX2 A;  3N6I A;  1OT9 A;  4KG5 A;  3IS2 A;  3QP5 A;  2MJ6 A;  1DP6 A;  4HH3 A;  3T4K A;  1E3U A;  2WZZ A;  5DTK A;  4P6Z M;  5HWT A;  3IX4 A;  1VEU A;  1I5Q A;  3NDE A;  5DKL A;  4N1H A;  2Y2I A;  3M2K A;  3OBF A;  5DVA A;  4N9L A;  5FDS A;  5HFO A;  1SDE A;  2WGV A;  4DJ3 A;  4KQO A;  3UB5 P;  4LGW A;  3GEC A;  4LV3 A;  4GCZ A;  5KSH A;  1YSQ A;  4LEN A;  1NRF A;  1L3L A;  1ES3 A;  1XJ3 A;  3ZNY A;  3GSG A;  3T50 A;  4LCL A;  3D4F A;  2OWH A;  1H5X A;  2PU4 A;  2Y79 A;  3V3R A;  3VFH A;  4ID4 A;  1BSG A;  3IF6 B;  4H8R A;  2G2W A;  3ZFZ A;  1H8Z A;  3F1N B;  2EX8 A;  5F5Y A;  3LR5 A;  1HTZ A;  3C7V A;  4LRY C;  2HDR A;  1ERO A;  3VOY A;  5AQ9 A;  2G7U A;  1DJA A;  1BT5 A;  1C3B A;  4NET A;  3FZC A;  3VE3 A;  4Q0H A;  3T4L A;  1RGY A;  2VZW A;  3O87 A;  4WZ5 C;  3KSG A;  5HPF A;  1SCW A;  3NEC A;  5FQK A;  1YLY A;  2X01 A;  3RXW A;  5HL6 A;  4KG6 A;  3IF6 C;  3ITA A;  5JYP A;  5A92 A;  4NXF A;  1PI4 A;  1XJ2 A;  1H3Q A;  3KSH A;  4QU3 A;  2V2F F;  1JTD A;  3Q7V A;  2PYP A;  2FFF B;  4PKY G;  1OTB A;  4GW9 A;  3WS4 A;  1TEM A;  4NXG A;  3O88 A;  1GSW A;  1IKI A;  4HP9 A;  3BM6 A;  3QP2 A;  2Y2G A;  5TR7 A;  3V67 A;  3VSL A;  1SKO B;  2VV7 A;  2W3E A;  4Q0I A;  4RX2 A;  1K57 A;  4B9O A;  4Y7P A;  3TW8 A;  3IWQ A;  4FH4 A;  1K6R A;  4BL3 A;  3RJU A;  1LSV A;  4BBT A;  3V3S A;  2WZX A;  1CQA A;  3IWI A;  4CLC A;  2W3H A;  1OTE A;  3F1P A;  1GCE A;  4PM5 A;  1W8Q A;  3C7U A;  4EXO A;  1VQQ A;  1XXM A;  2HDU A;  1EWZ A;  1BUL A;  4R6L A;  2V8C A;  3G31 A;  2H10 A;  5TBM B;  3OPR A;  5HSQ A;  1BUE A;  2ZM2 A;  1TS7 A;  1PIO A;  4ZJ1 A;  1XFN A;  3NIA A;  3DBA A;  2PBD P;  1TDG A;  1N9B A;  4OOY A;  4KZ4 A;  5DF7 A;  3BLM A;  1YLJ A;  3UB9 A;  4DRT A;  4S2M A;  4GS9 B;  4Y15 A;  4ZTK A;  2INW A;  2ZL1 A;  4K0X A;  4EV4 A;  4S2N C;  3LIB A;  2L4R A;  3PBN A;  2DMW A;  2ZM8 A;  2Z6D A;  2VJW A;  3UB8 A;  4PAU A;  2PDR A;  2V1A A;  1RCJ A;  2UWX A;  2A24 A;  2ZQ8 A;  2J7V A;  1J9M A;  5IU1 A;  2Y2N A;  1FR1 A;  5CTM A;  1FCN A;  5GL9 A;  5M18 A;  2O99 A;  4LV0 A;  2O9A A;  3U4L P;  3KX0 X;  4OVD A;  1S1Y A;  4YNR A;  2ZC3 B;  1DP9 A;  4N9K A;  1K4E A;  1SHV A;  3A3F