1GSXA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s/g51s mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITSRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Photosynthesis
total genus 35
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsxA00
3H7WA 5DKKA 4LRXC 2QHKA 2QWSA 5J4EA 1EW0A 4DJ3A 3E4OA 5AVEA 2L4RA 3LIAA 3MQOA 3LIDA 4EW7A 2WKRA 3F1OB 4R3AA 1T19A 3LYXA 1N9NA 1LSXA 4R70A 1OJGA 3MQQA 1X0OA 5HDCA 1VB6A 4H6JA 5F6AA 2BASA 3NOPC 2VV6A 4I3IA 3HJIA 1DP9A 3NOTC 3ULFA 1T1CA 4EERA 1GSWA 4RQ9A 3A0RA 2V0UA 3ICYA 1F9IA 4I5SA 3BWLA 4HJ4A 3C8CA 5IU1A 5HWWA 4F3LB 3F1NB 3RTYA 2D02A 5DKLA 1S67L 1T18A 2P7JA 2W0NA 4L9EA 1OJ5A 4MN5A 1KOUA 2OWJA 4XT2B 4GCZA 4LPZA 2ZBBA 1P0ZA 2HV1A 4KQDA 4K08A 2H28A 4L9FA 2ZOHA 2YKFA 5G4ZA 3PHYA 3LIBA 4EXOA 3LICA 2PYRA 1XFNA 2QKPA 4LRYC 4F3LA 3F1NA 1JNUA 1G28A 3IBRA 3UB7A 4NXBA 2KX6A 1DRMA 3K3CA 3H82B 4XT2A 4WF0A 2Z6DA 3FC7A 4B9OA 2GJ3A 2R78A 4GS9B 2PD7A 1BYWA 2V9AA 3LI9A 4HJ6A 1OT9A 4HI4A 1XJ3A 5IS1A 4JGRA 4JGQA 2K7SA 4HY8A 1S1ZA 1V9YA 4BBTA 2VEAA 2WKQA 1TS6A 1LL8A 4WL9A 4L9GA 4HP4A 5HWVA 3CWFA 3H82A 3UB8A 2JHEA 3CLOA 1T1AA 2J80A 4MN6A 4GS9A 3KX0X 2PR5A 1OTDA 5AVFA 3A0VA 3T50A 2KDKA 1ODVA 4NXFA 3SW1A 3F1OA 4DJ2A 1TS0A 5HD5A 1N9OA 2L1MA 1XJ2A 3UE6A 3EEHA 2D01A 5DJTA 1D06A 3UB6A 4EETB 2OWHA 3UMDA 4LLOB 4WUJA 1S4RA 3H9WA 4HP9A 1T1BA 3NHQA 4KUKA 4HJ3A 2EA9A 5J3WA 4HHDA 2V1BA 1V9ZA 5HZHA 4HH3A 4NXGA 1LSWA 3F1PB 3ZQ5A 1P97A 4EESA 3RH8B 4JGPA 2JN7A 4I39A 2W27A 4LRZE 4M4XA 2QJ7A 4YWZA 1S1YA 5HSQA 5HD3A 3P7NA 4E04A 3NJAA 3NOUC 5J7EA 5HDSA 2INWA 1XFQA 2CMNA 1DP6A 3OLOA 2M1CA 2YKHA 4WN5A 1UGUA 3PYPA 4HIAA 4I3JA 1LSVA 4GW9A 2WKPA 1OT6A 1XJ6A 4BBVA 3F1PA 1GSXA 4I38A 3BY8A 4HH2A 1OTAA 3UB9A 1NWZA 4NXEA 2OOLA 5KIZA 3CAXA 1WA9A 5G4YA 2A24B 2V1AA 4EEUA 4KUOA 5TBMB 5F69A 3UMEA 5HDDA 2VLGA 1OTIA 3A0SA 1UWNX 3LI8A 4PKYA 2L0WA 4I3AA 3FG8A 4R6LA 1TS7A 4BBUA 1S4SA 3VE3A 4HNBA 1F98A 5HWTA 4GHIB 1Y28A 5F5YA 4HOIA 1N9LA 2PDRA 5DJUA 2PR6A 2PYPA 2PD8A 2PHYA 2A24A 5EFWA 3HJKA 4EQ1A 3LIFA 5TBMA 3VOLA 1GSVA 1TS8A 3MJQA 3IS2B 3MXQA 3GECA 2VV7A 3C2WA 4EEPA 2I9VA 5I5LA 3B33A 3BY9A 2ZOIA 1OTBA 3H7WB 3GDIA 2VV8A 3E4QA 1UWPX 1MZUA 4GHIA 3EWKA 1OTEA 3E4PA 2QJ5A 5F68A 2B02A 1XJ4A 4R38A 1S66L 3LIEA 5A8BA 4PKYG 4JGOA 4HQAA 4WLAA 1LT0A 3MFXA 2V0WA 3G6OA 3MR0A 1DP8A 1D7EA 3D72A 3IS2A 3VE4A 3LUQA 4H6JB 3K3DA 2Z6CA
chains in the Genus database with same CATH superfamily
3H7WA 5DKKA 4DE0A 5E2EA 2OV5A 3P98A 1EW0A 3NC8A 2AVXA 3E2KA 4DJ3A 4B93A 2L4RA 3N8LA 3UNWA 2ZLYA 3LIDA 4KQOA 2HDUA 3C4PA 1VEUB 3F1OB 2HJ9C 3MBZA 1FCMA 3HLBA 3LEZA 1S0WA 3S22A 2IWBA 1NZOA 4BD0A 3MQQA 1KDWA 4GOGA 1X0OA 2M7UA 1VB6A 2Q9MA 1YAXA 3R7WA 4BJPA 5CRFA 4KZ9A 4QPRA 1DP9A 4GLQA 4JXSA 1ZG6A 1VETB 4R4SA 3ZG9B 4EERA 4OOMA 1YKDA 2RCXA 2VZWA 2GZAA 1Q2PA 4CJNA 2OLUA 2OAQ1 3OZHA 4IVIA 3N6IA 2WZXA 1NYMA 2WKEA 2Y2PA 1VEUA 4GKUA 5DFXA 3C5AA 4P6ZS 1MWRA 4HJ4A 3HLGA 4X1MA 2JBFA 2ZM8A 3RTYA 3WS0A 1D1JA 2P7JA 4ID4A 2CC1A 3ZG5A 1YSPA 1KGEA 1ZC2A 3LR3A 4XT2B 3DBAA 4OP5A 2EFUA 5IHVA 2O99A 1P0ZA 4KQDA 4G3VA 1TEMA 2H28A 4L9FA 2Y2LA 4DF6A 1VETA 3RFBA 3PHYA 4S2PA 2NUPC 3LIBA 4P87A 4EXOA 1K57C 1CEGA 3HLEA 3LICA 2PYRA 4A5RA 4OH0A 3FYZA 2QKPA 4G3KA 5M18A 3EQVA 4X1LA 1MWUA 5HAPA 1DRMA 3LGOA 5AQBA 1BLPA 1H8ZA 4CLCB 5FASA 4XT2A 2W3HA 1BLHA 2H0TA 4PM5A 2V1ZA 4KG2A 2R78A 4GS9B 1CQAA 3SH9A 1GHPA 2V9AA 1OT9A 1XXMA 1XJ3A 2K7SA 1KE0A 3OPHA 3BLMA 4HY8A 1VM1A 1S1ZA 2ZM2A 4HBUA 3VP0A 1V9YA 4BBTA 4BMWA 1TS6A 1EWZA 3M2JA 4OONA 3Q81A 4QY5A 1CI8A 3A3FA 4MMNA 3CWFA 2XH9A 5DVAA 5TGFA 5D3OA 3UB8A 1ERMA 3A3EA 2HGVA 1FILA 2V20A 4BLMA 3NBLA 1L3LA 1SKFA 2ZC5B 4GS9A 1HVBA 3T1QB 3KX0X 2E8IA 2Y91A 3IX8A 5AVFA 1Z6FA 3ZGAB 3IX3A 4K91A 1ZKJA 1TS0A 4KG6A 4O7DA 5DTSA 1EROA 3PAGA 2LB5A 1YLYA 5CXWA 3UE6A 3LEQA 3V5MA 3UB6A 4IEDA 3DWZA 1KGGA 3FPVA 4DE3A 1BTLA 3EOIA 4JF5A 2XGNA 1S4RA 1LLBA 1PIOA 3G34A 3Q7VB 3ZHHA 4HJ3A 5FQ9A 3ZDJA 4UA9A 2EA9A 1I5QA 4ZJ1A 2G7UA 1BLSA 3T4SA 1KGFA 2J9PA 3IXBA 3G2YA 4LV2A 2V1BA 4PM8A 1NJ4A 1W8YA 5FQIA 1V9ZA 3VFFA 5HZHA 4MNRA 2UV0E 1LSWA 3F1PB 3T4QA 4EESA 3RH8B 4JGPA 3UO9A 4I39A 3UY6A 4BQMA 3KYQA 3CHWP 2QJ7A 3PBSA 5HSQA 1BSGA 4PAUA 3O5YA 3FKWA 3WS1A 2INWA 3SZTA 1H5XA 4S2KA 1XFQA 3N8RA 3Q7VA 2P04A 5TR7A 1ES2A 3CG5A 4MBFA 5CGXA 3HCYA 3PYPA 4KQRA 2ZMVA 2P9VB 4HIAA 4I3JA 2XA7S 5EV0A 1K25A 2H10A 4UQIS 3CZDA 3F1PA 4Z1WA 3U2AA 1K55A 1YLTA 3S4XA 4HH2A 3MXRA 2JKFA 1IYQA 1ES4A 3UB9A 1NWZA 4NXEA 2OOLA 2B18A 1XP4A 5GLCA 2V1AA 5FI2A 5FI6A 5GL9A 3GMWA 1G68A 5HDDA 1MY8A 4EU0A 4PKYA 1MWSA 2HDSA 4PHTA 1JTGA 5MC7A 2Y2KA 3PBRA 2P08A 4PM7A 1GCEA 3O3VA 2P9VA 4YNRA 4GHIB 3BFEA 5AJGA 3A3DA 1Y28A 3MKFA 5JYPA 2Y79A 1J9MA 2WGWB 4BENA 4EV4A 5GHZA 1L0FA 4DDSA 3GSGA 5DJUA 4FOFA 2PYPA 4KZ5A 2H0YA 3C7VA 3M6BA 4Y13A 3VOLA 3KO6A 1PWCA 4IVKA 1YLPA 2ZMFA 4X25A 3PBTA 2J8YA 2I9VA 2IWDA 3E2LA 3BY9A 3BFCA 4OP8A 5KMWA 1KVLA 4GHIA 2Y8HA 4OLDA 1OTEA 3O88A 3DWKA 2WGWA 1H8YA 3PBOA 5IT5A 3VP3A 3GVBA 2Y2QA 2W3DA 3S7NA 3LY3A 4LV3A 3LFVA 1H0MA 2J3TC 2Y2GA 4OQHA 3MFXA 2V0WA 3IWIA 3HLCA 3MR0A 1D7EA 1DP8A 