4X1LA

Structural basis for mutation-induced destabilization of profilin 1 in als
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
127
Chain Sequence
GWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRGLTLGGQKCSVIRDSLLQDGEFSMDLRTKPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Profilin-1
publication title Structural basis for mutation-induced destabilization of profilin 1 in ALS.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 127
sequence length 138
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4x1lA00
3NULA 1G5UA 2B95A 1F2KA 1VEUA 3T1RA 2JKFA 3T12B 3KYEA 4FUWA 1FIKA 4D60A 3T1XA 1K0KA 1SZVA 2HZ5A 1CQAA 2V8FA 1J3WA 3CPTA 4QWOA 4X25A 2PAVP 3LEQA 3L7HA 1SKOA 1YPRA 3UB5P 3MSHA 1HLUP 1PRQA 4ESPA 1FILA 3MS6A 5EVEA 5EV0A 1Z09A 1D1JA 2PRFA 2VK3A 1VETB 5EM1A 2ZL1B 1CJFA 3L9KA 4X1LA 5FDSA 1ACFA 1VEUB 1A0KA 2V8CA 1Y4OA 3LGOA 3NECA 1AWIA 4FTXA 3D9YA 2BTFP 1CF0A 2ACGA 3CPTB 3T1QB 3U4LP 3T1SA 2JKGA 2PBDP 1PNEA 1SKOB 1PFLA 2E8JA 5FEFA 3DAVA 5EM0A 5FEGA 4X1MA 3CHWP 1VETA 2ZL1A
chains in the Genus database with same CATH superfamily
1TD5A 1BZAA 1CI8A 2PYRA 2EFXA 5FQKA 1H8ZA 3T12B 1FCOA 3WS2A 1UWNX 3PBSA 1YLJA 2JKRM 4LRXC 5CERA 4JGQA 5C5KA 2HDSA 3TJZC 3VSLA 2IWCA 1K6RA 4DE2A 5E2FA 3LI9A 3L7HA 3UY6A 5EVIC 3NY4A 1T1CA 4EQIA 4ESPA 1PZOA 2J3WA 3GTCA 3E2LA 5BOHA 2KDKA 3KSHA 4O01A 5FDHA 3BFCA 2H10A 2XH9A 5CTMA 4DRTA 1W5DA 2Z2LB 5TBMB 4WLAA 3BWLA 3C5AA 4RYEA 4JF6A 4LRZE 3V5MA 4WEKA 1MXOA 3F1NB 4EWFA 3LGOA 3IH9A 1L0FA 3LR3A 4MN5A 1OTIA 2FFFB 4WZ5A 2V1ZA 2QHKA 3MZFA 2HP9A 3DTKA 3W2ZA 4JXWA 3EGXC 3CAXA 5TFQA 4PM8A 2W1TB 1MC0A 3FWLA 3Q81A 4NG2A 5FAQA 5EOEA 1JWVA 2A24A 4ID4A 1CK3A 2IWDA 5A91A 3MQ0A 3UMDA 3A3EA 3EWKA 2G2WA 5M18A 2Q0OA 1K56D 3SS5A 3OCLA 1NJ4A 2WAFA 3BQAA 3C30A 4BQMA 3W4OA 3F1PB 2EX9A 3GV9A 5HZHA 4LENA 1TVFA 5DFXA 5J7EA 1YAXA 2G7UA 4NXBA 2R78A 1QMEA 4X56A 5F83A 4O8GA 5CHMA 2HGVA 3VOLA 2Y55A 2Q9MA 2ZOIA 1TS8A 2E8IA 3A0SA 3OPHA 5GHYA 4OQGA 5EVIB 4DE3A 3ZG9B 4KG2A 2ZM0A 3FYZA 2W3HA 3E4OA 2EXAA 3KYZA 3UDIA 2GNXA 2W0NA 3JPUA 4IBRA 4R23A 1S4SA 4I38A 1G6AA 1TDGA 4QD4A 1IELA 3ZDJA 4NKPA 4EXOA 4OPYA 4NK3A 3G31A 3KSGA 1FR1A 3N6IA 3D9YA 4P85A 2QPNA 5M1AA 1CF0A 4RX2A 2B5RA 2O9AA 4S2LA 5AQAA 4N9KA 2K7SA 5FASA 2XK1A 1XJ2A 4EV4A 2XF3A 3OPRA 3U4LP 2NUPC 2JKGA 1NLYA 3T4TA 2WGWA 1JWZA 1SKOB 4AFIA 2Q9NA 4QY6A 3LR5A 1OJ5A 3ZQ5A 3MXSA 3MXRA 4BLMA 1GHPA 3EGDC 1CEFA 3R7WA 4Y5FA 3NULA 2W1RA 4U3TA 1L0GA 3ZNTA 3IXDA 1I2SA 5HWVA 2ZQ7A 4PM9A 1DP6A 3ISGA 4H6JA 4P87A 4HH3A 4Y0OA 4FD8A 4S2PA 3AGDA 2ZMFA 3M2JA 4QWOA 3G4PA 4LPZA 2W27A 5KMWA 5AJGA 2PAVP 3QP5A 4WYYA 2XA7M 4LV0A 1KVLA 3HVFA 3MR0A 1K4EA 1S0WA 3LIAA 5MC7A 3PBTA 1T1BA 4Y0TA 2PRFA 3D4FA 4GZBA 2HJEA 3MKFA 5CGWA 1YMXA 2ZQ8A 1ZG4A 3VP3A 2L0WA 3LR0A 1GSWA 4HHDA 4R70A 4EERA 1YLZA 3A0VA 5GL9A 3NDEA 3Q07A 3O86A 5HL6A 1XGIA 5IT5A 2W3FA 3T1SA 1HTZA 4PKYA 1TEMA 4ZAMA 3B33A 3IHAA 2ZQ9A 3QP6A 4XT2B 1I5QA 4IHQA 4N92A 5HWWA 5GLCA 5FA7A 3F1OB 2WKRA 2V9AA 1DJAA 1XA1A 1M6KA 3PBRA 5DFYA 3SOIA 1NWZA 4PKYG 3EOIA 3S22A 4R4RA 2WKQA 3HLFA 2UWXA 4KZ3A 1FIKA 5A93A 3T1XA 1SDNA 1G28A 4WZ5C 4ZJ3A 2WKEA 1ODVA 1PWCA 4WMCA 4Y3IA 1PI5A 4R4SA 5FAOA 2VZWA 3PBNA 1IFQA 5HAIA 1E4DA 4E6WA 3FPWA 3OC2A 2R9XA 4K08A 4HOIA 2D02A 2D01A 4NEED 1ZHHB 1V9YA 2JKRI 2PD7A 5IHVA 3BFGA 5DVAA 3GR2A 4UHUA 3W4QA 2ZL1B 1CJFA 5EE8A 4Q0HA 3HLDA 2EXBA 2XQZA 1ZG6A 3UE0A 4JPMA 4UAAA 1DJCA 1KDWA 3IQAA 4E3KA 4MN6A 2YKHA 3S7OA 4GN2A 2MJ6A 3UPOA 4G3VA 5GLDA 4KZ9A 2JHEA 4IUKA 3JVUA 3LIDA 1S66L 4MCWA 4Z9QA 1SCWA 4OOMA 1PIOA 4KQRA 1Q2PA 