4DJ2A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
307
structure length
276
Chain Sequence
DMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTEKSVFCRIRGGRYQPFRLTPYVTKIRVAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPDSDIQELSEQIHRLLLQPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Period circadian protein homolog 1
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 276
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj2A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj2A02
2JHEA 1OJGA 3LIEA 1TS0A 1G28A 2V1AA 5DJTA 2QHKA 3UMEA 5HD5A 5A8BA 5DKLA 2OWJA 1ODVA 4EEUA 2KDKA 5EFWA 1Y28A 4GW9A 1LSVA 2QKPA 1NWZA 1D06A 4PKYA 4HI4A 3MXQA 4PKYG 5HSQA 3K3DA 2R78A 3CWFA 5TBMB 1EW0A 5HDSA 4EW7A 4XT2A 4R3AA 4GHIB 2I9VA 1XJ4A 2PYPA 3UB8A 2YKHA 3H82B 3CAXA 3E4OA 4LPZA 1GSWA 1OJ5A 2OOLA 4HQAA 2L0WA 5F5YA 5HWWA 2L1MA 3PHYA 5HDCA 2PDRA 1XFNA 2EA9A 5IU1A 2D01A 2ZBBA 1V9YA 4I5SA 4LRXC 2INWA 5AVFA 3A0SA 2QJ7A 5HZHA 5J3WA 2M1CA 3GECA 2PD7A 5HWVA 3A0RA 2VLGA 3LIBA 4HIAA 4HP4A 3NOPC 5HDDA 3VOLA 4GS9A 3LI8A 1DP9A 4EESA 1F98A 2GJ3A 3HJIA 2V0UA 1TS8A 3FG8A 3GDIA 4GS9B 1OTDA 4HH3A 3LIAA 4HNBA 3PYPA 3P7NA 3H7WA 4WUJA 1UGUA 4EERA 4HJ6A 4NXFA 1XJ2A 1XJ6A 2PR6A 1LSWA 3ULFA 1S67L 3F1PA 2H28A 1S1ZA 1UWPX 4NXGA 3C8CA 2A24A 5I5LA 3OLOA 2KX6A 1UWNX 3LI9A 3BWLA 4KQDA 3MJQA 2K7SA 3LUQA 4LRZE 4GCZA 1JNUA 1P0ZA 4JGPA 3SW1A 4JGRA 2VV7A 1V9ZA 3B33A 3NJAA 3LIFA 4LRYC 1P97A 1TS7A 4M4XA 2VV6A 4L9GA 1T1CA 5F6AA 4LLOB 4HP9A 4RQ9A 4HHDA 4EEPA 3MFXA 2WKPA 3T50A 2W27A 2PD8A 3UB6A 1GSXA 2YKFA 4L9FA 2OWHA 3F1NA 3BY8A 3UB7A 4XT2B 4WLAA 4I3IA 4I3AA 4F3LA 1XJ3A 3EEHA 2QJ5A 3FC7A 5DKKA 3H9WA 1T1AA 3RTYA 3NOTC 2PHYA 2Z6CA 4WF0A 4H6JA 2B02A 4E04A 4KUOA 4EQ1A 1TS6A 4R6LA 4DJ3A 2V9AA 5F68A 3UB9A 1N9OA 5J7EA 1D7EA 5KIZA 3IS2A 4EETB 2PYRA 3G6OA 2D02A 4K08A 3A0VA 1T1BA 3F1OA 1GSVA 3HJKA 1X0OA 1DP8A 3D72A 4NXBA 2ZOHA 1T18A 1MZUA 1DRMA 3H7WB 2CMNA 1OTEA 4JGQA 3LICA 1WA9A 3F1PB 3NOUC 2PR5A 2A24B 4HJ4A 4JGOA 1OTIA 5HWTA 5G4YA 4HY8A 2L4RA 2WKQA 2J80A 1S66L 2BASA 4I39A 1XFQA 4BBTA 2ZOIA 3NHQA 5J4EA 5G4ZA 4DJ2A 5AVEA 4R70A 3VE3A 4HJ3A 2JN7A 4WL9A 3ZQ5A 4R38A 1S1YA 2V1BA 5TBMA 1LT0A 4BBVA 1OTAA 1F9IA 4GHIA 2W0NA 3H82A 1OT6A 3F1NB 3E4PA 3KX0X 4YWZA 1N9LA 2VEAA 1DP6A 5HD3A 3VE4A 5F69A 1S4RA 1OTBA 3C2WA 4F3LB 3LYXA 4KUKA 3ICYA 3E4QA 4B9OA 4H6JB 2P7JA 1LL8A 3BY9A 4L9EA 3LIDA 4NXEA 3K3CA 2QWSA 4WN5A 1KOUA 1T19A 3IS2B 2HV1A 2Z6DA 1BYWA 4I3JA 4BBUA 4I38A 3EWKA 3MQOA 3MQQA 1N9NA 1S4SA 2V0WA 3F1OB 5IS1A 1VB6A 3MR0A 2VV8A 4MN6A 4HH2A 3RH8B 4MN5A 3UE6A 1OT9A 1LSXA 3IBRA 3CLOA 2WKRA 4HOIA 5DJUA 3UMDA 4EXOA
chains in the Genus database with same CATH superfamily
3S7NA 1TS0A 3BLSA 5EPHA 5DJTA 4X56A 1D1JA 4R4SA 2MJ6A 5HD5A 3BFDA 3FKWA 4UA6A 3S22A 1ONHA 5AQAA 2Y59A 2KDKA 1H5XA 1LSVA 2ZC7A 4KZ8A 5K5BA 1NWZA 5C5KA 2A3UA 3KYZA 1YSPA 5HSQA 1MXOA 2HDSA 2O9BA 3WWXA 2Q0OA 3CI6A 1PW1A 1K55A 4HBUA 5E2GA 5HDSA 4OPZA 2ZMVA 2Y2HA 3IXDA 4XT2A 4GHIB 2JC7A 2I9VA 3VP3A 5FAOA 3VV4A 4K0XA 3MS6A 2C5WB 4S2KA 2PT7A 5HWWA 1F2KA 2G7UA 1E3UA 2PDRA 2VKSA 1XFNA 4KZBA 4Q0HA 4EQIA 3M2JA 4E6XA 4ZJ1A 4I5SA 3ZG7B 4E3LA 1K4FA 2Y8HA 3A0SA 3CUEA 5HZHA 5J3WA 3G31A 3WS1A 5CRFA 2PD7A 3A0RA 3IX4A 4WZ4A 4ETXA 3B47A 3DTKA 5KMWA 5HDDA 3VOLA 4GS9A 3UPNA 2K2NA 4WELA 5GLCA 2HPBA 1DP9A 1XXMA 5DVAA 2NUPC 3G4PA 2X02A 1E4DA 1F98A 4GS9B 3OPHA 4C6YA 5FI6A 3EOIA 4R4RA 3HVFA 3PYPA 1CI8A 3DAVA 3SH8A 1UGUA 3EEAA 1VETB 1HLUP 3FZCA 2JE5A 3QP8A 1K54A 4BWIA 3FPVA 4OOYA 1S1ZA 4X55A 1GHPA 2JKRM 3KO6A 1KGEA 3T4OA 2KX6A 1N9BA 1UWNX 1RGZA 5DFXA 4U3TA 1TDGA 2K7SA 3LUQA 5EVLA 4DRTA 2BG1A 4GCZA 2WUQA 3Q7VA 2GDNA 1V9ZA 4RX3A 1P9WA 1IFQA 4MBKA 1TS7A 4M4XA 4OVDA 4L9GA 2QMIA 4DKIA 5F6AA 1IKIA 3Q1FA 5A92A 4HP9A 5CTNA 3PXPA 2E8IA 3HREA 1SKOB 4EEPA 3C7UA 3MFXA 3T4JA 1JWPA 3R7WB 1NRJA 2W27A 3N7WA 3O5YA 1GSXA 4L9FA 3F1NA 2Z2LB 3C5AA 3M2KA 3HLEA 3TOIA 5FA7A 4WLAA 4I3IA 4I3AA 3B3XA 4OP5A 3EEHA 4AFIA 4X1LA 1TF1A 2IWDA 2QJ5A 1XKZA 3G32A 4PM7A 3RXXA 3EGXC 4WF0A 2B95A 3DTIA 4JF5A 1IKGA 2ZC5B 4GD8A 4KUOA 4R1GA 3QP5A 3CJMA 4EU0A 2Y2QA 2HF6A 2M7UA 3LY3A 1BLSA 4E3NA 1ZTUA 1Q2PA 2PBYA 4OQGA 5FASA 3NY4A 5KIZA 2W3EA 4Y3IA 1Y4OA 1J3WA 4BLMA 5TJJA 5AQ7A 1TVFA 3NECA 2W1TB 1IYSA 3VMAA 2OLUA 4K08A 4FD8A 2ZL1B 3ZDJA 1YLPA 3F1OA 2Y2IA 3HJKA 1X0OA 1YLWA 1W79A 4UEYA 5HX9A 5DTKA 4GD6A 1GHMA 4NG2A 4MLLA 4MNRA 5L07A 3V5MA 2CMNA 2O9AA 3O86A 3UPOA 4JGQA 4WZ5C 2Y2MA 4KG6A 3O87A 3MZFA 2EFUA 3SS3A 4LV0A 4PM5A 1ZG6A 4OKPA 1TDLA 5DTTA 5G4YA 3UDIA 1CJFA 2L4RA 2WKQA 1S66L 3MKEA 2PAVP 3MMHA 5HPIA 1DJCA 2XH9A 1XFQA 1VEUB 4JXSA 3ZNTA 3ZVWA 3NHQA 3U2AA 1PI5A 4JBFA 4DJ2A 1YLTA 4R70A 3DWKA 3VE3A 4QWOA 4MDZA 4LENA 3ZQ5A 4ZJ2A 3C4OA 4R0QA 4QB8A 1PZOA 1Q2QA 3DWZA 4GOGA 1CEFA 3KYEA 4K91A 3A3FA 1HZOA 1LT0A 1XGIA 3CPTB 4C3QA 2XSSA 4DN0A 3H82A 1FIKA 4MCWA 3A3IA 1YLYA 3RXWA 5KSCA 4P6ZM 3NDEA 5D3OA 1LL5A 3ZYTA 5HD3A 4PPRA 3MQ0A 3U4LP 1YLZA 4OOMA 3LYXA 3HLBA 4R3BA 2XR0A 2ZC6B 4BQMA 3AGDA 5FDSA 2Y2KA 5E2FA 1I2WA 3ZG5A 3IHAA 1FCOA 5FQMA 1LL8A 4OQ0A 4S2NC 3MBZA 2QWSA 5F1GA 1ESIA 4OPRA 4KG2A 3CITA 