3IXDA

X-ray crystal structure of the extended-spectrum ampc v298e mutant beta-lactamase at 2.64 angstrom resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
358
structure length
346
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIPEKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 111
structure length 346
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ixdA00
1LL9A 3C7UA 5EVID 1M40A 3A3DA 5AQAA 1W5DA 3E2KA 1SKFA 3MKEA 2H0YA 1ZG6A 1XXMA 2R9WA 3Q07A 4GOGA 4S2MA 3VOZA 2Y2NA 3PAEA 4OLGA 1GHMA 2I72A 3FKWA 5AQ9A 3S1YA 1HVBA 3W4PA 3ISGA 4R0QA 3MXRA 3LEZA 5GHZA 1KE4A 1FSWA 3WS2A 3BM6A 1CI8A 1YMXA 4L0LA 3LY3A 1ESIA 1QMEA 3TSGA 4WZ4A 4DE2A 4K0XA 5KMWA 1K57C 2HP5A 3CMZA 4R23A 1PZOA 2OSUA 4MNRA 3ZNYA 3A3IA 5CTNA 4QY5A 3HLEA 2HPBA 4JF6A 3BFDA 2JC7A 3IF6A 5CGWA 5TGFA 1FCOA 3NC8A 4P6BA 1JVJA 1VM1A 1LHYA 2JCHA 2XFSA 4KG5A 1YMSA 4EV4A 1BT5A 3GV9A 3QHYA 1E3UD 1MWRA 2WGVA 3IXDA 1PWGA 3OPRA 1PI4A 2IWBA 3PBQA 2HDQA 5EVIC 4F94A 1PIOA 1PWDA 2DRWA 3BFFA 2XDMA 4ZJ3A 1MBLA 4FH4A 4RYEA 3O3VA 1L0FA 5HAQA 1LLBA 4DXCA 3Q1FA 2JBFA 2EXBA 2HDUA 2XR0A 2Z2MB 2ZC3B 3N8LA 1PWCA 1BUEA 1E25A 4U0TA 1PZPA 5EECA 5DF8A 4C6YA 5M19A 3Q82A 4X55A 1NYYA 4KZAA 2ZC4B 4FCFA 4BD1A 2ZQDA 3HREA 3MXSA 1CK3A 1S0WA 5GHYA 1K55C 2QPNA 3WRZA 1BULA 1IELA 2BLSA 2QMIA 3NIAA 4WZ5C 4DDSA 1LL5A 4IBRA 5FAOA 4WMCA 2ZC6B 4OQ0A 1N9BA 4LV0A 1ERQA 4IEDA 1XPBA 4XUXA 3IQAA 4DE0A 3G35A 4R4SA 1VQQA 3ZNTA 3PBSA 2ZM0A 2P74A 4OP5A 1XA1A 2PBYA 5FI6A 3WRTA 3ZG0A 1L0GA 4KENB 4WYYA 4JXSA 5EPHA 3UO9A 1IYPA 2VGJA 3SH9A 4PM5A 4OOYA 1JWZA 1YLPA 3UNWA 4PM8A 4BJPA 1ZKJA 3W4OA 3HLDA 4FH2A 3ZCZA 4JLFA 1XGJA 3V39A 4S2PA 1EI5A 1Y54A 1I2WA 4GN2A 4LENA 4B4ZA 5CEBA 4OOMA 1WYCA 3C4PA 3SH7A 3SH8A 2A49A 3IWQA 5CXWA 4PMAA 4CPKA 2Y2GA 1CEGA 1K56D 2Y2JA 3FZCA 3BFEA 3IWIA 3ZFZA 1S6RA 4DDYA 1IYQA 3JYIA 5EOOA 2WUQA 1G68A 2C6WB 3G30A 4KZ9A 3HLBA 4HEFA 4RA7A 5KZHA 1CEFA 4KZ3A 1YLWA 3ITAA 4DXBA 1KGEA 4E3KA 3VSLA 3O88A 2H0TA 3Q7VA 1YT4A 2XD5A 2J9PA 3HUNA 3N6IA 1PW1A 2WAEA 4LV2A 4UA6A 1M6KA 4WEKA 5E2GA 3HLFA 3ZVTA 3GSGA 2J8YA 2WGWA 1NZUA 2IWDA 4PPRA 4DE1A 5FQKA 5EOEA 4OH0A 3UPPA 4JPMA 1YLZA 3NI9A 1ES5A 4C75A 1IYSA 5BOHA 2J9OA 2Y2IA 3IXHA 4KZ8A 4KZBA 1PW8A 4QD4A 1DY6A 3ZDJA 1FR1A 1PYYA 4EBNA 1DJCA 2ZM8A 4FSFA 5F82A 3WWXA 5I94A 3OZHA 3HVFA 3IXBA 1N4OA 3V50A 1Q2QA 3FV7A 4GD6A 5CRFA 1FQGA 1DJBA 2Z2LB 3HUMA 1KE0A 4ID4A 2XD1A 2Y2LA 1TDGA 3DWKA 2UWXA 5TFQA 4KZ7A 1RGZA 2EX2A 2PU2A 3W8KA 4EQIA 5J8XA 3UE1A 2WADA 4XXRA 5FQMA 4Z9QA 2ZC7A 2V2FF 1HD8A 5JYPA 1SHVA 2RCXA 3ITBA 1FOFA 3VP3A 5U47A 4DRTA 3I7JA 2ZQ7A 2DNSA 3Q7ZA 5DTTA 3OPLA 3S4XA 4JXVA 5FATA 2HDSA 2X71A 1WE4A 3V3SA 3GTCA 2DCFA 3OPPA 3MZEA 5FSRA 3CZDA 3GQZA 4R3JA 3DW0A 4N9KA 5EUAA 1XX2A 4GD8A 2G2WA 4GB7A 5FASA 1NY0A 4E6WA 1YLTA 1L0DA 4K0WA 1KVLA 4M3KA 3C7VA 1H5XA 4N9LA 2BG1A 4UAAA 3G32A 3QNCA 5DF7A 3MZDA 2ZD8A 3PBTA 4UA9A 4BD0A 3G2ZA 5HW3A 3OCLA 3BECA 2HDRA 4LV1A 4MBKA 4PM7A 5CHUA 4ZJ2A 3WS4A 4PM6A 3IF6B 4LCMA 5A90A 5DTSA 4MLLA 3BEBA 2EX9A 4OKPA 3M6HA 3AGEA 4LV3A 5E2HA 3M2JA 1ONGA 2FFFB 2Y2HA 5A91A 2P9VA 2HP9A 1K54A 2RL3A 1ES2A 4OOLA 3ZG7B 4EBPA 5GLAA 3HLGA 3RXXA 4E6XA 4OPYA 1IYOA 3BLMA 4N1HA 4RX3A 3UPNA 3MZFA 3PBOA 1IKIA 5FQIA 3DWZA 2Q9NA 3C5AA 5FAQA 2OLUA 5FAPA 1MPLA 3GRJA 1L2SA 1NXYA 3AGDA 2ZQAA 1KVMA 4Y0UA 1BSGA 5M1AA 2XLNA 2R9XA 4S2KA 4OQGA 2XF3A 5GHXA 2WKIA 1IKGA 4X6TA 5CHJA 3WS0A 2ZMAA 3A3JA 5EVLA 4Y7PA 4OONA 5D3OA 3D4FA 1K56A 3G4PA 4EBLA 4WBGA 5CTMA 3HUOA 4ZTKA 4OVDA 1Z6FA 3IF6C 3UPOA 4WMCD 1HTZA 5HL1A 2Y59A 1C3BA 4JBFA 3PBNA 3EQVA 4D2OA 1E4DA 2HP6A 1MXOA 2G2UA 4QJGA 3GR2A 2ZQCA 1SDEA 3BLSA 3N4IA 1NYMA 4JF4A 5FQJA 5HX9A 2VGKA 4JF5A 2GDNA 4Y0OA 3SS5A 3N7WA 1AXBA 4KQQA 4YINA 5M18A 3NCKA 4OQIA 1O07A 3IT9A 4N1XA 3HL9A 5F1GA 3SS4A 4S2IA 4PM9A 2EX8A 3VSKA 2CC1A 1NRFA 2WZXA 5CGSA 3V3RA 3ZHHA 1FSYA 3PBRA 1W7FA 1XP4A 2XH9A 1BTLA 3G2YA 4IVKA 3G31A 3A3FA 1BLCA 4NETA 1HZOA 4S2OA 4K91A 4OLDA 3UY6A 3VP4A 1K54C 4IVIA 4R3BA 5EVIA 3QNBA 4FD8A 2J7VA 1JWPA 1K25A 3HBRA 5DVAA 1CI9A 3NDGA 4YFMA 4B4XA 2XEPA 2WK0A 4ZJ1A 4HBTA 4X68A 5DF9A 1Q2PA 3LO7A 3IF5A 2XGNA 4GNUA 4KQRA 5CEDA 4DF6A 3CG5A 3WS5A 1O7EA 5E43A 1FR6A 1ZG4A 3WS1A 3Q7VB 1W8YA 2OLVA 3ZVWA 3VOYA 4P85A 4C3QA 1PI5A 2X02A 2Y2QA 1GA9A 5HFOA 1K55A 1MWUA 2WAFA 4JKTA 4E3JA 2Y2KA 2EXAA 2WGWB 3A3EA 3PTEA 4E3OA 2EFUA 4OQHA 4R4RA 4WZ5A 2Y2OA 1RP5A 1FCNA 3PAGA 4RX2A 4KQOA 1KGFA 2B5RA 3N8RA 4DKIA 1MKIA 4R1GA 2OV5A 2C5WB 1E3UA 3TG9A 3V5MA 4KG6A 4EWFA 5F83A 4H8RA 4QHCA 4ZDXA 4S2JA 3NBLA 4U3TA 5L2FA 2Y2MA 1W79A 3MFDA 3OCNA 5G18A 3IH8A 5FQQA 3OC2A 1JTDA 1H8YA 1JTGA 3UDFA 3SOIA 1ZC2A 3TOIA 3FWLA 3HLCA 4MBHA 1YQSA 1TVFA 1LI0A 5CHMA 1EWZA 4QB8A 4ZBEA 1K38A 3IHAA 2WZZA 1GA0A 3OPHA 5FDHA 4B88A 1ES3A 2V1ZA 1BLHA 4GDNA 4A5RA 1SDNA 3VFHA 3UDIA 2WKHA 1TEMA 3BFGA 3LCEA 3B3XA 5A93A 1KE3A 3E2LA 1GHPA 3LY4A 3CJMA 2ZJ9A 3DTMA 3S22A 4JXGA 1IEMA 5A92A 3IXGA 1BZAA 1K4EA 2FFYA 2WYXA 2Q9MA 2ZC5B 4U0XA 4O7DA 4E3IA 4BLMA 2E8IA 2A3UA 2Y55A 1KDWA 3EQUA 3P09A 1FCMA 1KGGA 4S2NA 5HAIA 3SS3A 3VP1A 1EROA 2XFTA 4JXWA 1MWSA 5GLCA 4HBUA 1I2SA 3ZG5A 3Q81A 3BRMA 1BLSA 1TDLA 2WGIA 1RCJA 3FYZA 4KZ4A 5IHVA 4BL2A 4IBXA 4Q8IA 2QZ6A 4HESA 5DTKA 5E2FA 5AQ7A 2XK1A 4E3LA 3UN7A 3ZGAB 3VP0A 2P9VB 4CJNA 3IH9A 4P87A 1K4FA 1ONHA 4QY6A 3GMWA 1XGIA 4UA7A 2ZM2A 1KDSA 3IWOA 1ERMA 1YLJA 1MWTA 3NY4A 4GKUA 4KZ5A 4OPRA 3ZG8B 1BLPA 4NK3A 1LI9A 4LCLA 3RJUA 4BQMA 4QU3A 1W8QA 4X53A 4GZBA 2JE5A 5GL9A 3UE0A 1GHIA 1J9MA 1XA7A 1H8ZA 5KSCA 3UDXA 4X69A 3VMAA 1I5QA 4MBFA 4EUZA 3M6BA 3O86A 4E3MA 4P0MA 3O87A 5CGXA 5FI7A 1OMEA 5GLDA 1K57A 1K6RA 2H5SA 3AGFA 4XUZA 3BYDA 5FI2A 2X01A 4KG2A 3VP2A 3NDEA 5JYOA 1WYBA 1JWVA 5F1FA 5E2EA 4S2LA 1K6SA 4WELA 1MY8A 2XQZA 1L0EA 3IHBA 3UE3A 4X56A 5CERA 4Y0TA 2PU4A 4OPZA 2IWCA 5HAPA 2Y91A 1YM1A 2WKEA 5HARA 3MKFA 1SCWA 5FA7A 1DJAA 3BFCA 5GLBA 1XKZA 1ES4A 4S2NC 5FQ9A 3MBZA 4ZAMA 1G6AA 4N92A 4BL3A 4WEJA 3C4OA 4DE3A 2ZQ9A 2EX6A 3HLWA 3ZG9B 2H10A 4KZ6A 2V20A 3M2KA 3N8SA 1NZOA 3GVBA 2Y2PA 1GCEA 5TR7A 5CECA 1QMFA 4OPQA 5KSHA 1RGYA 4RVAA 2Y4AA 3P98A 2ZLYA 1ALQA 1U60A 4OP8A 2EFXA 5AQBA 1ESUA 4E3NA 3G34A 4BENA 4UHUA 5EVIB 4WM9A 3FKVA 1NJ4A 4MEZA 2ZQ8A 3RXWA 5EE8A 1YLYA 3VFFA 4GDBA 3W4QA
chains in the Genus database with same CATH superfamily