1A0KA 5HAQA 3LUQA 4H6JB 3Q1FA 4EWFA 3K3DA 2W3FA 4X6TA 4LRXC 2QWSA 2XA7M 1KE4A 1TD5A 4KZBA 5J4EA 4CLCC 3IWOA 3E4OA 2HDRA 4IUHA 3LIAA 3MF0A 5DF9A 3NULA 1LI0A 1KDSA 5CERA 2VKSA 1DY6A 2WKRA 3HBRA 3IXGA 1N9NA 1LSXA 4D60A 4MEZA 4CLCD 2NUTC 3HVFA 1OJGA 1K38A 2FFYA 4FD8A 4H6JA 5F6AA 1ES5A 2BASA 2GDNA 2WYXA 2DCFA 1TF1A 2VV6A 5CEDA 1SHVA 4S2OA 4FCFA 2ZL1B 3IXDA 2XQZA 1FR6A 3NOTC 1PNEA 5HW3A 3G31A 4E6XA 2ZC7A 1GSWA 5AQ9A 1BLCA 3A0RA 3N4IA 4PPRA 3VFHA 1YPRA 5A90A 2JC7A 4Y15A 4R4RA 3C8CA 5IU1A 4F3LB 3T4KA 3ZG7B 2O9CA 2D02A 1S67L 3O87A 2W0NA 4H8RA 3CITA 4WMCD 2ZBBA 1JTDA 3C38A 5EECA 3TOIA 1NRJA 5FAPA 1NXYA 2ZL1A 4K08A 2YKFA 4IHQA 4R3BA 3QP4A 1MXOA 3L7HA 5BOHA 1DJAA 4S2NC 1FOFA 2G2UA 1KE3A 4QB8A 1XFNA 4RX2A 4B88A 4LRYC 4F3LA 4ETZA 3PBQA 3IBRA 1YM1A 1K55C 3K3CA 3WS2A 2VGJA 4IBXA 4WEJA 4B9OA 2M7VA 3SS4A 4HI4A 3V39A 5EVEA 5IS1A 4YFMA 4FH2A 4CQHA 4N1XA 2XEPA 3EGDC 2VEAA 4Y17A 3T1XA 1LL8A 4GNUA 4WL9A 3LCEA 4LENA 2WGVA 5EM1A 1MKIA 1W63Q 2OAP1 5EE8A 4HP4A 1S6RA 3CLOA 5M1AA 3BEBA 3TJZC 3UDXA 1G5UA 4KZ7A 1VQQA 1ONGA 2JKTM 3HUMA 4O01A 4IUKA 3NY4A 3IWQA 4KZAA 4K0XA 4ESPA 2KDKA 2WK0A 1ODVA 3O86A 3UPNA 5HPFA 4N9LA 3T12B 4KZ3A 3F1OA 4WM9A 4DJ2A 4X53A 4L0LA 3QP5A 1N9OA 3E0YA 1O7EA 2JKRI 4DRTA 1PI5A 4X68A 1D06A 1ESIA 4EETB 3VOZA 3T4LA 1PZOA 2OWHA 3WRZA 4LLOB 2Y4AA 5A92A 3H9WA 4HP9A 1T1BA 4Q0IA 5F1GA 1K56D 4S2IA 1W8QA 4JF4A 3BJNA 3PXPA 3VSKA 3D3OA 2ZC3B 5LBRA 1HD8A 2W3EA 4KENB 2PRFA 3AGFA 1P97A 5CEBA 1K6SA 4Y0TA 3G30A 3IHAA 4E6WA 5GHXA 3HUNA 4YWZA 1LL5A 4Q8IA 5E2HA 5HD3A 3P7NA 4MN7A 3NOUC 4DE2A 1YLJA 2XSSA 2CMNA 3BYDA 2B5RA 2KOIA 3VV4A 3KSFA 1DP6A 3OLOA 1MWTA 2ZQCA 1H8MA 2GX5A 4UEYA 5U47A 2YKHA 3UE1A 5FDSA 1OT6A 4BBVA 1GSXA 3BY8A 1OTAA 4LV1A 5EOEA 2EX2A 5AQ7A 3ZNYA 3EQUA 4HESA 3CAXA 4PM6A 4DE1A 1WA9A 3CMZA 5G4YA 4CLCA 3NIAA 4KUOA 2ZQ7A 3UMEA 4FH4A 2XFSA 3LI8A 1BUEA 2L0WA 3IT9A 4I3AA 3NCKA 3FG8A 4R6LA 4P85A 4C6YA 3UN7A 4OPQA 1XA1A 5CHJA 3VE3A 5HARA 3QNBA 5HL1A 3GV9A 1JWVA 4MBKA 4E3NA 2FH5A 2IA2A 1U60A 4HOIA 1N9LA 5E2GA 2Y2HA 3SS3A 1LHYA 3OPRA 1P9WA 2PBYA 2PHYA 3UE3A 1I2WA 4OPYA 5EFWA 1K4EA 2BLSA 1JVJA 1GSVA 5EVIB 2ZJ9A 4EBLA 1JWZA 3MS6A 1TS8A 2XD1A 3IS2B 3MXQA 3OPPA 2EX9A 4NK3A 4DXBA 4EEPA 2X01A 5I5LA 3B33A 2ZOIA 1OTBA 2XRNA 4WMCA 3GDIA 4MBHA 2VV8A 1FR1A 2WAFA 1LI9A 4MCWA 1K6RA 2Q0OA 1W79A 4NETA 5E43A 4JXWA 1Q2QA 1F5MA 4D2OA 2B02A 4OKPA 4R38A 5A8BA 4LCMA 4JGOA 4HEFA 3V50A 1IYPA 4RA7A 1IELA 5EVIA 4OQIA 2EWWA 3G6OA 3IS2A 4S2NA 3Q7ZA 3T4OA 3C30A 3QP6A 3VP4A 1WYBA 1HZOA 2VX8A 4BWIA 4ME4A 1FSWA 3W4OA 3BFDA 4K0WA 4RYEA 1YT4A 3MQOA 1YQSA 3BQ8A 4E3IA 4CLCE 1T19A 4E3MA 2Y55A 4R70A 2R9WA 3E98A 1NLYA 2PBDP 3EEAA 1RCJA 5GLBA 2V2FF 4KZ4A 4S2MA 1DJCA 2HP9A 4IJGA 5HDCA 1XA7A 1E3UD 5F1FA 1O07A 1P9RA 3UPOA 5CGSA 4LV0A 4I3IA 3HJIA 3C7UA 2X71A 4MDZA 1K0KA 2OLVA 3ULFA 3IF6B 3OBFA 2B95A 3OCLA 2J7VA 2XR0A 3M2KA 1I2SA 1PRQA 4RQ9A 3ZNTA 3DW0A 2V0UA 1XKZA 5FATA 3Q82A 4I5SA 4O8GA 3BWLA 2JE5A 3LR4A 5FQJA 3F1NB 1SZVA 5DKLA 1K4FA 1T18A 4L9EA 3DTEA 4QHCA 2QPNA 1NLZA 1FSYA 1OJ5A 4MN5A 1KOUA 4GD6A 3TRCA 5GLDA 3JYIA 4GCZA 4LPZA 2Y2NA 1K56A 2Z2MB 3HREA 1XGIA 1M6KA 2VJWA 2HV1A 2ZOHA 3FZCA 3IBJA 5G4ZA 3IF6A 4U0TA 5KSHA 4JLFA 5FQMA 2HF6A 3AGDA 4B4XA 2A49A 4GZBA 4DN0A 5FA7A 2VGLS 3F1NA 3W8KA 3UDIA 4NXBA 4QY6A 2KX6A 3ITAA 4X56A 3SH7A 4WF0A 2Z6DA 2XLNA 2GJ3A 3B42A 5F82A 2PD7A 1ALQA 1RP5A 3UPPA 3LI9A 4E3JA 4JGRA 4U0XA 4JGQA 3PAEA 4HBTA 3ZVTA 1XPBA 5L10A 3IH9A 3RJUA 3VP1A 2EFXA 4DMZA 3RXWA 2DRWA 2W1RA 3W2ZA 4E3KA 5HPIA 4RX3A 3TE8A 4ZRRA 4R1GA 4GJ4A 1CJFA 3CPTB 1YSQA 3NI9A 2WGIA 3IXHA 4GDNA 2J80A 4JXVA 1L0GA 5I94A 4R3JA 3WWXA 2PR5A 4Z9QA 1OTDA 3SS5A 3QP8A 3A0VA 2EX8A 4R0QA 3C4OA 3ISGA 5FQKA 4NXFA 3DTMA 3A3IA 4U3TA 2I72A 5DF7A 1JWPA 1YMSA 2L1MA 1GHMA 4P0MA 3VMAA 2ZQDA 3EEHA 5DJTA 1RGYA 5FQQA 3CI6A 1G6AA 4WUJA 4NKPA 3CPTA 4UA6A 5KSCA 5E2FA 1CI9A 2W1TB 2JCHA 4ZTKA 3NHQA 3G2ZA 4KUKA 2K2NA 1G6OA 5EVIC 4AFIA 2HP6A 4G3WA 1Y4OA 3IX4A 1ZTUA 3LY4A 3BQAA 4EBNA 3MXSA 4NXGA 4Y3IA 5FL3A 2VGLM 1AXBA 4QD4A 1Y54A 5EVID 1L0DA 2JN7A 2W27A 3DTIA 4LRZE 4ZJ2A 4LGWA 4E04A 4LFUA 3NJAA 1GA0A 1SKOB 4X55A 5TFQA 3QP1A 4ZBEA 4WYYA 1ES3A 2BG1A 2M1CA 2DMWA 2OSUA 4YINA 4WN5A 3R7WB 1UGUA 1E25A 4XUXA 4JBFA 1LSVA 3MKEA 4GW9A 2EXAA 5L2FA 2WKPA 2WUQA 1MC0A 2PU2A 2V8FA 3OC2A 4PMAA 3P01A 2ZMAA 1PZPA 5L07A 3OPLA 2O0YA 5DFYA 2A24B 1MPLA 2P74A 4KQQA 2LB9A 4OPRA 3VSLA 1SKOA 1SCWA 1UWNX 1E3UA 4YOFA 2XK1A 3BFFA 5GLAA 1TS7A 3GQZA 2XF3A 4BBUA 3SOIA 1F2KA 5FAQA 4IBRA 5HAIA 3KYEA 3V3RA 5CHMA 3W4PA 4ZJ3A 4EUVA 5F5YA 2Y59A 3T4JA 5FSRA 5FEGA 4WZ5A 2Y2MA 2HJEA 3IF6C 2HP5A 4ZAMA 2PD8A 2XROA 2J3WA 2UWXA 3QNCA 2A24A 3S7QA 3HJKA 4GD8A 4C75A 2PT7A 4EUZA 1XX2A 1CK3A 1YLWA 1PWDA 2VV7A 4QWOA 3S7OA 4JPMA 1PWGA 3C2WA 2BTFP 1W5DA 3BM6A 4OQGA 2HZ5A 4UHUA 1ZHHB 2MJ6A 1MZUA 3Q07A 4EQIA 1PFLA 4JXGA 3EGXC 3EWKA 1TDLA 4OLGA 3GRJA 3E4PA 5F68A 5FDHA 4QU3A 5CECA 3T4TA 4II7A 2PU4A 1NRFA 3BRMA 4PKYG 3DAVA 4HQAA 1LT0A 1XGJA 1MKMA 2R9XA 2WKIA 1OPXA 2FZ0A 2EX6A 5A93A 3NECA 3D72A 1FQGA 3MZDA 2Z6CA 3MZFA 4DKIA 3KSIA 4Q0HA 4LCLA 3K2NA 3WRTA 