4X1LA

Structural basis for mutation-induced destabilization of profilin 1 in als
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
127
Chain Sequence
GWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRGLTLGGQKCSVIRDSLLQDGEFSMDLRTKPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-1
publication title Structural basis for mutation-induced destabilization of profilin 1 in ALS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 39
structure length 127
sequence length 138
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4x1lA00
2PAVP 1HLUP 1YPRA 1VETB 2HZ5A 4X25A 3CPTB 5FEFA 3UB5P 3NECA 2PRFA 1FIKA 1SKOA 3CHWP 5EM0A 1F2KA 2ZL1A 2B95A 4X1LA 3T12B 3T1RA 2BTFP 2VK3A 4QWOA 1CF0A 1VEUA 4FUWA 3LGOA 4X1MA 3T1XA 1PNEA 5FEGA 2V8CA 1A0KA 1VETA 1CQAA 5EM1A 1ACFA 2JKGA 1Z09A 1SZVA 1K0KA 4FTXA 1D1JA 5EV0A 1PFLA 2V8FA 3L9KA 2E8JA 3KYEA 3U4LP 3MSHA 3T1QB 1PRQA 3CPTA 3NULA 3MS6A 5EVEA 1Y4OA 3DAVA 1SKOB 5FDSA 1G5UA 3T1SA 2JKFA 1AWIA 1CJFA 2ZL1B 4D60A 1J3WA 1VEUB 3L7HA 4ESPA 2ACGA 1FILA 3D9YA 2PBDP 3LEQA
chains in the Genus database with same CATH superfamily
2PAVP 3ZNTA 3RXXA 3F1PA 3NI9A 1I2SA 3RFBA 5CHJA 3ZCZA 3VSLA 4P6BA 5L10A 4P6ZS 1GCEA 2Y2IA 3LI8A 3T12B 4N9LA 1KGGA 2LB5A 4S2MA 1PWGA 5EVIC 3JYIA 3UN7A 4NXBA 1ES4A 3KSIA 4K0XA 4WYYA 1FSWA 4MBFA 3GR2A 2Y4AA 2BASA 1JWZA 2JKGA 1FR6A 1OTBA 3PBRA 2ZQ7A 4CLCB 3ZNYA 5CTMA 1YLZA 2X02A 2PBYA 1P97A 4OPZA 1YMSA 1Y28A 4LV3A 3GRJA 4LV1A 2W1RA 3N8SA 3HREA 3G4PA 5FATA 4GW9A 2A24B 2P9VB 2XD5A 1GSWA 4QHCA 5HSQA 4Q0HA 3HJIA 1QMFA 3VP3A 4JGPA 2J9OA 2G2UA 3FKVA 3UE1A 3QP6A 1K54C 4G3KA 3B33A 4R4SA 4FH4A 3DTKA 1GA9A 1TS8A 3A3FA 3P01A 5FEFA 3FKWA 3LO7A 3VE4A 1IYPA 3NOTC 4WZ5C 4ID4A 2L4RA 1ONHA 3NOPC 2PYPA 3WRTA 1OT6A 4LCLA 4R1GA 1LL8A 2XGNA 5EFWA 3F1NB 1VHMA 1LL5A 4OQIA 2HDRA 5K5BA 4JGQA 5HX9A 4HH3A 2WK0A 2QHKA 4OKPA 2H0YA 4XUXA 2B18A 1CEFA 3IWIA 1S1YA 1KGEA 3LR4A 4MN6A 1NZUA 4LRYC 3EQVA 2HDSA 2ZC5B 1YLJA 4DXCA 2ZQCA 4QY5A 3OPLA 5EUAA 5FI2A 3G35A 4R0QA 1LSXA 4NK3A 3ITBA 4Y17A 3DW0A 1MBLA 1N9BA 4HEFA 3T1QB 1DJCA 3DWZA 1H8MA 2JHEA 4I38A 3PHYA 3DAVA 4DMZA 3ZG0A 3M6HA 2H0TA 3QP4A 1WE4A 5GLCA 5F82A 3BQ8A 2Z6DA 2WKEA 4PKYA 4G3WA 4Y13A 4O01A 3TG9A 5M18A 5G4ZA 2WGVA 3OPPA 4GJ4A 5EOOA 1TDGA 4OP5A 4Y7PA 3SS4A 1IYOA 3LEZA 5FASA 1BLCA 2CMNA 4BL3A 4HJ3A 2QZ6A 1N9OA 4EERA 3HLCA 1MXOA 1OT9A 2JC7A 3C7VA 2Y2HA 2VK3A 5E2GA 2E8IA 4NXFA 1MWUA 3C30A 5FQMA 2R9XA 3RTYA 3IS2A 2XSSA 1NXYA 2ZOIA 1BSGA 5KSHA 4O0PA 3T4JA 2D01A 4DRTA 3H82B 5DKLA 1Q2QA 3ZGAB 3EGDC 4YNRA 3Q1FA 5J7EA 3IX8A 3RH8B 1O07A 3P98A 1HTZA 4X6TA 4Y5FA 3N6IA 4PPRA 1VQQA 2PU2A 3B42A 2Y2GA 1WYCA 4IUKA 1MC0A 4PAUA 4WN5A 5A8BA 4HBUA 4ZJ3A 4YFMA 1ERQA 3VOYA 5IS1A 5HL6A 1HZOA 1GSVA 2R9WA 3T4OA 5GHZA 3QP8A 4FOFA 3UPOA 2PHYA 2XEPA 4D60A 2XF3A 2O0YA 5EPHA 4IVKA 4QU3A 1TDLA 5I5LA 5F5YA 2G7UA 1KOUA 4B4ZA 3LICA 3BW6A 1S4SA 3IQAA 4LFUA 3E4OA 1H3QA 1I5QA 3MXRA 1UWPX 3VE3A 3K3CA 4E3JA 3LIEA 2HF6A 4U0XA 4EWFA 1GA0A 1SHVA 1BUEA 3SH9A 4JXGA 3LY4A 3IBRA 2JKRM 2QPNA 3MXQA 2JE5A 2Y8HA 2KDKA 1YLWA 3HUNA 2VGJA 1IYSA 3KO6A 5M19A 3OLOA 1K55A 1VEUA 2Q9MA 4DN0A 5U47A 4KZ3A 5HD3A 1L0GA 2GNXA 5G18A 1ES2A 5A93A 1LLBA 3MFDA 1HD8A 3CLOA 4OPYA 5FQJA 4OOMA 4DDSA 5CERA 5FI7A 2ZQDA 2Y2QA 5KSCA 2PD8A 4K91A 1GHPA 2Y79A 2W3EA 4GKUA 4WBGA 4LV0A 1OJGA 5TGFA 1S1ZA 3BLMA 2PDRA 1UWNX 3T4SA 1G28A 3NBLA 2HDQA 4B4XA 4MMNA 3NCKA 2I9VA 3MQQA 4QB8A 2IWCA 3MMHA 5HARA 3ZDJA 4PM7A 3OPRA 3M2JA 4S2JA 3IWOA 3VFHA 4RX3A 1FILA 4BD0A 3C2WA 3MXSA 3C7UA 2PBDP 4HP4A 3W4PA 4Q8IA 3F1OB 3E2LA 1YLPA 1PZPA 