4DJ2A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
307
structure length
276
Chain Sequence
b'DMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTEKSVFCRIRGGRYQPFRLTPYVTKIRVAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPDSDIQELSEQIHRLLLQPVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Period circadian protein homolog 1
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 67
structure length 276
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj2A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj2A02
4NXFA 4L9EA 3MR0A 4HJ4A 1Y28A 3GECA 4GW9A 4HQAA 5F68A 1T1BA 3MJQA 2HV1A 1N9NA 2PYPA 5J7EA 1DP9A 3LIBA 3E4QA 4BBVA 5A8BA 4RQ9A 5IS1A 1XJ2A 3D72A 2Z6DA 1ODVA 4I3AA 4NXEA 3KX0X 1XJ6A 3A0RA 3K3CA 5HWWA 3FC7A 2V9AA 3UB8A 1DP8A 1P0ZA 2W27A 4PKYA 1N9LA 2J80A 3RTYA 1G28A 4I3JA 3VE3A 2WKRA 1X0OA 3SW1A 3CWFA 3C2WA 4I5SA 3F1PA 4MN5A 4EQ1A 5AVEA 2L4RA 1KOUA 1OTEA 4WLAA 1BYWA 4HH3A 4LPZA 1N9OA 2Z6CA 3LI8A 4HIAA 2VV8A 4R38A 2VV6A 2OWHA 3NOTC 5KIZA 2PYRA 1LT0A 5HSQA 1DP6A 4BBTA 3MQOA 4JGPA 1XJ3A 4EW7A 2OOLA 2VEAA 4EEPA 1UGUA 1GSWA 2YKFA 1F98A 3UB6A 3H82B 4EETB 1OTBA 4KUOA 2B02A 1LL8A 3LIEA 2PHYA 5DKKA 5HD3A 2CMNA 2INWA 1TS7A 1T19A 4EESA 3HJKA 4H6JB 3OLOA 4LRXC 3T50A 1S66L 3NOUC 2JHEA 4DJ2A 3LIDA 1S4SA 3F1NB 2BASA 4JGOA 1UWPX 5TBMB 4HNBA 3E4OA 1OTDA 3MQQA 3IS2B 2A24B 1NWZA 3EEHA 4MN6A 4KUKA 4I3IA 5HZHA 5DKLA 4GS9B 2K7SA 1V9YA 3CAXA 4EXOA 1WA9A 2V0UA 4R3AA 2PR6A 3FG8A 5HD5A 2V1BA 3ZQ5A 2QWSA 3ICYA 4YWZA 4HJ3A 3H7WB 3MFXA 3G6OA 3E4PA 4EERA 1OJ5A 3F1OB 3EWKA 3LUQA 4R70A 3UB9A 4XT2B 1XFQA 2KX6A 4LRYC 4GHIB 3IBRA 2QJ7A 3LI9A 5F69A 2OWJA 1OT9A 1EW0A 1OTAA 4HH2A 5EFWA 4F3LB 5HDDA 4WF0A 3NOPC 2M1CA 4LLOB 3K3DA 1MZUA 4HOIA 1S4RA 4JGRA 1LSVA 4WN5A 2EA9A 5G4ZA 2W0NA 4B9OA 1S1ZA 4K08A 4L9GA 4JGQA 2PD8A 1T18A 1D7EA 5HWTA 3HJIA 2L0WA 3UMDA 1UWNX 3NHQA 4I38A 4HJ6A 4I39A 2L1MA 4R6LA 1TS8A 2I9VA 2QJ5A 5F5YA 3RH8B 1OTIA 5F6AA 1TS6A 2V1AA 2WKPA 4HY8A 5HDCA 3H82A 4NXBA 3MXQA 4WL9A 1D06A 3F1PB 4HI4A 3GDIA 2GJ3A 1GSVA 5G4YA 4H6JA 3P7NA 2QHKA 2YKHA 5DJUA 3UMEA 1XJ4A 1OJGA 1GSXA 2V0WA 5DJTA 3LIFA 5I5LA 4E04A 3F1NA 1F9IA 1T1CA 5TBMA 4HP9A 1LSXA 1XFNA 5IU1A 3BY8A 1V9ZA 3IS2A 2A24A 2R78A 3A0VA 4GCZA 2QKPA 2PDRA 1P97A 3VE4A 3BWLA 2D01A 5HDSA 3C8CA 4GS9A 3CLOA 2PR5A 2D02A 1T1AA 1LSWA 2VLGA 3UB7A 2ZOHA 3PHYA 2VV7A 3NJAA 4LRZE 4WUJA 3LICA 3A0SA 3UE6A 3H7WA 5J4EA 4HP4A 5J3WA 2PD7A 2P7JA 3F1OA 4DJ3A 3VOLA 4BBUA 3H9WA 2ZOIA 4HHDA 4KQDA 5HWVA 2KDKA 1OT6A 3ULFA 3B33A 4XT2A 5AVFA 1JNUA 2WKQA 1DRMA 2JN7A 4PKYG 4L9FA 2ZBBA 3BY9A 1S1YA 4M4XA 4GHIA 3PYPA 1VB6A 4EEUA 3LYXA 4NXGA 1TS0A 1S67L 4F3LA 3LIAA 2H28A
chains in the Genus database with same CATH superfamily
1JTGA 3ZFZA 3EGXC 3CITA 4NXFA 4L9EA 3MR0A 4IUKA 2HJ9C 2H5SA 4HJ4A 3WS4A 3CMZA 3NCKA 3UY6A 1T1BA 3MJQA 5L2FA 4X53A 2PYPA 2OSUA 4OQIA 3VOZA 2ACGA 4PHTA 3IH8A 3ZNTA 1H3QA 4IUHA 4GOGA 1BLSA 3KX0X 3A0RA 3K3CA 3RFBA 5FI2A 1QMFA 1MPLA 3FC7A 2JC7A 3E2LA 3KYQA 2OAP1 2V9AA 1DP8A 1P0ZA 4PKYA 4X25A 4I3JA 3GQZA 5TR7A 1PWGA 2HJEA 4NK3A 3CWFA 4N9LA 4OPYA 3C2WA 1HZOA 2XRNA 4O7DA 4I5SA 3WS1A 3EQVA 3PR6A 1LL5A 5FI7A 5AVEA 1KOUA 4PM6A 4MBFA 2BG1A 1DJCA 4Q0HA 5FASA 2Z6CA 3KO6A 4KZ5A 1M6KA 4WM9A 1L0DA 3JPUA 3OPRA 1GA0A 4C75A 2WZZA 1MKIA 4M3KA 3LR0A 1M40A 3T4LA 4EW7A 2ZQ9A 2E8JA 1LI9A 2O99A 3P01A 1GCEA 2VEAA 2ZL1A 4X56A 1NLZA 1F98A 1FR6A 1FILA 4HESA 1KDWA 4HBUA 4MN7A 2V20A 3UB6A 1FSWA 2ZC6B 1OTBA 3R4KA 1BULA 4GKUA 2B02A 4FH2A 3SS3A 3LIEA 3DWZA 2VJWA 1YSPA 2INWA 2QYBA 3T50A 4P6BA 3T4JA 4JXWA 3N6IA 2DMWA 5HAQA 4MEZA 5TJJA 1PIOA 3C7VA 3GV9A 4JGOA 2HP5A 4HNBA 3E4OA 3RXXA 3MQQA 4KQOA 1JVJA 5CHMA 4DDYA 2A24B 5C5KA 4QY5A 1K4FA 3EEHA 5E2GA 1IKGA 3BYDA 1L3LA 3S22A 4MN6A 5DTTA 3JVUA 2ZJ9A 4ZDXA 4KZ7A 4OOMA 4KZ3A 3S4XA 5HAPA 5A93A 1KGGA 5DF8A 3V3RA 2WYXA 4IJGA 3DTKA 4Y2FA 3EEAA 4R3AA 2PR6A 1H8ZA 2P9VB 4P6ZM 5HFOA 3WWXA 1VEUB 4KQQA 4EBNA 4EERA 4BD1A 2NUTC 4S2PA 3RXWA 3I7JA 4R70A 3C7UA 1ONHA 4DE2A 5M19A 4KENB 5GLBA 4PM7A 2Y2OA 1CK3A 3NC8A 4UA9A 3CUEA 3IBRA 2QJ7A 1G5UA 5CHUA 1XP4A 1N4OA 1GHIA 4Q0IA 1RGYA 3ZGAB 1VQQA 4II7A 4F3LB 3O3VA 2G2UA 1L0FA 3NOPC 4E3IA 1K55A 1ACFA 1MZUA 1S4RA 4JGRA 3BW6A 1K25A 3UDXA 1CEGA 2W0NA 4B9OA 1W63Q 4DE3A 3QHYA 3NBLA 4L9GA 4R4RA 3PAGA 3NULA 2HP6A 4JGQA 4K91A 3IWQA 4WMCA 3IWIA 4E6WA 4ZJ1A 2L0WA 1YQSA 1UWNX 1MWSA 4ZJ3A 4R6LA 3NI9A 3LCEA 2QJ5A 2H10A 2R9WA 1PZOA 1GA9A 4EBLA 3G32A 3KSFA 1BZAA 2W1TA 5E2HA 3Q82A 5HDCA 4FTXA 5GL9A 4S2IA 1ZTUA 4HI4A 4ZBEA 3M2KA 1K56A 3LGOA 4H6JA 4LGWA 3E2KA 3P7NA 3DTMA 3O88A 1NY0A 1GSXA 2V0WA 3LY3A 4WYYA 4UQIS 3GTCA 4X68A 1SDNA 2XFSA 2DCFA 3T1RA 3F1NA 5FQQA 1K54C 1ES5A 1LSXA 1XFNA 5IU1A 3BY8A 4XUXA 1V9ZA 2HDUA 2QKPA 3S1YA 3CPTB 3D9YA 3W4OA 2GX5A 4PM8A 3VE4A 3VSKA 5HDSA 3CLOA 3G2ZA 2EFXA 1KE0A 1LSWA 3VP0A 3MS6A 3PHYA 4WMCD 3LICA 3H7WA 1NYYA 1XXMA 5HW3A 4UHUA 2P7JA 3EQUA 2J9OA 3F1OA 3BRMA 4DE1A 5I94A 4FUWA 3IHBA 4HHDA 4OPQA 4JF4A 1EWZA 2WGWA 3PBTA 4JF6A 3B33A 5AVFA 3ULFA 1MKMA 1CF0A 3IBJA 3HUMA 4L9FA 5M18A 3HVFA 1IKIA 2HDRA 1FIKA 2ZMAA 4IEDA 5MC7A 2W3DA 2XEPA 1TS0A 3LO7A 4QU3A 