2QHKA 2RL3A 3FWLA 5DTTA 3KYZA 1Z09A 5AVEA 5DF8A 5FAOA 2FFFB 1KVMA 2WKHA 3MSHA 3V67A 4WBGA 4EW7A 1BULA 4R3AA 3BLSA 3N7WA 3LYXA 5A91A 1HLUP 3D9YA 3A3JA 3PR6A 2ACGA 3ZVWA 1FIKA 1L0EA 4ARZB 4B4ZA 2ZM0A 3NOPC 1FCOA 1NY0A 3JPUA 1N9BA 3KSHA 4DXCA 3B47A 1T1CA 2Y2IA 3TW8A 3OOVA 3ZG0A 5EM0A 3LR5A 1ESUA 3IQAA 3ICYA 1SDNA 1PW1A 4WEKA 1F9IA 1QMEA 4P6ZM 3I7JA 3G32A 1K54A 3GTCA 3D4FA 4N9KA 5GHYA 5HWWA 2ZQ9A 2W3GA 5C5KA 3CUEC 2C6WB 4X69A 3GR2A 2IWCA 4Y0OA 3P09A 1IYSA 2OWJA 3TG9A 4ARZA 1N4OA 1NZUA 4CPKA 2ZQAA 4UA7A 2O9BA 5CHUA 1STZA 2EWVA 3U4LP 1L2SA 3NDGA 4BL2A 4N92A 2XD5A 2QYBA 1GHIA 1VHMA 3HL9A 1JNUA 1G28A 2JKRM 3UB7A 4JKTA 3H82B 5L09A 3WS5A 3FC7A 1H3QA 4N1HA 4XXRA 1BYWA 3VP2A 1YLZA 3V3SA 4E3LA 4HJ6A 3MFDA 3B3XA 1ERQA 1EI5A 5CGWA 4BD1A 1YMXA 1E4DA 2WKQA 3ZYTA 2KLIA 4RVAA 4NEED 4L9GA 4Y0UA 5HWVA 3UE0A 3H82A 2JHEA 1AWIA 4GN2A 4WZ5C 3KSGA 4FSFA 1T1AA 5HL6A 3JVVA 3S7PA 3FV7A 4MN6A 5EVLA 3BFGA 4OPZA 5FI7A 3LO7A 2ZC4B 3T50A 1ONHA 3BECA 5TJJA 1OMEA 3SW1A 2HPBA 4FUWA 3ZG8B 3PBNA 5HD5A 1CEFA 1IOUA 1ACFA 3G4PA 1NYYA 1XJ2A 3N8SA 1M40A 4KG5A 2WADA 2D01A 4R23A 1IYOA 3UMDA 3MMHA 3HLFA 1IKGA 3OCNA 3VOYA 2JKGA 1ZG4A 3LR0A 2QMIA 2Z2LB 3QP2A 2A2LA 3ITBA 1FCNA 2EXBA 2H5SA 2G2WA 4E3OA 5J3WA 4HHDA 2WAEA 3FPWA 1SDEA 5EOOA 2PAVP 3R4KA 4O0PA 3S1YA 1J3WA 5CTNA 1IFQA 3UB5P 4HH3A 3HLDA 1PW8A 3ZQ5A 1TDGA 3FKVA 5JYOA 4M4XA 1LL9A 2HDQA 2QZ6A 3AGEA 3UDFA 4OQ0A 4PM9A 1S1YA 2JKTI 3W4QA 5J7EA 5HDSA 1BZAA 3MQ0A 3SH8A 4OOYA 5G18A 4JF6A 4WELA 1K57A 2VK3A 3MZEA 3L9KA 2VGKA 4F94A 5M19A 1QMFA 2V8CA 4Q0JA 5HFOA 4EBPA 2J3TD 4OOLA 4ZDXA 4BL3A 2C5WB 4UQIM 2VA0A 1XJ6A 1TVFA 4S2JA 2DNSA 5DTKA 4I38A 3PTEA 3ZFZA 4ETXA 3IHBA 5KIZA 4Y5FA 3HLWA 4EEUA 5TBMB 5F69A 5J8XA 2VLGA 3RXXA 4M3KA 5EPHA 1OTIA 3A0SA 1K54C 2E8JA 1DJBA 3ZCZA 5KZHA 1CF0A 3CJMA 1S4SA 3G35A 2X02A 2ZQ8A 4GB7A 1F98A 4HNBA 5HWTA 4WZ4A 2O9AA 4NG2A 2J9OA 2WZZA 5CX7A 5F83A 1W7FA 2GNXA 3QHYA 2PDRA 3IF5A 2PR6A 4MLLA 4FTXA 2Q9NA 2XFTA 3T1RA 4C3QA 1MBLA 4EQ1A 1WE4A 3JVUA 3LIFA 5TBMA 1IEMA 4KZ8A 4KZ6A 3MJQA 1GA9A 1BT5A 3GECA 5CTMA 4UAAA 2A3UA 3BW6A 4P6BA 3WS4A 4Y7PA 3H7WB 5EUAA 4OVDA 3CUEA 2ZD8A 5AQAA 3T1SA 3DTKA 3E4QA 1UWPX 2Y2JA 2XDMA 4GDBA 1W63M 1WYCA 3M6HA 4XUZA 2QJ5A 4QJGA 1XJ4A 1PI4A 3HUOA 1RGZA 3NDEA 1S66L 4S2LA 1HTZA 3LIEA 5HX9A 4WLAA 3IH8A 4Y2FA 2W1TA 1C3BA 3TSGA 4DDYA 2Y2OA 5L8MA 3VE4A 5FEFA 5K5BA 2K31A 2ZC6B 1IKIA 1PYYA
chains in the Genus database with same CATH topology
3H7WA 5DKKA 4LRXC 3K2NA 2QHKA 2QWSA 2XA7M 1TD5A 5J4EA 4CLCC 1EW0A 3KYZA 4DJ3A 3E4OA 5AVEA 2VX8A 4B93A 2L4RA 4IUHA 3LIAA 3MF0A 5DF9A 4BWIA 4ME4A 3MQOA 3LIDA 4KQOA 3V67A 3BQ8A 2VKSA 4CLCE 4EW7A 2WKRA 3F1OB 4R3AA 2HJ9C 1T19A 3LYXA 1N9NA 1LSXA 4R70A 4CLCD 3E98A 1NLYA 3PR6A 3EEAA 2NUTC 1OJGA 3MQQA 4IJGA 1X0OA 5HDCA 2M7UA 1VB6A 4H6JA 5F6AA 2BASA 1YAXA 4ARZB 1P9RA 3R7WA 3NOPC 4BJPA 1TF1A 2VV6A 4I3IA 3HJIA 4QPRA 1DP9A 4GLQA 3KSHA 4MDZA 3NOTC 3ULFA 3B47A 1T1CA 4EERA 4OOMA 1YKDA 3OBFA 3OCLA 2VZWA 2GZAA 3TW8A 3OOVA 1GSWA 4RQ9A 2OAQ1 3LR5A 3A0RA 2V0UA 3ICYA 4WEKA 1F9IA 4I5SA 5DFXA 4O8GA 3BWLA 4P6ZS 4P6ZM 4HJ4A 3C8CA 3LR4A 5IU1A 5HWWA 2W3GA 4F3LB 5C5KA 3F1NB 3RTYA 3CUEC 3T4KA 2O9CA 2D02A 1S67L 1T18A 2P7JA 4L9EA 2W0NA 5DKLA 1YSPA 1NLZA 1OJ5A 3LR3A 4MN5A 1KOUA 3CITA 3TRCA 2OWJA 4XT2B 3DBAA 4ARZA 4GCZA 4LPZA 2ZBBA 3C38A 2O99A 1NRJA 2VJWA 1P0ZA 2HV1A 4KQDA 4K08A 2O9BA 4G3VA 2H28A 4L9FA 2ZOHA 1STZA 3IBJA 2EWVA 2YKFA 5G4ZA 3RFBA 5KSHA 3PHYA 2NUPC 4IHQA 3LIBA 2HF6A 4EXOA 3LICA 2PYRA 1XFNA 2QKPA 4G3KA 4DN0A 3EQVA 2QYBA 4LRYC 2VGLS 3F1NA 4F3LA 1VHMA 4ETZA 1JNUA 1G28A 2JKRM 3PBQA 3IBRA 3UB7A 4NXBA 2KX6A 1DRMA 3K3CA 3H82B 4CLCB 4XT2A 4WF0A 2Z6DA 2W3HA 3FC7A 4WEJA 4B9OA 2GJ3A 1H3QA 2R78A 3B42A 4GS9B 2PD7A 1BYWA 2M7VA 2V9AA 3LI9A 4HJ6A 1OT9A 4HI4A 1XJ3A 5IS1A 4JGRA 4JGQA 2K7SA 4CQHA 4HY8A 3EGDC 1S1ZA 1V9YA 4BBTA 2VEAA 4BMWA 2WKQA 1TS6A 3ZYTA 1LL8A 2KLIA 4DMZA 4WL9A 4NEED 2W1RA 3W2ZA 1W63Q 2OAP1 4L9GA 4HP4A 5HPIA 5HWVA 4MMNA 3TE8A 3CWFA 4ZRRA 3H82A 3UB8A 2JHEA 3CLOA 4GJ4A 1YSQA 3KSGA 2HGVA 4FSFA 3TJZC 1T1AA 5HL6A 3JVVA 3S7PA 2J80A 4MN6A 2JKTM 4GS9A 4O01A 3KX0X 4IUKA 2PR5A 1OTDA 5AVFA 3A0VA 3T50A 2KDKA 1ODVA 5HPFA 4NXFA 5TJJA 3SW1A 3F1OA 4DJ2A 3PBNA 1TS0A 5HD5A 4L0LA 1IOUA 1N9OA 3E0YA 2L1MA 1XJ2A 2LB5A 2JKRI 3UE6A 3EEHA 2D01A 5DJTA 1D06A 3UB6A 4EETB 3CI6A 3T4LA 2OWHA 3FPVA 3UMDA 3MMHA 4LLOB 4WUJA 4NKPA 3OCNA 3EOIA 1S4RA 2W1TB 3LR0A 3H9WA 4HP9A 1T1BA 4Q0IA 3NHQA 4KUKA 2A2LA 4HJ3A 2K2NA 1G6OA 2EA9A 4AFIA 2G7UA 4G3WA 3BJNA 3T4SA 5J3WA 3PXPA 4HHDA 1ZTUA 3FPWA 3D3OA 2V1BA 3R4KA 4O0PA 3BQAA 5LBRA 2W3EA 1IFQA 1V9ZA 5HZHA 4HH3A 4NXGA 1LSWA 4Y3IA 3F1PB 3T4QA 3ZQ5A 1P97A 5FL3A 2VGLM 4EESA 3RH8B 4JGPA 2JN7A 4I39A 2W27A 4LRZE 4M4XA 3KYQA 2QJ7A 3PBSA 4YWZA 1S1YA 5HSQA 5HD3A 3P7NA 4MN7A 4E04A 2JKTI 3NJAA 3NOUC 5J7EA 4PAUA 3O5YA 5HDSA 2INWA 3MQ0A 1XFQA 2XSSA 2CMNA 2KOIA 3VV4A 2P04A 3KSFA 1DP6A 3OLOA 4WELA 1H8MA 2GX5A 2M1CA 4UEYA 2DMWA 3HCYA 2YKHA 4WN5A 3R7WB 1UGUA 3PYPA 2ZMVA 4Q0JA 4HIAA 4I3JA 2J3TD 2XA7S 4OOLA 1LSVA 4GW9A 4UQIS 4UQIM 2VA0A 1OT6A 1XJ6A 2WKPA 