5HARA 2VJWA 1M6KA 3IS2B 3ZVTA 4E3KA 3DTEA 4I38A 2GNXA 2V0WA 5IS1A 1VB6A 5JYOA 1XGJA 1HD8A 2Z2MB 4QJGA 1CEGA 4QPRA 1LSXA 4KG5A 4G3KA 5CX7A 1P9RA 1I5QA 2XFTA 1IEMA 4EXOA 3MSHA 3N6IA 5FAQA 1S6RA 4X6TA 2XDMA 1BUEA 5A8BA 5DKLA 4OQHA 5FDHA 2OWJA 2LB5A 1ODVA 3PBRA 3NDGA 3T1XA 1KVMA 2XEPA 2VGJA 1D06A 1RGYA 3MXQA 2GZAA 2X01A 3HLWA 4PKYG 1MBLA 2J7VA 2R78A 2WGWA 5F82A 4EW7A 2HJEA 3SZTA 2HDQA 2PYPA 5FSRA 5HW3A 1IYPA 4LPZA 1GSWA 4BD1A 4P6ZS 3C4PA 1K55C 4PAUA 2XGNA 2PBDP 3PHYA 5FL3A 5HDCA 2EA9A 2EXBA 3IH9A 5IU1A 2D01A 1W7FA 2HP6A 2W3DA 1L0FA 4QD4A 1V9YA 2Y2OA 3OZHA 3VP4A 3JPUA 4LRXC 3NBLA 5AVFA 2P9VA 3WRTA 2WAEA 4QY6A 3MXSA 3HLFA 3O88A 4Q0IA 1OPXA 5HWVA 3TRCA 2VLGA 1CI9A 5EVIA 1CF0A 2WYXA 4UA7A 3LI8A 2AVXA 1H8MA 3OC2A 5EECA 2WAFA 1QMFA 4UQIM 1NJ4A 5EM0A 2V8FA 4EESA 4UHUA 5CEBA 1TS8A 3GDIA 3S7QA 1OTDA 4E3OA 1W8QA 3NIAA 3SH7A 4ESPA 5I94A 3TJZC 3P7NA 3H7WA 3IBJA 2V1ZA 1LHYA 4NXFA 4L0LA 2PR6A 1RCJA 1YT4A 4O01A 1S67L 3F1PA 4NXGA 4MMNA 4O7DA 1YPRA 3OLOA 2JKFA 5FQ9A 1AXBA 3LI9A 2XK1A 4RVAA 3E2LA 2ZM8A 2WZZA 4E3JA 1K54C 1ES3A 4CLCA 3BFCA 2VV7A 4XXRA 3LIFA 2OSUA 2XD5A 1GA9A 4EV4A 4EUVA 3T4SA 2VV6A 3I7JA 4MN7A 3BM6A 4LLOB 4MEZA 3Q07A 3LEZA 1NLYA 4HHDA 5A90A 2FZ0A 3UDXA 3T4LA 4B4XA 1Z6FA 2PD8A 3UB6A 2YKFA 1YMSA 3UE1A 1FR1A 4B4ZA 4N1XA 3BYDA 3IWIA 4S2OA 4XT2B 2J8YA 4RX2A 4U0TA 2XF3A 2EWWA 2B18A 1O07A 5GHXA 5L10A 4F3LA 5A91A 4U0XA 5DF9A 4G3VA 4JKTA 3FC7A 3VSLA 3H9WA 1ZKJA 1MPLA 3NOTC 2PHYA 4NKPA 5AQ9A 2EX6A 4EQ1A 3IF5A 2LB9A 2VZWA 5EUAA 2PRFA 4WMCD 1IOUA 2JKTI 2V9AA 2OAQ1 4DJ3A 4WYYA 5F68A 2HP5A 4OLGA 3P98A 2ZLYA 3S7OA 2H5SA 2ZQAA 1G5UA 3AGFA 5GHZA 1PNEA 1IELA 4EBLA 3ZGAB 4A5RA 2PYRA 1TD5A 1Y54A 1SHVA 5GLDA 1EI5A 3UO9A 2ZD8A 4UQIS 5AQBA 5CHUA 4XUZA 2OV5A 2H10A 4PM9A 1GSVA 4NXBA 4HBTA 2ZOHA 2ZC3B 3ZHHA 1MZUA 1DRMA 3T1QB 4DMZA 3HLDA 3AGEA 4ID4A 4LV2A 4IUKA 4LCMA 1YQSA 2EFXA 1OTIA 1FR6A 5HWTA 1VHMA 3WS2A 2HZ5A 2J80A 3C30A 4GDBA 4X69A 3M6BA 1W63Q 3Q7VB 4BBTA 5J4EA 5AVEA 4KZ3A 1YM1A 3EGDC 1XPBA 1FOFA 4KZ4A 3G35A 4S2IA 1E3UD 1FCNA 5DF8A 2V1BA 5TBMA 3ZG9B 4P87A 3GMWA 1KGFA 3IWQA 1PWCA 3SOIA 1OTAA 5FI2A 2VA0A 2W0NA 1GHIA 1XA7A 3F1NB 3KYQA 4XUXA 3KX0X 4YWZA 3HBRA 1S4RA 1OTBA 1JWZA 3C2WA 1NXYA 3V3RA 2Q9MA 3Q7ZA 2RL3A 1XX2A 2XQZA 3GVBA 1L2SA 3IXHA 2QZ6A 1N4OA 2QYBA 1ONGA 1ZC2A 2JBFA 5F83A 3N4IA 4S2PA 5MC7A 4GNUA 3GV9A 2P7JA 2GX5A 2HP9A 3BY9A 3LIDA 4NXEA 1TEMA 3K3CA 3BQ8A 1BZAA 3V39A 1NYMA 3BFGA 4BMWA 2B5RA 4Y5FA 5EOOA 1ES5A 2XROA 2ZQ9A 1K56A 1KOUA 5FATA 1T19A 4GN2A 2JKGA 4NEED 5BOHA 1W63M 3BFFA 4FCFA 5EOEA 4I3JA 4DXBA 2XA7M 2RCXA 3MQOA 2Y4AA 3LFVA 1S4SA 4JXWA 3DTMA 3F1OB 1K25A 4DDYA 3MR0A 1IYQA 1L3LA 3QP2A 4HH2A 1VQQA 3LEQA 4D60A 2C6WB 1HVBA 3IBRA 3W4PA 3BEBA 4X53A 4IJGA 3S4XA 2A2LA 4EWFA 3GQZA 1RP5A 4MBFA 2JHEA 3BQAA 1NY0A 2P08A 2BTFP 2J9OA 3UMEA 2WZXA 4BJPA 5EFWA 3WS0A 1Y28A 4GW9A 5M19A 3ZG0A 1BULA 1M40A 2QKPA 5CEDA 4N1HA 4DE2A 3WRZA 5CGXA 5TR7A 4OPQA 4KQOA 3K3DA 3CWFA 1ZG4A 3T1RA 4KZ9A 3QNCA 1EW0A 3T4KA 4QHCA 5L09A 3PTEA 3D9YA 2VGLM 3PR6A 4R3AA 2UWXA 3H82B 4BD0A 3CAXA 1DJBA 2V2FF 3MZDA 5FQJA 3IF6A 2ZQ8A 1ES2A 2WGIA 2L1MA 2WKEA 4O0PA 4R23A 1G68A 1QMEA 1ALQA 4P6BA 4GDNA 1L0DA 3KSGA 2M1CA 2XFSA 1I2SA 2G2WA 3GECA 4ARZA 2J9PA 4HIAA 3PBOA 3VP2A 1MWTA 1L0EA 4D2OA 4WEKA 5TGFA 3GSGA 3IXBA 2Y91A 4IBXA 2J3TC 1BSGA 5EE8A 3LR4A 3HJIA 5F1FA 2XA7S 3FG8A 4F94A 5EVIC 1BLHA 3K2NA 3KSIA 4HNBA 2IWCA 3W4OA 4WUJA 1YLJA 3UN7A 3T1SA 1BLPA 3G2YA 3A3JA 1XJ2A 2EXAA 4DF6A 3CZDA 1NZUA 2QPNA 3ULFA 3DW0A 1ZHHB 1PZPA 4FTXA 4Y2FA 1UWPX 2A24A 5I5LA 1O7EA 3VSKA 1STZA 2ZMFA 1LL9A 4N92A 4MBHA 3BWLA 4KQDA 3UB5P 3ZCZA 3CHWP 2Y2NA 4LRZE 4ME4A 3HCYA 3QNBA 4X68A 3OCNA 4FSFA 4E6WA 2OLVA 4JGPA 3DBAA 5LBRA 3WS4A 4CJNA 4JGRA 3NJAA 4Y0UA 1P97A 2XRNA 2JKRI 4P85A 4HESA 1YKDA 4JLFA 3EQUA 4IEDA 5GLAA 3W8KA 2J3WA 4PM8A 2DRWA 4CLCC 4NETA 3ITBA 5FEFA 1PW8A 1W8YA 5HPFA 1EWZA 1PYYA 2WGWB 3E98A 4PM6A 5DF7A 1NRFA 2VGLS 2IA2A 1KDSA 3NCKA 2H0TA 4PHTA 5CHMA 4LGWA 1XJ3A 3S1YA 4YOFA 5HAIA 5EM1A 3JVUA 5L8MA 1T1AA 4X25A 4S2MA 3RTYA 2Z6CA 3P09A 3IT9A 4S2NA 3D4FA 4H6JA 2B02A 5FQIA 3HUMA 2ACGA 4R6LA 2P9VB 1G6OA 3MFDA 4FH2A 5J7EA 4KENB 5M1AA 1D7EA 3CUEC 4Y15A 3PAEA 2K31A 1VM1A 4YINA 5EVIB 4LV1A 4Z1WA 3G6OA 2W3GA 4GZBA 2PU2A 3V3SA 2ZQCA 2Y2LA 4IBRA 3D72A 1DP8A 3NULA 1ERQA 3MZEA 3VP1A 5JYPA 1CQAA 2O99A 3HLCA 1T18A 5L2FA 3UPPA 3H7WB 2EX9A 3TSGA 2OAP1 1MKMA 3ZFZA 1WA9A 4OONA 2JCHA 2KLIA 2G2UA 3E0YA 1SDNA 3F1PB 4BL2A 3VP0A 3NOUC 4Y7PA 1K57A 1K38A 2PR5A 4HJ4A 4JGOA 3MXRA 2DCFA 4HY8A 4O8GA 1NZOA 4DE0A 4Y0TA 1F5MA 1WE4A 2HDRA 1NLZA 1PFLA 4I39A 1KDWA 2W1RA 4CLCB 5CTMA 2ZOIA 3G30A 5G4ZA 3QP1A 2JN7A 4HEFA 3IHBA 4UAAA 2XLNA 1YAXA 4DXCA 1S1YA 3BLMA 3PAGA 1A0KA 3SS4A 4BBVA 2P04A 4GHIA 5HL1A 3BJNA 4Q8IA 4JXVA 1ES4A 2J3TD 1JTGA 1N9LA 3GRJA 1BT5A 5F69A 1PWGA 4F3LB 5EVID 2H0YA 1JTDA 4DE3A 4KUKA 3V50A 4ZBEA 4KQRA 4IUHA 4Z9QA 2M7VA 3LGOA 4JXGA 3G2ZA 3FKVA 3GTCA 3E4QA 4OOLA 1MWUA 4B9OA 5EVEA 4GLQA 3TE8A 2P74A 3BW6A 4DE1A 3C7VA 4K0WA 1MWSA 5HAQA 5E2HA 3LR0A 5CXWA 3O3VA 4M3KA 1SZVA 3LY4A 4N9LA 2HV1A 2Z6DA 1BYWA 1H8YA 4H8RA 3MKFA 3MQQA 3UNWA 