3IXDA

X-ray crystal structure of the extended-spectrum ampc v298e mutant beta-lactamase at 2.64 angstrom resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
358
structure length
346
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIPEKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 111
structure length 346
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ixdA00
2Y59A 3PBOA 2R9XA 4K0WA 4X69A 1MWSA 3HBRA 1W7FA 1NZUA 4NK3A 2J7VA 3MKEA 3PAEA 1K6RA 3M6BA 1Z6FA 3SH8A 3GMWA 4OLDA 1PYYA 3GTCA 4PM6A 3FWLA 2Y55A 1W79A 4DXCA 3ISGA 4N92A 1NJ4A 1JWZA 2EX6A 1TDLA 5DTKA 1BUEA 5FAQA 1NZOA 2VGKA 3O88A 2X01A 4WEJA 4S2MA 5DVAA 1IKIA 4C3QA 5AQ7A 3N8SA 4DRTA 3LY3A 1G68A 5E2GA 5L2FA 1H8YA 1TDGA 1LHYA 2P9VB 3HLWA 4RYEA 4ZJ3A 4BQMA 4JXWA 3G34A 3IF5A 1FSWA 1BT5A 4PM9A 4X55A 2XR0A 5F82A 2WKIA 3DWZA 4E6XA 5I94A 3FZCA 1XGJA 2P9VA 1BLPA 3G35A 4IBRA 5DTTA 3VP3A 4S2NC 1JTGA 1LLBA 3OC2A 1ERMA 4JF6A 4ZTKA 2DNSA 5FSRA 5GHYA 2A3UA 1SDEA 4R3JA 1DJCA 4IVIA 3PBNA 1ESIA 1EROA 4N1XA 5EOEA 3ZGAB 1ZG6A 3IXBA 3GVBA 1SHVA 2WGWB 4UA9A 4FCFA 4MNRA 4KQOA 1ZKJA 5TGFA 4R4SA 3IWIA 1PW8A 1G6AA 5M19A 2WGWA 2BG1A 5HW3A 5FI6A 1QMEA 5CGXA 3N8LA 4P6BA 5CHUA 2PU4A 3WS4A 2HPBA 1L0DA 4WM9A 1RP5A 4QB8A 1MY8A 5EPHA 5KSCA 3CMZA 4S2LA 1KDWA 1YLZA 5AQ9A 1K55C 4JLFA 1ES2A 4JPMA 1WE4A 2WKHA 3W4QA 1FQGA 4KG6A 2X02A 4JXSA 3LO7A 3WWXA 3MKFA 4M3KA 3G32A 4BLMA 4WZ4A 4N1HA 2UWXA 3NY4A 1YLJA 1BLHA 5GL9A 3WS5A 4EBLA 1XKZA 4GOGA 3IQAA 3AGDA 1ONHA 4UHUA 4DE2A 4ZJ2A 3IF6A 4U0TA 5AQBA 5A93A 2EX8A 3UPPA 2Y2NA 1K54A 3NIAA 3ZNYA 5HAIA 2ZM8A 2EXBA 4BL3A 3C4PA 5FQJA 1L0GA 2HDRA 2Q9MA 1VM1A 2ZQ7A 3BRMA 4N9LA 3ITBA 4CPKA 2WK0A 3WRTA 3IH9A 1TVFA 1ZC2A 3G2YA 1O7EA 3SS5A 4Q8IA 1MWUA 1BTLA 4LV1A 1E3UA 2Y2IA 3Q81A 4DE1A 1EWZA 3A3IA 1NY0A 3O86A 4K0XA 4DKIA 4R3BA 4EWFA 3EQUA 3M6HA 3M2KA 1NYYA 3GSGA 3ZG9B 4DDSA 3W4OA 3LY4A 2H0TA 1RGYA 5GLAA 2ZMAA 4KG2A 5FQKA 1H5XA 3OPRA 3P98A 5M1AA 3MFDA 2G2WA 3HUMA 4KZ5A 5CEBA 3Q7VB 1I5QA 1IELA 4RA7A 4PMAA 4GDBA 3HVFA 1ESUA 3WRZA 1MXOA 4E3IA 3Q7VA 3MXSA 4LENA 3NBLA 3MBZA 3BYDA 1PWDA 3NI9A 3VMAA 4OQHA 4OPQA 1H8ZA 1L0FA 4GD8A 5HX9A 2J9OA 5CHJA 4E3MA 1IYPA 5EVID 4UAAA 3NCKA 2WAEA 1ONGA 3VP1A 3G30A 2HDQA 1YT4A 3TSGA 2RL3A 3BFCA 4R0QA 3E2LA 4Y7PA 4KZAA 4QD4A 3WS0A 5F1GA 3HL9A 3OCNA 2GDNA 1KE4A 2DRWA 1ES3A 3C5AA 3IXHA 3N8RA 4RX2A 3BM6A 4X56A 3WS2A 4Z9QA 2JCHA 1RGZA 1K56D 1XXMA 2QMIA 3O3VA 3VOYA 1SCWA 1NYMA 2G2UA 3QNBA 2Y2KA 4FSFA 1LI9A 2H5SA 4HBTA 3UO9A 2H10A 1CK3A 3GQZA 4P0MA 4OQ0A 3VFFA 2Y4AA 1CEFA 2C5WB 3PBSA 3HREA 3OPPA 5HARA 2Z2LB 3DW0A 4WZ5A 5FQMA 3FKVA 2FFYA 2HP6A 3G31A 2V2FF 2V20A 2XFTA 3IF6C 2Z2MB 3MXRA 3A3DA 2XF3A 1XA7A 1K54C 4OH0A 3IXDA 3P09A 3MZEA 2CC1A 4DF6A 5J8XA 2OSUA 3UE3A 1E25A 1K25A 3V3RA 1DJBA 3DTMA 2Y2HA 1K4FA 1XPBA 4MBKA 5CERA 1YLTA 2ZC5B 1ES4A 3GV9A 4K91A 4EV4A 3ZNTA 3Q7ZA 3Q1FA 5CGSA 1IEMA 4GN2A 4B4XA 4U0XA 3IXGA 1IKGA 3NDGA 4XUZA 5DF7A 4LV0A 5FASA 3BFDA 4JXGA 4WMCD 1FCOA 5FQQA 2WYXA 3A3JA 4FH4A 1ERQA 3ZG5A 1U60A 1QMFA 5CHMA 2ZQ9A 4FH2A 5GLCA 3C4OA 4KZ6A 1BSGA 3PBRA 4OQGA 5GHXA 1J9MA 4S2OA 4DE3A 1HVBA 4EUZA 5CECA 5EVLA 5M18A 4YFMA 3QNCA 2HDUA 1CI9A 2FFFB 2ZQDA 3WS1A 3IF6B 3SOIA 2XH9A 5F1FA 1KGFA 1GHMA 3ITAA 1LL9A 2Y2PA 1BLCA 1NXYA 4GD6A 4HBUA 3FKWA 3HLEA 3V5MA 2XD1A 1GA9A 2ZJ9A 1NRFA 1OMEA 4RVAA 4DXBA 1PZOA 3FYZA 2ZC6B 1C3BA 2R9WA 1O07A 1Q2PA 2ZM0A 1MWRA 4S2JA 5E43A 2X71A 2OLVA 5KMWA 4MBHA 4X6TA 4QU3A 5CXWA 3LCEA 2ZQAA 5EOOA 4QJGA 4YINA 3SH7A 5FAPA 3SS3A 1KGGA 2QPNA 3N6IA 1WYBA 1ZG4A 4FD8A 4H8RA 5A90A 4CJNA 1LI0A 4QHCA 1FCMA 2DCFA 1I2WA 3C7UA 4LCMA 3N4IA 4OOLA 4BENA 3S22A 4N9KA 3ZDJA 1L0EA 1EI5A 3ZG7B 4S2KA 1YMXA 1K38A 2XD5A 5DF8A 1W8QA 2XEPA 4P85A 3UPOA 2XFSA 1GHPA 2WZZA 4BD1A 4OQIA 3VSKA 1PIOA 3CG5A 2Y2QA 4MLLA 4WZ5C 2XDMA 4E6WA 2EX2A 4UA7A 3UE1A 1YM1A 4KENB 3I7JA 5A91A 3PAGA 1YMSA 3UN7A 4ZBEA 3VP0A 1JVJA 4PM8A 3IWOA 3OZHA 5DF9A 4OOYA 2EX9A 4KG5A 3O87A 5KZHA 1WYCA 2PU2A 2Q9NA 4X68A 4OPRA 1I2SA 4OONA 4OKPA 4EBPA 1K4EA 5F83A 3CZDA 3ZVWA 2Y2OA 4QY6A 4GDNA 5CTMA 3IT9A 5IHVA 2JE5A 4HEFA 4KQQA 4WEKA 1SKFA 2XK1A 3S4XA 2WGIA 2Y2JA 3SS4A 3VOZA 3HLBA 3ZFZA 3V39A 2IWDA 2VGJA 3QHYA 1KGEA 2HDSA 4KZ7A 4P87A 4X53A 4O7DA 1BLSA 3SH9A 5EE8A 5GLDA 5E2FA 3MZDA 2WGVA 3CJMA 4IEDA 4E3OA 2Y91A 5GLBA 4KZ9A 1YLPA 4WBGA 4OLGA 1SDNA 5CGWA 3D4FA 1PI5A 1FSYA 5FATA 4GKUA 3HLDA 1TEMA 4L0LA 4Y0TA 1PWGA 1XA1A 5EVIB 3JYIA 4XXRA 4JKTA 1MKIA 4IVKA 3GRJA 3A3EA 1FOFA 1HTZA 2ZM2A 3NDEA 5FI2A 3ZG0A 1XX2A 1K57A 1PWCA 1IYSA 1JWPA 1M6KA 1N4OA 3RJUA 2HP5A 5EVIA 5HAPA 5G18A 4B4ZA 2Y2GA 5CEDA 1IYOA 1MWTA 2ZC4B 4QY5A 3W8KA 3OPHA 4OP5A 4R23A 4F94A 3UE0A 2HP9A 3GR2A 1FR1A 4OOMA 5FQIA 2PBYA 2JBFA 4UA6A 1VQQA 3VFHA 1MBLA 3LEZA 5CTNA 1Q2QA 4GB7A 4MBFA 2I72A 3A3FA 5GHZA 2ZD8A 3IH8A 3UPNA 5HL1A 1K56A 3AGFA 5FQ9A 4ZJ1A 3UDIA 3VSLA 3UY6A 1W5DA 4E3JA 3C7VA 4OVDA 3AGEA 4JBFA 4JF4A 3BFGA 4HESA 4S2IA 4EQIA 2V1ZA 4KZ8A 5KSHA 2BLSA 4KZ4A 3VP4A 2ZLYA 4GZBA 2ZQCA 3N7WA 4OPZA 4DE0A 3BLSA 1CEGA 3EQVA 3IWQA 3V50A 1PZPA 5TR7A 2Y2LA 1ES5A 1DY6A 4S2PA 2EFUA 4ZDXA 2J9PA 1E4DA 1CI8A 3PBQA 3ZG8B 2OLUA 1YLYA 5BOHA 3W4PA 4IBXA 3V3SA 2EFXA 4JF5A 1YQSA 4LV2A 1AXBA 2IWBA 1XP4A 4NETA 4PPRA 3IHAA 3Q82A 4WELA 1YLWA 1FR6A 3PTEA 2C6WB 2J8YA 4R1GA 3HLCA 2WZXA 1MPLA 4LV3A 4OP8A 5JYPA 1DJAA 1KVMA 2WADA 1HD8A 3UNWA 1PI4A 3G4PA 1RCJA 4XUXA 4ID4A 5DTSA 4JXVA 4WMCA 3ZCZA 5HFOA 3ZVTA 3BFFA 5U47A 1E3UD 2ZQ8A 1KDSA 3B3XA 4MEZA 5D3OA 2Y2MA 2XGNA 3IHBA 4BJPA 1JWVA 4PM5A 5FI7A 3DWKA 3OPLA 2WUQA 4PM7A 1S0WA 3ZHHA 4WYYA 4EBNA 4Y0OA 2E8IA 4A5RA 2EXAA 1KE0A 2ZC7A 4RX3A 4S2NA 4GNUA 3S1YA 3NC8A 4DDYA 1K6SA 2WKEA 5EECA 1Y54A 5FAOA 2WAFA 5A92A 3G2ZA 1IYQA 3HUOA 1L2SA 4E3KA 3BFEA 3UDXA 4KQRA 3E2KA 3M2JA 1GCEA 3TG9A 4BD0A 1K57C 3HLFA 2A49A 5HAQA 1W8YA 5EVIC 2B5RA 1M40A 3FV7A 2XLNA 1JTDA 4R4RA 4Y0UA 2OV5A 1FCNA 1GHIA 5AQAA 4C75A 2QZ6A 3TOIA 3PBTA 5CRFA 4C6YA 5E2HA 4BL2A 3BECA 4E3LA 3OCLA 1BULA 4U3TA 1ALQA 1N9BA 3VP2A 3RXXA 3HLGA 5FDHA 3BLMA 1LL5A 4KZBA 4B88A 2XQZA 3HUNA 1HZOA 3Q07A 3MZFA 1BZAA 5FA7A 2IWCA 1K55A 4ZAMA 4D2OA 5TFQA 4OPYA 3BEBA 4E3NA 2H0YA 2JC7A 2RCXA 1KE3A 5EUAA 2P74A 5E2EA 1XGIA 2ZC3B 1KVLA 3UDFA 4LCLA 5JYOA 3RXWA 1GA0A 1S6RA 4KZ3A 1PW1A
chains in the Genus database with same CATH superfamily