5E43A 5CECA 4I3JA 3OPPA 3BECA 1LL8A 3CHWP 4EBLA 3VMAA 2XRNA 2LB5A 4S2OA 5CHUA 4PMAA 1UWPX 1WE4A 1LSVA 1P0ZA 4YOFA 3GVBA 3VFFA 3LY4A 1CI9A 3OLOA 1OT6A 3RJUA 4WL9A 3C7UA 1OPXA 5A92A 3IWQA 1RGZA 1KOUA 5L10A 3NHQA 2OSUA 2ZC7A 1YLTA 3QHYA 4RX3A 1S4RA 3BFDA 5LBRA 1PRQA 3SS3A 5L2FA 2A24B 3DTEA 5CRFA 4DJ2A 3FG8A 4OQIA 4UEYA 5HFOA 2XGNA 2O0YA 4WF0A 4PM5A 3TW8A 3G34A 4LGWA 3V67A 2V8CA 4C6YA 3TSGA 1YLWA 2BASA 4NETA 4B4XA 3V50A 2J3TD 5EFWA 2Z6DA 3M6BA 2BG1A 3T1QB 5KSCA 3S7PA 4JXSA 1XXMA 2ZLYA 2DRWA 1MPLA 3E4QA 5FAPA 1BLPA 2WAEA 5EPHA 3T4OA 4GD6A 4S2JA 2K2NA 3UE1A 3C38A 3DAVA 1EI5A 1K55A 1EWZA 2ZC6B 1VETA 3G32A 4KZ7A 1GA0A 2EX2A 2Y4AA 4IBXA 1TDLA 2Y2IA 2NUTC 4P6ZM 3LICA 1HVBA 3KYEA 4CPKA 5HD5A 4HQAA 1KE4A 2GJ3A 3FKVA 2EA9A 5F69A 4HP9A 4WELA 4EW7A 2HF6A 4KZ8A 3DTMA 1FQGA 2WUQA 4GB7A 5DF8A 1MKMA 2WADA 5HPFA 3UPPA 1E3UD 3I7JA 2V0WA 2ZM2A 4R3AA 2Y59A 3HBRA 4GKUA 4NXGA 4JBFA 4R3JA 2OLVA 2FFYA 1SHVA 2WGWB 3ZG8B 1HLUP 1K56A 2Y2GA 3RFBA 3SS4A 2VJWA 4JGPA 5IU1A 2H0YA 3NIAA 3E2KA 2V1AA 3K3CA 1YSQA 3R7WB 1DP8A 3ZGAB 5L09A 4BL3A 4E3NA 4DKIA 2I9VA 3RH8B 1GSXA 3MZEA 4GLQA 4MDZA 4N9LA 4L9GA 4XXRA 4I39A 4H6JB 4FTXA 1Z6FA 1S6RA 2VV7A 1L0EA 1BUEA 1YKDA 3SH8A 1FCMA 4DXBA 4B88A 1MWRA 4E04A 1DRMA 4EEUA 1RP5A 1UGUA 3LR4A 1M40A 1KDSA 3KYQA 2E8JA 2PU2A 3ITAA 4KENB 3Q1FA 2HPBA 4E3IA 2HP6A 1L2SA 3N8RA 3TE8A 1F2KA 2QMIA 2ZC5B 4DDSA 5DTTA 1LI9A 4KQOA 3Q82A 1ERMA 1S1ZA 4GCZA 1F9IA 3KSIA 1J3WA 3OBFA 4ZBEA 1KE0A 3LIBA 2PHYA 4OP8A 2EX6A 2WKPA 1W63M 4DE1A 4MBFA 2VV8A 3V39A 1IEMA 5FQIA 4OH0A 4XUZA 3MF0A 3UB5P 2BLSA 4GHIA 4IVKA 2EX8A 1FILA 5F5YA 1XA7A 4OQHA 1EW0A 4KZ5A 3O3VA 1NZUA 1XJ3A 1MWSA 5GLAA 3B47A 4MBKA 2Z2MB 5EECA 3EQVA 3M2KA 1N9OA 1T19A 2P7JA 4B9OA 2HP5A 4Y17A 5F82A 1Y4OA 1NLZA 3VP2A 3NECA 3P98A 4I3AA 5FI6A 4OLGA 4ZRRA 3HLEA 3UMEA 4OPQA 1H8YA 3Q7VA 3GECA 1IYQA 4E3LA 3HLBA 3O87A 1PFLA 4L0LA 2PR5A 4Q8IA 4Y13A 4P6ZS 1LL9A 4EQ1A 3HJIA 2X01A 1VHMA 1VM1A 1VEUA 2HV1A 1NYMA 3KSFA 2XSSA 1V9ZA 5DF7A 1H8MA 1K0KA 1SZVA 2DMWA 3BEBA 4JGOA 1P9RA 4Z1WA 4IVIA 3IF5A 3FV7A 2HDUA 1Q2QA 3C7VA 3K3DA 2WGIA 1XPBA 5GHXA 4RA7A 4U0TA 4OLDA 3IT9A 1K57A 4YINA 2ZMAA 4MBHA 1BYWA 2Y2KA 2OWHA 4PHTA 4QY5A 4PM7A 5DJTA 2JC7A 1K55C 2Y8HA 1Z09A 2V2FF 2VGJA 2VK3A 3DWZA 5EM1A 5D3OA 5HW3A 5FQJA 4NXEA 5G18A 1KGFA 4PAUA 3UB6A 4GD8A 5AQ7A 3MFDA 3A3JA 1G6OA 1A0KA 1LL5A 5HDSA 3ITBA 4IEDA 1XKZA 4Y15A 3IH8A 4UA6A 4CLCD 3SW1A 1TS0A 3EQUA 1AWIA 1L3LA 3GRJA 5L07A 4JXGA 4UQIM 4HI4A 4MMNA 3HREA 3CMZA 3FZCA 1W8YA 3CLOA 3CJMA 4JGRA 5CXWA 1XFNA 1YM1A 3CI6A 3IXGA 1STZA 3HJKA 1MBLA 3H9WA 1EROA 1K6SA 3BW6A 5HWTA 2OAQ1 5CEBA 2GDNA 2PT7A 1NZOA 3ZVTA 4A5RA 5G4YA 1P9WA 4LFUA 3IX4A 4DF6A 2JKFA 5HDCA 5I94A 4JXVA 1GHIA 4Y7PA 3M6HA 4LCLA 5DTSA 4DMZA 4YWZA 3JVVA 2AVXA 3ZHHA 2K31A 5M19A 2EFUA 4ZJ2A 3PBQA 5E2EA 4DDYA 4CQHA 1NXYA 4ME4A 1DY6A 4OPZA 1BLCA 1ZTUA 2VGKA 3MBZA 5EVLA 3IXHA 3PYPA 3LUQA 1LHYA 5FQMA 1S1YA 3UN7A 3VP0A 3GQZA 2B18A 2OLUA 2ZQDA 4LV1A 1FSYA 1GHMA 1VETB 2O9CA 3OZHA 3IX3A 5FDSA 1FCNA 3G6OA 2YKFA 3WWXA 4BBUA 1ACFA 5AQBA 4X53A 3DWKA 5HSQA 5IS1A 2R9WA 1D06A 2C5WB 2PBYA 2Y2OA 1N9NA 2J9OA 3SH9A 2XDMA 3ZYTA 5E2GA 4DXCA 3MJQA 2VA0A 5FEFA 5FEGA 4P6BA 1NY0A 4D2OA 3AGEA 1YLYA 4I3IA 3Q7ZA 3B42A 4DJ3A 4C75A 3UE6A 1BT5A 2X71A 3LI8A 1VQQA 2ZMVA 5GLBA 1GSVA 3QNBA 1CQAA 3WS0A 3A3IA 2ZC3B 5KSHA 3CPTA 2O9BA 3PTEA 1C3BA 2GX5A 2M7VA 1MY8A 3IF6A 4P0MA 5JYPA 2VV6A 2DNSA 1K25A 5TGFA 1U60A 3G30A 4N1HA 1IKIA 4MLLA 3BFEA 3IWIA 3UB9A 2A49A 3P01A 2XA7S 2QJ5A 4R38A 4BWIA 4K0XA 5EVID 5FI2A 1PW8A 5AVFA 3LIEA 2C6WB 1D7EA 2Y91A 4X69A 