2A49A

Crystal structure of clavulanic acid bound to e166a variant of shv-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title High Resolution Crystal Structures of the trans-Enamine Intermediates Formed by Sulbactam and Clavulanic Acid and E166A SHV-1 {beta}-Lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2a49A00
4WZ5C 2FFYA 2V2FF 3IF6A 3OPPA 4ZJ2A 1AXBA 4IEDA 2WGWA 3QNBA 5F83A 1W79A 4GKUA 2ZMAA 3SS3A 2A3UA 2Y2HA 3IHAA 3GVBA 2RL3A 4HESA 1H5XA 3N7WA 2EX2A 1BLSA 3IT9A 4F94A 4ZDXA 3WRZA 3JYIA 3LO7A 5DF7A 3ZG0A 3C5AA 1Z6FA 4XUZA 3N8SA 3GQZA 4DRTA 1GHMA 2Y2GA 3M2KA 2XFTA 1NZOA 3M2JA 4RYEA 4QJGA 4WMCA 2UWXA 1SDEA 4S2IA 2ZQDA 1KVMA 4RX3A 3PAGA 1G68A 5AQBA 4EWFA 3N8RA 4R0QA 1O07A 2H10A 3BLSA 1KE0A 4K91A 4KZAA 3ISGA 1ES2A 4LCMA 1BLCA 5F82A 5GLCA 1H8YA 4B88A 4CPKA 2Y59A 4BJPA 5L2FA 4R1GA 4KZ7A 2Y91A 3FZCA 1RGYA 1KGFA 3CG5A 3UDFA 3Q81A 1WYCA 4S2NC 4S2MA 3BRMA 3V39A 1CI9A 4R23A 4X68A 5U47A 1W7FA 4IBXA 4GOGA 5TFQA 1KDSA 1PZOA 1PZPA 3D4FA 2JCHA 4KG5A 3LCEA 4JBFA 4OQHA 1LL9A 1CI8A 3VMAA 4DF6A 3PBRA 3ZGAB 1MXOA 2HP9A 4WYYA 1IYOA 4H8RA 4OOYA 3WS1A 5FSRA 3IXDA 5HAQA 4M3KA 3VFFA 3UE0A 1YLJA 5E2FA 3MKFA 4PM8A 3A3IA 2FFFB 3CZDA 3WS0A 5CHJA 1EWZA 1ZC2A 1MWUA 1PW8A 2XLNA 3ZVWA 2ZQ9A 2WZZA 4IBRA 2Z2LB 4A5RA 3VOZA 4QY5A 4MBKA 1LLBA 4BQMA 4KG2A 5EUAA 3PBTA 1ZG6A 3QHYA 4Y0OA 5FAPA 4U0TA 2G2UA 1BULA 1FR1A 4CJNA 3GV9A 5A92A 1GA9A 1GCEA 3WWXA 4QD4A 5HFOA 2XR0A 3ZHHA 5A90A 5D3OA 3OCNA 1BZAA 3HLEA 4OVDA 3ZG9B 1C3BA 2EX6A 5EOEA 3S22A 4JXWA 1O7EA 2VGKA 1FOFA 1K4EA 1S6RA 3ZNYA 4Z9QA 3ZCZA 4GZBA 3ZVTA 3ZG5A 4N9KA 2H5SA 4UAAA 5CRFA 2HP6A 1KE3A 3UE1A 3G35A 4P85A 1NZUA 1ESUA 4E3OA 4EBPA 2XFSA 3IXBA 1NRFA 4BD1A 2Q9MA 4FSFA 1FQGA 3Q07A 4JF6A 4BL2A 4EUZA 3FYZA 1XX2A 4KZ5A 3C7VA 2IWBA 3BYDA 1KGEA 3HLBA 5E43A 1SKFA 2HDUA 5EOOA 2X02A 4DXCA 4Y7PA 2OLUA 1K38A 3SH9A 1MWTA 5TGFA 2ZQ7A 2XDMA 1K56D 2ZQAA 1DJCA 5HARA 3ZG8B 5J8XA 4BLMA 3MZDA 1MKIA 4WEKA 1KDWA 5CTNA 3FV7A 1IEMA 1YQSA 2ZLYA 2XD1A 4GN2A 5E2GA 1YT4A 2ZM8A 3A3DA 5GLAA 2OLVA 2J8YA 2Z2MB 4B4ZA 1K25A 5GHXA 5DTSA 5EVIA 4X56A 3ZG7B 4EV4A 1PI5A 2A49A 4KENB 3CMZA 3Q7VB 3NBLA 3OPRA 3DWKA 1PWDA 5A91A 1YLWA 1YMXA 2Y2LA 3IF6C 5EVIC 3RJUA 1ERQA 3PBQA 1U60A 3A3FA 2P9VA 2ZC6B 1GHIA 5HAIA 3GRJA 2X01A 4R3BA 4OQIA 5A93A 2X71A 4EBNA 4WEJA 4Y0UA 3FKWA 5E2HA 1ES3A 1Y54A 5FI6A 