4GLQA 3JVUA 1W7FA 5HDCA 4NK3A 3LIBA 3PAEA 3MKEA 3GMWA 1PYYA 3R7WA 2LB5A 3FWLA 1V9YA 2HZ5A 5KIZA 5DTKA 1BUEA 5FAQA 1NZOA 2VGKA 4DN0A 4C3QA 1G68A 5L2FA 1LHYA 4RYEA 3IF5A 4X55A 4E6XA 1OJ5A 5F82A 3DWZA 5TBMB 3FZCA 3NOTC 3VP3A 4S2NC 4ZTKA 5TBMA 2DNSA 5FSRA 5GHYA 1SDEA 5EOEA 3LIEA 3UB7A 3C2WA 4MNRA 1OT6A 2PU4A 2VK3A 4QB8A 3O5YA 5EPHA 3CMZA 3V67A 1YLZA 5AQ9A 1ES2A 3C8CA 4FOFA 4NXGA 1WE4A 4BBUA 2WKHA 3P01A 4RQ9A 5HPIA 4BLMA 4GOGA 3IQAA 3AGDA 4DE2A 3IF6A 3NIAA 5HAIA 1L0GA 2ZL1B 4MMNA 3UB8A 1TVFA 4Q8IA 1MWUA 1BTLA 1ZTUA 2Y2IA 4DE1A 3M2KA 1YAXA 1CJFA 2H0TA 1RGYA 5GLAA 4PKYG 4Z1WA 3IBJA 3D3OA 4UQIM 4G3VA 4RA7A 4PMAA 4GDBA 3NULA 5L09A 3S7OA 3NI9A 4OPQA 2VGLS 3G30A 1YT4A 2RL3A 4HP9A 2XSSA 3BFCA 4R0QA 3OCNA 4JGRA 3VOLA 4ME4A 2DRWA 5DJTA 1ES3A 4X56A 2JCHA 5EV0A 1RGZA 2QMIA 1N9NA 1SCWA 1CK3A 3GQZA 5J3WA 4OQ0A 1CEFA 3MQ0A 3JVVA 3FKVA 5IU1A 2FFYA 2ZOHA 4GCZA 2O99A 3IF6C 3MXRA 3PYPA 2JN7A 1FILA 3IXDA 2VV6A 2M7UA 1XPBA 1FIKA 4K91A 4NG2A 2V8FA 3CHWP 4Y17A 4GN2A 4P6ZS 3IXGA 5DF7A 5G4YA 5FASA 4WMCD 1FCOA 4HY8A 5FQQA 2CMNA 2YKFA 1ERQA 3DTKA 5GHXA 4G3WA 1T19A 1CF0A 5M18A 2FFFB 3WS1A 4HP4A 3CUEA 3ITAA 2QHKA 2Y2PA 4GD6A 3FKWA 2XD1A 5HZHA 5HWTA 4RVAA 1OMEA 3EGDC 2ZC6B 4F3LB 1O07A 2ZM0A 1MWRA 5E43A 2X71A 4QJGA 5FAPA 3K3CA 4IHQA 2QPNA 1WYBA 4H8RA 1LI0A 2I9VA 1GSVA 3ZDJA 5F68A 1VEUB 3LEQA 3LUQA 5DF8A 1P9WA 4BD1A 4OQIA 5IT5A 3CG5A 1F5MA 3UE1A 2Y79A 3PAGA 4ZBEA 4Y3IA 4KG5A 3E0YA 2PU2A 2Q9NA 5J4EA 1OJGA 2HF6A 4LLOB 1SKOB 3IT9A 1SKFA 3S4XA 3V39A 2IWDA 3OLOA 3F1OB 2JKFA 2HDSA 4P87A 4O7DA 2J3WA 1K0KA 2WGVA 3CJMA 2Y91A 3FPWA 4KZ9A 1OT9A 1PI5A 1T18A 3H9WA 5LBRA 4Y0TA 4FTXA 4XXRA 3F1PB 4IVKA 3GRJA 4MN6A 3NDEA 3CUEC 1JWPA 2HP5A 1S66L 3F1PA 1IYOA 1MWTA 2ZC4B 3W8KA 2EA9A 3OPHA 4OP5A 2B18A 3DTEA 3HCYA 3UE0A 2HP9A 5FQIA 3FPVA 2PYRA 1VQQA 3VFHA 1MBLA 2W3GA 1L3LA 4ZRRA 3CPTA 5CTNA 3A3FA 1LSXA 3IH8A 3UPNA 5FQ9A 4IUKA 3VSLA 3SW1A 3NECA 3LR0A 4HESA 1F2KA 4DE0A 1JNUA 3R4KA 1PZPA 1ES5A 2J9PA 2QKPA 1E4DA 3ZG8B 4NXBA 4IBXA 3V3SA 4JF5A 4HJ6A 2G7UA 2IWBA 4NETA 3LI9A 4WELA 3PTEA 2J8YA 5I5LA 3RH8B 1WA9A 4OP8A 3CI6A 5JYPA 4IJGA 1PI4A 1RCJA 4Q0HA 4XUXA 4JXVA 4B93A 5U47A 1E3UD 4WF0A 4PAUA 5D3OA 4BJPA 1JWVA 4PM5A 3OPLA 4PM7A 3ZHHA 2VGLM 4EBNA 1KE0A 3KYZA 2WAFA 3BFEA 5HAQA 2B5RA 2VJWA 1JTDA 2OV5A 2B95A 3MS6A 3TOIA 3PBTA 5CRFA 4CLCA 1ALQA 3HLGA 1LL5A 1T1AA 4H6JB 3HUNA 2IWCA 2JKRM 5C5KA 1S67L 1OTEA 4E3NA 4H6JA 3T4LA 2P74A 5HDSA 1KVLA 3L7HA 3JPUA 4K0WA 4X69A 5EM1A 3HBRA 1PFLA 5EFWA 4P6ZM 1NZUA 2J7VA 4NXFA 3M6BA 3UE6A 2J3TD 3GTCA 2P04A 1DP9A 2QYBA 1OTBA 4E04A 2Y55A 2GX5A 1NJ4A 2PAVP 3CITA 5AQ7A 4DRTA 5E2GA 1H8YA 3HLWA 5FATA 1FSWA 3NOUC 4IBRA 2W3FA 1JTGA 1LLBA 1ERMA 3UB6A 5HD5A 1T1CA 3U2AA 1XJ2A 3PBNA 2BASA 3IXBA 2O9CA 1PNEA 3KYEA 1BYWA 4AFIA 1ZKJA 3IWIA 1G6AA 2W27A 3N8LA 4P6BA 3ZQ5A 1L0DA 1KDWA 4R3AA 1DP6A 5FL3A 2X02A 3QP1A 4JXSA 3LO7A 3WWXA 3G32A 1OTIA 2UWXA 3NY4A 1YLJA 2Q0OA 4U0TA 5AQBA 1H8MA 3UPPA 5A8BA 4EETB 3ZNYA 1P0ZA 2EXBA 5FQJA 2HDRA 2ZQ7A 3BRMA 3UB9A 4CPKA 2WK0A 3IH9A 1W63M 1NY0A 4DMZA 2PBDP 1NYYA 2HGVA 3TRCA 2O9AA 3LY4A 3TW8A 2ZMAA 5DKKA 5M1AA 3MFDA 4KZ5A 1I5QA 1IELA 1MXOA 3KSIA 2NUPC 4LENA 3NBLA 1PWDA 1H8ZA 3A0RA 4GD8A 3R7WB 2J9OA 5CHJA 1IYPA 1H3QA 2KX6A 4LFUA 4Y7PA 4KZAA 3PXPA 3LIDA 2V8CA 5F1GA 3WS0A 2GDNA 2L0WA 1KE4A 3IXHA 3N8RA 3T1XA 1TS6A 5FEGA 4FSFA 3UO9A 1XFQA 2H10A 3VFFA 4P0MA 3E98A 2Y4AA 3PBSA 4WZ5A 5FQMA 2HP6A 3G31A 2V2FF 4HI4A 3LIFA 2XF3A 4OH0A 4DF6A 5J8XA 2OSUA 5F6AA 3UE3A 2PRFA 3EEAA 2Y2HA 4G3KA 1YLTA 1EW0A 3GV9A 3Q7ZA 3F1NA 1V9ZA 2ZOIA 4U0XA 4B4XA 1XJ4A 1NLZA 4JXGA 5HPFA 3A3JA 3ICYA 3LGOA 5CHMA 3C4OA 1J9MA 4S2OA 2JKTM 1XFNA 2K31A 4YFMA 2HDUA 3IF6B 3U4LP 1LL9A 1NXYA 3HLEA 2R9WA 1D06A 4EEPA 4MBHA 5CXWA 4CQHA 4YINA 2PDRA 1KGGA 4CJNA 2Z6DA 1XJ6A 3P7NA 1FCMA 2HV1A 1I2WA 4OOLA 4BENA 3S22A 4N9KA 1EI5A 4R38A 1YPRA 1YMXA 1K38A 2XD5A 1W8QA 3UPOA 2XFSA 2NUTC 1PIOA 4WZ5C 5EM0A 2QWSA 4UA7A 4BBTA 4KENB 3BQ8A 1YMSA 1YSQA 4OOYA 5KZHA 4X68A 2OAP1 1I2SA 4LPZA 4OKPA 5F83A 3CZDA 3VE3A 5CTMA 3QP5A 4NKPA 4HEFA 4KQQA 2WGIA 3SS4A 4HJ4A 3HJIA 1KGEA 2D02A 2KDKA 4L9GA 5EE8A 1HLUP 3MZDA 4E3OA 5GLBA 1YLPA 4WBGA 4DJ3A 1SDNA 5CGWA 3D4FA 5FI2A 1FOFA 1HTZA 3NJAA 1K57A 1M6KA 3RJUA 5G18A 2Y2GA 4F94A 4Q0JA 4CLCE 3GR2A 1FR1A 4OOMA 3D72A 3LR3A 3A0VA 4GB7A 4O01A 4GJ4A 1T1BA 1W5DA 4MN7A 3C7VA 4OVDA 3AGEA 4E3JA 4JBFA 5L07A 4EQIA 2BLSA 3VP4A 2ZLYA 4GZBA 2ZQCA 4X25A 1IFQA 3E4OA 1CEGA 3IWQA 5TR7A 2Y2LA 4ZDXA 3BWLA 4LGWA 4EEUA 1P9RA 3KO6A 4R1GA 3HLCA 2WZXA 4LV3A 1HD8A 3UNWA 3G4PA 3HJKA 4ID4A 2W3DA 4WMCA 3ZCZA 1KOUA 3B3XA 3PR6A 3S7PA 5FI7A 2ZMFA 3DWKA 4QPRA 3KX0X 2E8IA 3B33A 2EXAA 2ZC7A 4RX3A 4GNUA 1K6SA 5A92A 5FAOA 3KSGA 4E3KA 1G6OA 4KQRA 3M2JA 1GCEA 1K57C 3HLFA 4LRXC 3IBRA 3FV7A 2XLNA 1GHIA 2QZ6A 4EESA 2V0WA 3BECA 4NEED 4E3LA 4WN5A 3VP2A 4KZBA 3Q07A 5FA7A 1BZAA 1K55A 4ZAMA 4L9EA 4OPYA 3GDIA 1D7EA 4R6LA 2RCXA 3SZTA 2M1CA 4EU0A 3UDFA 3RXWA 4KZ3A 1PW1A 3FG8A 2VX8A 4EERA 2W1RA 3SH8A 4KUOA 4O0PA 5K5BA 4N92A 2EX6A 1TDLA 3CPTB 2GJ3A 1NLYA 2X01A 4S2MA 1IKIA 3LY3A 2PHYA 1TDGA 2HJEA 2P9VB 1Z09A 3G34A 5I94A 4JGOA 4BBVA 2WKIA 4WLAA 1XGJA 2P9VA 1BLPA 2A3UA 4R3JA 4IVIA 3LR5A 1EROA 4N1XA 1ZG6A 1SHVA 2GZAA 3LI8A 4UA9A 4KQOA 5TGFA 4R4SA 5M19A 1X0OA 2BG1A 5HW3A 5CGXA 5CHUA 2HPBA 1RP5A 1MY8A 1K55C 4DJ2A 4JPMA 3LIAA 3W4QA 1FQGA 4KG6A 3C38A 4M3KA 4X1LA 4N1HA 4O8GA 3WS5A 5G4ZA 1XKZA 3IX3A 3EGXC 4UHUA 5A93A 2EX8A 3H7WA 2ZM8A 4BL3A 3C4PA 2OOLA 3BW6A 2Q9MA 1PRQA 5FEFA 4ESPA 5HWVA 3WRTA 4CLCB 3H82A 3G2YA 4Y5FA 1E3UA 5DJUA 3Q81A 4K0XA 3O86A 4R3BA 3EQUA 3M6HA 1S1ZA 4I3AA 3W4OA 2XROA 4II7A 3DTIA 3B47A 2GNXA 4KG2A 3OPRA 3P98A 3K3DA 4BMWA 5AVEA 3Q7VB 1W63Q 3WRZA 3HVFA 1ESUA 4E3IA 1STZA 3Q7VA 5HDDA 3MXSA 3MBZA 1J3WA 3BYDA 1YKDA 3VMAA 5HX9A 4I39A 2PR5A 4E3MA 5EVID 3EOIA 3TE8A 4YWZA 4M4XA 3E2LA 4QD4A 3WS2A 3BM6A 1TD5A 4Z9QA 1NRJA 4K08A 1K56D 2EWVA 1NYMA 4HBTA 2Y2KA 1LI9A 3HREA 2Z2LB 3DW0A 1AWIA 2Z2MB 3A3DA 3P09A 3MZEA 1E25A 1K25A 3T12B 1DJBA 3DTMA 5CERA 2ZC5B 4EV4A 1Y4OA 2VLGA 3Q1FA 5CGSA 1IEMA 4CLCC 3UMEA 1SZVA 3NDGA 4XUZA 4LV0A 2WYXA 4HQAA 2B02A 3EEHA 5MC7A 1LSWA 5GLCA 2JKRI 4BWIA 1BSGA 4OQGA 1OPXA 4DE3A 1HVBA 4EUZA 5CECA 5EVLA 3QNCA 1CI9A 2ZQDA 3KSFA 3SOIA 1KGFA 3CAXA 2O0YA 1BLCA 3V5MA 1OTDA 1GA9A 1NRFA 1C3BA 4S2JA 2ZQAA 2VV8A 3SS3A 2PD7A 4QHCA 2AVXA 4LCMA 3C7UA 3N4IA 4EUVA 2FZ0A 4I38A 2XEPA 1GHPA 2WZZA 1Y28A 2L1MA 1LSVA 4MLLA 2ZBBA 2M7VA 1UWPX 4GS9B 1VETA 1YM1A 5A91A 2PT7A 3VP0A 1JVJA 4PM8A 4GS9A 5FDSA 5DF9A 4HHDA 3O87A 1WYCA 2PYPA 4OONA 1VB6A 1K4EA 2Y2OA 4QY6A 2W1TB 3MFXA 2XK1A 1G28A 3VOZA 3HLBA 1IOUA 2W1TA 3T4TA 2LB9A 4X53A 4LRYC 3SH9A 1GSWA 5E2FA 5AVFA 5HL6A 3NHQA 1S4RA 1NWZA 4EXOA 4GKUA 3HLDA 1TEMA 4L0LA 1PWGA 2W3EA 3JYIA 4JKTA 3ZG0A 2ZM2A 3FC7A 1IYSA 1N4OA 5HAPA 3OBFA 4R23A 2W0NA 2JBFA 2OWJA 4UA6A 3LEZA 2PR6A 3K2NA 2L4RA 2H28A 4MBFA 2I72A 3A0SA 3F1NB 2QJ7A 3AGFA 3UDIA 3IS2B 3CWFA 3T1QB 4JF4A 3IS2A 4HH2A 2V1ZA 4KZ4A 4OPZA 3UMDA 3BLSA 2A2LA 3BY8A 3QP2A 1LL8A 1F98A 1DY6A 2EFUA 4NXEA 5BOHA 3PBQA 2OLUA 5HWWA 3MQQA 2JKGA 1YQSA 4LV2A 1AXBA 3CLOA 1XP4A 4PPRA 2V1BA 3IHAA 4YNRA 4GW9A 3G6OA 4KUKA 3T4SA 1DRMA 3L9KA 5DTSA 1TS8A 2ZQ8A 5CX7A 2OAQ1 1KDSA 4MEZA 2Y2MA 2WUQA 3DAVA 1S0WA 4WYYA 2EWWA 4WUJA 3S1YA 4LRZE 3E4QA 4DDYA 5EECA 5L8MA 1Y54A 3G2ZA 3HUOA 1L2SA 3E2KA 2A24B 5HD3A 4BD0A 2A49A 4R4RA 2A24A 1FCNA 2ZL1A 3T4JA 5F69A 4C6YA 5E2HA 4BL2A 3OCLA 4U3TA 1F9IA 3QP8A 5FDHA 3BLMA 1HZOA 4MDZA 3QP6A 3D9YA 2WKPA 4D2OA 2O9BA 2H0YA 2JC7A 5EUAA 