4LRYC 1MZUA 3UE3A 3WRZA 1XX2A 2J7VA 3E0YA 1LI0A 4UQIS 4IUHA 1ONGA 4GOGA 4HEFA 2WGVA 4R6LA 2ZQCA 3A3DA 5CEDA 4R3BA 1OTAA 1F98A 4JLFA 3CZDA 1F5MA 1E3UA 4HY8A 3UDXA 4CLCE 3H82A 2Y2QA 3C2WA 4OQ0A 1K57C 2OWJA 3DTIA 4KG5A 4NXFA 1HZOA 4L9FA 2VGLM 4YNRA 2Y2JA 3C8CA 4BJPA 3V3SA 2RL3A 4GHIB 5GHZA 2V0UA 2JKTM 1IYOA 2VKSA 2WKIA 3PR6A 2PDRA 3C4PA 4UA9A 4R1GA 3E4PA 1RCJA 2XEPA 3LY3A 3GMWA 3RTYA 4BBTA 1H0MA 3NDGA 3G35A 4ARZA 4PPRA 4BBVA 4EU0A 2QZ6A 1ERQA 3ZG5A 3BY9A 1W79A 4EEPA 5DKLA 3HUNA 3VOYA 2XD1A 3VFHA 4JF5A 1L0DA 1J9MA 1WYBA 3Q7VB 3NOUC 2LB9A 1YLPA 3S4XA 2QYBA 2PD8A 1K54A 2QJ7A 1W8QA 1DJBA 1OTEA 3NC8A 1OTDA 2INWA 3QNCA 3U2AA 3DBAA 1YMSA 3GDIA 3OOVA 2QKPA 3L9KA 5DTKA 3PAGA 1VEUB 4IJGA 3C4OA 4S2NA 4BL2A 3IHBA 4G3KA 2XFSA 4E6XA 4KQDA 2WK0A 1IKGA 3N8SA 2IWBA 4F94A 4EBPA 4ZDXA 3PHYA 4X55A 1ES2A 5JYOA 3H7WA 5EUAA 2HDRA 3O88A 1TS6A 1BTLA 3NI9A 5CGXA 3ZVWA 1ZKJA 3PAEA 1OT9A 2KX6A 1YSPA 2XROA 4E3JA 2Y2HA 4WZ4A 5HPIA 4XUXA 4MNRA 3VSKA 2ZM8A 2WYXA 3CG5A 2JE5A 3IWOA 1YQSA 2JN7A 3ZG0A 1LLBA 3MXQA 3T4JA 3N7WA 4LLOB 1Y54A 4D60A 4YFMA 4F3LA 3IX8A 4GNUA 3G2YA 4X25A 1BSGA 3NOPC 3BYDA 1QMFA 1HD8A 5EOOA 3UB8A 5A90A 4FCFA 4OVDA 1NYYA 2GZAA 3SH7A 4LCMA 1S67L 3CUEA 4EETB 1W63Q 1MWTA 3BM6A 2OAP1 3QP1A 2P9VA 2J3TC 3NJAA 5CHJA 2VLGA 3ULFA 1PWDA 4I5SA 4ETXA 4WM9A 1TF1A 5A8BA 5HARA 4Y2FA 1PZPA 2VGLS 3T50A 4Y0UA 3B3XA 3T4LA 1O7EA 2Z6CA 3IF6C 3HUMA 1H5XA 1ALQA 2PU4A 4EBNA 4Q0IA 1XP4A 3MKEA 3A3FA 1X0OA 2RCXA 2M7UA 3IS2A 3RXXA 2EWWA 3HUOA 3JYIA 1G5UA 3T4SA 2A2LA 5HAPA 2B95A 1N9LA 4LV3A 4CLCA 1XGJA 5U47A 3OCNA 2JCHA 1XFQA 4KUKA 3MFXA 1OTBA 5F1GA 3WS4A 1NRFA 2KOIA 1ZC2A 4HP4A 5CX7A 2XR0A 2J9PA 2XD5A 2ZC4B 3W8KA 1LSWA 2EWVA 4RQ9A 1KGEA 3QP4A 3P09A 3PBOA 4GS9A 5DJUA 4EUVA 4ETZA 4OPRA 3VE4A 2M1CA 1E25A 2FH5A 1N9BA 1P97A 3IBJA 5EV0A 4HBUA 4U0XA 3T4QA 3TOIA 5HDDA 5I5LA 3ZCZA 4PM6A 1CEGA 3GSGA 4RVAA 4OOLA 1SDEA 1KGGA 2W3GA 3CITA 1OMEA 4HIAA 4B93A 4HJ4A 1PWGA 3BFFA 4E3OA 4M4XA 3FKWA 1W7FA 3MQQA 1G68A 5FATA 4FH2A 3LCEA 2FZ0A 4MEZA 3WS5A 4C3QA 2L1MA 5F68A 5J8XA 4WEJA 2CC1A 3CPTB 2J8YA 3ZNYA 4EUZA 3E98A 1IYPA 3IF6B 3K2NA 5FI7A 1K54C 4GDNA 1KE3A 3NCKA 3MMHA 1FSWA 4X1MA 5TBMA 1O07A 3DW0A 2H5SA 1N4OA 1XJ6A 2V20A 2P04A 2JBFA 3F1NA 3O5YA 4S2NC 3MQOA 4JKTA 1MWUA 5HD3A 4BD1A 2Y2LA 2JKTI 1GA9A 5E2HA 2L4RA 2H28A 1LSXA 2W1TA 3H82B 3LEQA 2Y2PA 3BY8A 3D72A 4KZAA 1ES4A 3NBLA 3MSHA 4S2IA 5K5BA 1JTGA 4UA7A 4QHCA 4KG6A 3UO9A 1BLHA 4E3MA 2G2UA 2HJ9C 4QJGA 4HBTA 3F1PA 4S2KA 3N4IA 4QPRA 1GCEA 1PI4A 2WZZA 5TR7A 4ARZB 3OPLA 5F6AA 1K4FA 3MZDA 1JWPA 1XJ4A 3VP1A 2ZBBA 4JF4A 1JNUA 3D3OA 3S1YA 2ACGA 2Y2NA 1ONHA 1ESIA 1JVJA 2XLNA 5HL1A 3LYXA 5FSRA 4OKPA 3W4PA 3R4KA 3VE3A 4G3WA 1VB6A 5EVIA 4R0QA 3ZG7B 3UDFA 4O7DA 1KVMA 3CUEC 5DF9A 2PBDP 4EESA 4KZ4A 4FH4A 3UB7A 5CGSA 1FOFA 5TJJA 3RXWA 2P08A 5FQQA 3S7NA 3T1RA 3PXPA 5J4EA 1PYYA 2VX8A 1AXBA 3EEHA 1WA9A 2A3UA 3WRTA 2UV0E 1T1AA 4MN7A 5L8MA 5FQ9A 2V8FA 1OJGA 1ESUA 1K38A 4BD0A 2B02A 4OP5A 3IXBA 4GDBA 1SKOA 3FC7A 3LIFA 3V3RA 4KZBA 4HNBA 1TS7A 4FSFA 3H7WB 3BJNA 2P74A 3VOZA 3IBRA 2CMNA 3MS6A 2WZXA 3UNWA 1DP9A 1Y28A 5KIZA 4M3KA 5CTNA 1IYSA 3HLGA 4CLCC 4KUOA 3KX0X 2W3EA 2PYPA 4K91A 4X6TA 4WUJA 3G2ZA 2ZOHA 2X02A 1JTDA 4DE0A 4GJ4A 5KZHA 4FOFA 3T4KA 4F3LB 1NRJA 1BULA 4LV2A 1PW1A 4WMCD 3P7NA 5J3WA 1I2WA 4L9EA 4DN0A 5AQ9A 2OOLA 4K0WA 3TRCA 2V1BA 2OV5A 5DKKA 3HCYA 3BQ8A 3HLWA 5EM0A 3EEAA 2ZQAA 4HJ3A 4ZJ1A 3A0RA 4OONA 4CJNA 3SZTA 1IOUA 4WBGA 4WN5A 2WKHA 2HDQA 4OOYA 1LT0A 4B4ZA 3LFVA 2XFTA 4FUWA 3HLCA 2P9VB 3BLSA 2HZ5A 2PR6A 4HJ6A 3BLMA 2KLIA 1BLSA 4H8RA 5F1FA 2Y2MA 3AGFA 4S2MA 2IA2A 4QU3A 4II7A 4KQQA 5AVEA 3KO6A 1YPRA 3UPNA 2J80A 1YT4A 1RGYA 4XT2A 4BMWA 2W3DA 3BRMA 4N1XA 1H3QA 2I72A 3LEZA 5G4ZA 3F1OA 5EVEA 3WS1A 3VP4A 3N8LA 1D1JA 4Q0JA 5FL3A 3IS2B 5HX9A 1WYCA 3ZFZA 3ICYA 2H0TA 4X1LA 2ZD8A 1SKFA 4HH2A 4BENA 4CLCB 3FPVA 3S7QA 3HL9A 3NOTC 5HAQA 4ZTKA 1T18A 2Y79A 2BTFP 2QWSA 1ES5A 2VEAA 3CWFA 4QB8A 2DCFA 1ES3A 3TG9A 4GW9A 4HESA 3LO7A 4KZ6A 1PNEA 3QP8A 4X68A 1FR6A 4GS9B 4O0PA 2ZJ9A 1MKIA 2O99A 2ZL1A 3QP2A 3VV4A