1M40A 3S7PA 3E2KA 1SKFA 4S2MA 1ZG6A 1XXMA 2Y2NA 3RH8B 5HD3A 3S1YA 1HVBA 3W4PA 3ISGA 4R0QA 3LEZA 5GHZA 1KE4A 4IHQA 3BM6A 4DE2A 4WZ4A 3CMZA 4PKYA 4R23A 3ZNYA 5L09A 1OPXA 2W3GA 5CGWA 3BFDA 2D01A 3IF6A 5HL6A 1VETB 4UQIS 2XFSA 4KG5A 1A0KA 1BT5A 2WGVA 2W3DA 1HLUP 3PBQA 3HCYA 3BFFA 4GW9A 1MBLA 3O3VA 1L0FA 1LLBA 2B02A 3S7QA 3Q1FA 2E8JA 3N8LA 2VGLM 5DF8A 1NYYA 2PRFA 4BD1A 1G5UA 3T1RA 5DKLA 2GNXA 3PR6A 2V8CA 4R4SA 1DP6A 1VQQA 3PBSA 4OP5A 5FI6A 1OTEA 3ZG0A 2QKPA 4WYYA 4JXSA 5EPHA 2VGJA 1JWZA 2V0UA 3E4OA 4PM8A 4FH2A 4JLFA 5CEBA 2AVXA 3SH7A 4MMNA 4PMAA 3ICYA 1J3WA 4EQ1A 4PAUA 4DDYA 2ZOIA 3G30A 3S7OA 5KZHA 1ZTUA 3ZQ5A 4L9EA 1D06A 3O88A 4MN7A 1OTDA 3K3DA 3N6IA 1M6KA 5DJUA 2IWDA 5FQKA 5AVFA 4JPMA 1ES5A 1XFQA 3ZDJA 4XT2B 1FR1A 4HQAA 2NUPC 4JGPA 5C5KA 4P6ZM 1N4OA 1Q2QA 4GD6A 3HUMA 4ID4A 4IUKA 2XD1A 2HJ9C 2Y2LA 2VV6A 4KZ7A 1LSXA 2GX5A 3MF0A 3W8KA 2CMNA 4EQIA 2WADA 3KYQA 1HD8A 2RCXA 1FOFA 3VP3A 3S4XA 3OPLA 3G6OA 3CUEA 4Y5FA 1WE4A 4KUOA 2A24A 3UMDA 4N9KA 2V1BA 4GB7A 4UQIM 3C7VA 4BD0A 4PM7A 4ZJ2A 3WS4A 4I3JA 3PYPA 5DTSA 1V9YA 2EX9A 4LLOB 1OT6A 3M6HA 3AGEA 5E2HA 1ONGA 2FFFB 5A91A 2B95A 1YPRA 5MC7A 4OOLA 3ZG7B 4Q0HA 5EM0A 4F3LB 3SW1A 4OPYA 3UPNA 3MZFA 5FQIA 5G4ZA 3GRJA 2P04A 1KVMA 1BSGA 5L07A 3VE3A 4LGWA 4NXGA 5I5LA 5L10A 2WKIA 3R7WA 1GSWA 4Y7PA 4NXEA 5D3OA 3HUOA 5KIZA 4RQ9A 3CUEC 4WMCD 2Y59A 3PBNA 2G2UA 5HZHA 4HJ6A 2ZQCA 4HY8A 3QP4A 1NYMA 5HX9A 4Y0OA 3T50A 4KQQA 4B93A 3SS4A 2K2NA 5CGSA 1TS8A 1EW0A 1H0MA 4IVKA 4NETA 3A0SA 3UY6A 2OWHA 4IVIA 2VV8A 3QNBA 4FD8A 2J7VA 1K25A 3TRCA 4B4XA 2XEPA 2WK0A 4HBTA 2XGNA 3EGDC 2J3TC 3ZVWA 4P85A 1PI5A 2PDRA 2QYBA 1GA9A 5HFOA 1K55A 1MWUA 4R4RA 4ETZA 4WZ5A 1RP5A 5EM1A 3LIEA 2M7UA 2JKFA 1MC0A 2VZWA 2J80A 3VOLA 5HWVA 1MKIA 3TG9A 1VETA 5F69A 5F83A 4D60A 3BQ8A 4S2JA 2W1RA 3NBLA 2Y2MA 1JTGA 3UDFA 1K0KA 1ZC2A 3JVVA 5EFWA 3HLCA 5CHMA 5J7EA 3IHAA 5FDHA 4B88A 2V1ZA 4KQDA 3UDIA 1G6OA 5A93A 1KE3A 4LRXC 3DTMA 3IXGA 1BZAA 1DP8A 2ZC5B 4E3IA 4FUWA 3L9KA 1CF0A 1SKOB 4AFIA 1MWSA 4HBUA 3ZG5A 4WUJA 4Q8IA 2QZ6A 4HESA 2XK1A 3VP0A 2P9VB 2B18A 1KOUA 1MWTA 4GKUA 4GLQA 4LFUA 4NK3A 1LI9A 3FPWA 1J9MA 4R70A 4X69A 1I5QA 4EUZA 1Y28A 2XROA 4O0PA 4P0MA 5FL3A 1K6RA 2H5SA 3BYDA 1D7EA 4KG2A 3QP8A 2ZMFA 4WELA 2XQZA 3F1PB 4G3VA 1YM1A 3LI8A 1TD5A 1W63Q 1H8MA 5HDDA 4XT2A 1ES4A 3MBZA 1G6AA 4N92A 1CQAA 4WEJA 2ZQ9A 2OOLA 5KSHA 3UB6A 4RVAA 4EESA 2ZLYA 1ODVA 2O99A 2EFXA 4E3NA 2ZMVA 5EVIB 5EE8A 4E04A 2VKSA 4EU0A 3W4QA 4X1LA 3C7UA 5EVID 1P0ZA 5AQAA 3MKEA 3Q07A 4Z1WA 3FKWA 1PRQA 3U4LP 1MZUA 3WS2A 3TSGA 1YMXA 4L0LA 3OLOA 5KMWA 2WKPA 3T4LA 2V9AA 3CITA 4JF6A 2HPBA 2XSSA 5TGFA 2WKRA 4P6BA 3A0VA 1VHMA 1E3UD 1MWRA 1CJFA 3IXDA 3OPRA 5F6AA 3C38A 4BBUA 4F3LA 2XDMA 5HAQA 4NKPA 2GJ3A 2HDUA 2ZC3B 1PWCA 4C6YA 4X55A 4FCFA 3MXSA 3T4QA 1BULA 2BLSA 3NIAA 4DDSA 4IBRA 4WMCA 2V0WA 3BQAA 4XUXA 3IQAA 3C8CA 1P9RA 4EERA 2ZM0A 1XA1A 3MJQA 3CHWP 4PM5A 1YLPA 4EEPA 1ZKJA 1XJ2A 1XGJA 3V39A 4S2PA 3SZTA 3U2AA 3CPTB 3SH8A 3VE4A 2A49A 4CPKA 5A8BA 2KOIA 3FZCA 3ZFZA 3EEAA 1IOUA 2WUQA 1G68A 4KZ9A 3HLBA 2BASA 1CEFA 3O5YA 3B47A 2ZL1B 3DTKA 4DXBA 5HDCA 2H0TA 3HUNA 4LV2A 3KSIA 3GSGA 2ZOHA 4PPRA 1OTAA 1YLZA 2Y2IA 3IXHA 4KZBA 1PW8A 1DY6A 4Q0JA 4EBNA 1DJCA 4FSFA 3WWXA 5I94A 3OZHA 3HVFA 3DBAA 3V50A 3FV7A 3KSHA 1FQGA 1DJBA 1T1CA 2Z2LB 2PYRA 5TFQA 5J8XA 3UE1A 4XXRA 5FQMA 4Z9QA 2V2FF 3ITBA 2W0NA 3I7JA 3MQOA 1PFLA 2DNSA 3MR0A 5FATA 4I38A 1FIKA 3GQZA 4R3JA 4HIAA 4GD8A 2G2WA 4K0WA 1KVLA 3DTEA 4M3KA 3LIFA 2BG1A 1SKOA 5HW3A 3OCLA 3BECA 3MMHA 5CHUA 4PM6A 4LCMA 3BEBA 3T4OA 2HF6A 4OKPA 4LV3A 3M2JA 2Y2HA 4CLCB 1V9ZA 2P9VA 2O9CA 5HPFA 5GLAA 3HLGA 3RXXA 4G3KA 4CLCD 3E0YA 3BLMA 4RX3A 4BBVA 3C5AA 5FAPA 1L2SA 1NXYA 2XLNA 3NULA 2R9XA 4S2KA 4WN5A 4OQGA 2XF3A 4R3AA 2I9VA 3A3JA 1XJ3A 3D4FA 4HJ3A 3IF6C 3UPOA 3TE8A 1XJ4A 3F1PA 1C3BA 2R78A 4JBFA 3F1OB 4M4XA 2HP6A 4QJGA 1F9IA 4DN0A 2JKRM 3BLSA 3N4IA 5FQJA 1AXBA 2LB9A 4YINA 5M18A 1O07A 2Y79A 3V3RA 1FSYA 3G2YA 3UMEA 1BLCA 1HZOA 4S2OA 3ULFA 3NOUC 2JKRI 4R3BA 4I3IA 5EVIA 2XRNA 1H3QA 4FOFA 1CI9A 5DVAA 2QJ5A 3K3CA 4ZJ1A 4X68A 5DF9A 1Q2PA 4KQRA 5CEDA 4DF6A 1S66L 1FR6A 3Q7VB 1W8YA 3E4QA 4C3QA 2Y2QA 4JKTA 2Y2KA 3EEHA 4OQHA 2Y2OA 3LR0A 3N8RA 3C30A 4IUHA 3NOPC 4R1GA 1E3UA 4EWFA 1W63M 5L2FA 1W79A 3MFDA 3IH8A 5FQQA 1JTDA 1LSWA 1H8YA 3TW8A 3TOIA 3FWLA 1YQSA 4ZBEA 4QB8A 1K38A 4ARZB 2WZZA 1BLHA 1SDNA 3C2WA 1STZA 2WYXA 2FFYA 4U0XA 3LGOA 4BLMA 2A3UA 2K31A 4ETXA 3P09A 3SS3A 5HAIA 1ACFA 1BLSA 2WGIA 3EOIA 4KZ4A 4BL2A 1VEUB 5DTKA 3UB8A 2O9AA 4ME4A 4E3LA 3LI9A 4CJNA 1F5MA 1K4FA 3GMWA 1XGIA 3QP5A 2ZM2A 3IWOA 5EV0A 2P08A 4OPRA 4NG2A 3CPTA 1BLPA 4LCLA 4BQMA 4GZBA 2JE5A 4DJ3A 1IFQA 3IBJA 4L9GA 1XA7A 1H8ZA 5KSCA 3M6BA 1OJGA 3O87A 4BMWA 2ZL1A 1TS6A 4XUZA 5FI2A 1TS0A 1T1BA 4EEUA 1WYBA 1JWVA 5F1FA 1T18A 1K6SA 1MY8A 3IHBA 3UE3A 5CERA 3BY9A 3CWFA 2UV0E 2WKEA 4NXBA 4FTXA 1SCWA 2KX6A 5GLBA 3CLOA 5FQ9A 4ZAMA 4DE3A 3T1QB 2EX6A 2JKTI 3GDIA 1S67L 1GCEA 2PR5A 5CECA 4OPQA 1RGYA 3P98A 4UEYA 4OP8A 1ESUA 4BENA 2KLIA 3RXWA 1YLYA 3VFFA 1VB6A 1LL9A 3A3DA 2H0YA 4MN6A 4GOGA 4OLGA 2I72A 3T4KA 3MXRA 1FSWA 3H82B 5G4YA 5K5BA 3LY3A 4K0XA 2M1CA 1PZOA 3LYXA 3A3IA 4LRYC 3MXQA 2JC7A 1FCOA 4PHTA 1JVJA 2K7SA 1LHYA 1YMSA 4CLCA 4Q0IA 4EV4A 2L0WA 1PI4A 2DRWA 4O8GA 3QP1A 4LRZE 1D1JA 2JBFA 2Z2MB 1BUEA 3Q82A 2LB5A 2ZQDA 3HREA 5DFXA 1S0WA 1K55C 2O9BA 3PHYA 3WRZA 1IELA 3V67A 4WZ5C 1GSVA 5FAOA 4MCWA 2L4RA 1TF1A 1S1YA 2ZC6B 4OQ0A 5HPIA 1XPBA 2VA0A 3NJAA 4NXFA 3ZNTA 3F1OA 1P97A 4KENB 1L0GA 4HJ4A 5IU1A 3UO9A 3B42A 4OOYA 3GECA 2VX8A 3HLDA 3ZCZA 1EI5A 1Y54A 3BJNA 4QPRA 1WYCA 2VEAA 3P7NA 1XFNA 2Y2GA 2Y2JA 3IWIA 4CLCC 1S6RA 5EOOA 2C6WB 5CX7A 1YLWA 3RFBA 3R4KA 1KGEA 4IJGA 3QP6A 3S7NA 3Q7VA 1YT4A 1LL8A 2J9PA 2WAEA 4WEKA 5E2GA 3HLFA 3ZVTA 2J8YA 1YKDA 1OJ5A 4NEED 4DE1A 2MJ6A 5EOEA 3UPPA 2EWVA 3NI9A 4C75A 1IYSA 5L8MA 3KSGA 4WF0A 2W3FA 3L7HA 1PYYA 3LR4A 2ZM8A 4GHIB 3EGXC 5F82A 3IXBA 2W1TB 2EA9A 3KX0X 1NWZA 1TDGA 3DWKA 1RGZA 5IS1A 2PU2A 4ARZA 2ZC7A 5JYPA 2ZQ7A 3Q7ZA 5DTTA 2HDSA 2X71A 3V3SA 3GTCA 3OPPA 5FSRA 3CZDA 3DW0A 3MQQA 5EUAA 1S4SA 4E6WA 3IBRA 3LIAA 3FG8A 1LSVA 1H5XA 4UAAA 1G28A 4R6LA 2HDRA 4LV1A 4MBKA 1PNEA 4MLLA 1VEUA 2HGVA 1K54A 4EBPA 3P01A 1IYOA 1TS7A 3PBOA 1IKIA 1MPLA 2VJWA 4Y0UA 2HV1A 4LPZA 3D72A 4X6TA 3UB5P 2OWJA 3WS0A 2ZMAA 2PD8A 4Y2FA 3DTIA 1K56A 5CTMA 2PBDP 3MS6A 5HL1A 1YSPA 3EQVA 5DKKA 1MXOA 4PKYG 3GR2A 3D3OA 4GCZA 4JF4A 2VGKA 4JF5A 3SS5A 1OTBA 4N1XA 4DMZA 4Y17A 4S2IA 4PM9A 3VSKA 2CC1A 2D02A 3W2ZA 3PBRA 2INWA 1W7FA 3H7WB 3T4JA 2XH9A 1T1AA 3A3FA 4HI4A 4K91A 2JN7A 2GZAA 4OLDA 1K54C 3VP4A 4MN5A 3HBRA 2Q0OA 3NDGA 4YFMA 2YKHA 2VK3A 4GNUA 1O7EA 1ZG4A 3WS1A 2OLVA 3VOYA 1UGUA 1GSXA 3TJZC 3H82A 4E3JA 2WAFA 2WGWB 4E3OA 1DP9A 2XA7S 1FCNA 4HH3A 2Z6CA 1KGFA 2B5RA 3OOVA 4DKIA 3IS2B 4KG6A 3DAVA 4H8RA 4QHCA 4ZDXA 5DFYA 3OC2A 3HJKA 2L1MA 4DJ2A 2FH5A 1TVFA 4Y13A 1GA0A 3OPHA 1ES3A 2WKHA 3BFGA 3T4TA 2PR6A 2V1AA 3B3XA 3LCEA 3E2LA 2ZJ9A 2PHYA 3S22A 1IEMA 5A92A 4CQHA 4O7DA 3T1SA 2Y55A 1KDWA 3EQUA 4S2NA 1FCMA 1EROA 5GLCA 1I2SA 3Q81A 1TDLA 1RCJA 3FYZA 5IHVA 4IBXA 1X0OA 3ZGAB 1OT9A 1NLYA 3IH9A 4QY6A 4JGQA 4UA7A 1ERMA 4KZ5A 3ZG8B 3RJUA 3QP2A 3UDXA 3VMAA 4MBFA 1YAXA 4E3MA 5CGXA 4HH2A 5FI7A 1K57A 3AGFA 5JYOA 3NDEA 3BWLA 4S2LA 3FPVA 1L0EA 4X25A 4EW7A 4X56A 5HAPA 2Y91A 5HARA 3MKFA 2IA2A 5FA7A 3BFCA 1XKZA 4S2NC 4GHIA 4BL3A 4X1MA 3ZG9B 2H10A 5HDSA 4YNRA 5HWWA 3D9YA 1DRMA 2W1TA 4HOIA 5TR7A 1Z09A 5TBMB 4HP4A 4EXOA 2PYPA 3G34A 3LIDA 3LICA 3T4SA 4MEZA 2VV7A 1L3LA 2XA7M 