4R4RA 2PRFA 1T1AA 4LCMA 5HL1A 3UDXA 2OSUA 3UDFA 1P9WA 5CRFA 4EEPA 5DJUA 3A0RA 3NJAA 3ZVWA 3HJKA 3G34A 2Z6CA 2WGWA 4PM5A 1N9LA 1W63Q 4QY6A 2JN7A 3LGOA 2QYBA 3PBTA 3S4XA 3LIDA 2O99A 4JKTA 5TBMA 2Z2MB 2V1AA 3R7WA 3B3XA 4OOLA 3P09A 1VETA 4KZ5A 4C3QA 3OC2A 3LUQA 1KE3A 4E6WA 4OP8A 2Y2PA 4FTXA 1BLSA 2M1CA 1BTLA 5L07A 4B9OA 3MZEA 2Y91A 3ITAA 2V0UA 1T18A 3BFDA 3SS5A 1L0FA 4LPZA 4WZ4A 1G68A 3BRMA 1Y4OA 3G30A 4R3BA 5GL9A 4BBVA 2GDNA 5I94A 2ZOHA 4GDBA 4II7A 3ISGA 3NOUC 2Y2LA 1GHIA 3GQZA 4EBNA 5TR7A 3MQOA 5DVAA 4QD4A 2ZC7A 5F1GA 2HP6A 4KZBA 1W8YA 4IHQA 5GHYA 4I3IA 3VV4A 3OBFA 3T50A 3UB5P 4X53A 5FDHA 4E3LA 2M7VA 5FQKA 5BOHA 1SKOA 2FFYA 5HPFA 4KQOA 5TFQA 1DP6A 5EM0A 4S2OA 2W27A 4F94A 3NY4A 1KDWA 2A3UA 1M40A 1BYWA 5CEDA 3QNBA 3H7WB 5KZHA 4EETB 1K4EA 3PR6A 4UEYA 4IVIA 5GHXA 2EFUA 1NY0A 3EEHA 4EEUA 2Y2OA 4KG6A 2EFXA 3IXDA 3WS1A 5JYOA 4L9EA 4O8GA 2VKSA 2C6WB 4BBTA 4HP9A 3Q81A 1XJ6A 3B47A 1BT5A 3BY9A 2DNSA 2NUTC 3W4QA 3A3DA 2XA7S 3HCYA 1IELA 3FZCA 3ZYTA 5D3OA 1PW8A 3WS5A 4N1XA 3VOLA 4Q0JA 2O9AA 4R23A 4E04A 1ODVA 3LI9A 3IX3A 1OTAA 2CC1A 4RYEA 3A3EA 3VP2A 2XROA 4B93A 1PW1A 2WZZA 4N1HA 5A91A 2J9PA 4UA6A 3V3RA 2QWSA 3UB6A 2H5SA 5FSRA 5KIZA 1FQGA 2V2FF 3WS0A 4DJ3A 2GX5A 4L9FA 2JKRI 4K0WA 4QPRA 2BLSA 4LENA 2WKIA 4ZBEA 1FR1A 3IHBA 4DF6A 1YQSA 2P04A 3EEAA 3UMEA 2VX8A 2HZ5A 1XFNA 4HHDA 3NDEA 3D4FA 3QP1A 2W1TB 4AFIA 3S7PA 3GDIA 4GN2A 2Q9NA 2V1BA 5HWWA 2GJ3A 5DTTA 1K55C 4OPQA 4X56A 4X1LA 2DMWA 5C5KA 3G31A 4QWOA 1XJ4A 4JXSA 4GCZA 1YKDA 5E2HA 3CWFA 3GTCA 3IF6A 4JXWA 3WRZA 3VSKA 2ZMAA 4GD6A 1IKIA 1XXMA 5HFOA 1X0OA 2PU4A 4GS9A 3JVUA 5F69A 3SH8A 4O7DA 5HDSA 3A3IA 4XT2A 1Z09A 4UA9A 1NJ4A 4R3JA 2ZJ9A 2ZQ8A 2OWJA 5HAQA 2W3FA 5CGWA 2OAQ1 5IT5A 2V8FA 2EWVA 4EUZA 3F1PB 4GNUA 2PYRA 4HIAA 2ZC6B 3BLSA 2EX9A 4MBKA 3FG8A 5A90A 3GV9A 4GD8A 2HJEA 2J8YA 3LR5A 3FPVA 1F5MA 4ZAMA 1D7EA 1MWTA 5E2FA 4ZTKA 4ESPA 3V39A 5FAOA 4XUZA 2J3TD 4I3AA 5FQIA 3VMAA 4OQHA 2V20A 1K56A 1NZOA 3C38A 3UDIA 4BLMA 2J7VA 4KZ8A 4IUHA 3OCLA 1PWDA 2ZQ9A 3CITA 2WUQA 4DE2A 3BYDA 2A2LA 5AQ9A 1FSYA 2ZL1A 2B95A 5F1FA 2BTFP 4WEJA 4BMWA 3ZFZA 3CJMA 4OLDA 5AQBA 4JPMA 4G3VA 2KX6A 1A0KA 1IEMA 3WS2A 4H6JA 5M1AA 1CQAA 1KGFA 3TJZC 1WYBA 4MLLA 4FCFA 1NRFA 2VGLM 5F68A 4E3OA 3BWLA 3PBSA 4JF4A 4KZ7A 3HVFA 3EQUA 4BD1A 3TOIA 1XX2A 3NIAA 1N4OA 4EBLA 2VJWA 2QMIA 2EXBA 3FWLA 1L3LA 3V3SA 3IF6B 4HJ4A 3EGXC 3NULA 2MJ6A 1M6KA 4HOIA 3W8KA 2ZMVA 3WWXA 1MZUA 3HLEA 5FQ9A 3EWKA 1F98A 2KOIA 3AGDA 2H28A 2UV0E 2K31A 1ZKJA 1ALQA 4WF0A 1XP4A 4EU0A 1E4DA 1W63M 2IWDA 1LI0A 4F3LA 4M3KA 1K56D 5FAQA 2RCXA 1NLYA 3PAGA 3Q7VA 5AJGA 2L1MA 2VV7A 2W0NA 4D2OA 1PIOA 4L9GA 5EVIA 4Y0TA 3PBNA 4P87A 4MEZA 4IBXA 4ME4A 2K7SA 1LL9A 1TEMA 2PD7A 1H0MA 4GHIA 1MKMA 5CGSA 4EV4A 3QP5A 1P9RA 1C3BA 2OLVA 4OQ0A 1KVLA 5AQAA 4ETZA 5FEGA 5F83A 1KE0A 4WELA 4WM9A 1S67L 4NXEA 4YOFA 1SZVA 3A0SA 2WAFA 2VGLS 4P0MA 5CHMA 4ARZA 4KUOA 3QP2A 4S2NA 1DP9A 4WL9A 2HP9A 3HLGA 2JBFA 3T4QA 4U0TA 4DXBA 1EI5A 3E0YA 4S2PA 3FV7A 1G5UA 2ZM2A 1TVFA 4ZRRA 2V1ZA 3IT9A 5J3WA 2ACGA 3IBJA 2J3TC 3IS2B 4KZAA 1XFQA 2V0WA 3ZG5A 5CXWA 4MN5A 1ZC2A 1MWSA 4KQRA 1YPRA 5EVID 2PR5A 2W3GA 2OOLA 1KVMA 1XPBA 3HUMA 3TRCA 4NETA 1CEGA 1BLPA 1DY6A 4EW7A 2ZMFA 4MDZA 3QNCA 3IF6C 1CF0A 4HESA 3BM6A 1NYYA 5AQ7A 1SDNA 3ZG7B 3BQAA 3KSFA 1ESUA 4Y15A 4HJ6A 3OZHA 3UE3A 3O86A 1NRJA 2W3HA 3UMDA 3A0VA 5HD5A 1S4RA 1PI4A 3HLBA 1RGYA 3TE8A 1LSWA 1VM1A 1QMEA 2H10A 4I5SA 4H8RA 3O87A 1FCNA 3Q07A 1IKGA 2I72A 4UA7A 4EESA 4E3NA 2Z2LB 5CEBA 3KSGA 1OPXA 4YWZA 3L9KA 5GLBA 3U4LP 1K6RA 3CPTA 1KDSA 2XA7M 4Y0OA 2XK1A 3MR0A 1VB6A 4RQ9A 