A;  1P97 A;  4E3K A;  3H9W A;  2J3T D;  4KG2 A;  3HLE A;  2Y2O A;  4OPY A;  2P7J A;  3BY8 A;  3WS0 A;  5GLA A;  2ZJ9 A;  1LI9 A;  2PR5 A;  4HNB A;  2GX5 A;  4IVK A;  4DMZ A;  3LID A;  1FSY A;  4NKP A;  2WYX A;  4HP4 A;  4I3J A;  2W3D A;  2DRW A;  3VSK A;  3V5M A;  3BFD A;  2VV6 A;  3BY9 A;  3K2N A;  1S4S A;  1BZA A;  2ZOI A;  4NK3 A;  2Y2H A;  2PAV P;  4JXG A;  5CHU A;  4UQI S;  1YM1 A;  4OKP A;  3ZG8 B;  3PBR A;  3EQU A;  4JGP A;  1GA9 A;  1JTG A;  3NOU C;  1W8Y A;  3GR2 A;  3IH9 A;  3HVF A;  3UDF A;  1RGZ A;  2ZQD A;  3CWF A;  3NBL A;  3MFX A;  2J80 A;  4IUH A;  4R3A A;  1K55 C;  1IKG A;  5J4E A;  3GMW A;  4DXC A;  4ESP A;  3LYX A;  2YKH A;  3PHY A;  1L0F A;  4DDY A;  3Q81 A;  2KOI A;  2I72 A;  3H7W A;  4HJ6 A;  2FZ0 A;  2WUQ A;  4IJG A;  2XK1 A;  4ZRR A;  4Y3I A;  5CXW A;  3C38 A;  4ME4 A;  3W4O A;  3IHB A;  2XRO A;  3DTM A;  4LLO B;  4E3N A;  5FQJ A;  3TOI A;  4MBF A;  4KQD A;  1G6A A;  4OLD A;  4NG2 A;  1YT4 A;  2BLS A;  4NXE A;  2WGW B;  1BLP A;  2WKP A;  2HJE A;  1ERM A;  3ZVW A;  1BTL A;  4U3T A;  3KSF A;  1LLB A;  4ZBE A;  3BEB A;  1A0K A;  5EM1 A;  4UA9 A;  5EPH A;  2E8I A;  3G35 A;  3GRJ A;  4QD4 A;  4UAA A;  1ODV A;  4KZ5 A;  4KZ9 A;  3MS6 A;  5AQB A;  4Z1W A;  4NEE D;  4HQA A;  1J3W A;  1SKF A;  3IXG A;  2PU2 A;  1PWC A;  2PT7 A;  3ZQ5 A;  3SS5 A;  5E2G A;  4X55 A;  3PYP A;  2VEA A;  1PNE A;  5K5B A;  1PYY A;  2NUP C;  3TSG A;  3OPH A;  3NUL A;  5HAI A;  4YOF A;  2OLV A;  1W5D A;  1AWI A;  4KZA A;  2XA7 S;  5CGW A;  3NI9 A;  3HJI A;  5M19 A;  2ZQ7 A;  3ZVT A;  2O9B A;  4EBN A;  4DDS A;  4BLM A;  3IS2 B;  1K56 D;  1OTI A;  1ACF A;  4WEJ A;  4MMN A;  3E4Q A;  1BLC A;  2AVX A;  1WYB A;  2RCX A;  5EOE A;  3GTC A;  1VET A;  3FYZ A;  5F68 A;  3IXD A;  3MKE A;  1NRJ A;  3MXR A;  5F1F A;  3P98 A;  2P9V A;  3RXX A;  4OOM A;  1YPR A;  4WEK A;  4JXS A;  3PXP A;  3CIT A;  5EVI D;  3JPU A;  2OSU A;  1YLP A;  4DJ2 A;  3SS4 A;  4C75 A;  3G4P A;  1XPB A;  2H5S A;  2EXA A;  4PM7 A;  2L1M A;  4FSF A;  4WMC D;  1ESI A;  4HBT A;  5EUA A;  4CJN A;  2ZMV A;  4ZDX A;  5EFW A;  1K54 A;  2WKH A;  3G34 A;  4PM9 A;  1X0O A;  4Y2F A;  2JKR I;  5F82 A;  3M6H A;  1K56 