4L9FA 5E2EA 2KLIA 2WKQA 2ZC3B 5DKLA 2V0UA 1D1JA 2V1AA 1GA0A 1S6RA 2Y59A 3PBOA 1N9OA 2R9XA 4JGQA 3LR4A 1MWSA 1DP8A 3LFVA 3QP4A 1K6RA 2E8JA 1Z6FA 2JKTI 4OLDA 4PM6A 1P97A 1MZUA 3GECA 3IX4A 4HNBA 3BJNA 1W79A 4DXCA 3ISGA 3LICA 1JWZA 5F5YA 3KSHA 2BTFP 3O88A 4WEJA 4Q0IA 2VZWA 5DVAA 3BY9A 3N8SA 4ZJ3A 4BQMA 4JXWA 4EBPA 3MXQA 1BT5A 4PM9A 2XR0A 3G35A 5DTTA 3T4QA 2K7SA 3OC2A 4JF6A 1DJCA 1ESIA 5DFYA 3ZGAB 2UV0E 5HSQA 2WKRA 2J80A 3GVBA 3ZYTA 3EWKA 2WGWB 4FCFA 1PW8A 2WGWA 5FI6A 1QMEA 3T1SA 3WS4A 4WM9A 3W2ZA 5KSCA 4S2LA 4JLFA 3MMHA 3MKFA 4EW7A 4WZ4A 1BLHA 5GL9A 1A0KA 4EBLA 1ONHA 4ZJ2A 2Y2NA 1K54A 4R70A 4EQ1A 1GSXA 1YSPA 3T1RA 4B9OA 5DFXA 4F3LA 1VM1A 4N9LA 3ITBA 1LT0A 1ZC2A 3SS5A 1O7EA 4FUWA 4LV1A 4I3IA 4DKIA 1EWZA 3A3IA 4EWFA 2D01A 4QWOA 4YOFA 5L10A 3GSGA 3ZG9B 4DDSA 1VEUA 2XA7S 1UGUA 4MCWA 5FQKA 1H5XA 2FH5A 2G2WA 3HUMA 5CEBA 2ACGA 1OTAA 4PHTA 3S7NA 4OQHA 1L0FA 4UAAA 3NCKA 2WAEA 1ONGA 3VP1A 1CQAA 2K2NA 3TJZC 3IX8A 2HDQA 3TSGA 1SKOA 3HL9A 3MF0A 3C5AA 4RX2A 3ULFA 1S1YA 3F1OA 1XXMA 3O3VA 3VOYA 3T4OA 2G2UA 3QNBA 2H5SA 4GHIB 4HOIA 2C5WB 5HARA 3OPPA 2JHEA 2Y8HA 4GHIA 1G5UA 2V20A 4ETXA 2XFTA 1H0MA 1XA7A 1K54C 2HJ9C 1ZHHB 2CC1A 4D60A 3V3RA 3E4PA 1K4FA 4MBKA 1ES4A 3ZNTA 2YKHA 4KQDA 1IKGA 2V9AA 3BFDA 2VKSA 1ODVA 4FH4A 3ZG5A 1U60A 5IS1A 1QMFA 2ZQ9A 4FH2A 4KZ6A 3PBRA 2W3HA 1VHMA 3B42A 5F1FA 2XH9A 3H7WB 1GHMA 1ACFA 4HBUA 2ZJ9A 4DXBA 1PZOA 3FYZA 1Q2PA 3VV4A 2R78A 2OLVA 3H82B 5KMWA 4X6TA 4QU3A 3LCEA 5EOOA 4CLCD 3SH7A 4I3JA 3N6IA 2P7JA 1ZG4A 4FD8A 5A90A 2DCFA 3ZG7B 1L0EA 4S2KA 4P85A 3VSKA 2Y2QA 2XDMA 4JGPA 4E6WA 2EX2A 4HJ3A 3I7JA 3UN7A 3IWOA 3OZHA 2EX9A 4OPRA 2XRNA 3ZVWA 4GDNA 4Y13A 1N9LA 5AJGA 5IHVA 2JE5A 4WEKA 4Y2FA 4X1MA 2Y2JA 3ZFZA 3VE4A 2P08A 2VGJA 3QHYA 4KZ7A 1BLSA 5GLDA 2VA0A 4I5SA 2QJ5A 5EVEA 2VEAA 4IEDA 4OLGA 1FSYA 2IA2A 1XA1A 5EVIB 1MKIA 2DMWA 3A3EA 3MSHA 1XX2A 1XJ3A 1PWCA 3PHYA 5EVIA 3DBAA 4B4ZA 5CEDA 1UWNX 4QY5A 4XT2B 3S7QA 1TS0A 3BQAA 3MJQA 2MJ6A 2INWA 2PBYA 4XT2A 4UQIS 1TS7A 1Q2QA 5HL1A 5GHZA 2Z6CA 2ZD8A 1K56A 4ZJ1A 3UY6A 2ZMVA 2OWHA 3RTYA 3BFGA 4S2IA 4KZ8A 3KYQA 5KSHA 3T50A 4UEYA 2VV7A 1MKMA 3OOVA 3N7WA 3EQVA 3V50A 4S2PA 1CI8A 2PD8A 4Y15A 1YLYA 3W4PA 3RFBA 2EFXA 3T4KA 2XA7M 4WL9A 3Q82A 1YLWA 1FR6A 2C6WB 1MPLA 1DJAA 5J7EA 1KVMA 2WADA 4MN5A 4ARZB 3MQOA 3ZVTA 5HFOA 4PKYA 3BFFA 4ARZA 2XGNA 3IHBA 5TJJA 4HIAA 4Y0OA 4A5RA 4S2NA 3NC8A 3MR0A 2WKEA 1IYQA 4IUHA 1VETB 3UDXA 3TG9A 4HH3A 1W8YA 5EVIC 1M40A 4Y0UA 2J3TC 5AQAA 1MC0A 4C75A 3NOPC 2KOIA 1TF1A 1BULA 1N9BA 1S4SA 3RXXA 3UB5P 4B88A 2XQZA 3MZFA 4ETZA 3LYXA 5TFQA 3BEBA 1KE3A 3C30A 1XGIA 4LCLA 5JYOA
chains in the Genus database with same CATH topology
2Y59A 3PBOA 2R9XA 4K0WA 4X69A 1MWSA 3HBRA 1W7FA 1NZUA 4NK3A 2J7VA 3MKEA 3PAEA 1K6RA 3M6BA 1Z6FA 3SH8A 3GMWA 4OLDA 1PYYA 3GTCA 4PM6A 3FWLA 2Y55A 1W79A 4DXCA 3ISGA 4N92A 1NJ4A 1JWZA 2EX6A 1TDLA 5DTKA 1BUEA 5FAQA 1NZOA 2VGKA 3O88A 2X01A 4WEJA 4S2MA 5DVAA 1IKIA 4C3QA 5AQ7A 3N8SA 4DRTA 3LY3A 1G68A 5E2GA 5L2FA 1H8YA 1TDGA 1LHYA 2P9VB 3HLWA 4RYEA 4ZJ3A 4BQMA 4JXWA 3G34A 3IF5A 1FSWA 1BT5A 4PM9A 4X55A 2XR0A 5F82A 2WKIA 3DWZA 4E6XA 5I94A 3FZCA 1XGJA 2P9VA 1BLPA 3G35A 4IBRA 5DTTA 3VP3A 4S2NC 1JTGA 1LLBA 3OC2A 1ERMA 4JF6A 4ZTKA 2DNSA 5FSRA 5GHYA 2A3UA 1SDEA 4R3JA 1DJCA 4IVIA 3PBNA 1ESIA 1EROA 4N1XA 5EOEA 3ZGAB 1ZG6A 3IXBA 3GVBA 1SHVA 2WGWB 4UA9A 4FCFA 4MNRA 4KQOA 1ZKJA 5TGFA 4R4SA 3IWIA 1PW8A 1G6AA 5M19A 2WGWA 2BG1A 5HW3A 5FI6A 1QMEA 5CGXA 3N8LA 4P6BA 5CHUA 2PU4A 3WS4A 2HPBA 1L0DA 4WM9A 1RP5A 4QB8A 1MY8A 5EPHA 5KSCA 3CMZA 4S2LA 1KDWA 1YLZA 5AQ9A 1K55C 4JLFA 1ES2A 4JPMA 1WE4A 2WKHA 3W4QA 1FQGA 4KG6A 2X02A 4JXSA 3LO7A 3WWXA 3MKFA 4M3KA 3G32A 4BLMA 4WZ4A 4N1HA 2UWXA 3NY4A 1YLJA 1BLHA 5GL9A 3WS5A 4EBLA 1XKZA 4GOGA 3IQAA 3AGDA 1ONHA 4UHUA 4DE2A 4ZJ2A 3IF6A 4U0TA 5AQBA 5A93A 2EX8A 3UPPA 2Y2NA 1K54A 3NIAA 3ZNYA 5HAIA 2ZM8A 2EXBA 4BL3A 3C4PA 5FQJA 1L0GA 2HDRA 2Q9MA 1VM1A 2ZQ7A 3BRMA 4N9LA 3ITBA 4CPKA 2WK0A 3WRTA 3IH9A 1TVFA 1ZC2A 3G2YA 1O7EA 3SS5A 4Q8IA 1MWUA 1BTLA 4LV1A 1E3UA 2Y2IA 3Q81A 4DE1A 1EWZA 3A3IA 1NY0A 3O86A 4K0XA 4DKIA 4R3BA 4EWFA 3EQUA 3M6HA 3M2KA 1NYYA 3GSGA 3ZG9B 4DDSA 3W4OA 3LY4A 2H0TA 1RGYA 5GLAA 2ZMAA 4KG2A 5FQKA 1H5XA 3OPRA 3P98A 5M1AA 3MFDA 2G2WA 3HUMA 4KZ5A 5CEBA 3Q7VB 1I5QA 1IELA 4RA7A 4PMAA 4GDBA 3HVFA 1ESUA 3WRZA 1MXOA 4E3IA 3Q7VA 3MXSA 4LENA 3NBLA 3MBZA 3BYDA 1PWDA 3NI9A 3VMAA 4OQHA 4OPQA 1H8ZA 1L0FA 4GD8A 5HX9A 2J9OA 5CHJA 4E3MA 1IYPA 5EVID 4UAAA 3NCKA 2WAEA 1ONGA 3VP1A 3G30A 2HDQA 1YT4A 3TSGA 2RL3A 3BFCA 4R0QA 3E2LA 4Y7PA 4KZAA 4QD4A 3WS0A 5F1GA 3HL9A 3OCNA 2GDNA 1KE4A 2DRWA 1ES3A 3C5AA 3IXHA 3N8RA 4RX2A 3BM6A 4X56A 3WS2A 4Z9QA 2JCHA 1RGZA 1K56D 1XXMA 2QMIA 3O3VA 3VOYA 1SCWA 1NYMA 2G2UA 3QNBA 2Y2KA 4FSFA 1LI9A 2H5SA 4HBTA 3UO9A 2H10A 1CK3A 3GQZA 4P0MA 4OQ0A 3VFFA 2Y4AA 1CEFA 2C5WB 3PBSA 3HREA 3OPPA 5HARA 2Z2LB 3DW0A 4WZ5A 5FQMA 3FKVA 2FFYA 2HP6A 3G31A 2V2FF 2V20A 2XFTA 3IF6C 2Z2MB 3MXRA 3A3DA 2XF3A 1XA7A 1K54C 4OH0A 3IXDA 3P09A 3MZEA 2CC1A 4DF6A 5J8XA 2OSUA 3UE3A 1E25A 1K25A 3V3RA 1DJBA 3DTMA 2Y2HA 1K4FA 1XPBA 4MBKA 5CERA 1YLTA 2ZC5B 1ES4A 3GV9A 4K91A 4EV4A 3ZNTA 3Q7ZA 3Q1FA 5CGSA 1IEMA 4GN2A 4B4XA 4U0XA 3IXGA 1IKGA 3NDGA 4XUZA 5DF7A 4LV0A 5FASA 3BFDA 4JXGA 4WMCD 1FCOA 5FQQA 2WYXA 3A3JA 4FH4A 1ERQA 3ZG5A 1U60A 1QMFA 5CHMA 2ZQ9A 4FH2A 5GLCA 3C4OA 4KZ6A 1BSGA 3PBRA 4OQGA 5GHXA 1J9MA 4S2OA 4DE3A 1HVBA 4EUZA 5CECA 5EVLA 5M18A 4YFMA 3QNCA 2HDUA 1CI9A 2FFFB 2ZQDA 3WS1A 3IF6B 3SOIA 2XH9A 5F1FA 1KGFA 1GHMA 3ITAA 1LL9A 2Y2PA 1BLCA 1NXYA 4GD6A 4HBUA 3FKWA 3HLEA 3V5MA 2XD1A 1GA9A 2ZJ9A 1NRFA 1OMEA 4RVAA 4DXBA 1PZOA 3FYZA 2ZC6B 1C3BA 2R9WA 1O07A 1Q2PA 2ZM0A 1MWRA 4S2JA 5E43A 2X71A 2OLVA 5KMWA 4MBHA 4X6TA 4QU3A 5CXWA 3LCEA 2ZQAA 5EOOA 4QJGA 4YINA 3SH7A 5FAPA 3SS3A 1KGGA 2QPNA 3N6IA 1WYBA 1ZG4A 4FD8A 4H8RA 5A90A 4CJNA 1LI0A 4QHCA 1FCMA 2DCFA 1I2WA 3C7UA 4LCMA 3N4IA 4OOLA 4BENA 3S22A 4N9KA 3ZDJA 1L0EA 1EI5A 3ZG7B 4S2KA 1YMXA 1K38A 2XD5A 5DF8A 1W8QA 2XEPA 4P85A 3UPOA 2XFSA 1GHPA 2WZZA 4BD1A 4OQIA 3VSKA 1PIOA 3CG5A 2Y2QA 4MLLA 4WZ5C 2XDMA 4E6WA 2EX2A 4UA7A 3UE1A 1YM1A 4KENB 3I7JA 5A91A 3PAGA 1YMSA 3UN7A 4ZBEA 3VP0A 1JVJA 4PM8A 3IWOA 3OZHA 5DF9A 4OOYA 2EX9A 4KG5A 3O87A 5KZHA 1WYCA 2PU2A 2Q9NA 4X68A 4OPRA 1I2SA 4OONA 4OKPA 4EBPA 1K4EA 5F83A 3CZDA 3ZVWA 2Y2OA 4QY6A 4GDNA 5CTMA 3IT9A 5IHVA 2JE5A 4HEFA 4KQQA 4WEKA 1SKFA 2XK1A 3S4XA 2WGIA 2Y2JA 3SS4A 3VOZA 3HLBA 3ZFZA 3V39A 2IWDA 2VGJA 3QHYA 1KGEA 2HDSA 4KZ7A 4P87A 4X53A 4O7DA 1BLSA 3SH9A 5EE8A 5GLDA 5E2FA 3MZDA 2WGVA 3CJMA 4IEDA 4E3OA 2Y91A 5GLBA 4KZ9A 1YLPA 4WBGA 4OLGA 1SDNA 5CGWA 3D4FA 1PI5A 1FSYA 5FATA 4GKUA 3HLDA 1TEMA 4L0LA 4Y0TA 1PWGA 1XA1A 5EVIB 3JYIA 4XXRA 4JKTA 1MKIA 4IVKA 3GRJA 3A3EA 1FOFA 1HTZA 2ZM2A 3NDEA 5FI2A 3ZG0A 1XX2A 1K57A 1PWCA 1IYSA 1JWPA 1M6KA 1N4OA 3RJUA 2HP5A 5EVIA 5HAPA 5G18A 4B4ZA 2Y2GA 5CEDA 1IYOA 1MWTA 2ZC4B 4QY5A 