4DJ2A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
307
structure length
276
Chain Sequence
DMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTEKSVFCRIRGGRYQPFRLTPYVTKIRVAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPDSDIQELSEQIHRLLLQPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Period circadian protein homolog 1
total genus 67
structure length 276
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj2A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj2A02
3F1NA 2L0WA 4EERA 4H6JA 1VB6A 3F1PA 4WL9A 2ZOIA 5HD5A 1LL8A 4NXFA 2H28A 4KUOA 3LI9A 5HDCA 3GECA 4DJ2A 2PD8A 2VV7A 1JNUA 4GS9A 2V9AA 1NWZA 1LT0A 1XJ3A 3EWKA 5KIZA 1EW0A 4RQ9A 2YKHA 4R38A 3NOUC 2R78A 4HJ3A 3OLOA 2GJ3A 1P0ZA 1XFQA 1KOUA 1V9ZA 1Y28A 2J80A 5HDDA 3MJQA 1DRMA 3A0VA 4GHIB 2PHYA 2WKQA 4JGPA 2VV6A 3LIBA 4I3AA 4F3LB 1GSXA 2QJ7A 3SW1A 1D7EA 5HWWA 4B9OA 1TS6A 3A0SA 2L1MA 1OTIA 3LI8A 3LIDA 5DKLA 4BBVA 4DJ3A 1DP9A 1F98A 3VE3A 2QKPA 3G6OA 4I39A 4EQ1A 3MFXA 1OTEA 2OWHA 2A24B 1TS0A 3B33A 1N9NA 5DJUA 1T1BA 3H9WA 4HY8A 4KUKA 3C2WA 3BY8A 5J4EA 4XT2B 1G28A 2Z6CA 5IS1A 1GSVA 3FG8A 1X0OA 2V0UA 3BWLA 4HI4A 1T19A 1F9IA 3GDIA 4GCZA 1UGUA 3MQOA 5TBMB 3VE4A 5G4YA 5AVEA 2PYPA 2VV8A 4NXBA 1LSVA 1S67L 2INWA 1LSXA 4PKYA 1WA9A 2YKFA 4HNBA 3D72A 4MN6A 2W27A 3T50A 4JGQA 5AVFA 3NOPC 4E04A 1XFNA 4LRZE 5I5LA 3MR0A 5EFWA 2A24A 3LIAA 4LPZA 1OT6A 2B02A 1TS7A 3IS2A 1P97A 4LRXC 5F6AA 4YWZA 5HZHA 4EW7A 1T18A 4R6LA 4I5SA 1BYWA 4I38A 3UB9A 5IU1A 3LICA 3UE6A 1OTDA 4BBTA 2V1AA 4HP9A 2VLGA 3K3CA 4MN5A 3HJIA 4R3AA 3HJKA 3H7WA 4WN5A 2K7SA 4HH3A 2M1CA 5HSQA 4GW9A 2L4RA 2W0NA 5A8BA 3IBRA 5DJTA 4JGOA 3F1PB 3LIEA 3LYXA 2JN7A 3MXQA 3UB7A 3ZQ5A 2QHKA 2I9VA 3H82B 3UB6A 2BASA 2PD7A 4EEPA 2CMNA 4NXEA 2D02A 4KQDA 4XT2A 4F3LA 1N9OA 2QJ5A 3UB8A 2P7JA 3E4PA 1T1AA 2QWSA 3NHQA 4LLOB 2KX6A 3H82A 1LSWA 2EA9A 5TBMA 3UMEA 1S4RA 1OTBA 1V9YA 1MZUA 2D01A 2PR6A 4L9GA 3VOLA 4L9FA 2WKPA 4I3IA 5G4ZA 1N9LA 1XJ2A 2Z6DA 4I3JA 4HIAA 5HDSA 4HH2A 4HJ4A 2PDRA 4WF0A 3CAXA 1ODVA 3PHYA 1S1YA 5F5YA 2JHEA 5HWTA 2V1BA 5J3WA 3UMDA 4HP4A 1S4SA 1D06A 2KDKA 4HHDA 2OWJA 3CLOA 4M4XA 3RTYA 1OJ5A 2ZBBA 2ZOHA 4JGRA 4NXGA 3NOTC 4EXOA 3A0RA 3E4QA 4GHIA 4R70A 3F1NB 3ICYA 4EESA 1TS8A 1OT9A 4BBUA 4HQAA 3H7WB 3F1OA 1OJGA 2V0WA 3LUQA 2PR5A 1T1CA 3KX0X 1XJ4A 3PYPA 3RH8B 4GS9B 3ULFA 5J7EA 3IS2B 3LIFA 5HWVA 3P7NA 3FC7A 4HJ6A 3F1OB 1XJ6A 1S1ZA 4EETB 3BY9A 4L9EA 1DP8A 1GSWA 1OTAA 3CWFA 3NJAA 4K08A 2OOLA 1UWNX 3MQQA 3EEHA 4PKYG 2HV1A 4WUJA 5HD3A 1S66L 2VEAA 1DP6A 3C8CA 4H6JB 5F68A 5DKKA 4LRYC 4EEUA 3K3DA 5F69A 4WLAA 3E4OA 2PYRA 4HOIA 2WKRA 1UWPX
chains in the Genus database with same CATH superfamily
1JTDA 3GR2A 1PZPA 1RGZA 3UB5P 1ZG4A 5KIZA 1PIOA 4Y0TA 2WKEA 5E2GA 4HJ3A 4P87A 2GJ3A 1TDLA 1XFQA 4U0TA 2ZLYA 4KG5A 4WZ5C 4PM6A 3WS5A 3ZNTA 2GZAA 3G35A 3AGFA 4KUKA 5J4EA 3IX4A 1WYBA 1X0OA 4S2IA 1GA9A 4KZ3A 2E8JA 2EXAA 3IWQA 2PRFA 4KZBA 4O0PA 1VHMA 1S6RA 4DN0A 1JWVA 5I5LA 2HPBA 3MR0A 3NCKA 4DDYA 4N1HA 3PBQA 5AJGA 5FA7A 3IWOA 3VP2A 3LICA 1OTDA 4R1GA 1ZKJA 3O87A 2QMIA 2R9WA 2L4RA 1KDSA 3MSHA 1L2SA 4EQIA 3D4FA 4R0QA 2QHKA 3Q7VB 3BW6A 5D3OA 1IFQA 2P7JA 1T1AA 3E4PA 2PR6A 3AGDA 3T4JA 1RCJA 3KSFA 3MZFA 4WYYA 3M6HA 3GV9A 5CERA 2OWJA 1HTZA 4Z1WA 2P9VA 3BFDA 4IBRA 4R70A 3A3JA 1AWIA 4ZJ2A 2O9CA 3ULFA 4CLCC 3TOIA 1LLBA 3NJAA 3DTKA 3LR4A 3E4OA 1U60A 3F1PA 2JKRI 4DDSA 4WEKA 1ES5A 1EW0A 1MWSA 1G5UA 1NRJA 2XFTA 5FI2A 3WWXA 5E2HA 1DRMA 3LEZA 2VV6A 2ZMVA 3VFFA 4DJ3A 1D1JA 2V8FA 5K5BA 3MMHA 3S22A 1N9NA 3HREA 1G28A 2V0UA 1F9IA 3O3VA 2VV8A 2XA7S 4WMCA 4OPZA 2P74A 4GD8A 4FD8A 1HVBA 3OPPA 5FEFA 3T1SA 3NY4A 2XGNA 4S2JA 4YWZA 4UA6A 5EVLA 4A5RA 4HH3A 3BFCA 3F1PB 3MXQA 1HLUP 4K0WA 4S2MA 4KQDA 2X02A 4RX3A 1V9YA 3MBZA 4P6ZS 3IXBA 4EUVA 5HDSA 4DF6A 1ODVA 1S1YA 2J7VA 3QP2A 2JKTI 2QYBA 1CEFA 2J8YA 3E98A 5FQQA 5GHXA 4ZBEA 4DE2A 3ICYA 1CK3A 1GCEA 3IXGA 1NXYA 2EFUA 3HL9A 5HWVA 3GRJA 4JXVA 3N7WA 4P85A 1E25A 3ITAA 1XKZA 4K08A 4Q0IA 5DKKA 2VJWA 1RP5A 2M7VA 1Z09A 2A49A 3G2YA 3VSKA 1FOFA 2XDMA 5EV0A 4UQIS 1MWUA 1O07A 3A3IA 5AQ7A 2HP6A 4BMWA 4XXRA 4ZJ3A 3M6BA 1K54A 2C5WB 2DNSA 3A0SA 3MF0A 4BBVA 3VE3A 1IOUA 3DTEA 5GL9A 3FG8A 3MFDA 5DFXA 1MY8A 3DTMA 5TBMB 3U2AA 1CI9A 3W8KA 1FIKA 3IT9A 2W3GA 4KZ7A 2ZQAA 4WBGA 4UA9A 1TF1A 4B4XA 5IT5A 2OV5A 4YOFA 4LPZA 4I5SA 1BYWA 2DCFA 2EFXA 4LV0A 4OPRA 3AGEA 2OLVA 4CLCD 5FQ9A 4NXEA 4XT2A 2OAQ1 2QWSA 2PT7A 2KX6A 2ZC5B 1LSWA 3KYQA 2WKPA 2I72A 2X01A 3BJNA 3QHYA 5EOOA 2A3UA 3T1XA 3CLOA 1KDWA 1Y54A 5A90A 1MWRA 3WS4A 2P04A 4JXWA 4OQHA 3NOTC 2Z2MB 2J3WA 5TGFA 2JKFA 1TS8A 1A0KA 5L10A 1STZA 3LIFA 4IVKA 2ZD8A 2EX6A 2HDQA 3MQQA 3EEHA 2XRNA 4EEUA 1KE4A 3CHWP 3LY3A 4WL9A 2ZC6B 1YT4A 3DTIA 2V9AA 4GS9A 5EE8A 4ZRRA 4LCLA 4R38A 1YKDA 3T12B 2OSUA 4Y2FA 4YNRA 5HDDA 1C3BA 4I3AA 1J3WA 3UNWA 2QKPA 2PU2A 5CRFA 4EQ1A 2J9PA 2ZL1B 3ZYTA 2BLSA 3Q7VA 3OC2A 1NLYA 3HUMA 3O5YA 4CLCA 5EVID 3MQ0A 3GDIA 3IHBA 3ZCZA 1KE3A 4LGWA 4GD6A 2WAFA 1IEMA 2WGWA 3N6IA 1PW8A 4QJGA 3HJKA 4DE3A 4KG2A 5L07A 4S2NA 3B42A 1YPRA 3OPRA 4WZ5A 1HZOA 4OPQA 3CMZA 3WRZA 2Z6DA 4NKPA 1CQAA 3IHAA 3EGXC 