4N1XA 3ZG5A 5FAPA 2Q0OA 3O5YA 3IXHA 4S2MA 3GECA 5HL1A 4O01A 4HQAA 4KG2A 3UNWA 2HV1A 2Q9MA 1A0KA 5J8XA 3T4OA 5CGWA 3S7QA 3V39A 4BBVA 3VP3A 1RP5A 3UPOA 5IS1A 1PI5A 4KG6A 4I3AA 5CTMA 2VA0A 3NECA 3U2AA 4N1HA 5EOEA 3BFDA 1IFQA 3N8RA 4S2NC 2J80A 3RTYA 5FEGA 1IOUA 2WKRA 2DNSA 3LEZA 2XROA 1H0MA 2QPNA 1FCMA 5JYPA 1TDGA 4MNRA 3IT9A 3IF6C 3SS4A 2ZQDA 1BLHA 3Q07A 4WLAA 3AGEA 5FQKA 4LPZA 5E2FA 4F94A 1N9OA 4GJ4A 3E98A 3ZNYA 5A90A 2VV8A 4Y7PA 5F1GA 3KYZA 4P87A 1CI9A 2FFFB 1I2WA 3NOTC 5KIZA 1DP6A 2NUPC 3SS5A 5E2EA 3HCYA 3PAEA 1ZHHB 4N9KA 1NRFA 5EM0A 4BL3A 1O07A 1YLYA 4YFMA 3PXPA 1G68A 1UGUA 3N8LA 4EEPA 2R9XA 3HLGA 5BOHA 2P04A 3LEQA 1GSWA 2YKFA 4WEJA 2ZM0A 2O9BA 2PU4A 4K0XA 4D60A 1D1JA 5EVIA 1LL8A 2XGNA 1FCNA 2W3FA 2CMNA 4EBPA 1L0GA 1TS7A 4EV4A 3PBNA 3E0YA 5TGFA 2O0YA 4LRXC 3HLWA 3NOUC 4IHQA 4GDBA 3LIDA 4XUZA 3IX4A 2HF6A 4ARZA 3G35A 1MWRA 4OP8A 1LLBA 5CX7A 2VGKA 3T1QB 3IS2B 5EV0A 1BUEA 3HLFA 3SOIA 2LB5A 3V67A 5HZHA 3VP2A 2VKSA 5DKLA 4GS9B 2P74A 2K7SA 1VM1A 4EXOA 2KOIA 3M6BA 4OH0A 5HD5A 2M7VA 1JTDA 3VSLA 2Z2MB 1WE4A 2PBYA 2QWSA 1ZG4A 3MFXA 3G6OA 3OOVA 3WS0A 1AWIA 2GDNA 3MZDA 4Y15A 3GMWA 3UB9A 3ZG7B 4JF5A 4CJNA 2ZMVA 2FZ0A 3B47A 1AXBA 4MCWA 2KX6A 3B3XA 3T4SA 3DTIA 3U4LP 4AFIA 3QNBA 3QP8A 1VETB 3HLEA 5F69A 5EVID 5DF9A 1OT9A 1PRQA 4B4ZA 1EW0A 5LBRA 5EVEA 4HH2A 1W8YA 1ZC2A 3QP4A 3EGDC 4WF0A 4WBGA 4QJGA 2ZLYA 2FFYA 5FQJA 1BLCA 3HUNA 3BFGA 4LLOB 3K3DA 3S7NA 5CGXA 1W79A 5AQ9A 2J8YA 2OV5A 4EUVA 1LSVA 2ZC5B 5EPHA 4LV1A 4WN5A 2EA9A 4P85A 4KG5A 2EWWA 2VGJA 1S1ZA 3AGDA 4B93A 3FV7A 2PD8A 3PBRA 5HWTA 4S2KA 3UMDA 2HGVA 1BT5A 3W2ZA 3W8KA 4HJ6A 4WELA 3Q7VB 4OKPA 5F1FA 4P0MA 5HARA 1TS8A 3GRJA 1ES3A 2WAEA 1W63M 2A49A 4JPMA 3TJZC 2ZQ7A 2Y2HA 4OPZA 5GLAA 2H0YA 2X02A 4WL9A 1D06A 3F1PB 3GR2A 1OMEA 5AQ7A 3C4PA 2GJ3A 5F82A 3SH7A 1S6RA 3D3OA 4GD8A 1JWVA 2JKRI 2QHKA 2YKHA 3UDFA 5A92A 4EUZA 4MBKA 2J3TC 3HUOA 3Q1FA 4CLCC 1PW8A 3QP2A 4PAUA 3UPNA 1T1CA 2XR0A 1GHPA 2ZMFA 4KQRA 2A24A 4U0TA 4GCZA 1Q2PA 2PDRA 2C6WB 2XDMA 1ALQA 3WRTA 4RX3A 3BWLA 4CLCB 2D01A 1ESUA 4WZ4A 3C8CA 3G31A 1PWDA 4RYEA 3DWKA 1T1AA 4ID4A 5JYOA 1W8QA 2VLGA 3ISGA 2P9VA 2G2WA 3UB7A 5DVAA 2ZOHA 1YPRA 4WEKA 3IWOA 2VV7A 4HEFA 4LRZE 3R7WB 3SH9A 1VEUA 5GLCA 4B88A 3T4TA 2JKGA 4FOFA 3GSGA 3H9WA 3OBFA 2ZOIA 5HAIA 2V1ZA 1JNUA 3FWLA 2JN7A 2A3UA 4RX2A 4PKYG 3BY9A 3SZTA 1S1YA 4M4XA 3OCLA 3RJUA 3D4FA 5AJGA 4LV0A 1ONGA 1PNEA 2XLNA 2EWVA 4NXGA 3C38A 3BJNA 5U47A 4F3LA 4UA7A 3ZG8B 5TFQA 4ZRRA 3BFFA 4JBFA 4BQMA 4Y13A 1Y28A 4NETA 3L7HA 2JCHA 3ITBA 2ZQCA 5KSCA 4O8GA 2HDSA 1BTLA 1N9NA 4Y0OA 2MJ6A 5FL3A 3Q81A 3LIBA 2HPBA 4D2OA 4RQ9A 1KE4A 3TG9A 4JXSA 1Y4OA 1ZG6A 3ZHHA 3D72A 4DF6A 2ZQAA 1SKOB 1SDEA 1YMXA 2PT7A 1YLJA 4ME4A 2EX9A 2XH9A 2WGVA 2IWCA 2XSSA 5FAOA 3NY4A 4CQHA 3OZHA 3MZEA 1Z09A 1KE3A 2W3GA 3MXSA 2W27A 2A2LA 2O9CA 1PI4A 3FKVA 4GNUA 3VE3A 1K6RA 4B4XA 1Y54A 3TRCA 3SW1A 4R23A 5L8MA 1YLZA 3A3DA 3MFDA 1IELA 4C3QA 1RGZA 1DJAA 1LL9A 4EQ1A 3BECA 2L4RA 2WUQA 1OTEA 1BYWA 4HH3A 1H5XA 3V50A 1JWZA 3LI8A 4H8RA 5KSHA 2V8FA 4HIAA 4BL2A 5L10A 4R38A 3K2NA 4BD0A 3O87A 2E8IA 2WK0A 3TSGA 2J3TD 1ZKJA 2PYRA 3KYEA 2Y2GA 3MQOA 3CJMA 4JGPA 4GLQA 3ZYTA 1YLWA 3AGFA 3BFEA 2ZQ8A 3L9KA 3IX8A 4IVIA 3VP4A 1NXYA 3CPTA 2X71A 3H82B 5FQIA 4LV3A 4KZ9A 4R0QA 1K54A 5HD3A 3TOIA 4YOFA 2IWBA 1T19A 4OLDA 1K56D 3OLOA 2Y2PA 4DXCA 2J9PA 3PBOA 4E3MA 3QP5A 4JLFA 1HLUP 2JHEA 1CI8A 1S4SA 2VZWA 3DW0A 4QD4A 1UWPX 3ZG9B 5TBMB 1OTDA 5CXWA 3CHWP 3M2JA 5A91A 1XKZA 1KGFA 3VFFA 1XGJA 3OPLA 4FD8A 1NWZA 2J7VA 4KUKA 4I3IA 4UAAA 2VX8A 3PBQA 1E25A 3B42A 1XA7A 3N7WA 1WA9A 1K0KA 3FPWA 2V0UA 1IYPA 2EXAA 1ES2A 1W5DA 5GLDA 3FG8A 2DRWA 3BM6A 4OPRA 5EVLA 2V1BA 2HDQA 3G4PA 1ES4A 4KZ8A 4YWZA 4HJ3A 2K2NA 1EROA 1PFLA 2FH5A 1XGIA 3E4PA 3CG5A 1OJ5A 4UQIM 4XT2B 1XFQA 2Y2MA 4N92A 3MF0A 4U3TA 1ERMA 4LRYC 5FAQA 3GVBA 4GHIB 2G7UA 3LI9A 1YMSA 1G6AA 4Y3IA 1OTAA 3IF5A 5DFXA 1RCJA 1W7FA 4ZJ2A 3IX3A 5FA7A 2EXBA 5HDDA 3IXBA 2JBFA 1Q2QA 3FKWA 3UN7A 5FDSA 2EX8A 2C5WB 4HOIA 2XD5A 1SKFA 2ZC3B 3V5MA 2WKIA 3HREA 1YM1A 1MWTA 5G4ZA 3C4OA 2OAQ1 1C3BA 4S2NA 3NDEA 2PRFA 5CGSA 3A3JA 1STZA 1XX2A 3MBZA 1D7EA 4LFUA 4E6XA 4Z1WA 3NDGA 5CRFA 3UO9A 2RL3A 3IF6A 2L1MA 2I9VA 5IHVA 4OQHA 5F5YA 3RH8B 1KVMA 1OTIA 2Z2LB 5F6AA 5CERA 1P9WA 2PU2A 1TS6A 3JVVA 4Z9QA 4OQ0A 2WKPA 4MMNA 5CHJA 1LI0A 3NIAA 4A5RA 3UB5P 1TVFA 3FPVA 4LV2A 4NXBA 3MXQA 4KZ4A 3PBSA 4OVDA 3ZDJA 1MBLA 3EOIA 5KZHA 3MMHA 4P6ZS 3QNCA 1BSGA 3MKFA 4KZ6A 1SCWA 1S0WA 3HL9A 5G4YA 4YNRA 3IH9A 2WKHA 1OPXA 4E3NA 3UMEA 1XJ4A 5DJTA 5GHZA 3LIFA 3LFVA 1NZOA 4PM5A 4OOLA 5K5BA 3W4QA 5EECA 2OLVA 2RCXA 4HP9A 4X55A 4WZ5C 2ZL1B 2VGLM 3S7PA 3IS2A 4X69A 1XPBA 5HX9A 2Y2KA 1O7EA 2BTFP 1HD8A 4GS9A 1F5MA 1H8MA 2PR5A 1G6OA 5EM1A 2D02A 4MDZA 2HP9A 3ZVWA 1TF1A 2XQZA 3O86A 4DRTA 2Y2IA 3TW8A 4IVKA 1MC0A 3P09A 1SHVA 4WUJA 3UE6A 3A0SA 2Y2LA 3G30A 2IWDA 1BLPA 3MKEA 5J4EA 4HP4A 2IA2A 3HLDA 5J3WA 2PD7A 4DJ3A 1YLPA 3VOLA 3FYZA 1I2SA 4RA7A 4KQDA 5FQ9A 1OT6A 5CEDA 4BJPA 1K6SA 1PYYA 3JYIA 3C30A 2XA7M 4R4SA 4LCMA 1VETA 2WADA 5CECA 5E43A 1NLYA 3BLSA 5FI6A 1N9BA 3PYPA 1VB6A 2ZD8A 3LY4A 1MXOA 3IXGA 4DXBA 1JWPA 