3W8KA 3OPHA 4OP5A 4R23A 4F94A 3UE0A 2HP9A 3GR2A 1FR1A 4OOMA 5FQIA 2PBYA 2JBFA 4UA6A 1VQQA 3VFHA 1MBLA 3LEZA 5CTNA 1Q2QA 4GB7A 4MBFA 2I72A 3A3FA 5GHZA 2ZD8A 3IH8A 3UPNA 5HL1A 1K56A 3AGFA 5FQ9A 4ZJ1A 3UDIA 3VSLA 3UY6A 1W5DA 4E3JA 3C7VA 4OVDA 3AGEA 4JBFA 4JF4A 3BFGA 4HESA 4S2IA 4EQIA 2V1ZA 4KZ8A 5KSHA 2BLSA 4KZ4A 3VP4A 2ZLYA 4GZBA 2ZQCA 3N7WA 4OPZA 4DE0A 3BLSA 1CEGA 3EQVA 3IWQA 3V50A 1PZPA 5TR7A 2Y2LA 1ES5A 1DY6A 4S2PA 2EFUA 4ZDXA 2J9PA 1E4DA 1CI8A 3PBQA 3ZG8B 2OLUA 1YLYA 5BOHA 3W4PA 4IBXA 3V3SA 2EFXA 4JF5A 1YQSA 4LV2A 1AXBA 2IWBA 1XP4A 4NETA 4PPRA 3IHAA 3Q82A 4WELA 1YLWA 1FR6A 3PTEA 2C6WB 2J8YA 4R1GA 3HLCA 2WZXA 1MPLA 4LV3A 4OP8A 5JYPA 1DJAA 1KVMA 2WADA 1HD8A 3UNWA 1PI4A 3G4PA 1RCJA 4XUXA 4ID4A 5DTSA 4JXVA 4WMCA 3ZCZA 5HFOA 3ZVTA 3BFFA 5U47A 1E3UD 2ZQ8A 1KDSA 3B3XA 4MEZA 5D3OA 2Y2MA 2XGNA 3IHBA 4BJPA 1JWVA 4PM5A 5FI7A 3DWKA 3OPLA 2WUQA 4PM7A 1S0WA 3ZHHA 4WYYA 4EBNA 4Y0OA 2E8IA 4A5RA 2EXAA 1KE0A 2ZC7A 4RX3A 4S2NA 4GNUA 3S1YA 3NC8A 4DDYA 1K6SA 2WKEA 5EECA 1Y54A 5FAOA 2WAFA 5A92A 3G2ZA 1IYQA 3HUOA 1L2SA 4E3KA 3BFEA 3UDXA 4KQRA 3E2KA 3M2JA 1GCEA 3TG9A 4BD0A 1K57C 3HLFA 2A49A 5HAQA 1W8YA 5EVIC 2B5RA 1M40A 3FV7A 2XLNA 1JTDA 4R4RA 4Y0UA 2OV5A 1FCNA 1GHIA 5AQAA 4C75A 2QZ6A 3TOIA 3PBTA 5CRFA 4C6YA 5E2HA 4BL2A 3BECA 4E3LA 3OCLA 1BULA 4U3TA 1ALQA 1N9BA 3VP2A 3RXXA 3HLGA 5FDHA 3BLMA 1LL5A 4KZBA 4B88A 2XQZA 3HUNA 1HZOA 3Q07A 3MZFA 1BZAA 5FA7A 2IWCA 1K55A 4ZAMA 4D2OA 5TFQA 4OPYA 3BEBA 4E3NA 2H0YA 2JC7A 2RCXA 1KE3A 5EUAA 2P74A 5E2EA 1XGIA 2ZC3B 1KVLA 3UDFA 4LCLA 5JYOA 3RXWA 1GA0A 1S6RA 4KZ3A 1PW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y59 A;  3PBO A;  2R9X A;  4K0W A;  4X69 A;  1MWS A;  3HBR A;  1W7F A;  1NZU A;  4NK3 A;  2J7V A;  3MKE A;  3PAE A;  1K6R A;  3M6B A;  1Z6F A;  3SH8 A;  3GMW A;  4OLD A;  1PYY A;  3GTC A;  4PM6 A;  3FWL A;  2Y55 A;  1W79 A;  4DXC A;  3ISG A;  4N92 A;  1NJ4 A;  1JWZ A;  2EX6 A;  1TDL A;  5DTK A;  1BUE A;  5FAQ A;  1NZO A;  2VGK A;  3O88 A;  2X01 A;  4WEJ A;  4S2M A;  5DVA A;  1IKI A;  4C3Q A;  5AQ7 A;  3N8S A;  4DRT A;  3LY3 A;  1G68 A;  5E2G A;  5L2F A;  1H8Y A;  1TDG A;  1LHY A;  2P9V B;  3HLW A;  4RYE A;  4ZJ3 A;  4BQM A;  4JXW A;  3G34 A;  3IF5 A;  1FSW A;  1BT5 A;  4PM9 A;  4X55 A;  2XR0 A;  5F82 A;  2WKI A;  3DWZ A;  4E6X A;  5I94 A;  3FZC A;  1XGJ A;  2P9V A;  1BLP A;  3G35 A;  4IBR A;  5DTT A;  3VP3 A;  4S2N C;  1JTG A;  1LLB A;  3OC2 A;  1ERM A;  4JF6 A;  4ZTK A;  2DNS A;  5FSR A;  5GHY A;  2A3U A;  1SDE A;  4R3J A;  1DJC A;  4IVI A;  3PBN A;  1ESI A;  1ERO A;  4N1X A;  5EOE A;  3ZGA B;  1ZG6 A;  3IXB A;  3GVB A;  1SHV A;  2WGW B;  4UA9 A;  4FCF A;  4MNR A;  4KQO A;  1ZKJ A;  5TGF A;  4R4S A;  3IWI A;  1PW8 A;  1G6A A;  5M19 A;  2WGW A;  2BG1 A;  5HW3 A;  5FI6 A;  1QME A;  5CGX A;  3N8L A;  4P6B A;  5CHU A;  2PU4 A;  3WS4 A;  2HPB A;  1L0D A;  4WM9 A;  1RP5 A;  4QB8 A;  1MY8 A;  5EPH A;  5KSC A;  3CMZ A;  4S2L A;  1KDW A;  1YLZ A;  5AQ9 A;  1K55 C;  4JLF A;  1ES2 A;  4JPM A;  1WE4 A;  2WKH A;  3W4Q A;  1FQG A;  4KG6 A;  2X02 A;  4JXS A;  3LO7 A;  3WWX A;  3MKF A;  4M3K A;  3G32 A;  4BLM A;  4WZ4 A;  4N1H A;  2UWX A;  3NY4 A;  1YLJ A;  1BLH A;  5GL9 A;  3WS5 A;  4EBL A;  1XKZ A;  4GOG A;  3IQA A;  3AGD A;  1ONH A;  4UHU A;  4DE2 A;  4ZJ2 A;  3IF6 A;  4U0T A;  5AQB A;  5A93 A;  2EX8 A;  3UPP A;  2Y2N A;  1K54 A;  3NIA A;  3ZNY A;  5HAI A;  2ZM8 A;  2EXB A;  4BL3 A;  3C4P A;  5FQJ A;  1L0G A;  2HDR A;  2Q9M A;  1VM1 A;  2ZQ7 A;  3BRM A;  4N9L A;  3ITB A;  4CPK A;  2WK0 A;  3WRT A;  3IH9 A;  1TVF A;  1ZC2 A;  3G2Y A;  1O7E A;  3SS5 A;  4Q8I A;  1MWU A;  1BTL A;  4LV1 A;  1E3U A;  2Y2I A;  3Q81 A;  4DE1 A;  1EWZ A;  3A3I A;  1NY0 A;  3O86 A;  4K0X A;  4DKI A;  4R3B A;  4EWF A;  3EQU A;  3M6H A;  3M2K A;  1NYY A;  3GSG A;  3ZG9 B;  4DDS A;  3W4O A;  3LY4 A;  2H0T A;  1RGY A;  5GLA A;  2ZMA A;  4KG2 A;  5FQK A;  1H5X A;  3OPR A;  3P98 A;  5M1A A;  3MFD A;  2G2W A;  3HUM A;  4KZ5 A;  5CEB A;  3Q7V B;  1I5Q A;  1IEL A;  4RA7 A;  4PMA A;  4GDB A;  3HVF A;  1ESU A;  3WRZ A;  1MXO A;  4E3I A;  3Q7V A;  3MXS A;  4LEN A;  3NBL A;  3MBZ A;  3BYD A;  1PWD A;  3NI9 A;  3VMA A;  4OQH A;  4OPQ A;  1H8Z A;  1L0F A;  4GD8 A;  5HX9 A;  2J9O A;  5CHJ A;  4E3M A;  1IYP A;  5EVI D;  4UAA A;  3NCK A;  2WAE A;  1ONG A;  3VP1 A;  3G30 A;  2HDQ A;  1YT4 A;  3TSG A;  2RL3 A;  3BFC A;  4R0Q A;  3E2L A;  4Y7P A;  4KZA A;  4QD4 A;  3WS0 A;  5F1G A;  3HL9 A;  3OCN A;  2GDN A;  1KE4 A;  2DRW A;  1ES3 A;  3C5A A;  3IXH A;  3N8R A;  4RX2 A;  3BM6 A;  4X56 A;  3WS2 A;  4Z9Q A;  2JCH A;  1RGZ A;  1K56 D;  1XXM A;  2QMI A;  3O3V A;  3VOY A;  1SCW A;  1NYM A;  2G2U A;  3QNB A;  2Y2K A;  4FSF A;  1LI9 A;  2H5S A;  4HBT A;  3UO9 A;  2H10 A;  1CK3 A;  3GQZ A;  4P0M A;  4OQ0 A;  3VFF A;  2Y4A A;  1CEF A;  2C5W B;  3PBS A;  3HRE A;  3OPP A;  5HAR A;  2Z2L B;  3DW0 A;  4WZ5 A;  5FQM A;  3FKV A;  2FFY A;  2HP6 A;  3G31 A;  2V2F F;  2V20 A;  2XFT A;  3IF6 C;  2Z2M B;  3MXR A;  3A3D A;  2XF3 A;  1XA7 A;  1K54 C;  4OH0 A;  3IXD A;  3P09 A;  3MZE A;  2CC1 A;  4DF6 A;  5J8X A;  2OSU A;  3UE3 A;  1E25 A;  1K25 A;  3V3R A;  1DJB A;  3DTM A;  2Y2H A;  1K4F A;  1XPB A;  4MBK A;  5CER A;  1YLT A;  2ZC5 B;  1ES4 A;  3GV9 A;  4K91 A;  4EV4 A;  3ZNT A;  3Q7Z A;  3Q1F A;  5CGS A;  1IEM A;  4GN2 A;  4B4X A;  4U0X A;  3IXG A;  1IKG A;  3NDG A;  4XUZ A;  5DF7 A;  4LV0 A;  5FAS A;  3BFD A;  4JXG A;  4WMC D;  1FCO A;  5FQQ A;  2WYX A;  3A3J A;  4FH4 A;  1ERQ A;  3ZG5 A;  1U60 A;  1QMF A;  5CHM A;  2ZQ9 A;  4FH2 A;  5GLC A;  3C4O A;  4KZ6 A;  1BSG A;  3PBR A;  4OQG A;  5GHX A;  1J9M A;  4S2O A;  4DE3 A;  1HVB A;  4EUZ A;  5CEC A;  5EVL A;  5M18 A;  4YFM A;  3QNC A;  2HDU A;  1CI9 A;  2FFF B;  2ZQD A;  3WS1 A;  3IF6 B;  3SOI A;  2XH9 A;  5F1F A;  1KGF A;  1GHM A;  3ITA A;  1LL9 A;  2Y2P A;  1BLC A;  1NXY A;  4GD6 A;  4HBU A;  3FKW A;  3HLE A;  3V5M A;  2XD1 A;  1GA9 A;  2ZJ9 A;  1NRF A;  1OME A;  4RVA A;  4DXB A;  1PZO A;  3FYZ A;  2ZC6 B;  1C3B A;  2R9W A;  1O07 A;  1Q2P A;  2ZM0 A;  1MWR A;  4S2J A;  5E43 A;  2X71 A;  2OLV A;  5KMW A;  4MBH A;  4X6T A;  4QU3 A;  5CXW A;  3LCE A;  2ZQA A;  5EOO A;  4QJG A;  4YIN A;  3SH7 A;  5FAP A;  3SS3 A;  1KGG A;  2QPN A;  3N6I A;  1WYB A;  1ZG4 A;  4FD8 A;  4H8R A;  5A90 A;  4CJN A;  1LI0 A;  4QHC A;  1FCM A;  2DCF A;  1I2W A;  3C7U A;  4LCM A;  3N4I A;  4OOL A;  4BEN A;  3S22 A;  4N9K A;  3ZDJ A;  1L0E A;  1EI5 A;  3ZG7 B;  4S2K A;  1YMX A;  1K38 A;  2XD5 A;  5DF8 A;  1W8Q A;  2XEP A;  4P85 A;  3UPO A;  2XFS A;  1GHP A;  2WZZ A;  4BD1 A;  4OQI A;  3VSK A;  1PIO A;  3CG5 A;  2Y2Q A;  4MLL A;  4WZ5 C;  2XDM A;  4E6W A;  2EX2 A;  4UA7 A;  3UE1 A;  1YM1 A;  4KEN B;  3I7J A;  5A91 A;  3PAG A;  1YMS A;  3UN7 A;  4ZBE A;  3VP0 A;  1JVJ A;  4PM8 A;  