4EUZA 3IX8A 3GR2A 4JPMA 5TFQA 2WK0A 1VETA 2KOIA 3FV7A 3D3OA 4CLCD 4GJ4A 5GL9A 4MN5A 4ZJ3A 1OT9A 5AJGA 3BFEA 3CLOA 2FFYA 1FQGA 2WKRA 2Y2JA 5KZHA 3OPRA 4HOIA 2HGVA 1ERMA 5DJUA 3UMDA 3ZNYA 1YMXA 1EROA 1MKIA 1OJGA 3LIEA 1G28A 2V1AA 2QHKA 4LV3A 4X1MA 3NI9A 5EV0A 5FQKA 3E2KA 4EEUA 4QU3A 2ZMAA 4ZDXA 1SKOA 5CERA 4PKYA 1KE4A 4HI4A 3V67A 2HDUA 3R7WA 1KE3A 3ITAA 4WM9A 3IH8A 3T4QA 5TBMB 3RJUA 2VGKA 2ZM2A 1KVLA 1XJ4A 3UB8A 2YKHA 2E8JA 3E4OA 2DNSA 1OJ5A 2OOLA 4HQAA 4RA7A 2L0WA 4R3JA 1LLBA 4P0MA 5F5YA 2R9XA 1J9MA 1KE0A 1PIOA 3LR5A 4Q0JA 2ZBBA 3CG5A 4GKUA 3T4TA 3LR3A 4OLDA 2X71A 3VFFA 4FOFA 2INWA 1CK3A 3KSHA 2QJ7A 1W5DA 2ZC4B 3IF6C 2Y79A 1Z09A 3LIBA 5E2EA 2ZQ7A 3N8RA 4HP4A 3FPWA 4Y17A 1MY8A 3NOPC 2W1TA 3FYZA 3OCLA 3KSFA 3PBQA 3QP4A 2ZL1A 2A49A 5IHVA 2GJ3A 2O9CA 4CLCE 3PBSA 2V0UA 3WS5A 3P01A 2W3HA 4G3WA 3C38A 4HH3A 4EBPA 3QHYA 4IVKA 3LIAA 2CC1A 4OPYA 2HJ9C 5J8XA 2VX8A 4HJ6A 4B88A 4EERA 3IX3A 4S2LA 1XJ6A 1SKFA 4CQHA 1LSWA 5HAPA 2EWVA 5CGSA 2H28A 3C8CA 5U47A 3ZG8B 1BTLA 1JWVA 3OOVA 4OH0A 2ZQDA 3LO7A 2IWBA 3MJQA 2Y2GA 1ESUA 4C75A 1GCEA 1WYBA 1PRQA 3W4QA 1JNUA 1P0ZA 1VEUA 3SW1A 5CECA 3OPPA 3B33A 4LRYC 2Y2PA 3W2ZA 1T1CA 4RQ9A 3A3EA 3IQAA 2WADA 4GB7A 4Y0OA 3TG9A 2WKPA 3VOYA 3T50A 1DJAA 4KZ7A 4KZ5A 3CPTA 4CPKA 4S2JA 3T12B 2BLSA 1H8ZA 4LCLA 2OWHA 5CGWA 3BY8A 3VOZA 3UB7A 4YFMA 1WYCA 3HUOA 2EX8A 2JKTM 2Q9NA 1DY6A 3RFBA 3PBTA 1NYYA 5HL6A 3M6HA 4B93A 5DKKA 3IF6B 1FCMA 1K56D 4FH4A 5M18A 1IYOA 4IHQA 4E04A 3BECA 4KQQA 1TS6A 1XA1A 1JVJA 3G34A 2VK3A 5FQQA 1HTZA 1H3QA 1N9OA 3UB9A 4ZRRA 3UY6A 2EX2A 5KSHA 4OP8A 1LI9A 4ARZB 4NK3A 3IS2A 4ZTKA 5GLBA 3OPLA 3NC8A 4EETB 3TW8A 3MF0A 4II7A 5E43A 2W3FA 2D02A 4EBNA 1K0KA 4WZ5A 3PBNA 4YNRA 3A0VA 1PWDA 1T1BA 5FI7A 4KZ6A 5CHJA 4ETZA 1BLCA 1AWIA 1MC0A 2O0YA 1MWRA 3BRMA 1FSWA 1K6SA 3UE0A 1YSQA 1OTEA 2Y55A 2XD1A 3HL9A 4KZAA 3LICA 2WKIA 4WEJA 5G18A 5HFOA 2A24B 4DDSA 4BENA 3SH9A 4N9KA 3R4KA 4IVIA 4PMAA 2BASA 1E25A 3LCEA 1K57C 1FSYA 4HJ3A 4LFUA 5A93A 4WL9A 1H0MA 4R38A 4UA9A 4RYEA 4E3MA 3EQVA 1KGGA 1SDEA 1FILA 3L7HA 2UV0E 3Q81A 3UE3A 3IWOA 1F9IA 4Y13A 4E3IA 5DFYA 1L0GA 2ZJ9A 1OT6A 3SS5A 1G6AA 3E4PA 2V20A 3N8LA 2VEAA 1DP6A 3VE4A 1GA0A 3IXGA 2R9WA 3JVVA 3ISGA 3HLGA 3ICYA 5IT5A 4H6JB 2DMWA 4JF4A 1SCWA 5FEGA 5FAPA 4L9EA 1U60A 3Q82A 2WKHA 5DTSA 2ZM0A 1XP4A 4WN5A 3N8SA 2FH5A 3JYIA 4FUWA 1OMEA 2FFFB 4BBUA 3EWKA 3VFHA 3L9KA 4WMCA 1N9NA 1LI0A 3B42A 3QP6A 2NUTC 2V8CA 2PU4A 4QY5A 1K4EA 2I72A 3S7PA 3UDFA 2VV8A 2WGVA 4MN6A 3A3DA 4ZAMA 1ACFA 3RH8B 3UE6A 5GHYA 3FWLA 3OBFA 1K6RA 4JF6A 4OQIA 3CMZA 4BL3A 4WBGA 1S0WA 3HUNA 1PI4A 1C3BA
chains in the Genus database with same CATH topology
2JHEA 1OJGA 3LIEA 3S7NA 1TS0A 3BQAA 1G28A 2V1AA 5DJTA 2P08A 2QHKA 2MJ6A 3UMEA 5HD5A 5A8BA 5DKLA 2OWJA 4BJPA 2LB5A 1ODVA 3PBRA 4EEUA 2KDKA 5EFWA 1Y28A 4GW9A 1LSVA 5K5BA 2QKPA 1NWZA 5C5KA 1D06A 4PKYA 4HI4A 3V67A 3MXQA 3KYZA 2GZAA 3R7WA 1YSPA 4PKYG 5HSQA 4KQOA 3K3DA 2O9BA 2R78A 3CWFA 3CI6A 3T4QA 5TBMB 1EW0A 5HDSA 3T4KA 4EW7A 2ZMVA 4XT2A 2HJEA 2VGLM 3PR6A 4GHIB 4R3AA 2I9VA 1XJ4A 2PYPA 3UB8A 3VV4A 3H82B 2YKHA 3CAXA 3E4OA 4LPZA 1GSWA 1OJ5A 2OOLA 4HQAA 2L0WA 4P6ZS 2PT7A 5F5YA 5HWWA 2G7UA 4PAUA 2L1MA 3PHYA 5FL3A 5HDCA 4O0PA 2PDRA 2VKSA 1XFNA 2EA9A 3LR5A 4Q0JA 5IU1A 2D01A 2ZBBA 4Q0HA 2W3DA 1V9YA 3T4TA 3LR3A 4I5SA 4LRXC 2Y8HA 2INWA 4FOFA 5AVFA 3A0SA 3KSHA 3CUEA 2QJ7A 5HZHA 5J3WA 3KSGA 2M1CA 2Y79A 3GECA 4Q0IA 1OPXA 4ARZA 2PD7A 5HWVA 3A0RA 3TRCA 2VLGA 3LIBA 4HIAA 3PBOA 4HP4A 3FPWA 4ETXA 3B47A 3NOPC 2W1TA 5HDDA 4WEKA 3VOLA 4GS9A 3OCLA 2K2NA 4WELA 3KSFA 3LI8A 1H8MA 3OC2A 3PBQA 1DP9A 2NUPC 4UQIM 2J3TC 4EESA 1F98A 2GJ3A 3HJIA 3LR4A 2O9CA 4CLCE 3PBSA 2V0UA 2XA7S 1TS8A 3FG8A 3GDIA 4GS9B 3S7QA 1OTDA 3P01A 2W3HA 4G3WA 3C38A 4HH3A 3K2NA 3EOIA 3KSIA 3LIAA 4HNBA 3PYPA 3TJZC 3P7NA 3H7WA 2HJ9C 4WUJA 3IBJA 1UGUA 2VX8A 3EEAA 4HJ6A 4EERA 4NXFA 4L0LA 1XJ2A 1XJ6A 2PR6A 4CQHA 1LSWA 4O01A 4BWIA 2EWVA 3ULFA 3FPVA 1S67L 3F1PA 1ZHHB 4Y2FA 2H28A 1S1ZA 1UWPX 4NXGA 2JKRM 3C8CA 2A24A 4MMNA 3KO6A 5I5LA 3T4OA 3OLOA 2KX6A 3OOVA 1UWNX 3LI9A 5DFXA 1STZA 2ZMFA 3BWLA 4KQDA 3MJQA 2K7SA 3LUQA 4LRZE 4ME4A 3HCYA 4GCZA 3OCNA 4FSFA 1JNUA 1P0ZA 4JGPA 4CLCA 3DBAA 5LBRA 3SW1A 4JGRA 2VV7A 1V9ZA 1P9WA 3B33A 1IFQA 3LIFA 3NJAA 4LRYC 4EUVA 1P97A 2XRNA 1TS7A 2JKRI 4M4XA 3T4SA 2VV6A 4MN7A 3W2ZA 4L9GA 1T1CA 5F6AA 1YKDA 4LLOB 3EQUA 4HP9A 4RQ9A 1NLYA 3PXPA 2J3WA 4HHDA 4EEPA 3MFXA 3T4JA 2FZ0A 4CLCC 2WKPA 3T4LA 3T50A 3R7WB 1NRJA 2W27A 2PD8A 3UB6A 3O5YA 1GSXA 2YKFA 4L9FA 5HPFA 3E98A 2OWHA 3F1NA 3BY8A 3UB7A 4XT2B 4WLAA 2VGLS 2IA2A 4I3IA 4I3AA 2EWWA 2B18A 2JKTM 4PHTA 4F3LA 1XJ3A 4YOFA 3EEHA 3RFBA 4AFIA 5DF9A 4G3VA 3PBTA 1TF1A 5HL6A 3JVUA 2QJ5A 3FC7A 5L8MA 4B93A 5DKKA 3H9WA 1T1AA 3RTYA 3NOTC 3EGXC 2PHYA 2Z6CA 4WF0A 4IHQA 4NKPA 4H6JA 2B02A 4E04A 4KUOA 4EQ1A 1TS6A 2LB9A 2VZWA 1IOUA 4R6LA 4EU0A 2JKTI 2V9AA 2OAQ1 4DJ3A 2HF6A 5F68A 1G6OA 2M7UA 1H3QA 1N9OA 3UB9A 5J7EA 1ZTUA 4ZRRA 3S7OA 5KSHA 1D7EA 4ARZB 3CUEC 5KIZA 2W3EA 4Y3IA 3IS2A 2K31A 5TJJA 4EETB 3TW8A 2W1TB 2PYRA 3MF0A 4Z1WA 4II7A 1TD5A 3G6OA 2W3GA 2W3FA 2D02A 4K08A 4UQIS 3PBNA 4YNRA 