3KYZA 1NLZA 1W5DA 3VOZA 2R9WA 3PAEA 1GHMA 4WLAA 5AQ9A 4GS9B 4HP9A 3T12B 4Y15A 5F68A 4MDZA 1CI8A 1ESIA 1QMEA 3OBFA 3KO6A 1K57C 2HP5A 4ZRRA 2OSUA 4MNRA 5EVEA 5CTNA 4QY5A 3HLEA 3NC8A 1S1ZA 1VM1A 2JCHA 4I39A 2W3EA 3GV9A 3QHYA 1PWGA 2IWBA 2ZBBA 4F94A 2HDQA 5EVIC 1PIOA 1PWDA 4ZJ3A 4FH4A 4RYEA 4DXCA 2EXBA 2XR0A 1E25A 4U0TA 1PZPA 3T1XA 5EECA 5M19A 4KZAA 5J4EA 2ZC4B 1CK3A 2PT7A 5GHYA 4H6JB 2QPNA 2ACGA 2QMIA 2M7VA 1LL5A 1P9WA 1N9BA 4LV0A 1ERQA 4IEDA 4K08A 5AJGA 4DE0A 3G35A 3UE6A 4QWOA 2P74A 2PBYA 3F1NB 3WRTA 3LFVA 4G3WA 1IYPA 2NUTC 3SH9A 4HHDA 3UNWA 4BJPA 3W4OA 3IX8A 2HZ5A 4GN2A 4LENA 1I2WA 4B4ZA 4OOMA 2JKTM 3C4PA 3H7WA 3IWQA 5CXWA 1CEGA 1K56D 3BFEA 2EWWA 3MQ0A 1XJ6A 4JGOA 2A2LA 1IYQA 3JYIA 4L9FA 4HEFA 4RA7A 4KZ3A 3ITAA 4E3KA 1JNUA 3VSLA 2XD5A 1PW1A 4UA6A 2WGWA 1NZUA 2O0YA 4OH0A 5BOHA 1FILA 2J9OA 5FEFA 4KZ8A 4QD4A 3NHQA 3JVUA 3IS2A 4YOFA 5HWTA 5CRFA 1T19A 2V8FA 1Y4OA 2FZ0A 1KE0A 2UWXA 2EX2A 1NRJA 2JHEA 3RTYA 1SHVA 3NOTC 5U47A 4DRTA 2DMWA 4JXVA 2DCFA 3MZEA 4HNBA 1XX2A 5FASA 1NY0A 1YLTA 1L0DA 3JPUA 4N9LA 1MKMA 3G32A 3QNCA 4I5SA 3MZDA 2ZD8A 3PBTA 4UA9A 5DF7A 3G2ZA 1UWNX 3BW6A 3IX3A 3E98A 4WL9A 1F2KA 3IF6B 2QHKA 3MSHA 5A90A 3K2NA 3UB7A 1BYWA 1N9OA 3B33A 2HP9A 3ZYTA 2RL3A 1AWIA 1ES2A 2J3WA 4JGRA 4E6XA 4N1HA 3DWZA 2Q9NA 2OLUA 3E4PA 1SZVA 2P7JA 3AGDA 2ZQAA 5M1AA 3KYEA 5FEGA 1F98A 5GHXA 1IKGA 2Z6DA 5CHJA 4ESPA 5EVLA 4OONA 4EBLA 3G4PA 5IT5A 4WBGA 1ZHHB 4ZTKA 4OVDA 1Z6FA 3LR5A 1HTZA 1UWPX 1N9LA 4D2OA 1E4DA 4B9OA 5J3WA 1LT0A 1SDEA 2GDNA 3N7WA 3NCKA 4OQIA 3IT9A 3HL9A 5F1GA 2EX8A 1NRFA 2WZXA 3ZHHA 1XP4A 1BTLA 3PXPA 3G31A 5DJTA 5TBMA 2G7UA 2YKFA 4EETB 1JWPA 2OAP1 4Y3IA 4KUKA 2JKGA 3LO7A 3IF5A 3CG5A 3WS5A 5E43A 3MFXA 4GS9A 2X02A 5HSQA 2EXAA 3PTEA 3A3EA 2EFUA 4R38A 4EUVA 3PAGA 4RX2A 4KQOA 4I3AA 2OV5A 2C5WB 3V5MA 2QWSA 3BY8A 4U3TA 3OCNA 5G18A 2VLGA 3SOIA 3FC7A 3UB9A 4MBHA 1LI0A 1EWZA 2WKQA 3A0RA 3EWKA 4GDNA 4A5RA 3VFHA 4BBTA 1TEMA 5AVEA 2HJEA 4H6JA 1GHPA 3LY4A 4CLCE 3CJMA 4II7A 4JXGA 2A24B 2VGLS 1K4EA 2Q9MA 3LR3A 2E8IA 3LEQA 1KGGA 3VP1A 2XFTA 4JXWA 3BRMA 3F1NA 5TJJA 5E2FA 5AQ7A 1WA9A 3UN7A 2PD7A 3LUQA 3CI6A 4P87A 1ONHA 3NECA 1YSQA 1KDSA 1YLJA 3NY4A 1S4RA 1W8QA 2QJ7A 4O01A 4QU3A 4X53A 3H9WA 5GL9A 3UE0A 1GHIA 4YWZA 2BTFP 3HJIA 2PAVP 3O86A 4GJ4A 5FDSA 3R7WB 2J3TD 1OMEA 5GLDA 3LIBA 2KDKA 2X01A 3VP2A 5HD5A 5E2EA 5LBRA 3VV4A 3CAXA 4Y0TA 2PU4A 4OPZA 2IWCA 3IX4A 1DJAA 2Y8HA 3KSFA 4BWIA 2W3HA 3C4OA 3HLWA 4KZ6A 2V20A 3M2KA 3N8SA 1N9NA 1NZOA 3GVBA 2Y2PA 2OAQ1 1QMFA 2Y4AA 1ALQA 1U60A 5AQBA 4UHUA 2W27A 4P6ZS 4WM9A 3FKVA 1NJ4A 2H28A 1OTIA 2ZQ8A 5FAQA 5F5YA 4GDBA
chains in the Genus database with same CATH topology
1LL9A 3C7UA 5EVID 1M40A 3A3DA 5AQAA 1W5DA 3E2KA 1SKFA 3MKEA 2H0YA 1ZG6A 1XXMA 2R9WA 3Q07A 4GOGA 4S2MA 3VOZA 2Y2NA 3PAEA 4OLGA 1GHMA 2I72A 3FKWA 5AQ9A 3S1YA 1HVBA 3W4PA 3ISGA 4R0QA 3MXRA 3LEZA 5GHZA 1KE4A 1FSWA 3WS2A 3BM6A 1CI8A 1YMXA 4L0LA 3LY3A 1ESIA 1QMEA 3TSGA 4WZ4A 4DE2A 4K0XA 5KMWA 1K57C 2HP5A 3CMZA 4R23A 1PZOA 2OSUA 4MNRA 3ZNYA 3A3IA 5CTNA 4QY5A 3HLEA 2HPBA 4JF6A 3BFDA 2JC7A 3IF6A 5CGWA 5TGFA 1FCOA 3NC8A 4P6BA 1JVJA 1VM1A 1LHYA 2JCHA 2XFSA 4KG5A 1YMSA 4EV4A 1BT5A 3GV9A 3QHYA 1E3UD 1MWRA 2WGVA 3IXDA 1PWGA 3OPRA 1PI4A 2IWBA 3PBQA 2HDQA 5EVIC 4F94A 1PIOA 1PWDA 2DRWA 3BFFA 2XDMA 4ZJ3A 1MBLA 4FH4A 4RYEA 3O3VA 1L0FA 5HAQA 1LLBA 4DXCA 3Q1FA 2JBFA 2EXBA 2HDUA 2XR0A 2Z2MB 2ZC3B 3N8LA 1PWCA 1BUEA 1E25A 4U0TA 1PZPA 5EECA 5DF8A 4C6YA 5M19A 3Q82A 4X55A 1NYYA 4KZAA 2ZC4B 4FCFA 4BD1A 2ZQDA 3HREA 3MXSA 1CK3A 1S0WA 5GHYA 1K55C 2QPNA 3WRZA 1BULA 1IELA 2BLSA 2QMIA 3NIAA 4WZ5C 4DDSA 1LL5A 4IBRA 5FAOA 4WMCA 2ZC6B 4OQ0A 1N9BA 4LV0A 1ERQA 4IEDA 1XPBA 4XUXA 3IQAA 4DE0A 3G35A 4R4SA 1VQQA 3ZNTA 3PBSA 2ZM0A 2P74A 4OP5A 1XA1A 2PBYA 5FI6A 3WRTA 3ZG0A 1L0GA 4KENB 4WYYA 4JXSA 5EPHA 3UO9A 1IYPA 2VGJA 3SH9A 4PM5A 4OOYA 1JWZA 1YLPA 3UNWA 4PM8A 4BJPA 1ZKJA 3W4OA 3HLDA 4FH2A 3ZCZA 4JLFA 1XGJA 3V39A 4S2PA 1EI5A 1Y54A 1I2WA 4GN2A 4LENA 4B4ZA 5CEBA 4OOMA 1WYCA 3C4PA 3SH7A 3SH8A 2A49A 3IWQA 5CXWA 4PMAA 4CPKA 2Y2GA 1CEGA 1K56D 2Y2JA 3FZCA 3BFEA 3IWIA 3ZFZA 1S6RA 4DDYA 1IYQA 3JYIA 5EOOA 2WUQA 1G68A 2C6WB 3G30A 4KZ9A 3HLBA 4HEFA 4RA7A 5KZHA 1CEFA 4KZ3A 1YLWA 3ITAA 4DXBA 1KGEA 4E3KA 3VSLA 3O88A 2H0TA 3Q7VA 1YT4A 2XD5A 2J9PA 3HUNA 3N6IA 1PW1A 2WAEA 4LV2A 4UA6A 1M6KA 4WEKA 5E2GA 3HLFA 3ZVTA 3GSGA 2J8YA 2WGWA 1NZUA 2IWDA 4PPRA 4DE1A 5FQKA 5EOEA 4OH0A 3UPPA 4JPMA 1YLZA 3NI9A 1ES5A 4C75A 1IYSA 5BOHA 2J9OA 2Y2IA 3IXHA 4KZ8A 4KZBA 1PW8A 4QD4A 1DY6A 3ZDJA 1FR1A 1PYYA 4EBNA 1DJCA 2ZM8A 4FSFA 5F82A 3WWXA 5I94A 3OZHA 3HVFA 3IXBA 1N4OA 3V50A 1Q2QA 3FV7A 4GD6A 5CRFA 1FQGA 1DJBA 2Z2LB 3HUMA 1KE0A 4ID4A 2XD1A 2Y2LA 1TDGA 3DWKA 2UWXA 5TFQA 4KZ7A 1RGZA 2EX2A 2PU2A 3W8KA 4EQIA 5J8XA 3UE1A 2WADA 4XXRA 5FQMA 4Z9QA 2ZC7A 2V2FF 1HD8A 5JYPA 1SHVA 2RCXA 3ITBA 1FOFA 3VP3A 5U47A 4DRTA 3I7JA 2ZQ7A 2DNSA 3Q7ZA 5DTTA 3OPLA 3S4XA 4JXVA 5FATA 2HDSA 2X71A 1WE4A 3V3SA 3GTCA 2DCFA 3OPPA 3MZEA 5FSRA 3CZDA 3GQZA 4R3JA 3DW0A 4N9KA 5EUAA 1XX2A 4GD8A 2G2WA 4GB7A 5FASA 1NY0A 4E6WA 1YLTA 1L0DA 4K0WA 1KVLA 4M3KA 3C7VA 1H5XA 4N9LA 2BG1A 4UAAA 3G32A 3QNCA 5DF7A 3MZDA 2ZD8A 3PBTA 4UA9A 4BD0A 3G2ZA 5HW3A 3OCLA 3BECA 2HDRA 4LV1A 4MBKA 4PM7A 5CHUA 4ZJ2A 3WS4A 4PM6A 3IF6B 4LCMA 5A90A 5DTSA 4MLLA 3BEBA 2EX9A 4OKPA 3M6HA 3AGEA 4LV3A 5E2HA 3M2JA 1ONGA 2FFFB 2Y2HA 5A91A 2P9VA 2HP9A 1K54A 2RL3A 1ES2A 4OOLA 3ZG7B 4EBPA 5GLAA 3HLGA 3RXXA 4E6XA 4OPYA 1IYOA 3BLMA 4N1HA 4RX3A 3UPNA 3MZFA 3PBOA 1IKIA 5FQIA 3DWZA 2Q9NA 3C5AA 5FAQA 2OLUA 5FAPA 1MPLA 3GRJA 1L2SA 1NXYA 3AGDA 2ZQAA 1KVMA 4Y0UA 1BSGA 5M1AA 2XLNA 2R9XA 4S2KA 4OQGA 2XF3A 5GHXA 2WKIA 1IKGA 4X6TA 5CHJA 3WS0A 2ZMAA 3A3JA 5EVLA 4Y7PA 4OONA 5D3OA 3D4FA 1K56A 3G4PA 4EBLA 4WBGA 5CTMA 3HUOA 4ZTKA 4OVDA 1Z6FA 3IF6C 3UPOA 4WMCD 1HTZA 5HL1A 2Y59A 1C3BA 4JBFA 3PBNA 3EQVA 4D2OA 1E4DA 2HP6A 1MXOA 2G2UA 4QJGA 3GR2A 2ZQCA 1SDEA 3BLSA 3N4IA 1NYMA 4JF4A 5FQJA 5HX9A 2VGKA 4JF5A 2GDNA 4Y0OA 3SS5A 3N7WA 1AXBA 4KQQA 4YINA 5M18A 3NCKA 4OQIA 1O07A 3IT9A 4N1XA 3HL9A 5F1GA 3SS4A 4S2IA 4PM9A 2EX8A 3VSKA 2CC1A 1NRFA 2WZXA 5CGSA 3V3RA 3ZHHA 1FSYA 3PBRA 1W7FA 1XP4A 2XH9A 1BTLA 3G2YA 4IVKA 3G31A 3A3FA 1BLCA 4NETA 1HZOA 4S2OA 4K91A 4OLDA 3UY6A 3VP4A 1K54C 4IVIA 4R3BA 5EVIA 3QNBA 4FD8A 2J7VA 1JWPA 1K25A 3HBRA 5DVAA 1CI9A 3NDGA 4YFMA 4B4XA 2XEPA 2WK0A 4ZJ1A 4HBTA 4X68A 5DF9A 1Q2PA 3LO7A 3IF5A 2XGNA 4GNUA 4KQRA 5CEDA 4DF6A 3CG5A 3WS5A 1O7EA 5E43A 1FR6A 1ZG4A 3WS1A 3Q7VB 1W8YA 2OLVA 3ZVWA 3VOYA 4P85A 4C3QA 1PI5A 2X02A 2Y2QA 1GA9A 5HFOA 1K55A 1MWUA 2WAFA 4JKTA 4E3JA 2Y2KA 2EXAA 2WGWB 3A3EA 3PTEA 4E3OA 2EFUA 4OQHA 4R4RA 4WZ5A 2Y2OA 1RP5A 1FCNA 3PAGA 4RX2A 4KQOA 1KGFA 2B5RA 3N8RA 4DKIA 1MKIA 4R1GA 2OV5A 2C5WB 1E3UA 3TG9A 3V5MA 4KG6A 4EWFA 5F83A 4H8RA 4QHCA 4ZDXA 4S2JA 3NBLA 4U3TA 5L2FA 2Y2MA 1W79A 3MFDA 3OCNA 5G18A 3IH8A 5FQQA 3OC2A 1JTDA 1H8YA 1JTGA 