1PZOA 1YSPA 1ONGA 2QJ5A 5E43A 5LBRA 1T1BA 5DFXA 2ZQAA 1W7FA 1VEUB 2X01A 2HPBA 3P7NA 1SDEA 4CLCA 3S7OA 1Y54A 1E3UA 3CI6A 4DE3A 1LT0A 3IX4A 5KMWA 2IA2A 5FI6A 1FIKA 3SW1A 5L09A 3PXPA 1F2KA 2A24A 2P9VA 1BLHA 1HVBA 2EXAA 2WKRA 4Y2FA 2INWA 1Z6FA 4UHUA 2VV8A 4CQHA 3G2YA 4E3MA 2WYXA 4BBUA 2EX8A 4JXVA 1NWZA 3V67A 1EW0A 1SCWA 1STZA 1CI9A 3BJNA 5EM1A 4MCWA 3VP1A 3KYQA 3Q7ZA 4A5RA 2FZ0A 4QJGA 3DTMA 3HLWA 4JF6A 3HLDA 3RXWA 4R70A 1D06A 2ZC4B 1PFLA 5EV0A 3F1NA 3LIFA 4YINA 1TD5A 3KYEA 4JLFA 3FYZA 3IXBA 4N92A 5FQQA 5TJJA 3VP4A 2XDMA 4C75A 2XRNA 3MBZA 1YSQA 3TW8A 5FDSA 1XGIA 3NDGA 4DE0A 2WGWB 1ES5A 2D02A 3SS3A 1MY8A 3D72A 2WAEA 4CLCD 3GSGA 2ZM0A 1E3UD 4PHTA 5TBMB 2JKTI 5EE8A 1OJ5A 3R7WB 3LEQA 2XQZA 2Y2KA 3ZHHA 1VETB 3CPTB 4X55A 2WZXA 3S7NA 4HQAA 5G4YA 4PM8A 4WUJA 2ZD8A 3WS4A 1K57A 3RJUA 3VOZA 1TS6A 3E4PA 3MZFA 3VFFA 1MPLA 4NKPA 1I2WA 4DKIA 5MC7A 4MN7A 1XJ2A 1YMXA 4OH0A 3MKEA 1YLYA 3UB9A 3KYZA 3M2KA 4HH2A 1F9IA 5GLDA 4GLQA 4XXRA 4HI4A 2XLNA 4E3IA 4Q0IA 1OTDA 2G2WA 4K08A 5IHVA 2A49A 4S2NC 3CUEA 3KSHA 1MWRA 4MNRA 2Y59A 2PR6A 4NXGA 1DP8A 2VA0A 4RVAA 1IYQA 1PYYA 2K2NA 1G6AA 2XFSA 3HLFA 3HL9A 5L8MA 1SKOB 3LCEA 2P08A 2O9CA 2Y2MA 3H82A 4BENA 3ZG9B 1J3WA 1XA7A 3ZVTA 4Z9QA 5J8XA 2P7JA 1K38A 4EUVA 4R38A 2LB9A 4KUKA 1S0WA 1V9YA 3UE0A 3OCNA 1YLTA 5JYPA 4S2KA 3MJQA 1CI8A 4BQMA 1HLUP 3SZTA 3LY3A 3BY8A 4DJ2A 2EX2A 3UE6A 2RL3A 2Y2JA 4Y3IA 3H9WA 3BFEA 3M6BA 3ULFA 3G2ZA 3O3VA 4WLAA 2X71A 3E2KA 3BFFA 3DWKA 3U2AA 4P85A 5HPIA 4JF5A 4OOYA 3VP0A 3V50A 2VV6A 1LHYA 4U3TA 3LR3A 5AVEA 4X1MA 4ZJ2A 4HBTA 1PNEA 3GMWA 2VEAA 1ERMA 2EX6A 1AXBA 3UPNA 2YKFA 3C5AA 4GB7A 3CAXA 1OTEA 3C8CA 1V9ZA 2R78A 5HZHA 2FFFB 3OPHA 2C5WB 2QJ7A 2WKHA 4HY8A 3O88A 1OMEA 2WKQA 1L2SA 2WKPA 3LIBA 4BWIA 2PT7A 3MFXA 4KG5A 1S6RA 4RX2A 4EQ1A 2E8JA 3IWQA 5GLAA 3JVVA 5DF7A 1DJAA 1JTDA 1PRQA 4GZBA 4KENB 3R4KA 3MS6A 3PBOA 4KZ9A 3UY6A 2Y2NA 3MKFA 4R6LA 1W79A 3T4LA 4Y0UA 1AWIA 1BZAA 3QHYA 4C6YA 4IBRA 2VZWA 4MBHA 4FSFA 3HBRA 1H8ZA 4CLCC 2BG1A 3IH8A 3K2NA 1JWPA 1E25A 1FOFA 2Q0OA 5DFYA 4ETXA 5CECA 4PM6A 1FCMA 4GS9B 2WGIA 4PMAA 4X25A 2XR0A 4B88A 3LYXA 2ZLYA 4XT2B 3NC8A 3BEBA 3I7JA 5CHUA 3JPUA 1ESIA 3PYPA 4BJPA 1DRMA 3T4KA 2W3DA 4GOGA 4JBFA 4OQGA 1BULA 4FUWA 1T1CA 4CLCE 2AVXA 3T1XA 1UGUA 3E4QA 5IU1A 4I3JA 2JCHA 2QKPA 4BL2A 2V8CA 4EQIA 3IHAA 3W2ZA 3BECA 2ZBBA 3MZDA 2VGKA 1ZG6A 3F1OA 4EXOA 5A92A 4LV2A 2JKTM 1ES3A 2WADA 5CTNA 3Q82A 4KQDA 2P74A 3E98A 4E6XA 5L2FA 1O7EA 1D1JA 3S7QA 5EECA 1LI9A 5DF8A 3UNWA 5FAPA 3PTEA 4UAAA 4NG2A 4CJNA 3IXGA 4KZ4A 1KE4A 4N9KA 3EOIA 1XJ3A 4LRXC 4L0LA 2DCFA 3CG5A 3MF0A 2EWWA 2ZL1B 3ICYA 3BFCA 4LLOB 5FL3A 4I39A 3T4TA 2XFTA 1N9NA 2J3WA 4PM9A 4WMCA 2VLGA 5HDCA 2XH9A 1K54A 5HWVA 2Y55A 3GVBA 1IOUA 4H6JB 4HNBA 1TS7A 1TS0A 3GECA 2YKHA 3NECA 2IWBA 3HUOA 3IF5A 4M4XA 1K57C 1P0ZA 1L0DA 1CK3A 1K25A 2KLIA 3MQ0A 4LRZE 1RGZA 1JNUA 4WZ5A 2B02A 5J4EA 1OTIA 1FCOA 4UQIM 2EA9A 2J80A 3BFGA 3ZG8B 1ZG4A 3OOVA 5HDDA 2DRWA 3AGEA 4OVDA 4IJGA 3N8LA 1GSXA 5AVFA 3PBQA 3KX0X 3UPPA 2XD1A 2OV5A 3N8RA 3N7WA 4FD8A 1YT4A 3C4OA 1XA1A 1ACFA 5HAIA 1K0KA 3CUEC 4WEKA 2V9AA 1TF1A 4DDYA 3PAEA 5DKKA 4F3LB 2HDUA 4FH2A 2M7UA 4DE1A 2OAP1 1K6SA 3Q7VB 5E2EA 4ZJ1A 3AGFA 1PWCA 4EBPA 3CMZA 1EROA 1K4FA 3H7WA 5DTKA 1H5XA 3MSHA 3UB7A 2ZM8A 5EVIB 2HJ9C 4RA7A 4GDNA 1EWZA 2NUPC 1MKIA 1Q2PA 3C4PA 2B5RA 5EVLA 2JKFA 1CJFA 1H8YA 4Z1WA 3K3DA 4GHIB 3LIAA 4WMCD 3UO9A 1RCJA 4X69A 3A3JA 3D9YA 3UB8A 3IH9A 3NHQA 4P6ZM 3S22A 3CZDA 2OWHA 4JGRA 1ZTUA 1LSVA 3G6OA 1WA9A 3LR0A 3V5MA 2L0WA 4E3KA 1L0EA 5HW3A 1G6OA 3CHWP 2UWXA 4KQQA 5CGXA 3SOIA 1U60A 1J9MA 3T1RA 4S2LA 1XKZA 4ARZB 4X68A 4KG2A 1YAXA 5DJTA 5DF9A 3SH7A 1GHMA 4NEED 3D3OA 4R3AA 3LFVA 5FA7A 4UQIS 2GZAA 4LGWA 1XGJA 1ZHHB 3O5YA 4CPKA 1NYMA 4KZ6A 1JVJA 3DTEA 5HAPA 4OONA 2W1TA 1DJBA 1JTGA 3W4OA 4ZDXA 1JWVA 4IEDA 1W5DA 2HGVA 4S2IA 4OLGA 3FC7A 2OLUA 3N4IA 3DBAA 5DTSA 1T19A 2FH5A 1W8QA 4JGOA 1SKFA 3ZQ5A 1PI5A 5F6AA 5EOEA 1YM1A 3TSGA 3FPWA 5EVEA 5HWTA 3G32A 1RP5A 3DTIA 5CX7A 2ZC3B 3T1SA 4OPRA 1NLZA 2O9BA 3IXHA 2HV1A 4PKYG 3L7HA 1S66L 2HP5A 1IFQA 3S1YA