4PPRA 4EQIA 4NG2A 1L2SA 1L0EA 3BLMA 3BFCA 3CI6A 1TD5A 4NKPA 2H28A 1CJFA 4WZ5A 2Y8HA 2K31A 3MSHA 3DAVA 4L0LA 2B95A 1J9MA 1DJBA 1IEMA 4GW9A 3CUEC 1E3UA 2W3EA 3QP1A 3LR5A 5F68A 1Z6FA 3MZFA 2JKRM 1TEMA 3A3EA 4EU0A 2QZ6A 5J7EA 1DP9A 4RVAA 3E4QA 2GZAA 5A8BA 4S2JA 4IBRA 1WYCA 4OP5A 4CPKA 4YINA 1XJ2A 2WAFA 1K55C 1ESIA 1U60A 2Z6DA 4QB8A 1ODVA 4NXEA 2HZ5A 1XJ6A 5HWWA 1KDSA 3Q7VA 1IYOA 3UB8A 4QWOA 1N9LA 1PW1A 1IYQA 4BWIA 5IT5A 2XFTA 1G28A 4OOYA 3T4KA 4IBXA 4DMZA 4K0WA 1X0OA 4PM9A 3OCNA 5HL6A 4BENA 3WS5A 3F1PA 4MN5A 1YSQA 4GDNA 1FSYA 5M1AA 5FATA 3ZG0A 2BLSA 1CQAA 5DF7A 3HLCA 4E3OA 5KMWA 3HBRA 2LB9A 3S7OA 3W4PA 3KSIA 4S2OA 2VV6A 4X6TA 2OWHA 4HBTA 3N8SA 4FH4A 1LT0A 5HSQA 4BBTA 1XJ3A 4G3KA 2OOLA 2W1RA 2H0TA 1EI5A 4ZTKA 4GZBA 5DFYA 2PAVP 4Y17A 3UDIA 1F2KA 4C6YA 4DKIA 2W1TB 4OLGA 1E3UD 4Q0JA 3KSGA 4EETB 1MY8A 4CLCA 4KUOA 4KZBA 3G34A 5F83A 3OPHA 4X1MA 4E3LA 2PHYA 5DKKA 4UEYA 4G3VA 4EESA 4DDSA 5D3OA 2ZC7A 3HJKA 4H6JB 2EFUA 2ZC4B 3ZVTA 3VP1A 1S66L 2ZM2A 1FQGA 3R7WA 3A3FA 3VV4A 4GN2A 3BQAA 4S2LA 4QY6A 4R3JA 4ZAMA 3LR4A 4BLMA 3WS2A 2XF3A 4DJ2A 2Q9NA 3F1NB 2BASA 3QP6A 3IQAA 2JKFA 4Y0UA 4MBHA 4ESPA 2Y79A 3MXRA 4LENA 3UE3A 1YLTA 3UE0A 3G2YA 5CEBA 2KLIA 1TDLA 2O9AA 5DTKA 5HPFA 5EUAA 4JXGA 5GHYA 4G3WA 1YT4A 3CZDA 3P98A 3T1XA 1HTZA 1V9YA 3CAXA 3FZCA 4PMAA 5FQMA 1I5QA 3ZQ5A 4MLLA 3WRZA 3ICYA 3H7WB 1DY6A 1K57C 4FCFA 2EX6A 2I72A 2Y2JA 5HPIA 3SH8A 3F1OB 1YAXA 2AVXA 3EWKA 3LUQA 1SZVA 2WGWB 1WYBA 1SKOA 2B18A 2UV0E 2V8CA 3V3SA 2OWJA 1MWUA 4CLCD 1QMEA 5L07A 1FR1A 5EFWA 3C5AA 3DBAA 3N4IA 3UPPA 2M1CA 4CLCE 2WKEA 2WGIA 2UWXA 3VFHA 3ZCZA 2GNXA 3PTEA 3TE8A 2EX2A 3T4QA 3IHAA 4GB7A 5CTNA 1FCOA 4DE0A 4K08A 4OQGA 4FSFA 1K4EA 4DN0A 1T18A 2Y59A 3T12B 4QPRA 1J3WA 3HJIA 1YKDA 1K57A 3NHQA 4R1GA 1P9RA 4I38A 4I39A 4R3BA 2CC1A 2XD1A 1NRJA 3BQ8A 3LR3A 3OPPA 2ZM8A 2V1AA 5AQAA 4GD6A 3M6HA 4HY8A 2VK3A 2XK1A 3H82A 4U0XA 5GHXA 2J3WA 4Y5FA 1ERQA 3GDIA 1IYSA 3DTEA 3A3IA 4O0PA 1GSVA 1NYMA 4QHCA 1HVBA 2Y91A 4KZAA 2Y4AA 4JXVA 5DJUA 2WZXA 3ITAA 5EOOA 1NJ4A 1OJGA 5EVIC 2PBDP 2Y2NA 5I5LA 2VGLS 5AQBA 4E04A 5FEFA 1F9IA 1FOFA 4BMWA 2Y55A 5DTSA 5TBMA 4EWFA 2Y2QA 4E3KA 1LHYA 2R78A 4LCLA 3A0VA 3MQ0A 4Y0TA 4X1LA 1PWCA 1GHMA 3VMAA 3BEBA 1P97A 5EVIB 1E4DA 2M7UA 4ETZA 1PZPA 3UE1A 2V2FF 4NEED 1NZUA 2B5RA 1XA1A 4Q8IA 4ETXA 3VOYA 3NJAA 5L09A 4E3JA 3Q7ZA 1KGEA 3IF6B 3KSHA 2XA7S 1KVLA 5EE8A 3OC2A 4BBUA 3T1SA 5HWVA 1VHMA 2KDKA 2QMIA 4XT2A 2WKQA 4ARZB 1DRMA 4UA6A 2P08A 2X01A 1H8YA 2ZBBA 4JKTA 2JKTM 5FDHA 2JE5A 4GHIA 1K38A 3HLBA 5G18A 5FSRA 4OONA 1CEFA 3IXDA 2OLUA 3LYXA 4EEUA 2W3HA 2JKTI 1S67L 4XXRA 3LIAA
chains in the Genus database with same CATH topology
2Y8HA 3EGXC 4ZRRA 3CITA 4NXFA 4L9EA 2K31A 3MR0A 4IUKA 2HJ9C 3O5YA 4HJ4A 4L0LA 1Y28A 3GECA 4GW9A 3CUEC 4O01A 4HQAA 2W3EA 3LR5A 5F68A 1T1BA 4O8GA 3MJQA 2HV1A 1N9NA 2JKRM 4EU0A 2PYPA 5J7EA 2MJ6A 5FL3A 1DP9A 3T4OA 3LIBA 3E4QA 3S7QA 4BBVA 2GZAA 5A8BA 4PHTA 4RQ9A 5IS1A 1H3QA 1XJ2A 4IUHA 3D72A 2Z6DA 1ODVA 4I3AA 4NXEA 3KX0X 1XJ6A 3A0RA 3K3CA 5HWWA 2VA0A 3RFBA 2PT7A 4ME4A 3U2AA 3FC7A 2XSSA 4CQHA 3KYQA 2OAP1 1IFQA 2V9AA 3UB8A 1DP8A 2W3GA 1P0ZA 2W27A 4PKYA 1N9LA 2A2LA 4BWIA 2J80A 3RTYA 2O9CA 5IT5A 1G28A 4I3JA 3VE3A 1IOUA 2WKRA 3T4KA 4DMZA 2XROA 3TRCA 1X0OA 3SW1A 2HJEA 3CWFA 5L8MA 3C2WA 3OCNA 5HL6A 2XRNA 4I5SA 3EQVA 3PR6A 3F1PA 4MN5A 1YSQA 4EQ1A 5AVEA 2L4RA 1KOUA 1OTEA 4WLAA 1BYWA 4HH3A 4LPZA 4Q0HA 1N9OA 4GJ4A 2Z6CA 3LI8A 3E98A 5KSHA 3KO6A 4HIAA 2LB9A 2VV8A 3S7OA 3KSIA 4R38A 3K2NA 2VV6A 3KYZA 2OWHA 2J3TD 3NOTC 5KIZA 2PYRA 1LT0A 5HSQA 1DP6A 4BBTA 3MQOA 2NUPC 4JGPA 4GLQA 3ZYTA 3HCYA 3LR0A 1XJ3A 1ZHHB 3T4LA 4G3KA 4EW7A 2OOLA 2W1RA 2O99A 3P01A 2VEAA 3PXPA 4EEPA 1UGUA 2P04A 5DFYA 1GSWA 2YKFA 4WEJA 1NLZA 1F98A 2O9BA 4MN7A 2W1TB 3UB6A 3H82B 4Q0JA 3KSGA 4EETB 1OTBA 3R4KA 4CLCA 4KUOA 2B02A 1LL8A 3LIEA 2PHYA 5DKKA 5HD3A 2W3FA 2CMNA 2VJWA 4UEYA 4YOFA 1YSPA 2INWA 1TS7A 4G3VA 1T19A 2QYBA 4EESA 3PBNA 3E0YA 3HJKA 4H6JB 2O0YA 1TD5A 3OLOA 4LRXC 3T50A 1S66L 3R7WA 3NOUC 3VV4A 3T4JA 3BQAA 4IHQA 3PBOA 3LR4A 2JHEA 2DMWA 4DJ2A 5TJJA 3LIDA 1S4SA 2VZWA 3F1NB 2BASA 4JGOA 1UWPX 5TBMB 4HNBA 3E4OA 1OTDA 2Y79A 3MQQA 4KQOA 2HF6A 4ARZA 3UE3A 5CX7A 3IS2B 2A24B 5C5KA 2KLIA 1NWZA 2O9AA 3EEHA 5HPFA 4MN6A 4KUKA 3JVUA 4I3IA 2LB5A 4OOMA 3V67A 5HZHA 4G3WA 2VX8A 3PBQA 3B42A 2VKSA 5DKLA 4GS9B 2K7SA 4IJGA 1V9YA 3CAXA 4EXOA 2KOIA 1WA9A 4Y2FA 3FPWA 2V0UA 3EEAA 4R3AA 2PR6A 3FG8A 5HD5A 2M7VA 4P6ZM 2V1BA 3ZQ5A 2QWSA 3ICYA 4YWZA 4HJ3A 3H7WB 2K2NA 3MFXA 2FH5A 3G6OA 3E4PA 4EERA 1OJ5A 2NUTC 3OOVA 5HPIA 3F1OB 1YAXA 3EWKA 3LUQA 4UQIM 4R70A 3UB9A 2ZMVA 2FZ0A 3B47A 4XT2B 1XFQA 4MCWA 2KX6A 3MF0A 3T4SA 4AFIA 4LRYC 2B18A 3CUEA 4GHIB 3IBRA 2G7UA 2QJ7A 3LI9A 5F69A 2OWJA 5DF9A 1OT9A 4CLCD 1EW0A 4Y3IA 5LBRA 1OTAA 4Q0IA 5DFXA 4HH2A 4II7A 5EFWA 4F3LB 3EGDC 3DBAA 5HDDA 4WF0A 3NOPC 2M1CA 4CLCE 4LLOB 3K3DA 3S7NA 1MZUA 4HOIA 1S4RA 4JGRA 2GNXA 4EUVA 1LSVA 3BW6A 3TE8A 4WN5A 2EA9A 5G4ZA 2W0NA 3T4QA 1W63Q 4B9OA 2OAQ1 2EWWA 1S1ZA 4K08A 4L9GA 1STZA 4B93A 4FSFA 4JGQA 4DN0A 2PD8A 1T18A 1D7EA 3PBRA 5HWTA 4Z1WA 4QPRA 3HJIA 1YKDA 2L0WA 3UMDA 