3UDFA 3SOIA 1ZC2A 3TOIA 3FWLA 3HLCA 4MBHA 1YQSA 1TVFA 1LI0A 5CHMA 1EWZA 4QB8A 4ZBEA 1K38A 3IHAA 2WZZA 1GA0A 3OPHA 5FDHA 4B88A 1ES3A 2V1ZA 1BLHA 4GDNA 4A5RA 1SDNA 3VFHA 3UDIA 2WKHA 1TEMA 3BFGA 3LCEA 3B3XA 5A93A 1KE3A 3E2LA 1GHPA 3LY4A 3CJMA 2ZJ9A 3DTMA 3S22A 4JXGA 1IEMA 5A92A 3IXGA 1BZAA 1K4EA 2FFYA 2WYXA 2Q9MA 2ZC5B 4U0XA 4O7DA 4E3IA 4BLMA 2E8IA 2A3UA 2Y55A 1KDWA 3EQUA 3P09A 1FCMA 1KGGA 4S2NA 5HAIA 3SS3A 3VP1A 1EROA 2XFTA 4JXWA 1MWSA 5GLCA 4HBUA 1I2SA 3ZG5A 3Q81A 3BRMA 1BLSA 1TDLA 2WGIA 1RCJA 3FYZA 4KZ4A 5IHVA 4BL2A 4IBXA 4Q8IA 2QZ6A 4HESA 5DTKA 5E2FA 5AQ7A 2XK1A 4E3LA 3UN7A 3ZGAB 3VP0A 2P9VB 4CJNA 3IH9A 4P87A 1K4FA 1ONHA 4QY6A 3GMWA 1XGIA 4UA7A 2ZM2A 1KDSA 3IWOA 1ERMA 1YLJA 1MWTA 3NY4A 4GKUA 4KZ5A 4OPRA 3ZG8B 1BLPA 4NK3A 1LI9A 4LCLA 3RJUA 4BQMA 4QU3A 1W8QA 4X53A 4GZBA 2JE5A 5GL9A 3UE0A 1GHIA 1J9MA 1XA7A 1H8ZA 5KSCA 3UDXA 4X69A 3VMAA 1I5QA 4MBFA 4EUZA 3M6BA 3O86A 4E3MA 4P0MA 3O87A 5CGXA 5FI7A 1OMEA 5GLDA 1K57A 1K6RA 2H5SA 3AGFA 4XUZA 3BYDA 5FI2A 2X01A 4KG2A 3VP2A 3NDEA 5JYOA 1WYBA 1JWVA 5F1FA 5E2EA 4S2LA 1K6SA 4WELA 1MY8A 2XQZA 1L0EA 3IHBA 3UE3A 4X56A 5CERA 4Y0TA 2PU4A 4OPZA 2IWCA 5HAPA 2Y91A 1YM1A 2WKEA 5HARA 3MKFA 1SCWA 5FA7A 1DJAA 3BFCA 5GLBA 1XKZA 1ES4A 4S2NC 5FQ9A 3MBZA 4ZAMA 1G6AA 4N92A 4BL3A 4WEJA 3C4OA 4DE3A 2ZQ9A 2EX6A 3HLWA 3ZG9B 2H10A 4KZ6A 2V20A 3M2KA 3N8SA 1NZOA 3GVBA 2Y2PA 1GCEA 5TR7A 5CECA 1QMFA 4OPQA 5KSHA 1RGYA 4RVAA 2Y4AA 3P98A 2ZLYA 1ALQA 1U60A 4OP8A 2EFXA 5AQBA 1ESUA 4E3NA 3G34A 4BENA 4UHUA 5EVIB 4WM9A 3FKVA 1NJ4A 4MEZA 2ZQ8A 3RXWA 5EE8A 1YLYA 3VFFA 4GDBA 3W4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LL9 A;  3C7U A;  5EVI D;  1M40 A;  3A3D A;  5AQA A;  1W5D A;  3E2K A;  1SKF A;  3MKE A;  2H0Y A;  1ZG6 A;  1XXM A;  2R9W A;  3Q07 A;  4GOG A;  4S2M A;  3VOZ A;  2Y2N A;  3PAE A;  4OLG A;  1GHM A;  2I72 A;  3FKW A;  5AQ9 A;  3S1Y A;  1HVB A;  3W4P A;  3ISG A;  4R0Q A;  3MXR A;  3LEZ A;  5GHZ A;  1KE4 A;  1FSW A;  3WS2 A;  3BM6 A;  1CI8 A;  1YMX A;  4L0L A;  3LY3 A;  1ESI A;  1QME A;  3TSG A;  4WZ4 A;  4DE2 A;  4K0X A;  5KMW A;  1K57 C;  2HP5 A;  3CMZ A;  4R23 A;  1PZO A;  2OSU A;  4MNR A;  3ZNY A;  3A3I A;  5CTN A;  4QY5 A;  3HLE A;  2HPB A;  4JF6 A;  3BFD A;  2JC7 A;  3IF6 A;  5CGW A;  5TGF A;  1FCO A;  3NC8 A;  4P6B A;  1JVJ A;  1VM1 A;  1LHY A;  2JCH A;  2XFS A;  4KG5 A;  1YMS A;  4EV4 A;  1BT5 A;  3GV9 A;  3QHY A;  1E3U D;  1MWR A;  2WGV A;  3IXD A;  1PWG A;  3OPR A;  1PI4 A;  2IWB A;  3PBQ A;  2HDQ A;  5EVI C;  4F94 A;  1PIO A;  1PWD A;  2DRW A;  3BFF A;  2XDM A;  4ZJ3 A;  1MBL A;  4FH4 A;  4RYE A;  3O3V A;  1L0F A;  5HAQ A;  1LLB A;  4DXC A;  3Q1F A;  2JBF A;  2EXB A;  2HDU A;  2XR0 A;  2Z2M B;  2ZC3 B;  3N8L A;  1PWC A;  1BUE A;  1E25 A;  4U0T A;  1PZP A;  5EEC A;  5DF8 A;  4C6Y A;  5M19 A;  3Q82 A;  4X55 A;  1NYY A;  4KZA A;  2ZC4 B;  4FCF A;  4BD1 A;  2ZQD A;  3HRE A;  3MXS A;  1CK3 A;  1S0W A;  5GHY A;  1K55 C;  2QPN A;  3WRZ A;  1BUL A;  1IEL A;  2BLS A;  2QMI A;  3NIA A;  4WZ5 C;  4DDS A;  1LL5 A;  4IBR A;  5FAO A;  4WMC A;  2ZC6 B;  4OQ0 A;  1N9B A;  4LV0 A;  1ERQ A;  4IED A;  1XPB A;  4XUX A;  3IQA A;  4DE0 A;  3G35 A;  4R4S A;  1VQQ A;  3ZNT A;  3PBS A;  2ZM0 A;  2P74 A;  4OP5 A;  1XA1 A;  2PBY A;  5FI6 A;  3WRT A;  3ZG0 A;  1L0G A;  4KEN B;  4WYY A;  4JXS A;  5EPH A;  3UO9 A;  1IYP A;  2VGJ A;  3SH9 A;  4PM5 A;  4OOY A;  1JWZ A;  1YLP A;  3UNW A;  4PM8 A;  4BJP A;  1ZKJ A;  3W4O A;  3HLD A;  4FH2 A;  3ZCZ A;  4JLF A;  1XGJ A;  3V39 A;  4S2P A;  1EI5 A;  1Y54 A;  1I2W A;  4GN2 A;  4LEN A;  4B4Z A;  5CEB A;  4OOM A;  1WYC A;  3C4P A;  3SH7 A;  3SH8 A;  2A49 A;  3IWQ A;  5CXW A;  4PMA A;  4CPK A;  2Y2G A;  1CEG A;  1K56 D;  2Y2J A;  3FZC A;  3BFE A;  3IWI A;  3ZFZ A;  1S6R A;  4DDY A;  1IYQ A;  3JYI A;  5EOO A;  2WUQ A;  1G68 A;  2C6W B;  3G30 A;  4KZ9 A;  3HLB A;  4HEF A;  4RA7 A;  5KZH A;  1CEF A;  4KZ3 A;  1YLW A;  3ITA A;  4DXB A;  1KGE A;  4E3K A;  3VSL A;  3O88 A;  2H0T A;  3Q7V A;  1YT4 A;  2XD5 A;  2J9P A;  3HUN A;  3N6I A;  1PW1 A;  2WAE A;  4LV2 A;  4UA6 A;  1M6K A;  4WEK A;  5E2G A;  3HLF A;  3ZVT A;  3GSG A;  2J8Y A;  2WGW A;  1NZU A;  2IWD A;  4PPR A;  4DE1 A;  5FQK A;  5EOE A;  4OH0 A;  3UPP A;  4JPM A;  1YLZ A;  3NI9 A;  1ES5 A;  4C75 A;  1IYS A;  5BOH A;  2J9O A;  2Y2I A;  3IXH A;  4KZ8 A;  4KZB A;  1PW8 A;  4QD4 A;  1DY6 A;  3ZDJ A;  1FR1 A;  1PYY A;  4EBN A;  1DJC A;  2ZM8 A;  4FSF A;  5F82 A;  3WWX A;  5I94 A;  3OZH A;  3HVF A;  3IXB A;  1N4O A;  3V50 A;  1Q2Q A;  3FV7 A;  4GD6 A;  5CRF A;  1FQG A;  1DJB A;  2Z2L B;  3HUM A;  1KE0 A;  4ID4 A;  2XD1 A;  2Y2L A;  1TDG A;  3DWK A;  2UWX A;  5TFQ A;  4KZ7 A;  1RGZ A;  2EX2 A;  2PU2 A;  3W8K A;  4EQI A;  5J8X A;  3UE1 A;  2WAD A;  4XXR A;  5FQM A;  4Z9Q A;  2ZC7 A;  2V2F F;  1HD8 A;  5JYP A;  1SHV A;  2RCX A;  3ITB A;  1FOF A;  3VP3 A;  5U47 A;  4DRT A;  3I7J A;  2ZQ7 A;  2DNS A;  3Q7Z A;  5DTT A;  3OPL A;  3S4X A;  4JXV A;  5FAT A;  2HDS A;  2X71 A;  1WE4 A;  3V3S A;  3GTC A;  2DCF A;  3OPP A;  3MZE A;  5FSR A;  3CZD A;  3GQZ A;  4R3J A;  3DW0 A;  4N9K A;  5EUA A;  1XX2 A;  4GD8 A;  2G2W A;  4GB7 A;  5FAS A;  1NY0 A;  4E6W A;  1YLT A;  1L0D A;  4K0W A;  1KVL A;  4M3K A;  3C7V A;  1H5X A;  4N9L A;  2BG1 A;  4UAA A;  3G32 A;  3QNC A;  5DF7 A;  3MZD A;  2ZD8 A;  3PBT A;  4UA9 A;  4BD0 A;  3G2Z A;  5HW3 A;  3OCL A;  3BEC A;  2HDR A;  4LV1 A;  4MBK A;  4PM7 A;  5CHU A;  4ZJ2 A;  3WS4 A;  4PM6 A;  3IF6 B;  4LCM A;  5A90 A;  5DTS A;  4MLL A;  3BEB A;  2EX9 A;  4OKP A;  3M6H A;  3AGE A;  4LV3 A;  5E2H A;  3M2J A;  1ONG A;  2FFF B;  2Y2H A;  5A91 A;  2P9V A;  2HP9 A;  1K54 A;  2RL3 A;  1ES2 A;  4OOL A;  3ZG7 B;  4EBP A;  5GLA A;  3HLG A;  3RXX A;  4E6X A;  4OPY A;  1IYO A;  3BLM A;  4N1H A;  4RX3 A;  3UPN A;  3MZF A;  3PBO A;  1IKI A;  5FQI A;  3DWZ A;  2Q9N A;  3C5A A;  5FAQ A;  2OLU A;  5FAP A;  1MPL A;  3GRJ A;  1L2S A;  1NXY A;  3AGD A;  2ZQA A;  1KVM A;  4Y0U A;  1BSG A;  5M1A A;  2XLN A;  2R9X A;  4S2K A;  4OQG A;  2XF3 A;  5GHX A;  2WKI A;  1IKG A;  4X6T A;  5CHJ A;  3WS0 A;  2ZMA A;  3A3J A;  5EVL A;  4Y7P A;  4OON A;  5D3O A;  3D4F A;  1K56 A;  3G4P A;  4EBL A;  4WBG A;  5CTM A;  3HUO A;  4ZTK A;  4OVD A;  1Z6F A;  3IF6 C;  3UPO A;  4WMC D;  1HTZ A;  5HL1 A;  2Y59 A;  1C3B A;  4JBF A;  3PBN A;  3EQV A;  4D2O A;  1E4D A;  2HP6 A;  1MXO A;  2G2U A;  4QJG A;  3GR2 A;  2ZQC A;  1SDE A;  3BLS A;  3N4I A;  1NYM A;  4JF4 A;  5FQJ A;  5HX9 A;  2VGK A;  4JF5 A;  2GDN A;  4Y0O A;  3SS5 A;  3N7W A;  1AXB A;  4KQQ A;  4YIN A;  5M18 A;  3NCK A;  4OQI A;  1O07 A;  3IT9 A;  4N1X A;  3HL9 A;  5F1G A;  3SS4 A;  4S2I A;  4PM9 A;  2EX8 A;  3VSK A;  2CC1 A;  1NRF A;  2WZX A;  5CGS A;  3V3R A;  3ZHH A;  1FSY A;  3PBR A;  1W7F A;  1XP4 A;  2XH9 A;  1BTL A;  3G2Y A;  