4Y13A 4BL3A 5JYOA 1QMEA 4P6ZM 1XP4A 4NXGA 4E6WA 5JYPA 1K57A 1YQSA 4EBNA 4EV4A 3F1OA 1NJ4A 3KX0X 3IS2B 4QY6A 3HLEA 4QB8A 4HJ6A 4L9EA 2ACGA 4WLAA 3QNCA 4GJ4A 4H6JA 3E2LA 5EUAA 5KSHA 1YLTA 4Q8IA 4E6XA 1KOUA 3SZTA 4PM5A 3MJQA 5AQ9A 5J7EA 2PHYA 2V20A 3IQAA 1K4FA 1XA7A 4ARZB 2L1MA 1ALQA 4DMZA 3LR0A 1BLHA 4G3KA 2IWCA 2W3FA 2DMWA 1FQGA 3C2WA 4BL2A 4FH4A 1GSVA 5L8MA 3Q7ZA 1K56A 2VGJA 4F94A 1ACFA 3TW8A 2HJEA 4NXBA 1EROA 4OQGA 3RFBA 2YKFA 2HF6A 4RA7A 4ZDXA 3Q07A 5CHJA 5J8XA 4OLDA 5CTNA 3UB9A 3FKWA 3UE6A 4IJGA 4MN5A 2LB9A 2EWWA 3MKFA 5CHUA 2Y2KA 3BFFA 3H82A 3UE3A 1ONHA 4JF6A 3VFHA 5G4ZA 4E3MA 1XJ2A 2GX5A 2UWXA 1WYCA 2WADA 5F5YA 3ZG7B 5J3WA 4MBKA 1QMFA 5HFOA 3MZEA 1KVMA 3A0RA 3E4QA 2Y2HA 3F1NB 4Y0UA 2XD1A 2K2NA 3VP0A 5M19A 2Y2LA 1DP6A 2HP9A 3CZDA 4LRYC 3NOUC 2PYRA 3ZG8B 2VV7A 4JF4A 1SZVA 1P0ZA 3ZVWA 3A0VA 3W4OA 3S7QA 3EEAA 4MEZA 3BFGA 1FCMA 3MFXA 3N4IA 1I2WA 3BY8A 2W3HA 5IS1A 5DF8A 1K6RA 4E3JA 3KSIA 1T19A 3EGDC 1W8YA 2Y2PA 1FCNA 3VP4A 1LSVA 4ARZA 1PNEA 3D72A 4E04A 4LV1A 3LCEA 4LRZE 2G2WA 4P6BA 2Y8HA 5HZHA 1T18A 4Z9QA 3CI6A 4I38A 1YLWA 4O7DA 5CTMA 4GLQA 4HP9A 3K3CA 3KO6A 3H7WA 2K7SA 4CQHA 1JWPA 4GW9A 1ERMA 2UV0E 4KZAA 1JWZA 2PD7A 3G4PA 2D02A 3FKVA 4KZ9A 3HLFA 3KYZA 2H5SA 1FR1A 1YMSA 1N9LA 1ONGA 3CJMA 3WS2A 3HUNA 1N9BA 1XGIA 4LV3A 2PDRA 3UMDA 4HHDA 4M4XA 1XX2A 3UPPA 3BQ8A 4BD0A 4G3WA 1Q2QA 3IXHA 5EPHA 3PBTA 4HQAA 4UA7A 3LEQA 3T4SA 4FCFA 3KYEA 1S1ZA 3T4OA 3CWFA 5HD3A 5FQKA 3P98A 2L0WA 1L0GA 1LL8A 4GOGA 2Y2JA 1XJ3A 1O7EA 1LL9A 4EWFA 2XH9A 4NEED 5CXWA 4UHUA 3LIBA 1BUEA 3IF6B 2QJ7A 4FUWA 4HBUA 4DE1A 2FH5A 3NIAA 4BENA 1PI4A 3Q82A 2FFYA 1ZHHB 3S4XA 3BWLA 1SDNA 4GCZA 1H8MA 2Y2GA 2PYPA 2INWA 4LFUA 3MXSA 1ZG6A 4WM9A 1PW1A 5A91A 4X1MA 2AVXA 4CPKA 1NYMA 4IHQA 5HPFA 4E3LA 1E3UA 3OBFA 4R3AA 3V5MA 2W0NA 1NLZA 4EEPA 3DBAA 2Y2QA 4WZ4A 5CECA 2GDNA 2H10A 4DXBA 3G2ZA 4L9FA 5FEGA 2VKSA 4O01A 3LGOA 4QY5A 1S4SA 2ZOHA 2ZBBA 4FOFA 5CEBA 3UO9A 4QD4A 2JBFA 4ZAMA 4E3NA 1K56D 4OQIA 1Q2PA 2V0WA 4JBFA 4MNRA 1T1CA 4OP8A 1YSPA 5DF9A 2XEPA 3WS1A 3NC8A 3QP6A 1UWNX 4KZ4A 2HV1A 2XLNA 5EVIA 1Y4OA 4FTXA 4C3QA 3LO7A 5GLDA 1TD5A 5TJJA 1L0EA 4U0XA 2H28A 5HDCA 3KSHA 2Y59A 4OQ0A 4AFIA 3CUEC 2R78A 2OAP1 4OPYA 3TE8A 4F3LB 1G68A 3W2ZA 4GKUA 4BQMA 1K55A 2O99A 4Y0OA 1L3LA 4R23A 2WGVA 5G4YA 2C6WB 1LSXA 4OKPA 2W27A 2BG1A 3HBRA 3RJUA 5A93A 1RGYA 4N9LA 2Z2LB 3IS2A 4DKIA 4R6LA 1BULA 3CPTB 2XR0A 1H0MA 4BBTA 2V1AA 5FSRA 1BT5A 1H8ZA 3OCNA 4GDNA 3BLSA 4JXGA 4GZBA 1K4EA 1BLCA 3UB6A 2ZM0A 5DTKA 5CEDA 3OPLA 4Y17A 3T4QA 3GSGA 1SKFA 4LLOB 1FCOA 3D3OA 4MBFA 1ZTUA 4HH2A 4IEDA 3PHYA 2Y55A 5HWTA 1PWDA 2WAEA 3UDXA 5GHZA 1BSGA 3BECA 2CC1A 2R9XA 2XSSA 4GN2A 4JF5A 3R4KA 3PYPA 3UDIA 5L2FA 3T1QB 1XJ6A 1DP8A 1OMEA 2ZM8A 2PBYA 3C5AA 3A3DA 3TG9A 1GA0A 2XF3A 5F1FA 5E2FA 1MPLA 1NWZA 1ES2A 4JGPA 4RYEA 4KZ5A 2ZQ9A 1PI5A 3LIDA 5KSCA 1F98A 4LV2A 1OTEA 2A24B 2WZXA 4B4ZA 4RX2A 4Q0JA 1PZOA 4QHCA 4NK3A 5FL3A 1Z6FA 3KSGA 1FR6A 2JKTM 3UE1A 3DAVA 3BFEA 4EU0A 1XFNA 1EI5A 3MXRA 5DFYA 4K0XA 2G2UA 2XA7M 3P09A 3T4KA 2W3DA 3T1RA 3LYXA 2HDUA 5DVAA 4PHTA 4ZJ1A 1EWZA 3N8LA 3IF6A 3UB8A 4BLMA 3VOLA 4X6TA 5HAIA 2ZC7A 4Y3IA 1TEMA 5FASA 4B93A 4Y7PA 2B5RA 1OT9A 4D60A 4GS9B 3F1OB 2ZQ7A 4PKYG 4WUJA 4MDZA 1H3QA 4S2NC 1DJCA 4HOIA 5EECA 1YSQA 1KGGA 3V3SA 4OOLA 3EQUA 1ZC2A 4ETZA 1Y28A 4E3KA 1W5DA 3QP1A 1LL5A 4GHIB 4S2PA 3LY4A 1CEGA 5HWWA 4B9OA 1SCWA 2EX2A 3QNBA 3CG5A 3WS0A 3V67A 3K2NA 1TS0A 4X55A 2JE5A 3LR5A 1JTGA 2XQZA 3FZCA 2Y2MA 1BZAA 1TS7A 5F6AA 5HL1A 2WKIA 4G3VA 3R7WB 4L0LA 2WKHA 1I5QA 1NYYA 5G18A 2IWBA 4F3LA 1SKOA 1N9OA 2PBDP 3NHQA 5EVIB 5TBMA 1S4RA 5FAPA 3SOIA 1K25A 2B18A 2Y2IA 3N8RA 4KG6A 5FAQA 3IH8A 3PBRA 1W63M 5M18A 1W7FA 3C30A 4LCMA 5FI7A 3C4OA 4EESA 4BBUA 5DTTA 2PR5A 1XJ4A 4N92A 1MKIA 1PFLA 3RXXA 1YMXA 4O8GA 4DXCA 3CPTA 1W63Q 3EOIA 3B3XA 3LI9A 3OOVA 3GECA 2PD8A 1LT0A 4RQ9A 3CUEA 4FSFA 4BWIA 1GHMA 1GSXA 1P9RA 4PM7A 5DKLA 4UAAA 4HESA 2HDSA 1DJBA 2OWHA 2EXBA 1T1BA 3S7OA 2EWVA 1SHVA 1VETB 4UEYA 3JYIA 4HEFA 1FSYA 5HAPA 1S0WA 1W79A 2XD5A 3HLWA 3S1YA 1WA9A 4MN6A 2BTFP 2O9BA 3ZG9B 1YLJA 2EX8A 1MC0A 1OT6A 1P97A 2Q9MA 2VA0A 3WRTA 3B47A 3GTCA 3VV4A 3O88A 3UE0A 4JXSA 4KQOA 4HBTA 4MBHA 2V2FF 4E3IA 3GMWA 3DWZA 5EVIC 2EX9A 5CX7A 2QPNA 1FILA 2E8IA 2ZQCA 2WGWB 4JPMA 1MKMA 3JVUA 3OCLA 3LR3A 3IWIA 4PMAA 4C75A 4H8RA 1XPBA 3D9YA 3RTYA 3V3RA 3C7VA 4II7A 3BM6A 2KOIA 5E2EA 3LUQA 2WGIA 5F82A 5GLBA 5U47A 3EQVA 2JCHA 3C8CA 4X69A 5FI6A 1YLPA 4WEJA 4KUOA 5F83A 3SS3A 4JKTA 4RVAA 2YKHA 2W1RA 1AXBA 2WK0A 5F1GA 1SDEA 1TS6A 4IBXA 2DRWA 3MKEA 3G6OA 2FZ0A 1JVJA 2H0TA 2Z6CA 3HCYA 2RCXA 3BRMA 1XXMA 4Y15A 1G6AA 2Y91A 3NULA 1GHPA 1GHIA 5TR7A 1KVLA 4OOYA 2XFSA 1E4DA 5CGWA 1PWCA 3TRCA 3HJIA 1VEUB 1ESIA 4WN5A 3JVVA 2M1CA 5A8BA 2P08A 1VM1A 4IUKA 5LBRA 1XGJA 1YLZA 3NBLA 3ZQ5A 3E0YA 1IYPA 2BASA 3JPUA 2QJ5A 1H8YA 2H0YA 2VGLM 5FQIA 3SH8A 4NG2A 4X1LA 3ZG5A 4WF0A 3SS5A 2JKGA 3HVFA 3IX3A 2ZQDA 3I7JA 1DJAA 1ES3A 2Q9NA 3M2KA 2B95A 5C5KA 2VGLS 3T4LA 2NUTC 1I2SA 3G30A 2ZMAA 1BLPA 4EETB 1GSWA 4OP5A 1G6OA 3RXWA 2OOLA 1F2KA 4H6JB 2V8CA 3BEBA 4CJNA 1UWPX 5HD5A 4D2OA 2ZC4B 1CI8A 4DJ2A 