1GSXA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s/g51s mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITSRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
total genus 35
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsxA00
2PR6A 2JN7A 1OJGA 3H7WB 3C8CA 4F3LB 4NXBA 5HD5A 2QHKA 3LIBA 5HDSA 3RTYA 1LSWA 1XJ3A 1N9OA 1LL8A 3H82A 4L9GA 4WN5A 4R38A 3EEHA 4HOIA 4LRZE 3BY8A 4WLAA 1F9IA 4I3IA 3LIEA 4I3JA 4KUOA 4EERA 3PYPA 1N9NA 1D7EA 4EW7A 1DP9A 2ZOIA 4XT2B 3OLOA 3MFXA 2V1BA 3F1PB 3UE6A 4JGOA 2VLGA 3HJKA 5F5YA 3IBRA 2HV1A 1WA9A 1P0ZA 2WKQA 3EWKA 2D01A 5AVEA 3CAXA 2B02A 1NWZA 4HQAA 3LIFA 4I39A 4RQ9A 3VOLA 2QWSA 4K08A 3HJIA 5F6AA 4I38A 1VB6A 4EQ1A 3FG8A 3NHQA 1DRMA 1F98A 5HDDA 2KDKA 2M1CA 2D02A 3P7NA 5J4EA 1GSXA 3NOTC 4JGQA 5DKLA 1OT6A 5HWWA 2VV7A 1KOUA 4EEUA 4H6JB 4GHIA 1JNUA 1LSXA 1DP8A 4R70A 2PHYA 2VV8A 2QJ5A 2PYPA 1T1AA 4HH2A 3FC7A 1P97A 1S4RA 1TS7A 4LLOB 2JHEA 2V1AA 4BBTA 3CLOA 4DJ2A 4LRYC 5I5LA 2L1MA 4EEPA 3F1NB 3IS2A 4HH3A 3LI8A 5G4YA 4R3AA 1ODVA 4WUJA 2Z6CA 4HIAA 2R78A 2QJ7A 3KX0X 2YKFA 4E04A 5F69A 5HWVA 4B9OA 4GS9B 4LRXC 2A24B 3NOUC 5TBMB 1LT0A 1LSVA 3VE4A 3LICA 4BBUA 2PYRA 4YWZA 3LYXA 1XFQA 3F1OA 4HNBA 2CMNA 1XFNA 4I5SA 2OWHA 1OTIA 5EFWA 4JGRA 5HSQA 1Y28A 3BWLA 2INWA 2J80A 1T19A 2W0NA 4EXOA 3GECA 4HP4A 2WKRA 2W27A 5IS1A 4LPZA 3UB9A 3H82B 3E4OA 2GJ3A 1S1ZA 2EA9A 4HJ3A 1T18A 1MZUA 3K3DA 2ZOHA 4F3LA 4L9FA 3UMEA 3MQOA 4HJ6A 3MXQA 3MQQA 1UWNX 1EW0A 4EETB 3T50A 3E4PA 3BY9A 1OTDA 3NJAA 4HI4A 2L4RA 3C2WA 5G4ZA 4L9EA 2KX6A 3VE3A 2VEAA 3UB6A 3A0RA 2H28A 2BASA 2OWJA 1OT9A 2Z6DA 4KQDA 1V9YA 2OOLA 1TS0A 4R6LA 2QKPA 2V9AA 2P7JA 3ZQ5A 3B33A 1UGUA 4XT2A 4HHDA 4DJ3A 1S66L 3F1PA 2V0WA 1T1BA 3K3CA 1X0OA 1OTBA 2ZBBA 2YKHA 1D06A 1OTEA 4MN6A 1TS8A 1G28A 3H9WA 5A8BA 3G6OA 4NXFA 2L0WA 3NOPC 3SW1A 2PD7A 4JGPA 4WF0A 1GSVA 4GHIB 1TS6A 4GW9A 2I9VA 3LIDA 3A0VA 4I3AA 5DKKA 1N9LA 1OJ5A 4NXGA 4HP9A 5HZHA 4PKYG 5HDCA 1S4SA 3IS2B 3CWFA 4BBVA 5F68A 4H6JA 5DJTA 2VV6A 1XJ6A 3MR0A 1UWPX 3PHYA 5J3WA 3A0SA 1BYWA 1OTAA 1XJ4A 3UB8A 1S67L 3H7WA 2PD8A 3MJQA 5DJUA 1S1YA 1GSWA 3LUQA 3ICYA 2K7SA 3F1NA 1T1CA 3F1OB 4HY8A 4NXEA 5KIZA 4KUKA 4EESA 2WKPA 3LIAA 3LI9A 4PKYA 4GCZA 5HD3A 3UMDA 2V0UA 4HJ4A 3UB7A 4GS9A 4M4XA 1DP6A 2A24A 4MN5A 5IU1A 2PR5A 3GDIA 3ULFA 3D72A 1V9ZA 5J7EA 1XJ2A 2PDRA 5AVFA 5TBMA 3E4QA 3RH8B 5HWTA 4WL9A
chains in the Genus database with same CATH superfamily
2Y2KA 4NETA 5M1AA 4F3LB 1K54A 1YQSA 3KSGA 1G6AA 3NCKA 3BYDA 2HDQA 2QHKA 3JVVA 3LIBA 2HP5A 4IVKA 2HJEA 1LSWA 1XJ3A 1P9WA 3B47A 3MZEA 3MKFA 3QP4A 5CGXA 4S2KA 1Y54A 5FASA 5CTMA 4Q0IA 5EV0A 3L9KA 2VZWA 3GMWA 4KG2A 1K0KA 2XGNA 4B93A 4XXRA 4LRZE 4UEYA 4WEJA 1IKGA 2ZC4B 3CG5A 4I3JA 5E2FA 1M40A 5HX9A 1D7EA 3MKEA 4EW7A 4Y0TA 2XROA 3MFXA 3TRCA 3VV4A 5LBRA 1VEUB 5KSCA 1WE4A 4N92A 5AVEA 4Y2FA 3VSLA 2B02A 1K4FA 4R1GA 1NWZA 5D3OA 3A3EA 1N9BA 4G3VA 4HQAA 3CHWP 3G34A 2EFXA 3D4FA 1JWZA 4R4RA 3LIFA 1MKIA 3HCYA 3T12B 2GNXA 4I39A 4RQ9A 4PM8A 1KDSA 1ES5A 1VETB 2OAQ1 4JLFA 1BZAA 3OPHA 4QPRA 1KGEA 3U2AA 3DTIA 1F98A 3G30A 5MC7A 3Q7VA 3BLMA 3AGEA 1MWTA 1PNEA 3PAGA 4JXSA 5GHZA 1GSXA 5DKLA 4QB8A 1ALQA 1S6RA 1KOUA 4GHIA 1SKOA 4X56A 4R70A 2XFSA 5HFOA 2PHYA 4Y7PA 1K4EA 3RXWA 4GLQA 2LB9A 4OOLA 3ZG5A 2C6WB 4Q0JA 1TS7A 2EX6A 4GD8A 4S2PA 2V1AA 3CLOA 1CJFA 4X68A 4DJ2A 4GB7A 4EEPA 3WRTA 2VKSA 1GHIA 5G4YA 4PM9A 4R3AA 4IJGA 2Z6CA 1JWPA 2Y4AA 2QJ7A 2YKFA 2Y91A 4E04A 3IWQA 5A91A 5EM1A 4OVDA 5EVIC 1Q2QA 3LFVA 4Q0HA 3VFFA 3HLEA 5TFQA 3LY3A 3S7OA 1D1JA 1ZC2A 3DWZA 3W4OA 4K0WA 4E3IA 2J7VA 1O07A 1MBLA 1SKOB 5DTTA 4S2NA 4YWZA 3IH8A 2J3TC 3IHAA 3PBTA 1XFNA 1FR1A 1O7EA 3UY6A 3LCEA 1OTIA 5EFWA 2PRFA 5FQMA 4WZ4A 4FTXA 5FDSA 3BWLA 3T4QA 1DY6A 3CMZA 4X6TA 2XD5A 4ETZA 3RJUA 2W27A 1PZPA 5IS1A 4IVIA 2W3GA 4LPZA 2GJ3A 4U3TA 4E3JA 5GLCA 3UDIA 5G18A 5AQ9A 3O5YA 5E2EA 1XA1A 4EU0A 3NECA 3AGDA 3PR6A 4EETB 5FEFA 5CRFA 3BY9A 4X55A 4HI4A 1DJAA 4BD1A 1SDEA 5G4ZA 4CLCB 4ZJ2A 4RYEA 4L9EA 1NYMA 4BL2A 1PYYA 1HTZA 4Y17A 2BASA 1OT9A 3NBLA 2OOLA 1TS0A 1K57C 2V9AA 1NRFA 4P6BA 3SOIA 5A92A 5DTSA 1W63M 4S2LA 4DXCA 2P7JA 1OPXA 1UGUA 2RL3A 1SDNA 4XT2A 1EI5A 5CEBA 4UA7A 3HREA 1LLBA 2V0WA 4MDZA 1T1BA 2NUPC 5GLBA 1ZKJA 1X0OA 2ZMVA 5HW3A 2ZBBA 2G7UA 1BULA 2YKHA 4OP5A 2E8JA 3LY4A 2WYXA 2NUTC 5EE8A 1NY0A 1ERMA 1TDGA 2P74A 1G28A 1G6OA 2QMIA 3OCLA 1YLWA 3NOPC 4EV4A 1STZA 1ESIA 1H5XA 2PD7A 4WF0A 1XKZA 5L8MA 2O9BA 1J3WA 4GKUA 1E3UD 3HUMA 2X02A 1BLCA 3MXSA 3IF6A 3NC8A 4E3OA 4Y0UA 1FQGA 3IXBA 4FUWA 2XD1A 4HP9A 3A3DA 2GX5A 4N9KA 3IQAA 1XGIA 4KENB 1H8MA 2VGLS 3E0YA 4AFIA 1PW8A 5F68A 5EPHA 1PWDA 1XJ6A 4N1HA 3PHYA 3UPOA 3EGDC 3S7PA 1K55A 3G4PA 5FQIA 2G2UA 1KGFA 2V20A 3C30A 2V8FA 5KSHA 3EEAA 4WBGA 1YLTA 2OLUA 5DJUA 3C5AA 2J9PA 1RGZA 3OC2A 4YFMA 4B4XA 4Y3IA 1P9RA 1T1CA 1XP4A 4C75A 2XH9A 1JVJA 2W1TA 4PPRA 2WKPA 4X1LA 1NJ4A 4DE0A 3T4JA 3T1QB 3UMDA 3LO7A 4LFUA 4OKPA 3UB7A 1VHMA 5CHMA 3NY4A 2PR5A 3GDIA 1V9ZA 5AVFA 4WMCD 5HARA 3UN7A 3BQ8A 4PAUA 3UO9A 3QP2A 1PIOA 4OPQA 4FCFA 4JKTA 1OJGA 4EBNA 2R9WA 2DMWA 4DF6A 4UQIM 4DRTA 3HVFA 3S1YA 3TG9A 