4IVK A;  3G31 A;  3A3F A;  1BLC A;  4NET A;  1HZO A;  4S2O A;  4K91 A;  4OLD A;  3UY6 A;  3VP4 A;  1K54 C;  4IVI A;  4R3B A;  5EVI A;  3QNB A;  4FD8 A;  2J7V A;  1JWP A;  1K25 A;  3HBR A;  5DVA A;  1CI9 A;  3NDG A;  4YFM A;  4B4X A;  2XEP A;  2WK0 A;  4ZJ1 A;  4HBT A;  4X68 A;  5DF9 A;  1Q2P A;  3LO7 A;  3IF5 A;  2XGN A;  4GNU A;  4KQR A;  5CED A;  4DF6 A;  3CG5 A;  3WS5 A;  1O7E A;  5E43 A;  1FR6 A;  1ZG4 A;  3WS1 A;  3Q7V B;  1W8Y A;  2OLV A;  3ZVW A;  3VOY A;  4P85 A;  4C3Q A;  1PI5 A;  2X02 A;  2Y2Q A;  1GA9 A;  5HFO A;  1K55 A;  1MWU A;  2WAF A;  4JKT A;  4E3J A;  2Y2K A;  2EXA A;  2WGW B;  3A3E A;  3PTE A;  4E3O A;  2EFU A;  4OQH A;  4R4R A;  4WZ5 A;  2Y2O A;  1RP5 A;  1FCN A;  3PAG A;  4RX2 A;  4KQO A;  1KGF A;  2B5R A;  3N8R A;  4DKI A;  1MKI A;  4R1G A;  2OV5 A;  2C5W B;  1E3U A;  3TG9 A;  3V5M A;  4KG6 A;  4EWF A;  5F83 A;  4H8R A;  4QHC A;  4ZDX A;  4S2J A;  3NBL A;  4U3T A;  5L2F A;  2Y2M A;  1W79 A;  3MFD A;  3OCN A;  5G18 A;  3IH8 A;  5FQQ A;  3OC2 A;  1JTD A;  1H8Y A;  1JTG A;  3UDF A;  3SOI A;  1ZC2 A;  3TOI A;  3FWL A;  3HLC A;  4MBH A;  1YQS A;  1TVF A;  1LI0 A;  5CHM A;  1EWZ A;  4QB8 A;  4ZBE A;  1K38 A;  3IHA A;  2WZZ A;  1GA0 A;  3OPH A;  5FDH A;  4B88 A;  1ES3 A;  2V1Z A;  1BLH A;  4GDN A;  4A5R A;  1SDN A;  3VFH A;  3UDI A;  2WKH A;  1TEM A;  3BFG A;  3LCE A;  3B3X A;  5A93 A;  1KE3 A;  3E2L A;  1GHP A;  3LY4 A;  3CJM A;  2ZJ9 A;  3DTM A;  3S22 A;  4JXG A;  1IEM A;  5A92 A;  3IXG A;  1BZA A;  1K4E A;  2FFY A;  2WYX A;  2Q9M A;  2ZC5 B;  4U0X A;  4O7D A;  4E3I A;  4BLM A;  2E8I A;  2A3U A;  2Y55 A;  1KDW A;  3EQU A;  3P09 A;  1FCM A;  1KGG A;  4S2N A;  5HAI A;  3SS3 A;  3VP1 A;  1ERO A;  2XFT A;  4JXW A;  1MWS A;  5GLC A;  4HBU A;  1I2S A;  3ZG5 A;  3Q81 A;  3BRM A;  1BLS A;  1TDL A;  2WGI A;  1RCJ A;  3FYZ A;  4KZ4 A;  5IHV A;  4BL2 A;  4IBX A;  4Q8I A;  2QZ6 A;  4HES A;  5DTK A;  5E2F A;  5AQ7 A;  2XK1 A;  4E3L A;  3UN7 A;  3ZGA B;  3VP0 A;  2P9V B;  4CJN A;  3IH9 A;  4P87 A;  1K4F A;  1ONH A;  4QY6 A;  3GMW A;  1XGI A;  4UA7 A;  2ZM2 A;  1KDS A;  3IWO A;  1ERM A;  1YLJ A;  1MWT A;  3NY4 A;  4GKU A;  4KZ5 A;  4OPR A;  3ZG8 B;  1BLP A;  4NK3 A;  1LI9 A;  4LCL A;  3RJU A;  4BQM A;  4QU3 A;  1W8Q A;  4X53 A;  4GZB A;  2JE5 A;  5GL9 A;  3UE0 A;  1GHI A;  1J9M A;  1XA7 A;  1H8Z A;  5KSC A;  3UDX A;  4X69 A;  3VMA A;  1I5Q A;  4MBF A;  4EUZ A;  3M6B A;  3O86 A;  4E3M A;  4P0M A;  3O87 A;  5CGX A;  5FI7 A;  1OME A;  5GLD A;  1K57 A;  1K6R A;  2H5S A;  3AGF A;  4XUZ A;  3BYD A;  5FI2 A;  2X01 A;  4KG2 A;  3VP2 A;  3NDE A;  5JYO A;  1WYB A;  1JWV A;  5F1F A;  5E2E A;  4S2L A;  1K6S A;  4WEL A;  1MY8 A;  2XQZ A;  1L0E A;  3IHB A;  3UE3 A;  4X56 A;  5CER A;  4Y0T A;  2PU4 A;  4OPZ A;  2IWC A;  5HAP A;  2Y91 A;  1YM1 A;  2WKE A;  5HAR A;  3MKF A;  1SCW A;  5FA7 A;  1DJA A;  3BFC A;  5GLB A;  1XKZ A;  1ES4 A;  4S2N C;  5FQ9 A;  3MBZ A;  4ZAM A;  1G6A A;  4N92 A;  4BL3 A;  4WEJ A;  3C4O A;  4DE3 A;  2ZQ9 A;  2EX6 A;  3HLW A;  3ZG9 B;  2H10 A;  4KZ6 A;  2V20 A;  3M2K A;  3N8S A;  1NZO A;  3GVB A;  2Y2P A;  1GCE A;  5TR7 A;  5CEC A;  1QMF A;  4OPQ A;  5KSH A;  1RGY A;  4RVA A;  2Y4A A;  3P98 A;  2ZLY A;  1ALQ A;  1U60 A;  4OP8 A;  2EFX A;  5AQB A;  1ESU A;  4E3N A;  3G34 A;  4BEN A;  4UHU A;  5EVI B;  4WM9 A;  3FKV A;  1NJ4 A;  4MEZ A;  2ZQ8 A;  3RXW A;  5EE8 A;  1YLY A;  3VFF A;  4GDB A;  3W4Q A; 
#chains in the Genus database with same CATH topology
 1M40 A;  3S7P A;  3E2K A;  1SKF A;  4S2M A;  1ZG6 A;  1XXM A;  2Y2N A;  3RH8 B;  5HD3 A;  3S1Y A;  1HVB A;  3W4P A;  3ISG A;  4R0Q A;  3LEZ A;  5GHZ A;  1KE4 A;  4IHQ A;  3BM6 A;  4DE2 A;  4WZ4 A;  3CMZ A;  4PKY A;  4R23 A;  3ZNY A;  5L09 A;  1OPX A;  2W3G A;  5CGW A;  3BFD A;  2D01 A;  3IF6 A;  5HL6 A;  1VET B;  4UQI S;  2XFS A;  4KG5 A;  1A0K A;  1BT5 A;  2WGV A;  2W3D A;  1HLU P;  3PBQ A;  3HCY A;  3BFF A;  4GW9 A;  1MBL A;  3O3V A;  1L0F A;  1LLB A;  2B02 A;  3S7Q A;  3Q1F A;  2E8J A;  3N8L A;  2VGL M;  5DF8 A;  1NYY A;  2PRF A;  4BD1 A;  1G5U A;  3T1R A;  5DKL A;  2GNX A;  3PR6 A;  2V8C A;  4R4S A;  1DP6 A;  1VQQ A;  3PBS A;  4OP5 A;  5FI6 A;  1OTE A;  3ZG0 A;  2QKP A;  4WYY A;  4JXS A;  5EPH A;  2VGJ A;  1JWZ A;  2V0U A;  3E4O A;  4PM8 A;  4FH2 A;  4JLF A;  5CEB A;  2AVX A;  3SH7 A;  4MMN A;  4PMA A;  3ICY A;  1J3W A;  4EQ1 A;  4PAU A;  4DDY A;  2ZOI A;  3G30 A;  3S7O A;  5KZH A;  1ZTU A;  3ZQ5 A;  4L9E A;  1D06 A;  3O88 A;  4MN7 A;  1OTD A;  3K3D A;  3N6I A;  1M6K A;  5DJU A;  2IWD A;  5FQK A;  5AVF A;  4JPM A;  1ES5 A;  1XFQ A;  3ZDJ A;  4XT2 B;  1FR1 A;  4HQA A;  2NUP C;  4JGP A;  5C5K A;  4P6Z M;  1N4O A;  1Q2Q A;  4GD6 A;  3HUM A;  4ID4 A;  4IUK A;  2XD1 A;  2HJ9 C;  2Y2L A;  2VV6 A;  4KZ7 A;  1LSX A;  2GX5 A;  3MF0 A;  3W8K A;  2CMN A;  4EQI A;  2WAD A;  3KYQ A;  1HD8 A;  2RCX A;  1FOF A;  3VP3 A;  3S4X A;  3OPL A;  3G6O A;  3CUE A;  4Y5F A;  1WE4 A;  4KUO A;  2A24 A;  3UMD A;  4N9K A;  2V1B A;  4GB7 A;  4UQI M;  3C7V A;  4BD0 A;  4PM7 A;  4ZJ2 A;  3WS4 A;  4I3J A;  3PYP A;  5DTS A;  1V9Y A;  2EX9 A;  4LLO B;  1OT6 A;  3M6H A;  3AGE A;  5E2H A;  1ONG A;  2FFF B;  5A91 A;  2B95 A;  1YPR A;  5MC7 A;  4OOL A;  3ZG7 B;  4Q0H A;  5EM0 A;  4F3L B;  3SW1 A;  4OPY A;  3UPN A;  3MZF A;  5FQI A;  5G4Z A;  3GRJ A;  2P04 A;  1KVM A;  1BSG A;  5L07 A;  3VE3 A;  4LGW A;  4NXG A;  5I5L A;  5L10 A;  2WKI A;  3R7W A;  1GSW A;  4Y7P A;  4NXE A;  5D3O A;  3HUO A;  5KIZ A;  4RQ9 A;  3CUE C;  4WMC D;  2Y59 A;  3PBN A;  2G2U A;  5HZH A;  4HJ6 A;  2ZQC A;  4HY8 A;  3QP4 A;  1NYM A;  5HX9 A;  4Y0O A;  3T50 A;  4KQQ A;  4B93 A;  3SS4 A;  2K2N A;  5CGS A;  1TS8 A;  1EW0 A;  1H0M A;  4IVK A;  4NET A;  3A0S A;  3UY6 A;  2OWH A;  4IVI A;  2VV8 A;  3QNB A;  4FD8 A;  2J7V A;  1K25 A;  3TRC A;  4B4X A;  2XEP A;  2WK0 A;  4HBT A;  2XGN A;  3EGD C;  2J3T C;  3ZVW A;  4P85 A;  1PI5 A;  2PDR A;  2QYB A;  1GA9 A;  5HFO A;  1K55 A;  1MWU A;  4R4R A;  4ETZ A;  4WZ5 A;  1RP5 A;  5EM1 A;  3LIE A;  2M7U A;  2JKF A;  1MC0 A;  2VZW A;  2J80 A;  3VOL A;  5HWV A;  1MKI A;  3TG9 A;  1VET A;  5F69 A;  5F83 A;  4D60 A;  3BQ8 A;  4S2J A;  2W1R A;  3NBL A;  2Y2M A;  1JTG A;  3UDF A;  1K0K A;  1ZC2 A;  3JVV A;  5EFW A;  3HLC A;  5CHM A;  5J7E A;  3IHA A;  5FDH A;  4B88 A;  2V1Z A;  4KQD A;  3UDI A;  1G6O A;  5A93 A;  1KE3 A;  4LRX C;  3DTM A;  3IXG A;  1BZA A;  1DP8 A;  2ZC5 B;  4E3I A;  4FUW A;  3L9K A;  1CF0 A;  1SKO B;  4AFI A;  1MWS A;  4HBU A;  3ZG5 A;  4WUJ A;  4Q8I A;  2QZ6 A;  4HES A;  2XK1 A;  3VP0 A;  2P9V B;  2B18 A;  1KOU A;  1MWT A;  4GKU A;  4GLQ A;  4LFU A;  4NK3 A;  1LI9 A;  3FPW A;  1J9M A;  4R70 A;  4X69 A;  1I5Q A;  4EUZ A;  1Y28 A;  2XRO A;  4O0P A;  4P0M A;  5FL3 A;  1K6R A;  2H5S A;  3BYD A;  1D7E A;  4KG2 