chains in the Genus database with same CATH topology
3NULA 1G5UA 2B95A 1F2KA 1VEUA 3T1RA 2JKFA 3T12B 3KYEA 4FUWA 1FIKA 4D60A 3T1XA 1K0KA 1SZVA 2HZ5A 1CQAA 2V8FA 1J3WA 3CPTA 4QWOA 4X25A 2PAVP 3LEQA 3L7HA 1SKOA 1YPRA 3UB5P 3MSHA 1HLUP 1PRQA 4ESPA 1FILA 3MS6A 5EVEA 5EV0A 1Z09A 1D1JA 2PRFA 2VK3A 1VETB 5EM1A 2ZL1B 1CJFA 3L9KA 4X1LA 5FDSA 1ACFA 1VEUB 1A0KA 2V8CA 1Y4OA 3LGOA 3NECA 1AWIA 4FTXA 3D9YA 2BTFP 1CF0A 2ACGA 3CPTB 3T1QB 3U4LP 3T1SA 2JKGA 2PBDP 1PNEA 1SKOB 1PFLA 2E8JA 5FEFA 3DAVA 5EM0A 5FEGA 4X1MA 3CHWP 1VETA 2ZL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUL A;  1G5U A;  2B95 A;  1F2K A;  1VEU A;  3T1R A;  2JKF A;  3T12 B;  3KYE A;  4FUW A;  1FIK A;  4D60 A;  3T1X A;  1K0K A;  1SZV A;  2HZ5 A;  1CQA A;  2V8F A;  1J3W A;  3CPT A;  4QWO A;  4X25 A;  2PAV P;  3LEQ A;  3L7H A;  1SKO A;  1YPR A;  3UB5 P;  3MSH A;  1HLU P;  1PRQ A;  4ESP A;  1FIL A;  3MS6 A;  5EVE A;  5EV0 A;  1Z09 A;  1D1J A;  2PRF A;  2VK3 A;  1VET B;  5EM1 A;  2ZL1 B;  1CJF A;  3L9K A;  4X1L A;  5FDS A;  1ACF A;  1VEU B;  1A0K A;  2V8C A;  1Y4O A;  3LGO A;  3NEC A;  1AWI A;  4FTX A;  3D9Y A;  2BTF P;  1CF0 A;  2ACG A;  3CPT B;  3T1Q B;  3U4L P;  3T1S A;  2JKG A;  2PBD P;  1PNE A;  1SKO B;  1PFL A;  2E8J A;  5FEF A;  3DAV A;  5EM0 A;  5FEG A;  4X1M A;  3CHW P;  1VET A;  2ZL1 A; 
#chains in the Genus database with same CATH topology
 1TD5 A;  1BZA A;  1CI8 A;  2PYR A;  2EFX A;  5FQK A;  1H8Z A;  3T12 B;  1FCO A;  3WS2 A;  1UWN X;  3PBS A;  1YLJ A;  2JKR M;  4LRX C;  5CER A;  4JGQ A;  5C5K A;  2HDS A;  3TJZ C;  3VSL A;  2IWC A;  1K6R A;  4DE2 A;  5E2F A;  3LI9 A;  3L7H A;  3UY6 A;  5EVI C;  3NY4 A;  1T1C A;  4EQI A;  4ESP A;  1PZO A;  2J3W A;  3GTC A;  3E2L A;  5BOH A;  2KDK A;  3KSH A;  4O01 A;  5FDH A;  3BFC A;  2H10 A;  2XH9 A;  5CTM A;  4DRT A;  1W5D A;  2Z2L B;  5TBM B;  4WLA A;  3BWL A;  3C5A A;  4RYE A;  4JF6 A;  4LRZ E;  3V5M A;  4WEK A;  1MXO A;  3F1N B;  4EWF A;  3LGO A;  3IH9 A;  1L0F A;  3LR3 A;  4MN5 A;  1OTI A;  2FFF B;  4WZ5 A;  2V1Z A;  2QHK A;  3MZF A;  2HP9 A;  3DTK A;  3W2Z A;  4JXW A;  3EGX C;  3CAX A;  5TFQ A;  4PM8 A;  2W1T B;  1MC0 A;  3FWL A;  3Q81 A;  4NG2 A;  5FAQ A;  5EOE A;  1JWV A;  2A24 A;  4ID4 A;  1CK3 A;  2IWD A;  5A91 A;  3MQ0 A;  3UMD A;  3A3E A;  3EWK A;  2G2W A;  5M18 A;  2Q0O A;  1K56 D;  3SS5 A;  3OCL A;  1NJ4 A;  2WAF A;  3BQA A;  3C30 A;  4BQM A;  3W4O A;  3F1P B;  2EX9 A;  3GV9 A;  5HZH A;  4LEN A;  1TVF A;  5DFX A;  5J7E A;  1YAX A;  2G7U A;  4NXB A;  2R78 A;  1QME A;  4X56 A;  5F83 A;  4O8G A;  5CHM A;  2HGV A;  3VOL A;  2Y55 A;  2Q9M A;  2ZOI A;  1TS8 A;  2E8I A;  3A0S A;  3OPH A;  5GHY A;  4OQG A;  5EVI B;  4DE3 A;  3ZG9 B;  4KG2 A;  2ZM0 A;  3FYZ A;  2W3H A;  3E4O A;  2EXA A;  3KYZ A;  3UDI A;  2GNX A;  2W0N A;  3JPU A;  4IBR A;  4R23 A;  1S4S A;  4I38 A;  1G6A A;  1TDG A;  4QD4 A;  1IEL A;  3ZDJ A;  4NKP A;  4EXO A;  4OPY A;  4NK3 A;  3G31 A;  3KSG A;  1FR1 A;  3N6I A;  3D9Y A;  4P85 A;  2QPN A;  5M1A A;  1CF0 A;  4RX2 A;  2B5R A;  2O9A A;  4S2L