4B88A 5DF8A 2W3HA 1FSYA 3ZFZA 4R3BA 3IX3A 2E8IA 4OONA 3DTEA 1N9OA 3A3JA 2W1TB 2Y55A 1DJBA 1NZUA 3H82A 4CQHA 2WAFA 4X1MA 4K0XA 5E2HA 5FQ9A 4LGWA 3ZG7B 2ZC3B 4E3MA 2BTFP 2EWVA 1F9IA 1YLYA 3R4KA 4KZ6A 4IHQA 4EERA 1W8YA 3PYPA 4P6ZS 4FD8A 3V5MA 2ZOIA 5FSRA 1MWRA 2V1BA 5TJJA 4JGOA 3C4OA 4U0TA 4DXBA 2O99A 4L0LA 4JF6A 3FKVA 1WYCA 4ZJ1A 3KYZA 1PW1A 2PBYA 4WZ5C 4KZ3A 3W8KA 3VOLA 2QWSA 5F6AA 1E3UA 3BEBA 3NHQA 3MMHA 3IXGA 3T4LA 1G68A 5HDDA 2KDKA 1BLPA 2ZQ7A 2VX8A 5CGWA 2ZQDA 5J4EA 3ZG0A 3Q81A 4JGQA 3NDGA 1ONGA 3IBJA 3O3VA 3NI9A 4H6JB 5F1FA 3HUNA 3UE1A 3VMAA 1L2SA 2EFUA 3BJNA 3A3FA 2K2NA 1RGYA 1S4RA 1CK3A 3BFDA 5EVID 2JHEA 4UHUA 4WELA 5DTKA 1KVLA 2L1MA 1W8QA 3F1NB 3IS2A 3MBZA 2Y79A 3UDXA 3FWLA 3CUEC 3S7QA 1ODVA 3ZVWA 4ZDXA 3S4XA 2ZD8A 3O87A 3IF5A 5CERA 5F69A 3JPUA 5HWVA 3G35A 3N8RA 1F5MA 3UPNA 4Z9QA 4IBRA 4OQGA 3NOUC 3ZG8B 5JYPA 1LT0A 4YOFA 1N4OA 3VE4A 3LICA 1SHVA 4MCWA 2PYRA 1MWUA 1ACFA 3LYXA 4WMCA 3F1OA 1TF1A 4S2OA 3BLSA 3VP1A 2CMNA 4DE3A 2OWHA 3W4QA 2XSSA 1OMEA 4LCMA 3BFGA 4ZBEA 2J80A 1T19A 2OSUA 5L2FA 4EXOA 3HLFA 3GECA 3HLCA 3MS6A 5GL9A 4ID4A 3NIAA 3VOZA 3EQUA 2ZMAA 3V39A 3E4OA 1S1ZA 2EA9A 4NEED 1KVMA 4LV0A 3RFBA 3K3DA 1EWZA 1FILA 1ES4A 3MXQA 5F82A 1Y4OA 4FH4A 3LR3A 1PI5A 3T50A 1KDWA 5FI7A 2M7VA 5FQQA 2L4RA 2J9OA 4QD4A 5L09A 3QP1A 1LL9A 3M6BA 5FQKA 4R0QA 4KZ8A 1JTGA 4DKIA 2C5WB 4QJGA 1SCWA 3IH9A 3FV7A 2JKRI 2VEAA 4M3KA 3S22A 3N6IA 5AQ7A 4R6LA 2QKPA 5EVLA 3R7WA 3P01A 2J8YA 3ZQ5A 2P9VA 3QNBA 3OOVA 4HHDA 4WM9A 4X25A 1IYSA 1S66L 3F1PA 3K3CA 3LEQA 5IT5A 1D06A 3ITAA 2WK0A 4DE2A 3WS0A 3Q7VB 4Y5FA 1TS8A 3M2KA 5A8BA 2XK1A 4KZAA 3O86A 2Y2IA 3T4TA 1GA9A 3SW1A 1BSGA 4CLCC 2J3WA 3P09A 2WGWA 3UDFA 3IX8A 1K6SA 4GHIB 1TS6A 4E3NA 4GW9A 4Q8IA 3GR2A 3Q82A 5L07A 3BFEA 3ZDJA 3ZYTA 3SH9A 4RX3A 4BWIA 1SKFA 4I3AA 3IX4A 4FOFA 2HPBA 1PI4A 1N9LA 1OJ5A 5FI2A 3D9YA 5HZHA 4PKYG 5HDCA 5EVIA 2GZAA 1FR6A 4MBKA 2P9VB 5EECA 1S4SA 4OP8A 4Z1WA 4BQMA 3A0SA 1ZG4A 3ZCZA 1K25A 3NDEA 3GRJA 4JXWA 4KZ9A 3M2JA 3E2LA 4BLMA 2PBDP 2FFYA 1DJCA 3FYZA 3QHYA 1FCNA 2B18A 4QHCA 4RVAA 1PWGA 3ICYA 2H0TA 4HY8A 2Y8HA 4XUXA 5K5BA 1CI8A 4NXEA 3MSHA 2KOIA 2KLIA 4EESA 4OPRA 5GHYA 2IWDA 2HF6A 4ME4A 4GCZA 5HD3A 3ZG9B 1E25A 2V0UA 2EXBA 4GS9A 2H10A 1ES2A 1YLPA 2A24A 3GSGA 5DFYA 5FAOA 3OPLA 4P85A 1XJ2A 5TBMA 3HLDA 1XA7A 1IOUA 4WL9A 3KYEA 4OPZA 5HPFA 2PR6A 3PBOA 4NXBA 1NLZA 2ZC6B 4IBXA 3HLWA 2X71A 5HL6A 5HDSA 3RTYA 2ZC5B 2HP6A 2HGVA 5KMWA 3VP0A 3DBAA 4A5RA 1K57A 1LL8A 5FI6A 2Q9NA 1VQQA 2WUQA 1LI9A 2VJWA 4GN2A 4D2OA 4NK3A 3DWKA 4HOIA 3WS2A 2Y2GA 2JKRM 3SS4A 3UB5P 4BD0A 4I3IA 4QY6A 1NRJA 3BQAA 1CEFA 1GCEA 4O0PA 4ARZA 1N9NA 1DP9A 2HZ5A 4XT2B 4PMAA 5U47A 3OLOA 3PBSA 2WADA 1YM1A 3IBRA 2HV1A 2HDUA 3VP2A 1WA9A 5FDHA 2WKQA 2D01A 2WKHA 1I2SA 3LR5A 3BRMA 2OAP1 1IYPA 2LB5A 3HLGA 5DFXA 2X01A 3CZDA 1Z6FA 5TR7A 4UA6A 1YKDA 4FSFA 3C7UA 3O88A 5A90A 1YSPA 3QP6A 3IF6B 3HUOA 4I38A 3UE0A 4GD6A 3FG8A 2H5SA 3T4KA 4GJ4A 4R3JA 4EBLA 2M1CA 3KSHA 3E2KA 2D02A 3P7NA 3I7JA 3SH8A 3PBQA 1OT6A 4O7DA 4EEUA 3MZFA 5FQJA 1JNUA 1LSXA 2XRNA 4ETXA 1DP8A 2QJ5A 4LV2A 3G2YA 1T1AA 2JKTI 4Y13A 2V1ZA 1AWIA 1YAXA 1IEMA 5AJGA 2ZJ9A 3UPPA 3HLBA 1W79A 3D3OA 4BBTA 5I5LA 4R4SA 1K38A 5HAQA 3K2NA 1ZHHB 1F2KA 1PFLA 3G32A 4HH3A 1BLSA 2EXAA 2XA7M 3MQ0A 4HIAA 4HEFA 3OPRA 1U60A 1QMEA 1RCJA 2WZZA 3MXRA 4MMNA 5FEGA 1TVFA 1YPRA 5FATA 4LRXC 3VP3A 4R23A 3T1XA 4O8GA 2JE5A 4FH2A 4S2JA 1LSVA 2CC1A 1JTDA 3W4PA 4BBUA 1XFQA 5CHJA 2B95A 1ZG6A 3OCNA 3T1SA 4JGRA 2PU4A 5HSQA 5CTNA 3TW8A 5F1GA 1Y28A 4KQOA 2INWA 3EQVA 2H0YA 1IYQA 2WKIA 2FZ0A 3PTEA 4HP4A 1L0DA 2WGIA 3CPTA 5HPIA 3UB9A 3H82B 2Y2OA 1TD5A 4IUHA 1T18A 4Y0OA 3DW0A 2MJ6A 1H0MA 3GTCA 4EWFA 4OQ0A 4UA9A 1KGGA 4F3LA 1NLYA 3UMEA 3MQOA 3MZDA 3MQQA 1UWNX 1YMXA 5BOHA 3BFFA 3E4PA 4QY5A 3FPWA 1OTDA 4PM5A 2AVXA 1LHYA 3SZTA 1QMFA 1WYBA 2P04A 3T4OA 1EROA 4N1XA 4CPKA 1K54C 1L0GA 4HESA 4WZ5A 2Y2LA 2W3FA 4JPMA 2KX6A 3VE3A 1G5UA 3ZNTA 3QP8A 1S0WA 3UB6A 3A0RA 2P08A 3P98A 2JC7A 2H28A 5JYOA 2Z6DA 3BM6A 4KQDA 1V9YA 5KZHA 4ESPA 2ZL1A 4OLGA 1H8YA 4PM6A 4BJPA 3B33A 4YNRA 5HAPA 4CLCD 3ZNYA 1BLHA 4DJ3A 1L0FA 3QP5A 1OTBA 2J3TD 1VEUA 1XXMA 4DDYA 2OLVA 4MN6A 4ZRRA 1XGJA 3VOYA 1NYYA 3JVUA 2UV0E 3G6OA 3IXHA 4EUVA 3BW6A 2ZLYA 3VP4A 4JBFA 1GHMA 4NG2A 4JGPA 1GSVA 4D60A 5GLDA 3EGXC 1CI9A 3SS5A 2I9VA 3WS1A 4BL3A 1YLZA 4GDNA 1VETA 4IEDA 3A3IA 3A0VA 4II7A 3CUEA 3N4IA 4NKPA 2Y2JA 1LI0A 2JKTM 3ITBA 1I2WA 2ZL1B 5M18A 3VSKA 3WS5A 3C38A 2I72A 4OH0A 4WYYA 3IS2B 3CWFA 3IWOA 3HBRA 3DTKA 3MR0A 1UWPX 5J3WA 3DTMA 1BYWA 2G2WA 2ZQCA 3G2ZA 2DCFA 4LV3A 1S67L 2VA0A 3H7WA 3MF0A 4LV1A 2OV5A 3HL9A 3MJQA 1TDLA 2DRWA 1S1YA 2GDNA 4N9LA 1GSWA 3QNCA 2K7SA 1E4DA 1M6KA 3F1OB 2VGKA 3DAVA 4KZBA 2JKFA 4PKYA 2QZ6A 5CX7A 2ZM0A 5FL3A 4HJ4A 4ZAMA 1XPBA 4M4XA 2WGVA 1IKIA 1DP6A 4KG6A 2IA2A 4MN5A 5IU1A 2EWWA 3KSIA 5J7EA 4MBFA 4CLCE 1BTLA 4KG5A 5A93A 3CJMA 2XF3A 5HWTA 2ZQ9A 1L3LA 1W5DA 4DN0A 2JN7A 2W3EA 1CEGA 3H7WB 3C8CA 4G3KA 4E6WA 2UWXA 4BENA 5HD5A 1PZOA 2O0YA 2BG1A 3KO6A 2ACGA 2WZXA 5EVEA 4K91A 1FOFA 1Q2PA 2V8CA 4S2NC 5HL1A 3GQZA 5I94A 3L7HA 5GHXA 