1UWNX 2HGVA 3NHQA 1P9RA 3W2ZA 4I38A 4HJ6A 4I39A 2L1MA 4R6LA 4WELA 1TS8A 2I9VA 2QJ5A 1NRJA 5F5YA 3RH8B 1OTIA 3BQ8A 1W63M 5F6AA 3LR3A 1P9WA 1TS6A 2V1AA 3JVVA 3TJZC 2WKPA 4MMNA 3KSFA 4HY8A 2W1TA 3FPVA 5HDCA 3H82A 4NXBA 3MXQA 3PBSA 4WL9A 2J3WA 4Y5FA 1D06A 3F1PB 3EOIA 1ZTUA 4HI4A 3GDIA 3MMHA 4P6ZS 2GJ3A 4O0PA 1GSVA 5G4YA 4H6JA 4YNRA 3D3OA 3P7NA 2JKRI 2QHKA 2YKHA 1OPXA 5DJUA 2J3TC 3UMEA 1XJ4A 1OJGA 1GSXA 2V0WA 4UQIS 5DJTA 3LIFA 5I5LA 3LFVA 4CLCC 2VGLS 4E04A 3F1NA 4PAUA 1F9IA 4OOLA 5K5BA 4BMWA 1T1CA 5TBMA 4HP9A 1LSXA 1XFNA 5IU1A 2ZMFA 3BY8A 2VGLM 1V9ZA 3S7PA 3IS2A 2A24A 2R78A 3A0VA 3MQ0A 4GCZA 2QKPA 2PDRA 1P97A 2GX5A 3VE4A 3BWLA 4CLCB 2D01A 5HDSA 3C8CA 4GS9A 2M7UA 1F5MA 3CLOA 4ETZA 1H8MA 2PR5A 1G6OA 2D02A 4MDZA 1TF1A 1T1AA 1LSWA 4NEED 2VLGA 3TW8A 3UB7A 2ZOHA 3PHYA 4ETXA 1MC0A 4WEKA 2VV7A 3NJAA 4LRZE 4WUJA 3LICA 3A0SA 3R7WB 3UE6A 3H7WA 5J4EA 4HP4A 2IA2A 5J3WA 2PD7A 2P7JA 3EQUA 3T4TA 3F1OA 3KSHA 2XA7S 4FOFA 4DJ3A 3OC2A 3VOLA 4BBUA 3H9WA 3OBFA 2ZOIA 4HHDA 4KQDA 1VHMA 2KDKA 5HWVA 3PBTA 1OT6A 3B33A 4XT2A 5AVFA 1MKMA 3ULFA 4BJPA 1JNUA 2WKQA 4ARZB 1DRMA 3IBJA 2JN7A 2P08A 2XA7M 3C30A 4PKYG 4L9FA 2ZBBA 3BY9A 1S1YA 4M4XA 2JKTM 3OCLA 5AJGA 1NLYA 4GHIA 3PYPA 1VB6A 4EEUA 3LYXA 2W3HA 2EWVA 4NXGA 3C38A 5MC7A 3BJNA 2JKTI 2W3DA 1TS0A 1S67L 4F3LA 3CI6A 3LIAA 4NKPA 2H28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXF A;  4L9E A;  3MR0 A;  4HJ4 A;  1Y28 A;  3GEC A;  4GW9 A;  4HQA A;  5F68 A;  1T1B A;  3MJQ A;  2HV1 A;  1N9N A;  2PYP A;  5J7E A;  1DP9 A;  3LIB A;  3E4Q A;  4BBV A;  5A8B A;  4RQ9 A;  5IS1 A;  1XJ2 A;  3D72 A;  2Z6D A;  1ODV A;  4I3A A;  4NXE A;  3KX0 X;  1XJ6 A;  3A0R A;  3K3C A;  5HWW A;  3FC7 A;  2V9A A;  3UB8 A;  1DP8 A;  1P0Z A;  2W27 A;  4PKY A;  1N9L A;  2J80 A;  3RTY A;  1G28 A;  4I3J A;  3VE3 A;  2WKR A;  1X0O A;  3SW1 A;  3CWF A;  3C2W A;  4I5S A;  3F1P A;  4MN5 A;  4EQ1 A;  5AVE A;  2L4R A;  1KOU A;  1OTE A;  4WLA A;  1BYW A;  4HH3 A;  4LPZ A;  1N9O A;  2Z6C A;  3LI8 A;  4HIA A;  2VV8 A;  4R38 A;  2VV6 A;  2OWH A;  3NOT C;  5KIZ A;  2PYR A;  1LT0 A;  5HSQ A;  1DP6 A;  4BBT A;  3MQO A;  4JGP A;  1XJ3 A;  4EW7 A;  2OOL A;  2VEA A;  4EEP A;  1UGU A;  1GSW A;  2YKF A;  1F98 A;  3UB6 A;  3H82 B;  4EET B;  1OTB A;  4KUO A;  2B02 A;  1LL8 A;  3LIE A;  2PHY A;  5DKK A;  5HD3 A;  2CMN A;  2INW A;  1TS7 A;  1T19 A;  4EES A;  3HJK A;  4H6J B;  3OLO A;  4LRX C;  3T50 A;  1S66 L;  3NOU C;  2JHE A;  4DJ2 A;  3LID A;  1S4S A;  3F1N B;  2BAS A;  4JGO A;  1UWP X;  5TBM B;  4HNB A;  3E4O A;  1OTD A;  3MQQ A;  3IS2 B;  2A24 B;  1NWZ A;  3EEH A;  4MN6 A;  4KUK A;  4I3I A;  5HZH A;  5DKL A;  4GS9 B;  2K7S A;  1V9Y A;  3CAX A;  4EXO A;  1WA9 A;  2V0U A;  4R3A A;  2PR6 A;  3FG8 A;  5HD5 A;  2V1B A;  3ZQ5 A;  2QWS A;  3ICY A;  4YWZ A;  4HJ3 A;  3H7W B;  3MFX A;  3G6O A;  3E4P A;  4EER A;  1OJ5 A;  3F1O B;  3EWK A;  3LUQ A;  4R70 A;  3UB9 A;  4XT2 B;  1XFQ A;  2KX6 A;  4LRY C;  4GHI B;  3IBR A;  2QJ7 A;  3LI9 A;  5F69 A;  2OWJ A;  1OT9 A;  1EW0 A;  1OTA A;  4HH2 A;  5EFW A;  4F3L B;  5HDD A;  4WF0 A;  3NOP C;  2M1C A;  4LLO B;  3K3D A;  1MZU A;  4HOI A;  1S4R A;  4JGR A;  1LSV A;  4WN5 A;  2EA9 A;  5G4Z A;  2W0N A;  4B9O A;  1S1Z A;  4K08 A;  4L9G A;  4JGQ A;  2PD8 A;  1T18 A;  1D7E A;  5HWT A;  3HJI A;  2L0W A;  3UMD A;  1UWN X;  3NHQ A;  4I38 A;  4HJ6 A;  4I39 A;  2L1M A;  4R6L A;  1TS8 A;  2I9V A;  2QJ5 A;  5F5Y A;  3RH8 B;  1OTI A;  5F6A A;  1TS6 A;  2V1A A;  2WKP A;  4HY8 A;  5HDC A;  3H82 A;  4NXB A;  3MXQ A;  4WL9 A;  1D06 A;  3F1P B;  4HI4 A;  3GDI A;  2GJ3 A;  1GSV A;  5G4Y A;  4H6J A;  3P7N A;  2QHK A;  2YKH A;  5DJU A;  3UME A;  1XJ4 A;  1OJG A;  1GSX A;  2V0W A;  5DJT A;  3LIF A;  5I5L A;  4E04 A;  3F1N A;  1F9I A;  1T1C A;  5TBM A;  4HP9 A;  1LSX A;  1XFN A;  5IU1 A;  3BY8 A;  1V9Z A;  3IS2 A;  2A24 A;  2R78 A;  3A0V A;  4GCZ A;  2QKP A;  2PDR A;  1P97 A;  3VE4 A;  3BWL A;  2D01 A;  5HDS A;  3C8C A;  4GS9 A;  3CLO A;  2PR5 A;  2D02 A;  1T1A A;  1LSW A;  2VLG A;  3UB7 A;  2ZOH A;  3PHY A;  2VV7 A;  3NJA A;  4LRZ E;  4WUJ A;  3LIC A;  3A0S A;  3UE6 A;  3H7W A;  5J4E A;  4HP4 A;  5J3W A;  2PD7 A;  2P7J A;  3F1O A;  4DJ3 A;  3VOL A;  4BBU A;  3H9W A;  2ZOI A;  4HHD A;  4KQD A;  5HWV A;  2KDK A;  1OT6 A;  3ULF A;  3B33 A;  4XT2 A;  5AVF A;  1JNU A;  2WKQ A;  1DRM A;  2JN7 A;  4PKY G;  4L9F A;  2ZBB A;  3BY9 A;  1S1Y A;  4M4X A;  4GHI A;  3PYP A;  1VB6 A;  4EEU A;  3LYX A;  4NXG A;  1TS0 A;  1S67 L;  4F3L A;  3LIA A;  2H28 A; 
#chains in the Genus database with same CATH topology