A;  5AQA A;  4N9K A;  2K7S A;  5FAS A;  2XK1 A;  1XJ2 A;  4EV4 A;  2XF3 A;  3OPR A;  3U4L P;  2NUP C;  2JKG A;  1NLY A;  3T4T A;  2WGW A;  1JWZ A;  1SKO B;  4AFI A;  2Q9N A;  4QY6 A;  3LR5 A;  1OJ5 A;  3ZQ5 A;  3MXS A;  3MXR A;  4BLM A;  1GHP A;  3EGD C;  1CEF A;  3R7W A;  4Y5F A;  3NUL A;  2W1R A;  4U3T A;  1L0G A;  3ZNT A;  3IXD A;  1I2S A;  5HWV A;  2ZQ7 A;  4PM9 A;  1DP6 A;  3ISG A;  4H6J A;  4P87 A;  4HH3 A;  4Y0O A;  4FD8 A;  4S2P A;  3AGD A;  2ZMF A;  3M2J A;  4QWO A;  3G4P A;  4LPZ A;  2W27 A;  5KMW A;  5AJG A;  2PAV P;  3QP5 A;  4WYY A;  2XA7 M;  4LV0 A;  1KVL A;  3HVF A;  3MR0 A;  1K4E A;  1S0W A;  3LIA A;  5MC7 A;  3PBT A;  1T1B A;  4Y0T A;  2PRF A;  3D4F A;  4GZB A;  2HJE A;  3MKF A;  5CGW A;  1YMX A;  2ZQ8 A;  1ZG4 A;  3VP3 A;  2L0W A;  3LR0 A;  1GSW A;  4HHD A;  4R70 A;  4EER A;  1YLZ A;  3A0V A;  5GL9 A;  3NDE A;  3Q07 A;  3O86 A;  5HL6 A;  1XGI A;  5IT5 A;  2W3F A;  3T1S A;  1HTZ A;  4PKY A;  1TEM A;  4ZAM A;  3B33 A;  3IHA A;  2ZQ9 A;  3QP6 A;  4XT2 B;  1I5Q A;  4IHQ A;  4N92 A;  5HWW A;  5GLC A;  5FA7 A;  3F1O B;  2WKR A;  2V9A A;  1DJA A;  1XA1 A;  1M6K A;  3PBR A;  5DFY A;  3SOI A;  1NWZ A;  4PKY G;  3EOI A;  3S22 A;  4R4R A;  2WKQ A;  3HLF A;  2UWX A;  4KZ3 A;  1FIK A;  5A93 A;  3T1X A;  1SDN A;  1G28 A;  4WZ5 C;  4ZJ3 A;  2WKE A;  1ODV A;  1PWC A;  4WMC A;  4Y3I A;  1PI5 A;  4R4S A;  5FAO A;  2VZW A;  3PBN A;  1IFQ A;  5HAI A;  1E4D A;  4E6W A;  3FPW A;  3OC2 A;  2R9X A;  4K08 A;  4HOI A;  2D02 A;  2D01 A;  4NEE D;  1ZHH B;  1V9Y A;  2JKR I;  2PD7 A;  5IHV A;  3BFG A;  5DVA A;  3GR2 A;  4UHU A;  3W4Q A;  2ZL1 B;  1CJF A;  5EE8 A;  4Q0H A;  3HLD A;  2EXB A;  2XQZ A;  1ZG6 A;  3UE0 A;  4JPM A;  4UAA A;  1DJC A;  1KDW A;  3IQA A;  4E3K A;  4MN6 A;  2YKH A;  3S7O A;  4GN2 A;  2MJ6 A;  3UPO A;  4G3V A;  5GLD A;  4KZ9 A;  2JHE A;  4IUK A;  3JVU A;  3LID A;  1S66 L;  4MCW A;  4Z9Q A;  1SCW A;  4OOM A;  1PIO A;  4KQR A;  1Q2P A;  5E43 A;  5CEC A;  4I3J A;  3OPP A;  3BEC A;  1LL8 A;  3CHW P;  4EBL A;  3VMA A;  2XRN A;  2LB5 A;  4S2O A;  5CHU A;  4PMA A;  1UWP X;  1WE4 A;  1LSV A;  1P0Z A;  4YOF A;  3GVB A;  3VFF A;  3LY4 A;  1CI9 A;  3OLO A;  1OT6 A;  3RJU A;  4WL9 A;  3C7U A;  1OPX A;  5A92 A;  3IWQ A;  1RGZ A;  1KOU A;  5L10 A;  3NHQ A;  2OSU A;  2ZC7 A;  1YLT A;  3QHY A;  4RX3 A;  1S4R A;  3BFD A;  5LBR A;  1PRQ A;  3SS3 A;  5L2F A;  2A24 B;  3DTE A;  5CRF A;  4DJ2 A;  3FG8 A;  4OQI A;  4UEY A;  5HFO A;  2XGN A;  2O0Y A;  4WF0 A;  4PM5 A;  3TW8 A;  3G34 A;  4LGW A;  3V67 A;  2V8C A;  4C6Y A;  3TSG A;  1YLW A;  2BAS A;  4NET A;  4B4X A;  3V50 A;  2J3T D;  5EFW A;  2Z6D A;  3M6B A;  2BG1 A;  3T1Q B;  5KSC A;  3S7P A;  4JXS A;  1XXM A;  2ZLY A;  2DRW A;  1MPL A;  3E4Q A;  5FAP A;  1BLP A;  2WAE A;  5EPH A;  3T4O A;  4GD6 A;  4S2J A;  2K2N A;  3UE1 A;  3C38 A;  3DAV A;  1EI5 A;  1K55 A;  1EWZ A;  2ZC6 B;  1VET A;  3G32 A;  4KZ7 A;  1GA0 A;  2EX2 A;  2Y4A A;  4IBX A;  1TDL A;  2Y2I A;  2NUT C;  4P6Z M;  3LIC A;  1HVB A;  3KYE A;  4CPK A;  5HD5 A;  4HQA A;  1KE4 A;  2GJ3 A;  3FKV A;  2EA9 A;  5F69 A;  4HP9 A;  4WEL A;  4EW7 A;  2HF6 A;  4KZ8 A;  3DTM A;  1FQG A;  2WUQ A;  4GB7 A;  5DF8 A;  1MKM A;  2WAD A;  5HPF A;  3UPP A;  1E3U D;  3I7J A;  2V0W A;  2ZM2 A;  4R3A A;  2Y59 A;  3HBR A;  4GKU A;  4NXG A;  4JBF A;  4R3J A;  2OLV A;  2FFY A;  1SHV A;  2WGW B;  3ZG8 B;  1HLU P;  1K56 A;  2Y2G A;  3RFB A;  3SS4 A;  2VJW A;  4JGP A;  5IU1 A;  2H0Y A;  3NIA A;  3E2K A;  2V1A A;  3K3C A;  1YSQ A;  3R7W B;  