A;  2HDQ A;  5I94 A;  3HCY A;  1XJ6 A;  1PI5 A;  4EQI A;  2K31 A;  4B88 A;  4ETX A;  4JXV A;  3WWX A;  2H28 A;  4G3W A;  5DF8 A;  3NOT C;  3LY4 A;  4MCW A;  5DTT A;  4BJP A;  5CGX A;  4ARZ A;  3BFE A;  1YMS A;  3JYI A;  4PPR A;  2Y8H A;  4C6Y A;  4U0T A;  1ERQ A;  1KVL A;  2EX9 A;  5AQA A;  3Q7V B;  3A3I A;  1N4O A;  3AGF A;  3G2Y A;  1L0G A;  3T12 B;  4GN2 A;  3A3J A;  2W1R A;  4I3A A;  5HD3 A;  3UPP A;  2JN7 A;  1ZHH B;  5A91 A;  2EWV A;  3IT9 A;  5FQQ A;  3NDG A;  2ZBB A;  1DP8 A;  1LL5 A;  4OQH A;  4R3J A;  5CHM A;  3MXQ A;  3SS3 A;  1NZU A;  3SZT A;  3S7O A;  4UQI M;  3LUQ A;  5EVE A;  5FI2 A;  4EBP A;  2Y91 A;  1P9W A;  3L7H A;  2ZC5 B;  1NJ4 A;  3ZDJ A;  3VFF A;  1LSW A;  3R7W A;  5IT5 A;  3WRZ A;  1OTA A;  4OLG A;  4L9F A;  3FG8 A;  4JF4 A;  2PRF A;  5A8B A;  4OOL A;  1F5M A;  3N8R A;  3NHQ A;  3I7J A;  4CLC B;  3F1P B;  4JF6 A;  3BFG A;  3CMZ A;  2M7U A;  1K57 C;  4DE3 A;  1KVM A;  1YSP A;  5HD5 A;  3PBT A;  3M6B A;  5DTS A;  3OCL A;  4CQH A;  3JVU A;  3LEZ A;  2EFX A;  3FPW A;  3ITB A;  3BLS A;  3BRM A;  5F83 A;  4IUK A;  2PYR A;  4CLC C;  1GSV A;  2ZLY A;  4UEY A;  4ZJ3 A;  1YKD A;  3FKV A;  3SW1 A;  5CGS A;  3T1S A;  4G3V A;  1L0E A;  3Q7Z A;  3MQ0 A;  1NLY A;  2ZL1 B;  3QP4 A;  5EV0 A;  1Y4O A;  3H82 A;  3LIE A;  4LRZ E;  4OQI A;  4E3I A;  1I2S A;  3GQZ A;  4X68 A;  2A24 B;  4E3M A;  3VP4 A;  2XF3 A;  2Y4A A;  3DWK A;  2P04 A;  4PM8 A;  1LSX A;  5E43 A;  1OTD A;  1FSW A;  3IBR A;  5AVF A;  4KUK A;  2KDK A;  1MZU A;  2GZA A;  3E4P A;  2CC1 A;  2HGV A;  2V0W A;  2QMI A;  2WK0 A;  4QB8 A;  4WUJ A;  1HLU P;  4E6X A;  2HPB A;  3OCN A;  1XGJ A;  4HHD A;  1BLH A;  1CI8 A;  1S66 L;  1YLZ A;  2EWW A;  2V20 A;  1KGF A;  2DNS A;  3UME A;  3D72 A;  3DW0 A;  3NCK A;  3VP0 A;  2XRN A;  4OP8 A;  2JHE A;  4IVI A;  2XA7 M;  4BMW A;  2Y2K A;  5GHX A;  5HAQ A;  2OAQ 1;  4QJG A;  3E2L A;  3QP6 A;  3T4T A;  3IX3 A;  2EX6 A;  4IBR A;  4Y0O A;  1NY0 A;  1SDN A;  1FQG A;  5G4Z A;  1MC0 A;  4L9E A;  3TRC A;  4X1M A;  2W0N A;  1Z09 A;  4EEP A;  1NXY A;  2ZOH A;  3MMH A;  4HJ3 A;  1O07 A;  5HPI A;  5FAT A;  4D2O A;  5FQ9 A;  4EES A;  3WS5 A;  4R4S A;  4BL2 A;  1IYO