3A0VA 1T1BA 3F1OA 1GSVA 3HJKA 1X0OA 1DP8A 3D72A 4ETZA 4NXBA 4UEYA 2O99A 2ZOHA 1T18A 1MZUA 1MC0A 1DRMA 2O0YA 3H7WB 4DMZA 2CMNA 2O9AA 1YSQA 1OTEA 4JGQA 2OAP1 1MKMA 3LICA 1WA9A 4IUKA 2KLIA 3E0YA 4WEJA 3F1PB 3NOUC 2PR5A 2A24B 4HJ4A 4JGOA 1OTIA 5HWTA 5G4YA 1VHMA 4HY8A 4O8GA 2L4RA 2WKQA 2J80A 1S66L 1F5MA 3C30A 3R4KA 1NLZA 2BASA 4I39A 3MMHA 5HPIA 2W1RA 1XFQA 1W63Q 4CLCB 4BBTA 2ZOIA 3NHQA 3U2AA 5J4EA 5G4ZA 4DJ2A 5AVEA 4R70A 3VE3A 3EGDC 4HJ3A 2JN7A 4WL9A 4MDZA 3ZQ5A 1YAXA 4R38A 1S1YA 3EQVA 2V1BA 5TBMA 1LT0A 3UE3A 4BBVA 1OTAA 1F9IA 2P04A 4GHIA 2VA0A 2XSSA 2W0NA 4DN0A 5DFYA 3H82A 3BJNA 1OT6A 3F1NB 4MCWA 3KYQA 3E4PA 4P6ZM 3KX0X 4YWZA 2J3TD 1N9LA 2VEAA 3ZYTA 1DP6A 5HD3A 3VE4A 5F69A 1S4RA 3MQ0A 1OTBA 3C2WA 4F3LB 4OOMA 3LYXA 4KUKA 4IUHA 3JVVA 2M7VA 2QYBA 3ICYA 5IT5A 3E4QA 4OOLA 4B9OA 4H6JB 5MC7A 2DMWA 2P7JA 2GX5A 4GLQA 3TE8A 1LL8A 3BY9A 3BW6A 4L9EA 3LIDA 4NXEA 3K3CA 3BQ8A 2QWSA 4BMWA 3LR0A 4Y5FA 3CITA 2XROA 4WN5A 1KOUA 2VJWA 1T19A 3IS2B 2FH5A 4NEED 1W63M 2HV1A 2Z6DA 1BYWA 4I3JA 2XA7M 4BBUA 4I38A 3EWKA 3MQOA 3MQQA 1N9NA 3B42A 3LFVA 2GNXA 1S4SA 2V0WA 2NUTC 3F1OB 5IS1A 3S7PA 1VB6A 3MR0A 2VV8A 4MN6A 2KOIA 3D3OA 4HH2A 4CLCD 4QPRA 3RH8B 4GJ4A 4MN5A 3UE6A 1OT9A 1LSXA 3IBRA 5AJGA 3OBFA 4G3KA 5CX7A 1P9RA 3CLOA 4IJGA 2WKRA 2A2LA 4HOIA 2HGVA 5DJUA 3UMDA 4EXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHE A;  1OJG A;  3LIE A;  1TS0 A;  1G28 A;  2V1A A;  5DJT A;  2QHK A;  3UME A;  5HD5 A;  5A8B A;  5DKL A;  2OWJ A;  1ODV A;  4EEU A;  2KDK A;  5EFW A;  1Y28 A;  4GW9 A;  1LSV A;  2QKP A;  1NWZ A;  1D06 A;  4PKY A;  4HI4 A;  3MXQ A;  4PKY G;  5HSQ A;  3K3D A;  2R78 A;  3CWF A;  5TBM B;  1EW0 A;  5HDS A;  4EW7 A;  4XT2 A;  4R3A A;  4GHI B;  2I9V A;  1XJ4 A;  2PYP A;  3UB8 A;  2YKH A;  3H82 B;  3CAX A;  3E4O A;  4LPZ A;  1GSW A;  1OJ5 A;  2OOL A;  4HQA A;  2L0W A;  5F5Y A;  5HWW A;  2L1M A;  3PHY A;  5HDC A;  2PDR A;  1XFN A;  2EA9 A;  5IU1 A;  2D01 A;  2ZBB A;  1V9Y A;  4I5S A;  4LRX C;  2INW A;  5AVF A;  3A0S A;  2QJ7 A;  5HZH A;  5J3W A;  2M1C A;  3GEC A;  2PD7 A;  5HWV A;  3A0R A;  2VLG A;  3LIB A;  4HIA A;  4HP4 A;  3NOP C;  5HDD A;  3VOL A;  4GS9 A;  3LI8 A;  1DP9 A;  4EES A;  1F98 A;  2GJ3 A;  3HJI A;  2V0U A;  1TS8 A;  3FG8 A;  3GDI A;  4GS9 B;  1OTD A;  4HH3 A;  3LIA A;  4HNB A;  3PYP A;  3P7N A;  3H7W A;  4WUJ A;  1UGU A;  4EER A;  4HJ6 A;  4NXF A;  1XJ2 A;  1XJ6 A;  2PR6 A;  1LSW A;  3ULF A;  1S67 L;  3F1P A;  2H28 A;  1S1Z A;  1UWP X;  4NXG A;  3C8C A;  2A24 A;  5I5L A;  3OLO A;  2KX6 A;  1UWN X;  3LI9 A;  3BWL A;  4KQD A;  3MJQ A;  2K7S A;  3LUQ A;  4LRZ E;  4GCZ A;  1JNU A;  1P0Z A;  4JGP A;  3SW1 A;  4JGR A;  2VV7 A;  1V9Z A;  3B33 A;  3NJA A;  3LIF A;  4LRY C;  1P97 A;  1TS7 A;  4M4X A;  2VV6 A;  4L9G A;  1T1C A;  5F6A A;  4LLO B;  4HP9 A;  4RQ9 A;  4HHD A;  4EEP A;  3MFX A;  2WKP A;  3T50 A;  2W27 A;  2PD8 A;  3UB6 A;  1GSX A;  2YKF A;  4L9F A;  2OWH A;  3F1N A;  3BY8 A;  3UB7 A;  4XT2 B;  4WLA A;  4I3I A;  4I3A A;  4F3L A;  1XJ3 A;  3EEH A;  2QJ5 A;  3FC7 A;  5DKK A;  3H9W A;  1T1A A;  3RTY A;  3NOT C;  2PHY A;  2Z6C A;  4WF0 A;  4H6J A;  2B02 A;  4E04 A;  4KUO A;  4EQ1 A;  1TS6 A;  4R6L A;  4DJ3 A;  2V9A A;  5F68 A;  3UB9 A;  1N9O A;  5J7E A;  1D7E A;  5KIZ A;  3IS2 A;  4EET B;  2PYR A;  3G6O A;  2D02 A;  4K08 A;  3A0V A;  1T1B A;  3F1O A;  1GSV A;  3HJK A;  1X0O A;  1DP8 A;  3D72 A;  4NXB A;  2ZOH A;  1T18 A;  1MZU A;  1DRM A;  3H7W B;  2CMN A;  1OTE A;  4JGQ A;  3LIC A;  1WA9 A;  3F1P B;  3NOU C;  2PR5 A;  2A24 B;  4HJ4 A;  4JGO A;  1OTI A;  5HWT A;  5G4Y A;  4HY8 A;  2L4R A;  2WKQ A;  2J80 A;  1S66 L;  2BAS A;  4I39 A;  1XFQ A;  4BBT A;  2ZOI A;  3NHQ A;  5J4E A;  5G4Z A;  4DJ2 A;  5AVE A;  4R70 A;  3VE3 A;  4HJ3 A;  2JN7 A;  4WL9 A;  3ZQ5 A;  4R38 A;  1S1Y A;  2V1B A;  5TBM A;  1LT0 A;  4BBV A;  1OTA A;  1F9I A;  4GHI A;  2W0N A;  3H82 A;  1OT6 A;  3F1N B;  3E4P A;  3KX0 X;  4YWZ A;  1N9L A;  2VEA A;  1DP6 A;  5HD3 A;  3VE4 A;  5F69 A;  1S4R A;  1OTB A;  3C2W A;  4F3L B;  3LYX A;  4KUK A;  3ICY A;  3E4Q A;  4B9O A;  4H6J B;  2P7J A;  1LL8 A;  3BY9 A;  4L9E A;  3LID A;  4NXE A;  3K3C A;  2QWS A;  4WN5 A;  1KOU A;  1T19 A;  3IS2 B;  2HV1 A;  2Z6D A;  1BYW A;  4I3J A;  4BBU A;  4I38 A;  3EWK A;  3MQO A;  3MQQ A;  1N9N A;  1S4S A;  2V0W A;  3F1O B;  5IS1 A;  1VB6 A;  3MR0 A;  2VV8 A;  4MN6 A;  4HH2 A;  3RH8 B;  4MN5 A;  3UE6 A;  1OT9 A;  1LSX A;  3IBR A;  3CLO A;  2WKR A;  4HOI A;  5DJU A;  3UMD A;  4EXO A; 
#chains in the Genus database with same CATH topology