 1JTG A;  3ZFZ A;  3EGX C;  3CIT A;  4NXF A;  4L9E A;  3MR0 A;  4IUK A;  2HJ9 C;  2H5S A;  4HJ4 A;  3WS4 A;  3CMZ A;  3NCK A;  3UY6 A;  1T1B A;  3MJQ A;  5L2F A;  4X53 A;  2PYP A;  2OSU A;  4OQI A;  3VOZ A;  2ACG A;  4PHT A;  3IH8 A;  3ZNT A;  1H3Q A;  4IUH A;  4GOG A;  1BLS A;  3KX0 X;  3A0R A;  3K3C A;  3RFB A;  5FI2 A;  1QMF A;  1MPL A;  3FC7 A;  2JC7 A;  3E2L A;  3KYQ A;  2OAP 1;  2V9A A;  1DP8 A;  1P0Z A;  4PKY A;  4X25 A;  4I3J A;  3GQZ A;  5TR7 A;  1PWG A;  2HJE A;  4NK3 A;  3CWF A;  4N9L A;  4OPY A;  3C2W A;  1HZO A;  2XRN A;  4O7D A;  4I5S A;  3WS1 A;  3EQV A;  3PR6 A;  1LL5 A;  5FI7 A;  5AVE A;  1KOU A;  4PM6 A;  4MBF A;  2BG1 A;  1DJC A;  4Q0H A;  5FAS A;  2Z6C A;  3KO6 A;  4KZ5 A;  1M6K A;  4WM9 A;  1L0D A;  3JPU A;  3OPR A;  1GA0 A;  4C75 A;  2WZZ A;  1MKI A;  4M3K A;  3LR0 A;  1M40 A;  3T4L A;  4EW7 A;  2ZQ9 A;  2E8J A;  1LI9 A;  2O99 A;  3P01 A;  1GCE A;  2VEA A;  2ZL1 A;  4X56 A;  1NLZ A;  1F98 A;  1FR6 A;  1FIL A;  4HES A;  1KDW A;  4HBU A;  4MN7 A;  2V20 A;  3UB6 A;  1FSW A;  2ZC6 B;  1OTB A;  3R4K A;  1BUL A;  4GKU A;  2B02 A;  4FH2 A;  3SS3 A;  3LIE A;  3DWZ A;  2VJW A;  1YSP A;  2INW A;  2QYB A;  3T50 A;  4P6B A;  3T4J A;  4JXW A;  3N6I A;  2DMW A;  5HAQ A;  4MEZ A;  5TJJ A;  1PIO A;  3C7V A;  3GV9 A;  4JGO A;  2HP5 A;  4HNB A;  3E4O A;  3RXX A;  3MQQ A;  4KQO A;  1JVJ A;  5CHM A;  4DDY A;  2A24 B;  5C5K A;  4QY5 A;  1K4F A;  3EEH A;  5E2G A;  1IKG A;  3BYD A;  1L3L A;  3S22 A;  4MN6 A;  5DTT A;  3JVU A;  2ZJ9 A;  4ZDX A;  4KZ7 A;  4OOM A;  4KZ3 A;  3S4X A;  5HAP A;  5A93 A;  1KGG A;  5DF8 A;  3V3R A;  2WYX A;  4IJG A;  3DTK A;  4Y2F A;  3EEA A;  4R3A A;  2PR6 A;  1H8Z A;  2P9V B;  4P6Z M;  5HFO A;  3WWX A;  1VEU B;  4KQQ A;  4EBN A;  4EER A;  4BD1 A;  2NUT C;  4S2P A;  3RXW A;  3I7J A;  4R70 A;  3C7U A;  1ONH A;  4DE2 A;  5M19 A;  4KEN B;  5GLB A;  4PM7 A;  2Y2O A;  1CK3 A;  3NC8 A;  4UA9 A;  3CUE A;  3IBR A;  2QJ7 A;  1G5U A;  5CHU A;  1XP4 A;  1N4O A;  1GHI A;  4Q0I A;  1RGY A;  3ZGA B;  1VQQ A;  4II7 A;  4F3L B;  3O3V A;  2G2U A;  1L0F A;  3NOP C;  4E3I A;  1K55 A;  1ACF A;  1MZU A;  1S4R A;  4JGR A;  3BW6 A;  1K25 A;  3UDX A;  1CEG A;  2W0N A;  4B9O A;  1W63 Q;  4DE3 A;  3QHY A;  3NBL A;  4L9G A;  4R4R A;  3PAG A;  3NUL A;  2HP6 A;  4JGQ A;  4K91 A;  3IWQ A;  4WMC A;  3IWI A;  4E6W A;  4ZJ1 A;  2L0W A;  1YQS A;  1UWN X;  1MWS A;  4ZJ3 A;  4R6L A;  3NI9 A;  3LCE A;  2QJ5 A;  2H10 A;  2R9W A;  1PZO A;  1GA9 A;  4EBL A;  3G32 A;  3KSF A;  1BZA A;  2W1T A;  5E2H A;  3Q82 A;  5HDC A;  4FTX A;  5GL9 A;  4S2I A;  1ZTU A;  4HI4 A;  4ZBE A;  3M2K A;  1K56 A;  3LGO A;  4H6J A;  4LGW A;  3E2K A;  3P7N A;  3DTM A;  3O88 A;  1NY0 A;  1GSX A;  2V0W A;  3LY3 A;  4WYY A;  4UQI S;  3GTC A;  4X68 A;  1SDN A;  2XFS A;  2DCF A;  3T1R A;  3F1N A;  5FQQ A;  1K54 C;  1ES5 A;  1LSX A;  1XFN A;  5IU1 A;  3BY8 A;  4XUX A;  1V9Z A;  2HDU A;  2QKP A;  3S1Y A;  3CPT B;  3D9Y A;  3W4O A;  2GX5 A;  4PM8 A;  3VE4 A;  3VSK A;  5HDS A;  3CLO A;  3G2Z A;  2EFX A;  1KE0 A;  1LSW A;  3VP0 A;  3MS6 A;  3PHY A;  4WMC D;  3LIC A;  3H7W A;  1NYY A;  1XXM A;  5HW3 A;  4UHU A;  2P7J A;  3EQU A;  2J9O A;  3F1O A;  3BRM A;  4DE1 A;  5I94 A;  4FUW A;  3IHB A;  4HHD A;  4OPQ A;  4JF4 A;  1EWZ A;  2WGW A;  3PBT A;  4JF6 A;  3B33 A;  5AVF A;  3ULF A;  1MKM A;  1CF0 A;  3IBJ A;  3HUM A;  4L9F A;  5M18 A;  3HVF A;  1IKI A;  2HDR A;  1FIK A;  2ZMA A;  4IED A;  5MC7 A;  2W3D A;  2XEP A;  1TS0 A;  3LO7 A;  4QU3 A;  4N1X A;  3ZG5 A;  5FAP A;  2Q0O A;  3O5Y A;  3IXH A;  4S2M A;  3GEC A;  5HL1 A;  4O01 A;  4HQA A;  4KG2 A;  3UNW A;  2HV1 A;  2Q9M A;  1A0K A;  5J8X A;  3T4O A;  5CGW A;  3S7Q A;  3V39 A;  4BBV A;  3VP3 A;  1RP5 A;  3UPO A;  5IS1 A;  1PI5 A;  4KG6 A;  4I3A A;  5CTM A;  2VA0 A;  3NEC A;  3U2A A;  4N1H A;  5EOE A;  3BFD A;  1IFQ A;  3N8R A;  4S2N C;  2J80 A;  3RTY A;  5FEG A;  1IOU A;  2WKR A;  2DNS A;  3LEZ A;  2XRO A;  1H0M A;  2QPN A;  1FCM A;  5JYP A;  1TDG A;  4MNR A;  3IT9 A;  3IF6 C;  3SS4 A;  2ZQD A;  1BLH A;  3Q07 A;  4WLA A;  3AGE A;  5FQK A;  4LPZ A;  5E2F A;  4F94 A;  1N9O A;  4GJ4 A;  3E98 A;  3ZNY A;  5A90 A;  2VV8 A;  4Y7P A;  5F1G A;  3KYZ A;  4P87 A;  1CI9 A;  2FFF B;  1I2W A;  3NOT C;  5KIZ A;  1DP6 A;  2NUP C;  3SS5 A;  5E2E A;  3HCY A;  3PAE A;  1ZHH B;  4N9K A;  1NRF A;  5EM0 A;  4BL3 A;  1O07 A;  1YLY A;  4YFM A;  3PXP A;  1G68 A;  1UGU A;  3N8L A;  4EEP A;  2R9X A;  3HLG A;  5BOH A;  2P04 A;  3LEQ A;  1GSW A;  2YKF A;  4WEJ A;  2ZM0 A;  2O9B A;  2PU4 A;  4K0X A;  4D60 A;  1D1J A;  5EVI A;  1LL8 A;  2XGN A;  1FCN A;  2W3F A;  2CMN A;  4EBP A;  1L0G A;  1TS7 A;  4EV4 A;  3PBN A;  3E0Y A;  5TGF A;  2O0Y A;  4LRX C;  3HLW A;  3NOU C;  4IHQ A;  4GDB A;  3LID A;  4XUZ A;  3IX4 A;  2HF6 A;  4ARZ A;  3G35 A;  1MWR A;  4OP8 A;  1LLB A;  5CX7 A;  2VGK A;  3T1Q B;  3IS2 B;  5EV0 A;  1BUE A;  3HLF A;  3SOI A;  2LB5 A;  3V67 A;  5HZH A;  3VP2 A;  2VKS A;  5DKL A;  4GS9 B;  2P74 A;  2K7S A;  1VM1 A;  4EXO A;  2KOI A;  3M6B A;  4OH0 A;  5HD5 A;  2M7V A;  1JTD A;  3VSL A;  2Z2M B;  1WE4 A;  2PBY A;  2QWS A;  1ZG4 A;  3MFX A;  3G6O A;  3OOV A;  3WS0 A;  1AWI A;  2GDN A;  3MZD A;  4Y15 A;  3GMW A;  3UB9 A;  3ZG7 B;  4JF5 A;  4CJN A;  2ZMV A;  2FZ0 A;  3B47 A;  1AXB A;  4MCW A;  2KX6 A;  3B3X A;  3T4S A;  3DTI A;  3U4L P;  4AFI A;  3QNB A;  3QP8 A;  1VET B;  3HLE A;  5F69 A;  5EVI D;  5DF9 A;  1OT9 A;  1PRQ A;  4B4Z A;  1EW0 A;  5LBR A;  5EVE A;  4HH2 A;  1W8Y A;  1ZC2 A;  3QP4 A;  3EGD C;  