A;  1KE0 A;  3EWK A;  5I5L A;  3ZG0 A;  5L10 A;  4UHU A;  5FAO A;  1PRQ A;  1SZV A;  4HEF A;  4I39 A;  3C4P A;  1EI5 A;  4CPK A;  2HZ5 A;  1XKZ A;  3H7W B;  4JKT A;  2JKG A;  1OJG A;  4FOF A;  5HDS A;  3GDI A;  4GNU A;  3LI9 A;  3HBR A;  3E2K A;  2V1B A;  2G2U A;  2VKS A;  1KE3 A;  1PFL A;  3MR0 A;  2UV0 E;  4EUZ A;  2Q9N A;  3TE8 A;  4N1X A;  3HLB A;  4M3K A;  4R38 A;  4XT2 A;  3NC8 A;  2PD8 A;  5KZH A;  1K6S A;  5TJJ A;  1JWV A;  5FDH A;  1TVF A;  3A0R A;  1ALQ A;  3UNW A;  4EER A;  3BQA A;  4GHI A;  4S2P A;  1ES5 A;  3T4J A;  2VV8 A;  2Y2M A;  3MKF A;  3A3E A;  3LY3 A;  5LBR A;  3IH8 A;  4ETZ A;  1NYY A;  3AGE A;  1UWN X;  1CJF A;  2Z6C A;  2ZMA A;  2OV5 A;  5DKK A;  2PHY A;  1LL8 A;  4EW7 A;  3IHA A;  4JLF A;  3UE1 A;  3N8L A;  3S7N A;  1Y28 A;  3W4Q A;  4Z9Q A;  2W3F A;  3UDI A;  4O01 A;  2XH9 A;  2IWC A;  4BEN A;  2V8F A;  2A2L A;  3P09 A;  2JCH A;  2IWD A;  2W1T A;  4P6B A;  4OPR A;  4JGR A;  2XD5 A;  3VOZ A;  2VX8 A;  4LV1 A;  3CLO A;  3TG9 A;  3G2Z A;  2H0T A;  4MN6 A;  4S2I A;  1W63 M;  3OPL A;  3QNC A;  2Y2L A;  4LCM A;  3RH8 B;  1JWP A;  1F98 A;  1CEG A;  5CED A;  5DF9 A;  3W2Z A;  2J8Y A;  3T4S A;  3V50 A;  1VET B;  2BAS A;  2W3G A;  1HZO A;  4EET B;  2R9X A;  4Q0J A;  5FSR A;  2P9V B;  1MKM A;  2VK3 A;  3W4P A;  1PZP A;  4F94 A;  3WS1 A;  4S2J A;  4I38 A;  4E3L A;  1KDW A;  3P01 A;  3CG5 A;  4P87 A;  4RVA A;  2GNX A;  1JWZ A;  2M7V A;  1DJB A;  3KO6 A;  4GDN A;  2JE5 A;  4PMA A;  1BLS A;  2XQZ A;  3LO7 A;  4E3O A;  3EEA A;  1TS0 A;  5CTN A;  1W7F A;  2JKT I;  3ZHH A;  1MKI A;  4OQG A;  1YLT A;  1PW1 A;  5TFQ A;  3UN7 A;  4R1G A;  4KZB A;  3CPT A;  4D60 A;  4EEU A;  4OON A;  1F9I A;  4K0W A;  2VA0 A;  4OPZ A;  1ES4 A;  3GVB A;  3Q07 A;  4ARZ B;  5HDC A;  4HIA A;  5KSC A;  3UB7 A;  1K54 C;  2B18 A;  4WBG A;  4YFM A;  1BYW A;  4CLC E;  3IX8 A;  4FD8 A;  2K2N A;  1W63 Q;  1Y54 A;  4HOI A;  2WGI A;  4R4R A;  2Y59 A;  3IQA A;  2OLU A;  4Y17 A;  4F3L A;  3D3O A;  4KQR A;  3ICY A;  4R3B A;  4M4X A;  1H0M A;  1XFQ A;  1KGE A;  3DTE A;  3OC2 A;  2FFY A;  3UPN A;  5HAR A;  2B95 A;  5GHZ A;  1PWD A;  3ZG5 A;  1VM1 A;  5AVE A;  3F1O A;  4WN5 A;  4MBH