4BBVA 1MC0A 3F1PA 4Z1WA 1GSXA 3U2AA 4I38A 3OC2A 3BY8A 3P01A 4HH2A 1OTAA 4ETXA 3UB9A 1NWZA 4NXEA 2OOLA 2B18A 5KIZA 3EQUA 4Y5FA 3CAXA 2O0YA 1WA9A 5DFYA 5G4YA 4CLCA 2A24B 2V1AA 4EEUA 4KUOA 5TBMB 5F69A 3UMEA 5HDDA 2LB9A 2VLGA 4EU0A 1OTIA 3A0SA 1UWNX 3LI8A 4PKYA 2L0WA 4I3AA 4PHTA 4YOFA 3FG8A 4R6LA 1TS7A 5MC7A 4BBUA 3PBRA 1S4SA 2P08A 3VE3A 4HNBA 1F98A 5HWTA 4YNRA 4GHIB 5AJGA 2O9AA 1Y28A 2Y79A 5CX7A 4EUVA 2FH5A 5F5YA 2IA2A 3T4JA 4HOIA 1N9LA 2GNXA 2PDRA 2HJEA 2PR6A 5DJUA 4FOFA 2PYPA 2PD8A 2XROA 2J3WA 1P9WA 2PHYA 3UE3A 2A24A 3S7QA 5EFWA 3HJKA 4EQ1A 3LIFA 3JVUA 5TBMA 3VOLA 1GSVA 3KO6A 2PT7A 1TS8A 2ZMFA 3MJQA 3IS2B 3MXQA 3GECA 3PBTA 2VV7A 3S7OA 3BW6A 3C2WA 4EEPA 2I9VA 5I5LA 3B33A 3BY9A 2ZOIA 1OTBA 2XRNA 3H7WB 3GDIA 2VV8A 1ZHHB 3CUEA 4MCWA 2MJ6A 3E4QA 1UWPX 1MZUA 4GHIA 2Y8HA 3EGXC 3EWKA 1OTEA 1W63M 3E4PA 1F5MA 2QJ5A 3PBOA 5F68A 2B02A 1XJ4A 3T4TA 5IT5A 4R38A 1S66L 4II7A 3LIEA 5A8BA 4PKYG 4JGOA 4HQAA 4WLAA 2W3DA 1LT0A 3S7NA 3LFVA 1MKMA 2J3TC 4Y2FA 2W1TA 1OPXA 2FZ0A 3MFXA 2EWWA 2V0WA 3G6OA 3MR0A 3IS2A 1DP8A 1D7EA 3D72A 5L8MA 3VE4A 3LUQA 4H6JB 5K5BA 3K3DA 2Z6CA 3T4OA 2K31A 2W3FA 3C30A 3KSIA 4Q0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7W A;  5DKK A;  4LRX C;  2QHK A;  2QWS A;  5J4E A;  1EW0 A;  4DJ3 A;  3E4O A;  5AVE A;  2L4R A;  3LIA A;  3MQO A;  3LID A;  4EW7 A;  2WKR A;  3F1O B;  4R3A A;  1T19 A;  3LYX A;  1N9N A;  1LSX A;  4R70 A;  1OJG A;  3MQQ A;  1X0O A;  5HDC A;  1VB6 A;  4H6J A;  5F6A A;  2BAS A;  3NOP C;  2VV6 A;  4I3I A;  3HJI A;  1DP9 A;  3NOT C;  3ULF A;  1T1C A;  4EER A;  1GSW A;  4RQ9 A;  3A0R A;  2V0U A;  3ICY A;  1F9I A;  4I5S A;  3BWL A;  4HJ4 A;  3C8C A;  5IU1 A;  5HWW A;  4F3L B;  3F1N B;  3RTY A;  2D02 A;  5DKL A;  1S67 L;  1T18 A;  2P7J A;  2W0N A;  4L9E A;  1OJ5 A;  4MN5 A;  1KOU A;  2OWJ A;  4XT2 B;  4GCZ A;  4LPZ A;  2ZBB A;  1P0Z A;  2HV1 A;  4KQD A;  4K08 A;  2H28 A;  4L9F A;  2ZOH A;  2YKF A;  5G4Z A;  3PHY A;  3LIB A;  4EXO A;  3LIC A;  2PYR A;  1XFN A;  2QKP A;  4LRY C;  4F3L A;  3F1N A;  1JNU A;  1G28 A;  3IBR A;  3UB7 A;  4NXB A;  2KX6 A;  1DRM A;  3K3C A;  3H82 B;  4XT2 A;  4WF0 A;  2Z6D A;  3FC7 A;  4B9O A;  2GJ3 A;  2R78 A;  4GS9 B;  2PD7 A;  1BYW A;  2V9A A;  3LI9 A;  4HJ6 A;  1OT9 A;  4HI4 A;  1XJ3 A;  5IS1 A;  4JGR A;  4JGQ A;  2K7S A;  4HY8 A;  1S1Z A;  1V9Y A;  4BBT A;  2VEA A;  2WKQ A;  1TS6 A;  1LL8 A;  4WL9 A;  4L9G A;  4HP4 A;  5HWV A;  3CWF A;  3H82 A;  3UB8 A;  2JHE A;  3CLO A;  1T1A A;  2J80 A;  4MN6 A;  4GS9 A;  3KX0 X;  2PR5 A;  1OTD A;  5AVF A;  3A0V A;  3T50 A;  2KDK A;  1ODV A;  4NXF A;  3SW1 A;  3F1O A;  4DJ2 A;  1TS0 A;  5HD5 A;  1N9O A;  2L1M A;  1XJ2 A;  3UE6 A;  3EEH A;  2D01 A;  5DJT A;  1D06 A;  3UB6 A;  4EET B;  2OWH A;  3UMD A;  4LLO B;  4WUJ A;  1S4R A;  3H9W A;  4HP9 A;  1T1B A;  3NHQ A;  4KUK A;  4HJ3 A;  2EA9 A;  5J3W A;  4HHD A;  2V1B A;  1V9Z A;  5HZH A;  4HH3 A;  4NXG A;  1LSW A;  3F1P B;  3ZQ5 A;  1P97 A;  4EES A;  3RH8 B;  4JGP A;  2JN7 A;  4I39 A;  2W27 A;  4LRZ E;  4M4X A;  2QJ7 A;  4YWZ A;  1S1Y A;  5HSQ A;  5HD3 A;  3P7N A;  4E04 A;  3NJA A;  3NOU C;  5J7E A;  5HDS A;  2INW A;  1XFQ A;  2CMN A;  1DP6 A;  3OLO A;  2M1C A;  2YKH A;  4WN5 A;  1UGU A;  3PYP A;  4HIA A;  4I3J A;  1LSV A;  4GW9 A;  2WKP A;  1OT6 A;  1XJ6 A;  4BBV A;  3F1P A;  1GSX A;  4I38 A;  3BY8 A;  4HH2 A;  1OTA A;  3UB9 A;  1NWZ A;  4NXE A;  2OOL A;  5KIZ A;  3CAX A;  1WA9 A;  5G4Y A;  2A24 B;  2V1A A;  4EEU A;  4KUO A;  5TBM B;  5F69 A;  3UME A;  5HDD A;  2VLG A;  1OTI A;  3A0S A;  1UWN X;  3LI8 A;  4PKY A;  2L0W A;  4I3A A;  3FG8 A;  4R6L A;  1TS7 A;  4BBU A;  1S4S A;  3VE3 A;  4HNB A;  1F98 A;  5HWT A;  4GHI B;  1Y28 A;  5F5Y A;  4HOI A;  1N9L A;  2PDR A;  5DJU A;  2PR6 A;  2PYP A;  2PD8 A;  2PHY A;  2A24 A;  5EFW A;  3HJK A;  4EQ1 A;  3LIF A;  5TBM A;  3VOL A;  1GSV A;  1TS8 A;  3MJQ A;  3IS2 B;  3MXQ A;  3GEC A;  2VV7 A;  3C2W A;  4EEP A;  2I9V A;  5I5L A;  3B33 A;  3BY9 A;  2ZOI A;  1OTB A;  3H7W B;  3GDI A;  2VV8 A;  3E4Q A;  1UWP X;  1MZU A;  4GHI A;  3EWK A;  1OTE A;  3E4P A;  2QJ5 A;  5F68 A;  2B02 A;  1XJ4 A;  4R38 A;  1S66 L;  3LIE A;  5A8B A;  4PKY G;  4JGO A;  4HQA A;  4WLA A;  1LT0 A;  3MFX A;  2V0W A;  3G6O A;  3MR0 A;  1DP8 A;  1D7E A;  3D72 A;  3IS2 A;  3VE4 A;  3LUQ A;  4H6J B;  3K3D A;  2Z6C A; 
#chains in the Genus database with same CATH topology