4WF0 A;  4WBG A;  4QJG A;  2ZLY A;  2FFY A;  5FQJ A;  1BLC A;  3HUN A;  3BFG A;  4LLO B;  3K3D A;  3S7N A;  5CGX A;  1W79 A;  5AQ9 A;  2J8Y A;  2OV5 A;  4EUV A;  1LSV A;  2ZC5 B;  5EPH A;  4LV1 A;  4WN5 A;  2EA9 A;  4P85 A;  4KG5 A;  2EWW A;  2VGJ A;  1S1Z A;  3AGD A;  4B93 A;  3FV7 A;  2PD8 A;  3PBR A;  5HWT A;  4S2K A;  3UMD A;  2HGV A;  1BT5 A;  3W2Z A;  3W8K A;  4HJ6 A;  4WEL A;  3Q7V B;  4OKP A;  5F1F A;  4P0M A;  5HAR A;  1TS8 A;  3GRJ A;  1ES3 A;  2WAE A;  1W63 M;  2A49 A;  4JPM A;  3TJZ C;  2ZQ7 A;  2Y2H A;  4OPZ A;  5GLA A;  2H0Y A;  2X02 A;  4WL9 A;  1D06 A;  3F1P B;  3GR2 A;  1OME A;  5AQ7 A;  3C4P A;  2GJ3 A;  5F82 A;  3SH7 A;  1S6R A;  3D3O A;  4GD8 A;  1JWV A;  2JKR I;  2QHK A;  2YKH A;  3UDF A;  5A92 A;  4EUZ A;  4MBK A;  2J3T C;  3HUO A;  3Q1F A;  4CLC C;  1PW8 A;  3QP2 A;  4PAU A;  3UPN A;  1T1C A;  2XR0 A;  1GHP A;  2ZMF A;  4KQR A;  2A24 A;  4U0T A;  4GCZ A;  1Q2P A;  2PDR A;  2C6W B;  2XDM A;  1ALQ A;  3WRT A;  4RX3 A;  3BWL A;  4CLC B;  2D01 A;  1ESU A;  4WZ4 A;  3C8C A;  3G31 A;  1PWD A;  4RYE A;  3DWK A;  1T1A A;  4ID4 A;  5JYO A;  1W8Q A;  2VLG A;  3ISG A;  2P9V A;  2G2W A;  3UB7 A;  5DVA A;  2ZOH A;  1YPR A;  4WEK A;  3IWO A;  2VV7 A;  4HEF A;  4LRZ E;  3R7W B;  3SH9 A;  1VEU A;  5GLC A;  4B88 A;  3T4T A;  2JKG A;  4FOF A;  3GSG A;  3H9W A;  3OBF A;  2ZOI A;  5HAI A;  2V1Z A;  1JNU A;  3FWL A;  2JN7 A;  2A3U A;  4RX2 A;  4PKY G;  3BY9 A;  3SZT A;  1S1Y A;  4M4X A;  3OCL A;  3RJU A;  3D4F A;  5AJG A;  4LV0 A;  1ONG A;  1PNE A;  2XLN A;  2EWV A;  4NXG A;  3C38 A;  3BJN A;  5U47 A;  4F3L A;  4UA7 A;  3ZG8 B;  5TFQ A;  4ZRR A;  3BFF A;  4JBF A;  4BQM A;  4Y13 A;  1Y28 A;  4NET A;  3L7H A;  2JCH A;  3ITB A;  2ZQC A;  5KSC A;  4O8G A;  2HDS A;  1BTL A;  1N9N A;  4Y0O A;  2MJ6 A;  5FL3 A;  3Q81 A;  3LIB A;  2HPB A;  4D2O A;  4RQ9 A;  1KE4 A;  3TG9 A;  4JXS A;  1Y4O A;  1ZG6 A;  3ZHH A;  3D72 A;  4DF6 A;  2ZQA A;  1SKO B;  1SDE A;  1YMX A;  2PT7 A;  1YLJ A;  4ME4 A;  2EX9 A;  2XH9 A;  2WGV A;  2IWC A;  2XSS A;  5FAO A;  3NY4 A;  4CQH A;  3OZH A;  3MZE A;  1Z09 A;  1KE3 A;  2W3G A;  3MXS A;  2W27 A;  2A2L A;  2O9C A;  1PI4 A;  3FKV A;  4GNU A;  3VE3 A;  1K6R A;  4B4X A;  1Y54 A;  3TRC A;  3SW1 A;  4R23 A;  5L8M A;  1YLZ A;  3A3D A;  3MFD A;  1IEL A;  4C3Q A;  1RGZ A;  1DJA A;  1LL9 A;  4EQ1 A;  3BEC A;  2L4R A;  2WUQ A;  1OTE A;  1BYW A;  4HH3 A;  1H5X A;  3V50 A;  1JWZ A;  3LI8 A;  4H8R A;  5KSH A;  2V8F A;  4HIA A;  4BL2 A;  5L10 A;  4R38 A;  3K2N A;  4BD0 A;  3O87 A;  2E8I A;  2WK0 A;  3TSG A;  2J3T D;  1ZKJ A;  2PYR A;  3KYE A;  2Y2G A;  3MQO A;  3CJM A;  4JGP A;  4GLQ A;  3ZYT A;  1YLW A;  3AGF A;  3BFE A;  2ZQ8 A;  3L9K A;  3IX8 A;  4IVI A;  3VP4 A;  1NXY A;  3CPT A;  2X71 A;  3H82 B;  5FQI A;  4LV3 A;  4KZ9 A;  4R0Q A;  1K54 A;  5HD3 A;  3TOI A;  4YOF A;  2IWB A;  1T19 A;  4OLD A;  1K56 D;  3OLO A;  2Y2P A;  4DXC A;  2J9P A;  3PBO A;  4E3M A;  3QP5 A;  4JLF A;  1HLU P;  2JHE A;  1CI8 A;  1S4S A;  2VZW A;  3DW0 A;  4QD4 A;  1UWP X;  3ZG9 B;  5TBM B;  1OTD A;  5CXW A;  3CHW P;  3M2J A;  5A91 A;  1XKZ A;  1KGF A;  3VFF A;  1XGJ A;  3OPL A;  4FD8 A;  1NWZ A;  2J7V A;  4KUK A;  4I3I A;  4UAA A;  2VX8 A;  3PBQ A;  1E25 A;  3B42 A;  1XA7 A;  3N7W A;  1WA9 A;  1K0K A;  3FPW A;  2V0U A;  1IYP A;  2EXA A;  1ES2 A;  1W5D A;  5GLD A;  3FG8 A;  2DRW A;  3BM6 A;  4OPR A;  5EVL A;  2V1B A;  2HDQ A;  3G4P A;  1ES4 A;  4KZ8 A;  4YWZ A;  4HJ3 A;  2K2N A;  1ERO A;  1PFL A;  2FH5 A;  1XGI A;  3E4P A;  3CG5 A;  1OJ5 A;  4UQI M;  4XT2 B;  1XFQ A;  2Y2M A;  4N92 A;  3MF0 A;  4U3T A;  1ERM A;  4LRY C;  5FAQ A;  3GVB A;  4GHI B;  2G7U A;  3LI9 A;  1YMS A;  1G6A A;  4Y3I A;  1OTA A;  3IF5 A;  5DFX A;  1RCJ A;  1W7F A;  4ZJ2 A;  3IX3 A;  5FA7 A;  2EXB A;  5HDD A;  3IXB A;  2JBF A;  1Q2Q A;  3FKW A;  3UN7 A;  5FDS A;  2EX8 A;  2C5W B;  4HOI A;  2XD5 A;  1SKF A;  2ZC3 B;  3V5M A;  2WKI A;  3HRE A;  1YM1 A;  1MWT A;  5G4Z A;  3C4O A;  2OAQ 1;  1C3B A;  4S2N A;  3NDE A;  2PRF A;  5CGS A;  3A3J A;  1STZ A;  1XX2 A;  3MBZ A;  1D7E A;  4LFU A;  4E6X A;  4Z1W A;  3NDG A;  5CRF A;  3UO9 A;  2RL3 A;  3IF6 A;  2L1M A;  2I9V A;  5IHV A;  4OQH A;  5F5Y A;  3RH8 B;  1KVM A;  1OTI A;  2Z2L B;  5F6A A;  5CER A;  1P9W A;  2PU2 A;  1TS6 A;  3JVV A;  4Z9Q A;  4OQ0 A;  2WKP A;  4MMN A;  5CHJ A;  1LI0 A;  3NIA A;  4A5R A;  3UB5 P;  1TVF A;  3FPV A;  4LV2 A;  4NXB A;  3MXQ A;  4KZ4 A;  3PBS A;  4OVD A;  3ZDJ A;  1MBL A;  3EOI A;  5KZH A;  3MMH A;  4P6Z S;  3QNC A;  1BSG A;  3MKF A;  4KZ6 A;  1SCW A;  1S0W A;  3HL9 A;  5G4Y A;  4YNR A;  3IH9 A;  2WKH A;  1OPX A;  4E3N A;  3UME A;  1XJ4 A;  5DJT A;  5GHZ A;  3LIF A;  3LFV A;  1NZO A;  4PM5 A;  4OOL A;  5K5B A;  3W4Q A;  5EEC A;  2OLV A;  2RCX A;  4HP9 A;  4X55 A;  4WZ5 C;  2ZL1 B;  2VGL M;  3S7P A;  3IS2 A;  4X69 A;  1XPB A;  5HX9 A;  2Y2K A;  1O7E A;  2BTF P;  1HD8 A;  4GS9 A;  1F5M A;  1H8M A;  2PR5 A;  1G6O A;  5EM1 A;  2D02 A;  4MDZ A;  2HP9 A;  3ZVW A;  1TF1 A;  2XQZ A;  3O86 A;  4DRT A;  2Y2I