chains in the Genus database with same CATH topology
2PAVP 1HLUP 1YPRA 1VETB 2HZ5A 4X25A 3CPTB 5FEFA 3UB5P 3NECA 2PRFA 1FIKA 1SKOA 3CHWP 5EM0A 1F2KA 2ZL1A 2B95A 4X1LA 3T12B 3T1RA 2BTFP 2VK3A 4QWOA 1CF0A 1VEUA 4FUWA 3LGOA 4X1MA 3T1XA 1PNEA 5FEGA 2V8CA 1A0KA 1VETA 1CQAA 5EM1A 1ACFA 2JKGA 1Z09A 1SZVA 1K0KA 4FTXA 1D1JA 5EV0A 1PFLA 2V8FA 3L9KA 2E8JA 3KYEA 3U4LP 3MSHA 3T1QB 1PRQA 3CPTA 3NULA 3MS6A 5EVEA 1Y4OA 3DAVA 1SKOB 5FDSA 1G5UA 3T1SA 2JKFA 1AWIA 1CJFA 2ZL1B 4D60A 1J3WA 1VEUB 3L7HA 4ESPA 2ACGA 1FILA 3D9YA 2PBDP 3LEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PAV P;  1HLU P;  1YPR A;  1VET B;  2HZ5 A;  4X25 A;  3CPT B;  5FEF A;  3UB5 P;  3NEC A;  2PRF A;  1FIK A;  1SKO A;  3CHW P;  5EM0 A;  1F2K A;  2ZL1 A;  2B95 A;  4X1L A;  3T12 B;  3T1R A;  2BTF P;  2VK3 A;  4QWO A;  1CF0 A;  1VEU A;  4FUW A;  3LGO A;  4X1M A;  3T1X A;  1PNE A;  5FEG A;  2V8C A;  1A0K A;  1VET A;  1CQA A;  5EM1 A;  1ACF A;  2JKG A;  1Z09 A;  1SZV A;  1K0K A;  4FTX A;  1D1J A;  5EV0 A;  1PFL A;  2V8F A;  3L9K A;  2E8J A;  3KYE A;  3U4L P;  3MSH A;  3T1Q B;  1PRQ A;  3CPT A;  3NUL A;  3MS6 A;  5EVE A;  1Y4O A;  3DAV A;  1SKO B;  5FDS A;  1G5U A;  3T1S A;  2JKF A;  1AWI A;  1CJF A;  2ZL1 B;  4D60 A;  1J3W A;  1VEU B;  3L7H A;  4ESP A;  2ACG A;  1FIL A;  3D9Y A;  2PBD P;  3LEQ A; 
#chains in the Genus database with same CATH topology
 2PAV P;  3ZNT A;  3RXX A;  3F1P A;  3NI9 A;  1I2S A;  3RFB A;  5CHJ A;  3ZCZ A;  3VSL A;  4P6B A;  5L10 A;  4P6Z S;  1GCE A;  2Y2I A;  3LI8 A;  3T12 B;  4N9L A;  1KGG A;  2LB5 A;  4S2M A;  1PWG A;  5EVI C;  3JYI A;  3UN7 A;  4NXB A;  1ES4 A;  3KSI A;  4K0X A;  4WYY A;  1FSW A;  4MBF A;  3GR2 A;  2Y4A A;  2BAS A;  1JWZ A;  2JKG A;  1FR6 A;  1OTB A;  3PBR A;  2ZQ7 A;  4CLC B;  3ZNY A;  5CTM A;  1YLZ A;  2X02 A;  2PBY A;  1P97 A;  4OPZ A;  1YMS A;  1Y28 A;  4LV3 A;  3GRJ A;  4LV1 A;  2W1R A;  3N8S A;  3HRE A;  3G4P A;  5FAT A;  4GW9 A;  2A24 B;  2P9V B;  2XD5 A;  1GSW A;  4QHC A;  5HSQ A;  4Q0H A;  3HJI A;  1QMF A;  3VP3 A;  4JGP A;  2J9O A;  2G2U A;  3FKV A;  3UE1 A;  3QP6 A;  1K54 C;  4G3K A;  3B33 A;  4R4S A;  4FH4 A;  3DTK A;  1GA9 A;  1TS8 A;  3A3F A;  3P01 A;  5FEF A;  3FKW A;  3LO7 A;  3VE4 A;  1IYP A;  3NOT C;  4WZ5 C;  4ID4 A;  2L4R A;  1ONH A;  3NOP C;  2PYP A;  3WRT A;  1OT6 A;  4LCL A;  4R1G A;  1LL8 A;  2XGN A;  5EFW A;  3F1N B;  1VHM A;  1LL5 A;  4OQI A;  2HDR A;  5K5B A;  4JGQ A;  5HX9 A;  4HH3 A;  2WK0 A;  2QHK A;  4OKP A;  2H0Y A;  4XUX A;  2B18 A;  1CEF A;  3IWI A;  1S1Y A;  1KGE A;  3LR4 A;  4MN6 A;  1NZU A;  4LRY C;  3EQV A;  2HDS A;  2ZC5 B;  1YLJ A;  4DXC A;  2ZQC A;  4QY5 A;  3OPL A;  5EUA A;  5FI2 A;  3G35 A;  4R0Q A;  1LSX A;  4NK3 A;  3ITB A;  4Y17 A;  3DW0 A;  1MBL A;  1N9B A;  4HEF A;  3T1Q B;  1DJC A;  3DWZ A;  1H8M A;  2JHE A;  4I38 A;  3PHY A;  3DAV A;  4DMZ A;  3ZG0 A;  3M6H A;  2H0T A;  3QP4 A;  1WE4 A;  5GLC A;  5F82 A;  3BQ8 A;  2Z6D A;  2WKE A;  4PKY A;  4G3W A;  4Y13 A;  4O01 A;  3TG9 A;  5M18 A;  5G4Z A;  2WGV A;  3OPP