 3H7W A;  5DKK A;  4DE0 A;  5E2E A;  2OV5 A;  3P98 A;  1EW0 A;  3NC8 A;  2AVX A;  3E2K A;  4DJ3 A;  4B93 A;  2L4R A;  3N8L A;  3UNW A;  2ZLY A;  3LID A;  4KQO A;  2HDU A;  3C4P A;  1VEU B;  3F1O B;  2HJ9 C;  3MBZ A;  1FCM A;  3HLB A;  3LEZ A;  1S0W A;  3S22 A;  2IWB A;  1NZO A;  4BD0 A;  3MQQ A;  1KDW A;  4GOG A;  1X0O A;  2M7U A;  1VB6 A;  2Q9M A;  1YAX A;  3R7W A;  4BJP A;  5CRF A;  4KZ9 A;  4QPR A;  1DP9 A;  4GLQ A;  4JXS A;  1ZG6 A;  1VET B;  4R4S A;  3ZG9 B;  4EER A;  4OOM A;  1YKD A;  2RCX A;  2VZW A;  2GZA A;  1Q2P A;  4CJN A;  2OLU A;  2OAQ 1;  3OZH A;  4IVI A;  3N6I A;  2WZX A;  1NYM A;  2WKE A;  2Y2P A;  1VEU A;  4GKU A;  5DFX A;  3C5A A;  4P6Z S;  1MWR A;  4HJ4 A;  3HLG A;  4X1M A;  2JBF A;  2ZM8 A;  3RTY A;  3WS0 A;  1D1J A;  2P7J A;  4ID4 A;  2CC1 A;  3ZG5 A;  1YSP A;  1KGE A;  1ZC2 A;  3LR3 A;  4XT2 B;  3DBA A;  4OP5 A;  2EFU A;  5IHV A;  2O99 A;  1P0Z A;  4KQD A;  4G3V A;  1TEM A;  2H28 A;  4L9F A;  2Y2L A;  4DF6 A;  1VET A;  3RFB A;  3PHY A;  4S2P A;  2NUP C;  3LIB A;  4P87 A;  4EXO A;  1K57 C;  1CEG A;  3HLE A;  3LIC A;  2PYR A;  4A5R A;  4OH0 A;  3FYZ A;  2QKP A;  4G3K A;  5M18 A;  3EQV A;  4X1L A;  1MWU A;  5HAP A;  1DRM A;  3LGO A;  5AQB A;  1BLP A;  1H8Z A;  4CLC B;  5FAS A;  4XT2 A;  2W3H A;  1BLH A;  2H0T A;  4PM5 A;  2V1Z A;  4KG2 A;  2R78 A;  4GS9 B;  1CQA A;  3SH9 A;  1GHP A;  2V9A A;  1OT9 A;  1XXM A;  1XJ3 A;  2K7S A;  1KE0 A;  3OPH A;  3BLM A;  4HY8 A;  1VM1 A;  1S1Z A;  2ZM2 A;  4HBU A;  3VP0 A;  1V9Y A;  4BBT A;  4BMW A;  1TS6 A;  1EWZ A;  3M2J A;  4OON A;  3Q81 A;  4QY5 A;  1CI8 A;  3A3F A;  4MMN A;  3CWF A;  2XH9 A;  5DVA A;  5TGF A;  5D3O A;  3UB8 A;  1ERM A;  3A3E A;  2HGV A;  1FIL A;  2V20 A;  4BLM A;  3NBL A;  1L3L A;  1SKF A;  2ZC5 B;  4GS9 A;  1HVB A;  3T1Q B;  3KX0 X;  2E8I A;  2Y91 A;  3IX8 A;  5AVF A;  1Z6F A;  3ZGA B;  3IX3 A;  4K91 A;  1ZKJ A;  1TS0 A;  4KG6 A;  4O7D A;  5DTS A;  1ERO A;  3PAG A;  2LB5 A;  1YLY A;  5CXW A;  3UE6 A;  3LEQ A;  3V5M A;  3UB6 A;  4IED A;  3DWZ A;  1KGG A;  3FPV A;  4DE3 A;  1BTL A;  3EOI A;  4JF5 A;  2XGN A;  1S4R A;  1LLB A;  1PIO A;  3G34 A;  3Q7V B;  3ZHH A;  4HJ3 A;  5FQ9 A;  3ZDJ A;  4UA9 A;  2EA9 A;  1I5Q A;  4ZJ1 A;  2G7U A;  1BLS A;  3T4S A;  1KGF A;  2J9P A;  3IXB A;  3G2Y A;  4LV2 A;  2V1B A;  4PM8 A;  1NJ4 A;  1W8Y A;  5FQI A;  1V9Z A;  3VFF A;  5HZH A;  4MNR A;  2UV0 E;  1LSW A;  3F1P B;  3T4Q A;  4EES A;  3RH8 B;  4JGP A;  3UO9 A;  4I39 A;  3UY6 A;  4BQM A;  3KYQ A;  3CHW P;  2QJ7 A;  3PBS A;  5HSQ A;  1BSG A;  4PAU A;  3O5Y A;  3FKW A;  3WS1 A;  2INW A;  3SZT A;  1H5X A;  4S2K A;  1XFQ A;  3N8R A;  3Q7V A;  2P04 A;  5TR7 A;  1ES2 A;  3CG5 A;  4MBF A;  5CGX A;  3HCY A;  3PYP A;  4KQR A;  2ZMV A;  2P9V B;  4HIA A;  4I3J A;  2XA7 S;  5EV0 A;  1K25 A;  2H10 A;  4UQI S;  3CZD A;  3F1P A;  4Z1W A;  3U2A A;  1K55 A;  1YLT A;  3S4X A;  4HH2 A;  3MXR A;  2JKF A;  1IYQ A;  1ES4 A;  3UB9 A;  1NWZ A;  4NXE A;  2OOL A;  2B18 A;  1XP4 A;  5GLC A;  2V1A A;  5FI2 A;  5FI6 A;  5GL9 A;  3GMW A;  1G68 A;  5HDD A;  1MY8 A;  4EU0 A;  4PKY A;  1MWS A;  2HDS A;  4PHT A;  1JTG A;  5MC7 A;  2Y2K A;  3PBR A;  2P08 A;  4PM7 A;  1GCE A;  3O3V A;  2P9V A;  4YNR A;  4GHI B;  3BFE A;  5AJG A;  3A3D A;  1Y28 A;  3MKF A;  5JYP A;  2Y79 A;  1J9M A;  2WGW B;  4BEN A;  4EV4 A;  5GHZ A;  1L0F A;  4DDS A;  3GSG A;  5DJU A;  4FOF A;  2PYP A;  4KZ5 A;  2H0Y A;  3C7V A;  3M6B A;  4Y13 A;  3VOL A;  3KO6 A;  1PWC A;  4IVK A;  1YLP A;  2ZMF A;  4X25 A;  3PBT A;  2J8Y A;  2I9V A;  2IWD A;  3E2L A;  3BY9 A;  3BFC A;  4OP8 A;  5KMW A;  1KVL A;  4GHI A;  2Y8H A;  4OLD A;  1OTE A;  3O88 A;  3DWK A;  2WGW A;  1H8Y A;  3PBO A;  5IT5 A;  3VP3 A;  3GVB A;  2Y2Q A;  2W3D A;  3S7N A;  3LY3 A;  4LV3 A;  3LFV A;  1H0M A;  2J3T C;  2Y2G A;  4OQH A;  3MFX A;  2V0W A;  3IWI A;  3HLC A;  3MR0 A;  1D7E A;  1DP8 A;  1A0K A;  5HAQ A;  3LUQ A;  4H6J B;  3Q1F A;  4EWF A;  3K3D A;  2W3F A;  4X6T A;  4LRX C;  2QWS A;  2XA7 M;  1KE4 A;  1TD5 A;  4KZB A;  5J4E A;  4CLC C;  3IWO A;  3E4O A;  2HDR A;  4IUH A;  3LIA A;  3MF0 A;  5DF9 A;  3NUL A;  1LI0 A;  1KDS A;  5CER A;  2VKS A;  1DY6 A;  2WKR A;  3HBR A;  3IXG A;  1N9N A;  1LSX A;  4D60 A;  4MEZ A;  4CLC D;  2NUT C;  3HVF A;  1OJG A;  1K38 A;  2FFY A;  4FD8 A;  4H6J A;  5F6A A;  1ES5 A;  2BAS A;  2GDN A;  2WYX A;  2DCF A;  1TF1 A;  2VV6 A;  5CED A;  1SHV A;  4S2O A;  4FCF A;  2ZL1 B;  3IXD A;  2XQZ A;  1FR6 A;  3NOT C;  1PNE A;  5HW3 A;  3G31 A;  4E6X A;  2ZC7 A;  1GSW A;  5AQ9 A;  1BLC A;  3A0R A;  3N4I A;  4PPR A;  3VFH A;  1YPR A;  5A90 A;  2JC7 A;  4Y15 A;  4R4R A;  3C8C A;  5IU1 A;  4F3L B;  3T4K A;  3ZG7 B;  2O9C A;  2D02 A;  1S67 L;  3O87 A;  2W0N A;  4H8R A;  3CIT A;  4WMC D;  2ZBB A;  1JTD A;  3C38 A;  5EEC A;  3TOI A;  1NRJ A;  5FAP A;  1NXY A;  2ZL1 A;  4K08 A;  2YKF A;  4IHQ A;  4R3B A;  3QP4 A;  1MXO A;  3L7H A;  5BOH A;  1DJA A;  4S2N C;  1FOF A;  2G2U A;  1KE3 A;  4QB8 A;  1XFN A;  4RX2 A;  4B88 A;  4LRY C;  4F3L A;  4ETZ A;  3PBQ A;  3IBR A;  1YM1 A;  1K55 C;  3K3C A;  3WS2 A;  2VGJ A;  4IBX A;  4WEJ A;  4B9O A;  2M7V A;  3SS4 A;  4HI4 A;  3V39 A;  5EVE A;  5IS1 A;  4YFM A;  4FH2 A;  4CQH A;  4N1X A;  2XEP A;  3EGD C;  2VEA A;  4Y17 A;  3T1X A;  1LL8 A;  4GNU A;  4WL9 A;  3LCE A;  4LEN A;  2WGV A;  5EM1 A;  1MKI A;  1W63 Q;  2OAP 1;  5EE8 A;  4HP4 A;  1S6R A;  3CLO A;  5M1A A;  3BEB A;  3TJZ C;  3UDX A;  1G5U A;  4KZ7 A;  1VQQ A;  1ONG A;  2JKT M;  3HUM A;  4O01 A;  4IUK A;  3NY4 A;  3IWQ A;  4KZA A;  4K0X A;  4ESP A;  2KDK A;  2WK0 A;  1ODV A;  3O86 A;  3UPN A;  5HPF A;  4N9L A;  3T12 B;  4KZ3 