 3S7N A;  1TS0 A;  3BLS A;  5EPH A;  5DJT A;  4X56 A;  1D1J A;  4R4S A;  2MJ6 A;  5HD5 A;  3BFD A;  3FKW A;  4UA6 A;  3S22 A;  1ONH A;  5AQA A;  2Y59 A;  2KDK A;  1H5X A;  1LSV A;  2ZC7 A;  4KZ8 A;  5K5B A;  1NWZ A;  5C5K A;  2A3U A;  3KYZ A;  1YSP A;  5HSQ A;  1MXO A;  2HDS A;  2O9B A;  3WWX A;  2Q0O A;  3CI6 A;  1PW1 A;  1K55 A;  4HBU A;  5E2G A;  5HDS A;  4OPZ A;  2ZMV A;  2Y2H A;  3IXD A;  4XT2 A;  4GHI B;  2JC7 A;  2I9V A;  3VP3 A;  5FAO A;  3VV4 A;  4K0X A;  3MS6 A;  2C5W B;  4S2K A;  2PT7 A;  5HWW A;  1F2K A;  2G7U A;  1E3U A;  2PDR A;  2VKS A;  1XFN A;  4KZB A;  4Q0H A;  4EQI A;  3M2J A;  4E6X A;  4ZJ1 A;  4I5S A;  3ZG7 B;  4E3L A;  1K4F A;  2Y8H A;  3A0S A;  3CUE A;  5HZH A;  5J3W A;  3G31 A;  3WS1 A;  5CRF A;  2PD7 A;  3A0R A;  3IX4 A;  4WZ4 A;  4ETX A;  3B47 A;  3DTK A;  5KMW A;  5HDD A;  3VOL A;  4GS9 A;  3UPN A;  2K2N A;  4WEL A;  5GLC A;  2HPB A;  1DP9 A;  1XXM A;  5DVA A;  2NUP C;  3G4P A;  2X02 A;  1E4D A;  1F98 A;  4GS9 B;  3OPH A;  4C6Y A;  5FI6 A;  3EOI A;  4R4R A;  3HVF A;  3PYP A;  1CI8 A;  3DAV A;  3SH8 A;  1UGU A;  3EEA A;  1VET B;  1HLU P;  3FZC A;  2JE5 A;  3QP8 A;  1K54 A;  4BWI A;  3FPV A;  4OOY A;  1S1Z A;  4X55 A;  1GHP A;  2JKR M;  3KO6 A;  1KGE A;  3T4O A;  2KX6 A;  1N9B A;  1UWN X;  1RGZ A;  5DFX A;  4U3T A;  1TDG A;  2K7S A;  3LUQ A;  5EVL A;  4DRT A;  2BG1 A;  4GCZ A;  2WUQ A;  3Q7V A;  2GDN A;  1V9Z A;  4RX3 A;  1P9W A;  1IFQ A;  4MBK A;  1TS7 A;  4M4X A;  4OVD A;  4L9G A;  2QMI A;  4DKI A;  5F6A A;  1IKI A;  3Q1F A;  5A92 A;  4HP9 A;  5CTN A;  3PXP A;  2E8I A;  3HRE A;  1SKO B;  4EEP A;  3C7U A;  3MFX A;  3T4J A;  1JWP A;  3R7W B;  1NRJ A;  2W27 A;  3N7W A;  3O5Y A;  1GSX A;  4L9F A;  3F1N A;  2Z2L B;  3C5A A;  3M2K A;  3HLE A;  3TOI A;  5FA7 A;  4WLA A;  4I3I A;  4I3A A;  3B3X A;  4OP5 A;  3EEH A;  4AFI A;  4X1L A;  1TF1 A;  2IWD A;  2QJ5 A;  1XKZ A;  3G32 A;  4PM7 A;  3RXX A;  3EGX C;  4WF0 A;  2B95 A;  3DTI A;  4JF5 A;  1IKG A;  2ZC5 B;  4GD8 A;  4KUO A;  4R1G A;  3QP5 A;  3CJM A;  4EU0 A;  2Y2Q A;  2HF6 A;  2M7U A;  3LY3 A;  1BLS A;  4E3N A;  1ZTU A;  1Q2P A;  2PBY A;  4OQG A;  5FAS A;  3NY4 A;  5KIZ A;  2W3E A;  4Y3I A;  1Y4O A;  1J3W A;  4BLM A;  5TJJ A;  5AQ7 A;  1TVF A;  3NEC A;  2W1T B;  1IYS A;  3VMA A;  2OLU A;  4K08 A;  4FD8 A;  2ZL1 B;  3ZDJ A;  1YLP A;  3F1O A;  2Y2I A;  3HJK A;  1X0O A;  1YLW A;  1W79 A;  4UEY A;  5HX9 A;  5DTK A;  4GD6 A;  1GHM A;  4NG2 A;  4MLL A;  4MNR A;  5L07 A;  3V5M A;  2CMN A;  2O9A A;  3O86 A;  3UPO A;  4JGQ A;  4WZ5 C;  2Y2M A;  4KG6 A;  3O87 A;  3MZF A;  2EFU A;  3SS3 A;  4LV0 A;  4PM5 A;  1ZG6 A;  4OKP A;  1TDL A;  5DTT A;  5G4Y A;  3UDI A;  1CJF A;  2L4R A;  2WKQ A;  1S66 L;  3MKE A;  2PAV P;  3MMH A;  5HPI A;  1DJC A;  2XH9 A;  1XFQ A;  1VEU B;  4JXS A;  3ZNT A;  3ZVW A;  3NHQ A;  3U2A A;  1PI5 A;  4JBF A;  4DJ2 A;  1YLT A;  4R70 A;  3DWK A;  3VE3 A;  4QWO A;  4MDZ A;  4LEN A;  3ZQ5 A;  4ZJ2 A;  3C4O A;  4R0Q A;  4QB8 A;  1PZO A;  1Q2Q A;  3DWZ A;  4GOG A;  1CEF A;  3KYE A;  4K91 A;  3A3F A;  1HZO A;  1LT0 A;  1XGI A;  3CPT B;  4C3Q A;  2XSS A;  4DN0 A;  3H82 A;  1FIK A;  4MCW A;  3A3I A;  1YLY A;  3RXW A;  5KSC A;  4P6Z M;  3NDE A;  5D3O A;  1LL5 A;  3ZYT A;  5HD3 A;  4PPR A;  3MQ0 A;  3U4L P;  1YLZ A;  4OOM A;  3LYX A;  3HLB A;  4R3B A;  2XR0 A;  2ZC6 B;  4BQM A;  3AGD A;  5FDS A;  2Y2K A;  5E2F A;  1I2W A;  3ZG5 A;  3IHA A;  1FCO A;  5FQM A;  1LL8 A;  4OQ0 A;  4S2N C;  3MBZ A;  2QWS A;  5F1G A;  1ESI A;  4OPR A;  4KG2 A;  3CIT A;  5HAR A;  2VJW A;  1M6K A;  3IS2 B;  3ZVT A;  4E3K A;  3DTE A;  4I38 A;  2GNX A;  2V0W A;  5IS1 A;  1VB6 A;  5JYO A;  1XGJ A;  1HD8 A;  2Z2M B;  4QJG A;  1CEG A;  4QPR A;  1LSX A;  4KG5 A;  4G3K A;  5CX7 A;  1P9R A;  1I5Q A;  2XFT A;  1IEM A;  4EXO A;  3MSH A;  3N6I A;  5FAQ A;  1S6R A;  4X6T A;  2XDM A;  1BUE A;  5A8B A;  5DKL A;  4OQH A;  5FDH A;  2OWJ A;  2LB5 A;  1ODV A;  3PBR A;  3NDG A;  3T1X A;  1KVM A;  2XEP A;  2VGJ A;  1D06 A;  1RGY A;  3MXQ A;  2GZA A;  2X01 A;  3HLW A;  4PKY G;  1MBL A;  2J7V A;  2R78 A;  2WGW A;  5F82 A;  4EW7 A;  2HJE A;  3SZT A;  2HDQ A;  2PYP A;  5FSR A;  5HW3 A;  1IYP A;  4LPZ A;  1GSW A;  4BD1 A;  4P6Z S;  3C4P A;  1K55 C;  4PAU A;  2XGN A;  2PBD P;  3PHY A;  5FL3 A;  5HDC A;  2EA9 A;  2EXB A;  3IH9 A;  5IU1 A;  2D01 A;  1W7F A;  2HP6 A;  2W3D A;  1L0F A;  4QD4 A;  1V9Y A;  2Y2O A;  3OZH A;  3VP4 A;  3JPU A;  4LRX C;  3NBL A;  5AVF A;  2P9V A;  3WRT A;  2WAE A;  4QY6 A;  3MXS A;  3HLF A;  3O88 A;  4Q0I A;  1OPX A;  5HWV A;  3TRC A;  2VLG A;  1CI9 A;  5EVI A;  1CF0 A;  2WYX A;  4UA7 A;  3LI8 A;  2AVX A;  1H8M A;  3OC2 A;  5EEC A;  2WAF A;  1QMF A;  4UQI M;  1NJ4 A;  5EM0 A;  2V8F A;  4EES A;  4UHU A;  5CEB A;  1TS8 A;  3GDI A;  3S7Q A;  1OTD A;  4E3O A;  1W8Q A;  3NIA A;  3SH7 A;  4ESP A;  5I94 A;  3TJZ C;  3P7N A;  3H7W A;  3IBJ A;  2V1Z A;  1LHY A;  4NXF A;  4L0L A;  2PR6 A;  1RCJ A;  1YT4 A;  4O01 A;  1S67 L;  3F1P A;  4NXG A;  4MMN A;  4O7D A;  1YPR A;  3OLO A;  2JKF A;  5FQ9 A;  1AXB A;  3LI9 A;  2XK1 A;  4RVA A;  3E2L A;  2ZM8 A;  2WZZ A;  4E3J A;  1K54 C;  1ES3 A;  4CLC A;  3BFC A;  2VV7 A;  4XXR A;  3LIF A;  2OSU A;  2XD5 A;  1GA9 A;  4EV4 A;  4EUV A;  3T4S A;  2VV6 A;  3I7J A;  4MN7 A;  3BM6 A;  4LLO B;  4MEZ A;  3Q07 A;  3LEZ A;  1NLY A;  4HHD A;  5A90 A;  2FZ0 A;  3UDX A;  3T4L A;  4B4X A;  1Z6F A;  2PD8 A;  3UB6 A;  2YKF A;  1YMS A;  3UE1 A;  1FR1 A;  4B4Z A;  4N1X A;  3BYD A;  3IWI A;  4S2O A;  4XT2 B;  2J8Y A;  4RX2 A;  4U0T A;  