3PBOA 1E3UD 1N9BA 4P0MA 3HUNA 4O7DA 1ZKJA 3UPNA 4QU3A 4WZ4A 2DRWA 1PW1A 1OMEA 5AQAA 4KZ8A 1ALQA 4LCLA 1PI4A 3G2YA 4YINA 1IELA 2WAEA 1YMSA 5FI7A 3Q82A 4GD6A 4LENA 4PM9A 3HLDA 4XUXA 3IWQA 4OPYA 2G2WA 2ZC7A 3SS4A 3G31A 4B4XA 4E3KA 3DW0A 1DY6A 3A3JA 1I5QA 1S0WA 1CK3A 3BFEA 4KZBA 4OKPA 2IWDA 4OONA 5CGWA 5HW3A 2HDRA 4OPRA 3WRTA 1IYPA 2J9OA 1YLTA 3W8KA 3RXWA 1K54A 4LV3A 4KQQA 3TG9A 1Q2PA 5FDHA 3VP3A 3IXGA 3IH9A 5EECA 1L2SA 5FQQA 3UPOA 2XEPA 1K54C 2JE5A 1K6SA 4QY6A 3O87A 1W8YA 2Y2JA 4JXGA 4ZJ1A 2BG1A 3IF6B 5M1AA 3ZDJA 4EQIA 3IXHA 2WGWB 3AGEA 4OPQA 3NI9A 1L0FA 2RCXA 1L0GA 3NY4A 3NDGA 1NXYA 3VP4A 4FD8A 3N8LA 3OCLA 4MBHA 4IVIA 4JF5A 1SHVA 3W4QA 1RP5A 3RXXA 3SS5A 4U3TA 4KZ3A 3VP1A 2XF3A 1ERMA 1BUEA 1K6RA 1FCOA 4RX2A 1VM1A 4E3NA 4FCFA 4P6BA 4P87A 2OV5A 1BSGA 1LHYA 2XGNA 1FCNA 2HPBA 1IYSA 2J7VA 4UHUA 4OH0A 2B5RA 3LEZA 3S4XA 2ZQ8A 3UDIA 4OOMA 3HUOA 3SOIA 3AGFA 1JTGA 1SCWA 4GD8A 2HDQA 4DE2A 1NY0A 3G30A 1JWZA 3IWOA 2Y2OA 5HX9A 4YFMA 1G6AA 5IHVA 4DE3A 1XKZA 2GDNA 5FQJA 5EE8A 1RCJA 1YLYA 1I2WA 3G32A 3LY4A 4X55A 5M19A 1XA1A 4LV1A 3EQUA 5CXWA 3VSLA 4OP8A 1QMEA 2ZJ9A 3EQVA 5CEBA 5FQ9A 3FWLA 4KZ6A 1TVFA 3MBZA 4ZBEA 4R4RA 1ES5A 1MPLA 3Q1FA 1JWVA 2XH9A 1E4DA 4ZTKA 3UY6A 5CECA 4KZ9A 1GA0A 2ZC4B 3PBSA 3VFHA 4XXRA 1MY8A 4OPZA 5CGSA 1BT5A 1BTLA 2WADA 4N1HA 3V3SA 5EVLA 2CC1A 4HBUA 4N9LA 1FR6A 4DDSA 1L0DA 5I94A 2EXAA 1JTDA 2P74A 3MKEA 3GMWA 1LL5A 3UO9A 2WKEA 3ITBA 4GB7A 1DJBA 1K55A 4NETA 5FASA 4LV0A 5FQIA 3N4IA 4PM7A 5KZHA 2H0YA 4R3JA 1K4FA 3O3VA 4HBTA 4X53A 3TSGA 4ZAMA 1K55C 2Y4AA 2EX8A 3V50A 2I72A 3O86A 2DNSA 2ZM2A 1H8ZA 1PYYA 3E2KA 3MZEA 2EX9A 4OQGA 1PWGA 1K56A 1LI9A 4GDNA 5DF9A 3NC8A 3P98A 5JYOA 4RVAA 1YLPA 2V20A 4EBLA 3OZHA 4UA7A 3PBNA 1ZG4A 3BFCA 2ZQCA 1XGJA 4K0WA 3DWZA 4PM6A 1XPBA 2ZC3B 4GDBA 4KZ4A 1NYYA 1M6KA 4WELA 5G18A 4E3LA 1EI5A 4BD0A 1HVBA 5CTMA 1RGZA 5E2EA 2HDSA 3MXRA 4UA6A 4OQ0A 4K0XA 3VP2A 3BECA 3OC2A 2EFXA 1M40A 1LI0A 5GL9A 1KE4A 1FSWA 2ZM0A 2XQZA 4ID4A 3W4PA 2WK0A 3BLMA 2C6WB 2WGIA 2Y2IA 2Y2MA 1TDLA 1K57A 3PAEA 4PMAA 3BEBA 4HEFA 4DE0A 1XGIA 3HVFA 1FCMA 5F1GA 3E2LA 4JLFA 4X6TA 4Q8IA 1K57C 2BLSA 1XXMA 1VQQA 3MZFA 4JPMA 4UA9A 4WMCD 3UE3A 4DE1A 2R9XA 1MBLA 3QNCA 4C3QA 2Y55A 1XP4A 1E3UA 2WZXA 2Q9NA 4E3IA 3M6HA 2OSUA 4KQRA 4X69A 5AQ7A 5CGXA 4KQOA 3SH7A 5BOHA 1FSYA 3O88A 1TDGA 2R9WA 4FH4A 5TR7A 3VP0A 1Q2QA 