3IWO A;  3OZH A;  5DF9 A;  4OOY A;  2EX9 A;  4KG5 A;  3O87 A;  5KZH A;  1WYC A;  2PU2 A;  2Q9N A;  4X68 A;  4OPR A;  1I2S A;  4OON A;  4OKP A;  4EBP A;  1K4E A;  5F83 A;  3CZD A;  3ZVW A;  2Y2O A;  4QY6 A;  4GDN A;  5CTM A;  3IT9 A;  5IHV A;  2JE5 A;  4HEF A;  4KQQ A;  4WEK A;  1SKF A;  2XK1 A;  3S4X A;  2WGI A;  2Y2J A;  3SS4 A;  3VOZ A;  3HLB A;  3ZFZ A;  3V39 A;  2IWD A;  2VGJ A;  3QHY A;  1KGE A;  2HDS A;  4KZ7 A;  4P87 A;  4X53 A;  4O7D A;  1BLS A;  3SH9 A;  5EE8 A;  5GLD A;  5E2F A;  3MZD A;  2WGV A;  3CJM A;  4IED A;  4E3O A;  2Y91 A;  5GLB A;  4KZ9 A;  1YLP A;  4WBG A;  4OLG A;  1SDN A;  5CGW A;  3D4F A;  1PI5 A;  1FSY A;  5FAT A;  4GKU A;  3HLD A;  1TEM A;  4L0L A;  4Y0T A;  1PWG A;  1XA1 A;  5EVI B;  3JYI A;  4XXR A;  4JKT A;  1MKI A;  4IVK A;  3GRJ A;  3A3E A;  1FOF A;  1HTZ A;  2ZM2 A;  3NDE A;  5FI2 A;  3ZG0 A;  1XX2 A;  1K57 A;  1PWC A;  1IYS A;  1JWP A;  1M6K A;  1N4O A;  3RJU A;  2HP5 A;  5EVI A;  5HAP A;  5G18 A;  4B4Z A;  2Y2G A;  5CED A;  1IYO A;  1MWT A;  2ZC4 B;  4QY5 A;  3W8K A;  3OPH A;  4OP5 A;  4R23 A;  4F94 A;  3UE0 A;  2HP9 A;  3GR2 A;  1FR1 A;  4OOM A;  5FQI A;  2PBY A;  2JBF A;  4UA6 A;  1VQQ A;  3VFH A;  1MBL A;  3LEZ A;  5CTN A;  1Q2Q A;  4GB7 A;  4MBF A;  2I72 A;  3A3F A;  5GHZ A;  2ZD8 A;  3IH8 A;  3UPN A;  5HL1 A;  1K56 A;  3AGF A;  5FQ9 A;  4ZJ1 A;  3UDI A;  3VSL A;  3UY6 A;  1W5D A;  4E3J A;  3C7V A;  4OVD A;  3AGE A;  4JBF A;  4JF4 A;  3BFG A;  4HES A;  4S2I A;  4EQI A;  2V1Z A;  4KZ8 A;  5KSH A;  2BLS A;  4KZ4 A;  3VP4 A;  2ZLY A;  4GZB A;  2ZQC A;  3N7W A;  4OPZ A;  4DE0 A;  3BLS A;  1CEG A;  3EQV A;  3IWQ A;  3V50 A;  1PZP A;  5TR7 A;  2Y2L A;  1ES5 A;  1DY6 A;  4S2P A;  2EFU A;  4ZDX A;  2J9P A;  1E4D A;  1CI8 A;  3PBQ A;  3ZG8 B;  2OLU A;  1YLY A;  5BOH A;  3W4P A;  4IBX A;  3V3S A;  2EFX A;  4JF5 A;  1YQS A;  4LV2 A;  1AXB A;  2IWB A;  1XP4 A;  4NET A;  4PPR A;  3IHA A;  3Q82 A;  4WEL A;  1YLW A;  1FR6 A;  3PTE A;  2C6W B;  2J8Y A;  4R1G A;  3HLC A;  2WZX A;  1MPL A;  4LV3 A;  4OP8 A;  5JYP A;  1DJA A;  1KVM A;  2WAD A;  1HD8 A;  3UNW A;  1PI4 A;  3G4P A;  1RCJ A;  4XUX A;  4ID4 A;  5DTS A;  4JXV A;  4WMC A;  3ZCZ A;  5HFO A;  3ZVT A;  3BFF A;  5U47 A;  1E3U D;  2ZQ8 A;  1KDS A;  3B3X A;  4MEZ A;  5D3O A;  2Y2M A;  2XGN A;  3IHB A;  4BJP A;  1JWV A;  4PM5 A;  5FI7 A;  3DWK A;  3OPL A;  2WUQ A;  4PM7 A;  1S0W A;  3ZHH A;  4WYY A;  4EBN A;  4Y0O A;  2E8I A;  4A5R A;  2EXA A;  1KE0 A;  2ZC7 A;  4RX3 A;  4S2N A;  4GNU A;  3S1Y A;  3NC8 A;  4DDY A;  1K6S A;  2WKE A;  5EEC A;  1Y54 A;  5FAO A;  2WAF A;  5A92 A;  3G2Z A;  1IYQ A;  3HUO A;  1L2S A;  4E3K A;  3BFE A;  3UDX A;  4KQR A;  3E2K A;  3M2J A;  1GCE A;  3TG9 A;  4BD0 A;  1K57 C;  3HLF A;  2A49 A;  5HAQ A;  1W8Y A;  5EVI C;  2B5R A;  1M40 A;  3FV7 A;  2XLN A;  1JTD A;  4R4R A;  4Y0U A;  2OV5 A;  1FCN A;  1GHI A;  5AQA A;  4C75 A;  2QZ6 A;  3TOI A;  3PBT A;  5CRF A;  4C6Y A;  5E2H A;  4BL2 A;  3BEC A;  4E3L A;  3OCL A;  1BUL A;  4U3T A;  1ALQ A;  1N9B A;  3VP2 A;  3RXX A;  3HLG A;  5FDH A;  3BLM A;  1LL5 A;  4KZB A;  4B88 A;  2XQZ A;  3HUN A;  1HZO A;  3Q07 A;  3MZF A;  1BZA A;  5FA7 A;  2IWC A;  1K55 A;  4ZAM A;  4D2O A;  5TFQ A;  4OPY A;  3BEB A;  4E3N A;  2H0Y A;  2JC7 A;  2RCX A;  1KE3 A;  5EUA A;  2P74 A;  5E2E A;  1XGI A;  2ZC3 B;  1KVL A;  3UDF A;  4LCL A;  5JYO A;  3RXW A;  1GA0 A;  1S6R A;  4KZ3 A;  1PW1 A; 
#chains in the Genus database with same CATH topology
 4GLQ A;  3JVU A;  1W7F A;  5HDC A;  4NK3 A;  3LIB A;  3PAE A;  3MKE A;  3GMW A;  1PYY A;  3R7W A;  2LB5 A;  3FWL A;  1V9Y A;  2HZ5 A;  5KIZ A;  5DTK A;  1BUE A;  5FAQ A;  1NZO A;  2VGK A;  4DN0 A;  4C3Q A;  1G68 A;  5L2F A;  1LHY A;  4RYE A;  3IF5 A;  4X55 A;  4E6X A;  1OJ5 A;  5F82 A;  3DWZ A;  5TBM B;  3FZC A;  3NOT C;  3VP3 A;  4S2N C;  4ZTK A;  5TBM A;  2DNS A;  5FSR A;  5GHY A;  1SDE A;  5EOE A;  3LIE A;  3UB7 A;  3C2W A;  4MNR A;  1OT6 A;  2PU4 A;  2VK3 A;  4QB8 A;  3O5Y A;  5EPH A;  3CMZ A;  3V67 A;  1YLZ A;  5AQ9 A;  1ES2 A;  3C8C A;  4FOF A;  4NXG A;  1WE4 A;  4BBU A;  2WKH A;  3P01 A;  4RQ9 A;  5HPI A;  4BLM A;  4GOG A;  3IQA A;  3AGD A;  4DE2 A;  3IF6 A;  3NIA A;  5HAI A;  1L0G A;  2ZL1 B;  4MMN A;  3UB8 A;  1TVF A;  4Q8I A;  1MWU A;  1BTL A;  1ZTU A;  2Y2I A;  4DE1 A;  3M2K A;  1YAX A;  1CJF A;  2H0T A;  1RGY A;  5GLA A;  4PKY G;  4Z1W A;  3IBJ A;  3D3O A;  4UQI M;  4G3V A;  4RA7 A;  4PMA A;  4GDB A;  3NUL A;  5L09 A;  3S7O A;  3NI9 A;  4OPQ A;  2VGL S;  3G30 A;  1YT4 A;  2RL3 A;  4HP9 A;  2XSS A;  3BFC A;  4R0Q A;  3OCN A;  4JGR A;  3VOL A;  4ME4 A;  2DRW A;  5DJT A;  1ES3 A;  4X56 A;  2JCH A;  5EV0 A;  1RGZ A;  2QMI A;  1N9N A;  1SCW A;  1CK3 A;  3GQZ A;  5J3W A;  4OQ0 A;  1CEF A;  3MQ0 A;  3JVV A;  3FKV A;  5IU1 A;  2FFY A;  2ZOH A;  4GCZ A;  2O99 A;  3IF6 C;  3MXR A;  3PYP A;  2JN7 A;  1FIL A;  3IXD A;  2VV6 A;  2M7U A;  1XPB A;  1FIK A;  4K91 A;  4NG2 A;  2V8F A;  3CHW P;  4Y17 A;  4GN2 A;  4P6Z S;  3IXG A;  5DF7 A;  5G4Y A;  5FAS A;  4WMC D;  1FCO A;  4HY8 A;  5FQQ A;  2CMN A;  2YKF A;  1ERQ A;  3DTK A;  5GHX A;  4G3W A;  1T19 A;  1CF0 A;  5M18 A;  2FFF B;  3WS1 A;  4HP4 A;  3CUE A;  3ITA A;  2QHK A;  2Y2P A;  4GD6 A;  3FKW A;  2XD1 A;  5HZH A;  5HWT A;  4RVA A;  1OME A;  3EGD C;  2ZC6 B;  4F3L B;  1O07 A;  2ZM0 A;  1MWR A;  5E43 A;  2X71 A;  4QJG A;  5FAP A;  3K3C A;  4IHQ A;  2QPN A;  1WYB A;  4H8R A;  1LI0 A;  2I9V A;  1GSV A;  3ZDJ A;  5F68 A;  1VEU B;  3LEQ A;  3LUQ A;  5DF8 A;  1P9W A;  4BD1 A;  4OQI A;  5IT5 A;  3CG5 A;  1F5M A;  3UE1 A;  2Y79 A;  3PAG A;  4ZBE A;  4Y3I A;  4KG5 A;  3E0Y A;  2PU2 A;  2Q9N A;  5J4E A;  1OJG A;  2HF6 A;  4LLO B;  1SKO B;  3IT9 A;  1SKF A;  3S4X A;  3V39 A;  2IWD A;  3OLO A;  3F1O B;  2JKF A;  2HDS A;  4P87 A;  4O7D A;  2J3W A;  1K0K A;  2WGV A;  3CJM A;  2Y91 A;  3FPW A;  4KZ9 A;  1OT9 A;  1PI5 A;  1T18 A;  3H9W A;  5LBR A;  4Y0T A;  4FTX A;  4XXR A;  3F1P B;  4IVK A;  3GRJ A;  4MN6 A;  3NDE A;  3CUE C;  1JWP A;  2HP5 A;  1S66 L;  3F1P A;  1IYO A;  1MWT A;  2ZC4 B;  3W8K A;  2EA9 A;  3OPH A;  4OP5 A;  2B18 A;  3DTE A;  3HCY A;  3UE0 A;  2HP9 A;  5FQI A;  3FPV A;  2PYR A;  1VQQ A;  3VFH A;  1MBL A;  2W3G A;  1L3L A;  4ZRR A;  3CPT A;  5CTN A;  3A3F A;  1LSX A;  3IH8 A;  3UPN A;  5FQ9 A;  4IUK A;  3VSL A;  3SW1 A;  3NEC A;  3LR0 A;  4HES A;  1F2K A;  4DE0 A;  1JNU A;  3R4K A;  1PZP A;  1ES5 A;  2J9P A;  2QKP A;  1E4D A;  3ZG8 B;  4NXB A;  4IBX A;  3V3S A;  4JF5 A;  4HJ6 A;  2G7U A;  2IWB A;  4NET A;  3LI9 A;  4WEL A;  3PTE A;  2J8Y A;  5I5L A;  3RH8 B;  1WA9 A;  4OP8 A;  3CI6 A;  5JYP A;  4IJG A;  1PI4 A;  1RCJ A;  4Q0H A;  4XUX A;  4JXV A;  4B93 A;  5U47 A;  1E3U D;  4WF0 A;  4PAU A;  5D3O A;  4BJP A;  1JWV A;  4PM5 A;  3OPL A;  4PM7 