2XF3 A;  2EWW A;  2B18 A;  1O07 A;  5GHX A;  5L10 A;  4F3L A;  5A91 A;  4U0X A;  5DF9 A;  4G3V A;  4JKT A;  3FC7 A;  3VSL A;  3H9W A;  1ZKJ A;  1MPL A;  3NOT C;  2PHY A;  4NKP A;  5AQ9 A;  2EX6 A;  4EQ1 A;  3IF5 A;  2LB9 A;  2VZW A;  5EUA A;  2PRF A;  4WMC D;  1IOU A;  2JKT I;  2V9A A;  2OAQ 1;  4DJ3 A;  4WYY A;  5F68 A;  2HP5 A;  4OLG A;  3P98 A;  2ZLY A;  3S7O A;  2H5S A;  2ZQA A;  1G5U A;  3AGF A;  5GHZ A;  1PNE A;  1IEL A;  4EBL A;  3ZGA B;  4A5R A;  2PYR A;  1TD5 A;  1Y54 A;  1SHV A;  5GLD A;  1EI5 A;  3UO9 A;  2ZD8 A;  4UQI S;  5AQB A;  5CHU A;  4XUZ A;  2OV5 A;  2H10 A;  4PM9 A;  1GSV A;  4NXB A;  4HBT A;  2ZOH A;  2ZC3 B;  3ZHH A;  1MZU A;  1DRM A;  3T1Q B;  4DMZ A;  3HLD A;  3AGE A;  4ID4 A;  4LV2 A;  4IUK A;  4LCM A;  1YQS A;  2EFX A;  1OTI A;  1FR6 A;  5HWT A;  1VHM A;  3WS2 A;  2HZ5 A;  2J80 A;  3C30 A;  4GDB A;  4X69 A;  3M6B A;  1W63 Q;  3Q7V B;  4BBT A;  5J4E A;  5AVE A;  4KZ3 A;  1YM1 A;  3EGD C;  1XPB A;  1FOF A;  4KZ4 A;  3G35 A;  4S2I A;  1E3U D;  1FCN A;  5DF8 A;  2V1B A;  5TBM A;  3ZG9 B;  4P87 A;  3GMW A;  1KGF A;  3IWQ A;  1PWC A;  3SOI A;  1OTA A;  5FI2 A;  2VA0 A;  2W0N A;  1GHI A;  1XA7 A;  3F1N B;  3KYQ A;  4XUX A;  3KX0 X;  4YWZ A;  3HBR A;  1S4R A;  1OTB A;  1JWZ A;  3C2W A;  1NXY A;  3V3R A;  2Q9M A;  3Q7Z A;  2RL3 A;  1XX2 A;  2XQZ A;  3GVB A;  1L2S A;  3IXH A;  2QZ6 A;  1N4O A;  2QYB A;  1ONG A;  1ZC2 A;  2JBF A;  5F83 A;  3N4I A;  4S2P A;  5MC7 A;  4GNU A;  3GV9 A;  2P7J A;  2GX5 A;  2HP9 A;  3BY9 A;  3LID A;  4NXE A;  1TEM A;  3K3C A;  3BQ8 A;  1BZA A;  3V39 A;  1NYM A;  3BFG A;  4BMW A;  2B5R A;  4Y5F A;  5EOO A;  1ES5 A;  2XRO A;  2ZQ9 A;  1K56 A;  1KOU A;  5FAT A;  1T19 A;  4GN2 A;  2JKG A;  4NEE D;  5BOH A;  1W63 M;  3BFF A;  4FCF A;  5EOE A;  4I3J A;  4DXB A;  2XA7 M;  2RCX A;  3MQO A;  2Y4A A;  3LFV A;  1S4S A;  4JXW A;  3DTM A;  3F1O B;  1K25 A;  4DDY A;  3MR0 A;  1IYQ A;  1L3L A;  3QP2 A;  4HH2 A;  1VQQ A;  3LEQ A;  4D60 A;  2C6W B;  1HVB A;  3IBR A;  3W4P A;  3BEB A;  4X53 A;  4IJG A;  3S4X A;  2A2L A;  4EWF A;  3GQZ A;  1RP5 A;  4MBF A;  2JHE A;  3BQA A;  1NY0 A;  2P08 A;  2BTF P;  2J9O A;  3UME A;  2WZX A;  4BJP A;  5EFW A;  3WS0 A;  1Y28 A;  4GW9 A;  5M19 A;  3ZG0 A;  1BUL A;  1M40 A;  2QKP A;  5CED A;  4N1H A;  4DE2 A;  3WRZ A;  5CGX A;  5TR7 A;  4OPQ A;  4KQO A;  3K3D A;  3CWF A;  1ZG4 A;  3T1R A;  4KZ9 A;  3QNC A;  1EW0 A;  3T4K A;  4QHC A;  5L09 A;  3PTE A;  3D9Y A;  2VGL M;  3PR6 A;  4R3A A;  2UWX A;  3H82 B;  4BD0 A;  3CAX A;  1DJB A;  2V2F F;  3MZD A;  5FQJ A;  3IF6 A;  2ZQ8 A;  1ES2 A;  2WGI A;  2L1M A;  2WKE A;  4O0P A;  4R23 A;  1G68 A;  1QME A;  1ALQ A;  4P6B A;  4GDN A;  1L0D A;  3KSG A;  2M1C A;  2XFS A;  1I2S A;  2G2W A;  3GEC A;  4ARZ A;  2J9P A;  4HIA A;  3PBO A;  3VP2 A;  1MWT A;  1L0E A;  4D2O A;  4WEK A;  5TGF A;  3GSG A;  3IXB A;  2Y91 A;  4IBX A;  2J3T C;  1BSG A;  5EE8 A;  3LR4 A;  3HJI A;  5F1F A;  2XA7 S;  3FG8 A;  4F94 A;  5EVI C;  1BLH A;  3K2N A;  3KSI A;  4HNB A;  2IWC A;  3W4O A;  4WUJ A;  1YLJ A;  3UN7 A;  3T1S A;  1BLP A;  3G2Y A;  3A3J A;  1XJ2 A;  2EXA A;  4DF6 A;  3CZD A;  1NZU A;  2QPN A;  3ULF A;  3DW0 A;  1ZHH B;  1PZP A;  4FTX A;  4Y2F A;  1UWP X;  2A24 A;  5I5L A;  1O7E A;  3VSK A;  1STZ A;  2ZMF A;  1LL9 A;  4N92 A;  4MBH A;  3BWL A;  4KQD A;  3UB5 P;  3ZCZ A;  3CHW P;  2Y2N A;  4LRZ E;  4ME4 A;  3HCY A;  3QNB A;  4X68 A;  3OCN A;  4FSF A;  4E6W A;  2OLV A;  4JGP A;  3DBA A;  5LBR A;  3WS4 A;  4CJN A;  4JGR A;  3NJA A;  4Y0U A;  1P97 A;  2XRN A;  2JKR I;  4P85 A;  4HES A;  1YKD A;  4JLF A;  3EQU A;  4IED A;  5GLA A;  3W8K A;  2J3W A;  4PM8 A;  2DRW A;  4CLC C;  4NET A;  3ITB A;  5FEF A;  1PW8 A;  1W8Y A;  5HPF A;  1EWZ A;  1PYY A;  2WGW B;  3E98 A;  4PM6 A;  5DF7 A;  1NRF A;  2VGL S;  2IA2 A;  1KDS A;  3NCK A;  2H0T A;  4PHT A;  5CHM A;  4LGW A;  1XJ3 A;  3S1Y A;  4YOF A;  5HAI A;  5EM1 A;  3JVU A;  5L8M A;  1T1A A;  4X25 A;  4S2M A;  3RTY A;  2Z6C A;  3P09 A;  3IT9 A;  4S2N A;  3D4F A;  4H6J A;  2B02 A;  5FQI A;  3HUM A;  2ACG A;  4R6L A;  2P9V B;  1G6O A;  3MFD A;  4FH2 A;  5J7E A;  4KEN B;  5M1A A;  1D7E A;  3CUE C;  4Y15 A;  3PAE A;  2K31 A;  1VM1 A;  4YIN A;  5EVI B;  4LV1 A;  4Z1W A;  3G6O A;  2W3G A;  4GZB A;  2PU2 A;  3V3S A;  2ZQC A;  2Y2L A;  4IBR A;  3D72 A;  1DP8 A;  3NUL A;  1ERQ A;  3MZE A;  3VP1 A;  5JYP A;  1CQA A;  2O99 A;  3HLC A;  1T18 A;  5L2F A;  3UPP A;  3H7W B;  2EX9 A;  3TSG A;  2OAP 1;  1MKM A;  3ZFZ A;  1WA9 A;  4OON A;  2JCH A;  2KLI A;  2G2U A;  3E0Y A;  1SDN A;  3F1P B;  4BL2 A;  3VP0 A;  3NOU C;  4Y7P A;  1K57 A;  1K38 A;  2PR5 A;  4HJ4 A;  4JGO A;  3MXR A;  2DCF A;  4HY8 A;  4O8G A;  1NZO A;  4DE0 A;  4Y0T A;  1F5M A;  1WE4 A;  2HDR A;  1NLZ A;  1PFL A;  4I39 A;  1KDW A;  2W1R A;  4CLC B;  5CTM A;  2ZOI A;  3G30 A;  5G4Z A;  3QP1 A;  2JN7 A;  4HEF A;  3IHB A;  4UAA A;  2XLN A;  1YAX A;  4DXC A;  1S1Y A;  3BLM A;  3PAG A;  1A0K A;  3SS4 A;  4BBV A;  2P04 A;  4GHI A;  5HL1 A;  3BJN A;  4Q8I A;  4JXV A;  