A;  3QP8 A;  2ZMF A;  4WEL A;  2XQZ A;  3F1P B;  4G3V A;  1YM1 A;  3LI8 A;  1TD5 A;  1W63 Q;  1H8M A;  5HDD A;  4XT2 A;  1ES4 A;  3MBZ A;  1G6A A;  4N92 A;  1CQA A;  4WEJ A;  2ZQ9 A;  2OOL A;  5KSH A;  3UB6 A;  4RVA A;  4EES A;  2ZLY A;  1ODV A;  2O99 A;  2EFX A;  4E3N A;  2ZMV A;  5EVI B;  5EE8 A;  4E04 A;  2VKS A;  4EU0 A;  3W4Q A;  4X1L A;  3C7U A;  5EVI D;  1P0Z A;  5AQA A;  3MKE A;  3Q07 A;  4Z1W A;  3FKW A;  1PRQ A;  3U4L P;  1MZU A;  3WS2 A;  3TSG A;  1YMX A;  4L0L A;  3OLO A;  5KMW A;  2WKP A;  3T4L A;  2V9A A;  3CIT A;  4JF6 A;  2HPB A;  2XSS A;  5TGF A;  2WKR A;  4P6B A;  3A0V A;  1VHM A;  1E3U D;  1MWR A;  1CJF A;  3IXD A;  3OPR A;  5F6A A;  3C38 A;  4BBU A;  4F3L A;  2XDM A;  5HAQ A;  4NKP A;  2GJ3 A;  2HDU A;  2ZC3 B;  1PWC A;  4C6Y A;  4X55 A;  4FCF A;  3MXS A;  3T4Q A;  1BUL A;  2BLS A;  3NIA A;  4DDS A;  4IBR A;  4WMC A;  2V0W A;  3BQA A;  4XUX A;  3IQA A;  3C8C A;  1P9R A;  4EER A;  2ZM0 A;  1XA1 A;  3MJQ A;  3CHW P;  4PM5 A;  1YLP A;  4EEP A;  1ZKJ A;  1XJ2 A;  1XGJ A;  3V39 A;  4S2P A;  3SZT A;  3U2A A;  3CPT B;  3SH8 A;  3VE4 A;  2A49 A;  4CPK A;  5A8B A;  2KOI A;  3FZC A;  3ZFZ A;  3EEA A;  1IOU A;  2WUQ A;  1G68 A;  4KZ9 A;  3HLB A;  2BAS A;  1CEF A;  3O5Y A;  3B47 A;  2ZL1 B;  3DTK A;  4DXB A;  5HDC A;  2H0T A;  3HUN A;  4LV2 A;  3KSI A;  3GSG A;  2ZOH A;  4PPR A;  1OTA A;  1YLZ A;  2Y2I A;  3IXH A;  4KZB A;  1PW8 A;  1DY6 A;  4Q0J A;  4EBN A;  1DJC A;  4FSF A;  3WWX A;  5I94 A;  3OZH A;  3HVF A;  3DBA A;  3V50 A;  3FV7 A;  3KSH A;  1FQG A;  1DJB A;  1T1C A;  2Z2L B;  2PYR A;  5TFQ A;  5J8X A;  3UE1 A;  4XXR A;  5FQM A;  4Z9Q A;  2V2F F;  3ITB A;  2W0N A;  3I7J A;  3MQO A;  1PFL A;  2DNS A;  3MR0 A;  5FAT A;  4I38 A;  1FIK A;  3GQZ A;  4R3J A;  4HIA A;  4GD8 A;  2G2W A;  4K0W A;  1KVL A;  3DTE A;  4M3K A;  3LIF A;  2BG1 A;  1SKO A;  5HW3 A;  3OCL A;  3BEC A;  3MMH A;  5CHU A;  4PM6 A;  4LCM A;  3BEB A;  3T4O A;  2HF6 A;  4OKP A;  4LV3 A;  3M2J A;  2Y2H A;  4CLC B;  1V9Z A;  2P9V A;  2O9C A;  5HPF A;  5GLA A;  3HLG A;  3RXX A;  4G3K A;  4CLC D;  3E0Y A;  3BLM A;  4RX3 A;  4BBV A;  3C5A A;  5FAP A;  1L2S A;  1NXY A;  2XLN A;  3NUL A;  2R9X A;  4S2K A;  4WN5 A;  4OQG A;  2XF3 A;  4R3A A;  2I9V A;  3A3J A;  1XJ3 A;  3D4F A;  4HJ3 A;  3IF6 C;  3UPO A;  3TE8 A;  1XJ4 A;  3F1P A;  1C3B A;  2R78 A;  4JBF A;  3F1O B;  4M4X A;  2HP6 A;  4QJG A;  1F9I A;  4DN0 A;  2JKR M;  3BLS A;  3N4I A;  5FQJ A;  1AXB A;  2LB9 A;  4YIN A;  5M18 A;  1O07 A;  2Y79 A;  3V3R A;  1FSY A;  3G2Y A;  3UME A;  1BLC A;  1HZO A;  4S2O A;  3ULF A;  3NOU C;  2JKR I;  4R3B A;  4I3I A;  5EVI A;  2XRN A;  1H3Q A;  4FOF A;  1CI9 A;  5DVA A;  2QJ5 A;  3K3C A;  4ZJ1 A;  4X68 A;  5DF9 A;  1Q2P A;  4KQR A;  5CED A;  4DF6 A;  1S66 L;  1FR6 A;  3Q7V B;  1W8Y A;  3E4Q A;  4C3Q A;  2Y2Q A;  4JKT A;  2Y2K A;  3EEH A;  4OQH A;  2Y2O A;  3LR0 A;  3N8R A;  3C30 A;  4IUH A;  3NOP C;  4R1G A;  1E3U A;  4EWF A;  1W63 M;  5L2F A;  1W79 A;  3MFD A;  3IH8 A;  5FQQ A;  1JTD A;  1LSW A;  1H8Y A;  3TW8 A;  3TOI A;  3FWL A;  1YQS A;  4ZBE A;  4QB8 A;  1K38 A;  4ARZ B;  2WZZ A;  1BLH A;  1SDN A;  3C2W A;  1STZ A;  2WYX A;  2FFY A;  4U0X A;  3LGO A;  4BLM A;  2A3U A;  2K31 A;  4ETX A;  3P09 A;  3SS3 A;  5HAI A;  1ACF A;  1BLS A;  2WGI A;  3EOI A;  4KZ4 A;  4BL2 A;  1VEU B;  5DTK A;  3UB8 A;  2O9A A;  4ME4 A;  4E3L A;  3LI9 A;  4CJN A;  1F5M A;  1K4F A;  3GMW A;  1XGI A;  3QP5 A;  2ZM2 A;  3IWO A;  5EV0 A;  2P08 A;  4OPR A;  4NG2 A;  3CPT A;  1BLP A;  4LCL A;  4BQM A;  4GZB A;  2JE5 A;  4DJ3 A;  1IFQ A;  3IBJ A;  4L9G A;  1XA7 A;  1H8Z A;  5KSC A;  3M6B A;  1OJG A;  3O87 A;  4BMW A;  2ZL1 A;  1TS6 A;  4XUZ A;  5FI2 A;  1TS0 A;  1T1B A;  4EEU A;  1WYB A;  1JWV A;  5F1F A;  1T18 A;  1K6S A;  1MY8 A;  3IHB A;  3UE3 A;  5CER A;  3BY9 A;  3CWF A;  2UV0 E;  2WKE A;  4NXB A;  4FTX A;  1SCW A;  2KX6 A;  5GLB A;  3CLO A;  5FQ9 A;  4ZAM A;  4DE3 A;  3T1Q B;  2EX6 A;  2JKT I;  3GDI A;  1S67 L;  1GCE A;  2PR5 A;  5CEC A;  4OPQ A;  1RGY A;  3P98 A;  4UEY A;  4OP8 A;  1ESU A;  4BEN A;  2KLI A;  3RXW A;  1YLY A;  3VFF A;  1VB6 A;  1LL9 A;  3A3D A;  2H0Y A;  4MN6 A;  4GOG A;  4OLG A;  2I72 A;  3T4K A;  3MXR A;  1FSW A;  3H82 B;  5G4Y A;  5K5B A;  3LY3 A;  4K0X A;  2M1C A;  1PZO A;  3LYX A;  3A3I A;  4LRY C;  3MXQ A;  2JC7 A;  1FCO A;  4PHT A;  1JVJ A;  2K7S A;  1LHY A;  1YMS A;  4CLC A;  4Q0I A;  4EV4 A;  2L0W A;  1PI4 A;  2DRW A;  4O8G A;  3QP1 A;  4LRZ E;  1D1J A;  2JBF A;  2Z2M B;  1BUE A;  3Q82 A;  2LB5 A;  2ZQD A;  3HRE A;  5DFX A;  1S0W A;  1K55 C;  2O9B A;  3PHY A;  3WRZ A;  1IEL A;  3V67 A;  4WZ5 C;  1GSV A;  5FAO A;  4MCW A;  2L4R A;  1TF1 A;  1S1Y A;  2ZC6 B;  4OQ0 A;  5HPI A;  1XPB A;  2VA0 A;  3NJA A;  4NXF A;  3ZNT A;  3F1O A;  1P97 A;  4KEN B;  1L0G A;  4HJ4 A;  5IU1 A;  3UO9 A;  3B42 A;  4OOY A;  3GEC A;  2VX8 A;  3HLD A;  3ZCZ A;  1EI5 A;  1Y54 A;  3BJN A;  4QPR A;  1WYC A;  2VEA A;  3P7N A;  1XFN A;  2Y2G A;  2Y2J A;  3IWI A;  4CLC C;  1S6R A;  5EOO A;  2C6W B;  5CX7 A;  1YLW A;  3RFB A;  3R4K A;  1KGE A;  4IJG A;  3QP6 A;  3S7N A;  3Q7V A;  1YT4 A;  1LL8 A;  2J9P A;  2WAE A;  4WEK A;  5E2G A;  3HLF A;  3ZVT A;  2J8Y A;  1YKD A;  1OJ5 A;  4NEE D;  4DE1 A;  2MJ6 A;  5EOE A;  3UPP A;  2EWV A;  3NI9 A;  4C75 A;  1IYS A;  5L8M A;  3KSG A;  4WF0 A;  2W3F A;  3L7H A;  1PYY A;  3LR4 A;  2ZM8 A;  4GHI B;  3EGX C;  5F82 A;  3IXB A;  2W1T B;  2EA9 A;  3KX0 X;  1NWZ A;  1TDG A;  3DWK A;  1RGZ A;  5IS1 A;  2PU2 A;  4ARZ A;  2ZC7 A;  5JYP A;  2ZQ7 A;  3Q7Z A;  5DTT A;  2HDS A;  2X71 A;  3V3S A;  3GTC A;  3OPP A;  5FSR A;  3CZD A;  3DW0 A;  3MQQ A;  5EUA A;  1S4S A;  4E6W A;  3IBR A;  3LIA A;  3FG8 A;  1LSV A;  1H5X A;  4UAA A;  1G28 A;  4R6L A;  2HDR A;  4LV1 A;  4MBK A;  1PNE A;  4MLL A;  1VEU A;  2HGV A;  1K54 A;  4EBP A;  3P01 A;  1IYO A;  1TS7 A;  3PBO A;  1IKI A;  1MPL A;  2VJW A;  4Y0U A;  2HV1 A;  4LPZ A;  3D72 A;  4X6T A;  3UB5 P;  2OWJ A;  3WS0 A;  2ZMA A;  2PD8 A;  4Y2F A;  3DTI A;  1K56 A;  5CTM A;  2PBD P;  3MS6 A;  5HL1 A;  1YSP A;  3EQV A;  5DKK A;  1MXO A;  4PKY G;  3GR2 A;  3D3O A;  4GCZ A;  4JF4 A;  2VGK A;  4JF5 A;  3SS5 A;  1OTB A;  4N1X A;  4DMZ A;  4Y17 A;  4S2I A;  4PM9 A;  3VSK A;  2CC1 A;  2D02 A;  3W2Z A;  3PBR A;  2INW A;  1W7F A;  3H7W B;  3T4J A;  2XH9 A;  1T1A A;  3A3F A;  4HI4 A;  4K91 A;  2JN7 A;  2GZA A;  4OLD A;  1K54 C;  3VP4 A;  4MN5 A;  3HBR A;  2Q0O A;  3NDG A;  4YFM A;  2YKH A;  2VK3 A;  4GNU A;  1O7E A;  1ZG4 A;  3WS1 A;  2OLV A;  3VOY A;  1UGU A;  1GSX A;  3TJZ C;  3H82 A;  4E3J A;  2WAF A;  2WGW B;  4E3O A;  1DP9 A;  2XA7 S;  1FCN A;  4HH3 A;  2Z6C A;  1KGF A;  2B5R A;  3OOV A;  4DKI A;  3IS2 B;  4KG6 A;  3DAV A;  4H8R A;  4QHC A;  4ZDX A;  5DFY A;  3OC2 A;  