A;  3F1O A;  4WM9 A;  4DJ2 A;  4X53 A;  4L0L A;  3QP5 A;  1N9O A;  3E0Y A;  1O7E A;  2JKR I;  4DRT A;  1PI5 A;  4X68 A;  1D06 A;  1ESI A;  4EET B;  3VOZ A;  3T4L A;  1PZO A;  2OWH A;  3WRZ A;  4LLO B;  2Y4A A;  5A92 A;  3H9W A;  4HP9 A;  1T1B A;  4Q0I A;  5F1G A;  1K56 D;  4S2I A;  1W8Q A;  4JF4 A;  3BJN A;  3PXP A;  3VSK A;  3D3O A;  2ZC3 B;  5LBR A;  1HD8 A;  2W3E A;  4KEN B;  2PRF A;  3AGF A;  1P97 A;  5CEB A;  1K6S A;  4Y0T A;  3G30 A;  3IHA A;  4E6W A;  5GHX A;  3HUN A;  4YWZ A;  1LL5 A;  4Q8I A;  5E2H A;  5HD3 A;  3P7N A;  4MN7 A;  3NOU C;  4DE2 A;  1YLJ A;  2XSS A;  2CMN A;  3BYD A;  2B5R A;  2KOI A;  3VV4 A;  3KSF A;  1DP6 A;  3OLO A;  1MWT A;  2ZQC A;  1H8M A;  2GX5 A;  4UEY A;  5U47 A;  2YKH A;  3UE1 A;  5FDS A;  1OT6 A;  4BBV A;  1GSX A;  3BY8 A;  1OTA A;  4LV1 A;  5EOE A;  2EX2 A;  5AQ7 A;  3ZNY A;  3EQU A;  4HES A;  3CAX A;  4PM6 A;  4DE1 A;  1WA9 A;  3CMZ A;  5G4Y A;  4CLC A;  3NIA A;  4KUO A;  2ZQ7 A;  3UME A;  4FH4 A;  2XFS A;  3LI8 A;  1BUE A;  2L0W A;  3IT9 A;  4I3A A;  3NCK A;  3FG8 A;  4R6L A;  4P85 A;  4C6Y A;  3UN7 A;  4OPQ A;  1XA1 A;  5CHJ A;  3VE3 A;  5HAR A;  3QNB A;  5HL1 A;  3GV9 A;  1JWV A;  4MBK A;  4E3N A;  2FH5 A;  2IA2 A;  1U60 A;  4HOI A;  1N9L A;  5E2G A;  2Y2H A;  3SS3 A;  1LHY A;  3OPR A;  1P9W A;  2PBY A;  2PHY A;  3UE3 A;  1I2W A;  4OPY A;  5EFW A;  1K4E A;  2BLS A;  1JVJ A;  1GSV A;  5EVI B;  2ZJ9 A;  4EBL A;  1JWZ A;  3MS6 A;  1TS8 A;  2XD1 A;  3IS2 B;  3MXQ A;  3OPP A;  2EX9 A;  4NK3 A;  4DXB A;  4EEP A;  2X01 A;  5I5L A;  3B33 A;  2ZOI A;  1OTB A;  2XRN A;  4WMC A;  3GDI A;  4MBH A;  2VV8 A;  1FR1 A;  2WAF A;  1LI9 A;  4MCW A;  1K6R A;  2Q0O A;  1W79 A;  4NET A;  5E43 A;  4JXW A;  1Q2Q A;  1F5M A;  4D2O A;  2B02 A;  4OKP A;  4R38 A;  5A8B A;  4LCM A;  4JGO A;  4HEF A;  3V50 A;  1IYP A;  4RA7 A;  1IEL A;  5EVI A;  4OQI A;  2EWW A;  3G6O A;  3IS2 A;  4S2N A;  3Q7Z A;  3T4O A;  3C30 A;  3QP6 A;  3VP4 A;  1WYB A;  1HZO A;  2VX8 A;  4BWI A;  4ME4 A;  1FSW A;  3W4O A;  3BFD A;  4K0W A;  4RYE A;  1YT4 A;  3MQO A;  1YQS A;  3BQ8 A;  4E3I A;  4CLC E;  1T19 A;  4E3M A;  2Y55 A;  4R70 A;  2R9W A;  3E98 A;  1NLY A;  2PBD P;  3EEA A;  1RCJ A;  5GLB A;  2V2F F;  4KZ4 A;  4S2M A;  1DJC A;  2HP9 A;  4IJG A;  5HDC A;  1XA7 A;  1E3U D;  5F1F A;  1O07 A;  1P9R A;  3UPO A;  5CGS A;  4LV0 A;  4I3I A;  3HJI A;  3C7U A;  2X71 A;  4MDZ A;  1K0K A;  2OLV A;  3ULF A;  3IF6 B;  3OBF A;  2B95 A;  3OCL A;  2J7V A;  2XR0 A;  3M2K A;  1I2S A;  1PRQ A;  4RQ9 A;  3ZNT A;  3DW0 A;  2V0U A;  1XKZ A;  5FAT A;  3Q82 A;  4I5S A;  4O8G A;  3BWL A;  2JE5 A;  3LR4 A;  5FQJ A;  3F1N B;  1SZV A;  5DKL A;  1K4F A;  1T18 A;  4L9E A;  3DTE A;  4QHC A;  2QPN A;  1NLZ A;  1FSY A;  1OJ5 A;  4MN5 A;  1KOU A;  4GD6 A;  3TRC A;  5GLD A;  3JYI A;  4GCZ A;  4LPZ A;  2Y2N A;  1K56 A;  2Z2M B;  3HRE A;  1XGI A;  1M6K A;  2VJW A;  2HV1 A;  2ZOH A;  3FZC A;  3IBJ A;  5G4Z A;  3IF6 A;  4U0T A;  5KSH A;  4JLF A;  5FQM A;  2HF6 A;  3AGD A;  4B4X A;  2A49 A;  4GZB A;  4DN0 A;  5FA7 A;  2VGL S;  3F1N A;  3W8K A;  3UDI A;  4NXB A;  4QY6 A;  2KX6 A;  3ITA A;  4X56 A;  3SH7 A;  4WF0 A;  2Z6D A;  2XLN A;  2GJ3 A;  3B42 A;  5F82 A;  2PD7 A;  1ALQ A;  1RP5 A;  3UPP A;  3LI9 A;  4E3J A;  4JGR A;  4U0X A;  4JGQ A;  3PAE A;  4HBT A;  3ZVT A;  1XPB A;  5L10 A;  3IH9 A;  3RJU A;  3VP1 A;  2EFX A;  4DMZ A;  3RXW A;  2DRW A;  2W1R A;  3W2Z A;  4E3K A;  5HPI A;  4RX3 A;  3TE8 A;  4ZRR A;  4R1G A;  4GJ4 A;  1CJF A;  3CPT B;  1YSQ A;  3NI9 A;  2WGI A;  3IXH A;  4GDN A;  2J80 A;  4JXV A;  1L0G A;  5I94 A;  4R3J A;  3WWX A;  2PR5 A;  4Z9Q A;  1OTD A;  3SS5 A;  3QP8 A;  3A0V A;  2EX8 A;  4R0Q A;  3C4O A;  3ISG A;  5FQK A;  4NXF A;  3DTM A;  3A3I A;  4U3T A;  2I72 A;  5DF7 A;  1JWP A;  1YMS A;  2L1M A;  1GHM A;  4P0M A;  3VMA A;  2ZQD A;  3EEH A;  5DJT A;  1RGY A;  5FQQ A;  3CI6 A;  1G6A A;  4WUJ A;  4NKP A;  3CPT A;  4UA6 A;  5KSC A;  5E2F A;  1CI9 A;  2W1T B;  2JCH A;  4ZTK A;  3NHQ A;  3G2Z A;  4KUK A;  2K2N A;  1G6O A;  5EVI C;  4AFI A;  2HP6 A;  4G3W A;  1Y4O A;  3IX4 A;  1ZTU A;  3LY4 A;  3BQA A;  4EBN A;  3MXS A;  4NXG A;  4Y3I A;  5FL3 A;  2VGL M;  1AXB A;  4QD4 A;  1Y54 A;  5EVI D;  1L0D A;  2JN7 A;  2W27 A;  3DTI A;  4LRZ E;  4ZJ2 A;  4LGW A;  4E04 A;  4LFU A;  3NJA A;  1GA0 A;  1SKO B;  4X55 A;  5TFQ A;  3QP1 A;  4ZBE A;  4WYY A;  1ES3 A;  2BG1 A;  2M1C A;  2DMW A;  2OSU A;  4YIN A;  4WN5 A;  3R7W B;  1UGU A;  1E25 A;  4XUX A;  4JBF A;  1LSV A;  3MKE A;  4GW9 A;  2EXA A;  5L2F A;  2WKP A;  2WUQ A;  1MC0 A;  2PU2 A;  2V8F A;  3OC2 A;  4PMA A;  3P01 A;  2ZMA A;  1PZP A;  5L07 A;  3OPL A;  2O0Y A;  5DFY A;  2A24 B;  1MPL A;  2P74 A;  4KQQ A;  2LB9 A;  4OPR A;  3VSL A;  1SKO A;  1SCW A;  1UWN X;  1E3U A;  4YOF A;  2XK1 A;  3BFF A;  5GLA A;  1TS7 A;  3GQZ A;  2XF3 A;  4BBU A;  3SOI A;  1F2K A;  5FAQ A;  4IBR A;  5HAI A;  3KYE A;  3V3R A;  5CHM A;  3W4P A;  4ZJ3 A;  4EUV A;  5F5Y A;  2Y59 A;  3T4J A;  5FSR A;  5FEG A;  