2XEPA 3BFCA 3GVBA 2PT7A 3Q07A 2Y2HA 1ZTUA 4OPYA 3LR0A 3MFDA 4L9GA 4WN5A 4E6XA 4LCLA 3S7NA 4R38A 1IYOA 3EEHA 4Y15A 2WAEA 3BY8A 4WLAA 3R7WB 5FAPA 5F83A 3LIEA 1J9MA 4KUOA 1KE0A 3ZGAB 3RXXA 2Y59A 1W7FA 3ZVTA 3F1PB 3UE6A 3N8SA 5EUAA 4CLCA 2VLGA 1SZVA 3HJKA 5F5YA 5FAQA 4H8RA 1CQAA 3ZHHA 1P0ZA 3EWKA 2DNSA 4LENA 3UNWA 3CAXA 1W63Q 3FZCA 2EX9A 4OOMA 1ESUA 4E3LA 4CJNA 1HZOA 2XLNA 3BECA 1ES3A 2WGWB 3V67A 1RP5A 4G3WA 3AGFA 2Z2LB 1HVBA 4KZ4A 4JF5A 4K08A 3HJIA 1VB6A 4EQ1A 4UAAA 1DRMA 4MLLA 2R9XA 2ZQ8A 3EOIA 1Z09A 2K31A 5M19A 2FFFB 2HDSA 5EVIB 3B42A 2JCHA 2XDMA 1TEMA 3KYQA 3NOTC 5HWWA 2VV7A 5AQAA 3VFHA 4RA7A 5TGFA 5C5KA 2VV8A 2PYPA 4HH2A 4KZ5A 4U0XA 3FC7A 4WEKA 3OZHA 2BLSA 1P97A 3WWXA 2JBFA 4LLOB 2ZQAA 1FSWA 1NXYA 4BMWA 4LRYC 3Q7ZA 4GDBA 3T1RA 4X53A 2VK3A 5DF7A 3IF6C 3LI8A 4WUJA 1IELA 3OBFA 2R78A 4OQHA 5DF9A 3NULA 3KX0X 2PU2A 3V3RA 4JXGA 5EM0A 1CF0A 1C3BA 1LL5A 4F94A 4B9OA 3CITA 4GS9B 3IXDA 4OLDA 2A24B 1BT5A 1K6RA 3TJZC 5TBMB 3G31A 4JXVA 4OOYA 2M7UA 1K55C 2ZM8A 5IHVA 2Y2QA 4HNBA 5CGSA 2VGLM 4I5SA 2Y2PA 3PAEA 5GLAA 3PBRA 2B5RA 4GOGA 4P87A 5EOOA 1K56D 1PRQA 4EUZA 3CI6A 4DMZA 5CXWA 4QWOA 2W0NA 2A3UA 3LEZA 3KSFA 2WKRA 5CECA 1MKMA 3TOIA 4B4ZA 2A2LA 1GA0A 2O9CA 4HJ3A 1MZUA 1YT4A 4S2MA 1BUEA 5L10A 5AQBA 3IWIA 3T4SA 2Q0OA 2Q9MA 1I5QA 2ZOHA 1PWCA 4YINA 1H3QA 4L9FA 3U4LP 4GNUA 4MNRA 4HJ6A 3FPVA 1AXBA 1EW0A 2RCXA 2Y2NA 4HBTA 4ARZB 3UE3A 3TE8A 3NJAA 4IUKA 1L0EA 3C2WA 1HD8A 5E2GA 5J8XA 3Q1FA 2W3DA 4O01A 3E98A 1FCMA 2QYBA 3N7WA 5CHUA 1ERQA 3PBNA 1VM1A 2OWJA 1MWSA 4RX2A 3WRZA 1YLJA 2XFTA 2IWCA 4EBPA 1YMSA 4ZTKA 4EQIA 2W1RA 4S2IA 4X69A 3FKWA 1JWVA 4UQIS 2FH5A 1OTEA 1GHPA 4DE1A 3IHBA 1NZOA 2EX8A 5CEDA 3PXPA 3C4PA 3H9WA 3GV9A 4NXFA 3V3SA 2L0WA 4KZ7A 2XA7S 4PM7A 2XQZA 4XUZA 2VGJA 5E43A 3LR4A 4MEZA 2A49A 4P6ZM 1MY8A 2HP9A 3LIDA 3B3XA 1MXOA 5HAIA 5DKKA 1MC0A 4DDSA 1FCOA 4C6YA 4NXGA 2Y2MA 4KQQA 2WKEA 3IT9A 3N8LA 4KQRA 2HDRA 2O9AA 4JF4A 4C3QA 4GZBA 4PHTA 4BBVA 1FIKA 3OPPA 2Z2MB 4H6JA 5DJTA 2VV6A 4E3KA 4HBUA 4QU3A 1OTAA 1XJ4A 1IFQA 3UB8A 2PAVP 2JKGA 2QPNA 2PD8A 2ZM2A 3M6HA 4MBHA 4MN7A 3LUQA 3W2ZA 3F1NA 3TSGA 3C7VA 5KIZA 3SH7A 1MPLA 4KUKA 2HJ9C 2V2FF 3LIAA 2ZC7A 3LGOA 3V50A 3LI9A 4ZJ3A 2EX2A 1A0KA 3WS4A 1YSQA 3SS3A 4OQIA 4P0MA 5DVAA 1H8ZA 2XR0A 1HLUP 1K56A 3ULFA 2IWBA 3D72A 5FA7A 2PDRA 2ZMFA 3ISGA 3RH8B 3E4QA 3CPTB 5EOEA 1XX2A 3JYIA 1KE4A 1KE3A 1ONHA
chains in the Genus database with same CATH topology
5HPFA 2PR6A 4DN0A 2JN7A 2W3EA 1OJGA 3H7WB 3PBOA 2DMWA 3C8CA 4F3LB 4G3KA 4UQIM 4NXBA 3KSGA 5HD5A 2O0YA 3KO6A 1NLZA 2QHKA 3JVVA 3LIBA 5HL6A 2W3HA 5HDSA 2HJEA 3RTYA 1LSWA 2HGVA 1XJ3A 1P9WA 3B47A 3DBAA 1N9OA 1LL8A 2W1TB 2PT7A 4CQHA 3H82A 1ZTUA 4Q0IA 3LR0A 2VZWA 4L9GA 4WN5A 2VJWA 3S7NA 4R38A 4B93A 3EEHA 4HOIA 4LRZE 4UEYA 3BY8A 2JKRM 4WEJA 4WLAA 3R7WB 2EWVA 1F9IA 3R4KA 4I3IA 1NRJA 3LIEA 3BQAA 4I3JA 4KUOA 4IHQA 4EERA 4ARZA 3PYPA 4O0PA 1N9NA 4P6ZS 1D7EA 4EW7A 1DP9A 2ZOIA 4XT2B 2XROA 3OLOA 3MFXA 3PBSA 3TRCA 2V1BA 3F1PB 3UE6A 5TJJA 4JGOA 4CLCA 2VLGA 3HJKA 5F5YA 3IBRA 3VV4A 5LBRA 2HV1A 1WA9A 1P0ZA 2WKQA 3EWKA 2D01A 5AVEA 3CAXA 4Y2FA 3LR5A 1W63Q 2B02A 2O99A 4L0LA 2OAP1 4OOMA 1NWZA 2LB5A 4G3VA 3KYZA 5DFXA 4HQAA 3V67A 3LIFA 3HCYA 2GNXA 4I39A 4G3WA 4RQ9A 1YKDA 4FSFA 1YSPA 3VOLA 2OAQ1 2QWSA 4K08A 3HJIA 5F6AA 4I38A 1VB6A 4QPRA 4EQ1A 3FG8A 3U2AA 3NHQA 3MMHA 1DRMA 3T4KA 1F98A 3T4LA 3EOIA 4GJ4A 5MC7A 2K31A 5HDDA 2KDKA 2M1CA 3B42A 3KSHA 2VX8A 2D02A 3P7NA 5J4EA 1GSXA 3KYQA 3NOTC 4JGQA 3PBQA 5DKLA 1OT6A 5HWWA 2VV7A 1KOUA 4EEUA 3IBJA 4H6JB 4GHIA 1JNUA 1LSXA 2XRNA 4ETXA 1DP8A 3BJNA 4R70A 5C5KA 2PHYA 2VV8A 2QJ5A 2PYPA 1T1AA 2JKTI 4HH2A 4GLQA 2LB9A 4OOLA 2K2NA 3FC7A 4WEKA 1YAXA 5AJGA 1P97A 1S4RA 4Q0JA 1TS7A 4LLOB 2JHEA 3D3OA 4WELA 2V1AA 4BBTA 3CLOA 4DJ2A 4BMWA 4LRYC 5I5LA 2L1MA 4EEPA 3K2NA 3F1NB 3IS2A 1ZHHB 2Y79A 2VKSA 4HH3A 3LI8A 5G4YA 3CUEC 4R3AA 1ODVA 2XA7M 4WUJA 3S7QA 2Z6CA 3MQ0A 4HIAA 3OBFA 4IJGA 2R78A 5DF9A 2QJ7A 3KX0X 2YKFA 4E04A 5F69A 4MMNA 5HWVA 3LFVA 4Q0HA 1F5MA 4B9OA 3CITA 4GS9B 4LRXC 2A24B 3S7OA 4O8GA 3TJZC 3NOUC 5TBMB 1LT0A 4YOFA 1LSVA 3VE4A 2M7UA 3LICA 4BBUA 4MCWA 2PYRA 4YWZA 3LYXA 1XFQA 3F1OA 2J3TC 1TF1A 3PBTA 4HNBA 2VGLM 2CMNA 1XFNA 4I5SA 2OWHA 1OTIA 3OCNA 5EFWA 4JGRA 2XSSA 5HSQA 3PBRA 3TW8A 1Y28A 4KQOA 3BWLA 2INWA 2J80A 3EQVA 1T19A 3T4QA 3CI6A 4DMZA 2W0NA 2FZ0A 4EXOA 3GECA 4HP4A 3KSFA 2WKRA 4ETZA 2W27A 1MKMA 5IS1A 3EQUA 5HPIA 2W3GA 4LPZA 2A2LA 3H82B 3UB9A 1TD5A 3E4OA 2O9CA 2GJ3A 1S1ZA 2EA9A 4HJ3A 1T18A 4IUHA 1MZUA 4NEED 2MJ6A 3T4SA 3O5YA 3RFBA 3K3DA 2ZOHA 4F3LA 1H3QA 1NLYA 4L9FA 3UMEA 3MQOA 4HJ6A 4EU0A 3FPVA 3MQQA 3MXQA 1UWNX 1EW0A 3PR6A 4ARZB 4EETB 3LR3A 3T50A 3E4PA 3UE3A 3BY9A 3FPWA 1OTDA 3TE8A 3NJAA 4HI4A 2M7VA 4IUKA 2L4RA 3C2WA 2P04A 5G4ZA 2W3DA 3T4OA 4CLCB 4O01A 4L9EA 3E98A 2QYBA 2W3FA 2KX6A 3VE3A 2JKRI 2VEAA 3UB6A 3A0RA 3PBNA 2P08A 2H28A 2BASA 2OWJA 1OT9A 2Z6DA 4KQDA 1V9YA 2OOLA 1TS0A 4R6LA 2QKPA 2V9AA 3R7WA 3P01A 1W63M 2P7JA 3ZQ5A 1OPXA 4BJPA 3B33A 4YNRA 1UGUA 4CLCD 3OOVA 4XT2A 4HHDA 4DJ3A 1S66L 3F1PA 2V0WA 4MDZA 1T1BA 2W1RA 2NUPC 