5CEDA 5DF8A 1KVLA 2PU2A 4N92A 5CHMA 5CERA 4BENA 5HL1A 3HBRA 1SDNA 4S2KA 3UN7A 3ZNTA 2V1ZA 2JC7A 3IH8A 4GNUA 1DJAA 4OOLA 4E6XA 1IKIA 1YLZA 4JXSA 2H0TA 2PBYA 1EROA 2Y2KA 3NIAA 3M6BA 1BLPA 3HLFA 3MFDA 3BM6A 2E8IA 4JKTA 2ZC5B 3VSKA 3ZFZA 2WAFA 4S2NA 2XK1A 1CEFA 1HD8A 2ZD8A 5EVIB 4WM9A 1ESIA 2QZ6A 4QB8A 5FQKA 2Y2PA 3TOIA 5HAPA 3IHBA 3C4PA 1W8QA 4WBGA 1L0EA 1GHPA 1YM1A 3AGDA 1IYQA 1HTZA 2QMIA 3V5MA 3P09A 5GHYA 2P9VB 3B3XA 1W5DA 3C4OA 3HLWA 4MBFA 3IF5A 1IKGA 3LY3A 4OP5A 2Y2NA 3HLGA 3GSGA 1ONHA 3CJMA 1MWSA 5AQ9A 3G34A 3UNWA 4KG6A 4MEZA 4S2OA 2HP5A 1KGGA 4OLGA 4E6WA 3V3RA 2JBFA 2WKHA 1I2SA 2EXBA 3WS2A 1J9MA 1NYMA 4D2OA 5DTKA 4S2PA 4ZJ3A 3UPPA 4OLDA 4PM5A 1NJ4A 3Q7ZA 2WUQA 2QPNA 3SH8A 3FKVA 4IVKA 4E3JA 3A3EA 1ES4A 5FA7A 3NDEA 3Q7VA 3IQAA 4FH2A 3OPHA 2Y2QA 5KMWA 4DDYA 3HLCA 4PPRA 1JWPA 4C75A 2IWCA 4R4SA 3HL9A 5FQMA 1BLHA 5GHZA 1PIOA 3WS5A 2WGVA 3BFGA 3IWIA 2WYXA 4NK3A 3OPLA 4L0LA 4C6YA 3ITAA 3W4OA 3N6IA 4JXVA 4QHCA 4S2JA 4Y0TA 1HZOA 1QMFA 1JVJA 4RA7A 5JYPA 3UDXA 1WE4A 1ONGA 3NCKA 2EFUA 2VGJA 4BL3A 5EPHA 3BFFA 3G4PA 3G2ZA 2C5WB 2PU4A 3BFDA 3DTMA 5DVAA 4JF4A 1PWCA 4E3MA 5M18A 5FATA 3MXSA 4DXBA 4MLLA 3HUMA 3S1YA 4S2LA 5KSCA 4DKIA 5GLDA 3PTEA 1N4OA 1XA7A 5F1FA 2DCFA 5KSHA 1CEGA 5EVID 2WKIA 1E25A 3HREA 5CHUA 2J9PA 3C7UA 4N1XA 4U0XA 5DTTA 1MWRA 3GR2A 1WYBA 3I7JA 2XD5A 4MNRA 5GLBA 3GTCA 5FAOA 4WZ5A 1TEMA 4LV2A 3WS4A 5FAQA 3VOYA 5FI2A
chains in the Genus database with same CATH superfamily
4IEDA 2J3WA 2ZMAA 2A3UA 5F6AA 1BLSA 4EQ1A 3UMEA 4YOFA 4ZDXA 3WRZA 4DRTA 3SW1A 2XFTA 2UWXA 4K08A 1OT6A 4S2IA 4CPKA 1H8YA 2Y91A 3EGDC 4S2MA 5U47A 4EERA 4GOGA 5TFQA 2JCHA 5C5KA 4WN5A 1OTDA 4OQHA 1LL9A 3VMAA 3PBRA 4WYYA 5AJGA 1P9RA 4QPRA 4F3LB 3A3IA 3QP6A 1ZC2A 1PW8A 5HDCA 3CUEC 3MR0A 4HIAA 1ZG6A 4Y0OA 4R38A 3A0RA 4CJNA 3GV9A 3QP1A 1GCEA 3E4PA 2M7VA 3R7WA 3ZHHA 4OVDA 4WF0A 5HDSA 2VGKA 2HP6A 1KE3A 3IS2B 4P85A 2GJ3A 3IXBA 2Q9MA 4H6JA 4EUZA 2ZL1A 4MMNA 2HDUA 1GSVA 2OLUA 1K56D 4LGWA 3QP4A 5J8XA 4CLCE 3PXPA 4BLMA 5L8MA 1KDWA 5CTNA 1YQSA 3HCYA 5DTSA 1YSQA 1OJGA 4EV4A 2A49A 2PDRA 1S1YA 2I9VA 1YLWA 3RJUA 3PBQA 3A3FA 5IT5A 2ACGA 5A93A 2X71A 4EBNA 1TS6A 4WEJA 3T4SA 4Y0UA 1CQAA 5FI6A 1X0OA 4I3AA 1N9BA 5FDSA 3HUNA 4O7DA 2QYBA 3P7NA 2DRWA 5AQAA 1OT9A 4KZ8A 4YINA 3RTYA 4LLOB 4YWZA 1YMSA 2WKRA 4PM9A 2Y8HA 3IWQA 2G2WA 3LGOA 1D06A 