A;  2PD7 A;  1G28 A;  2YKF A;  5EEC A;  5E2H A;  1DJC A;  4GLQ A;  1D1J A;  5CRF A;  2B02 A;  5GHY A;  3LCE A;  3IWO A;  5CEB A;  3VP2 A;  1S67 L;  3IXB A;  1VEU B;  3R7W B;  1HVB A;  4GB7 A;  5CHJ A;  1TD5 A;  3VOL A;  5F6A A;  1KOU A;  3W8K A;  1HD8 A;  3BFF A;  1JNU A;  2CMN A;  3L9K A;  1TS6 A;  3A0S A;  3T1X A;  1U60 A;  2XEP A;  3SH8 A;  4S2L A;  5EOO A;  3ZGA B;  1MY8 A;  1STZ A;  4ZJ2 A;  1FCO A;  1D7E A;  5E2F A;  3RFB A;  1YMX A;  1P0Z A;  3C5A A;  3KYE A;  5J8X A;  3QNB A;  3BW6 A;  2XDM A;  1PZO A;  3CUE A;  2ZMF A;  1G6O A;  1IYP A;  2JC7 A;  3MFD A;  4KZ3 A;  1T1B A;  1L0D A;  2JKF A;  2ZC4 B;  4JF5 A;  2XSS A;  3H82 B;  3QHY A;  4QWO A;  2EFU A;  3FKW A;  1IFQ A;  1VB6 A;  3E0Y A;  1TF1 A;  4R70 A;  3PBO A;  1V9Y A;  4P0M A;  2WKQ A;  4R0Q A;  3CAX A;  3VE4 A;  3K3C A;  4II7 A;  4Y0T A;  1H8Y A; 
#chains in the Genus database with same CATH homology
 3CUE C;  3KX0 X;  1N9O A;  2HGV A;  3TJZ C;  2V0W A;  1S1Y A;  1OJ5 A;  4YNR A;  1DP9 A;  4WUJ A;  1H8M A;  1P97 A;  3H9W A;  3OCN A;  2J3T D;  4DN0 A;  3EQV A;  4HHD A;  4EU0 A;  4O8G A;  1S1Z A;  1S66 L;  2P7J A;  3BY8 A;  2PR5 A;  4QPR A;  2EWW A;  1YAX A;  4HNB A;  2GX5 A;  3FPV A;  4DMZ A;  3LID A;  2O9C A;  3UME A;  3D72 A;  1OPX A;  4NKP A;  2XRN A;  3KYZ A;  1N9N A;  2JHE A;  4HP4 A;  4I3J A;  2XA7 M;  4BMW A;  2W3D A;  3VV4 A;  2LB9 A;  4K08 A;  2I9V A;  2OAQ 1;  5F69 A;  2VV6 A;  3BY9 A;  3K2N A;  4WF0 A;  1S4S A;  2K7S A;  4HY8 A;  2ZOI A;  3LIC A;  3OOV A;  3T4T A;  2HF6 A;  4YWZ A;  4UQI S;  2OOL A;  4G3K A;  2QJ7 A;  3PBR A;  3EQU A;  5G4Z A;  2GJ3 A;  1UWP X;  3LFV A;  4JGP A;  1MC0 A;  3IBJ A;  4O0P A;  4L9E A;  3TRC A;  4B93 A;  2V9A A;  3ULF A;  3NOU C;  3S7P A;  2W0N A;  4NXB A;  3EEH A;  4EEP A;  2JKR M;  2JKT M;  2ZOH A;  3MMH A;  4HJ3 A;  5HPI A;  3KYQ A;  3CWF A;  3B47 A;  5J3W A;  3MFX A;  2QWS A;  4EES A;  5HZH A;  2J80 A;  4IUH A;  3C8C A;  5HWV A;  4HJ4 A;  3EWK A;  4R3A A;  5DFY A;  5I5L A;  5J4E A;  3LYX A;  2YKH A;  3PHY A;  4I39 A;  5KIZ A;  2KOI A;  4E04 A;  3H7W A;  4HJ6 A;  2FZ0 A;  2QJ5 A;  1GSX A;  1XJ4 A;  5CX7 A;  4I3I A;  3H7W B;  4Y5F A;  5C5K A;  4IJG