3HJK A;  2L1M A;  4DJ2 A;  2FH5 A;  1TVF A;  4Y13 A;  1GA0 A;  3OPH A;  1ES3 A;  2WKH A;  3BFG A;  3T4T A;  2PR6 A;  2V1A A;  3B3X A;  3LCE A;  3E2L A;  2ZJ9 A;  2PHY A;  3S22 A;  1IEM A;  5A92 A;  4CQH A;  4O7D A;  3T1S A;  2Y55 A;  1KDW A;  3EQU A;  4S2N A;  1FCM A;  1ERO A;  5GLC A;  1I2S A;  3Q81 A;  1TDL A;  1RCJ A;  3FYZ A;  5IHV A;  4IBX A;  1X0O A;  3ZGA B;  1OT9 A;  1NLY A;  3IH9 A;  4QY6 A;  4JGQ A;  4UA7 A;  1ERM A;  4KZ5 A;  3ZG8 B;  3RJU A;  3QP2 A;  3UDX A;  3VMA A;  4MBF A;  1YAX A;  4E3M A;  5CGX A;  4HH2 A;  5FI7 A;  1K57 A;  3AGF A;  5JYO A;  3NDE A;  3BWL A;  4S2L A;  3FPV A;  1L0E A;  4X25 A;  4EW7 A;  4X56 A;  5HAP A;  2Y91 A;  5HAR A;  3MKF A;  2IA2 A;  5FA7 A;  3BFC A;  1XKZ A;  4S2N C;  4GHI A;  4BL3 A;  4X1M A;  3ZG9 B;  2H10 A;  5HDS A;  4YNR A;  5HWW A;  3D9Y A;  1DRM A;  2W1T A;  4HOI A;  5TR7 A;  1Z09 A;  5TBM B;  4HP4 A;  4EXO A;  2PYP A;  3G34 A;  3LID A;  3LIC A;  3T4S A;  4MEZ A;  2VV7 A;  1L3L A;  2XA7 M;  3KYZ A;  1NLZ A;  1W5D A;  3VOZ A;  2R9W A;  3PAE A;  1GHM A;  4WLA A;  5AQ9 A;  4GS9 B;  4HP9 A;  3T12 B;  4Y15 A;  5F68 A;  4MDZ A;  1CI8 A;  1ESI A;  1QME A;  3OBF A;  3KO6 A;  1K57 C;  2HP5 A;  4ZRR A;  2OSU A;  4MNR A;  5EVE A;  5CTN A;  4QY5 A;  3HLE A;  3NC8 A;  1S1Z A;  1VM1 A;  2JCH A;  4I39 A;  2W3E A;  3GV9 A;  3QHY A;  1PWG A;  2IWB A;  2ZBB A;  4F94 A;  2HDQ A;  5EVI C;  1PIO A;  1PWD A;  4ZJ3 A;  4FH4 A;  4RYE A;  4DXC A;  2EXB A;  2XR0 A;  1E25 A;  4U0T A;  1PZP A;  3T1X A;  5EEC A;  5M19 A;  4KZA A;  5J4E A;  2ZC4 B;  1CK3 A;  2PT7 A;  5GHY A;  4H6J B;  2QPN A;  2ACG A;  2QMI A;  2M7V A;  1LL5 A;  1P9W A;  1N9B A;  4LV0 A;  1ERQ A;  4IED A;  4K08 A;  5AJG A;  4DE0 A;  3G35 A;  3UE6 A;  4QWO A;  2P74 A;  2PBY A;  3F1N B;  3WRT A;  3LFV A;  4G3W A;  1IYP A;  2NUT C;  3SH9 A;  4HHD A;  3UNW A;  4BJP A;  3W4O A;  3IX8 A;  2HZ5 A;  4GN2 A;  4LEN A;  1I2W A;  4B4Z A;  4OOM A;  2JKT M;  3C4P A;  3H7W A;  3IWQ A;  5CXW A;  1CEG A;  1K56 D;  3BFE A;  2EWW A;  3MQ0 A;  1XJ6 A;  4JGO A;  2A2L A;  1IYQ A;  3JYI A;  4L9F A;  4HEF A;  4RA7 A;  4KZ3 A;  3ITA A;  4E3K A;  1JNU A;  3VSL A;  2XD5 A;  1PW1 A;  4UA6 A;  2WGW A;  1NZU A;  2O0Y A;  4OH0 A;  5BOH A;  1FIL A;  2J9O A;  5FEF A;  4KZ8 A;  4QD4 A;  3NHQ A;  3JVU A;  3IS2 A;  4YOF A;  5HWT A;  5CRF A;  1T19 A;  2V8F A;  1Y4O A;  2FZ0 A;  1KE0 A;  2UWX A;  2EX2 A;  1NRJ A;  2JHE A;  3RTY A;  1SHV A;  3NOT C;  5U47 A;  4DRT A;  2DMW A;  4JXV A;  2DCF A;  3MZE A;  4HNB A;  1XX2 A;  5FAS A;  1NY0 A;  1YLT A;  1L0D A;  3JPU A;  4N9L A;  1MKM A;  3G32 A;  3QNC A;  4I5S A;  3MZD A;  2ZD8 A;  3PBT A;  4UA9 A;  5DF7 A;  3G2Z A;  1UWN X;  3BW6 A;  3IX3 A;  3E98 A;  4WL9 A;  1F2K A;  3IF6 B;  2QHK A;  3MSH A;  5A90 A;  3K2N A;  3UB7 A;  1BYW A;  1N9O A;  3B33 A;  2HP9 A;  3ZYT A;  2RL3 A;  1AWI A;  1ES2 A;  2J3W A;  4JGR A;  4E6X A;  4N1H A;  3DWZ A;  2Q9N A;  2OLU A;  3E4P A;  1SZV A;  2P7J A;  3AGD A;  2ZQA A;  5M1A A;  3KYE A;  5FEG A;  1F98 A;  5GHX A;  1IKG A;  2Z6D A;  5CHJ A;  4ESP A;  5EVL A;  4OON A;  4EBL A;  3G4P A;  5IT5 A;  4WBG A;  1ZHH B;  4ZTK A;  4OVD A;  1Z6F A;  3LR5 A;  1HTZ A;  1UWP X;  1N9L A;  4D2O A;  1E4D A;  4B9O A;  5J3W A;  1LT0 A;  1SDE A;  2GDN A;  3N7W A;  3NCK A;  4OQI A;  3IT9 A;  3HL9 A;  5F1G A;  2EX8 A;  1NRF A;  2WZX A;  3ZHH A;  1XP4 A;  1BTL A;  3PXP A;  3G31 A;  5DJT A;  5TBM A;  2G7U A;  2YKF A;  4EET B;  1JWP A;  2OAP 1;  4Y3I A;  4KUK A;  2JKG A;  3LO7 A;  3IF5 A;  3CG5 A;  3WS5 A;  5E43 A;  3MFX A;  4GS9 A;  2X02 A;  5HSQ A;  2EXA A;  3PTE A;  3A3E A;  2EFU A;  4R38 A;  4EUV A;  3PAG A;  4RX2 A;  4KQO A;  4I3A A;  2OV5 A;  2C5W B;  3V5M A;  2QWS A;  3BY8 A;  4U3T A;  3OCN A;  5G18 A;  2VLG A;  3SOI A;  3FC7 A;  3UB9 A;  4MBH A;  1LI0 A;  1EWZ A;  2WKQ A;  3A0R A;  3EWK A;  4GDN A;  4A5R A;  3VFH A;  4BBT A;  1TEM A;  5AVE A;  2HJE A;  4H6J A;  1GHP A;  3LY4 A;  4CLC E;  3CJM A;  4II7 A;  4JXG A;  2A24 B;  2VGL S;  1K4E A;  2Q9M A;  3LR3 A;  2E8I A;  3LEQ A;  1KGG A;  3VP1 A;  2XFT A;  4JXW A;  3BRM A;  3F1N A;  5TJJ A;  5E2F A;  5AQ7 A;  1WA9 A;  3UN7 A;  2PD7 A;  3LUQ A;  3CI6 A;  4P87 A;  1ONH A;  3NEC A;  1YSQ A;  1KDS A;  1YLJ A;  3NY4 A;  1S4R A;  1W8Q A;  2QJ7 A;  4O01 A;  4QU3 A;  4X53 A;  3H9W A;  5GL9 A;  3UE0 A;  1GHI A;  4YWZ A;  2BTF P;  3HJI A;  2PAV P;  3O86 A;  4GJ4 A;  5FDS A;  3R7W B;  2J3T D;  1OME A;  5GLD A;  3LIB A;  2KDK A;  2X01 A;  3VP2 A;  5HD5 A;  5E2E A;  5LBR A;  3VV4 A;  3CAX A;  4Y0T A;  2PU4 A;  4OPZ A;  2IWC A;  3IX4 A;  1DJA A;  2Y8H A;  3KSF A;  4BWI A;  2W3H A;  3C4O A;  3HLW A;  4KZ6 A;  2V20 A;  3M2K A;  3N8S A;  1N9N A;  1NZO A;  3GVB A;  2Y2P A;  2OAQ 1;  1QMF A;  2Y4A A;  1ALQ A;  1U60 A;  5AQB A;  4UHU A;  2W27 A;  4P6Z S;  4WM9 A;  3FKV A;  1NJ4 A;  2H28 A;  1OTI A;  2ZQ8 A;  5FAQ A;  5F5Y A;  4GDB A; 
#chains in the Genus database with same CATH homology
 1LL9 A;  3C7U A;  5EVI D;  1M40 A;  3A3D A;  5AQA A;  1W5D A;  3E2K A;  1SKF A;  3MKE A;  2H0Y A;  1ZG6 A;  1XXM A;  2R9W A;  3Q07 A;  4GOG A;  4S2M A;  3VOZ A;  2Y2N A;  3PAE A;  4OLG A;  1GHM A;  2I72 A;  3FKW A;  5AQ9 A;  3S1Y A;  1HVB A;  3W4P A;  3ISG A;  4R0Q A;  3MXR A;  3LEZ A;  5GHZ A;  1KE4 A;  1FSW A;  3WS2 A;  3BM6 A;  1CI8 A;  1YMX A;  4L0L A;  3LY3 A;  1ESI A;  1QME A;  3TSG A;  4WZ4 A;  4DE2 A;  4K0X A;  5KMW A;  1K57 C;  2HP5 A;  3CMZ A;  4R23 A;  1PZO A;  2OSU A;  4MNR A;  3ZNY A;  3A3I A;  5CTN A;  4QY5 A;  3HLE A;  2HPB A;  4JF6 A;  3BFD A;  2JC7 A;  3IF6 A;  5CGW A;  5TGF A;  1FCO A;  3NC8 A;  4P6B A;  1JVJ A;  1VM1 A;  1LHY A;  2JCH A;  2XFS A;  4KG5 A;  1YMS A;  4EV4 A;  1BT5 A;  3GV9 A;  3QHY A;  1E3U D;  1MWR A;  2WGV A;  3IXD A;  1PWG A;  3OPR A;  1PI4 A;  2IWB A;  3PBQ A;  2HDQ A;  5EVI C;  4F94 A;  1PIO A;  1PWD A;  2DRW A;  3BFF A;  2XDM A;  4ZJ3 A;  1MBL A;  4FH4 A;  4RYE A;  3O3V A;  1L0F A;  5HAQ A;  1LLB A;  4DXC A;  3Q1F A;  2JBF A;  2EXB A;  2HDU A;  2XR0 A;  2Z2M B;  2ZC3 B;  3N8L A;  1PWC A;  1BUE A;  1E25 A;  4U0T A;  1PZP A;  5EEC A;  5DF8 A;  4C6Y A;  5M19 A;  3Q82 A;  4X55 A;  1NYY A;  4KZA A;  2ZC4 B;  4FCF A;  4BD1 A;  2ZQD A;  3HRE A;  3MXS A;  1CK3 A;  1S0W A;  5GHY A;  1K55 C;  2QPN A;  3WRZ A;  1BUL A;  1IEL A;  2BLS A;  2QMI A;  3NIA A;  4WZ5 C;  4DDS A;  1LL5 A;  4IBR A;  5FAO A;  4WMC A;  2ZC6 B;  4OQ0 A;  1N9B A;  4LV0 A;  1ERQ A;  4IED A;  1XPB A;  4XUX A;  3IQA A;  4DE0 A;  3G35 A;  4R4S A;  1VQQ A;  3ZNT A;  3PBS A;  2ZM0 A;  2P74 A;  4OP5 A;  1XA1 A;  2PBY A;  5FI6 A;  3WRT A;  3ZG0 A;  1L0G A;  4KEN B;  4WYY A;  4JXS A;  5EPH A;  3UO9 A;  1IYP A;  2VGJ A;  3SH9 A;  4PM5 A;  4OOY A;  1JWZ A;  1YLP A;  3UNW A;  4PM8 A;  4BJP A;  1ZKJ A;  3W4O A;  3HLD A;  4FH2 A;  3ZCZ A;  4JLF A;  