A;  3TW8 A;  4IVK A;  1MC0 A;  3P09 A;  1SHV A;  4WUJ A;  3UE6 A;  3A0S A;  2Y2L A;  3G30 A;  2IWD A;  1BLP A;  3MKE A;  5J4E A;  4HP4 A;  2IA2 A;  3HLD A;  5J3W A;  2PD7 A;  4DJ3 A;  1YLP A;  3VOL A;  3FYZ A;  1I2S A;  4RA7 A;  4KQD A;  5FQ9 A;  1OT6 A;  5CED A;  4BJP A;  1K6S A;  1PYY A;  3JYI A;  3C30 A;  2XA7 M;  4R4S A;  4LCM A;  1VET A;  2WAD A;  5CEC A;  5E43 A;  1NLY A;  3BLS A;  5FI6 A;  1N9B A;  3PYP A;  1VB6 A;  2ZD8 A;  3LY4 A;  1MXO A;  3IXG A;  4DXB A;  1JWP A;  4PPR A;  4EQI A;  4NG2 A;  1L2S A;  1L0E A;  3BLM A;  3BFC A;  3CI6 A;  1TD5 A;  4NKP A;  2H28 A;  1CJF A;  4WZ5 A;  2Y8H A;  2K31 A;  3MSH A;  3DAV A;  4L0L A;  2B95 A;  1J9M A;  1DJB A;  1IEM A;  4GW9 A;  3CUE C;  1E3U A;  2W3E A;  3QP1 A;  3LR5 A;  5F68 A;  1Z6F A;  3MZF A;  2JKR M;  1TEM A;  3A3E A;  4EU0 A;  2QZ6 A;  5J7E A;  1DP9 A;  4RVA A;  3E4Q A;  2GZA A;  5A8B A;  4S2J A;  4IBR A;  1WYC A;  4OP5 A;  4CPK A;  4YIN A;  1XJ2 A;  2WAF A;  1K55 C;  1ESI A;  1U60 A;  2Z6D A;  4QB8 A;  1ODV A;  4NXE A;  2HZ5 A;  1XJ6 A;  5HWW A;  1KDS A;  3Q7V A;  1IYO A;  3UB8 A;  4QWO A;  1N9L A;  1PW1 A;  1IYQ A;  4BWI A;  5IT5 A;  2XFT A;  1G28 A;  4OOY A;  3T4K A;  4IBX A;  4DMZ A;  4K0W A;  1X0O A;  4PM9 A;  3OCN A;  5HL6 A;  4BEN A;  3WS5 A;  3F1P A;  4MN5 A;  1YSQ A;  4GDN A;  1FSY A;  5M1A A;  5FAT A;  3ZG0 A;  2BLS A;  1CQA A;  5DF7 A;  3HLC A;  4E3O A;  5KMW A;  3HBR A;  2LB9 A;  3S7O A;  3W4P A;  3KSI A;  4S2O A;  2VV6 A;  4X6T A;  2OWH A;  4HBT A;  3N8S A;  4FH4 A;  1LT0 A;  5HSQ A;  4BBT A;  1XJ3 A;  4G3K A;  2OOL A;  2W1R A;  2H0T A;  1EI5 A;  4ZTK A;  4GZB A;  5DFY A;  2PAV P;  4Y17 A;  3UDI A;  1F2K A;  4C6Y A;  4DKI A;  2W1T B;  4OLG A;  1E3U D;  4Q0J A;  3KSG A;  4EET B;  1MY8 A;  4CLC A;  4KUO A;  4KZB A;  3G34 A;  5F83 A;  3OPH A;  4X1M A;  4E3L A;  2PHY A;  5DKK A;  4UEY A;  4G3V A;  4EES A;  4DDS A;  5D3O A;  2ZC7 A;  3HJK A;  4H6J B;  2EFU A;  2ZC4 B;  3ZVT A;  3VP1 A;  1S66 L;  2ZM2 A;  1FQG A;  3R7W A;  3A3F A;  3VV4 A;  4GN2 A;  3BQA A;  4S2L A;  4QY6 A;  4R3J A;  4ZAM A;  3LR4 A;  4BLM A;  3WS2 A;  2XF3 A;  4DJ2 A;  2Q9N A;  3F1N B;  2BAS A;  3QP6 A;  3IQA A;  2JKF A;  4Y0U A;  4MBH A;  4ESP A;  2Y79 A;  3MXR A;  4LEN A;  3UE3 A;  1YLT A;  3UE0 A;  3G2Y A;  5CEB A;  2KLI A;  1TDL A;  2O9A A;  5DTK A;  5HPF A;  5EUA A;  4JXG A;  5GHY A;  4G3W A;  1YT4 A;  3CZD A;  3P98 A;  3T1X A;  1HTZ A;  1V9Y A;  3CAX A;  3FZC A;  4PMA A;  5FQM A;  1I5Q A;  3ZQ5 A;  4MLL A;  3WRZ A;  3ICY A;  3H7W B;  1DY6 A;  1K57 C;  4FCF A;  2EX6 A;  2I72 A;  2Y2J A;  5HPI A;  3SH8 A;  3F1O B;  1YAX A;  2AVX A;  3EWK A;  3LUQ A;  1SZV A;  2WGW B;  1WYB A;  1SKO A;  2B18 A;  2UV0 E;  2V8C A;  3V3S A;  2OWJ A;  1MWU A;  4CLC D;  1QME A;  5L07 A;  1FR1 A;  5EFW A;  3C5A A;  3DBA A;  3N4I A;  3UPP A;  2M1C A;  4CLC E;  2WKE A;  2WGI A;  2UWX A;  3VFH A;  3ZCZ A;  2GNX A;  3PTE A;  3TE8 A;  2EX2 A;  3T4Q A;  3IHA A;  4GB7 A;  5CTN A;  1FCO A;  4DE0 A;  4K08 A;  4OQG A;  4FSF A;  1K4E A;  4DN0 A;  1T18 A;  2Y59 A;  3T12 B;  4QPR A;  1J3W A;  3HJI A;  1YKD A;  1K57 A;  3NHQ A;  4R1G A;  1P9R A;  4I38 A;  4I39 A;  4R3B A;  2CC1 A;  2XD1 A;  1NRJ A;  3BQ8 A;  3LR3 A;  3OPP A;  2ZM8 A;  2V1A A;  5AQA A;  4GD6 A;  3M6H A;  4HY8 A;  2VK3 A;  2XK1 A;  3H82 A;  4U0X A;  5GHX A;  2J3W A;  4Y5F A;  1ERQ A;  3GDI A;  1IYS A;  3DTE A;  3A3I A;  4O0P A;  1GSV A;  1NYM A;  4QHC A;  1HVB A;  2Y91 A;  4KZA A;  2Y4A A;  4JXV A;  5DJU A;  2WZX A;  3ITA A;  5EOO A;  1NJ4 A;  1OJG A;  5EVI C;  2PBD P;  2Y2N A;  5I5L A;  2VGL S;  5AQB A;  4E04 A;  5FEF A;  1F9I A;  1FOF A;  4BMW A;  2Y55 A;  5DTS A;  5TBM A;  4EWF A;  2Y2Q A;  4E3K A;  1LHY A;  2R78 A;  4LCL A;  3A0V A;  3MQ0 A;  4Y0T A;  4X1L A;  1PWC A;  1GHM A;  3VMA A;  3BEB A;  1P97 A;  5EVI B;  1E4D A;  2M7U A;  4ETZ A;  1PZP A;  3UE1 A;  2V2F F;  4NEE D;  1NZU A;  2B5R A;  1XA1 A;  4Q8I A;  4ETX A;  3VOY A;  3NJA A;  5L09 A;  4E3J A;  3Q7Z A;  1KGE A;  3IF6 B;  3KSH A;  2XA7 S;  1KVL A;  5EE8 A;  3OC2 A;  4BBU A;  3T1S A;  5HWV A;  1VHM A;  2KDK A;  2QMI A;  4XT2 A;  2WKQ A;  4ARZ B;  1DRM A;  4UA6 A;  2P08 A;  2X01 A;  1H8Y A;  2ZBB A;  4JKT A;  2JKT M;  5FDH A;  2JE5 A;  4GHI A;  1K38 A;  3HLB A;  5G18 A;  5FSR A;  4OON A;  1CEF A;  3IXD A;  2OLU A;  3LYX A;  4EEU A;  2W3H A;  2JKT I;  1S67 L;  4XXR A;  3LIA A; 
#chains in the Genus database with same CATH homology