4WZ5 A;  2Y2M A;  2HJE A;  3IF6 C;  2HP5 A;  4ZAM A;  2PD8 A;  2XRO A;  2J3W A;  2UWX A;  3QNC A;  2A24 A;  3S7Q A;  3HJK A;  4GD8 A;  4C75 A;  2PT7 A;  4EUZ A;  1XX2 A;  1CK3 A;  1YLW A;  1PWD A;  2VV7 A;  4QWO A;  3S7O A;  4JPM A;  1PWG A;  3C2W A;  2BTF P;  1W5D A;  3BM6 A;  4OQG A;  2HZ5 A;  4UHU A;  1ZHH B;  2MJ6 A;  1MZU A;  3Q07 A;  4EQI A;  1PFL A;  4JXG A;  3EGX C;  3EWK A;  1TDL A;  4OLG A;  3GRJ A;  3E4P A;  5F68 A;  5FDH A;  4QU3 A;  5CEC A;  3T4T A;  4II7 A;  2PU4 A;  1NRF A;  3BRM A;  4PKY G;  3DAV A;  4HQA A;  1LT0 A;  1XGJ A;  1MKM A;  2R9X A;  2WKI A;  1OPX A;  2FZ0 A;  2EX6 A;  5A93 A;  3NEC A;  3D72 A;  1FQG A;  3MZD A;  2Z6C A;  3MZF A;  4DKI A;  3KSI A;  4Q0H A;  4LCL A;  3K2N A;  3WRT A;  2QHK A;  2RL3 A;  3FWL A;  5DTT A;  3KYZ A;  1Z09 A;  5AVE A;  5DF8 A;  5FAO A;  2FFF B;  1KVM A;  2WKH A;  3MSH A;  3V67 A;  4WBG A;  4EW7 A;  1BUL A;  4R3A A;  3BLS A;  3N7W A;  3LYX A;  5A91 A;  1HLU P;  3D9Y A;  3A3J A;  3PR6 A;  2ACG A;  3ZVW A;  1FIK A;  1L0E A;  4ARZ B;  4B4Z A;  2ZM0 A;  3NOP C;  1FCO A;  1NY0 A;  3JPU A;  1N9B A;  3KSH A;  4DXC A;  3B47 A;  1T1C A;  2Y2I A;  3TW8 A;  3OOV A;  3ZG0 A;  5EM0 A;  3LR5 A;  1ESU A;  3IQA A;  3ICY A;  1SDN A;  1PW1 A;  4WEK A;  1F9I A;  1QME A;  4P6Z M;  3I7J A;  3G32 A;  1K54 A;  3GTC A;  3D4F A;  4N9K A;  5GHY A;  5HWW A;  2ZQ9 A;  2W3G A;  5C5K A;  3CUE C;  2C6W B;  4X69 A;  3GR2 A;  2IWC A;  4Y0O A;  3P09 A;  1IYS A;  2OWJ A;  3TG9 A;  4ARZ A;  1N4O A;  1NZU A;  4CPK A;  2ZQA A;  4UA7 A;  2O9B A;  5CHU A;  1STZ A;  2EWV A;  3U4L P;  1L2S A;  3NDG A;  4BL2 A;  4N92 A;  2XD5 A;  2QYB A;  1GHI A;  1VHM A;  3HL9 A;  1JNU A;  1G28 A;  2JKR M;  3UB7 A;  4JKT A;  3H82 B;  5L09 A;  3WS5 A;  3FC7 A;  1H3Q A;  4N1H A;  4XXR A;  1BYW A;  3VP2 A;  1YLZ A;  3V3S A;  4E3L A;  4HJ6 A;  3MFD A;  3B3X A;  1ERQ A;  1EI5 A;  5CGW A;  4BD1 A;  1YMX A;  1E4D A;  2WKQ A;  3ZYT A;  2KLI A;  4RVA A;  4NEE D;  4L9G A;  4Y0U A;  5HWV A;  3UE0 A;  3H82 A;  2JHE A;  1AWI A;  4GN2 A;  4WZ5 C;  3KSG A;  4FSF A;  1T1A A;  5HL6 A;  3JVV A;  3S7P A;  3FV7 A;  4MN6 A;  5EVL A;  3BFG A;  4OPZ A;  5FI7 A;  3LO7 A;  2ZC4 B;  3T50 A;  1ONH A;  3BEC A;  5TJJ A;  1OME A;  3SW1 A;  2HPB A;  4FUW A;  3ZG8 B;  3PBN A;  5HD5 A;  1CEF A;  1IOU A;  1ACF A;  3G4P A;  1NYY A;  1XJ2 A;  3N8S A;  1M40 A;  4KG5 A;  2WAD A;  2D01 A;  4R23 A;  1IYO A;  3UMD A;  3MMH A;  3HLF A;  1IKG A;  3OCN A;  3VOY A;  2JKG A;  1ZG4 A;  3LR0 A;  2QMI A;  2Z2L B;  3QP2 A;  2A2L A;  3ITB A;  1FCN A;  2EXB A;  2H5S A;  2G2W A;  4E3O A;  5J3W A;  4HHD A;  2WAE A;  3FPW A;  1SDE A;  5EOO A;  2PAV P;  3R4K A;  4O0P A;  3S1Y A;  1J3W A;  5CTN A;  1IFQ A;  3UB5 P;  4HH3 A;  3HLD A;  1PW8 A;  3ZQ5 A;  1TDG A;  3FKV A;  5JYO A;  4M4X A;  1LL9 A;  2HDQ A;  2QZ6 A;  3AGE A;  3UDF A;  4OQ0 A;  4PM9 A;  1S1Y A;  2JKT I;  3W4Q A;  5J7E A;  5HDS A;  1BZA A;  3MQ0 A;  3SH8 A;  4OOY A;  5G18 A;  4JF6 A;  4WEL A;  1K57 A;  2VK3 A;  3MZE A;  3L9K A;  2VGK A;  4F94 A;  5M19 A;  1QMF A;  2V8C A;  4Q0J A;  5HFO A;  4EBP A;  2J3T D;  4OOL A;  4ZDX A;  4BL3 A;  2C5W B;  4UQI M;  2VA0 A;  1XJ6 A;  1TVF A;  4S2J A;  2DNS A;  5DTK A;  4I38 A;  3PTE A;  3ZFZ A;  4ETX A;  3IHB A;  5KIZ A;  4Y5F A;  3HLW A;  4EEU A;  5TBM B;  5F69 A;  5J8X A;  2VLG A;  3RXX A;  4M3K A;  5EPH A;  1OTI A;  3A0S A;  1K54 C;  2E8J A;  1DJB A;  3ZCZ A;  5KZH A;  1CF0 A;  3CJM A;  1S4S A;  3G35 A;  2X02 A;  2ZQ8 A;  4GB7 A;  1F98 A;  4HNB A;  5HWT A;  4WZ4 A;  2O9A A;  4NG2 A;  2J9O A;  2WZZ A;  5CX7 A;  5F83 A;  1W7F A;  2GNX A;  3QHY A;  2PDR A;  3IF5 A;  2PR6 A;  4MLL A;  4FTX A;  2Q9N A;  2XFT A;  3T1R A;  4C3Q A;  1MBL A;  4EQ1 A;  1WE4 A;  3JVU A;  3LIF A;  5TBM A;  1IEM A;  4KZ8 A;  4KZ6 A;  3MJQ A;  1GA9 A;  1BT5 A;  3GEC A;  5CTM A;  4UAA A;  2A3U A;  3BW6 A;  4P6B A;  3WS4 A;  4Y7P A;  3H7W B;  5EUA A;  4OVD A;  3CUE A;  2ZD8 A;  5AQA A;  3T1S A;  3DTK A;  3E4Q A;  1UWP X;  2Y2J A;  2XDM A;  4GDB A;  1W63 M;  1WYC A;  3M6H A;  4XUZ A;  2QJ5 A;  4QJG A;  1XJ4 A;  1PI4 A;  3HUO A;  1RGZ A;  3NDE A;  1S66 L;  4S2L A;  1HTZ A;  3LIE A;  5HX9 A;  4WLA A;  3IH8 A;  4Y2F A;  2W1T A;  1C3B A;  3TSG A;  4DDY A;  2Y2O A;  5L8M A;  3VE4 A;  5FEF A;  5K5B A;  2K31 A;  2ZC6 B;  1IKI A;  1PYY A; 
#chains in the Genus database with same CATH homology