4E3KA 1DY6A 2W3HA 1S0WA 3NECA 1CK3A 4KZBA 3GECA 4L9GA 2JKTM 2V1AA 3RXWA 3IH9A 4WLAA 2JE5A 1K6SA 3ZDJA 2WGWB 1L0GA 3VP4A 2AVXA 4IVIA 4JF5A 1S1ZA 1UWNX 3VP1A 4MN7A 1K6RA 1BSGA 1FCNA 2HPBA 1T1CA 2CMNA 2B5RA 3LEZA 1PRQA 2ZOIA 2ZQ8A 3UDIA 3AGFA 1SCWA 1JWZA 5HX9A 3CHWP 1AWIA 3R4KA 3UE6A 4Y17A 4LV1A 3EQUA 3VSLA 3FWLA 4KZ6A 4ESPA 2XH9A 3UY6A 2ZC4B 3PBSA 1F98A 2V1BA 4OPZA 5CGSA 4N1HA 3MSHA 4GS9B 2W3EA 4N9LA 2OWJA 2O9AA 5I94A 2EXAA 1JTDA 2MJ6A 3GMWA 1LL5A 4II7A 1K55A 3MS6A 5FASA 4LV0A 2H0YA 4P6ZS 3FPVA 4X53A 3TSGA 2Y4AA 5DKKA 3V50A 3LR4A 2EX9A 3P01A 5G4ZA 3NC8A 4UEYA 3ICYA 1OJ5A 1ZG4A 3EWKA 2ZQCA 3NJAA 3MF0A 4KZ4A 1M6KA 1T18A 3MMHA 4E3LA 1EI5A 1UWPX 1HVBA 1RGZA 2HDSA 1K0KA 3BECA 3UB9A 2EFXA 2ZM0A 2XQZA 2WK0A 3T4OA 2C6WB 2WGIA 1VEUB 1MKMA 4DE0A 1XGIA 4HJ4A 1K57C 3MZFA 4WMCD 4JPMA 2DMWA 4C3QA 4CLCA 1XP4A 1E3UA 4E3IA 2Q9NA 2Z6DA 2OSUA 4KQOA 4NEED 3O88A 1TDGA 5TR7A 3VP0A 1KVLA 4N92A 5HL1A 3ZNTA 3MQQA 3F1NA 3NIAA 3HLFA 3MFDA 3VSKA 2E8IA 3LFVA 4JKTA 3S7NA 2XK1A 2E8JA 1HD8A 4WM9A 1NRJA 4QB8A 3TOIA 3C4PA 3K3CA 3NOPC 5HWVA 1IYQA 1HTZA 2QMIA 2GZAA 3B3XA 5TJJA 3KX0X 3C4OA 3HLWA 4MBFA 3UMDA 4OP5A 2PR5A 3UNWA 3KSHA 1YKDA 4E6WA 2W1TB 3ZQ5A 4PM5A 1F5MA 1A0KA 1NJ4A 4IVKA 1ES4A 3Q7VA 1V9YA 3T1SA 4FH2A 1JWPA 4EEPA 2JHEA 4HI4A 5FEFA 3V67A 2J80A 4ARZB 1N9LA 4L0LA 1T1BA 4C6YA 3N6IA 2B02A 2PD8A 4NXFA 2EFUA 1TD5A 3FG8A 3LIBA 3OLOA 3H7WA 5DVAA 4E3MA 5FATA 4MLLA 4Y2FA 1J3WA 4S2LA 5L09A 1XA7A 5EVID 3B47A 5FL3A 4G3WA 5GLBA 2XD5A 3OOVA 4ME4A 1TEMA 4WZ5C 3L9KA 2FFYA 3EEHA 3OPPA 3QNBA 5F83A 4GKUA 1FILA 3B42A 3IHAA 2VA0A 1D1JA 4JGQA 2EX2A 4P6ZM 5HDDA 4NXGA 1DP8A 2XROA 3LO7A 5DF7A 3ZG0A 4UQIS 2Y2GA 3M2KA 1NZOA 4RYEA 1P97A 4RX3A 2H28A 5AQBA 3LR0A 3BLSA 2H10A 4KZAA 1ES2A 5HPFA 5GLCA 5L2FA 4BJPA 4R1GA 3FZCA 1RGYA 2V8CA 1KGFA 3CG5A 3Q81A 2K7SA 1MZUA 1W7FA 3D4FA 1CI8A 3ZGAB 2VZWA 5HAQA 3IXDA 3VFFA 5E2FA 3CZDA 2K2NA 1MWUA 2A2LA 3CUEA 4GCZA 2ZQ9A 2WZZA 4A5RA 2W27A 3PBTA 1V9ZA 4U0TA 1OPXA 3B33A 4JGPA 3WWXA 3LR5A 3FPWA 2XR0A 5HFOA 5A90A 5D3OA 4BBVA 3CITA 2EX6A 5J3WA 3IX4A 4JXWA 3F1OA 1K4EA 1S6RA 3NHQA 3K3DA 3UB6A 3ZG5A 4N9KA 4UAAA 3UE1A 4ZRRA 1NZUA 4E3OA 1TS0A 3T12B 2PHYA 2Z6CA 2EWVA 4BL2A 4KZ5A 3T4TA 5EOOA 5TBMB 2L1MA 2X02A 4Y7PA 5HD5A 3SH9A 1T1AA 2ZQAA 2D01A 3ZG8B 1ZHHB 2INWA 3MZDA 2OAQ1 4NXBA 4GN2A 2ZM8A 2OLVA 2Z2MB 1PI5A 3NBLA 