1ES4 A;  2J3T D;  1JTG A;  1N9L A;  3GRJ A;  1BT5 A;  5F69 A;  1PWG A;  4F3L B;  5EVI D;  2H0Y A;  1JTD A;  4DE3 A;  4KUK A;  3V50 A;  4ZBE A;  4KQR A;  4IUH A;  4Z9Q A;  2M7V A;  3LGO A;  4JXG A;  3G2Z A;  3FKV A;  3GTC A;  3E4Q A;  4OOL A;  1MWU A;  4B9O A;  5EVE A;  4GLQ A;  3TE8 A;  2P74 A;  3BW6 A;  4DE1 A;  3C7V A;  4K0W A;  1MWS A;  5HAQ A;  5E2H A;  3LR0 A;  5CXW A;  3O3V A;  4M3K A;  1SZV A;  3LY4 A;  4N9L A;  2HV1 A;  2Z6D A;  1BYW A;  1H8Y A;  4H8R A;  3MKF A;  3MQQ A;  3UNW A;  4EUZ A;  3IX8 A;  3GR2 A;  4JPM A;  5TFQ A;  2WK0 A;  1VET A;  2KOI A;  3FV7 A;  3D3O A;  4CLC D;  4GJ4 A;  5GL9 A;  4MN5 A;  4ZJ3 A;  1OT9 A;  5AJG A;  3BFE A;  3CLO A;  2FFY A;  1FQG A;  2WKR A;  2Y2J A;  5KZH A;  3OPR A;  4HOI A;  2HGV A;  1ERM A;  5DJU A;  3UMD A;  3ZNY A;  1YMX A;  1ERO A;  1MKI A;  1OJG A;  3LIE A;  1G28 A;  2V1A A;  2QHK A;  4LV3 A;  4X1M A;  3NI9 A;  5EV0 A;  5FQK A;  3E2K A;  4EEU A;  4QU3 A;  2ZMA A;  4ZDX A;  1SKO A;  5CER A;  4PKY A;  1KE4 A;  4HI4 A;  3V67 A;  2HDU A;  3R7W A;  1KE3 A;  3ITA A;  4WM9 A;  3IH8 A;  3T4Q A;  5TBM B;  3RJU A;  2VGK A;  2ZM2 A;  1KVL A;  1XJ4 A;  3UB8 A;  2YKH A;  2E8J A;  3E4O A;  2DNS A;  1OJ5 A;  2OOL A;  4HQA A;  4RA7 A;  2L0W A;  4R3J A;  1LLB A;  4P0M A;  5F5Y A;  2R9X A;  1J9M A;  1KE0 A;  1PIO A;  3LR5 A;  4Q0J A;  2ZBB A;  3CG5 A;  4GKU A;  3T4T A;  3LR3 A;  4OLD A;  2X71 A;  3VFF A;  4FOF A;  2INW A;  1CK3 A;  3KSH A;  2QJ7 A;  1W5D A;  2ZC4 B;  3IF6 C;  2Y79 A;  1Z09 A;  3LIB A;  5E2E A;  2ZQ7 A;  3N8R A;  4HP4 A;  3FPW A;  4Y17 A;  1MY8 A;  3NOP C;  2W1T A;  3FYZ A;  3OCL A;  3KSF A;  3PBQ A;  3QP4 A;  2ZL1 A;  2A49 A;  5IHV A;  2GJ3 A;  2O9C A;  4CLC E;  3PBS A;  2V0U A;  3WS5 A;  3P01 A;  2W3H A;  4G3W A;  3C38 A;  4HH3 A;  4EBP A;  3QHY A;  4IVK A;  3LIA A;  2CC1 A;  4OPY A;  2HJ9 C;  5J8X A;  2VX8 A;  4HJ6 A;  4B88 A;  4EER A;  3IX3 A;  4S2L A;  1XJ6 A;  1SKF A;  4CQH A;  1LSW A;  5HAP A;  2EWV A;  5CGS A;  2H28 A;  3C8C A;  5U47 A;  3ZG8 B;  1BTL A;  1JWV A;  3OOV A;  4OH0 A;  2ZQD A;  3LO7 A;  2IWB A;  3MJQ A;  2Y2G A;  1ESU A;  4C75 A;  1GCE A;  1WYB A;  1PRQ A;  3W4Q A;  1JNU A;  1P0Z A;  1VEU A;  3SW1 A;  5CEC A;  3OPP A;  3B33 A;  4LRY C;  2Y2P A;  3W2Z A;  1T1C A;  4RQ9 A;  3A3E A;  3IQA A;  2WAD A;  4GB7 A;  4Y0O A;  3TG9 A;  2WKP A;  3VOY A;  3T50 A;  1DJA A;  4KZ7 A;  4KZ5 A;  3CPT A;  4CPK A;  4S2J A;  3T12 B;  2BLS A;  1H8Z A;  4LCL A;  2OWH A;  5CGW A;  3BY8 A;  3VOZ A;  3UB7 A;  4YFM A;  1WYC A;  3HUO A;  2EX8 A;  2JKT M;  2Q9N A;  1DY6 A;  3RFB A;  3PBT A;  1NYY A;  5HL6 A;  3M6H A;  4B93 A;  5DKK A;  3IF6 B;  1FCM A;  1K56 D;  4FH4 A;  5M18 A;  1IYO A;  4IHQ A;  4E04 A;  3BEC A;  4KQQ A;  1TS6 A;  1XA1 A;  1JVJ A;  3G34 A;  2VK3 A;  5FQQ A;  1HTZ A;  1H3Q A;  1N9O A;  3UB9 A;  4ZRR A;  3UY6 A;  2EX2 A;  5KSH A;  4OP8 A;  1LI9 A;  4ARZ B;  4NK3 A;  3IS2 A;  4ZTK A;  5GLB A;  3OPL A;  3NC8 A;  4EET B;  3TW8 A;  3MF0 A;  4II7 A;  5E43 A;  2W3F A;  2D02 A;  4EBN A;  1K0K A;  4WZ5 A;  3PBN A;  4YNR A;  3A0V A;  1PWD A;  1T1B A;  5FI7 A;  4KZ6 A;  5CHJ A;  4ETZ A;  1BLC A;  1AWI A;  1MC0 A;  2O0Y A;  1MWR A;  3BRM A;  1FSW A;  1K6S A;  3UE0 A;  1YSQ A;  1OTE A;  2Y55 A;  2XD1 A;  3HL9 A;  4KZA A;  3LIC A;  2WKI A;  4WEJ A;  5G18 A;  5HFO A;  2A24 B;  4DDS A;  4BEN A;  3SH9 A;  4N9K A;  3R4K A;  4IVI A;  4PMA A;  2BAS A;  1E25 A;  3LCE A;  1K57 C;  1FSY A;  4HJ3 A;  4LFU A;  5A93 A;  4WL9 A;  1H0M A;  4R38 A;  4UA9 A;  4RYE A;  4E3M A;  3EQV A;  1KGG A;  1SDE A;  1FIL A;  3L7H A;  2UV0 E;  3Q81 A;  3UE3 A;  3IWO A;  1F9I A;  4Y13 A;  4E3I A;  5DFY A;  1L0G A;  2ZJ9 A;  1OT6 A;  3SS5 A;  1G6A A;  3E4P A;  2V20 A;  3N8L A;  2VEA A;  1DP6 A;  3VE4 A;  1GA0 A;  3IXG A;  2R9W A;  3JVV A;  3ISG A;  3HLG A;  3ICY A;  5IT5 A;  4H6J B;  2DMW A;  4JF4 A;  1SCW A;  5FEG A;  5FAP A;  4L9E A;  1U60 A;  3Q82 A;  2WKH A;  5DTS A;  2ZM0 A;  1XP4 A;  4WN5 A;  3N8S A;  2FH5 A;  3JYI A;  4FUW A;  1OME A;  2FFF B;  4BBU A;  3EWK A;  3VFH A;  3L9K A;  4WMC A;  1N9N A;  1LI0 A;  3B42 A;  3QP6 A;  2NUT C;  2V8C A;  2PU4 A;  4QY5 A;  1K4E A;  2I72 A;  3S7P A;  3UDF A;  2VV8 A;  2WGV A;  4MN6 A;  3A3D A;  4ZAM A;  1ACF A;  3RH8 B;  3UE6 A;  5GHY A;  3FWL A;  3OBF A;  1K6R A;  4JF6 A;  4OQI A;  3CMZ A;  4BL3 A;  4WBG A;  1S0W A;  3HUN A;  1PI4 A;  1C3B A; 
#chains in the Genus database with same CATH homology