A;  3ZHH A;  2VGL M;  4EBN A;  1KE0 A;  3KYZ A;  2WAF A;  3BFE A;  5HAQ A;  2B5R A;  2VJW A;  1JTD A;  2OV5 A;  2B95 A;  3MS6 A;  3TOI A;  3PBT A;  5CRF A;  4CLC A;  1ALQ A;  3HLG A;  1LL5 A;  1T1A A;  4H6J B;  3HUN A;  2IWC A;  2JKR M;  5C5K A;  1S67 L;  1OTE A;  4E3N A;  4H6J A;  3T4L A;  2P74 A;  5HDS A;  1KVL A;  3L7H A;  3JPU A;  4K0W A;  4X69 A;  5EM1 A;  3HBR A;  1PFL A;  5EFW A;  4P6Z M;  1NZU A;  2J7V A;  4NXF A;  3M6B A;  3UE6 A;  2J3T D;  3GTC A;  2P04 A;  1DP9 A;  2QYB A;  1OTB A;  4E04 A;  2Y55 A;  2GX5 A;  1NJ4 A;  2PAV P;  3CIT A;  5AQ7 A;  4DRT A;  5E2G A;  1H8Y A;  3HLW A;  5FAT A;  1FSW A;  3NOU C;  4IBR A;  2W3F A;  1JTG A;  1LLB A;  1ERM A;  3UB6 A;  5HD5 A;  1T1C A;  3U2A A;  1XJ2 A;  3PBN A;  2BAS A;  3IXB A;  2O9C A;  1PNE A;  3KYE A;  1BYW A;  4AFI A;  1ZKJ A;  3IWI A;  1G6A A;  2W27 A;  3N8L A;  4P6B A;  3ZQ5 A;  1L0D A;  1KDW A;  4R3A A;  1DP6 A;  5FL3 A;  2X02 A;  3QP1 A;  4JXS A;  3LO7 A;  3WWX A;  3G32 A;  1OTI A;  2UWX A;  3NY4 A;  1YLJ A;  2Q0O A;  4U0T A;  5AQB A;  1H8M A;  3UPP A;  5A8B A;  4EET B;  3ZNY A;  1P0Z A;  2EXB A;  5FQJ A;  2HDR A;  2ZQ7 A;  3BRM A;  3UB9 A;  4CPK A;  2WK0 A;  3IH9 A;  1W63 M;  1NY0 A;  4DMZ A;  2PBD P;  1NYY A;  2HGV A;  3TRC A;  2O9A A;  3LY4 A;  3TW8 A;  2ZMA A;  5DKK A;  5M1A A;  3MFD A;  4KZ5 A;  1I5Q A;  1IEL A;  1MXO A;  3KSI A;  2NUP C;  4LEN A;  3NBL A;  1PWD A;  1H8Z A;  3A0R A;  4GD8 A;  3R7W B;  2J9O A;  5CHJ A;  1IYP A;  1H3Q A;  2KX6 A;  4LFU A;  4Y7P A;  4KZA A;  3PXP A;  3LID A;  2V8C A;  5F1G A;  3WS0 A;  2GDN A;  2L0W A;  1KE4 A;  3IXH A;  3N8R A;  3T1X A;  1TS6 A;  5FEG A;  4FSF A;  3UO9 A;  1XFQ A;  2H10 A;  3VFF A;  4P0M A;  3E98 A;  2Y4A A;  3PBS A;  4WZ5 A;  5FQM A;  2HP6 A;  3G31 A;  2V2F F;  4HI4 A;  3LIF A;  2XF3 A;  4OH0 A;  4DF6 A;  5J8X A;  2OSU A;  5F6A A;  3UE3 A;  2PRF A;  3EEA A;  2Y2H A;  4G3K A;  1YLT A;  1EW0 A;  3GV9 A;  3Q7Z A;  3F1N A;  1V9Z A;  2ZOI A;  4U0X A;  4B4X A;  1XJ4 A;  1NLZ A;  4JXG A;  5HPF A;  3A3J A;  3ICY A;  3LGO A;  5CHM A;  3C4O A;  1J9M A;  4S2O A;  2JKT M;  1XFN A;  2K31 A;  4YFM A;  2HDU A;  3IF6 B;  3U4L P;  1LL9 A;  1NXY A;  3HLE A;  2R9W A;  1D06 A;  4EEP A;  4MBH A;  5CXW A;  4CQH A;  4YIN A;  2PDR A;  1KGG A;  4CJN A;  2Z6D A;  1XJ6 A;  3P7N A;  1FCM A;  2HV1 A;  1I2W A;  4OOL A;  4BEN A;  3S22 A;  4N9K A;  1EI5 A;  4R38 A;  1YPR A;  1YMX A;  1K38 A;  2XD5 A;  1W8Q A;  3UPO A;  2XFS A;  2NUT C;  1PIO A;  4WZ5 C;  5EM0 A;  2QWS A;  4UA7 A;  4BBT A;  4KEN B;  3BQ8 A;  1YMS A;  1YSQ A;  4OOY A;  5KZH A;  4X68 A;  2OAP 1;  1I2S A;  4LPZ A;  4OKP A;  5F83 A;  3CZD A;  3VE3 A;  5CTM A;  3QP5 A;  4NKP A;  4HEF A;  4KQQ A;  2WGI A;  3SS4 A;  4HJ4 A;  3HJI A;  1KGE A;  2D02 A;  2KDK A;  4L9G A;  5EE8 A;  1HLU P;  3MZD A;  4E3O A;  5GLB A;  1YLP A;  4WBG A;  4DJ3 A;  1SDN A;  5CGW A;  3D4F A;  5FI2 A;  1FOF A;  1HTZ A;  3NJA A;  1K57 A;  1M6K A;  3RJU A;  5G18 A;  2Y2G A;  4F94 A;  4Q0J A;  4CLC E;  3GR2 A;  1FR1 A;  4OOM A;  3D72 A;  3LR3 A;  3A0V A;  4GB7 A;  4O01 A;  4GJ4 A;  1T1B A;  1W5D A;  4MN7 A;  3C7V A;  4OVD A;  3AGE A;  4E3J A;  4JBF A;  5L07 A;  4EQI A;  2BLS A;  3VP4 A;  2ZLY A;  4GZB A;  2ZQC A;  4X25 A;  1IFQ A;  3E4O A;  1CEG A;  3IWQ A;  5TR7 A;  2Y2L A;  4ZDX A;  3BWL A;  4LGW A;  4EEU A;  1P9R A;  3KO6 A;  4R1G A;  3HLC A;  2WZX A;  4LV3 A;  1HD8 A;  3UNW A;  3G4P A;  3HJK A;  4ID4 A;  2W3D A;  4WMC A;  3ZCZ A;  1KOU A;  3B3X A;  3PR6 A;  3S7P A;  5FI7 A;  2ZMF A;  3DWK A;  4QPR A;  3KX0 X;  2E8I A;  3B33 A;  2EXA A;  2ZC7 A;  4RX3 A;  4GNU A;  1K6S A;  5A92 A;  5FAO A;  3KSG A;  4E3K A;  1G6O A;  4KQR A;  3M2J A;  1GCE A;  1K57 C;  3HLF A;  4LRX C;  3IBR A;  3FV7 A;  2XLN A;  1GHI A;  2QZ6 A;  4EES A;  2V0W A;  3BEC A;  4NEE D;  4E3L A;  4WN5 A;  3VP2 A;  4KZB A;  3Q07 A;  5FA7 A;  1BZA A;  1K55 A;  4ZAM A;  4L9E A;  4OPY A;  3GDI A;  1D7E A;  4R6L A;  2RCX A;  3SZT A;  2M1C A;  4EU0 A;  3UDF A;  3RXW A;  4KZ3 A;  1PW1 A;  3FG8 A;  2VX8 A;  4EER A;  2W1R A;  3SH8 A;  4KUO A;  4O0P A;  5K5B A;  4N92 A;  2EX6 A;  1TDL A;  3CPT B;  2GJ3 A;  1NLY A;  2X01 A;  4S2M A;  1IKI A;  3LY3 A;  2PHY A;  1TDG A;  2HJE A;  2P9V B;  1Z09 A;  3G34 A;  5I94 A;  4JGO A;  4BBV A;  2WKI A;  4WLA A;  1XGJ A;  2P9V A;  1BLP A;  2A3U A;  4R3J A;  4IVI A;  3LR5 A;  1ERO A;  4N1X A;  1ZG6 A;  1SHV A;  2GZA A;  3LI8 A;  4UA9 A;  4KQO A;  5TGF A;  4R4S A;  5M19 A;  1X0O A;  2BG1 A;  5HW3 A;  5CGX A;  5CHU A;  2HPB A;  1RP5 A;  1MY8 A;  1K55 C;  4DJ2 A;  4JPM A;  3LIA A;  3W4Q A;  1FQG A;  4KG6 A;  3C38 A;  4M3K A;  4X1L A;  4N1H A;  4O8G A;  3WS5 A;  5G4Z A;  1XKZ A;  3IX3 A;  3EGX C;  4UHU A;  5A93 A;  2EX8 A;  3H7W A;  2ZM8 A;  4BL3 A;  3C4P A;  2OOL A;  3BW6 A;  2Q9M A;  1PRQ A;  5FEF A;  4ESP A;  5HWV A;  3WRT A;  4CLC B;  3H82 A;  3G2Y A;  4Y5F A;  1E3U A;  5DJU A;  3Q81 A;  4K0X A;  3O86 A;  4R3B A;  3EQU A;  3M6H A;  1S1Z A;  4I3A A;  3W4O A;  2XRO A;  4II7 A;  3DTI A;  3B47 A;  2GNX A;  4KG2 A;  3OPR A;  3P98 A;  3K3D A;  4BMW A;  5AVE A;  3Q7V B;  1W63 Q;  3WRZ A;  3HVF A;  1ESU A;  4E3I A;  1STZ A;  3Q7V A;  5HDD A;  3MXS A;  3MBZ A;  1J3W A;  3BYD A;  1YKD A;  3VMA A;  5HX9 A;  4I39 A;  2PR5 A;  4E3M A;  5EVI D;  3EOI A;  3TE8 A;  4YWZ A;  4M4X A;  3E2L A;  4QD4 A;  3WS2 A;  3BM6 A;  1TD5 A;  4Z9Q A;  1NRJ A;  4K08 A;  1K56 D;  2EWV A;  1NYM A;  4HBT A;  2Y2K A;  1LI9 A;  3HRE A;  2Z2L B;  3DW0 A;  1AWI A;  2Z2M B;  3A3D A;  3P09 A;  3MZE A;  1E25 A;  1K25 A;  3T12 B;  1DJB A;  3DTM A;  5CER A;  2ZC5 B;  4EV4 A;  1Y4O A;  2VLG A;  3Q1F A;  5CGS A;  1IEM A;  4CLC C;  3UME A;  1SZV A;  3NDG A;  4XUZ A;  4LV0 A;  2WYX A;  4HQA A;  2B02 A;  3EEH A;  5MC7 A;  1LSW A;  5GLC A;  2JKR I;  4BWI A;  1BSG A;  4OQG A;  1OPX A;  4DE3 A;  1HVB A;  4EUZ A;  5CEC A;  5EVL A;  3QNC A;  1CI9 A;  2ZQD A;  3KSF A;  3SOI A;  1KGF A;  3CAX A;  2O0Y A;  1BLC A;  3V5M A;  1OTD A;  1GA9 A;  1NRF A;  1C3B A;  4S2J A;  2ZQA A;  2VV8 A;  3SS3 A;  2PD7 A;  4QHC A;  2AVX A;  4LCM A;  3C7U A;  3N4I A;  4EUV A;  2FZ0 A;  4I38 A;  2XEP A;  1GHP A;  2WZZ A;  1Y28 A;  2L1M A;  1LSV A;  4MLL A;  2ZBB A;  2M7V A;  1UWP X;  4GS9 B;  1VET A;  1YM1 A;  5A91 A;  2PT7 A;  3VP0 A;  1JVJ A;  4PM8 A;  4GS9 A;  5FDS A;  5DF9 A;  4HHD A;  3O87 A;  1WYC A;  2PYP A;  4OON A;  1VB6 A;  1K4E A;  2Y2O A;  4QY6 A;  2W1T B;  3MFX A;  2XK1 A;  1G28 A;  3VOZ A;  3HLB A;  1IOU A;  2W1T A;  3T4T A;  2LB9 A;  4X53 A;  4LRY C;  3SH9 A;  1GSW A;  5E2F A;  5AVF A;  5HL6 A;  3NHQ A;  1S4R A;  1NWZ A;  4EXO A;  4GKU A;  3HLD A;  1TEM A;  4L0L A;  1PWG A;  2W3E A;  3JYI A;  4JKT A;  3ZG0 A;  2ZM2 A;  3FC7 A;  1IYS A;  1N4O A;  5HAP A;  3OBF A;  4R23 A;  2W0N A;  2JBF A;  2OWJ A;  4UA6 A;  