5A91A 5EVIC 2V0WA 4PHTA 1ERQA 4HH3A 1ZTUA 1GHIA 4R3BA 4OQIA 3F1PB 3C8CA 1Y54A 4F3LA 4MN6A 4EXOA 1LSVA 1PI4A 3VE3A 4XT2A 3QP8A 3LI9A 3Q82A 4GD6A 4LENA 4JGOA 4LRXC 4HP9A 2NUPC 4OPYA 2ZC7A 3DW0A 3A3JA 3BFEA 5CGWA 2G7UA 5L10A 4HJ6A 5HW3A 4OPRA 3WRTA 4MCWA 4KQQA 3TG9A 1FIKA 1N9NA 5EECA 2W0NA 5FQQA 3UPOA 1K54C 4UQIM 3O87A 3CI6A 4FTXA 5F68A 3NDGA 3OCLA 1SHVA 1RP5A 1LL8A 4FCFA 1CF0A 4P6BA 2J7VA 1IYSA 4HH2A 4UHUA 3H82A 4X25A 4EUVA 3SOIA 2B18A 3BY9A 3S7PA 1NY0A 1MC0A 2Y2OA 3PR6A 1G6AA 3ZYTA 5EE8A 4MDZA 3G32A 1XJ2A 4OP8A 3EQVA 5CEBA 2HZ5A 1TVFA 3T4LA 4R4RA 1ES5A 1MPLA 4ZTKA 1E4DA 1S4RA 4RQ9A 3VFHA 3KYQA 4XXRA 1MY8A 1BT5A 1BTLA 2EA9A 4E04A 3V3SA 4ETZA 3MKEA 4LFUA 3UO9A 1LSXA 3W2ZA 4GB7A 5EFWA 4NETA 3CPTA 3O3VA 4HBTA 2O9BA 4G3KA 4HJ3A 2GX5A 2PBDP 3O86A 2M7UA 3E2KA 1K56A 2HJEA 4GDNA 3P98A 5JYOA 3OZHA 3PBNA 3R7WB 1XGJA 3DWZA 4NG2A 3DTEA 4HNBA 4WELA 1XFNA 4BD0A 2VV8A 3MXRA 4UA6A 3SZTA 4Z1WA 4Y5FA 1IFQA 2VEAA 1FSWA 5HD3A 1Z09A 3BLMA 2Y2IA 1K57A 3PAEA 1W63Q 4HEFA 1DRMA 5F1GA 3E2LA 4JLFA 3D9YA 4GHIA 4Q8IA 1VQQA 4DE1A 4H6JB 3QNCA 1MBLA 2K31A 5DFXA 2ZL1B 3PYPA 4X69A 3KSIA 3SH7A 4FH4A 1NLYA 5DF8A 5CHMA 4BENA 1VETA 1SKOA 1YLZA 2W3FA 2H0TA 3BJNA 1STZA 2IA2A 2YKFA 3ZFZA 2WAFA 3LIFA 4S2NA 3TW8A 1CEFA 1UGUA 5FQKA 1GHPA 4YNRA 2LB5A 3P09A 4R3AA 2PYPA 4L9FA 2V0UA 1MWSA 4KG6A 2HP5A 2VJWA 2HJ9C 3TE8A 4KUOA 1I2SA 1J9MA 4IUHA 4EESA 2JN7A 2WKPA 3UPPA 5HWTA 5L07A 2VGLM 2WUQA 3SH8A 2XSSA 3FKVA 3IX8A 3NDEA 4Y15A 5KMWA 4DDYA 4Y13A 4PPRA 2IWCA 5DKLA 3HL9A 5GHZA 2WGVA 2WYXA 3OPLA 1JNUA 3ITAA 3W4OA 4JXVA 4L9EA 4QHCA 4S2JA 1QMFA 1JVJA 1WE4A 1VEUA 4WUJA 5K5BA 2VGJA 4R6LA 3BFFA 2VV7A 3G2ZA 3DTMA 3DAVA 4JF4A 3BWLA 1OTIA 3S1YA 1H3QA 4DKIA 1S66L 1Y28A 2HGVA 4DN0A 2WKIA 3VOLA 5CHUA 3C7UA 4U0XA 5DTTA 1MWRA 3GR2A 2D02A 5FAOA 1HLUP 4CQHA 4WZ5A 3A0VA 4LV2A 3VOYA 5FI2A 2V2FF 3IF6A 4ZJ2A 2A24A 1W79A 3SS3A 4IHQA 2Y2HA 1TS8A 3GVBA 5HZHA 4HESA 1H5XA 3MXQA 1G6OA 2OOLA 1XJ3A 5IS1A 3C5AA 1Z6FA 4ETXA 3GQZA 1PFLA 1GHMA 2LB9A 1OTEA 3T4QA 4QJGA 4WMCA 2JKRI 2ZQDA 3PAGA 1G68A 4I5SA 3LUQA 3N8RA 1KE0A 4LCMA 5F82A 4B88A 4I38A 4KZ7A 4S2NC 1WYCA 3V39A 1CI9A 1S67L 2ZMVA 4X68A 3U2AA 4IBXA 1KDSA 3E98A 5CX7A 1MXOA 1XJ6A 1IYOA 4H8RA 4OOYA 5EV0A 3UB7A 3WS1A 4LRZE 4M3KA 4PM8A 3WS0A 2FFFB 1S4SA 2J3TD 3ZVWA 2XLNA 2Z2LB 3U4LP 4MBKA 1LLBA 4KG2A 1YPRA 2BTFP 5FEGA 2ZBBA 