 3H7W A;  5DKK A;  4LRX C;  3K2N A;  2QHK A;  2QWS A;  2XA7 M;  1TD5 A;  5J4E A;  4CLC C;  1EW0 A;  3KYZ A;  4DJ3 A;  3E4O A;  5AVE A;  2VX8 A;  4B93 A;  2L4R A;  4IUH A;  3LIA A;  3MF0 A;  5DF9 A;  4BWI A;  4ME4 A;  3MQO A;  3LID A;  4KQO A;  3V67 A;  3BQ8 A;  2VKS A;  4CLC E;  4EW7 A;  2WKR A;  3F1O B;  4R3A A;  2HJ9 C;  1T19 A;  3LYX A;  1N9N A;  1LSX A;  4R70 A;  4CLC D;  3E98 A;  1NLY A;  3PR6 A;  3EEA A;  2NUT C;  1OJG A;  3MQQ A;  4IJG A;  1X0O A;  5HDC A;  2M7U A;  1VB6 A;  4H6J A;  5F6A A;  2BAS A;  1YAX A;  4ARZ B;  1P9R A;  3R7W A;  3NOP C;  4BJP A;  1TF1 A;  2VV6 A;  4I3I A;  3HJI A;  4QPR A;  1DP9 A;  4GLQ A;  3KSH A;  4MDZ A;  3NOT C;  3ULF A;  3B47 A;  1T1C A;  4EER A;  4OOM A;  1YKD A;  3OBF A;  3OCL A;  2VZW A;  2GZA A;  3TW8 A;  3OOV A;  1GSW A;  4RQ9 A;  2OAQ 1;  3LR5 A;  3A0R A;  2V0U A;  3ICY A;  4WEK A;  1F9I A;  4I5S A;  5DFX A;  4O8G A;  3BWL A;  4P6Z S;  4P6Z M;  4HJ4 A;  3C8C A;  3LR4 A;  5IU1 A;  5HWW A;  2W3G A;  4F3L B;  5C5K A;  3F1N B;  3RTY A;  3CUE C;  3T4K A;  2O9C A;  2D02 A;  1S67 L;  1T18 A;  2P7J A;  4L9E A;  2W0N A;  5DKL A;  1YSP A;  1NLZ A;  1OJ5 A;  3LR3 A;  4MN5 A;  1KOU A;  3CIT A;  3TRC A;  2OWJ A;  4XT2 B;  3DBA A;  4ARZ A;  4GCZ A;  4LPZ A;  2ZBB A;  3C38 A;  2O99 A;  1NRJ A;  2VJW A;  1P0Z A;  2HV1 A;  4KQD A;  4K08 A;  2O9B A;  4G3V A;  2H28 A;  4L9F A;  2ZOH A;  1STZ A;  3IBJ A;  2EWV A;  2YKF A;  5G4Z A;  3RFB A;  5KSH A;  3PHY A;  2NUP C;  4IHQ A;  3LIB A;  2HF6 A;  4EXO A;  3LIC A;  2PYR A;  1XFN A;  2QKP A;  4G3K A;  4DN0 A;  3EQV A;  2QYB A;  4LRY C;  2VGL S;  3F1N A;  4F3L A;  1VHM A;  4ETZ A;  1JNU A;  1G28 A;  2JKR M;  3PBQ A;  3IBR A;  3UB7 A;  4NXB A;  2KX6 A;  1DRM A;  3K3C A;  3H82 B;  4CLC B;  4XT2 A;  4WF0 A;  2Z6D A;  2W3H A;  3FC7 A;  4WEJ A;  4B9O A;  2GJ3 A;  1H3Q A;  2R78 A;  3B42 A;  4GS9 B;  2PD7 A;  1BYW A;  2M7V A;  2V9A A;  3LI9 A;  4HJ6 A;  1OT9 A;  4HI4 A;  1XJ3 A;  5IS1 A;  4JGR A;  4JGQ A;  2K7S A;  4CQH A;  4HY8 A;  3EGD C;  1S1Z A;  1V9Y A;  4BBT A;  2VEA A;  4BMW A;  2WKQ A;  1TS6 A;  3ZYT A;  1LL8 A;  2KLI A;  4DMZ A;  4WL9 A;  4NEE D;  2W1R A;  3W2Z A;  1W63 Q;  2OAP 1;  4L9G A;  4HP4 A;  5HPI A;  5HWV A;  4MMN A;  3TE8 A;  3CWF A;  4ZRR A;  3H82 A;  3UB8 A;  2JHE A;  3CLO A;  4GJ4 A;  1YSQ A;  3KSG A;  2HGV A;  4FSF A;  3TJZ C;  1T1A A;  5HL6 A;  3JVV A;  3S7P A;  2J80 A;  4MN6 A;  2JKT M;  4GS9 A;  4O01 A;  3KX0 X;  4IUK A;  2PR5 A;  1OTD A;  5AVF A;  3A0V A;  3T50 A;  2KDK A;  1ODV A;  5HPF A;  4NXF A;  5TJJ A;  3SW1 A;  3F1O A;  4DJ2 A;  3PBN A;  1TS0 A;  5HD5 A;  4L0L A;  1IOU A;  1N9O A;  3E0Y A;  2L1M A;  1XJ2 A;  2LB5 A;  2JKR I;  3UE6 A;  3EEH A;  2D01 A;  5DJT A;  1D06 A;  3UB6 A;  4EET B;  3CI6 A;  3T4L A;  2OWH A;  3FPV A;  3UMD A;  3MMH A;  4LLO B;  4WUJ A;  4NKP A;  3OCN A;  3EOI A;  1S4R A;  2W1T B;  3LR0 A;  3H9W A;  4HP9 A;  1T1B A;  4Q0I A;  3NHQ A;  4KUK A;  2A2L A;  4HJ3 A;  2K2N A;  1G6O A;  2EA9 A;  4AFI A;  2G7U A;  4G3W A;  3BJN A;  3T4S A;  5J3W A;  3PXP A;  4HHD A;  1ZTU A;  3FPW A;  3D3O A;  2V1B A;  3R4K A;  4O0P A;  3BQA A;  5LBR A;  2W3E A;  1IFQ A;  1V9Z A;  5HZH A;  4HH3 A;  4NXG A;  1LSW A;  4Y3I A;  3F1P B;  3T4Q A;  3ZQ5 A;  1P97 A;  5FL3 A;  2VGL M;  4EES A;  3RH8 B;  4JGP A;  2JN7 A;  4I39 A;  2W27 A;  4LRZ E;  4M4X A;  3KYQ A;  2QJ7 A;  3PBS A;  4YWZ A;  1S1Y A;  5HSQ A;  5HD3 A;  3P7N A;  4MN7 A;  4E04 A;  2JKT I;  3NJA A;  3NOU C;  5J7E A;  4PAU A;  3O5Y A;  5HDS A;  2INW A;  3MQ0 A;  1XFQ A;  2XSS A;  2CMN A;  2KOI A;  3VV4 A;  2P04 A;  3KSF A;  1DP6 A;  3OLO A;  4WEL A;  1H8M A;  2GX5 A;  2M1C A;  4UEY A;  2DMW A;  3HCY A;  2YKH A;  4WN5 A;  3R7W B;  1UGU A;  3PYP A;  2ZMV A;  4Q0J A;  4HIA A;  4I3J A;  2J3T D;  2XA7 S;  4OOL A;  1LSV A;  4GW9 A;  4UQI S;  4UQI M;  2VA0 A;  1OT6 A;  1XJ6 A;  2WKP A;  4BBV A;  1MC0 A;  3F1P A;  4Z1W A;  1GSX A;  3U2A A;  4I38 A;  3OC2 A;  3BY8 A;  3P01 A;  4HH2 A;  1OTA A;  4ETX A;  3UB9 A;  1NWZ A;  4NXE A;  2OOL A;  2B18 A;  5KIZ A;  3EQU A;  4Y5F A;  3CAX A;  2O0Y A;  1WA9 A;  5DFY A;  5G4Y A;  4CLC A;  2A24 B;  2V1A A;  4EEU A;  4KUO A;  5TBM B;  5F69 A;  3UME A;  5HDD A;  2LB9 A;  2VLG A;  4EU0 A;  1OTI A;  3A0S A;  1UWN X;  3LI8 A;  4PKY A;  2L0W A;  4I3A A;  4PHT A;  4YOF A;  3FG8 A;  4R6L A;  1TS7 A;  5MC7 A;  4BBU A;  3PBR A;  1S4S A;  2P08 A;  3VE3 A;  4HNB A;  1F98 A;  5HWT A;  4YNR A;  4GHI B;  5AJG A;  2O9A A;  1Y28 A;  2Y79 A;  5CX7 A;  4EUV A;  2FH5 A;  5F5Y A;  2IA2 A;  3T4J A;  4HOI A;  1N9L A;  2GNX A;  2PDR A;  2HJE A;  2PR6 A;  5DJU A;  4FOF A;  2PYP A;  2PD8 A;  2XRO A;  2J3W A;  1P9W A;  2PHY A;  3UE3 A;  2A24 A;  3S7Q A;  5EFW A;  3HJK A;  4EQ1 A;  3LIF A;  3JVU A;  5TBM A;  3VOL A;  1GSV A;  3KO6 A;  2PT7 A;  1TS8 A;  2ZMF A;  3MJQ A;  3IS2 B;  3MXQ A;  3GEC A;  3PBT A;  2VV7 A;  3S7O A;  3BW6 A;  3C2W A;  4EEP A;  2I9V A;  5I5L A;  3B33 A;  3BY9 A;  2ZOI A;  1OTB A;  2XRN A;  3H7W B;  3GDI A;  2VV8 A;  1ZHH B;  3CUE A;  4MCW A;  2MJ6 A;  3E4Q A;  1UWP X;  1MZU A;  4GHI A;  2Y8H A;  3EGX C;  3EWK A;  1OTE A;  1W63 M;  3E4P A;  1F5M A;  2QJ5 A;  3PBO A;  5F68 A;  2B02 A;  1XJ4 A;  3T4T A;  5IT5 A;  4R38 A;  1S66 L;  4II7 A;  3LIE A;  5A8B A;  4PKY G;  4JGO A;  4HQA A;  4WLA A;  2W3D A;  1LT0 A;  3S7N A;  3LFV A;  1MKM A;  2J3T C;  4Y2F A;  2W1T A;  1OPX A;  2FZ0 A;  3MFX A;  2EWW A;  2V0W A;  3G6O A;  3MR0 A;  3IS2 A;  1DP8 A;  1D7E A;  3D72 A;  5L8M A;  3VE4 A;  3LUQ A;  4H6J B;  5K5B A;  3K3D A;  2Z6C A;  3T4O A;  2K31 A;  2W3F A;  3C30 A;  3KSI A;  4Q0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...