3K3CA 2ZMVA 1X0OA 1OTBA 2J3TD 2ZBBA 4UQIS 2G7UA 2YKHA 5IT5A 2FH5A 1D06A 1OTEA 2NUTC 4MN6A 4ZRRA 4Y5FA 3JVUA 3PXPA 1TS8A 1G28A 1G6OA 3H9WA 5A8BA 3G6OA 4NXFA 2L0WA 4EUVA 3BW6A 3OCLA 3T4TA 3NOPC 1STZA 3SW1A 4CLCC 2XA7S 2J3WA 2PD7A 4JGPA 4WF0A 1GSVA 5L8MA 4GHIB 3LR4A 1TS6A 3EGXC 4GW9A 2O9BA 2I9VA 4P6ZM 3ZYTA 3LIDA 4BWIA 3A0VA 4II7A 3CUEA 4I3AA 5DKKA 4NKPA 1MC0A 4FOFA 1N9LA 1OJ5A 2JKTM 4NXGA 4HP9A 5HZHA 4PKYG 5HDCA 2GZAA 3C38A 2GX5A 1S4SA 2O9AA 3IS2B 3CWFA 1H8MA 2VGLS 3E0YA 4PHTA 4BBVA 4AFIA 5F68A 4H6JA 5DJTA 2VV6A 1XJ6A 4Z1WA 3MR0A 1UWPX 3PHYA 5J3WA 3EGDC 3A0SA 3S7PA 1BYWA 1OTAA 1XJ4A 1IFQA 3UB8A 1S67L 2VA0A 3C30A 3H7WA 5KSHA 3MF0A 3EEAA 2PD8A 3MJQA 5DJUA 1S1YA 2B18A 3OC2A 1GSWA 4Y3IA 4MN7A 3LUQA 3ICYA 1P9RA 2K7SA 3F1NA 1T1CA 3W2ZA 3F1OB 2Y8HA 4HY8A 5K5BA 4NXEA 5KIZA 4KUKA 2KOIA 2HJ9C 2KLIA 2W1TA 4EESA 2WKPA 3LIAA 3LI9A 4PKYA 2HF6A 3T4JA 5CX7A 4ME4A 4GCZA 5HD3A 5FL3A 3UMDA 1YSQA 2V0UA 4HJ4A 3UB7A 4GS9A 1VHMA 4M4XA 1DP6A 2A24A 2IA2A 4MN5A 5IU1A 5DFYA 2EWWA 2PR5A 3GDIA 3ULFA 3D72A 1V9ZA 3KSIA 5J7EA 1XJ2A 2PDRA 2ZMFA 5AVFA 5TBMA 3E4QA 3RH8B 4CLCE 3BQ8A 4PAUA 5HWTA 1IOUA 4WL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR6 A;  2JN7 A;  1OJG A;  3H7W B;  3C8C A;  4F3L B;  4NXB A;  5HD5 A;  2QHK A;  3LIB A;  5HDS A;  3RTY A;  1LSW A;  1XJ3 A;  1N9O A;  1LL8 A;  3H82 A;  4L9G A;  4WN5 A;  4R38 A;  3EEH A;  4HOI A;  4LRZ E;  3BY8 A;  4WLA A;  1F9I A;  4I3I A;  3LIE A;  4I3J A;  4KUO A;  4EER A;  3PYP A;  1N9N A;  1D7E A;  4EW7 A;  1DP9 A;  2ZOI A;  4XT2 B;  3OLO A;  3MFX A;  2V1B A;  3F1P B;  3UE6 A;  4JGO A;  2VLG A;  3HJK A;  5F5Y A;  3IBR A;  2HV1 A;  1WA9 A;  1P0Z A;  2WKQ A;  3EWK A;  2D01 A;  5AVE A;  3CAX A;  2B02 A;  1NWZ A;  4HQA A;  3LIF A;  4I39 A;  4RQ9 A;  3VOL A;  2QWS A;  4K08 A;  3HJI A;  5F6A A;  4I38 A;  1VB6 A;  4EQ1 A;  3FG8 A;  3NHQ A;  1DRM A;  1F98 A;  5HDD A;  2KDK A;  2M1C A;  2D02 A;  3P7N A;  5J4E A;  1GSX A;  3NOT C;  4JGQ A;  5DKL A;  1OT6 A;  5HWW A;  2VV7 A;  1KOU A;  4EEU A;  4H6J B;  4GHI A;  1JNU A;  1LSX A;  1DP8 A;  4R70 A;  2PHY A;  2VV8 A;  2QJ5 A;  2PYP A;  1T1A A;  4HH2 A;  3FC7 A;  1P97 A;  1S4R A;  1TS7 A;  4LLO B;  2JHE A;  2V1A A;  4BBT A;  3CLO A;  4DJ2 A;  4LRY C;  5I5L A;  2L1M A;  4EEP A;  3F1N B;  3IS2 A;  4HH3 A;  3LI8 A;  5G4Y A;  4R3A A;  1ODV A;  4WUJ A;  2Z6C A;  4HIA A;  2R78 A;  2QJ7 A;  3KX0 X;  2YKF A;  4E04 A;  5F69 A;  5HWV A;  4B9O A;  4GS9 B;  4LRX C;  2A24 B;  3NOU C;  5TBM B;  1LT0 A;  1LSV A;  3VE4 A;  3LIC A;  4BBU A;  2PYR A;  4YWZ A;  3LYX A;  1XFQ A;  3F1O A;  4HNB A;  2CMN A;  1XFN A;  4I5S A;  2OWH A;  1OTI A;  5EFW A;  4JGR A;  5HSQ A;  1Y28 A;  3BWL A;  2INW A;  2J80 A;  1T19 A;  2W0N A;  4EXO A;  3GEC A;  4HP4 A;  2WKR A;  2W27 A;  5IS1 A;  4LPZ A;  3UB9 A;  3H82 B;  3E4O A;  2GJ3 A;  1S1Z A;  2EA9 A;  4HJ3 A;  1T18 A;  1MZU A;  3K3D A;  2ZOH A;  4F3L A;  4L9F A;  3UME A;  3MQO A;  4HJ6 A;  3MXQ A;  3MQQ A;  1UWN X;  1EW0 A;  4EET B;  3T50 A;  3E4P A;  3BY9 A;  1OTD A;  3NJA A;  4HI4 A;  2L4R A;  3C2W A;  5G4Z A;  4L9E A;  2KX6 A;  3VE3 A;  2VEA A;  3UB6 A;  3A0R A;  2H28 A;  2BAS A;  2OWJ A;  1OT9 A;  2Z6D A;  4KQD A;  1V9Y A;  2OOL A;  1TS0 A;  4R6L A;  2QKP A;  2V9A A;  2P7J A;  3ZQ5 A;  3B33 A;  1UGU A;  4XT2 A;  4HHD A;  4DJ3 A;  1S66 L;  3F1P A;  2V0W A;  1T1B A;  3K3C A;  1X0O A;  1OTB A;  2ZBB A;  2YKH A;  1D06 A;  1OTE A;  4MN6 A;  1TS8 A;  1G28 A;  3H9W A;  5A8B A;  3G6O A;  4NXF A;  2L0W A;  3NOP C;  3SW1 A;  2PD7 A;  4JGP A;  4WF0 A;  1GSV A;  4GHI B;  1TS6 A;  4GW9 A;  2I9V A;  3LID A;  3A0V A;  4I3A A;  5DKK A;  1N9L A;  1OJ5 A;  4NXG A;  4HP9 A;  5HZH A;  4PKY G;  5HDC A;  1S4S A;  3IS2 B;  3CWF A;  4BBV A;  5F68 A;  4H6J A;  5DJT A;  2VV6 A;  1XJ6 A;  3MR0 A;  1UWP X;  3PHY A;  5J3W A;  3A0S A;  1BYW A;  1OTA A;  1XJ4 A;  3UB8 A;  1S67 L;  3H7W A;  2PD8 A;  3MJQ A;  5DJU A;  1S1Y A;  1GSW A;  3LUQ A;  3ICY A;  2K7S A;  3F1N A;  1T1C A;  3F1O B;  4HY8 A;  4NXE A;  5KIZ A;  4KUK A;  4EES A;  2WKP A;  3LIA A;  3LI9 A;  4PKY A;  4GCZ A;  5HD3 A;  3UMD A;  2V0U A;  4HJ4 A;  3UB7 A;  4GS9 A;  4M4X A;  1DP6 A;  2A24 A;  4MN5 A;  5IU1 A;  2PR5 A;  3GDI A;  3ULF A;  3D72 A;  1V9Z A;  5J7E A;  1XJ2 A;  2PDR A;  5AVF A;  5TBM A;  3E4Q A;  3RH8 B;  5HWT A;  4WL9 A; 
#chains in the Genus database with same CATH topology