5FAPA 2VX8A 4CLCB 2G2UA 1FR1A 3KYEA 2KDKA 5A92A 1GA9A 4QD4A 1BZAA 3HLEA 3ZG9B 1C3BA 3CLOA 3S22A 1O7EA 1FOFA 3F1NB 2VV6A 3ZNYA 3T1QB 3ZVTA 2P04A 2H5SA 1D7EA 1YSPA 3BQAA 5IU1A 2XFSA 4FSFA 3Q07A 4JF6A 2PT7A 4Q0JA 1KGEA 1SKFA 5AVEA 4DXCA 5TGFA 2XDMA 2P08A 2P7JA 1MKIA 2VKSA 3E4QA 2XD1A 5E2GA 1YT4A 2QHKA 2HV1A 5GLAA 2J8YA 3DBAA 4B4ZA 5GHXA 5EVIA 4KENB 3Q7VB 3DWKA 4HQAA 3IF6C 1U60A 2P9VA 5DFYA 2ZC6B 1G5UA 3GRJA 2X01A 5HSQA 1Y4OA 4BWIA 1ES3A 4EU0A 1N9OA 1YAXA 3LIEA 3EEAA 4QU3A 4WZ4A 3H9WA 1PW1A 1XJ4A 2FZ0A 3H7WB 3D3OA 2WAEA 3IBJA 3LICA 2Y79A 4XUXA 3SS4A 3G31A 3ULFA 1F9IA 1IOUA 3CWFA 3VV4A 2J9OA 1YLTA 2QKPA 1K54A 1Q2PA 3VP3A 4B9OA 1L2SA 2JKTI 1W63M 3CAXA 4JXGA 2Y2JA 4O0PA 4DJ2A 4EQIA 3IXHA 3S7OA 4BBUA 3AGEA 4OPQA 3D72A 1L0FA 1NXYA 4FD8A 3N8LA 4MBHA 3W4QA 3SS5A 2V9AA 4U3TA 4KZ3A 1H0MA 2XF3A 1BUEA 3IBRA 1FCOA 1VM1A 2OV5A 2J3TC 1JTGA 5EM0A 4GD8A 2HDQA 4DE2A 3IWOA 4R70A 5FQJA 2O0YA 3QP2A 1RCJA 4X55A 5M19A 1XA1A 5CXWA 3OBFA 1QMEA 2ZJ9A 4O01A 5FQ9A 3MBZA 1CJFA 5CECA 4KZ9A 3MQOA 2WADA 5EVLA 4HBUA 4DDSA 3G6OA 2P74A 2WKEA 5FQIA 1P0ZA 3N4IA 4PM7A 4R3JA 3MQ0A 2DNSA 2ZM2A 1PYYA 3MZEA 4OQGA 4UA7A 5DJTA 4DMZA 4HY8A 4K0WA 4PM6A 1XPBA 2ZC3B 4GDBA 1KOUA 3C2WA 1NYYA 5F5YA 3QP5A 2XRNA 3F1OB 5CTMA 1F2KA 5E2EA 4LRYC 2OWHA 4K0XA 3VP2A 5GL9A 4ID4A 5MC7A 1TDLA 4HHDA 2EWWA 4PMAA 3BEBA 3PHYA 1FCMA 2R9XA 2L0WA 3M6HA 2JKRM 3E4OA 5BOHA 3T4JA 2R9WA 5CEDA 2PU2A 1SDNA 2V8FA 4GLQA 4S2KA 3UN7A 2JC7A 3IH8A 4GNUA 1DJAA 2ZMFA 4OOLA 1IKIA 4E6XA 2QJ7A 3LYXA 2PBYA 3TRCA 2VGLS 2Y2KA 3M6BA 2JKFA 2L4RA 3IS2A 3JPUA 5HAPA 1W8QA 4WBGA 1L0EA 1YM1A 3AGDA 1VHMA 2O9CA 1W5DA 3LY3A 2Y2NA 1ONHA 3CJMA 4BMWA 2M1CA 1XFQA 4MEZA 1KGGA 3LR3A 3V3RA 2JBFA 2WKHA 1NYMA 5HPIA 4D2OA 5DTKA 4S2PA 4ZJ3A 3HJKA 5KIZA 2JKGA 4XT2B 2QPNA 5FA7A 2PAVP 3T50A 4I3IA 3IWIA 4NK3A 4Y3IA 5JYPA 3UDXA 2FH5A 1ONGA 3KO6A 3NCKA 4BL3A 5EPHA 3G4PA 2PU4A 1WA9A 1PWCA 5M18A 4B93A 3T1XA 1DP9A 2GNXA 4HOIA 5KSCA 3O5YA 3PTEA 1N4OA 5F1FA 1OTAA 4DJ3A 3RFBA 5KSHA 1CEGA 3H82B 3HREA 5DJUA 4N1XA 3NULA 1WYBA 4MNRA 3GTCA 3FC7A 1LT0A 5FAQA 2KOIA 1AXBA 2WGWA 2RL3A 3N7WA 2NUTC 3IT9A 4F94A 3JYIA 4XUZA 2W3DA 3N8SA 4KQDA 3M2JA 4EEUA 2ZOHA 1SDEA 1KVMA 3CPTB 4BBTA 4O8GA 5HL6A 4EWFA 4R0QA 1O07A 2BASA 4K91A 3ISGA 1BLCA 2Y59A 1ODVA 4PKYG 4I39A 3UDFA 3BRMA 4R23A 3JVUA 2XA7S 1PZOA 1PZPA 4KG5A 4GS9A 3LCEA 