3LEZ A;  2PR6 A;  3K2N A;  2L4R A;  2H28 A;  4MBF A;  2I72 A;  3A0S A;  3F1N B;  2QJ7 A;  3AGF A;  3UDI A;  3IS2 B;  3CWF A;  3T1Q B;  4JF4 A;  3IS2 A;  4HH2 A;  2V1Z A;  4KZ4 A;  4OPZ A;  3UMD A;  3BLS A;  2A2L A;  3BY8 A;  3QP2 A;  1LL8 A;  1F98 A;  1DY6 A;  2EFU A;  4NXE A;  5BOH A;  3PBQ A;  2OLU A;  5HWW A;  3MQQ A;  2JKG A;  1YQS A;  4LV2 A;  1AXB A;  3CLO A;  1XP4 A;  4PPR A;  2V1B A;  3IHA A;  4YNR A;  4GW9 A;  3G6O A;  4KUK A;  3T4S A;  1DRM A;  3L9K A;  5DTS A;  1TS8 A;  2ZQ8 A;  5CX7 A;  2OAQ 1;  1KDS A;  4MEZ A;  2Y2M A;  2WUQ A;  3DAV A;  1S0W A;  4WYY A;  2EWW A;  4WUJ A;  3S1Y A;  4LRZ E;  3E4Q A;  4DDY A;  5EEC A;  5L8M A;  1Y54 A;  3G2Z A;  3HUO A;  1L2S A;  3E2K A;  2A24 B;  5HD3 A;  4BD0 A;  2A49 A;  4R4R A;  2A24 A;  1FCN A;  2ZL1 A;  3T4J A;  5F69 A;  4C6Y A;  5E2H A;  4BL2 A;  3OCL A;  4U3T A;  1F9I A;  3QP8 A;  5FDH A;  3BLM A;  1HZO A;  4MDZ A;  3QP6 A;  3D9Y A;  2WKP A;  4D2O A;  2O9B A;  2H0Y A;  2JC7 A;  5EUA A;  4L9F A;  5E2E A;  2KLI A;  2WKQ A;  2ZC3 B;  5DKL A;  2V0U A;  1D1J A;  2V1A A;  1GA0 A;  1S6R A;  2Y59 A;  3PBO A;  1N9O A;  2R9X A;  4JGQ A;  3LR4 A;  1MWS A;  1DP8 A;  3LFV A;  3QP4 A;  1K6R A;  2E8J A;  1Z6F A;  2JKT I;  4OLD A;  4PM6 A;  1P97 A;  1MZU A;  3GEC A;  3IX4 A;  4HNB A;  3BJN A;  1W79 A;  4DXC A;  3ISG A;  3LIC A;  1JWZ A;  5F5Y A;  3KSH A;  2BTF P;  3O88 A;  4WEJ A;  4Q0I A;  2VZW A;  5DVA A;  3BY9 A;  3N8S A;  4ZJ3 A;  4BQM A;  4JXW A;  4EBP A;  3MXQ A;  1BT5 A;  4PM9 A;  2XR0 A;  3G35 A;  5DTT A;  3T4Q A;  2K7S A;  3OC2 A;  4JF6 A;  1DJC A;  1ESI A;  5DFY A;  3ZGA B;  2UV0 E;  5HSQ A;  2WKR A;  2J80 A;  3GVB A;  3ZYT A;  3EWK A;  2WGW B;  4FCF A;  1PW8 A;  2WGW A;  5FI6 A;  1QME A;  3T1S A;  3WS4 A;  4WM9 A;  3W2Z A;  5KSC A;  4S2L A;  4JLF A;  3MMH A;  3MKF A;  4EW7 A;  4WZ4 A;  1BLH A;  5GL9 A;  1A0K A;  4EBL A;  1ONH A;  4ZJ2 A;  2Y2N A;  1K54 A;  4R70 A;  4EQ1 A;  1GSX A;  1YSP A;  3T1R A;  4B9O A;  5DFX A;  4F3L A;  1VM1 A;  4N9L A;  3ITB A;  1LT0 A;  1ZC2 A;  3SS5 A;  1O7E A;  4FUW A;  4LV1 A;  4I3I A;  4DKI A;  1EWZ A;  3A3I A;  4EWF A;  2D01 A;  4QWO A;  4YOF A;  5L10 A;  3GSG A;  3ZG9 B;  4DDS A;  1VEU A;  2XA7 S;  1UGU A;  4MCW A;  5FQK A;  1H5X A;  2FH5 A;  2G2W A;  3HUM A;  5CEB A;  2ACG A;  1OTA A;  4PHT A;  3S7N A;  4OQH A;  1L0F A;  4UAA A;  3NCK A;  2WAE A;  1ONG A;  3VP1 A;  1CQA A;  2K2N A;  3TJZ C;  3IX8 A;  2HDQ A;  3TSG A;  1SKO A;  3HL9 A;  3MF0 A;  3C5A A;  4RX2 A;  3ULF A;  1S1Y A;  3F1O A;  1XXM A;  3O3V A;  3VOY A;  3T4O A;  2G2U A;  3QNB A;  2H5S A;  4GHI B;  4HOI A;  2C5W B;  5HAR A;  3OPP A;  2JHE A;  2Y8H A;  4GHI A;  1G5U A;  2V20 A;  4ETX A;  2XFT A;  1H0M A;  1XA7 A;  1K54 C;  2HJ9 C;  1ZHH B;  2CC1 A;  4D60 A;  3V3R A;  3E4P A;  1K4F A;  4MBK A;  1ES4 A;  3ZNT A;  2YKH A;  4KQD A;  1IKG A;  2V9A A;  3BFD A;  2VKS A;  1ODV A;  4FH4 A;  3ZG5 A;  1U60 A;  5IS1 A;  1QMF A;  2ZQ9 A;  4FH2 A;  4KZ6 A;  3PBR A;  2W3H A;  1VHM A;  3B42 A;  5F1F A;  2XH9 A;  3H7W B;  1GHM A;  1ACF A;  4HBU A;  2ZJ9 A;  4DXB A;  1PZO A;  3FYZ A;  1Q2P A;  3VV4 A;  2R78 A;  2OLV A;  3H82 B;  5KMW A;  4X6T A;  4QU3 A;  3LCE A;  5EOO A;  4CLC D;  3SH7 A;  4I3J A;  3N6I A;  2P7J A;  1ZG4 A;  4FD8 A;  5A90 A;  2DCF A;  3ZG7 B;  1L0E A;  4S2K A;  4P85 A;  3VSK A;  2Y2Q A;  2XDM A;  4JGP A;  4E6W A;  2EX2 A;  4HJ3 A;  3I7J A;  3UN7 A;  3IWO A;  3OZH A;  2EX9 A;  4OPR A;  2XRN A;  3ZVW A;  4GDN A;  4Y13 A;  1N9L A;  5AJG A;  5IHV A;  2JE5 A;  4WEK A;  4Y2F A;  4X1M A;  2Y2J A;  3ZFZ A;  3VE4 A;  2P08 A;  2VGJ A;  3QHY A;  4KZ7 A;  1BLS A;  5GLD A;  2VA0 A;  4I5S A;  2QJ5 A;  5EVE A;  2VEA A;  4IED A;  4OLG A;  1FSY A;  2IA2 A;  1XA1 A;  5EVI B;  1MKI A;  2DMW A;  3A3E A;  3MSH A;  1XX2 A;  1XJ3 A;  1PWC A;  3PHY A;  5EVI A;  3DBA A;  4B4Z A;  5CED A;  1UWN X;  4QY5 A;  4XT2 B;  3S7Q A;  1TS0 A;  3BQA A;  3MJQ A;  2MJ6 A;  2INW A;  2PBY A;  4XT2 A;  4UQI S;  1TS7 A;  1Q2Q A;  5HL1 A;  5GHZ A;  2Z6C A;  2ZD8 A;  1K56 A;  4ZJ1 A;  3UY6 A;  2ZMV A;  2OWH A;  3RTY A;  3BFG A;  4S2I A;  4KZ8 A;  3KYQ A;  5KSH A;  3T50 A;  4UEY A;  2VV7 A;  1MKM A;  3OOV A;  3N7W A;  3EQV A;  3V50 A;  4S2P A;  1CI8 A;  2PD8 A;  4Y15 A;  1YLY A;  3W4P A;  3RFB A;  2EFX A;  3T4K A;  2XA7 M;  4WL9 A;  3Q82 A;  1YLW A;  1FR6 A;  2C6W B;  1MPL A;  1DJA A;  5J7E A;  1KVM A;  2WAD A;  4MN5 A;  4ARZ B;  3MQO A;  3ZVT A;  5HFO A;  4PKY A;  3BFF A;  4ARZ A;  2XGN A;  3IHB A;  5TJJ A;  4HIA A;  4Y0O A;  4A5R A;  4S2N A;  3NC8 A;  3MR0 A;  2WKE A;  1IYQ A;  4IUH A;  1VET B;  3UDX A;  3TG9 A;  4HH3 A;  1W8Y A;  5EVI C;  1M40 A;  4Y0U A;  2J3T C;  5AQA A;  1MC0 A;  4C75 A;  3NOP C;  2KOI A;  1TF1 A;  1BUL A;  1N9B A;  1S4S A;  3RXX A;  3UB5 P;  4B88 A;  2XQZ A;  3MZF A;  4ETZ A;  3LYX A;  5TFQ A;  3BEB A;  1KE3 A;  3C30 A;  1XGI A;  4LCL A;  5JYO A; 
#chains in the Genus database with same CATH homology
 2Y59 A;  3PBO A;  2R9X A;  4K0W A;  4X69 A;  1MWS A;  3HBR A;  1W7F A;  1NZU A;  4NK3 A;  2J7V A;  3MKE A;  3PAE A;  1K6R A;  3M6B A;  1Z6F A;  3SH8 A;  3GMW A;  4OLD A;  1PYY A;  3GTC A;  4PM6 A;  3FWL A;  2Y55 A;  1W79 A;  4DXC A;  3ISG A;  4N92 A;  1NJ4 A;  1JWZ A;  2EX6 A;  1TDL A;  5DTK A;  1BUE A;  5FAQ A;  1NZO A;  2VGK A;  3O88 A;  2X01 A;  4WEJ A;  4S2M A;  5DVA A;  1IKI A;  4C3Q A;  5AQ7 A;  3N8S A;  4DRT A;  3LY3 A;  1G68 A;  5E2G A;  5L2F A;  1H8Y A;  1TDG A;  1LHY A;  2P9V B;  3HLW A;  4RYE A;  4ZJ3 A;  4BQM A;  4JXW A;  3G34 A;  3IF5 A;  1FSW A;  1BT5 A;  4PM9 A;  4X55 A;  2XR0 A;  5F82 A;  2WKI A;  3DWZ A;  4E6X A;  5I94 A;  3FZC A;  1XGJ A;  2P9V A;  1BLP A;  3G35 A;  4IBR A;  5DTT A;  3VP3 A;  4S2N C;  1JTG A;  1LLB A;  3OC2 A;  1ERM A;  4JF6 A;  4ZTK A;  2DNS A;  5FSR A;  5GHY A;  2A3U A;  1SDE A;  4R3J A;  1DJC A;  4IVI A;  3PBN A;  1ESI A;  1ERO A;  4N1X A;  5EOE A;  3ZGA B;  1ZG6 A;  3IXB A;  3GVB A;  1SHV A;  2WGW B;  4UA9 A;  4FCF A;  4MNR A;  4KQO A;  1ZKJ A;  5TGF A;  4R4S A;  3IWI A;  1PW8 A;  1G6A A;  5M19 A;  2WGW A;  2BG1 A;  5HW3 A;  5FI6 A;  1QME A;  5CGX A;  3N8L A;  4P6B A;  5CHU A;  2PU4 A;  3WS4 A;  2HPB A;  1L0D A;  4WM9 A;  1RP5 A;  4QB8 A;  1MY8 A;  5EPH A;  5KSC A;  3CMZ A;  4S2L A;  1KDW A;  1YLZ A;  5AQ9 A;  1K55 C;  4JLF A;  1ES2 A;  4JPM A;  1WE4 A;  2WKH A;  3W4Q A;  1FQG A;  4KG6 A;  2X02 A;  4JXS A;  3LO7 A;  3WWX A;  3MKF A;  4M3K A;  3G32 A;  4BLM A;  4WZ4 A;  4N1H A;  2UWX A;  3NY4 A;  1YLJ A;  1BLH A;  5GL9 A;  3WS5 A;  4EBL A;  1XKZ A;  4GOG A;  3IQA A;  3AGD A;  1ONH A;  4UHU A;  4DE2 A;  4ZJ2 A;  3IF6 A;  4U0T A;  5AQB A;  5A93 A;  2EX8 A;  3UPP A;  2Y2N A;  1K54 A;  3NIA A;  3ZNY A;  5HAI A;  2ZM8 A;  2EXB A;  4BL3 A;  3C4P A;  5FQJ A;  1L0G A;  2HDR A;  2Q9M A;  1VM1 A;  2ZQ7 A;  