 2Y2K A;  4NET A;  5M1A A;  4F3L B;  1K54 A;  1YQS A;  3KSG A;  1G6A A;  3NCK A;  3BYD A;  2HDQ A;  2QHK A;  3JVV A;  3LIB A;  2HP5 A;  4IVK A;  2HJE A;  1LSW A;  1XJ3 A;  1P9W A;  3B47 A;  3MZE A;  3MKF A;  3QP4 A;  5CGX A;  4S2K A;  1Y54 A;  5FAS A;  5CTM A;  4Q0I A;  5EV0 A;  3L9K A;  2VZW A;  3GMW A;  4KG2 A;  1K0K A;  2XGN A;  4B93 A;  4XXR A;  4LRZ E;  4UEY A;  4WEJ A;  1IKG A;  2ZC4 B;  3CG5 A;  4I3J A;  5E2F A;  1M40 A;  5HX9 A;  1D7E A;  3MKE A;  4EW7 A;  4Y0T A;  2XRO A;  3MFX A;  3TRC A;  3VV4 A;  5LBR A;  1VEU B;  5KSC A;  1WE4 A;  4N92 A;  5AVE A;  4Y2F A;  3VSL A;  2B02 A;  1K4F A;  4R1G A;  1NWZ A;  5D3O A;  3A3E A;  1N9B A;  4G3V A;  4HQA A;  3CHW P;  3G34 A;  2EFX A;  3D4F A;  1JWZ A;  4R4R A;  3LIF A;  1MKI A;  3HCY A;  3T12 B;  2GNX A;  4I39 A;  4RQ9 A;  4PM8 A;  1KDS A;  1ES5 A;  1VET B;  2OAQ 1;  4JLF A;  1BZA A;  3OPH A;  4QPR A;  1KGE A;  3U2A A;  3DTI A;  1F98 A;  3G30 A;  5MC7 A;  3Q7V A;  3BLM A;  3AGE A;  1MWT A;  1PNE A;  3PAG A;  4JXS A;  5GHZ A;  1GSX A;  5DKL A;  4QB8 A;  1ALQ A;  1S6R A;  1KOU A;  4GHI A;  1SKO A;  4X56 A;  4R70 A;  2XFS A;  5HFO A;  2PHY A;  4Y7P A;  1K4E A;  3RXW A;  4GLQ A;  2LB9 A;  4OOL A;  3ZG5 A;  2C6W B;  4Q0J A;  1TS7 A;  2EX6 A;  4GD8 A;  4S2P A;  2V1A A;  3CLO A;  1CJF A;  4X68 A;  4DJ2 A;  4GB7 A;  4EEP A;  3WRT A;  2VKS A;  1GHI A;  5G4Y A;  4PM9 A;  4R3A A;  4IJG A;  2Z6C A;  1JWP A;  2Y4A A;  2QJ7 A;  2YKF A;  2Y91 A;  4E04 A;  3IWQ A;  5A91 A;  5EM1 A;  4OVD A;  5EVI C;  1Q2Q A;  3LFV A;  4Q0H A;  3VFF A;  3HLE A;  5TFQ A;  3LY3 A;  3S7O A;  1D1J A;  1ZC2 A;  3DWZ A;  3W4O A;  4K0W A;  4E3I A;  2J7V A;  1O07 A;  1MBL A;  1SKO B;  5DTT A;  4S2N A;  4YWZ A;  3IH8 A;  2J3T C;  3IHA A;  3PBT A;  1XFN A;  1FR1 A;  1O7E A;  3UY6 A;  3LCE A;  1OTI A;  5EFW A;  2PRF A;  5FQM A;  4WZ4 A;  4FTX A;  5FDS A;  3BWL A;  3T4Q A;  1DY6 A;  3CMZ A;  4X6T A;  2XD5 A;  4ETZ A;  3RJU A;  2W27 A;  1PZP A;  5IS1 A;  4IVI A;  2W3G A;  4LPZ A;  2GJ3 A;  4U3T A;  4E3J A;  5GLC A;  3UDI A;  5G18 A;  5AQ9 A;  3O5Y A;  5E2E A;  1XA1 A;  4EU0 A;  3NEC A;  3AGD A;  3PR6 A;  4EET B;  5FEF A;  5CRF A;  3BY9 A;  4X55 A;  4HI4 A;  1DJA A;  4BD1 A;  1SDE A;  5G4Z A;  4CLC B;  4ZJ2 A;  4RYE A;  4L9E A;  1NYM A;  4BL2 A;  1PYY A;  1HTZ A;  4Y17 A;  2BAS A;  1OT9 A;  3NBL A;  2OOL A;  1TS0 A;  1K57 C;  2V9A A;  1NRF A;  4P6B A;  3SOI A;  5A92 A;  5DTS A;  1W63 M;  4S2L A;  4DXC A;  2P7J A;  1OPX A;  1UGU A;  2RL3 A;  1SDN A;  4XT2 A;  1EI5 A;  5CEB A;  4UA7 A;  3HRE A;  1LLB A;  2V0W A;  4MDZ A;  1T1B A;  2NUP C;  5GLB A;  1ZKJ A;  1X0O A;  2ZMV A;  5HW3 A;  2ZBB A;  2G7U A;  1BUL A;  2YKH A;  4OP5 A;  2E8J A;  3LY4 A;  2WYX A;  2NUT C;  5EE8 A;  1NY0 A;  1ERM A;  1TDG A;  2P74 A;  1G28 A;  1G6O A;  2QMI A;  3OCL A;  1YLW A;  3NOP C;  4EV4 A;  1STZ A;  1ESI A;  1H5X A;  2PD7 A;  4WF0 A;  1XKZ A;  5L8M A;  2O9B A;  1J3W A;  4GKU A;  1E3U D;  3HUM A;  2X02 A;  1BLC A;  3MXS A;  3IF6 A;  3NC8 A;  4E3O A;  4Y0U A;  1FQG A;  3IXB A;  4FUW A;  2XD1 A;  4HP9 A;  3A3D A;  2GX5 A;  4N9K A;  3IQA A;  1XGI A;  4KEN B;  1H8M A;  2VGL S;  3E0Y A;  4AFI A;  1PW8 A;  5F68 A;  5EPH A;  1PWD A;  1XJ6 A;  4N1H A;  3PHY A;  3UPO A;  3EGD C;  3S7P A;  1K55 A;  3G4P A;  5FQI A;  2G2U A;  1KGF A;  2V20 A;  3C30 A;  2V8F A;  5KSH A;  3EEA A;  4WBG A;  1YLT A;  2OLU A;  5DJU A;  3C5A A;  2J9P A;  1RGZ A;  3OC2 A;  4YFM A;  4B4X A;  4Y3I A;  1P9R A;  1T1C A;  1XP4 A;  4C75 A;  2XH9 A;  1JVJ A;  2W1T A;  4PPR A;  2WKP A;  4X1L A;  1NJ4 A;  4DE0 A;  3T4J A;  3T1Q B;  3UMD A;  3LO7 A;  4LFU A;  4OKP A;  3UB7 A;  1VHM A;  5CHM A;  3NY4 A;  2PR5 A;  3GDI A;  1V9Z A;  5AVF A;  4WMC D;  5HAR A;  3UN7 A;  3BQ8 A;  4PAU A;  3UO9 A;  3QP2 A;  1PIO A;  4OPQ A;  4FCF A;  4JKT A;  1OJG A;  4EBN A;  2R9W A;  2DMW A;  4DF6 A;  4UQI M;  4DRT A;  3HVF A;  3S1Y A;  3TG9 A;  4B88 A;  5DF8 A;  2W3H A;  1FSY A;  3ZFZ A;  4R3B A;  3IX3 A;  2E8I A;  4OON A;  3DTE A;  1N9O A;  3A3J A;  2W1T B;  2Y55 A;  1DJB A;  1NZU A;  3H82 A;  4CQH A;  2WAF A;  4X1M A;  4K0X A;  5E2H A;  5FQ9 A;  4LGW A;  3ZG7 B;  2ZC3 B;  4E3M A;  2BTF P;  2EWV A;  1F9I A;  1YLY A;  3R4K A;  4KZ6 A;  4IHQ A;  4EER A;  1W8Y A;  3PYP A;  4P6Z S;  4FD8 A;  3V5M A;  2ZOI A;  5FSR A;  1MWR A;  2V1B A;  5TJJ A;  4JGO A;  3C4O A;  4U0T A;  4DXB A;  2O99 A;  4L0L A;  4JF6 A;  3FKV A;  1WYC A;  4ZJ1 A;  3KYZ A;  1PW1 A;  2PBY A;  4WZ5 C;  4KZ3 A;  3W8K A;  3VOL A;  2QWS A;  5F6A A;  1E3U A;  3BEB A;  3NHQ A;  3MMH A;  3IXG A;  3T4L A;  1G68 A;  5HDD A;  2KDK A;  1BLP A;  2ZQ7 A;  2VX8 A;  5CGW A;  2ZQD A;  5J4E A;  3ZG0 A;  3Q81 A;  4JGQ A;  3NDG A;  1ONG A;  3IBJ A;  3O3V A;  3NI9 A;  4H6J B;  5F1F A;  3HUN A;  3UE1 A;  3VMA A;  1L2S A;  2EFU A;  3BJN A;  3A3F A;  2K2N A;  1RGY A;  1S4R A;  1CK3 A;  3BFD A;  5EVI D;  2JHE A;  4UHU A;  4WEL A;  5DTK A;  1KVL A;  2L1M A;  1W8Q A;  3F1N B;  3IS2 A;  3MBZ A;  2Y79 A;  3UDX A;  3FWL A;  3CUE C;  3S7Q A;  1ODV A;  3ZVW A;  4ZDX A;  3S4X A;  2ZD8 A;  3O87 A;  3IF5 A;  5CER A;  5F69 A;  3JPU A;  5HWV A;  3G35 A;  3N8R A;  1F5M A;  3UPN A;  4Z9Q A;  4IBR A;  4OQG A;  3NOU C;  3ZG8 B;  5JYP A;  1LT0 A;  4YOF A;  1N4O A;  3VE4 A;  3LIC A;  1SHV A;  4MCW A;  2PYR A;  1MWU A;  1ACF A;  3LYX A;  4WMC A;  3F1O A;  1TF1 A;  4S2O A;  3BLS A;  3VP1 A;  2CMN A;  4DE3 A;  2OWH A;  3W4Q A;  2XSS A;  1OME A;  4LCM A;  3BFG A;  4ZBE A;  2J80 A;  1T19 A;  2OSU A;  5L2F A;  4EXO A;  3HLF A;  3GEC A;  3HLC A;  3MS6 A;  5GL9 A;  4ID4 A;  3NIA A;  3VOZ A;  3EQU A;  2ZMA A;  3V39 A;  3E4O A;  1S1Z A;  2EA9 A;  4NEE D;  