1HD8A 2W3EA 3FV7A 3ZDJA 1SKOB 3L9KA 3OLOA 1FSWA 1YLYA 5KMWA 4S2KA 1YM1A 4IVIA 1XA1A 1OTIA 4EBLA 3FPWA 3DWKA 1L0DA 3HLDA 4Q0HA 4S2OA 1NRFA 1IYOA 5AVEA 3T50A 3ZNYA 3W4PA 5L09A 3LIAA 2J3TD 4PPRA 5CGSA 4EBPA 1NY0A 3FPVA 1P9WA 4X25A 3IF6C 1K55C 3NDEA 2HP5A 4OONA 5MC7A 3H82B 1PYYA 2OLUA 3PBSA 2EA9A 2D01A 4XUZA 4I3IA 1MBLA 3BLMA 2ZL1A 1CF0A 2XROA 1ERQA 1L0FA 5FAOA 1KGEA 4WELA 1VETA 1D06A 1OJ5A 3ZVTA 1K38A 3GVBA 2WYXA 1IELA 3OPHA 2VZWA 3RH8B 3O86A 3UDFA 1IYSA 5CGXA 1OTAA 2ZMFA 3Q1FA 2IWDA 1M40A 2WKRA 3A3EA 4X56A 4DRTA 2O0YA 1ES4A 4U3TA 5FQMA 5TFQA 3PR6A 2J80A 4MMNA 2NUPC 4NETA 2J3TC 1KE0A 1E3UD 2P9VB 5AQAA 5DJUA 3UMEA 1LHYA 4PAUA 3H9WA 4LENA 2VX8A 4HI4A 2VGKA 4MN7A 3MQOA 3PBNA 3VE4A 2V1ZA 4KZ8A 5EOEA 4PKYA 3NDGA 3VSLA 3NOPC 3PAGA 3S7NA 2B02A 3ISGA 1M6KA 3W4QA 3ZFZA 4CLCB 3NI9A 1TVFA 5HAQA 4E3OA 2QZ6A 3SH7A 5HSQA 5EM1A 3IBRA 4JGOA 4X53A 2JN7A 4K91A 4OLGA 2I9VA 5FDHA 3NECA 4M3KA 3VP3A 5HPIA 3VOZA 3PXPA 4L9GA 1OTBA 1LI0A 2K31A 2HGVA 4HJ4A 1K57C 2JHEA 4HP4A 3SH9A 2KDKA 3IH9A 2ZM2A 2J9OA 4R3BA 4N1XA 3HUOA 3HLCA 4Y5FA 1W8QA 3LFVA 1OJGA 4ESPA 5E43A 3V50A 1WE4A 3P7NA 2WUQA 5F68A 1K54C 2ZOIA 2LB5A 2FFFB 1TDGA 3FYZA 1PRQA 2Y79A 3DW0A 1MWTA 4N9KA 3EWKA 1DY6A 4FH2A 1K6SA 3G32A 3QP8A 2HJ9C 3M2JA 3SS4A 5GLAA 5HARA 2IA2A 3BYDA 5CHMA 1BLSA 1BTLA 4I39A 1NZOA 4BJPA 4OVDA 1YAXA 5FATA 4HY8A 3MZDA 4XT2B 1N4OA 5FDSA 2Q0OA 1UGUA 2X71A 1S67L 4JGQA 4R3JA 3TJZC 2KLIA 4MLLA 3HLBA 1KGFA 5EFWA 4YINA 4JLFA 1IYQA 1F5MA 5AQBA 4KQQA 4C6YA 5GLCA 3CITA 2VK3A 1K0KA 3UPNA 5DTSA 3LIEA 3OZHA 4X68A 3ZG0A 4WMCD 2CMNA 1LI9A 2G7UA 5HX9A 3ZHHA 3QP5A 2PU4A 4I3JA 4HIAA 5HW3A 3VP1A 2RL3A 2V1BA 5GHYA 4PM9A 4BD1A 4ID4A 1PWGA 5M1AA 2JKRM 4QU3A 4S2LA 4XUXA 2MJ6A 4EXOA 5HL6A 4GHIA 5I94A 2PAVP 3HLGA 3C7UA 3IXDA 3VMAA 4CLCE 3U4LP 4R4RA 3BY9A 2ZJ9A 4PM8A 1S66L 2ZC3B 1H5XA 3K3DA 5F69A 3UPOA 4KENB 3F1NA 4EERA 4ETXA 2HZ5A 1VB6A 1ESUA 4NXFA 3GQZA 3PBOA 4ZTKA 1JNUA 3N8SA 1V9ZA 2Y4AA 3Q81A 2WKQA 3SW1A 1D7EA 3P01A 3LI8A 3R7WA 5EM0A 1DP9A 5FQJA 3PAEA 3B33A 2XK1A 4KQRA 4QPRA 3VOYA 2JC7A 3BQAA 3IF5A 4HNBA 5AVFA 2W1TB 3T4TA 4IUHA 1IKIA 4UQIM 4KZ6A 2A24A 3L7HA 1VQQA 2WZZA 4LRXC 2M7UA 4EW7A 2HDRA 5KZHA 1CJFA 5IU1A 4YFMA 3FWLA 2VLGA 4EUZA 2Y2OA 4OH0A 4ME4A 5DJTA 1NZUA 1MXOA 2ZQ8A 5EVEA 3UB7A 3G31A 3MS6A 3A3FA 1OPXA 4MCWA 3G34A 3C38A 4B88A 1MZUA 3E2KA 4GDBA 1VEUA 3CAXA 2O9AA 3UY6A 3IX8A 4GB7A 4GNUA 4JGRA 3C4PA 3QP4A 3ITBA 5IHVA 2Y2NA 3UN7A 4R4SA 5A92A 5DF7A 4QWOA 3H7WB 3TSGA 1J9MA 4DE0A 2A2LA 1IKGA 3FC7A 3IBJA 2GNXA 3S7PA 4OOMA 3V39A 2W1TA 2VEAA 3ZGAB 3PTEA 4P0MA 5BOHA
chains in the Genus database with same CATH topology
4GJ4A 4H6JA 5HD5A 4DJ2A 2W3EA 5KSHA 1NWZA 5KIZA 4HJ3A 3OLOA 2GJ3A 1XFQA 1KOUA 3MJQA 4JGPA 5J7EA 2PHYA 4ARZB 2L1MA 1OTIA 3LIDA 4DMZA 3LR0A 1F98A 4G3KA 3FPWA 2GZAA 2W3FA 2DMWA 1OTEA 2A24B 4KUKA 3C2WA 4Q0HA 5J4EA 4Q0JA 1GSVA 5L8MA 1X0OA 3TW8A 5FL3A 2HJEA 5AVEA 3KSGA 4NXBA 2JKTM 3RFBA 2YKFA 3T50A 2HF6A 4O0PA 1VHMA 4EU0A 1XFNA 4DN0A 5I5LA 3MR0A 5AJGA 3LIAA 3PBQA 2J3TD 5DFYA 3UB9A 3LICA 3UE6A 2XA7M 1OTDA 4IJGA 4MN5A 2W3DA 3T4KA 2LB9A 3FPVA 1P9WA 2EWWA 2L4RA 3LYXA 5MC7A 2QHKA 3H82B 4PHTA 3BW6A 3UB8A 1IFQA 2P7JA 1T1AA 3E4PA 3H82A 3UE3A 3PBSA 2EA9A 3VOLA 2PR6A 2D01A 4I3IA 3T4JA 3KSFA 5G4ZA 1XJ2A 2GX5A 2XROA 5F5YA 5J3WA 4WELA 1D06A 2OWJA 4Z1WA 4Y3IA 1OJ5A 3A0RA 3E4QA 4R70A 4B93A 3F1NB 1OT9A 2VZWA 3RH8B 2O9CA 4GS9B 3ULFA 4CLCC 2K2NA 3F1OB 1OTAA 3NJAA 4PKYG 4WUJA 2ZMFA 1DP6A 3LR4A 4MDZA 4LRYC 1H3QA 3NOUC 3E4OA 2PYRA 4HOIA 2WKRA 3F1PA 2JKRI 4WEKA 1YSQA 2VV7A 2O0YA 4OOLA 1EW0A 3EQUA 1NRJA 3PR6A 4ETZA 1P0ZA 1Y28A 2J80A 1DRMA 3A0VA 4GHIB 4MMNA 3S7QA 2NUPC 2VV6A 5HWWA 4B9OA 3EEAA 2ZMVA 4DJ3A 2J3TC 5K5BA 3MMHA 3V67A 3MFXA 3K2NA 5DJUA 3UMEA 1TS0A 1N9NA 4PAUA 3H9WA 3LR5A 3BY8A 2W3HA 1G28A 5IS1A 2V0UA 2VX8A 4HI4A 3KSIA 1T19A 3EGDC 1F9IA 4MN7A 3MQOA 3PBNA 3VE4A 2VV8A 4ARZA 1LSVA 2XA7S 4PKYA 3D72A 4E04A 3NOPC 4LRZE 3S7NA 2B02A 1TS7A 2Y8HA 4YWZA 5HZHA 5F6AA 1T18A 3CI6A 4I38A 4CLCB 4G3VA 4GLQA 4HP9A 3K3CA 3KO6A 3H7WA 3R7WB 2K7SA 4HH3A 4CQHA 4L0LA 5HSQA 4GW9A 3IBRA 4JGOA 3F1PB 2JN7A 3MXQA 2I9VA 2PD7A 4F3LA 2D02A 4KQDA 1N9OA 3NHQA 5HPIA 3KYZA 3PXPA 5TBMA 1S4RA 1OTBA 1V9YA 4L9GA 2K31A 1N9LA 4P6ZS 2B18A 2HGVA 4EUVA 5HDSA 4HJ4A 2PDRA 1ODVA 1S1YA 2JHEA 3UMDA 3PBRA 4HP4A 2JKTI 2QYBA 2KDKA 4HHDA 1W63M 4M4XA 3BQ8A 3C30A 3E98A 4G3WA 4Y5FA 3ICYA 4EESA 3PBTA 4BBUA 4HQAA 3LFVA 1OJGA 2PR5A 1XJ4A 3T4SA 5HWVA 3P7NA 4O8GA 1S1ZA 3T4OA 1W63Q 3EOIA 3CWFA 4K08A 5HD3A 4Q0IA 5F68A 5DKKA 2VJWA 2M7VA 2L0WA 2ZOIA 1LL8A 2LB5A 3LI9A 3OOVA 3GECA 2Y79A 4UQIS 2PD8A 1LT0A 1XJ3A 3EWKA 4RQ9A 3CUEA 4FSFA 4BWIA 4BMWA 2HJ9C 4NEED 3LIBA 1GSXA 2IA2A 2QJ7A 1P9RA 3A0SA 3MF0A 2FH5A 4BBVA 5DKLA 3VE3A 1IOUA 4I39A 4BJPA 1ZHHB 1YAXA 2OWHA 1T1BA 4HY8A 3S7OA 4XT2B 2EWVA 3FG8A 3BWLA 5DFXA 4GCZA 1UGUA 4UEYA 1H8MA 5TBMB 3U2AA 2PYPA 2INWA 1S67L 1WA9A 2W3GA 4MN6A 4JGQA 3TJZC 2O9BA 5IT5A 1TF1A 2KLIA 4YOFA 5EFWA 1MC0A 4LPZA 1OT6A 1F5MA 1P97A 2VA0A 3B47A 1BYWA 4I5SA 4IHQA 3VV4A 5HPFA 3OBFA 4R3AA 3CITA 4KQOA 2W0NA 3LIEA 4CLCD 1NLZA 4EEPA 3DBAA 2CMNA 4NXEA 2G7UA 