A;  4GJ4 A;  5EOO A;  1TDG A;  4OP5 A;  4Y7P A;  3SS4 A;  1IYO A;  3LEZ A;  5FAS A;  1BLC A;  2CMN A;  4BL3 A;  4HJ3 A;  2QZ6 A;  1N9O A;  4EER A;  3HLC A;  1MXO A;  1OT9 A;  2JC7 A;  3C7V A;  2Y2H A;  2VK3 A;  5E2G A;  2E8I A;  4NXF A;  1MWU A;  3C30 A;  5FQM A;  2R9X A;  3RTY A;  3IS2 A;  2XSS A;  1NXY A;  2ZOI A;  1BSG A;  5KSH A;  4O0P A;  3T4J A;  2D01 A;  4DRT A;  3H82 B;  5DKL A;  1Q2Q A;  3ZGA B;  3EGD C;  4YNR A;  3Q1F A;  5J7E A;  3IX8 A;  3RH8 B;  1O07 A;  3P98 A;  1HTZ A;  4X6T A;  4Y5F A;  3N6I A;  4PPR A;  1VQQ A;  2PU2 A;  3B42 A;  2Y2G A;  1WYC A;  4IUK A;  1MC0 A;  4PAU A;  4WN5 A;  5A8B A;  4HBU A;  4ZJ3 A;  4YFM A;  1ERQ A;  3VOY A;  5IS1 A;  5HL6 A;  1HZO A;  1GSV A;  2R9W A;  3T4O A;  5GHZ A;  3QP8 A;  4FOF A;  3UPO A;  2PHY A;  2XEP A;  4D60 A;  2XF3 A;  2O0Y A;  5EPH A;  4IVK A;  4QU3 A;  1TDL A;  5I5L A;  5F5Y A;  2G7U A;  1KOU A;  4B4Z A;  3LIC A;  3BW6 A;  1S4S A;  3IQA A;  4LFU A;  3E4O A;  1H3Q A;  1I5Q A;  3MXR A;  1UWP X;  3VE3 A;  3K3C A;  4E3J A;  3LIE A;  2HF6 A;  4U0X A;  4EWF A;  1GA0 A;  1SHV A;  1BUE A;  3SH9 A;  4JXG A;  3LY4 A;  3IBR A;  2JKR M;  2QPN A;  3MXQ A;  2JE5 A;  2Y8H A;  2KDK A;  1YLW A;  3HUN A;  2VGJ A;  1IYS A;  3KO6 A;  5M19 A;  3OLO A;  1K55 A;  1VEU A;  2Q9M A;  4DN0 A;  5U47 A;  4KZ3 A;  5HD3 A;  1L0G A;  2GNX A;  5G18 A;  1ES2 A;  5A93 A;  1LLB A;  3MFD A;  1HD8 A;  3CLO A;  4OPY A;  5FQJ A;  4OOM A;  4DDS A;  5CER A;  5FI7 A;  2ZQD A;  2Y2Q A;  5KSC A;  2PD8 A;  4K91 A;  1GHP A;  2Y79 A;  2W3E A;  4GKU A;  4WBG A;  4LV0 A;  1OJG A;  5TGF A;  1S1Z A;  3BLM A;  2PDR A;  1UWN X;  3T4S A;  1G28 A;  3NBL A;  2HDQ A;  4B4X A;  4MMN A;  3NCK A;  2I9V A;  3MQQ A;  4QB8 A;  2IWC A;  3MMH A;  5HAR A;  3ZDJ A;  4PM7 A;  3OPR A;  3M2J A;  4S2J A;  3IWO A;  3VFH A;  4RX3 A;  1FIL A;  4BD0 A;  3C2W A;  3MXS A;  3C7U A;  2PBD P;  4HP4 A;  3W4P A;  4Q8I A;  3F1O B;  3E2L A;  1YLP A;  1PZP A;  4R4R A;  2PRF A;  1T1A A;  4LCM A;  5HL1 A;  3UDX A;  2OSU A;  3UDF A;  1P9W A;  5CRF A;  4EEP A;  5DJU A;  3A0R A;  3NJA A;  3ZVW A;  3HJK A;  3G34 A;  2Z6C A;  2WGW A;  4PM5 A;  1N9L A;  1W63 Q;  4QY6 A;  2JN7 A;  3LGO A;  2QYB A;  3PBT A;  3S4X A;  3LID A;  2O99 A;  4JKT A;  5TBM A;  2Z2M B;  2V1A A;  3R7W A;  3B3X A;  4OOL A;  3P09 A;  1VET A;  4KZ5 A;  4C3Q A;  3OC2 A;  3LUQ A;  1KE3 A;  4E6W A;  4OP8 A;  2Y2P A;  4FTX A;  1BLS A;  2M1C A;  1BTL A;  5L07 A;  4B9O A;  3MZE A;  2Y91 A;  3ITA A;  2V0U A;  1T18 A;  3BFD A;  3SS5 A;  1L0F A;  4LPZ A;  4WZ4 A;  1G68 A;  3BRM A;  1Y4O A;  3G30 A;  4R3B A;  5GL9 A;  4BBV A;  2GDN A;  5I94 A;  2ZOH A;  4GDB A;  4II7 A;  3ISG A;  3NOU C;  2Y2L A;  1GHI A;  3GQZ A;  4EBN A;  5TR7 A;  3MQO A;  5DVA A;  4QD4 A;  2ZC7 A;  5F1G A;  2HP6 A;  4KZB A;  1W8Y A;  4IHQ A;  5GHY A;  4I3I A;  3VV4 A;  3OBF A;  3T50 A;  3UB5 P;  4X53 A;  5FDH A;  4E3L A;  2M7V A;  5FQK A;  5BOH A;  1SKO A;  2FFY A;  5HPF A;  4KQO A;  5TFQ A;  1DP6 A;  5EM0 A;  4S2O A;  2W27 A;  4F94 A;  3NY4 A;  1KDW A;  2A3U A;  1M40 A;  1BYW A;  5CED A;  3QNB A;  3H7W B;  5KZH A;  4EET B;  1K4E A;  3PR6 A;  4UEY A;  4IVI A;  5GHX A;  2EFU A;  1NY0 A;  3EEH A;  4EEU A;  2Y2O A;  4KG6 A;  2EFX A;  3IXD A;  3WS1 A;  5JYO A;  4L9E A;  4O8G A;  2VKS A;  2C6W B;  4BBT A;  4HP9 A;  3Q81 A;  1XJ6 A;  3B47 A;  1BT5 A;  3BY9 A;  2DNS A;  2NUT C;  3W4Q A;  3A3D A;  2XA7 S;  3HCY A;  1IEL A;  3FZC A;  3ZYT A;  5D3O A;  1PW8 A;  3WS5 A;  4N1X A;  3VOL A;  4Q0J A;  2O9A A;  4R23 A;  4E04 A;  1ODV