A;  4ZRR A;  1OJG A;  4Y3I A;  3C38 A;  4ME4 A;  4FOF A;  4H6J A;  5HDS A;  2XRO A;  3GDI A;  1T1A A;  4LLO B;  4H6J B;  3LI9 A;  4LRX C;  1P9R A;  2L0W A;  1NLZ A;  4AFI A;  1LT0 A;  5DJU A;  3LR0 A;  2HJ9 C;  5DJT A;  2V1B A;  4KQD A;  2VKS A;  3MR0 A;  3LI8 A;  4MN5 A;  5L8M A;  3TE8 A;  3HJK A;  4NXE A;  2O0Y A;  5J7E A;  3FC7 A;  4R38 A;  4XT2 A;  2PD8 A;  3PR6 A;  2WKP A;  5TJJ A;  2HJE A;  4XT2 B;  3ZYT A;  2VGL M;  4PKY A;  3KSF A;  3CI6 A;  2LB5 A;  3A0R A;  4EER A;  3BQA A;  4HI4 A;  4GHI A;  3UE3 A;  2D01 A;  3T4J A;  1IOU A;  1ODV A;  2VV8 A;  3BQ8 A;  4GHI B;  5IS1 A;  3MJQ A;  4CLC D;  3A0V A;  1V9Z A;  5LBR A;  4Z1W A;  4NEE D;  4ETZ A;  1T18 A;  2QHK A;  3B33 A;  1OT6 A;  4HQA A;  3G6O A;  3C30 A;  1UWN X;  2Z6C A;  3P7N A;  5DKK A;  2PHY A;  4JGQ A;  3U2A A;  1LL8 A;  1TS8 A;  4EW7 A;  2PT7 A;  3S7N A;  1Y28 A;  2W3F A;  4O01 A;  3ZQ5 A;  1WA9 A;  3S7Q A;  4RQ9 A;  3PYP A;  3O5Y A;  2HV1 A;  2A2L A;  1D06 A;  2VEA A;  5K5B A;  2KLI A;  3MF0 A;  2NUP C;  3E4O A;  4YOF A;  2W1T A;  3NJA A;  4JGR A;  2OAP 1;  2W1T B;  2XA7 S;  2VX8 A;  3MQQ A;  3CLO A;  3JVV A;  3HJI A;  1OT9 A;  4EUV A;  3IS2 A;  2MJ6 A;  2O9B A;  2QYB A;  3IS2 B;  1DP6 A;  2EA9 A;  4MN6 A;  4HH3 A;  3EGD C;  4WEL A;  1W63 M;  3T4K A;  1OTI A;  1EW0 A;  4WEJ A;  2KX6 A;  3RH8 B;  4MMN A;  3E4Q A;  4P6Z M;  1F98 A;  5HWT A;  5DF9 A;  5DKL A;  3OBF A;  3W2Z A;  5F68 A;  3T4S A;  4L9G A;  3NOP C;  1NRJ A;  2BAS A;  2W3G A;  4EET B;  4DJ3 A;  4KQO A;  4Q0J A;  3GEC A;  1N9L A;  4OOM A;  1VHM A;  1MKM A;  4WEK A;  3MQO A;  4GCZ A;  4IHQ A;  3K3D A;  3PXP A;  5KSH A;  1YSQ A;  3CIT A;  4I38 A;  2VLG A;  3P01 A;  1XJ3 A;  4DJ2 A;  2GNX A;  2M7V A;  2QKP A;  3T50 A;  2L1M A;  4FSF A;  3KO6 A;  2OWH A;  3LIF A;  2Y79 A;  2ZMV A;  2P08 A;  3F1N A;  5EFW A;  4MN7 A;  3EEA A;  3F1N B;  2J3T C;  5F5Y A;  1TS0 A;  3LR5 A;  1X0O A;  4Y2F A;  1T1C A;  2PR6 A;  2JKT I;  2JKR I;  2IA2 A;  4LRY C;  4KUO A;  5AJG A;  2G7U A;  3HCY A;  1XJ6 A;  4GJ4 A;  2K31 A;  4ETX A;  4WLA A;  3LR3 A;  3VE3 A;  4Q0H A;  3T4L A;  2VZW A;  4PHT A;  3KSG A;  5HPF A;  4EEU A;  2H28 A;  4G3W A;  3NOT C;  2VGL