1KVM A;  4LV0 A;  3RFB A;  3K3D A;  1EWZ A;  1FIL A;  1ES4 A;  3MXQ A;  5F82 A;  1Y4O A;  4FH4 A;  3LR3 A;  1PI5 A;  3T50 A;  1KDW A;  5FI7 A;  2M7V A;  5FQQ A;  2L4R A;  2J9O A;  4QD4 A;  5L09 A;  3QP1 A;  1LL9 A;  3M6B A;  5FQK A;  4R0Q A;  4KZ8 A;  1JTG A;  4DKI A;  2C5W B;  4QJG A;  1SCW A;  3IH9 A;  3FV7 A;  2JKR I;  2VEA A;  4M3K A;  3S22 A;  3N6I A;  5AQ7 A;  4R6L A;  2QKP A;  5EVL A;  3R7W A;  3P01 A;  2J8Y A;  3ZQ5 A;  2P9V A;  3QNB A;  3OOV A;  4HHD A;  4WM9 A;  4X25 A;  1IYS A;  1S66 L;  3F1P A;  3K3C A;  3LEQ A;  5IT5 A;  1D06 A;  3ITA A;  2WK0 A;  4DE2 A;  3WS0 A;  3Q7V B;  4Y5F A;  1TS8 A;  3M2K A;  5A8B A;  2XK1 A;  4KZA A;  3O86 A;  2Y2I A;  3T4T A;  1GA9 A;  3SW1 A;  1BSG A;  4CLC C;  2J3W A;  3P09 A;  2WGW A;  3UDF A;  3IX8 A;  1K6S A;  4GHI B;  1TS6 A;  4E3N A;  4GW9 A;  4Q8I A;  3GR2 A;  3Q82 A;  5L07 A;  3BFE A;  3ZDJ A;  3ZYT A;  3SH9 A;  4RX3 A;  4BWI A;  1SKF A;  4I3A A;  3IX4 A;  4FOF A;  2HPB A;  1PI4 A;  1N9L A;  1OJ5 A;  5FI2 A;  3D9Y A;  5HZH A;  4PKY G;  5HDC A;  5EVI A;  2GZA A;  1FR6 A;  4MBK A;  2P9V B;  5EEC A;  1S4S A;  4OP8 A;  4Z1W A;  4BQM A;  3A0S A;  1ZG4 A;  3ZCZ A;  1K25 A;  3NDE A;  3GRJ A;  4JXW A;  4KZ9 A;  3M2J A;  3E2L A;  4BLM A;  2PBD P;  2FFY A;  1DJC A;  3FYZ A;  3QHY A;  1FCN A;  2B18 A;  4QHC A;  4RVA A;  1PWG A;  3ICY A;  2H0T A;  4HY8 A;  2Y8H A;  4XUX A;  5K5B A;  1CI8 A;  4NXE A;  3MSH A;  2KOI A;  2KLI A;  4EES A;  4OPR A;  5GHY A;  2IWD A;  2HF6 A;  4ME4 A;  4GCZ A;  5HD3 A;  3ZG9 B;  1E25 A;  2V0U A;  2EXB A;  4GS9 A;  2H10 A;  1ES2 A;  1YLP A;  2A24 A;  3GSG A;  5DFY A;  5FAO A;  3OPL A;  4P85 A;  1XJ2 A;  5TBM A;  3HLD A;  1XA7 A;  1IOU A;  4WL9 A;  3KYE A;  4OPZ A;  5HPF A;  2PR6 A;  3PBO A;  4NXB A;  1NLZ A;  2ZC6 B;  4IBX A;  3HLW A;  2X71 A;  5HL6 A;  5HDS A;  3RTY A;  2ZC5 B;  2HP6 A;  2HGV A;  5KMW A;  3VP0 A;  3DBA A;  4A5R A;  1K57 A;  1LL8 A;  5FI6 A;  2Q9N A;  1VQQ A;  2WUQ A;  1LI9 A;  2VJW A;  4GN2 A;  4D2O A;  4NK3 A;  3DWK A;  4HOI A;  3WS2 A;  2Y2G A;  2JKR M;  3SS4 A;  3UB5 P;  4BD0 A;  4I3I A;  4QY6 A;  1NRJ A;  3BQA A;  1CEF A;  1GCE A;  4O0P A;  4ARZ A;  1N9N A;  1DP9 A;  2HZ5 A;  4XT2 B;  4PMA A;  5U47 A;  3OLO A;  3PBS A;  2WAD A;  1YM1 A;  3IBR A;  2HV1 A;  2HDU A;  3VP2 A;  1WA9 A;  5FDH A;  2WKQ A;  2D01 A;  2WKH A;  1I2S A;  3LR5 A;  3BRM A;  2OAP 1;  1IYP A;  2LB5 A;  3HLG A;  5DFX A;  2X01 A;  3CZD A;  1Z6F A;  5TR7 A;  4UA6 A;  1YKD A;  4FSF A;  3C7U A;  3O88 A;  5A90 A;  1YSP A;  3QP6 A;  3IF6 B;  3HUO A;  4I38 A;  3UE0 A;  4GD6 A;  3FG8 A;  2H5S A;  3T4K A;  4GJ4 A;  4R3J A;  4EBL A;  2M1C A;  3KSH A;  3E2K A;  2D02 A;  3P7N A;  3I7J A;  3SH8 A;  3PBQ A;  1OT6 A;  4O7D A;  4EEU A;  3MZF A;  5FQJ A;  1JNU A;  1LSX A;  2XRN A;  4ETX A;  1DP8 A;  2QJ5 A;  4LV2 A;  3G2Y A;  1T1A A;  2JKT I;  4Y13 A;  2V1Z A;  1AWI A;  1YAX A;  1IEM A;  5AJG A;  2ZJ9 A;  3UPP A;  3HLB A;  1W79 A;  3D3O A;  4BBT A;  5I5L A;  4R4S A;  1K38 A;  5HAQ A;  3K2N A;  1ZHH B;  1F2K A;  1PFL A;  3G32 A;  4HH3 A;  1BLS A;  2EXA A;  2XA7 M;  3MQ0 A;  4HIA A;  4HEF A;  3OPR A;  1U60 A;  1QME A;  1RCJ A;  2WZZ A;  3MXR A;  4MMN A;  5FEG A;  1TVF A;  1YPR A;  5FAT A;  4LRX C;  3VP3 A;  4R23 A;  3T1X A;  4O8G A;  2JE5 A;  4FH2 A;  4S2J A;  1LSV A;  2CC1 A;  1JTD A;  3W4P A;  4BBU A;  1XFQ A;  5CHJ A;  2B95 A;  1ZG6 A;  3OCN A;  3T1S A;  4JGR A;  2PU4 A;  5HSQ A;  5CTN A;  3TW8 A;  5F1G A;  1Y28 A;  4KQO A;  2INW A;  3EQV A;  2H0Y A;  1IYQ A;  2WKI A;  2FZ0 A;  3PTE A;  4HP4 A;  1L0D A;  2WGI A;  3CPT A;  5HPI A;  3UB9 A;  3H82 B;  2Y2O A;  1TD5 A;  4IUH A;  1T18 A;  4Y0O A;  3DW0 A;  2MJ6 A;  1H0M A;  3GTC A;  4EWF A;  4OQ0 A;  4UA9 A;  1KGG A;  4F3L A;  1NLY A;  3UME A;  3MQO A;  3MZD A;  3MQQ A;  1UWN X;  1YMX A;  5BOH A;  3BFF A;  3E4P A;  4QY5 A;  3FPW A;  1OTD A;  4PM5 A;  2AVX A;  1LHY A;  3SZT A;  1QMF A;  1WYB A;  2P04 A;  3T4O A;  1ERO A;  4N1X A;  4CPK A;  1K54 C;  1L0G A;  4HES A;  4WZ5 A;  2Y2L A;  2W3F A;  4JPM A;  2KX6 A;  3VE3 A;  1G5U A;  3ZNT A;  3QP8 A;  1S0W A;  3UB6 A;  3A0R A;  2P08 A;  3P98 A;  2JC7 A;  2H28 A;  5JYO A;  2Z6D A;  3BM6 A;  4KQD A;  1V9Y A;  5KZH A;  4ESP A;  2ZL1 A;  4OLG A;  1H8Y A;  4PM6 A;  4BJP A;  3B33 A;  4YNR A;  5HAP A;  4CLC D;  3ZNY A;  1BLH A;  4DJ3 A;  1L0F A;  3QP5 A;  1OTB A;  2J3T D;  1VEU A;  1XXM A;  4DDY A;  2OLV A;  4MN6 A;  4ZRR A;  1XGJ A;  3VOY A;  1NYY A;  3JVU A;  2UV0 E;  3G6O A;  3IXH A;  4EUV A;  3BW6 A;  2ZLY A;  3VP4 A;  4JBF A;  1GHM A;  4NG2 A;  4JGP A;  1GSV A;  4D60 A;  5GLD A;  3EGX C;  1CI9 A;  3SS5 A;  2I9V A;  3WS1 A;  4BL3 A;  1YLZ A;  4GDN A;  1VET A;  4IED A;  3A3I A;  3A0V A;  4II7 A;  3CUE A;  3N4I A;  4NKP A;  2Y2J A;  1LI0 A;  2JKT M;  3ITB A;  1I2W A;  2ZL1 B;  5M18 A;  3VSK A;  3WS5 A;  3C38 A;  2I72 A;  4OH0 A;  4WYY A;  3IS2 B;  3CWF A;  3IWO A;  3HBR A;  3DTK A;  3MR0 A;  1UWP X;  5J3W A;  3DTM A;  1BYW A;  2G2W A;  2ZQC A;  3G2Z A;  2DCF A;  4LV3 