1DP8 A;  3ZGA B;  5L09 A;  4BL3 A;  4E3N A;  4DKI A;  2I9V A;  3RH8 B;  1GSX A;  3MZE A;  4GLQ A;  4MDZ A;  4N9L A;  4L9G A;  4XXR A;  4I39 A;  4H6J B;  4FTX A;  1Z6F A;  1S6R A;  2VV7 A;  1L0E A;  1BUE A;  1YKD A;  3SH8 A;  1FCM A;  4DXB A;  4B88 A;  1MWR A;  4E04 A;  1DRM A;  4EEU A;  1RP5 A;  1UGU A;  3LR4 A;  1M40 A;  1KDS A;  3KYQ A;  2E8J A;  2PU2 A;  3ITA A;  4KEN B;  3Q1F A;  2HPB A;  4E3I A;  2HP6 A;  1L2S A;  3N8R A;  3TE8 A;  1F2K A;  2QMI A;  2ZC5 B;  4DDS A;  5DTT A;  1LI9 A;  4KQO A;  3Q82 A;  1ERM A;  1S1Z A;  4GCZ A;  1F9I A;  3KSI A;  1J3W A;  3OBF A;  4ZBE A;  1KE0 A;  3LIB A;  2PHY A;  4OP8 A;  2EX6 A;  2WKP A;  1W63 M;  4DE1 A;  4MBF A;  2VV8 A;  3V39 A;  1IEM A;  5FQI A;  4OH0 A;  4XUZ A;  3MF0 A;  3UB5 P;  2BLS A;  4GHI A;  4IVK A;  2EX8 A;  1FIL A;  5F5Y A;  1XA7 A;  4OQH A;  1EW0 A;  4KZ5 A;  3O3V A;  1NZU A;  1XJ3 A;  1MWS A;  5GLA A;  3B47 A;  4MBK A;  2Z2M B;  5EEC A;  3EQV A;  3M2K A;  1N9O A;  1T19 A;  2P7J A;  4B9O A;  2HP5 A;  4Y17 A;  5F82 A;  1Y4O A;  1NLZ A;  3VP2 A;  3NEC A;  3P98 A;  4I3A A;  5FI6 A;  4OLG A;  4ZRR A;  3HLE A;  3UME A;  4OPQ A;  1H8Y A;  3Q7V A;  3GEC A;  1IYQ A;  4E3L A;  3HLB A;  3O87 A;  1PFL A;  4L0L A;  2PR5 A;  4Q8I A;  4Y13 A;  4P6Z S;  1LL9 A;  4EQ1 A;  3HJI A;  2X01 A;  1VHM A;  1VM1 A;  1VEU A;  2HV1 A;  1NYM A;  3KSF A;  2XSS A;  1V9Z A;  5DF7 A;  1H8M A;  1K0K A;  1SZV A;  2DMW A;  3BEB A;  4JGO A;  1P9R A;  4Z1W A;  4IVI A;  3IF5 A;  3FV7 A;  2HDU A;  1Q2Q A;  3C7V A;  3K3D A;  2WGI A;  1XPB A;  5GHX A;  4RA7 A;  4U0T A;  4OLD A;  3IT9 A;  1K57 A;  4YIN A;  2ZMA A;  4MBH A;  1BYW A;  2Y2K A;  2OWH A;  4PHT A;  4QY5 A;  4PM7 A;  5DJT A;  2JC7 A;  1K55 C;  2Y8H A;  1Z09 A;  2V2F F;  2VGJ A;  2VK3 A;  3DWZ A;  5EM1 A;  5D3O A;  5HW3 A;  5FQJ A;  4NXE A;  5G18 A;  1KGF A;  4PAU A;  3UB6 A;  4GD8 A;  5AQ7 A;  3MFD A;  3A3J A;  1G6O A;  1A0K A;  1LL5 A;  5HDS A;  3ITB A;  4IED A;  1XKZ A;  4Y15 A;  3IH8 A;  4UA6 A;  4CLC D;  3SW1 A;  1TS0 A;  3EQU A;  1AWI A;  1L3L A;  3GRJ A;  5L07 A;  4JXG A;  4UQI M;  4HI4 A;  4MMN A;  3HRE A;  3CMZ A;  3FZC A;  1W8Y A;  3CLO A;  3CJM A;  4JGR A;  5CXW A;  1XFN A;  1YM1 A;  3CI6 A;  3IXG A;  1STZ A;  3HJK A;  1MBL A;  3H9W A;  1ERO A;  1K6S A;  3BW6 A;  5HWT A;  2OAQ 1;  5CEB A;  2GDN A;  2PT7 A;  1NZO A;  3ZVT A;  4A5R A;  5G4Y A;  1P9W A;  4LFU A;  3IX4 A;  4DF6 A;  2JKF A;  5HDC A;  5I94 A;  4JXV A;  1GHI A;  4Y7P A;  3M6H A;  4LCL A;  5DTS A;  4DMZ A;  4YWZ A;  3JVV A;  2AVX A;  3ZHH A;  2K31 A;  5M19 A;  2EFU A;  4ZJ2 A;  3PBQ A;  5E2E A;  4DDY A;  4CQH A;  1NXY A;  4ME4 A;  1DY6 A;  4OPZ A;  1BLC A;  1ZTU A;  2VGK A;  3MBZ A;  5EVL A;  3IXH A;  3PYP A;  3LUQ A;  1LHY A;  5FQM A;  1S1Y A;  3UN7 A;  3VP0 A;  3GQZ A;  2B18 A;  2OLU A;  2ZQD A;  4LV1 A;  1FSY A;  1GHM A;  1VET B;  2O9C A;  3OZH A;  3IX3 A;  5FDS A;  1FCN A;  3G6O A;  2YKF A;  3WWX A;  4BBU A;  1ACF A;  5AQB A;  4X53 A;  3DWK A;  5HSQ A;  5IS1 A;  2R9W A;  1D06 A;  2C5W B;  2PBY A;  2Y2O A;  1N9N A;  2J9O A;  3SH9 A;  2XDM A;  3ZYT A;  5E2G A;  4DXC A;  3MJQ A;  2VA0 A;  5FEF A;  5FEG A;  4P6B A;  1NY0 A;  4D2O A;  3AGE A;  1YLY A;  4I3I A;  3Q7Z A;  3B42 A;  4DJ3 A;  4C75 A;  3UE6 A;  1BT5 A;  2X71 A;  3LI8 A;  1VQQ A;  2ZMV A;  5GLB A;  1GSV A;  3QNB A;  1CQA A;  3WS0 A;  3A3I A;  2ZC3 B;  5KSH A;  3CPT A;  2O9B A;  3PTE A;  1C3B A;  2GX5 A;  2M7V A;  1MY8 A;  3IF6 A;  4P0M A;  5JYP A;  2VV6 A;  2DNS A;  1K25 A;  5TGF A;  1U60 A;  3G30 A;  4N1H