A;  3LI9 A;  3IX3 A;  1OTA A;  2CC1 A;  4RYE A;  3A3E A;  3VP2 A;  2XRO A;  4B93 A;  1PW1 A;  2WZZ A;  4N1H A;  5A91 A;  2J9P A;  4UA6 A;  3V3R A;  2QWS A;  3UB6 A;  2H5S A;  5FSR A;  5KIZ A;  1FQG A;  2V2F F;  3WS0 A;  4DJ3 A;  2GX5 A;  4L9F A;  2JKR I;  4K0W A;  4QPR A;  2BLS A;  4LEN A;  2WKI A;  4ZBE A;  1FR1 A;  3IHB A;  4DF6 A;  1YQS A;  2P04 A;  3EEA A;  3UME A;  2VX8 A;  2HZ5 A;  1XFN A;  4HHD A;  3NDE A;  3D4F A;  3QP1 A;  2W1T B;  4AFI A;  3S7P A;  3GDI A;  4GN2 A;  2Q9N A;  2V1B A;  5HWW A;  2GJ3 A;  5DTT A;  1K55 C;  4OPQ A;  4X56 A;  4X1L A;  2DMW A;  5C5K A;  3G31 A;  4QWO A;  1XJ4 A;  4JXS A;  4GCZ A;  1YKD A;  5E2H A;  3CWF A;  3GTC A;  3IF6 A;  4JXW A;  3WRZ A;  3VSK A;  2ZMA A;  4GD6 A;  1IKI A;  1XXM A;  5HFO A;  1X0O A;  2PU4 A;  4GS9 A;  3JVU A;  5F69 A;  3SH8 A;  4O7D A;  5HDS A;  3A3I A;  4XT2 A;  1Z09 A;  4UA9 A;  1NJ4 A;  4R3J A;  2ZJ9 A;  2ZQ8 A;  2OWJ A;  5HAQ A;  2W3F A;  5CGW A;  2OAQ 1;  5IT5 A;  2V8F A;  2EWV A;  4EUZ A;  3F1P B;  4GNU A;  2PYR A;  4HIA A;  2ZC6 B;  3BLS A;  2EX9 A;  4MBK A;  3FG8 A;  5A90 A;  3GV9 A;  4GD8 A;  2HJE A;  2J8Y A;  3LR5 A;  3FPV A;  1F5M A;  4ZAM A;  1D7E A;  1MWT A;  5E2F A;  4ZTK A;  4ESP A;  3V39 A;  5FAO A;  4XUZ A;  2J3T D;  4I3A A;  5FQI A;  3VMA A;  4OQH A;  2V20 A;  1K56 A;  1NZO A;  3C38 A;  3UDI A;  4BLM A;  2J7V A;  4KZ8 A;  4IUH A;  3OCL A;  1PWD A;  2ZQ9 A;  3CIT A;  2WUQ A;  4DE2 A;  3BYD A;  2A2L A;  5AQ9 A;  1FSY A;  2ZL1 A;  2B95 A;  5F1F A;  2BTF P;  4WEJ A;  4BMW A;  3ZFZ A;  3CJM A;  4OLD A;  5AQB A;  4JPM A;  4G3V A;  2KX6 A;  1A0K A;  1IEM A;  3WS2 A;  4H6J A;  5M1A A;  1CQA A;  1KGF A;  3TJZ C;  1WYB A;  4MLL A;  4FCF A;  1NRF A;  2VGL M;  5F68 A;  4E3O A;  3BWL A;  3PBS A;  4JF4 A;  4KZ7 A;  3HVF A;  3EQU A;  4BD1 A;  3TOI A;  1XX2 A;  3NIA A;  1N4O A;  4EBL A;  2VJW A;  2QMI A;  2EXB A;  3FWL A;  1L3L A;  3V3S A;  3IF6 B;  4HJ4 A;  3EGX C;  3NUL A;  2MJ6 A;  1M6K A;  4HOI A;  3W8K A;  2ZMV A;  3WWX A;  1MZU A;  3HLE A;  5FQ9 A;  3EWK A;  1F98 A;  2KOI A;  3AGD A;  2H28 A;  2UV0 E;  2K31 A;  1ZKJ A;  1ALQ A;  4WF0 A;  1XP4 A;  4EU0 A;  1E4D A;  1W63 M;  2IWD A;  1LI0 A;  4F3L A;  4M3K A;  1K56 D;  5FAQ A;  2RCX A;  1NLY A;  3PAG A;  3Q7V A;  5AJG A;  2L1M A;  2VV7 A;  2W0N A;  4D2O A;  1PIO A;  4L9G A;  5EVI A;  4Y0T A;  3PBN A;  4P87 A;  4MEZ A;  4IBX A;  4ME4 A;  2K7S A;  1LL9 A;  1TEM A;  2PD7 A;  1H0M A;  4GHI A;  1MKM A;  5CGS A;  4EV4 A;  3QP5 A;  1P9R A;  1C3B A;  2OLV A;  4OQ0 A;  1KVL A;  5AQA A;  4ETZ A;  5FEG A;  5F83 A;  1KE0 A;  4WEL A;  4WM9 A;  1S67 L;  4NXE A;  4YOF A;  1SZV A;  3A0S A;  2WAF A;  2VGL S;  4P0M A;  5CHM A;  4ARZ A;  4KUO A;  3QP2 A;  4S2N A;  1DP9 A;  4WL9 A;  2HP9 A;  3HLG A;  2JBF A;  3T4Q A;  4U0T A;  4DXB A;  1EI5 A;  3E0Y A;  4S2P A;  3FV7 A;  1G5U A;  2ZM2 A;  1TVF A;  4ZRR A;  2V1Z A;  3IT9 A;  5J3W A;  2ACG A;  3IBJ A;  2J3T C;  3IS2 B;  4KZA A;  1XFQ A;  2V0W A;  3ZG5 A;  5CXW A;  4MN5 A;  1ZC2 A;  1MWS A;  4KQR A;  1YPR A;  5EVI D;  2PR5 A;  2W3G A;  2OOL A;  1KVM A;  1XPB A;  3HUM A;  3TRC A;  4NET A;  1CEG A;  1BLP A;  1DY6 A;  4EW7 A;  2ZMF A;  4MDZ A;  3QNC A;  3IF6 C;  1CF0 A;  4HES A;  3BM6 A;  1NYY A;  5AQ7 A;  1SDN A;  3ZG7 B;  3BQA A;  3KSF A;  1ESU A;  4Y15 A;  4HJ6 A;  3OZH A;  3UE3 A;  3O86 A;  1NRJ A;  2W3H A;  3UMD A;  3A0V A;  5HD5 A;  1S4R A;  1PI4 A;  3HLB A;  1RGY A;  3TE8 A;  1LSW A;  1VM1 A;  1QME A;  2H10 A;  4I5S A;  4H8R A;  3O87 A;  1FCN A;  3Q07 A;  1IKG A;  