4XT2A 5CX7A 2OAQ1 2QWSA 2PT7A 2KX6A 1LSWA 3KYQA 4L9FA 1MKMA 2WKPA 3JVUA 3OCLA 2VKSA 3LR3A 4O01A 3BJNA 4I3JA 4HIAA 2V1BA 1S4SA 3RTYA 3CLOA 2ZOHA 2ZBBA 4II7A 2JKRM 2P04A 3NOTC 2MJ6A 4FOFA 2J3WA 5HL6A 4EXOA 4GHIA 1TS8A 2KOIA 2V0WA 3LUQA 1T1CA 1YSPA 4CLCE 1STZA 3LIFA 5DF9A 3BY9A 3EQVA 1UWNX 3MQQA 3EEHA 2HV1A 1S66L 2XRNA 3C8CA 4EEUA 3K3DA 5F69A 1TD5A 4WEJA 5TJJA 3F1NA 4EERA 4ETXA 1VB6A 4WL9A 4NXFA 2H28A 3PBOA 4KUOA 3KSHA 5HDCA 1JNUA 4GS9A 2V9AA 4ZRRA 2YKHA 4AFIA 4R38A 3CUEC 1YKDA 2R78A 2W1RA 1V9ZA 2OAP1 4Y2FA 4YNRA 5HDDA 3TE8A 4F3LB 2WKQA 4I3AA 3SW1A 1D7EA 3W2ZA 1TS6A 3P01A 3LI8A 3R7WA 1DP9A 2QKPA 3G6OA 4EQ1A 2FZ0A 3B33A 3ZYTA 3OC2A 1NLYA 2Z6CA 3HCYA 3O5YA 2O99A 4CLCA 3MQ0A 3GDIA 4QPRA 5G4YA 3BQAA 1LSXA 4HNBA 2W27A 5AVFA 2W1TB 3T4TA 4IUHA 4UQIM 2A24A 3IS2A 4LRXC 2M7UA 4R6LA 4EW7A 5IU1A 3TRCA 4BBTA 2V1AA 2VLGA 3HJIA 3HJKA 4WN5A 3JVVA 2M1CA 3OCNA 5A8BA 2P08A 4ME4A 5DJTA 4IUKA 5LBRA 3B42A 3UB7A 3ZQ5A 3E0YA 3UB6A 2BASA 1OPXA 3T4QA 4MCWA 2QJ5A 4LLOB 3C38A 3D3OA 1ZTUA 1MZUA 2VGLM 2Z6DA 4NKPA 4HH2A 3EGXC 4WF0A 3CAXA 3PHYA 2O9AA 5HWTA 4P6ZM 4JGRA 4NXGA 2XSSA 5C5KA 2VGLS 3H7WB 2NUTC 3T4LA 3F1OA 3R4KA 3KX0X 3PYPA 2A2LA 3IS2B 3FC7A 4HJ6A 3IBJA 1XJ6A 2GNXA 3S7PA 4OOMA 4L9EA 4EETB 1DP8A 1GSWA 1G6OA 2OOLA 2W1TA 2VEAA 4H6JB 4WLAA 1UWPX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1N A;  2L0W A;  4EER A;  4H6J A;  1VB6 A;  3F1P A;  4WL9 A;  2ZOI A;  5HD5 A;  1LL8 A;  4NXF A;  2H28 A;  4KUO A;  3LI9 A;  5HDC A;  3GEC A;  4DJ2 A;  2PD8 A;  2VV7 A;  1JNU A;  4GS9 A;  2V9A A;  1NWZ A;  1LT0 A;  1XJ3 A;  3EWK A;  5KIZ A;  1EW0 A;  4RQ9 A;  2YKH A;  4R38 A;  3NOU C;  2R78 A;  4HJ3 A;  3OLO A;  2GJ3 A;  1P0Z A;  1XFQ A;  1KOU A;  1V9Z A;  1Y28 A;  2J80 A;  5HDD A;  3MJQ A;  1DRM A;  3A0V A;  4GHI B;  2PHY A;  2WKQ A;  4JGP A;  2VV6 A;  3LIB A;  4I3A A;  4F3L B;  1GSX A;  2QJ7 A;  3SW1 A;  1D7E A;  5HWW A;  4B9O A;  1TS6 A;  3A0S A;  2L1M A;  1OTI A;  3LI8 A;  3LID A;  5DKL A;  4BBV A;  4DJ3 A;  1DP9 A;  1F98 A;  3VE3 A;  2QKP A;  3G6O A;  4I39 A;  4EQ1 A;  3MFX A;  1OTE A;  2OWH A;  2A24 B;  1TS0 A;  3B33 A;  1N9N A;  5DJU A;  1T1B A;  3H9W A;  4HY8 A;  4KUK A;  3C2W A;  3BY8 A;  5J4E A;  4XT2 B;  1G28 A;  2Z6C A;  5IS1 A;  1GSV A;  3FG8 A;  1X0O A;  2V0U A;  3BWL A;  4HI4 A;  1T19 A;  1F9I A;  3GDI A;  4GCZ A;  1UGU A;  3MQO A;  5TBM B;  3VE4 A;  5G4Y A;  5AVE A;  2PYP A;  2VV8 A;  4NXB A;  1LSV A;  1S67 L;  2INW A;  1LSX A;  4PKY A;  1WA9 A;  2YKF A;  4HNB A;  3D72 A;  4MN6 A;  2W27 A;  3T50 A;  4JGQ A;  5AVF A;  3NOP C;  4E04 A;  1XFN A;  4LRZ E;  5I5L A;  3MR0 A;  5EFW A;  2A24 A;  3LIA A;  4LPZ A;  1OT6 A;  2B02 A;  1TS7 A;  3IS2 A;  1P97 A;  4LRX C;  5F6A A;  4YWZ A;  5HZH A;  4EW7 A;  1T18 A;  4R6L A;  4I5S A;  1BYW A;  4I38 A;  3UB9 A;  5IU1 A;  3LIC A;  3UE6 A;  1OTD A;  4BBT A;  2V1A A;  4HP9 A;  2VLG A;  3K3C A;  4MN5 A;  3HJI A;  4R3A A;  3HJK A;  3H7W A;  4WN5 A;  2K7S A;  4HH3 A;  2M1C A;  5HSQ A;  4GW9 A;  2L4R A;  2W0N A;  5A8B A;  3IBR A;  5DJT A;  4JGO A;  3F1P B;  3LIE A;  3LYX A;  2JN7 A;  3MXQ A;  3UB7 A;  3ZQ5 A;  2QHK A;  2I9V A;  3H82 B;  3UB6 A;  2BAS A;  2PD7 A;  4EEP A;  2CMN A;  4NXE A;  2D02 A;  4KQD A;  4XT2 A;  4F3L A;  1N9O A;  2QJ5 A;  3UB8 A;  2P7J A;  3E4P A;  1T1A A;  2QWS A;  3NHQ A;  4LLO B;  2KX6 A;  3H82 A;  1LSW A;  2EA9 A;  5TBM A;  3UME A;  1S4R A;  1OTB A;  1V9Y A;  1MZU A;  2D01 A;  2PR6 A;  4L9G A;  3VOL A;  4L9F A;  2WKP A;  4I3I A;  5G4Z A;  1N9L A;  1XJ2 A;  2Z6D A;  4I3J A;  4HIA A;  5HDS A;  4HH2 A;  4HJ4 A;  2PDR A;  4WF0 A;  3CAX A;  1ODV A;  3PHY A;  1S1Y A;  5F5Y A;  2JHE A;  5HWT A;  2V1B A;  5J3W A;  3UMD A;  4HP4 A;  1S4S A;  1D06 A;  2KDK A;  4HHD A;  2OWJ A;  3CLO A;  4M4X A;  3RTY A;  1OJ5 A;  2ZBB A;  2ZOH A;  4JGR A;  4NXG A;  3NOT C;  4EXO A;  3A0R A;  3E4Q A;  4GHI A;  4R70 A;  3F1N B;  3ICY A;  4EES A;  1TS8 A;  1OT9 A;  4BBU A;  4HQA A;  3H7W B;  3F1O A;  1OJG A;  2V0W A;  3LUQ A;  2PR5 A;  1T1C A;  3KX0 X;  1XJ4 A;  3PYP A;  3RH8 B;  4GS9 B;  3ULF A;  5J7E A;  3IS2 B;  3LIF A;  5HWV A;  3P7N A;  3FC7 A;  4HJ6 A;  3F1O B;  1XJ6 A;  1S1Z A;  4EET B;  3BY9 A;  4L9E A;  1DP8 A;  1GSW A;  1OTA A;  3CWF A;  3NJA A;  4K08 A;  2OOL A;  1UWN X;  3MQQ A;  3EEH A;  4PKY G;  2HV1 A;  4WUJ A;  5HD3 A;  1S66 L;  2VEA A;  1DP6 A;  3C8C A;  4H6J B;  5F68 A;  5DKK A;  4LRY C;  4EEU A;  3K3D A;  5F69 A;  4WLA A;  3E4O A;  2PYR A;  4HOI A;  2WKR A;  1UWP X; 
#chains in the Genus database with same CATH topology