A;  1IKI A;  4MLL A;  3BFE A;  3IWI A;  3UB9 A;  2A49 A;  3P01 A;  2XA7 S;  2QJ5 A;  4R38 A;  4BWI A;  4K0X A;  5EVI D;  5FI2 A;  1PW8 A;  5AVF A;  3LIE A;  2C6W B;  1D7E A;  2Y91 A;  4X69 A;  4LRY C;  1MZU A;  3UE3 A;  3WRZ A;  1XX2 A;  2J7V A;  3E0Y A;  1LI0 A;  4UQI S;  4IUH A;  1ONG A;  4GOG A;  4HEF A;  2WGV A;  4R6L A;  2ZQC A;  3A3D A;  5CED A;  4R3B A;  1OTA A;  1F98 A;  4JLF A;  3CZD A;  1F5M A;  1E3U A;  4HY8 A;  3UDX A;  4CLC E;  3H82 A;  2Y2Q A;  3C2W A;  4OQ0 A;  1K57 C;  2OWJ A;  3DTI A;  4KG5 A;  4NXF A;  1HZO A;  4L9F A;  2VGL M;  4YNR A;  2Y2J A;  3C8C A;  4BJP A;  3V3S A;  2RL3 A;  4GHI B;  5GHZ A;  2V0U A;  2JKT M;  1IYO A;  2VKS A;  2WKI A;  3PR6 A;  2PDR A;  3C4P A;  4UA9 A;  4R1G A;  3E4P A;  1RCJ A;  2XEP A;  3LY3 A;  3GMW A;  3RTY A;  4BBT A;  1H0M A;  3NDG A;  3G35 A;  4ARZ A;  4PPR A;  4BBV A;  4EU0 A;  2QZ6 A;  1ERQ A;  3ZG5 A;  3BY9 A;  1W79 A;  4EEP A;  5DKL A;  3HUN A;  3VOY A;  2XD1 A;  3VFH A;  4JF5 A;  1L0D A;  1J9M A;  1WYB A;  3Q7V B;  3NOU C;  2LB9 A;  1YLP A;  3S4X A;  2QYB A;  2PD8 A;  1K54 A;  2QJ7 A;  1W8Q A;  1DJB A;  1OTE A;  3NC8 A;  1OTD A;  2INW A;  3QNC A;  3U2A A;  3DBA A;  1YMS A;  3GDI A;  3OOV A;  2QKP A;  3L9K A;  5DTK A;  3PAG A;  1VEU B;  4IJG A;  3C4O A;  4S2N A;  4BL2 A;  3IHB A;  4G3K A;  2XFS A;  4E6X A;  4KQD A;  2WK0 A;  1IKG A;  3N8S A;  2IWB A;  4F94 A;  4EBP A;  4ZDX A;  3PHY A;  4X55 A;  1ES2 A;  5JYO A;  3H7W A;  5EUA A;  2HDR A;  3O88 A;  1TS6 A;  1BTL A;  3NI9 A;  5CGX A;  3ZVW A;  1ZKJ A;  3PAE A;  1OT9 A;  2KX6 A;  1YSP A;  2XRO A;  4E3J A;  2Y2H A;  4WZ4 A;  5HPI A;  4XUX A;  4MNR A;  3VSK A;  2ZM8 A;  2WYX A;  3CG5 A;  2JE5 A;  3IWO A;  1YQS A;  2JN7 A;  3ZG0 A;  1LLB A;  3MXQ A;  3T4J A;  3N7W A;  4LLO B;  1Y54 A;  4D60 A;  4YFM A;  4F3L A;  3IX8 A;  4GNU A;  3G2Y A;  4X25 A;  1BSG A;  3NOP C;  3BYD A;  1QMF A;  1HD8 A;  5EOO A;  3UB8 A;  5A90 A;  4FCF A;  4OVD A;  1NYY A;  2GZA A;  3SH7 A;  4LCM A;  1S67 L;  3CUE A;  4EET B;  1W63 Q;  1MWT A;  3BM6 A;  2OAP 1;  3QP1 A;  2P9V A;  2J3T C;  3NJA A;  5CHJ A;  2VLG A;  3ULF A;  1PWD A;  4I5S A;  4ETX A;  4WM9 A;  1TF1 A;  5A8B A;  5HAR A;  4Y2F A;  1PZP A;  2VGL S;  3T50 A;  4Y0U A;  3B3X A;  3T4L A;  1O7E A;  2Z6C A;  3IF6 C;  3HUM A;  1H5X A;  1ALQ A;  2PU4 A;  4EBN A;  4Q0I A;  1XP4 A;  3MKE A;  3A3F A;  1X0O A;  2RCX A;  2M7U A;  3IS2 A;  3RXX A;  2EWW A;  3HUO A;  3JYI A;  1G5U A;  3T4S A;  2A2L A;  5HAP A;  2B95 A;  1N9L A;  4LV3 A;  4CLC A;  1XGJ A;  5U47 A;  3OCN A;  2JCH A;  1XFQ A;  4KUK A;  3MFX A;  1OTB A;  5F1G A;  3WS4 A;  1NRF A;  2KOI A;  1ZC2 A;  4HP4 A;  5CX7 A;  2XR0 A;  2J9P A;  2XD5 A;  2ZC4 B;  3W8K A;  1LSW A;  2EWV A;  4RQ9 A;  1KGE A;  3QP4 A;  3P09 A;  3PBO A;  4GS9 A;  5DJU A;  4EUV A;  4ETZ A;  4OPR A;  3VE4 A;  2M1C A;  1E25 A;  2FH5 A;  1N9B A;  1P97 A;  3IBJ A;  5EV0 A;  4HBU A;  4U0X A;  3T4Q A;  3TOI A;  5HDD A;  5I5L A;  3ZCZ A;  4PM6 A;  1CEG A;  3GSG A;  4RVA A;  4OOL A;  1SDE A;  1KGG A;  2W3G A;  3CIT A;  1OME A;  4HIA A;  4B93 A;  4HJ4 A;  1PWG A;  3BFF A;  4E3O A;  4M4X A;  3FKW A;  1W7F A;  3MQQ A;  1G68 A;  5FAT A;  4FH2 A;  3LCE A;  2FZ0 A;  4MEZ A;  3WS5 A;  4C3Q A;  2L1M A;  5F68 A;  5J8X A;  4WEJ A;  2CC1 A;  3CPT B;  2J8Y A;  3ZNY A;  4EUZ A;  3E98 A;  1IYP A;  3IF6 B;  3K2N A;  5FI7 A;  1K54 C;  4GDN A;  1KE3 A;  3NCK A;  3MMH A;  1FSW A;  4X1M A;  5TBM A;  1O07 A;  3DW0 A;  2H5S A;  1N4O A;  1XJ6 A;  2V20 A;  2P04 A;  2JBF A;  3F1N A;  3O5Y A;  