 2Y8H A;  3EGX C;  4ZRR A;  3CIT A;  4NXF A;  4L9E A;  2K31 A;  3MR0 A;  4IUK A;  2HJ9 C;  3O5Y A;  4HJ4 A;  4L0L A;  1Y28 A;  3GEC A;  4GW9 A;  3CUE C;  4O01 A;  4HQA A;  2W3E A;  3LR5 A;  5F68 A;  1T1B A;  4O8G A;  3MJQ A;  2HV1 A;  1N9N A;  2JKR M;  4EU0 A;  2PYP A;  5J7E A;  2MJ6 A;  5FL3 A;  1DP9 A;  3T4O A;  3LIB A;  3E4Q A;  3S7Q A;  4BBV A;  2GZA A;  5A8B A;  4PHT A;  4RQ9 A;  5IS1 A;  1H3Q A;  1XJ2 A;  4IUH A;  3D72 A;  2Z6D A;  1ODV A;  4I3A A;  4NXE A;  3KX0 X;  1XJ6 A;  3A0R A;  3K3C A;  5HWW A;  2VA0 A;  3RFB A;  2PT7 A;  4ME4 A;  3U2A A;  3FC7 A;  2XSS A;  4CQH A;  3KYQ A;  2OAP 1;  1IFQ A;  2V9A A;  3UB8 A;  1DP8 A;  2W3G A;  1P0Z A;  2W27 A;  4PKY A;  1N9L A;  2A2L A;  4BWI A;  2J80 A;  3RTY A;  2O9C A;  5IT5 A;  1G28 A;  4I3J A;  3VE3 A;  1IOU A;  2WKR A;  3T4K A;  4DMZ A;  2XRO A;  3TRC A;  1X0O A;  3SW1 A;  2HJE A;  3CWF A;  5L8M A;  3C2W A;  3OCN A;  5HL6 A;  2XRN A;  4I5S A;  3EQV A;  3PR6 A;  3F1P A;  4MN5 A;  1YSQ A;  4EQ1 A;  5AVE A;  2L4R A;  1KOU A;  1OTE A;  4WLA A;  1BYW A;  4HH3 A;  4LPZ A;  4Q0H A;  1N9O A;  4GJ4 A;  2Z6C A;  3LI8 A;  3E98 A;  5KSH A;  3KO6 A;  4HIA A;  2LB9 A;  2VV8 A;  3S7O A;  3KSI A;  4R38 A;  3K2N A;  2VV6 A;  3KYZ A;  2OWH A;  2J3T D;  3NOT C;  5KIZ A;  2PYR A;  1LT0 A;  5HSQ A;  1DP6 A;  4BBT A;  3MQO A;  2NUP C;  4JGP A;  4GLQ A;  3ZYT A;  3HCY A;  3LR0 A;  1XJ3 A;  1ZHH B;  3T4L A;  4G3K A;  4EW7 A;  2OOL A;  2W1R A;  2O99 A;  3P01 A;  2VEA A;  3PXP A;  4EEP A;  1UGU A;  2P04 A;  5DFY A;  1GSW A;  2YKF A;  4WEJ A;  1NLZ A;  1F98 A;  2O9B A;  4MN7 A;  2W1T B;  3UB6 A;  3H82 B;  4Q0J A;  3KSG A;  4EET B;  1OTB A;  3R4K A;  4CLC A;  4KUO A;  2B02 A;  1LL8 A;  3LIE A;  2PHY A;  5DKK A;  5HD3 A;  2W3F A;  2CMN A;  2VJW A;  4UEY A;  4YOF A;  1YSP A;  2INW A;  1TS7 A;  4G3V A;  1T19 A;  2QYB A;  4EES A;  3PBN A;  3E0Y A;  3HJK A;  4H6J B;  2O0Y A;  1TD5 A;  3OLO A;  4LRX C;  3T50 A;  1S66 L;  3R7W A;  3NOU C;  3VV4 A;  3T4J A;  3BQA A;  4IHQ A;  3PBO A;  3LR4 A;  2JHE A;  2DMW A;  4DJ2 A;  5TJJ A;  3LID A;  1S4S A;  2VZW A;  3F1N B;  2BAS A;  4JGO A;  1UWP X;  5TBM B;  4HNB A;  3E4O A;  1OTD A;  2Y79 A;  3MQQ A;  4KQO A;  2HF6 A;  4ARZ A;  3UE3 A;  5CX7 A;  3IS2 B;  2A24 B;  5C5K A;  2KLI A;  1NWZ A;  2O9A A;  3EEH A;  5HPF A;  4MN6 A;  4KUK A;  3JVU A;  4I3I A;  2LB5 A;  4OOM A;  3V67 A;  5HZH A;  4G3W A;  2VX8 A;  3PBQ A;  3B42 A;  2VKS A;  5DKL A;  4GS9 B;  2K7S A;  4IJG A;  1V9Y A;  3CAX A;  4EXO A;  2KOI A;  1WA9 A;  4Y2F A;  3FPW A;  2V0U A;  3EEA A;  4R3A A;  2PR6 A;  3FG8 A;  5HD5 A;  2M7V A;  4P6Z M;  2V1B A;  3ZQ5 A;  2QWS A;  3ICY A;  4YWZ A;  4HJ3 A;  3H7W B;  2K2N A;  3MFX A;  2FH5 A;  3G6O A;  3E4P A;  4EER A;  1OJ5 A;  2NUT C;  3OOV A;  5HPI A;  3F1O B;  1YAX A;  3EWK A;  3LUQ A;  4UQI M;  4R70 A;  3UB9 A;  2ZMV A;  2FZ0 A;  3B47 A;  4XT2 B;  1XFQ A;  4MCW A;  2KX6 A;  3MF0 A;  3T4S A;  4AFI A;  4LRY C;  2B18 A;  3CUE A;  4GHI B;  3IBR A;  2G7U A;  2QJ7 A;  3LI9 A;  5F69 A;  2OWJ A;  5DF9 A;  1OT9 A;  4CLC D;  1EW0 A;  4Y3I A;  5LBR A;  1OTA A;  4Q0I A;  5DFX A;  4HH2 A;  4II7 A;  5EFW A;  4F3L B;  3EGD C;  3DBA A;  5HDD A;  4WF0 A;  3NOP C;  2M1C A;  4CLC E;  4LLO B;  3K3D A;  3S7N A;  1MZU A;  4HOI A;  1S4R A;  4JGR A;  2GNX A;  4EUV A;  1LSV A;  3BW6 A;  3TE8 A;  4WN5 A;  2EA9 A;  5G4Z A;  2W0N A;  3T4Q A;  1W63 Q;  4B9O A;  2OAQ 1;  2EWW A;  1S1Z A;  4K08 A;  4L9G A;  1STZ A;  4B93 A;  4FSF A;  4JGQ A;  4DN0 A;  2PD8 A;  1T18 A;  1D7E A;  3PBR A;  5HWT A;  4Z1W A;  4QPR A;  3HJI A;  1YKD A;  2L0W A;  3UMD A;  1UWN X;  2HGV A;  3NHQ A;  1P9R A;  3W2Z A;  4I38 A;  4HJ6 A;  4I39 A;  2L1M A;  4R6L A;  4WEL A;  1TS8 A;  2I9V A;  2QJ5 A;  1NRJ A;  5F5Y A;  3RH8 B;  1OTI A;  3BQ8 A;  1W63 M;  5F6A A;  3LR3 A;  1P9W A;  1TS6 A;  2V1A A;  3JVV A;  3TJZ C;  2WKP A;  4MMN A;  3KSF A;  4HY8 A;  2W1T A;  3FPV A;  5HDC A;  3H82 A;  4NXB A;  3MXQ A;  3PBS A;  4WL9 A;  2J3W A;  4Y5F A;  1D06 A;  3F1P B;  3EOI A;  1ZTU A;  4HI4 A;  3GDI A;  3MMH A;  4P6Z S;  2GJ3 A;  4O0P A;  1GSV A;  5G4Y A;  4H6J A;  4YNR A;  3D3O A;  3P7N A;  2JKR I;  2QHK A;  2YKH A;  1OPX A;  5DJU A;  2J3T C;  3UME A;  1XJ4 A;  1OJG A;  1GSX A;  2V0W A;  4UQI S;  5DJT A;  3LIF A;  5I5L A;  3LFV A;  4CLC C;  2VGL S;  4E04 A;  3F1N A;  4PAU A;  1F9I A;  4OOL A;  5K5B A;  4BMW A;  1T1C A;  5TBM A;  4HP9 A;  1LSX A;  1XFN A;  5IU1 A;  2ZMF A;  3BY8 A;  2VGL M;  1V9Z A;  3S7P A;  3IS2 A;  2A24 A;  2R78 A;  3A0V A;  3MQ0 A;  4GCZ A;  2QKP A;  2PDR A;  1P97 A;  2GX5 A;  3VE4 A;  3BWL A;  4CLC B;  2D01 A;  5HDS A;  3C8C A;  4GS9 A;  2M7U A;  1F5M A;  3CLO A;  4ETZ A;  1H8M A;  2PR5 A;  1G6O A;  2D02 A;  4MDZ A;  1TF1 A;  1T1A A;  1LSW A;  4NEE D;  2VLG A;  3TW8 A;  3UB7 A;  2ZOH A;  3PHY A;  4ETX A;  1MC0 A;  4WEK A;  2VV7 A;  3NJA A;  4LRZ E;  4WUJ A;  3LIC A;  3A0S A;  3R7W B;  3UE6 A;  3H7W A;  5J4E A;  4HP4 A;  2IA2 A;  5J3W A;  2PD7 A;  2P7J A;  3EQU A;  3T4T A;  3F1O A;  3KSH A;  2XA7 S;  4FOF A;  4DJ3 A;  3OC2 A;  3VOL A;  4BBU A;  3H9W A;  3OBF A;  2ZOI A;  4HHD A;  4KQD A;  1VHM A;  2KDK A;  5HWV A;  3PBT A;  1OT6 A;  3B33 A;  4XT2 A;  5AVF A;  1MKM A;  3ULF A;  4BJP A;  1JNU A;  2WKQ A;  4ARZ B;  1DRM A;  3IBJ A;  2JN7 A;  2P08 A;  2XA7 M;  3C30 A;  4PKY G;  4L9F A;  2ZBB A;  3BY9 A;  1S1Y A;  4M4X A;  2JKT M;  3OCL A;  5AJG A;  1NLY A;  4GHI A;  3PYP A;  1VB6 A;  4EEU A;  3LYX A;  2W3H A;  2EWV A;  4NXG A;  3C38 A;  5MC7 A;  3BJN A;  2JKT I;  2W3D A;  1TS0 A;  1S67 L;  4F3L A;  3CI6 A;  3LIA A;  4NKP A;  2H28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...