 1JTD A;  3GR2 A;  1PZP A;  1RGZ A;  3UB5 P;  1ZG4 A;  5KIZ A;  1PIO A;  4Y0T A;  2WKE A;  5E2G A;  4HJ3 A;  4P87 A;  2GJ3 A;  1TDL A;  1XFQ A;  4U0T A;  2ZLY A;  4KG5 A;  4WZ5 C;  4PM6 A;  3WS5 A;  3ZNT A;  2GZA A;  3G35 A;  3AGF A;  4KUK A;  5J4E A;  3IX4 A;  1WYB A;  1X0O A;  4S2I A;  1GA9 A;  4KZ3 A;  2E8J A;  2EXA A;  3IWQ A;  2PRF A;  4KZB A;  4O0P A;  1VHM A;  1S6R A;  4DN0 A;  1JWV A;  5I5L A;  2HPB A;  3MR0 A;  3NCK A;  4DDY A;  4N1H A;  3PBQ A;  5AJG A;  5FA7 A;  3IWO A;  3VP2 A;  3LIC A;  1OTD A;  4R1G A;  1ZKJ A;  3O87 A;  2QMI A;  2R9W A;  2L4R A;  1KDS A;  3MSH A;  1L2S A;  4EQI A;  3D4F A;  4R0Q A;  2QHK A;  3Q7V B;  3BW6 A;  5D3O A;  1IFQ A;  2P7J A;  1T1A A;  3E4P A;  2PR6 A;  3AGD A;  3T4J A;  1RCJ A;  3KSF A;  3MZF A;  4WYY A;  3M6H A;  3GV9 A;  5CER A;  2OWJ A;  1HTZ A;  4Z1W A;  2P9V A;  3BFD A;  4IBR A;  4R70 A;  3A3J A;  1AWI A;  4ZJ2 A;  2O9C A;  3ULF A;  4CLC C;  3TOI A;  1LLB A;  3NJA A;  3DTK A;  3LR4 A;  3E4O A;  1U60 A;  3F1P A;  2JKR I;  4DDS A;  4WEK A;  1ES5 A;  1EW0 A;  1MWS A;  1G5U A;  1NRJ A;  2XFT A;  5FI2 A;  3WWX A;  5E2H A;  1DRM A;  3LEZ A;  2VV6 A;  2ZMV A;  3VFF A;  4DJ3 A;  1D1J A;  2V8F A;  5K5B A;  3MMH A;  3S22 A;  1N9N A;  3HRE A;  1G28 A;  2V0U A;  1F9I A;  3O3V A;  2VV8 A;  2XA7 S;  4WMC A;  4OPZ A;  2P74 A;  4GD8 A;  4FD8 A;  1HVB A;  3OPP A;  5FEF A;  3T1S A;  3NY4 A;  2XGN A;  4S2J A;  4YWZ A;  4UA6 A;  5EVL A;  4A5R A;  4HH3 A;  3BFC A;  3F1P B;  3MXQ A;  1HLU P;  4K0W A;  4S2M A;  4KQD A;  2X02 A;  4RX3 A;  1V9Y A;  3MBZ A;  4P6Z S;  3IXB A;  4EUV A;  5HDS A;  4DF6 A;  1ODV A;  1S1Y A;  2J7V A;  3QP2 A;  2JKT I;  2QYB A;  1CEF A;  2J8Y A;  3E98 A;  5FQQ A;  5GHX A;  4ZBE A;  4DE2 A;  3ICY A;  1CK3 A;  1GCE A;  3IXG A;  1NXY A;  2EFU A;  3HL9 A;  5HWV A;  3GRJ A;  4JXV A;  3N7W A;  4P85 A;  1E25 A;  3ITA A;  1XKZ A;  4K08 A;  4Q0I A;  5DKK A;  2VJW A;  1RP5 A;  2M7V A;  1Z09 A;  2A49 A;  3G2Y A;  3VSK A;  1FOF A;  2XDM A;  5EV0 A;  4UQI S;  1MWU A;  1O07 A;  3A3I A;  5AQ7 A;  2HP6 A;  4BMW A;  4XXR A;  4ZJ3 A;  3M6B A;  1K54 A;  2C5W B;  2DNS A;  3A0S A;  3MF0 A;  4BBV A;  3VE3 A;  1IOU A;  3DTE A;  5GL9 A;  3FG8 A;  3MFD A;  5DFX A;  1MY8 A;  3DTM A;  5TBM B;  3U2A A;  1CI9 A;  3W8K A;  1FIK A;  3IT9 A;  2W3G A;  4KZ7 A;  2ZQA A;  4WBG A;  4UA9 A;  1TF1 A;  4B4X A;  5IT5 A;  2OV5 A;  4YOF A;  4LPZ A;  4I5S A;  1BYW A;  2DCF A;  2EFX A;  4LV0 A;  4OPR A;  3AGE A;  2OLV A;  4CLC D;  5FQ9 A;  4NXE A;  4XT2 A;  2OAQ 1;  2QWS A;  2PT7 A;  2KX6 A;  2ZC5 B;  1LSW A;  3KYQ A;  2WKP A;  2I72 A;  2X01 A;  3BJN A;  3QHY A;  5EOO A;  2A3U A;  3T1X A;  3CLO A;  1KDW A;  1Y54 A;  5A90 A;  1MWR A;  3WS4 A;  2P04 A;  4JXW A;  4OQH A;  3NOT C;  2Z2M B;  2J3W A;  5TGF A;  2JKF A;  1TS8 A;  1A0K A;  5L10 A;  1STZ A;  3LIF A;  4IVK A;  2ZD8 A;  2EX6 A;  2HDQ A;  3MQQ A;  3EEH A;  2XRN A;  4EEU A;  1KE4 A;  3CHW P;  3LY3 A;  4WL9 A;  2ZC6 B;  1YT4 A;  3DTI A;  2V9A A;  4GS9 A;  5EE8 A;  4ZRR A;  4LCL A;  4R38 A;  1YKD A;  3T12 B;  2OSU A;  4Y2F A;  4YNR A;  5HDD A;  1C3B A;  4I3A A;  1J3W A;  3UNW A;  2QKP A;  2PU2 A;  5CRF A;  4EQ1 A;  2J9P A;  2ZL1 B;  3ZYT A;  2BLS A;  3Q7V A;  3OC2 A;  1NLY A;  3HUM A;  3O5Y A;  4CLC A;  5EVI D;  3MQ0 A;  3GDI A;  3IHB A;  3ZCZ A;  1KE3 A;  4LGW A;  4GD6 A;  2WAF A;  1IEM A;  2WGW A;  3N6I A;  1PW8 A;  4QJG A;  3HJK A;  4DE3 A;  4KG2 A;  5L07 A;  4S2N A;  3B42 A;  1YPR A;  3OPR A;  4WZ5 A;  1HZO A;  4OPQ A;  3CMZ A;  3WRZ A;  2Z6D A;  4NKP A;  1CQA A;  3IHA A;  3EGX C;  4Y13 A;  4BL3 A;  5JYO A;  1QME A;  4P6Z M;  1XP4 A;  4NXG A;  4E6W A;  5JYP A;  1K57 A;  1YQS A;  4EBN A;  4EV4 A;  3F1O A;  1NJ4 A;  3KX0 X;  3IS2 B;  4QY6 A;  3HLE A;  4QB8 A;  4HJ6 A;  4L9E A;  2ACG A;  4WLA A;  3QNC A;  4GJ4 A;  4H6J A;  3E2L A;  5EUA A;  5KSH A;  1YLT A;  4Q8I A;  4E6X A;  1KOU A;  3SZT A;  4PM5 A;  3MJQ A;  5AQ9 A;  5J7E A;  2PHY A;  2V20 A;  3IQA A;  1K4F A;  1XA7 A;  4ARZ B;  2L1M A;  1ALQ A;  4DMZ A;  3LR0 A;  1BLH A;  4G3K A;  2IWC A;  2W3F A;  2DMW A;  1FQG A;  3C2W A;  4BL2 A;  4FH4 A;  1GSV A;  5L8M A;  3Q7Z A;  1K56 A;  2VGJ A;  4F94 A;  1ACF A;  3TW8 A;  2HJE A;  4NXB A;  1ERO A;  4OQG A;  3RFB A;  2YKF A;  2HF6 A;  4RA7 A;  4ZDX A;  3Q07 A;  5CHJ A;  5J8X A;  4OLD A;  5CTN A;  3UB9 A;  3FKW A;  3UE6 A;  4IJG A;  4MN5 A;  2LB9 A;  2EWW A;  3MKF A;  5CHU A;  2Y2K A;  3BFF A;  3H82 A;  3UE3 A;  1ONH A;  4JF6 A;  3VFH A;  5G4Z A;  4E3M A;  1XJ2 A;  2GX5 A;  2UWX A;  1WYC A;  2WAD A;  5F5Y A;  3ZG7 B;  5J3W A;  4MBK A;  1QMF A;  5HFO A;  3MZE A;  1KVM A;  3A0R A;  3E4Q A;  2Y2H A;  3F1N B;  4Y0U A;  2XD1 A;  2K2N A;  3VP0 A;  5M19 A;  2Y2L A;  1DP6 A;  2HP9 A;  3CZD A;  4LRY C;  3NOU C;  2PYR A;  3ZG8 B;  2VV7 A;  4JF4 A;  1SZV A;  1P0Z A;  3ZVW A;  3A0V A;  3W4O A;  3S7Q A;  3EEA A;  4MEZ A;  3BFG A;  1FCM A;  3MFX A;  3N4I A;  1I2W A;  3BY8 A;  2W3H A;  5IS1 A;  5DF8 A;  1K6R A;  4E3J A;  3KSI A;  1T19 A;  3EGD C;  1W8Y A;  2Y2P A;  1FCN A;  3VP4 A;  1LSV A;  4ARZ A;  1PNE A;  3D72 A;  4E04 A;  4LV1 A;  3LCE A;  4LRZ E;  2G2W A;  4P6B A;  2Y8H A;  5HZH A;  1T18 A;  4Z9Q A;  3CI6 A;  4I38 A;  1YLW A;  4O7D A;  5CTM A;  4GLQ A;  4HP9 A;  3K3C A;  3KO6 A;  3H7W A;  2K7S A;  4CQH A;  1JWP A;  4GW9 A;  1ERM A;  2UV0 E;  4KZA A;  1JWZ A;  2PD7 A;  3G4P A;  2D02 A;  3FKV A;  4KZ9 A;  3HLF A;  3KYZ A;  2H5S A;  1FR1 A;  1YMS A;  1N9L A;  1ONG A;  3CJM A;  3WS2 A;  3HUN A;  1N9B A;  1XGI A;  4LV3 A;  2PDR A;  3UMD A;  4HHD A;  4M4X A;  