A;  1S67 L;  2VA0 A;  3H7W A;  3MF0 A;  4LV1 A;  2OV5 A;  3HL9 A;  3MJQ A;  1TDL A;  2DRW A;  1S1Y A;  2GDN A;  4N9L A;  1GSW A;  3QNC A;  2K7S A;  1E4D A;  1M6K A;  3F1O B;  2VGK A;  3DAV A;  4KZB A;  2JKF A;  4PKY A;  2QZ6 A;  5CX7 A;  2ZM0 A;  5FL3 A;  4HJ4 A;  4ZAM A;  1XPB A;  4M4X A;  2WGV A;  1IKI A;  1DP6 A;  4KG6 A;  2IA2 A;  4MN5 A;  5IU1 A;  2EWW A;  3KSI A;  5J7E A;  4MBF A;  4CLC E;  1BTL A;  4KG5 A;  5A93 A;  3CJM A;  2XF3 A;  5HWT A;  2ZQ9 A;  1L3L A;  1W5D A;  4DN0 A;  2JN7 A;  2W3E A;  1CEG A;  3H7W B;  3C8C A;  4G3K A;  4E6W A;  2UWX A;  4BEN A;  5HD5 A;  1PZO A;  2O0Y A;  2BG1 A;  3KO6 A;  2ACG A;  2WZX A;  5EVE A;  4K91 A;  1FOF A;  1Q2P A;  2V8C A;  4S2N C;  5HL1 A;  3GQZ A;  5I94 A;  3L7H A;  5GHX A;  2XEP A;  3BFC A;  3GVB A;  2PT7 A;  3Q07 A;  2Y2H A;  1ZTU A;  4OPY A;  3LR0 A;  3MFD A;  4L9G A;  4WN5 A;  4E6X A;  4LCL A;  3S7N A;  4R38 A;  1IYO A;  3EEH A;  4Y15 A;  2WAE A;  3BY8 A;  4WLA A;  3R7W B;  5FAP A;  5F83 A;  3LIE A;  1J9M A;  4KUO A;  1KE0 A;  3ZGA B;  3RXX A;  2Y59 A;  1W7F A;  3ZVT A;  3F1P B;  3UE6 A;  3N8S A;  5EUA A;  4CLC A;  2VLG A;  1SZV A;  3HJK A;  5F5Y A;  5FAQ A;  4H8R A;  1CQA A;  3ZHH A;  1P0Z A;  3EWK A;  2DNS A;  4LEN A;  3UNW A;  3CAX A;  1W63 Q;  3FZC A;  2EX9 A;  4OOM A;  1ESU A;  4E3L A;  4CJN A;  1HZO A;  2XLN A;  3BEC A;  1ES3 A;  2WGW B;  3V67 A;  1RP5 A;  4G3W A;  3AGF A;  2Z2L B;  1HVB A;  4KZ4 A;  4JF5 A;  4K08 A;  3HJI A;  1VB6 A;  4EQ1 A;  4UAA A;  1DRM A;  4MLL A;  2R9X A;  2ZQ8 A;  3EOI A;  1Z09 A;  2K31 A;  5M19 A;  2FFF B;  2HDS A;  5EVI B;  3B42 A;  2JCH A;  2XDM A;  1TEM A;  3KYQ A;  3NOT C;  5HWW A;  2VV7 A;  5AQA A;  3VFH A;  4RA7 A;  5TGF A;  5C5K A;  2VV8 A;  2PYP A;  4HH2 A;  4KZ5 A;  4U0X A;  3FC7 A;  4WEK A;  3OZH A;  2BLS A;  1P97 A;  3WWX A;  2JBF A;  4LLO B;  2ZQA A;  1FSW A;  1NXY A;  4BMW A;  4LRY C;  3Q7Z A;  4GDB A;  3T1R A;  4X53 A;  2VK3 A;  5DF7 A;  3IF6 C;  3LI8 A;  4WUJ A;  1IEL A;  3OBF A;  2R78 A;  4OQH A;  5DF9 A;  3NUL A;  3KX0 X;  2PU2 A;  3V3R A;  4JXG A;  5EM0 A;  1CF0 A;  1C3B A;  1LL5 A;  4F94 A;  4B9O A;  3CIT A;  4GS9 B;  3IXD A;  4OLD A;  2A24 B;  1BT5 A;  1K6R A;  3TJZ C;  5TBM B;  3G31 A;  4JXV A;  4OOY A;  2M7U A;  1K55 C;  2ZM8 A;  5IHV A;  2Y2Q A;  4HNB A;  5CGS A;  2VGL M;  4I5S A;  2Y2P A;  3PAE A;  5GLA A;  3PBR A;  2B5R A;  4GOG A;  4P87 A;  5EOO A;  1K56 D;  1PRQ A;  4EUZ A;  3CI6 A;  4DMZ A;  5CXW A;  4QWO A;  2W0N A;  2A3U A;  3LEZ A;  3KSF A;  2WKR A;  5CEC A;  1MKM A;  3TOI A;  4B4Z A;  2A2L A;  1GA0 A;  2O9C A;  4HJ3 A;  1MZU A;  1YT4 A;  4S2M A;  1BUE A;  5L10 A;  5AQB A;  3IWI A;  3T4S A;  2Q0O A;  2Q9M A;  1I5Q A;  2ZOH A;  1PWC A;  4YIN A;  1H3Q A;  4L9F A;  3U4L P;  4GNU A;  4MNR A;  4HJ6 A;  3FPV A;  1AXB A;  1EW0 A;  2RCX A;  2Y2N A;  4HBT A;  4ARZ B;  3UE3 A;  3TE8 A;  3NJA A;  4IUK A;  1L0E A;  3C2W A;  1HD8 A;  5E2G A;  5J8X A;  3Q1F A;  2W3D A;  4O01 A;  3E98 A;  1FCM A;  2QYB A;  3N7W A;  5CHU A;  1ERQ A;  3PBN A;  1VM1 A;  2OWJ A;  1MWS A;  4RX2 A;  3WRZ A;  1YLJ A;  2XFT A;  2IWC A;  4EBP A;  1YMS A;  4ZTK A;  4EQI A;  2W1R A;  4S2I A;  4X69 A;  3FKW A;  1JWV A;  4UQI S;  2FH5 A;  1OTE A;  1GHP A;  4DE1 A;  3IHB A;  1NZO A;  2EX8 A;  5CED A;  3PXP A;  3C4P A;  3H9W A;  3GV9 A;  4NXF A;  3V3S A;  2L0W A;  4KZ7 A;  2XA7 S;  4PM7 A;  2XQZ A;  4XUZ A;  2VGJ A;  5E43 A;  3LR4 A;  4MEZ A;  2A49 A;  4P6Z M;  1MY8 A;  2HP9 A;  3LID A;  3B3X A;  1MXO A;  5HAI A;  5DKK A;  1MC0 A;  4DDS A;  1FCO A;  4C6Y A;  4NXG A;  2Y2M A;  4KQQ A;  2WKE A;  3IT9 A;  3N8L A;  4KQR A;  2HDR A;  2O9A A;  4JF4 A;  4C3Q A;  4GZB A;  4PHT A;  4BBV A;  1FIK A;  3OPP A;  2Z2M B;  4H6J A;  5DJT A;  2VV6 A;  4E3K A;  4HBU A;  4QU3 A;  1OTA A;  1XJ4 A;  1IFQ A;  3UB8 A;  2PAV P;  2JKG A;  2QPN A;  2PD8 A;  2ZM2 A;  3M6H A;  4MBH A;  4MN7 A;  3LUQ A;  3W2Z A;  3F1N A;  3TSG A;  3C7V A;  5KIZ A;  3SH7 A;  1MPL A;  4KUK A;  2HJ9 C;  2V2F F;  3LIA A;  2ZC7 A;  3LGO A;  3V50 A;  3LI9 A;  4ZJ3 A;  2EX2 A;  1A0K A;  3WS4 A;  1YSQ A;  3SS3 A;  4OQI A;  4P0M A;  5DVA A;  1H8Z A;  2XR0 A;  1HLU P;  1K56 A;  3ULF A;  2IWB A;  3D72 A;  5FA7 A;  2PDR A;  2ZMF A;  3ISG A;  3RH8 B;  3E4Q A;  3CPT B;  5EOE A;  1XX2 A;  3JYI A;  1KE4 A;  1KE3 A;  1ONH A; 
#chains in the Genus database with same CATH homology