2I72 A;  4UA7 A;  4EES A;  4E3N A;  2Z2L B;  5CEB A;  3KSG A;  1OPX A;  4YWZ A;  3L9K A;  5GLB A;  3U4L P;  1K6R A;  3CPT A;  1KDS A;  2XA7 M;  4Y0O A;  2XK1 A;  3MR0 A;  1VB6 A;  4RQ9 A;  1PZO A;  1YSP A;  1ONG A;  2QJ5 A;  5E43 A;  5LBR A;  1T1B A;  5DFX A;  2ZQA A;  1W7F A;  1VEU B;  2X01 A;  2HPB A;  3P7N A;  1SDE A;  4CLC A;  3S7O A;  1Y54 A;  1E3U A;  3CI6 A;  4DE3 A;  1LT0 A;  3IX4 A;  5KMW A;  2IA2 A;  5FI6 A;  1FIK A;  3SW1 A;  5L09 A;  3PXP A;  1F2K A;  2A24 A;  2P9V A;  1BLH A;  1HVB A;  2EXA A;  2WKR A;  4Y2F A;  2INW A;  1Z6F A;  4UHU A;  2VV8 A;  4CQH A;  3G2Y A;  4E3M A;  2WYX A;  4BBU A;  2EX8 A;  4JXV A;  1NWZ A;  3V67 A;  1EW0 A;  1SCW A;  1STZ A;  1CI9 A;  3BJN A;  5EM1 A;  4MCW A;  3VP1 A;  3KYQ A;  3Q7Z A;  4A5R A;  2FZ0 A;  4QJG A;  3DTM A;  3HLW A;  4JF6 A;  3HLD A;  3RXW A;  4R70 A;  1D06 A;  2ZC4 B;  1PFL A;  5EV0 A;  3F1N A;  3LIF A;  4YIN A;  1TD5 A;  3KYE A;  4JLF A;  3FYZ A;  3IXB A;  4N92 A;  5FQQ A;  5TJJ A;  3VP4 A;  2XDM A;  4C75 A;  2XRN A;  3MBZ A;  1YSQ A;  3TW8 A;  5FDS A;  1XGI A;  3NDG A;  4DE0 A;  2WGW B;  1ES5 A;  2D02 A;  3SS3 A;  1MY8 A;  3D72 A;  2WAE A;  4CLC D;  3GSG A;  2ZM0 A;  1E3U D;  4PHT A;  5TBM B;  2JKT I;  5EE8 A;  1OJ5 A;  3R7W B;  3LEQ A;  2XQZ A;  2Y2K A;  3ZHH A;  1VET B;  3CPT B;  4X55 A;  2WZX A;  3S7N A;  4HQA A;  5G4Y A;  4PM8 A;  4WUJ A;  2ZD8 A;  3WS4 A;  1K57 A;  3RJU A;  3VOZ A;  1TS6 A;  3E4P A;  3MZF A;  3VFF A;  1MPL A;  4NKP A;  1I2W A;  4DKI A;  5MC7 A;  4MN7 A;  1XJ2 A;  1YMX A;  4OH0 A;  3MKE A;  1YLY A;  3UB9 A;  3KYZ A;  3M2K A;  4HH2 A;  1F9I A;  5GLD A;  4GLQ A;  4XXR A;  4HI4 A;  2XLN A;  4E3I A;  4Q0I A;  1OTD A;  2G2W A;  4K08 A;  5IHV A;  2A49 A;  4S2N C;  3CUE A;  3KSH A;  1MWR A;  4MNR A;  2Y59 A;  2PR6 A;  4NXG A;  1DP8 A;  2VA0 A;  4RVA A;  1IYQ A;  1PYY A;  2K2N A;  1G6A A;  2XFS A;  3HLF A;  3HL9 A;  5L8M A;  1SKO B;  3LCE A;  2P08 A;  2O9C A;  2Y2M A;  3H82 A;  4BEN A;  3ZG9 B;  1J3W A;  1XA7 A;  3ZVT A;  4Z9Q A;  5J8X A;  2P7J A;  1K38 A;  4EUV A;  4R38 A;  2LB9 A;  4KUK A;  1S0W A;  1V9Y A;  3UE0 A;  3OCN A;  1YLT A;  5JYP A;  4S2K A;  3MJQ A;  1CI8 A;  4BQM A;  1HLU P;  3SZT A;  3LY3 A;  3BY8 A;  4DJ2 A;  2EX2 A;  3UE6 A;  2RL3 A;  2Y2J A;  4Y3I A;  3H9W A;  3BFE A;  3M6B A;  3ULF A;  3G2Z A;  3O3V A;  4WLA A;  2X71 A;  3E2K A;  3BFF A;  3DWK A;  3U2A A;  4P85 A;  5HPI A;  4JF5 A;  4OOY A;  3VP0 A;  3V50 A;  2VV6 A;  1LHY A;  4U3T A;  3LR3 A;  5AVE A;  4X1M A;  4ZJ2 A;  4HBT A;  1PNE A;  3GMW A;  2VEA A;  1ERM A;  2EX6 A;  1AXB A;  3UPN A;  2YKF A;  3C5A A;  4GB7 A;  3CAX A;  1OTE A;  3C8C A;  1V9Z A;  2R78 A;  5HZH A;  2FFF B;  3OPH A;  2C5W B;  2QJ7 A;  2WKH A;  4HY8 A;  3O88 A;  1OME A;  2WKQ A;  1L2S A;  2WKP A;  3LIB A;  4BWI A;  2PT7 A;  3MFX A;  4KG5 A;  1S6R A;  4RX2 A;  4EQ1 A;  2E8J A;  3IWQ A;  5GLA A;  3JVV A;  5DF7 A;  1DJA A;  1JTD A;  1PRQ A;  4GZB A;  4KEN B;  3R4K A;  3MS6 A;  3PBO A;  4KZ9 A;  3UY6 A;  2Y2N A;  3MKF A;  4R6L A;  1W79 A;  3T4L A;  4Y0U A;  1AWI A;  1BZA A;  3QHY A;  4C6Y A;  4IBR A;  2VZW A;  4MBH A;  4FSF A;  3HBR A;  1H8Z A;  4CLC C;  2BG1 A;  3IH8 A;  3K2N A;  1JWP A;  1E25 A;  1FOF A;  2Q0O A;  5DFY A;  4ETX A;  5CEC A;  4PM6 A;  1FCM A;  4GS9 B;  2WGI A;  4PMA A;  4X25 A;  2XR0 A;  4B88 A;  3LYX A;  2ZLY A;  4XT2 B;  3NC8 A;  3BEB A;  3I7J A;  5CHU A;  3JPU A;  1ESI A;  3PYP A;  4BJP A;  1DRM A;  3T4K A;  2W3D A;  4GOG A;  4JBF A;  4OQG A;  1BUL A;  4FUW A;  1T1C A;  4CLC E;  2AVX A;  