4JBFA 2Q0OA 4I3JA 4DF6A 4KUKA 2HP9A 5FSRA 3UE0A 1YLJA 3MKFA 5CHJA 1EWZA 4IBRA 3VOZA 4QY5A 4FUWA 4BQMA 5EUAA 4GHIB 3QHYA 3NOTC 1BULA 2QJ5A 5J4EA 3OCNA 5EOEA 1VETB 1SKOB 4Z9QA 3ZCZA 4GZBA 3BY8A 2PYRA 3UB5P 5CRFA 5J7EA 4IJGA 3G35A 4HP4A 1ESUA 4EBPA 1NRFA 4MN5A 4BD1A 1NLZA 1FQGA 3LIDA 3FYZA 1XX2A 2PR6A 3C7VA 2IWBA 3BYDA 3HLBA 5E43A 1K38A 2WKQA 1MWTA 3VE4A 2ZQ7A 5G4YA 3RH8B 1DJCA 5HARA 1P9WA 4WEKA 3FV7A 3BW6A 4GJ4A 1IEMA 1ACFA 2ZLYA 2UV0E 3A3DA 1K25A 1BYWA 4X56A 3ZG7B 5AVFA 3CMZA 3NOUC 4G3VA 1TF1A 5A8BA 3OPRA 1PWDA 1YMXA 2Y2LA 3DTIA 1G28A 5HAIA 3FKWA 5E2HA 4GW9A 4CLCD 3PBOA 1E3UD 4P0MA 1ZKJA 3UPNA 1L3LA 3E0YA 3C38A 1OMEA 2W1TA 1ALQA 4LCLA 3G2YA 1IELA 2PD7A 4LPZA 5FI7A 3HLDA 1T19A 4B4XA 1I5QA 4OKPA 2IWDA 4OONA 2HDRA 2OAP1 3EOIA 4ARZA 1IYPA 5I5LA 3W8KA 4LV3A 1OTBA 3MFXA 5FDHA 3IXGA 2XEPA 5HWWA 3KSGA 4QY6A 1W8YA 3MJQA 4ZJ1A 2BG1A 3IF6B 5M1AA 1H8MA 3K2NA 2A24B 3NI9A 2RCXA 3NY4A 3DTKA 1SZVA 3RXXA 4PKYA 4QWOA 1ERMA 4Q0HA 4RX2A 4E3NA 4P87A 1LHYA 2XGNA 3BQ8A 2W1RA 4OH0A 3S4XA 4NKPA 4OOMA 3HUOA 3C30A 2XA7M 3G30A 5IHVA 4DE3A 4YFMA 2VLGA 1XKZA 2GDNA 1YLYA 1I2WA 3LY4A 4NXEA 4ZBEA 1PNEA 3Q1FA 1JWVA 1GA0A 4IUKA 5LBRA 2CC1A 1FR6A 1L0DA 5F69A 2PRFA 3ITBA 1DJBA 3JVVA 5KZHA 1K4FA 3KSFA 4ZAMA 1K55C 2EX8A 3EGXC 4WL9A 2I72A 1H8ZA 1PWGA 1LI9A 5DF9A 2R78A 4RVAA 1YLPA 2V20A 4EBLA 1NWZA 3BFCA 1TS7A 5G18A 2YKHA 3A0SA 4OQ0A 3LIAA 2B95A 3OC2A 1M40A 1LI0A 1KE4A 1GSXA 3W4PA 2Y2MA 3S7QA 2KX6A 3HVFA 4X6TA 3T1RA 2BLSA 1LSWA 1XXMA 4UA9A 3UE3A 3L7HA 2Y55A 2WZXA 4KQRA 5AQ7A 5EM1A 5CGXA 2VK3A 4CLCC 4X1MA 1FSYA 1Q2QA 5CERA 3HBRA 1EW0A 3GDIA 2V1ZA 4X1LA 2QWSA 4JXSA 1EROA 1BLPA 1VB6A 5EVEA 3BM6A 2ZC5B 2ZD8A 5EVIB 1ESIA 2QZ6A 4FOFA 2Y2PA 3IHBA 3V5MA 5GHYA 2P9VB 3T4KA 4AFIA 3IF5A 1IKGA 4M4XA 3HLGA 3GSGA 5TBMA 3KYZA 4Q0IA 4JGRA 5AQ9A 3G34A 4S2OA 4OLGA 3HJIA 3UB8A 2EXBA 3WS2A 4OLDA 3Q7ZA 4E3JA 3A3EA 2KLIA 3LI8A 3IQAA 3OPHA 2Y2QA 3HLCA 1GSWA 4C75A 4R4SA 4EW7A 5FQMA 1BLHA 3F1PA 1PIOA 3WS5A 3BFGA 4D60A 3IX3A 3LEQA 4Y0TA 1HZOA 4RA7A 2W3GA 3TJZC 4EETB 2C5WB 3BFDA 3MXSA 4DXBA 3HUMA 5GLDA 1DP6A 4PAUA 2DCFA 1E25A 2J9PA 2O99A 3I7JA 2HF6A 3WS4A
chains in the Genus database with same CATH topology