4S2N C;  3MQO A;  4JKT A;  1MWU A;  5HD3 A;  4BD1 A;  2Y2L A;  2JKT I;  1GA9 A;  5E2H A;  2L4R A;  2H28 A;  1LSX A;  2W1T A;  3H82 B;  3LEQ A;  2Y2P A;  3BY8 A;  3D72 A;  4KZA A;  1ES4 A;  3NBL A;  3MSH A;  4S2I A;  5K5B A;  1JTG A;  4UA7 A;  4QHC A;  4KG6 A;  3UO9 A;  1BLH A;  4E3M A;  2G2U A;  2HJ9 C;  4QJG A;  4HBT A;  3F1P A;  4S2K A;  3N4I A;  4QPR A;  1GCE A;  1PI4 A;  2WZZ A;  5TR7 A;  4ARZ B;  3OPL A;  5F6A A;  1K4F A;  3MZD A;  1JWP A;  1XJ4 A;  3VP1 A;  2ZBB A;  4JF4 A;  1JNU A;  3D3O A;  3S1Y A;  2ACG A;  2Y2N A;  1ONH A;  1ESI A;  1JVJ A;  2XLN A;  5HL1 A;  3LYX A;  5FSR A;  4OKP A;  3W4P A;  3R4K A;  3VE3 A;  4G3W A;  1VB6 A;  5EVI A;  4R0Q A;  3ZG7 B;  3UDF A;  4O7D A;  1KVM A;  3CUE C;  5DF9 A;  2PBD P;  4EES A;  4KZ4 A;  4FH4 A;  3UB7 A;  5CGS A;  1FOF A;  5TJJ A;  3RXW A;  2P08 A;  5FQQ A;  3S7N A;  3T1R A;  3PXP A;  5J4E A;  1PYY A;  2VX8 A;  1AXB A;  3EEH A;  1WA9 A;  2A3U A;  3WRT A;  2UV0 E;  1T1A A;  4MN7 A;  5L8M A;  5FQ9 A;  2V8F A;  1OJG A;  1ESU A;  1K38 A;  4BD0 A;  2B02 A;  4OP5 A;  3IXB A;  4GDB A;  1SKO A;  3FC7 A;  3LIF A;  3V3R A;  4KZB A;  4HNB A;  1TS7 A;  4FSF A;  3H7W B;  3BJN A;  2P74 A;  3VOZ A;  3IBR A;  2CMN A;  3MS6 A;  2WZX A;  3UNW A;  1DP9 A;  1Y28 A;  5KIZ A;  4M3K A;  5CTN A;  1IYS A;  3HLG A;  4CLC C;  4KUO A;  3KX0 X;  2W3E A;  2PYP A;  4K91 A;  4X6T A;  4WUJ A;  3G2Z A;  2ZOH A;  2X02 A;  1JTD A;  4DE0 A;  4GJ4 A;  5KZH A;  4FOF A;  3T4K A;  4F3L B;  1NRJ A;  1BUL A;  4LV2 A;  1PW1 A;  4WMC D;  3P7N A;  5J3W A;  1I2W A;  4L9E A;  4DN0 A;  5AQ9 A;  2OOL A;  4K0W A;  3TRC A;  2V1B A;  2OV5 A;  5DKK A;  3HCY A;  3BQ8 A;  3HLW A;  5EM0 A;  3EEA A;  2ZQA A;  4HJ3 A;  4ZJ1 A;  3A0R A;  4OON A;  4CJN A;  3SZT A;  1IOU A;  4WBG A;  4WN5 A;  2WKH A;  2HDQ A;  4OOY A;  1LT0 A;  4B4Z A;  3LFV A;  2XFT A;  4FUW A;  3HLC A;  2P9V B;  3BLS A;  2HZ5 A;  2PR6 A;  4HJ6 A;  3BLM A;  2KLI A;  1BLS A;  4H8R A;  5F1F A;  2Y2M A;  3AGF A;  4S2M A;  2IA2 A;  4QU3 A;  4II7 A;  4KQQ A;  5AVE A;  3KO6 A;  1YPR A;  3UPN A;  2J80 A;  1YT4 A;  1RGY A;  4XT2 A;  4BMW A;  2W3D A;  3BRM A;  4N1X A;  1H3Q A;  2I72 A;  3LEZ A;  5G4Z A;  3F1O A;  5EVE A;  3WS1 A;  3VP4 A;  3N8L A;  1D1J A;  4Q0J A;  5FL3 A;  3IS2 B;  5HX9 A;  1WYC A;  3ZFZ A;  3ICY A;  2H0T A;  4X1L A;  2ZD8 A;  1SKF A;  4HH2 A;  4BEN A;  4CLC B;  3FPV A;  3S7Q A;  3HL9 A;  3NOT C;  5HAQ A;  4ZTK A;  1T18 A;  2Y79 A;  2BTF P;  2QWS A;  1ES5 A;  2VEA A;  3CWF A;  4QB8 A;  2DCF A;  1ES3 A;  3TG9 A;  4GW9 A;  4HES A;  3LO7 A;  4KZ6 A;  1PNE A;  3QP8 A;  4X68 A;  1FR6 A;  4GS9 B;  4O0P A;  2ZJ9 A;  1MKI A;  2O99 A;  2ZL1 A;  3QP2 A;  3VV4 A; 
#chains in the Genus database with same CATH homology
 3NUL A;  1G5U A;  2B95 A;  1F2K A;  1VEU A;  3T1R A;  2JKF A;  3T12 B;  3KYE A;  4FUW A;  1FIK A;  4D60 A;  3T1X A;  1K0K A;  1SZV A;  2HZ5 A;  1CQA A;  2V8F A;  1J3W A;  3CPT A;  4QWO A;  4X25 A;  2PAV P;  3LEQ A;  3L7H A;  1SKO A;  1YPR A;  3UB5 P;  3MSH A;  1HLU P;  1PRQ A;  4ESP A;  1FIL A;  3MS6 A;  5EVE A;  5EV0 A;  1Z09 A;  1D1J A;  2PRF A;  2VK3 A;  1VET B;  5EM1 A;  2ZL1 B;  1CJF A;  3L9K A;  4X1L A;  5FDS A;  1ACF A;  1VEU B;  1A0K A;  2V8C A;  1Y4O A;  3LGO A;  3NEC A;  1AWI A;  4FTX A;  3D9Y A;  2BTF P;  1CF0 A;  2ACG A;  3CPT B;  3T1Q B;  3U4L P;  3T1S A;  2JKG A;  2PBD P;  1PNE A;  1SKO B;  1PFL A;  2E8J A;  5FEF A;  3DAV A;  5EM0 A;  5FEG A;  4X1M A;  3CHW P;  1VET A;  2ZL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...