 5HPF A;  2PR6 A;  4DN0 A;  2JN7 A;  2W3E A;  1OJG A;  3H7W B;  3PBO A;  2DMW A;  3C8C A;  4F3L B;  4G3K A;  4UQI M;  4NXB A;  3KSG A;  5HD5 A;  2O0Y A;  3KO6 A;  1NLZ A;  2QHK A;  3JVV A;  3LIB A;  5HL6 A;  2W3H A;  5HDS A;  2HJE A;  3RTY A;  1LSW A;  2HGV A;  1XJ3 A;  1P9W A;  3B47 A;  3DBA A;  1N9O A;  1LL8 A;  2W1T B;  2PT7 A;  4CQH A;  3H82 A;  1ZTU A;  4Q0I A;  3LR0 A;  2VZW A;  4L9G A;  4WN5 A;  2VJW A;  3S7N A;  4R38 A;  4B93 A;  3EEH A;  4HOI A;  4LRZ E;  4UEY A;  3BY8 A;  2JKR M;  4WEJ A;  4WLA A;  3R7W B;  2EWV A;  1F9I A;  3R4K A;  4I3I A;  1NRJ A;  3LIE A;  3BQA A;  4I3J A;  4KUO A;  4IHQ A;  4EER A;  4ARZ A;  3PYP A;  4O0P A;  1N9N A;  4P6Z S;  1D7E A;  4EW7 A;  1DP9 A;  2ZOI A;  4XT2 B;  2XRO A;  3OLO A;  3MFX A;  3PBS A;  3TRC A;  2V1B A;  3F1P B;  3UE6 A;  5TJJ A;  4JGO A;  4CLC A;  2VLG A;  3HJK A;  5F5Y A;  3IBR A;  3VV4 A;  5LBR A;  2HV1 A;  1WA9 A;  1P0Z A;  2WKQ A;  3EWK A;  2D01 A;  5AVE A;  3CAX A;  4Y2F A;  3LR5 A;  1W63 Q;  2B02 A;  2O99 A;  4L0L A;  2OAP 1;  4OOM A;  1NWZ A;  2LB5 A;  4G3V A;  3KYZ A;  5DFX A;  4HQA A;  3V67 A;  3LIF A;  3HCY A;  2GNX A;  4I39 A;  4G3W A;  4RQ9 A;  1YKD A;  4FSF A;  1YSP A;  3VOL A;  2OAQ 1;  2QWS A;  4K08 A;  3HJI A;  5F6A A;  4I38 A;  1VB6 A;  4QPR A;  4EQ1 A;  3FG8 A;  3U2A A;  3NHQ A;  3MMH A;  1DRM A;  3T4K A;  1F98 A;  3T4L A;  3EOI A;  4GJ4 A;  5MC7 A;  2K31 A;  5HDD A;  2KDK A;  2M1C A;  3B42 A;  3KSH A;  2VX8 A;  2D02 A;  3P7N A;  5J4E A;  1GSX A;  3KYQ A;  3NOT C;  4JGQ A;  3PBQ A;  5DKL A;  1OT6 A;  5HWW A;  2VV7 A;  1KOU A;  4EEU A;  3IBJ A;  4H6J B;  4GHI A;  1JNU A;  1LSX A;  2XRN A;  4ETX A;  1DP8 A;  3BJN A;  4R70 A;  5C5K A;  2PHY A;  2VV8 A;  2QJ5 A;  2PYP A;  1T1A A;  2JKT I;  4HH2 A;  4GLQ A;  2LB9 A;  4OOL A;  2K2N A;  3FC7 A;  4WEK A;  1YAX A;  5AJG A;  1P97 A;  1S4R A;  4Q0J A;  1TS7 A;  4LLO B;  2JHE A;  3D3O A;  4WEL A;  2V1A A;  4BBT A;  3CLO A;  4DJ2 A;  4BMW A;  4LRY C;  5I5L A;  2L1M A;  4EEP A;  3K2N A;  3F1N B;  3IS2 A;  1ZHH B;  2Y79 A;  2VKS A;  4HH3 A;  3LI8 A;  5G4Y A;  3CUE C;  4R3A A;  1ODV A;  2XA7 M;  4WUJ A;  3S7Q A;  2Z6C A;  3MQ0 A;  4HIA A;  3OBF A;  4IJG A;  2R78 A;  5DF9 A;  2QJ7 A;  3KX0 X;  2YKF A;  4E04 A;  5F69 A;  4MMN A;  5HWV A;  3LFV A;  4Q0H A;  1F5M A;  4B9O A;  3CIT A;  4GS9 B;  4LRX C;  2A24 B;  3S7O A;  4O8G A;  3TJZ C;  3NOU C;  5TBM B;  1LT0 A;  4YOF A;  1LSV A;  3VE4 A;  2M7U A;  3LIC A;  4BBU A;  4MCW A;  2PYR A;  4YWZ A;  3LYX A;  1XFQ A;  3F1O A;  2J3T C;  1TF1 A;  3PBT A;  4HNB A;  2VGL M;  2CMN A;  1XFN A;  4I5S A;  2OWH A;  1OTI A;  3OCN A;  5EFW A;  4JGR A;  2XSS A;  5HSQ A;  3PBR A;  3TW8 A;  1Y28 A;  4KQO A;  3BWL A;  2INW A;  2J80 A;  3EQV A;  1T19 A;  3T4Q A;  3CI6 A;  4DMZ A;  2W0N A;  2FZ0 A;  4EXO A;  3GEC A;  4HP4 A;  3KSF A;  2WKR A;  4ETZ A;  2W27 A;  1MKM A;  5IS1 A;  3EQU A;  5HPI A;  2W3G A;  4LPZ A;  2A2L A;  3H82 B;  3UB9 A;  1TD5 A;  3E4O A;  2O9C A;  2GJ3 A;  1S1Z A;  2EA9 A;  4HJ3 A;  1T18 A;  4IUH A;  1MZU A;  4NEE D;  2MJ6 A;  3T4S A;  3O5Y A;  3RFB A;  3K3D A;  2ZOH A;  4F3L A;  1H3Q A;  1NLY A;  4L9F A;  3UME A;  3MQO A;  4HJ6 A;  4EU0 A;  3FPV A;  3MQQ A;  3MXQ A;  1UWN X;  1EW0 A;  3PR6 A;  4ARZ B;  4EET B;  3LR3 A;  3T50 A;  3E4P A;  3UE3 A;  3BY9 A;  3FPW A;  1OTD A;  3TE8 A;  3NJA A;  4HI4 A;  2M7V A;  4IUK A;  2L4R A;  3C2W A;  2P04 A;  5G4Z A;  2W3D A;  3T4O A;  4CLC B;  4O01 A;  4L9E A;  3E98 A;  2QYB A;  2W3F A;  2KX6 A;  3VE3 A;  2JKR I;  2VEA A;  3UB6 A;  3A0R A;  3PBN A;  2P08 A;  2H28 A;  2BAS A;  2OWJ A;  1OT9 A;  2Z6D A;  4KQD A;  1V9Y A;  2OOL A;  1TS0 A;  4R6L A;  2QKP A;  2V9A A;  3R7W A;  3P01 A;  1W63 M;  2P7J A;  3ZQ5 A;  1OPX A;  4BJP A;  3B33 A;  4YNR A;  1UGU A;  4CLC D;  3OOV A;  4XT2 A;  4HHD A;  4DJ3 A;  1S66 L;  3F1P A;  2V0W A;  4MDZ A;  1T1B A;  2W1R A;  2NUP C;  3K3C A;  2ZMV A;  1X0O A;  1OTB A;  2J3T D;  2ZBB A;  4UQI S;  2G7U A;  2YKH A;  5IT5 A;  2FH5 A;  1D06 A;  1OTE A;  2NUT C;  4MN6 A;  4ZRR A;  4Y5F A;  3JVU A;  3PXP A;  1TS8 A;  1G28 A;  1G6O A;  3H9W A;  5A8B A;  3G6O A;  4NXF A;  2L0W A;  4EUV A;  3BW6 A;  3OCL A;  3T4T A;  3NOP C;  1STZ A;  3SW1 A;  4CLC C;  2XA7 S;  2J3W A;  2PD7 A;  4JGP A;  4WF0 A;  1GSV A;  5L8M A;  4GHI B;  3LR4 A;  1TS6 A;  3EGX C;  4GW9 A;  2O9B A;  2I9V A;  4P6Z M;  3ZYT A;  3LID A;  4BWI A;  3A0V A;  4II7 A;  3CUE A;  4I3A A;  5DKK A;  4NKP A;  1MC0 A;  4FOF A;  1N9L A;  1OJ5 A;  2JKT M;  4NXG A;  4HP9 A;  5HZH A;  4PKY G;  5HDC A;  2GZA A;  3C38 A;  2GX5 A;  1S4S A;  2O9A A;  3IS2 B;  3CWF A;  1H8M A;  2VGL S;  3E0Y A;  4PHT A;  4BBV A;  4AFI A;  5F68 A;  4H6J A;  5DJT A;  2VV6 A;  1XJ6 A;  4Z1W A;  3MR0 A;  1UWP X;  3PHY A;  5J3W A;  3EGD C;  3A0S A;  3S7P A;  1BYW A;  1OTA A;  1XJ4 A;  1IFQ A;  3UB8 A;  1S67 L;  2VA0 A;  3C30 A;  3H7W A;  5KSH A;  3MF0 A;  3EEA A;  2PD8 A;  3MJQ A;  5DJU A;  1S1Y A;  2B18 A;  3OC2 A;  1GSW A;  4Y3I A;  4MN7 A;  3LUQ A;  3ICY A;  1P9R A;  2K7S A;  3F1N A;  1T1C A;  3W2Z A;  3F1O B;  2Y8H A;  4HY8 A;  5K5B A;  4NXE A;  5KIZ A;  4KUK A;  2KOI A;  2HJ9 C;  2KLI A;  2W1T A;  4EES A;  2WKP A;  3LIA A;  3LI9 A;  4PKY A;  2HF6 A;  3T4J A;  5CX7 A;  4ME4 A;  4GCZ A;  5HD3 A;  5FL3 A;  3UMD A;  1YSQ A;  2V0U A;  4HJ4 A;  3UB7 A;  4GS9 A;  1VHM A;  4M4X A;  1DP6 A;  2A24 A;  2IA2 A;  4MN5 A;  5IU1 A;  5DFY A;  2EWW A;  2PR5 A;  3GDI A;  3ULF A;  3D72 A;  1V9Z A;  3KSI A;  5J7E A;  1XJ2 A;  2PDR A;  2ZMF A;  5AVF A;  5TBM A;  3E4Q A;  3RH8 B;  4CLC E;  3BQ8 A;  4PAU A;  5HWT A;  1IOU A;  4WL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...