1XGJ A;  3V39 A;  4S2P A;  1EI5 A;  1Y54 A;  1I2W A;  4GN2 A;  4LEN A;  4B4Z A;  5CEB A;  4OOM A;  1WYC A;  3C4P A;  3SH7 A;  3SH8 A;  2A49 A;  3IWQ A;  5CXW A;  4PMA A;  4CPK A;  2Y2G A;  1CEG A;  1K56 D;  2Y2J A;  3FZC A;  3BFE A;  3IWI A;  3ZFZ A;  1S6R A;  4DDY A;  1IYQ A;  3JYI A;  5EOO A;  2WUQ A;  1G68 A;  2C6W B;  3G30 A;  4KZ9 A;  3HLB A;  4HEF A;  4RA7 A;  5KZH A;  1CEF A;  4KZ3 A;  1YLW A;  3ITA A;  4DXB A;  1KGE A;  4E3K A;  3VSL A;  3O88 A;  2H0T A;  3Q7V A;  1YT4 A;  2XD5 A;  2J9P A;  3HUN A;  3N6I A;  1PW1 A;  2WAE A;  4LV2 A;  4UA6 A;  1M6K A;  4WEK A;  5E2G A;  3HLF A;  3ZVT A;  3GSG A;  2J8Y A;  2WGW A;  1NZU A;  2IWD A;  4PPR A;  4DE1 A;  5FQK A;  5EOE A;  4OH0 A;  3UPP A;  4JPM A;  1YLZ A;  3NI9 A;  1ES5 A;  4C75 A;  1IYS A;  5BOH A;  2J9O A;  2Y2I A;  3IXH A;  4KZ8 A;  4KZB A;  1PW8 A;  4QD4 A;  1DY6 A;  3ZDJ A;  1FR1 A;  1PYY A;  4EBN A;  1DJC A;  2ZM8 A;  4FSF A;  5F82 A;  3WWX A;  5I94 A;  3OZH A;  3HVF A;  3IXB A;  1N4O A;  3V50 A;  1Q2Q A;  3FV7 A;  4GD6 A;  5CRF A;  1FQG A;  1DJB A;  2Z2L B;  3HUM A;  1KE0 A;  4ID4 A;  2XD1 A;  2Y2L A;  1TDG A;  3DWK A;  2UWX A;  5TFQ A;  4KZ7 A;  1RGZ A;  2EX2 A;  2PU2 A;  3W8K A;  4EQI A;  5J8X A;  3UE1 A;  2WAD A;  4XXR A;  5FQM A;  4Z9Q A;  2ZC7 A;  2V2F F;  1HD8 A;  5JYP A;  1SHV A;  2RCX A;  3ITB A;  1FOF A;  3VP3 A;  5U47 A;  4DRT A;  3I7J A;  2ZQ7 A;  2DNS A;  3Q7Z A;  5DTT A;  3OPL A;  3S4X A;  4JXV A;  5FAT A;  2HDS A;  2X71 A;  1WE4 A;  3V3S A;  3GTC A;  2DCF A;  3OPP A;  3MZE A;  5FSR A;  3CZD A;  3GQZ A;  4R3J A;  3DW0 A;  4N9K A;  5EUA A;  1XX2 A;  4GD8 A;  2G2W A;  4GB7 A;  5FAS A;  1NY0 A;  4E6W A;  1YLT A;  1L0D A;  4K0W A;  1KVL A;  4M3K A;  3C7V A;  1H5X A;  4N9L A;  2BG1 A;  4UAA A;  3G32 A;  3QNC A;  5DF7 A;  3MZD A;  2ZD8 A;  3PBT A;  4UA9 A;  4BD0 A;  3G2Z A;  5HW3 A;  3OCL A;  3BEC A;  2HDR A;  4LV1 A;  4MBK A;  4PM7 A;  5CHU A;  4ZJ2 A;  3WS4 A;  4PM6 A;  3IF6 B;  4LCM A;  5A90 A;  5DTS A;  4MLL A;  3BEB A;  2EX9 A;  4OKP A;  3M6H A;  3AGE A;  4LV3 A;  5E2H A;  3M2J A;  1ONG A;  2FFF B;  2Y2H A;  5A91 A;  2P9V A;  2HP9 A;  1K54 A;  2RL3 A;  1ES2 A;  4OOL A;  3ZG7 B;  4EBP A;  5GLA A;  3HLG A;  3RXX A;  4E6X A;  4OPY A;  1IYO A;  3BLM A;  4N1H A;  4RX3 A;  3UPN A;  3MZF A;  3PBO A;  1IKI A;  5FQI A;  3DWZ A;  2Q9N A;  3C5A A;  5FAQ A;  2OLU A;  5FAP A;  1MPL A;  3GRJ A;  1L2S A;  1NXY A;  3AGD A;  2ZQA A;  1KVM A;  4Y0U A;  1BSG A;  5M1A A;  2XLN A;  2R9X A;  4S2K A;  4OQG A;  2XF3 A;  5GHX A;  2WKI A;  1IKG A;  4X6T A;  5CHJ A;  3WS0 A;  2ZMA A;  3A3J A;  5EVL A;  4Y7P A;  4OON A;  5D3O A;  3D4F A;  1K56 A;  3G4P A;  4EBL A;  4WBG A;  5CTM A;  3HUO A;  4ZTK A;  4OVD A;  1Z6F A;  3IF6 C;  3UPO A;  4WMC D;  1HTZ A;  5HL1 A;  2Y59 A;  1C3B A;  4JBF A;  3PBN A;  3EQV A;  4D2O A;  1E4D A;  2HP6 A;  1MXO A;  2G2U A;  4QJG A;  3GR2 A;  2ZQC A;  1SDE A;  3BLS A;  3N4I A;  1NYM A;  4JF4 A;  5FQJ A;  5HX9 A;  2VGK A;  4JF5 A;  2GDN A;  4Y0O A;  3SS5 A;  3N7W A;  1AXB A;  4KQQ A;  4YIN A;  5M18 A;  3NCK A;  4OQI A;  1O07 A;  3IT9 A;  4N1X A;  3HL9 A;  5F1G A;  3SS4 A;  4S2I A;  4PM9 A;  2EX8 A;  3VSK A;  2CC1 A;  1NRF A;  2WZX A;  5CGS A;  3V3R A;  3ZHH A;  1FSY A;  3PBR A;  1W7F A;  1XP4 A;  2XH9 A;  1BTL A;  3G2Y A;  4IVK A;  3G31 A;  3A3F A;  1BLC A;  4NET A;  1HZO A;  4S2O A;  4K91 A;  4OLD A;  3UY6 A;  3VP4 A;  1K54 C;  4IVI A;  4R3B A;  5EVI A;  3QNB A;  4FD8 A;  2J7V A;  1JWP A;  1K25 A;  3HBR A;  5DVA A;  1CI9 A;  3NDG A;  4YFM A;  4B4X A;  2XEP A;  2WK0 A;  4ZJ1 A;  4HBT A;  4X68 A;  5DF9 A;  1Q2P A;  3LO7 A;  3IF5 A;  2XGN A;  4GNU A;  4KQR A;  5CED A;  4DF6 A;  3CG5 A;  3WS5 A;  1O7E A;  5E43 A;  1FR6 A;  1ZG4 A;  3WS1 A;  3Q7V B;  1W8Y A;  2OLV A;  3ZVW A;  3VOY A;  4P85 A;  4C3Q A;  1PI5 A;  2X02 A;  2Y2Q A;  1GA9 A;  5HFO A;  1K55 A;  1MWU A;  2WAF A;  4JKT A;  4E3J A;  2Y2K A;  2EXA A;  2WGW B;  3A3E A;  3PTE A;  4E3O A;  2EFU A;  4OQH A;  4R4R A;  4WZ5 A;  2Y2O A;  1RP5 A;  1FCN A;  3PAG A;  4RX2 A;  4KQO A;  1KGF A;  2B5R A;  3N8R A;  4DKI A;  1MKI A;  4R1G A;  2OV5 A;  2C5W B;  1E3U A;  3TG9 A;  3V5M A;  4KG6 A;  4EWF A;  5F83 A;  4H8R A;  4QHC A;  4ZDX A;  4S2J A;  3NBL A;  4U3T A;  5L2F A;  2Y2M A;  1W79 A;  3MFD A;  3OCN A;  5G18 A;  3IH8 A;  5FQQ A;  3OC2 A;  1JTD A;  1H8Y A;  1JTG A;  3UDF A;  3SOI A;  1ZC2 A;  3TOI A;  3FWL A;  3HLC A;  4MBH A;  1YQS A;  1TVF A;  1LI0 A;  5CHM A;  1EWZ A;  4QB8 A;  4ZBE A;  1K38 A;  3IHA A;  2WZZ A;  1GA0 A;  3OPH A;  5FDH A;  4B88 A;  1ES3 A;  2V1Z A;  1BLH A;  4GDN A;  4A5R A;  1SDN A;  3VFH A;  3UDI A;  2WKH A;  1TEM A;  3BFG A;  3LCE A;  3B3X A;  5A93 A;  1KE3 A;  3E2L A;  1GHP A;  3LY4 A;  3CJM A;  2ZJ9 A;  3DTM A;  3S22 A;  4JXG A;  1IEM A;  5A92 A;  3IXG A;  1BZA A;  1K4E A;  2FFY A;  2WYX A;  2Q9M A;  2ZC5 B;  4U0X A;  4O7D A;  4E3I A;  4BLM A;  2E8I A;  2A3U A;  2Y55 A;  1KDW A;  3EQU A;  3P09 A;  1FCM A;  1KGG A;  4S2N A;  5HAI A;  3SS3 A;  3VP1 A;  1ERO A;  2XFT A;  4JXW A;  1MWS A;  5GLC A;  4HBU A;  1I2S A;  3ZG5 A;  3Q81 A;  3BRM A;  1BLS A;  1TDL A;  2WGI A;  1RCJ A;  3FYZ A;  4KZ4 A;  5IHV A;  4BL2 A;  4IBX A;  4Q8I A;  2QZ6 A;  4HES A;  5DTK A;  5E2F A;  5AQ7 A;  2XK1 A;  4E3L A;  3UN7 A;  3ZGA B;  3VP0 A;  2P9V B;  4CJN A;  3IH9 A;  4P87 A;  1K4F A;  1ONH A;  4QY6 A;  3GMW A;  1XGI A;  4UA7 A;  2ZM2 A;  1KDS A;  3IWO A;  1ERM A;  1YLJ A;  1MWT A;  3NY4 A;  4GKU A;  4KZ5 A;  4OPR A;  3ZG8 B;  1BLP A;  4NK3 A;  1LI9 A;  4LCL A;  3RJU A;  4BQM A;  4QU3 A;  1W8Q A;  4X53 A;  4GZB A;  2JE5 A;  5GL9 A;  3UE0 A;  1GHI A;  1J9M A;  1XA7 A;  1H8Z A;  5KSC A;  3UDX A;  4X69 A;  3VMA A;  1I5Q A;  4MBF A;  4EUZ A;  3M6B A;  3O86 A;  4E3M A;  4P0M A;  3O87 A;  5CGX A;  5FI7 A;  1OME A;  5GLD A;  1K57 A;  1K6R A;  2H5S A;  3AGF A;  4XUZ A;  3BYD A;  5FI2 A;  2X01 A;  4KG2 A;  3VP2 A;  3NDE A;  5JYO A;  1WYB A;  1JWV A;  5F1F A;  5E2E A;  4S2L A;  1K6S A;  4WEL A;  1MY8 A;  2XQZ A;  1L0E A;  3IHB A;  3UE3 A;  4X56 A;  5CER A;  4Y0T A;  2PU4 A;  4OPZ A;  2IWC A;  5HAP A;  2Y91 A;  1YM1 A;  2WKE A;  5HAR A;  3MKF A;  1SCW A;  5FA7 A;  1DJA A;  3BFC A;  5GLB A;  1XKZ A;  1ES4 A;  4S2N C;  5FQ9 A;  3MBZ A;  4ZAM A;  1G6A A;  4N92 A;  4BL3 A;  4WEJ A;  3C4O A;  4DE3 A;  2ZQ9 A;  2EX6 A;  3HLW A;  3ZG9 B;  2H10 A;  4KZ6 A;  2V20 A;  3M2K A;  3N8S A;  1NZO A;  3GVB A;  2Y2P A;  1GCE A;  5TR7 A;  5CEC A;  1QMF A;  4OPQ A;  5KSH A;  1RGY A;  4RVA A;  2Y4A A;  3P98 A;  2ZLY A;  1ALQ A;  1U60 A;  4OP8 A;  2EFX A;  5AQB A;  1ESU A;  4E3N A;  3G34 A;  4BEN A;  4UHU A;  5EVI B;  4WM9 A;  3FKV A;  1NJ4 A;  4MEZ A;  2ZQ8 A;  3RXW A;  5EE8 A;  1YLY A;  3VFF A;  4GDB A;  3W4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...