S;  4MCW A;  1F9I A;  5HL6 A;  2VA0 A;  4BJP A;  4ARZ A;  4NXF A;  3T4O A;  4ARZ B;  2Y8H A;  5HDC A;  1XJ2 A;  4HIA A;  3UB7 A;  1H3Q A;  2B18 A;  3KSH A;  3T4Q A;  1BYW A;  4CLC E;  2PYP A;  4L0L A;  4BBV A;  2K2N A;  1W63 Q;  4PKY G;  1OTB A;  4GW9 A;  5HWW A;  1S4R A;  4HOI A;  2FH5 A;  3EGX C;  4NXG A;  3UMD A;  1GSW A;  4F3L A;  4HP9 A;  2W1R A;  3D3O A;  4WL9 A;  4I3A A;  4F3L B;  5HD3 A;  2W27 A;  4LPZ A;  2JN7 A;  3ICY A;  1ZHH B;  3V67 A;  4M4X A;  2EWV A;  1XFQ A;  2VV7 A;  3LR4 A;  2W3E A;  2OWJ A;  3OC2 A;  4Q0I A;  2ZBB A;  1DP8 A;  5FL3 A;  5AVE A;  3F1O A;  4WN5 A;  4B9O A;  3TW8 A;  3MXQ A;  3F1O B;  2PD7 A;  1G28 A;  3S7O A;  2YKF A;  4UQI M;  3LUQ A;  1UGU A;  4GLQ A;  2J3W A;  1P9W A;  5HDD A;  2B02 A;  4JGO A;  3PBS A;  1LSV A;  2R78 A;  4BBT A;  1LSW A;  3R7W A;  5IT5 A;  1S67 L;  5DFX A;  1OTA A;  1ZTU A;  3R7W B;  4L9F A;  3FG8 A;  3UE6 A;  5MC7 A;  2M1C A;  4P6Z S;  3E98 A;  4CLC A;  2W3H A;  1OTE A;  5A8B A;  3F1P A;  4OOL A;  1TD5 A;  3VOL A;  1F5M A;  3NHQ A;  4CLC B;  4EXO A;  3F1P B;  5F6A A;  1KOU A;  2M7U A;  4MDZ A;  3OLO A;  3BJN A;  1JNU A;  1NWZ A;  2WKR A;  3PBQ A;  1YSP A;  4R6L A;  5TBM A;  2V0U A;  2CMN A;  1TS6 A;  3R4K A;  5HD5 A;  5TBM B;  3PBT A;  3RTY A;  5HSQ A;  4BBU A;  3A0S A;  3OCL A;  1TS7 A;  4CQH A;  3B42 A;  3C2W A;  3JVU A;  3UB6 A;  1XFN A;  3FPW A;  3DBA A;  1STZ A;  1D7E A;  3RFB A;  4GS9 A;  4IUK A;  2PYR A;  4CLC C;  1P0Z A;  3UB9 A;  2NUT C;  1GSV A;  4GS9 B;  4UEY A;  5G4Y A;  3BW6 A;  1YKD A;  1T19 A;  3SW1 A;  3CUE A;  2INW A;  4G3V A;  2ZMF A;  3MQ0 A;  3LIB A;  1G6O A;  2L4R A;  1NLY A;  3BWL A;  3PBN A;  1T1B A;  3LIA A;  2DMW A;  4I5S A;  2Z6D A;  3H82 A;  2VJW A;  3KSI A;  3LIE A;  3UB8 A;  4EQ1 A;  4PAU A;  2PDR A;  4LRZ E;  2XSS A;  2V1A A;  3H82 B;  2A24 A;  1IFQ A;  1VB6 A;  3E0Y A;  1TF1 A;  2A24 B;  4R70 A;  3PBO A;  1V9Y A;  5IU1 A;  2D02 A;  4HH2 A;  2P04 A;  1DRM A;  1LSX A;  2WKQ A;  4BWI A;  3CAX A;  1OTD A;  3IBR A;  3K3C A;  3VE4 A;  2O99 A;  5AVF A;  4KUK A;  2KDK A;  3EOI A;  4II7 A;  1MZU A;  2GZA A;  3E4P A;  2O9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...