3T1X A;  1UGU A;  3E4Q A;  5IU1 A;  4I3J A;  2JCH A;  2QKP A;  4BL2 A;  2V8C A;  4EQI A;  3IHA A;  3W2Z A;  3BEC A;  2ZBB A;  3MZD A;  2VGK A;  1ZG6 A;  3F1O A;  4EXO A;  5A92 A;  4LV2 A;  2JKT M;  1ES3 A;  2WAD A;  5CTN A;  3Q82 A;  4KQD A;  2P74 A;  3E98 A;  4E6X A;  5L2F A;  1O7E A;  1D1J A;  3S7Q A;  5EEC A;  1LI9 A;  5DF8 A;  3UNW A;  5FAP A;  3PTE A;  4UAA A;  4NG2 A;  4CJN A;  3IXG A;  4KZ4 A;  1KE4 A;  4N9K A;  3EOI A;  1XJ3 A;  4LRX C;  4L0L A;  2DCF A;  3CG5 A;  3MF0 A;  2EWW A;  2ZL1 B;  3ICY A;  3BFC A;  4LLO B;  5FL3 A;  4I39 A;  3T4T A;  2XFT A;  1N9N A;  2J3W A;  4PM9 A;  4WMC A;  2VLG A;  5HDC A;  2XH9 A;  1K54 A;  5HWV A;  2Y55 A;  3GVB A;  1IOU A;  4H6J B;  4HNB A;  1TS7 A;  1TS0 A;  3GEC A;  2YKH A;  3NEC A;  2IWB A;  3HUO A;  3IF5 A;  4M4X A;  1K57 C;  1P0Z A;  1L0D A;  1CK3 A;  1K25 A;  2KLI A;  3MQ0 A;  4LRZ E;  1RGZ A;  1JNU A;  4WZ5 A;  2B02 A;  5J4E A;  1OTI A;  1FCO A;  4UQI M;  2EA9 A;  2J80 A;  3BFG A;  3ZG8 B;  1ZG4 A;  3OOV A;  5HDD A;  2DRW A;  3AGE A;  4OVD A;  4IJG A;  3N8L A;  1GSX A;  5AVF A;  3PBQ A;  3KX0 X;  3UPP A;  2XD1 A;  2OV5 A;  3N8R A;  3N7W A;  4FD8 A;  1YT4 A;  3C4O A;  1XA1 A;  1ACF A;  5HAI A;  1K0K A;  3CUE C;  4WEK A;  2V9A A;  1TF1 A;  4DDY A;  3PAE A;  5DKK A;  4F3L B;  2HDU A;  4FH2 A;  2M7U A;  4DE1 A;  2OAP 1;  1K6S A;  3Q7V B;  5E2E A;  4ZJ1 A;  3AGF A;  1PWC A;  4EBP A;  3CMZ A;  1ERO A;  1K4F A;  3H7W A;  5DTK A;  1H5X A;  3MSH A;  3UB7 A;  2ZM8 A;  5EVI B;  2HJ9 C;  4RA7 A;  4GDN A;  1EWZ A;  2NUP C;  1MKI A;  1Q2P A;  3C4P A;  2B5R A;  5EVL A;  2JKF A;  1CJF A;  1H8Y A;  4Z1W A;  3K3D A;  4GHI B;  3LIA A;  4WMC D;  3UO9 A;  1RCJ A;  4X69 A;  3A3J A;  3D9Y A;  3UB8 A;  3IH9 A;  3NHQ A;  4P6Z M;  3S22 A;  3CZD A;  2OWH A;  4JGR A;  1ZTU A;  1LSV A;  3G6O A;  1WA9 A;  3LR0 A;  3V5M A;  2L0W A;  4E3K A;  1L0E A;  5HW3 A;  1G6O A;  3CHW P;  2UWX A;  4KQQ A;  5CGX A;  3SOI A;  1U60 A;  1J9M A;  3T1R A;  4S2L A;  1XKZ A;  4ARZ B;  4X68 A;  4KG2 A;  1YAX A;  5DJT A;  5DF9 A;  3SH7 A;  1GHM A;  4NEE D;  3D3O A;  4R3A A;  3LFV A;  5FA7 A;  4UQI S;  2GZA A;  4LGW A;  1XGJ A;  1ZHH B;  3O5Y A;  4CPK A;  1NYM A;  4KZ6 A;  1JVJ A;  3DTE A;  5HAP A;  4OON A;  2W1T A;  1DJB A;  1JTG A;  3W4O A;  4ZDX A;  1JWV A;  4IED A;  1W5D A;  2HGV A;  4S2I A;  4OLG A;  3FC7 A;  2OLU A;  3N4I A;  3DBA A;  5DTS A;  1T19 A;  2FH5 A;  1W8Q A;  4JGO A;  1SKF A;  3ZQ5 A;  1PI5 A;  5F6A A;  5EOE A;  1YM1 A;  3TSG A;  3FPW A;  5EVE A;  5HWT A;  3G32 A;  1RP5 A;  3DTI A;  5CX7 A;  2ZC3 B;  3T1S A;  4OPR A;  1NLZ A;  2O9B A;  3IXH A;  2HV1 A;  4PKY G;  3L7H A;  1S66 L;  2HP5 A;  1IFQ A;  3S1Y A; 
#chains in the Genus database with same CATH homology
 2PAV P;  1HLU P;  1YPR A;  1VET B;  2HZ5 A;  4X25 A;  3CPT B;  5FEF A;  3UB5 P;  3NEC A;  2PRF A;  1FIK A;  1SKO A;  3CHW P;  5EM0 A;  1F2K A;  2ZL1 A;  2B95 A;  4X1L A;  3T12 B;  3T1R A;  2BTF P;  2VK3 A;  4QWO A;  1CF0 A;  1VEU A;  4FUW A;  3LGO A;  4X1M A;  3T1X A;  1PNE A;  5FEG A;  2V8C A;  1A0K A;  1VET A;  1CQA A;  5EM1 A;  1ACF A;  2JKG A;  1Z09 A;  1SZV A;  1K0K A;  4FTX A;  1D1J A;  5EV0 A;  1PFL A;  2V8F A;  3L9K A;  2E8J A;  3KYE A;  3U4L P;  3MSH A;  3T1Q B;  1PRQ A;  3CPT A;  3NUL A;  3MS6 A;  5EVE A;  1Y4O A;  3DAV A;  1SKO B;  5FDS A;  1G5U A;  3T1S A;  2JKF A;  1AWI A;  1CJF A;  2ZL1 B;  4D60 A;  1J3W A;  1VEU B;  3L7H A;  4ESP A;  2ACG A;  1FIL A;  3D9Y A;  2PBD P;  3LEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...