 2JHE A;  1OJG A;  3LIE A;  3S7N A;  1TS0 A;  3BQA A;  1G28 A;  2V1A A;  5DJT A;  2P08 A;  2QHK A;  2MJ6 A;  3UME A;  5HD5 A;  5A8B A;  5DKL A;  2OWJ A;  4BJP A;  2LB5 A;  1ODV A;  3PBR A;  4EEU A;  2KDK A;  5EFW A;  1Y28 A;  4GW9 A;  1LSV A;  5K5B A;  2QKP A;  1NWZ A;  5C5K A;  1D06 A;  4PKY A;  4HI4 A;  3V67 A;  3MXQ A;  3KYZ A;  2GZA A;  3R7W A;  1YSP A;  4PKY G;  5HSQ A;  4KQO A;  3K3D A;  2O9B A;  2R78 A;  3CWF A;  3CI6 A;  3T4Q A;  5TBM B;  1EW0 A;  5HDS A;  3T4K A;  4EW7 A;  2ZMV A;  4XT2 A;  2HJE A;  2VGL M;  3PR6 A;  4GHI B;  4R3A A;  2I9V A;  1XJ4 A;  2PYP A;  3UB8 A;  3VV4 A;  3H82 B;  2YKH A;  3CAX A;  3E4O A;  4LPZ A;  1GSW A;  1OJ5 A;  2OOL A;  4HQA A;  2L0W A;  4P6Z S;  2PT7 A;  5F5Y A;  5HWW A;  2G7U A;  4PAU A;  2L1M A;  3PHY A;  5FL3 A;  5HDC A;  4O0P A;  2PDR A;  2VKS A;  1XFN A;  2EA9 A;  3LR5 A;  4Q0J A;  5IU1 A;  2D01 A;  2ZBB A;  4Q0H A;  2W3D A;  1V9Y A;  3T4T A;  3LR3 A;  4I5S A;  4LRX C;  2Y8H A;  2INW A;  4FOF A;  5AVF A;  3A0S A;  3KSH A;  3CUE A;  2QJ7 A;  5HZH A;  5J3W A;  3KSG A;  2M1C A;  2Y79 A;  3GEC A;  4Q0I A;  1OPX A;  4ARZ A;  2PD7 A;  5HWV A;  3A0R A;  3TRC A;  2VLG A;  3LIB A;  4HIA A;  3PBO A;  4HP4 A;  3FPW A;  4ETX A;  3B47 A;  3NOP C;  2W1T A;  5HDD A;  4WEK A;  3VOL A;  4GS9 A;  3OCL A;  2K2N A;  4WEL A;  3KSF A;  3LI8 A;  1H8M A;  3OC2 A;  3PBQ A;  1DP9 A;  2NUP C;  4UQI M;  2J3T C;  4EES A;  1F98 A;  2GJ3 A;  3HJI A;  3LR4 A;  2O9C A;  4CLC E;  3PBS A;  2V0U A;  2XA7 S;  1TS8 A;  3FG8 A;  3GDI A;  4GS9 B;  3S7Q A;  1OTD A;  3P01 A;  2W3H A;  4G3W A;  3C38 A;  4HH3 A;  3K2N A;  3EOI A;  3KSI A;  3LIA A;  4HNB A;  3PYP A;  3TJZ C;  3P7N A;  3H7W A;  2HJ9 C;  4WUJ A;  3IBJ A;  1UGU A;  2VX8 A;  3EEA A;  4HJ6 A;  4EER A;  4NXF A;  4L0L A;  1XJ2 A;  1XJ6 A;  2PR6 A;  4CQH A;  1LSW A;  4O01 A;  4BWI A;  2EWV A;  3ULF A;  3FPV A;  1S67 L;  3F1P A;  1ZHH B;  4Y2F A;  2H28 A;  1S1Z A;  1UWP X;  4NXG A;  2JKR M;  3C8C A;  2A24 A;  4MMN A;  3KO6 A;  5I5L A;  3T4O A;  3OLO A;  2KX6 A;  3OOV A;  1UWN X;  3LI9 A;  5DFX A;  1STZ A;  2ZMF A;  3BWL A;  4KQD A;  3MJQ A;  2K7S A;  3LUQ A;  4LRZ E;  4ME4 A;  3HCY A;  4GCZ A;  3OCN A;  4FSF A;  1JNU A;  1P0Z A;  4JGP A;  4CLC A;  3DBA A;  5LBR A;  3SW1 A;  4JGR A;  2VV7 A;  1V9Z A;  1P9W A;  3B33 A;  1IFQ A;  3LIF A;  3NJA A;  4LRY C;  4EUV A;  1P97 A;  2XRN A;  1TS7 A;  2JKR I;  4M4X A;  3T4S A;  2VV6 A;  4MN7 A;  3W2Z A;  4L9G A;  1T1C A;  5F6A A;  1YKD A;  4LLO B;  3EQU A;  4HP9 A;  4RQ9 A;  1NLY A;  3PXP A;  2J3W A;  4HHD A;  4EEP A;  3MFX A;  3T4J A;  2FZ0 A;  4CLC C;  2WKP A;  3T4L A;  3T50 A;  3R7W B;  1NRJ A;  2W27 A;  2PD8 A;  3UB6 A;  3O5Y A;  1GSX A;  2YKF A;  4L9F A;  5HPF A;  3E98 A;  2OWH A;  3F1N A;  3BY8 A;  3UB7 A;  4XT2 B;  4WLA A;  2VGL S;  2IA2 A;  4I3I A;  4I3A A;  2EWW A;  2B18 A;  2JKT M;  4PHT A;  4F3L A;  1XJ3 A;  4YOF A;  3EEH A;  3RFB A;  4AFI A;  5DF9 A;  4G3V A;  3PBT A;  1TF1 A;  5HL6 A;  3JVU A;  2QJ5 A;  3FC7 A;  5L8M A;  4B93 A;  5DKK A;  3H9W A;  1T1A A;  3RTY A;  3NOT C;  3EGX C;  2PHY A;  2Z6C A;  4WF0 A;  4IHQ A;  4NKP A;  4H6J A;  2B02 A;  4E04 A;  4KUO A;  4EQ1 A;  1TS6 A;  2LB9 A;  2VZW A;  1IOU A;  4R6L A;  4EU0 A;  2JKT I;  2V9A A;  2OAQ 1;  4DJ3 A;  2HF6 A;  5F68 A;  1G6O A;  2M7U A;  1H3Q A;  1N9O A;  3UB9 A;  5J7E A;  1ZTU A;  4ZRR A;  3S7O A;  5KSH A;  1D7E A;  4ARZ B;  3CUE C;  5KIZ A;  2W3E A;  4Y3I A;  3IS2 A;  2K31 A;  5TJJ A;  4EET B;  3TW8 A;  2W1T B;  2PYR A;  3MF0 A;  4Z1W A;  4II7 A;  1TD5 A;  3G6O A;  2W3G A;  2W3F A;  2D02 A;  4K08 A;  4UQI S;  3PBN A;  4YNR A;  3A0V A;  1T1B A;  3F1O A;  1GSV A;  3HJK A;  1X0O A;  1DP8 A;  3D72 A;  4ETZ A;  4NXB A;  4UEY A;  2O99 A;  2ZOH A;  1T18 A;  1MZU A;  1MC0 A;  1DRM A;  2O0Y A;  3H7W B;  4DMZ A;  2CMN A;  2O9A A;  1YSQ A;  1OTE A;  4JGQ A;  2OAP 1;  1MKM A;  3LIC A;  1WA9 A;  4IUK A;  2KLI A;  3E0Y A;  4WEJ A;  3F1P B;  3NOU C;  2PR5 A;  2A24 B;  4HJ4 A;  4JGO A;  1OTI A;  5HWT A;  5G4Y A;  1VHM A;  4HY8 A;  4O8G A;  2L4R A;  2WKQ A;  2J80 A;  1S66 L;  1F5M A;  3C30 A;  3R4K A;  1NLZ A;  2BAS A;  4I39 A;  3MMH A;  5HPI A;  2W1R A;  1XFQ A;  1W63 Q;  4CLC B;  4BBT A;  2ZOI A;  3NHQ A;  3U2A A;  5J4E A;  5G4Z A;  4DJ2 A;  5AVE A;  4R70 A;  3VE3 A;  3EGD C;  4HJ3 A;  2JN7 A;  4WL9 A;  4MDZ A;  3ZQ5 A;  1YAX A;  4R38 A;  1S1Y A;  3EQV A;  2V1B A;  5TBM A;  1LT0 A;  3UE3 A;  4BBV A;  1OTA A;  1F9I A;  2P04 A;  4GHI A;  2VA0 A;  2XSS A;  2W0N A;  4DN0 A;  5DFY A;  3H82 A;  3BJN A;  1OT6 A;  3F1N B;  4MCW A;  3KYQ A;  3E4P A;  4P6Z M;  3KX0 X;  4YWZ A;  2J3T D;  1N9L A;  2VEA A;  3ZYT A;  1DP6 A;  5HD3 A;  3VE4 A;  5F69 A;  1S4R A;  3MQ0 A;  1OTB A;  3C2W A;  4F3L B;  4OOM A;  3LYX A;  4KUK A;  4IUH A;  3JVV A;  2M7V A;  2QYB A;  3ICY A;  5IT5 A;  3E4Q A;  4OOL A;  4B9O A;  4H6J B;  5MC7 A;  2DMW A;  2P7J A;  2GX5 A;  4GLQ A;  3TE8 A;  1LL8 A;  3BY9 A;  3BW6 A;  4L9E A;  3LID A;  4NXE A;  3K3C A;  3BQ8 A;  2QWS A;  4BMW A;  3LR0 A;  4Y5F A;  3CIT A;  2XRO A;  4WN5 A;  1KOU A;  2VJW A;  1T19 A;  3IS2 B;  2FH5 A;  4NEE D;  1W63 M;  2HV1 A;  2Z6D A;  1BYW A;  4I3J A;  2XA7 M;  4BBU A;  4I38 A;  3EWK A;  3MQO A;  3MQQ A;  1N9N A;  3B42 A;  3LFV A;  2GNX A;  1S4S A;  2V0W A;  2NUT C;  3F1O B;  5IS1 A;  3S7P A;  1VB6 A;  3MR0 A;  2VV8 A;  4MN6 A;  2KOI A;  3D3O A;  4HH2 A;  4CLC D;  4QPR A;  3RH8 B;  4GJ4 A;  4MN5 A;  3UE6 A;  1OT9 A;  1LSX A;  3IBR A;  5AJG A;  3OBF A;  4G3K A;  5CX7 A;  1P9R A;  3CLO A;  4IJG A;  2WKR A;  2A2L A;  4HOI A;  2HGV A;  5DJU A;  3UMD A;  4EXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...