1XX2 A;  3UPP A;  3BQ8 A;  4BD0 A;  4G3W A;  1Q2Q A;  3IXH A;  5EPH A;  3PBT A;  4HQA A;  4UA7 A;  3LEQ A;  3T4S A;  4FCF A;  3KYE A;  1S1Z A;  3T4O A;  3CWF A;  5HD3 A;  5FQK A;  3P98 A;  2L0W A;  1L0G A;  1LL8 A;  4GOG A;  2Y2J A;  1XJ3 A;  1O7E A;  1LL9 A;  4EWF A;  2XH9 A;  4NEE D;  5CXW A;  4UHU A;  3LIB A;  1BUE A;  3IF6 B;  2QJ7 A;  4FUW A;  4HBU A;  4DE1 A;  2FH5 A;  3NIA A;  4BEN A;  1PI4 A;  3Q82 A;  2FFY A;  1ZHH B;  3S4X A;  3BWL A;  1SDN A;  4GCZ A;  1H8M A;  2Y2G A;  2PYP A;  2INW A;  4LFU A;  3MXS A;  1ZG6 A;  4WM9 A;  1PW1 A;  5A91 A;  4X1M A;  2AVX A;  4CPK A;  1NYM A;  4IHQ A;  5HPF A;  4E3L A;  1E3U A;  3OBF A;  4R3A A;  3V5M A;  2W0N A;  1NLZ A;  4EEP A;  3DBA A;  2Y2Q A;  4WZ4 A;  5CEC A;  2GDN A;  2H10 A;  4DXB A;  3G2Z A;  4L9F A;  5FEG A;  2VKS A;  4O01 A;  3LGO A;  4QY5 A;  1S4S A;  2ZOH A;  2ZBB A;  4FOF A;  5CEB A;  3UO9 A;  4QD4 A;  2JBF A;  4ZAM A;  4E3N A;  1K56 D;  4OQI A;  1Q2P A;  2V0W A;  4JBF A;  4MNR A;  1T1C A;  4OP8 A;  1YSP A;  5DF9 A;  2XEP A;  3WS1 A;  3NC8 A;  3QP6 A;  1UWN X;  4KZ4 A;  2HV1 A;  2XLN A;  5EVI A;  1Y4O A;  4FTX A;  4C3Q A;  3LO7 A;  5GLD A;  1TD5 A;  5TJJ A;  1L0E A;  4U0X A;  2H28 A;  5HDC A;  3KSH A;  2Y59 A;  4OQ0 A;  4AFI A;  3CUE C;  2R78 A;  2OAP 1;  4OPY A;  3TE8 A;  4F3L B;  1G68 A;  3W2Z A;  4GKU A;  4BQM A;  1K55 A;  2O99 A;  4Y0O A;  1L3L A;  4R23 A;  2WGV A;  5G4Y A;  2C6W B;  1LSX A;  4OKP A;  2W27 A;  2BG1 A;  3HBR A;  3RJU A;  5A93 A;  1RGY A;  4N9L A;  2Z2L B;  3IS2 A;  4DKI A;  4R6L A;  1BUL A;  3CPT B;  2XR0 A;  1H0M A;  4BBT A;  2V1A A;  5FSR A;  1BT5 A;  1H8Z A;  3OCN A;  4GDN A;  3BLS A;  4JXG A;  4GZB A;  1K4E A;  1BLC A;  3UB6 A;  2ZM0 A;  5DTK A;  5CED A;  3OPL A;  4Y17 A;  3T4Q A;  3GSG A;  1SKF A;  4LLO B;  1FCO A;  3D3O A;  4MBF A;  1ZTU A;  4HH2 A;  4IED A;  3PHY A;  2Y55 A;  5HWT A;  1PWD A;  2WAE A;  3UDX A;  5GHZ A;  1BSG A;  3BEC A;  2CC1 A;  2R9X A;  2XSS A;  4GN2 A;  4JF5 A;  3R4K A;  3PYP A;  3UDI A;  5L2F A;  3T1Q B;  1XJ6 A;  1DP8 A;  1OME A;  2ZM8 A;  2PBY A;  3C5A A;  3A3D A;  3TG9 A;  1GA0 A;  2XF3 A;  5F1F A;  5E2F A;  1MPL A;  1NWZ A;  1ES2 A;  4JGP A;  4RYE A;  4KZ5 A;  2ZQ9 A;  1PI5 A;  3LID A;  5KSC A;  1F98 A;  4LV2 A;  1OTE A;  2A24 B;  2WZX A;  4B4Z A;  4RX2 A;  4Q0J A;  1PZO A;  4QHC A;  4NK3 A;  5FL3 A;  1Z6F A;  3KSG A;  1FR6 A;  2JKT M;  3UE1 A;  3DAV A;  3BFE A;  4EU0 A;  1XFN A;  1EI5 A;  3MXR A;  5DFY A;  4K0X A;  2G2U A;  2XA7 M;  3P09 A;  3T4K A;  2W3D A;  3T1R A;  3LYX A;  2HDU A;  5DVA A;  4PHT A;  4ZJ1 A;  1EWZ A;  3N8L A;  3IF6 A;  3UB8 A;  4BLM A;  3VOL A;  4X6T A;  5HAI A;  2ZC7 A;  4Y3I A;  1TEM A;  5FAS A;  4B93 A;  4Y7P A;  2B5R A;  1OT9 A;  4D60 A;  4GS9 B;  3F1O B;  2ZQ7 A;  4PKY G;  4WUJ A;  4MDZ A;  1H3Q A;  4S2N C;  1DJC A;  4HOI A;  5EEC A;  1YSQ A;  1KGG A;  3V3S A;  4OOL A;  3EQU A;  1ZC2 A;  4ETZ A;  1Y28 A;  4E3K A;  1W5D A;  3QP1 A;  1LL5 A;  4GHI B;  4S2P A;  3LY4 A;  1CEG A;  5HWW A;  4B9O A;  1SCW A;  2EX2 A;  3QNB A;  3CG5 A;  3WS0 A;  3V67 A;  3K2N A;  1TS0 A;  4X55 A;  2JE5 A;  3LR5 A;  1JTG A;  2XQZ A;  3FZC A;  2Y2M A;  1BZA A;  1TS7 A;  5F6A A;  5HL1 A;  2WKI A;  4G3V A;  3R7W B;  4L0L A;  2WKH A;  1I5Q A;  1NYY A;  5G18 A;  2IWB A;  4F3L A;  1SKO A;  1N9O A;  2PBD P;  3NHQ A;  5EVI B;  5TBM A;  1S4R A;  5FAP A;  3SOI A;  1K25 A;  2B18 A;  2Y2I A;  3N8R A;  4KG6 A;  5FAQ A;  3IH8 A;  3PBR A;  1W63 M;  5M18 A;  1W7F A;  3C30 A;  4LCM A;  5FI7 A;  3C4O A;  4EES A;  4BBU A;  5DTT A;  2PR5 A;  1XJ4 A;  4N92 A;  1MKI A;  1PFL A;  3RXX A;  1YMX A;  4O8G A;  4DXC A;  3CPT A;  1W63 Q;  3EOI A;  3B3X A;  3LI9 A;  3OOV A;  3GEC A;  2PD8 A;  1LT0 A;  4RQ9 A;  3CUE A;  4FSF A;  4BWI A;  1GHM A;  1GSX A;  1P9R A;  4PM7 A;  5DKL A;  4UAA A;  4HES A;  2HDS A;  1DJB A;  2OWH A;  2EXB A;  1T1B A;  3S7O A;  2EWV A;  1SHV A;  1VET B;  4UEY A;  3JYI A;  4HEF A;  1FSY A;  5HAP A;  1S0W A;  1W79 A;  2XD5 A;  3HLW A;  3S1Y A;  1WA9 A;  4MN6 A;  2BTF P;  2O9B A;  3ZG9 B;  1YLJ A;  2EX8 A;  1MC0 A;  1OT6 A;  1P97 A;  2Q9M A;  2VA0 A;  3WRT A;  3B47 A;  3GTC A;  3VV4 A;  3O88 A;  3UE0 A;  4JXS A;  4KQO A;  4HBT A;  4MBH A;  2V2F F;  4E3I A;  3GMW A;  3DWZ A;  5EVI C;  2EX9 A;  5CX7 A;  2QPN A;  1FIL A;  2E8I A;  2ZQC A;  2WGW B;  4JPM A;  1MKM A;  3JVU A;  3OCL A;  3LR3 A;  3IWI A;  4PMA A;  4C75 A;  4H8R A;  1XPB A;  3D9Y A;  3RTY A;  3V3R A;  3C7V A;  4II7 A;  3BM6 A;  2KOI A;  5E2E A;  3LUQ A;  2WGI A;  5F82 A;  5GLB A;  5U47 A;  3EQV A;  2JCH A;  3C8C A;  4X69 A;  5FI6 A;  1YLP A;  4WEJ A;  4KUO A;  5F83 A;  3SS3 A;  4JKT A;  4RVA A;  2YKH A;  2W1R A;  1AXB A;  2WK0 A;  5F1G A;  1SDE A;  1TS6 A;  4IBX A;  2DRW A;  3MKE A;  3G6O A;  2FZ0 A;  1JVJ A;  2H0T A;  2Z6C A;  3HCY A;  2RCX A;  3BRM A;  1XXM A;  4Y15 A;  1G6A A;  2Y91 A;  3NUL A;  1GHP A;  1GHI A;  5TR7 A;  1KVL A;  4OOY A;  2XFS A;  1E4D A;  5CGW A;  1PWC A;  3TRC A;  3HJI A;  1VEU B;  1ESI A;  4WN5 A;  3JVV A;  2M1C A;  5A8B A;  2P08 A;  