3BRM A;  4N9L A;  3ITB A;  4CPK A;  2WK0 A;  3WRT A;  3IH9 A;  1TVF A;  1ZC2 A;  3G2Y A;  1O7E A;  3SS5 A;  4Q8I A;  1MWU A;  1BTL A;  4LV1 A;  1E3U A;  2Y2I A;  3Q81 A;  4DE1 A;  1EWZ A;  3A3I A;  1NY0 A;  3O86 A;  4K0X A;  4DKI A;  4R3B A;  4EWF A;  3EQU A;  3M6H A;  3M2K A;  1NYY A;  3GSG A;  3ZG9 B;  4DDS A;  3W4O A;  3LY4 A;  2H0T A;  1RGY A;  5GLA A;  2ZMA A;  4KG2 A;  5FQK A;  1H5X A;  3OPR A;  3P98 A;  5M1A A;  3MFD A;  2G2W A;  3HUM A;  4KZ5 A;  5CEB A;  3Q7V B;  1I5Q A;  1IEL A;  4RA7 A;  4PMA A;  4GDB A;  3HVF A;  1ESU A;  3WRZ A;  1MXO A;  4E3I A;  3Q7V A;  3MXS A;  4LEN A;  3NBL A;  3MBZ A;  3BYD A;  1PWD A;  3NI9 A;  3VMA A;  4OQH A;  4OPQ A;  1H8Z A;  1L0F A;  4GD8 A;  5HX9 A;  2J9O A;  5CHJ A;  4E3M A;  1IYP A;  5EVI D;  4UAA A;  3NCK A;  2WAE A;  1ONG A;  3VP1 A;  3G30 A;  2HDQ A;  1YT4 A;  3TSG A;  2RL3 A;  3BFC A;  4R0Q A;  3E2L A;  4Y7P A;  4KZA A;  4QD4 A;  3WS0 A;  5F1G A;  3HL9 A;  3OCN A;  2GDN A;  1KE4 A;  2DRW A;  1ES3 A;  3C5A A;  3IXH A;  3N8R A;  4RX2 A;  3BM6 A;  4X56 A;  3WS2 A;  4Z9Q A;  2JCH A;  1RGZ A;  1K56 D;  1XXM A;  2QMI A;  3O3V A;  3VOY A;  1SCW A;  1NYM A;  2G2U A;  3QNB A;  2Y2K A;  4FSF A;  1LI9 A;  2H5S A;  4HBT A;  3UO9 A;  2H10 A;  1CK3 A;  3GQZ A;  4P0M A;  4OQ0 A;  3VFF A;  2Y4A A;  1CEF A;  2C5W B;  3PBS A;  3HRE A;  3OPP A;  5HAR A;  2Z2L B;  3DW0 A;  4WZ5 A;  5FQM A;  3FKV A;  2FFY A;  2HP6 A;  3G31 A;  2V2F F;  2V20 A;  2XFT A;  3IF6 C;  2Z2M B;  3MXR A;  3A3D A;  2XF3 A;  1XA7 A;  1K54 C;  4OH0 A;  3IXD A;  3P09 A;  3MZE A;  2CC1 A;  4DF6 A;  5J8X A;  2OSU A;  3UE3 A;  1E25 A;  1K25 A;  3V3R A;  1DJB A;  3DTM A;  2Y2H A;  1K4F A;  1XPB A;  4MBK A;  5CER A;  1YLT A;  2ZC5 B;  1ES4 A;  3GV9 A;  4K91 A;  4EV4 A;  3ZNT A;  3Q7Z A;  3Q1F A;  5CGS A;  1IEM A;  4GN2 A;  4B4X A;  4U0X A;  3IXG A;  1IKG A;  3NDG A;  4XUZ A;  5DF7 A;  4LV0 A;  5FAS A;  3BFD A;  4JXG A;  4WMC D;  1FCO A;  5FQQ A;  2WYX A;  3A3J A;  4FH4 A;  1ERQ A;  3ZG5 A;  1U60 A;  1QMF A;  5CHM A;  2ZQ9 A;  4FH2 A;  5GLC A;  3C4O A;  4KZ6 A;  1BSG A;  3PBR A;  4OQG A;  5GHX A;  1J9M A;  4S2O A;  4DE3 A;  1HVB A;  4EUZ A;  5CEC A;  5EVL A;  5M18 A;  4YFM A;  3QNC A;  2HDU A;  1CI9 A;  2FFF B;  2ZQD A;  3WS1 A;  3IF6 B;  3SOI A;  2XH9 A;  5F1F A;  1KGF A;  1GHM A;  3ITA A;  1LL9 A;  2Y2P A;  1BLC A;  1NXY A;  4GD6 A;  4HBU A;  3FKW A;  3HLE A;  3V5M A;  2XD1 A;  1GA9 A;  2ZJ9 A;  1NRF A;  1OME A;  4RVA A;  4DXB A;  1PZO A;  3FYZ A;  2ZC6 B;  1C3B A;  2R9W A;  1O07 A;  1Q2P A;  2ZM0 A;  1MWR A;  4S2J A;  5E43 A;  2X71 A;  2OLV A;  5KMW A;  4MBH A;  4X6T A;  4QU3 A;  5CXW A;  3LCE A;  2ZQA A;  5EOO A;  4QJG A;  4YIN A;  3SH7 A;  5FAP A;  3SS3 A;  1KGG A;  2QPN A;  3N6I A;  1WYB A;  1ZG4 A;  4FD8 A;  4H8R A;  5A90 A;  4CJN A;  1LI0 A;  4QHC A;  1FCM A;  2DCF A;  1I2W A;  3C7U A;  4LCM A;  3N4I A;  4OOL A;  4BEN A;  3S22 A;  4N9K A;  3ZDJ A;  1L0E A;  1EI5 A;  3ZG7 B;  4S2K A;  1YMX A;  1K38 A;  2XD5 A;  5DF8 A;  1W8Q A;  2XEP A;  4P85 A;  3UPO A;  2XFS A;  1GHP A;  2WZZ A;  4BD1 A;  4OQI A;  3VSK A;  1PIO A;  3CG5 A;  2Y2Q A;  4MLL A;  4WZ5 C;  2XDM A;  4E6W A;  2EX2 A;  4UA7 A;  3UE1 A;  1YM1 A;  4KEN B;  3I7J A;  5A91 A;  3PAG A;  1YMS A;  3UN7 A;  4ZBE A;  3VP0 A;  1JVJ A;  4PM8 A;  3IWO A;  3OZH A;  5DF9 A;  4OOY A;  2EX9 A;  4KG5 A;  3O87 A;  5KZH A;  1WYC A;  2PU2 A;  2Q9N A;  4X68 A;  4OPR A;  1I2S A;  4OON A;  4OKP A;  4EBP A;  1K4E A;  5F83 A;  3CZD A;  3ZVW A;  2Y2O A;  4QY6 A;  4GDN A;  5CTM A;  3IT9 A;  5IHV A;  2JE5 A;  4HEF A;  4KQQ A;  4WEK A;  1SKF A;  2XK1 A;  3S4X A;  2WGI A;  2Y2J A;  3SS4 A;  3VOZ A;  3HLB A;  3ZFZ A;  3V39 A;  2IWD A;  2VGJ A;  3QHY A;  1KGE A;  2HDS A;  4KZ7 A;  4P87 A;  4X53 A;  4O7D A;  1BLS A;  3SH9 A;  5EE8 A;  5GLD A;  5E2F A;  3MZD A;  2WGV A;  3CJM A;  4IED A;  4E3O A;  2Y91 A;  5GLB A;  4KZ9 A;  1YLP A;  4WBG A;  4OLG A;  1SDN A;  5CGW A;  3D4F A;  1PI5 A;  1FSY A;  5FAT A;  4GKU A;  3HLD A;  1TEM A;  4L0L A;  4Y0T A;  1PWG A;  1XA1 A;  5EVI B;  3JYI A;  4XXR A;  4JKT A;  1MKI A;  4IVK A;  3GRJ A;  3A3E A;  1FOF A;  1HTZ A;  2ZM2 A;  3NDE A;  5FI2 A;  3ZG0 A;  1XX2 A;  1K57 A;  1PWC A;  1IYS A;  1JWP A;  1M6K A;  1N4O A;  3RJU A;  2HP5 A;  5EVI A;  5HAP A;  5G18 A;  4B4Z A;  2Y2G A;  5CED A;  1IYO A;  1MWT A;  2ZC4 B;  4QY5 A;  3W8K A;  3OPH A;  4OP5 A;  4R23 A;  4F94 A;  3UE0 A;  2HP9 A;  3GR2 A;  1FR1 A;  4OOM A;  5FQI A;  2PBY A;  2JBF A;  4UA6 A;  1VQQ A;  3VFH A;  1MBL A;  3LEZ A;  5CTN A;  1Q2Q A;  4GB7 A;  4MBF A;  2I72 A;  3A3F A;  5GHZ A;  2ZD8 A;  3IH8 A;  3UPN A;  5HL1 A;  1K56 A;  3AGF A;  5FQ9 A;  4ZJ1 A;  3UDI A;  3VSL A;  3UY6 A;  1W5D A;  4E3J A;  3C7V A;  4OVD A;  3AGE A;  4JBF A;  4JF4 A;  3BFG A;  4HES A;  4S2I A;  4EQI A;  2V1Z A;  4KZ8 A;  5KSH A;  2BLS A;  4KZ4 A;  3VP4 A;  2ZLY A;  4GZB A;  2ZQC A;  3N7W A;  4OPZ A;  4DE0 A;  3BLS A;  1CEG A;  3EQV A;  3IWQ A;  3V50 A;  1PZP A;  5TR7 A;  2Y2L A;  1ES5 A;  1DY6 A;  4S2P A;  2EFU A;  4ZDX A;  2J9P A;  1E4D A;  1CI8 A;  3PBQ A;  3ZG8 B;  2OLU A;  1YLY A;  5BOH A;  3W4P A;  4IBX A;  3V3S A;  2EFX A;  4JF5 A;  1YQS A;  4LV2 A;  1AXB A;  2IWB A;  1XP4 A;  4NET A;  4PPR A;  3IHA A;  3Q82 A;  4WEL A;  1YLW A;  1FR6 A;  3PTE A;  2C6W B;  2J8Y A;  4R1G A;  3HLC A;  2WZX A;  1MPL A;  4LV3 A;  4OP8 A;  5JYP A;  1DJA A;  1KVM A;  2WAD A;  1HD8 A;  3UNW A;  1PI4 A;  3G4P A;  1RCJ A;  4XUX A;  4ID4 A;  5DTS A;  4JXV A;  4WMC A;  3ZCZ A;  5HFO A;  3ZVT A;  3BFF A;  5U47 A;  1E3U D;  2ZQ8 A;  1KDS A;  3B3X A;  4MEZ A;  5D3O A;  2Y2M A;  2XGN A;  3IHB A;  4BJP A;  1JWV A;  4PM5 A;  5FI7 A;  3DWK A;  3OPL A;  2WUQ A;  4PM7 A;  1S0W A;  3ZHH A;  4WYY A;  4EBN A;  4Y0O A;  2E8I A;  4A5R A;  2EXA A;  1KE0 A;  2ZC7 A;  4RX3 A;  4S2N A;  4GNU A;  3S1Y A;  3NC8 A;  4DDY A;  1K6S A;  2WKE A;  5EEC A;  1Y54 A;  5FAO A;  2WAF A;  5A92 A;  3G2Z A;  1IYQ A;  3HUO A;  1L2S A;  4E3K A;  3BFE A;  3UDX A;  4KQR A;  3E2K A;  3M2J A;  1GCE A;  3TG9 A;  4BD0 A;  1K57 C;  3HLF A;  2A49 A;  5HAQ A;  1W8Y A;  5EVI C;  2B5R A;  1M40 A;  3FV7 A;  2XLN A;  1JTD A;  4R4R A;  4Y0U A;  2OV5 A;  1FCN A;  1GHI A;  5AQA A;  4C75 A;  2QZ6 A;  3TOI A;  3PBT A;  5CRF A;  4C6Y A;  5E2H A;  4BL2 A;  3BEC A;  4E3L A;  3OCL A;  1BUL A;  4U3T A;  1ALQ A;  1N9B A;  3VP2 A;  3RXX A;  3HLG A;  5FDH A;  3BLM A;  1LL5 A;  4KZB A;  4B88 A;  2XQZ A;  3HUN A;  1HZO A;  3Q07 A;  3MZF A;  1BZA A;  5FA7 A;  2IWC A;  1K55 A;  4ZAM A;  4D2O A;  5TFQ A;  4OPY A;  3BEB A;  4E3N A;  2H0Y A;  2JC7 A;  2RCX A;  1KE3 A;  5EUA A;  2P74 A;  5E2E A;  1XGI A;  2ZC3 B;  1KVL A;  3UDF A;  4LCL A;  5JYO A;  3RXW A;  1GA0 A;  1S6R A;  4KZ3 A;  1PW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...