1VM1 A;  4IUK A;  5LBR A;  1XGJ A;  1YLZ A;  3NBL A;  3ZQ5 A;  3E0Y A;  1IYP A;  2BAS A;  3JPU A;  2QJ5 A;  1H8Y A;  2H0Y A;  2VGL M;  5FQI A;  3SH8 A;  4NG2 A;  4X1L A;  3ZG5 A;  4WF0 A;  3SS5 A;  2JKG A;  3HVF A;  3IX3 A;  2ZQD A;  3I7J A;  1DJA A;  1ES3 A;  2Q9N A;  3M2K A;  2B95 A;  5C5K A;  2VGL S;  3T4L A;  2NUT C;  1I2S A;  3G30 A;  2ZMA A;  1BLP A;  4EET B;  1GSW A;  4OP5 A;  1G6O A;  3RXW A;  2OOL A;  1F2K A;  4H6J B;  2V8C A;  3BEB A;  4CJN A;  1UWP X;  5HD5 A;  4D2O A;  2ZC4 B;  1CI8 A;  4DJ2 A;  1HD8 A;  2W3E A;  3FV7 A;  3ZDJ A;  1SKO B;  3L9K A;  3OLO A;  1FSW A;  1YLY A;  5KMW A;  4S2K A;  1YM1 A;  4IVI A;  1XA1 A;  1OTI A;  4EBL A;  3FPW A;  3DWK A;  1L0D A;  3HLD A;  4Q0H A;  4S2O A;  1NRF A;  1IYO A;  5AVE A;  3T50 A;  3ZNY A;  3W4P A;  5L09 A;  3LIA A;  2J3T D;  4PPR A;  5CGS A;  4EBP A;  1NY0 A;  3FPV A;  1P9W A;  4X25 A;  3IF6 C;  1K55 C;  3NDE A;  2HP5 A;  4OON A;  5MC7 A;  3H82 B;  1PYY A;  2OLU A;  3PBS A;  2EA9 A;  2D01 A;  4XUZ A;  4I3I A;  1MBL A;  3BLM A;  2ZL1 A;  1CF0 A;  2XRO A;  1ERQ A;  1L0F A;  5FAO A;  1KGE A;  4WEL A;  1VET A;  1D06 A;  1OJ5 A;  3ZVT A;  1K38 A;  3GVB A;  2WYX A;  1IEL A;  3OPH A;  2VZW A;  3RH8 B;  3O86 A;  3UDF A;  1IYS A;  5CGX A;  1OTA A;  2ZMF A;  3Q1F A;  2IWD A;  1M40 A;  2WKR A;  3A3E A;  4X56 A;  4DRT A;  2O0Y A;  1ES4 A;  4U3T A;  5FQM A;  5TFQ A;  3PR6 A;  2J80 A;  4MMN A;  2NUP C;  4NET A;  2J3T C;  1KE0 A;  1E3U D;  2P9V B;  5AQA A;  5DJU A;  3UME A;  1LHY A;  4PAU A;  3H9W A;  4LEN A;  2VX8 A;  4HI4 A;  2VGK A;  4MN7 A;  3MQO A;  3PBN A;  3VE4 A;  2V1Z A;  4KZ8 A;  5EOE A;  4PKY A;  3NDG A;  3VSL A;  3NOP C;  3PAG A;  3S7N A;  2B02 A;  3ISG A;  1M6K A;  3W4Q A;  3ZFZ A;  4CLC B;  3NI9 A;  1TVF A;  5HAQ A;  4E3O A;  2QZ6 A;  3SH7 A;  5HSQ A;  5EM1 A;  3IBR A;  4JGO A;  4X53 A;  2JN7 A;  4K91 A;  4OLG A;  2I9V A;  5FDH A;  3NEC A;  4M3K A;  3VP3 A;  5HPI A;  3VOZ A;  3PXP A;  4L9G A;  1OTB A;  1LI0 A;  2K31 A;  2HGV A;  4HJ4 A;  1K57 C;  2JHE A;  4HP4 A;  3SH9 A;  2KDK A;  3IH9 A;  2ZM2 A;  2J9O A;  4R3B A;  4N1X A;  3HUO A;  3HLC A;  4Y5F A;  1W8Q A;  3LFV A;  1OJG A;  4ESP A;  5E43 A;  3V50 A;  1WE4 A;  3P7N A;  2WUQ A;  5F68 A;  1K54 C;  2ZOI A;  2LB5 A;  2FFF B;  1TDG A;  3FYZ A;  1PRQ A;  2Y79 A;  3DW0 A;  1MWT A;  4N9K A;  3EWK A;  1DY6 A;  4FH2 A;  1K6S A;  3G32 A;  3QP8 A;  2HJ9 C;  3M2J A;  3SS4 A;  5GLA A;  5HAR A;  2IA2 A;  3BYD A;  5CHM A;  1BLS A;  1BTL A;  4I39 A;  1NZO A;  4BJP A;  4OVD A;  1YAX A;  5FAT A;  4HY8 A;  3MZD A;  4XT2 B;  1N4O A;  5FDS A;  2Q0O A;  1UGU A;  2X71 A;  1S67 L;  4JGQ A;  4R3J A;  3TJZ C;  2KLI A;  4MLL A;  3HLB A;  1KGF A;  5EFW A;  4YIN A;  4JLF A;  1IYQ A;  1F5M A;  5AQB A;  4KQQ A;  4C6Y A;  5GLC A;  3CIT A;  2VK3 A;  1K0K A;  3UPN A;  5DTS A;  3LIE A;  3OZH A;  4X68 A;  3ZG0 A;  4WMC D;  2CMN A;  1LI9 A;  2G7U A;  5HX9 A;  3ZHH A;  3QP5 A;  2PU4 A;  4I3J A;  4HIA A;  5HW3 A;  3VP1 A;  2RL3 A;  2V1B A;  5GHY A;  4PM9 A;  4BD1 A;  4ID4 A;  1PWG A;  5M1A A;  2JKR M;  4QU3 A;  4S2L A;  4XUX A;  2MJ6 A;  4EXO A;  5HL6 A;  4GHI A;  5I94 A;  2PAV P;  3HLG A;  3C7U A;  3IXD A;  3VMA A;  4CLC E;  3U4L P;  4R4R A;  3BY9 A;  2ZJ9 A;  4PM8 A;  1S66 L;  2ZC3 B;  1H5X A;  3K3D A;  5F69 A;  3UPO A;  4KEN B;  3F1N A;  4EER A;  4ETX A;  2HZ5 A;  1VB6 A;  1ESU A;  4NXF A;  3GQZ A;  3PBO A;  4ZTK A;  1JNU A;  3N8S A;  1V9Z A;  2Y4A A;  3Q81 A;  2WKQ A;  3SW1 A;  1D7E A;  3P01 A;  3LI8 A;  3R7W A;  5EM0 A;  1DP9 A;  5FQJ A;  3PAE A;  3B33 A;  2XK1 A;  4KQR A;  4QPR A;  3VOY A;  2JC7 A;  3BQA A;  3IF5 A;  4HNB A;  5AVF A;  2W1T B;  3T4T A;  4IUH A;  1IKI A;  4UQI M;  4KZ6 A;  2A24 A;  3L7H A;  1VQQ A;  2WZZ A;  4LRX C;  2M7U A;  4EW7 A;  2HDR A;  5KZH A;  1CJF A;  5IU1 A;  4YFM A;  3FWL A;  2VLG A;  4EUZ A;  2Y2O A;  4OH0 A;  4ME4 A;  5DJT A;  1NZU A;  1MXO A;  2ZQ8 A;  5EVE A;  3UB7 A;  3G31 A;  3MS6 A;  3A3F A;  1OPX A;  4MCW A;  3G34 A;  3C38 A;  4B88 A;  1MZU A;  3E2K A;  4GDB A;  1VEU A;  3CAX A;  2O9A A;  3UY6 A;  3IX8 A;  4GB7 A;  4GNU A;  4JGR A;  3C4P A;  3QP4 A;  3ITB A;  5IHV A;  2Y2N A;  3UN7 A;  4R4S A;  5A92 A;  5DF7 A;  4QWO A;  3H7W B;  3TSG A;  1J9M A;  4DE0 A;  2A2L A;  1IKG A;  3FC7 A;  3IBJ A;  2GNX A;  3S7P A;  4OOM A;  3V39 A;  2W1T A;  2VEA A;  3ZGA B;  3PTE A;  4P0M A;  5BOH A; 
#chains in the Genus database with same CATH homology
 4GJ4 A;  4H6J A;  5HD5 A;  4DJ2 A;  2W3E A;  5KSH A;  1NWZ A;  5KIZ A;  4HJ3 A;  3OLO A;  2GJ3 A;  1XFQ A;  1KOU A;  3MJQ A;  4JGP A;  5J7E A;  2PHY A;  4ARZ B;  2L1M A;  1OTI A;  3LID A;  4DMZ A;  3LR0 A;  1F98 A;  4G3K A;  3FPW A;  2GZA A;  2W3F A;  2DMW A;  1OTE A;  2A24 B;  4KUK A;  3C2W A;  4Q0H A;  5J4E A;  4Q0J A;  1GSV A;  5L8M A;  1X0O A;  3TW8 A;  5FL3 A;  2HJE A;  5AVE A;  3KSG A;  4NXB A;  2JKT M;  3RFB A;  2YKF A;  3T50 A;  2HF6 A;  4O0P A;  1VHM A;  4EU0 A;  1XFN A;  4DN0 A;  5I5L A;  3MR0 A;  5AJG A;  3LIA A;  3PBQ A;  2J3T D;  5DFY A;  3UB9 A;  3LIC A;  3UE6 A;  2XA7 M;  1OTD A;  4IJG A;  4MN5 A;  2W3D A;  3T4K A;  2LB9 A;  3FPV A;  1P9W A;  2EWW A;  2L4R A;  3LYX A;  5MC7 A;  2QHK A;  3H82 B;  4PHT A;  3BW6 A;  3UB8 A;  1IFQ A;  2P7J A;  1T1A A;  3E4P A;  3H82 A;  3UE3 A;  3PBS A;  2EA9 A;  3VOL A;  2PR6 A;  2D01 A;  4I3I A;  3T4J A;  3KSF A;  5G4Z A;  1XJ2 A;  2GX5 A;  2XRO A;  5F5Y A;  5J3W A;  4WEL A;  1D06 A;  2OWJ A;  4Z1W A;  4Y3I A;  1OJ5 A;  3A0R A;  3E4Q A;  4R70 A;  4B93 A;  3F1N B;  1OT9 A;  2VZW A;  3RH8 B;  2O9C A;  4GS9 B;  3ULF A;  4CLC C;  2K2N A;  3F1O B;  1OTA A;  3NJA A;  4PKY G;  4WUJ A;  2ZMF A;  1DP6 A;  3LR4 A;  4MDZ A;  4LRY C;  1H3Q A;  3NOU C;  3E4O A;  2PYR A;  4HOI A;  2WKR A;  3F1P A;  2JKR I;  4WEK A;  1YSQ A;  2VV7 A;  2O0Y A;  4OOL A;  1EW0 A;  3EQU A;  1NRJ A;  3PR6 A;  4ETZ A;  1P0Z A;  1Y28 A;  2J80 A;  1DRM A;  3A0V A;  4GHI B;  4MMN A;  3S7Q A;  2NUP C;  2VV6 A;  5HWW A;  4B9O A;  3EEA A;  2ZMV A;  4DJ3 A;  2J3T C;  5K5B A;  3MMH A;  3V67 A;  3MFX A;  3K2N A;  5DJU A;  3UME A;  1TS0 A;  1N9N A;  4PAU A;  3H9W A;  3LR5 A;  3BY8 A;  2W3H A;  1G28 A;  5IS1 A;  2V0U A;  2VX8 A;  4HI4 A;  3KSI A;  1T19 A;  3EGD C;  1F9I A;  4MN7 A;  3MQO A;  3PBN A;  3VE4 A;  2VV8 A;  4ARZ A;  1LSV A;  2XA7 S;  4PKY A;  3D72 A;  4E04 A;  3NOP C;  4LRZ E;  3S7N A;  2B02 A;  1TS7 A;  2Y8H A;  4YWZ A;  5HZH A;  5F6A A;  1T18 A;  3CI6 A;  4I38 A;  4CLC B;  4G3V A;  4GLQ A;  4HP9 A;  3K3C A;  3KO6 A;  3H7W A;  3R7W B;  2K7S A;  4HH3 A;  4CQH A;  4L0L A;  5HSQ A;  4GW9 A;  3IBR A;  4JGO A;  3F1P B;  2JN7 A;  3MXQ A;  2I9V A;  2PD7 A;  4F3L A;  2D02 A;  4KQD A;  1N9O A;  3NHQ A;  5HPI A;  3KYZ A;  3PXP A;  5TBM A;  1S4R A;  1OTB A;  1V9Y A;  4L9G A;  2K31 A;  1N9L A;  4P6Z S;  2B18 A;  2HGV A;  4EUV A;  5HDS A;  4HJ4 A;  2PDR A;  1ODV A;  1S1Y A;  2JHE A;  3UMD A;  3PBR A;  4HP4 A;  2JKT I;  2QYB A;  2KDK A;  4HHD A;  1W63 M;  4M4X A;  3BQ8 A;  3C30 A;  3E98 A;  4G3W A;  4Y5F A;  3ICY A;  4EES A;  3PBT A;  4BBU A;  4HQA A;  3LFV A;  1OJG A;  2PR5 A;  1XJ4 A;  3T4S A;  5HWV A;  3P7N A;  4O8G A;  1S1Z A;  3T4O A;  1W63 Q;  3EOI A;  3CWF A;  4K08 A;  5HD3 A;  4Q0I A;  5F68 A;  5DKK A;  2VJW A;  2M7V A;  2L0W A;  2ZOI A;  1LL8 A;  2LB5 A;  3LI9 A;  3OOV A;  3GEC A;  2Y79 A;  4UQI S;  2PD8 A;  1LT0 A;  1XJ3 A;  3EWK A;  4RQ9 A;  3CUE A;  4FSF A;  4BWI A;  4BMW A;  2HJ9 C;  4NEE D;  3LIB A;  1GSX A;  2IA2 A;  2QJ7 A;  1P9R A;  3A0S A;  3MF0 A;  2FH5 A;  4BBV A;  5DKL A;  3VE3 A;  1IOU A;  4I39 A;  4BJP A;  1ZHH B;  1YAX A;  2OWH A;  1T1B A;  4HY8 A;  3S7O A;  4XT2 B;  2EWV A;  3FG8 A;  3BWL A;  5DFX A;  4GCZ A;  1UGU A;  4UEY A;  1H8M A;  5TBM B;  3U2A A;  2PYP A;  2INW A;  1S67 L;  1WA9 A;  2W3G A;  4MN6 A;  4JGQ A;  3TJZ C;  2O9B A;  5IT5 A;  1TF1 A;  2KLI A;  4YOF A;  5EFW A;  1MC0 A;  4LPZ A;  1OT6 A;  1F5M A;  1P97 A;  2VA0 A;  3B47 A;  1BYW A;  4I5S A;  4IHQ A;  3VV4 A;  5HPF A;  3OBF A;  4R3A A;  3CIT A;  4KQO A;  2W0N A;  3LIE A;  4CLC D;  1NLZ A;  4EEP A;  3DBA A;  2CMN A;  4NXE A;  2G7U A;  4XT2 A;  5CX7 A;  2OAQ 1;  2QWS A;  2PT7 A;  2KX6 A;  1LSW A;  3KYQ A;  4L9F A;  1MKM A;  2WKP A;  3JVU A;  3OCL A;  2VKS A;  3LR3 A;  4O01 A;  3BJN A;  4I3J A;  4HIA A;  2V1B A;  1S4S A;  3RTY A;  3CLO A;  2ZOH A;  2ZBB A;  4II7 A;  2JKR M;  2P04 A;  3NOT C;  2MJ6 A;  4FOF A;  2J3W A;  5HL6 A;  4EXO A;  4GHI A;  1TS8 A;  2KOI A;  2V0W A;  3LUQ A;  1T1C A;  1YSP A;  4CLC E;  1STZ A;  3LIF A;  5DF9 A;  3BY9 A;  3EQV A;  1UWN X;  3MQQ A;  3EEH A;  2HV1 A;  1S66 L;  2XRN A;  3C8C A;  4EEU A;  3K3D A;  5F69 A;  1TD5 A;  4WEJ A;  5TJJ A;  3F1N A;  4EER A;  4ETX A;  1VB6 A;  4WL9 A;  4NXF A;  2H28 A;  3PBO A;  4KUO A;  3KSH A;  5HDC A;  1JNU A;  4GS9 A;  2V9A A;  4ZRR A;  2YKH A;  4AFI A;  4R38 A;  3CUE C;  1YKD A;  2R78 A;  2W1R A;  1V9Z A;  2OAP 1;  4Y2F A;  4YNR A;  5HDD A;  3TE8 A;  4F3L B;  2WKQ A;  4I3A A;  3SW1 A;  1D7E A;  3W2Z A;  1TS6 A;  3P01 A;  3LI8 A;  3R7W A;  1DP9 A;  2QKP A;  3G6O A;  4EQ1 A;  2FZ0 A;  3B33 A;  3ZYT A;  3OC2 A;  1NLY A;  2Z6C A;  3HCY A;  3O5Y A;  2O99 A;  4CLC A;  3MQ0 A;  3GDI A;  4QPR A;  5G4Y A;  3BQA A;  1LSX A;  4HNB A;  2W27 A;  5AVF A;  2W1T B;  3T4T A;  4IUH A;  4UQI M;  2A24 A;  3IS2 A;  4LRX C;  2M7U A;  4R6L A;  4EW7 A;  5IU1 A;  3TRC A;  4BBT A;  2V1A A;  2VLG A;  3HJI A;  3HJK A;  4WN5 A;  3JVV A;  2M1C A;  3OCN A;  5A8B A;  2P08 A;  4ME4 A;  5DJT A;  4IUK A;  5LBR A;  3B42 A;  3UB7 A;  3ZQ5 A;  3E0Y A;  3UB6 A;  2BAS A;  1OPX A;  3T4Q A;  4MCW A;  2QJ5 A;  4LLO B;  3C38 A;  3D3O A;  1ZTU A;  1MZU A;  2VGL M;  2Z6D A;  4NKP A;  4HH2 A;  3EGX C;  4WF0 A;  3CAX A;  3PHY A;  2O9A A;  5HWT A;  4P6Z M;  4JGR A;  4NXG A;  2XSS A;  5C5K A;  2VGL S;  3H7W B;  2NUT C;  3T4L A;  3F1O A;  3R4K A;  3KX0 X;  3PYP A;  2A2L A;  3IS2 B;  3FC7 A;  4HJ6 A;  3IBJ A;  1XJ6 A;  2GNX A;  3S7P A;  4OOM A;  4L9E A;  4EET B;  1DP8 A;  1GSW A;  1G6O A;  2OOL A;  2W1T A;  2VEA A;  4H6J B;  4WLA A;  1UWP X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...