4WZ5C 2FFYA 2V2FF 3IF6A 3OPPA 4ZJ2A 1AXBA 4IEDA 2WGWA 3QNBA 5F83A 1W79A 4GKUA 2ZMAA 3SS3A 2A3UA 2Y2HA 3IHAA 3GVBA 2RL3A 4HESA 1H5XA 3N7WA 2EX2A 1BLSA 3IT9A 4F94A 4ZDXA 3WRZA 3JYIA 3LO7A 5DF7A 3ZG0A 3C5AA 1Z6FA 4XUZA 3N8SA 3GQZA 4DRTA 1GHMA 2Y2GA 3M2KA 2XFTA 1NZOA 3M2JA 4RYEA 4QJGA 4WMCA 2UWXA 1SDEA 4S2IA 2ZQDA 1KVMA 4RX3A 3PAGA 1G68A 5AQBA 4EWFA 3N8RA 4R0QA 1O07A 2H10A 3BLSA 1KE0A 4K91A 4KZAA 3ISGA 1ES2A 4LCMA 1BLCA 5F82A 5GLCA 1H8YA 4B88A 4CPKA 2Y59A 4BJPA 5L2FA 4R1GA 4KZ7A 2Y91A 3FZCA 1RGYA 1KGFA 3CG5A 3UDFA 3Q81A 1WYCA 4S2NC 4S2MA 3BRMA 3V39A 1CI9A 4R23A 4X68A 5U47A 1W7FA 4IBXA 4GOGA 5TFQA 1KDSA 1PZOA 1PZPA 3D4FA 2JCHA 4KG5A 3LCEA 4JBFA 4OQHA 1LL9A 1CI8A 3VMAA 4DF6A 3PBRA 3ZGAB 1MXOA 2HP9A 4WYYA 1IYOA 4H8RA 4OOYA 3WS1A 5FSRA 3IXDA 5HAQA 4M3KA 3VFFA 3UE0A 1YLJA 5E2FA 3MKFA 4PM8A 3A3IA 2FFFB 3CZDA 3WS0A 5CHJA 1EWZA 1ZC2A 1MWUA 1PW8A 2XLNA 3ZVWA 2ZQ9A 2WZZA 4IBRA 2Z2LB 4A5RA 3VOZA 4QY5A 4MBKA 1LLBA 4BQMA 4KG2A 5EUAA 3PBTA 1ZG6A 3QHYA 4Y0OA 5FAPA 4U0TA 2G2UA 1BULA 1FR1A 4CJNA 3GV9A 5A92A 1GA9A 1GCEA 3WWXA 4QD4A 5HFOA 2XR0A 3ZHHA 5A90A 5D3OA 3OCNA 1BZAA 3HLEA 4OVDA 3ZG9B 1C3BA 2EX6A 5EOEA 3S22A 4JXWA 1O7EA 2VGKA 1FOFA 1K4EA 1S6RA 3ZNYA 4Z9QA 3ZCZA 4GZBA 3ZVTA 3ZG5A 4N9KA 2H5SA 4UAAA 5CRFA 2HP6A 1KE3A 3UE1A 3G35A 4P85A 1NZUA 1ESUA 4E3OA 4EBPA 2XFSA 3IXBA 1NRFA 4BD1A 2Q9MA 4FSFA 1FQGA 3Q07A 4JF6A 4BL2A 4EUZA 3FYZA 1XX2A 4KZ5A 3C7VA 2IWBA 3BYDA 1KGEA 3HLBA 5E43A 1SKFA 2HDUA 5EOOA 2X02A 4DXCA 4Y7PA 2OLUA 1K38A 3SH9A 1MWTA 5TGFA 2ZQ7A 2XDMA 1K56D 2ZQAA 1DJCA 5HARA 3ZG8B 5J8XA 4BLMA 3MZDA 1MKIA 4WEKA 1KDWA 5CTNA 3FV7A 1IEMA 1YQSA 2ZLYA 2XD1A 4GN2A 5E2GA 1YT4A 2ZM8A 3A3DA 5GLAA 2OLVA 2J8YA 2Z2MB 4B4ZA 1K25A 5GHXA 5DTSA 5EVIA 4X56A 3ZG7B 4EV4A 1PI5A 2A49A 4KENB 3CMZA 3Q7VB 3NBLA 3OPRA 3DWKA 1PWDA 5A91A 1YLWA 1YMXA 2Y2LA 3IF6C 5EVIC 3RJUA 1ERQA 3PBQA 1U60A 3A3FA 2P9VA 2ZC6B 1GHIA 5HAIA 3GRJA 2X01A 4R3BA 4OQIA 5A93A 2X71A 4EBNA 4WEJA 4Y0UA 3FKWA 5E2HA 1ES3A 1Y54A 5FI6A 3PBOA 1E3UD 1N9BA 4P0MA 3HUNA 4O7DA 1ZKJA 3UPNA 4QU3A 4WZ4A 2DRWA 1PW1A 1OMEA 5AQAA 4KZ8A 1ALQA 4LCLA 1PI4A 3G2YA 4YINA 1IELA 2WAEA 1YMSA 5FI7A 3Q82A 4GD6A 4LENA 4PM9A 3HLDA 4XUXA 3IWQA 4OPYA 2G2WA 2ZC7A 3SS4A 3G31A 4B4XA 4E3KA 3DW0A 1DY6A 3A3JA 1I5QA 1S0WA 1CK3A 3BFEA 4KZBA 4OKPA 2IWDA 4OONA 5CGWA 5HW3A 2HDRA 4OPRA 3WRTA 1IYPA 2J9OA 1YLTA 3W8KA 3RXWA 1K54A 4LV3A 4KQQA 3TG9A 1Q2PA 5FDHA 3VP3A 3IXGA 3IH9A 5EECA 1L2SA 5FQQA 3UPOA 2XEPA 1K54C 2JE5A 1K6SA 4QY6A 3O87A 1W8YA 2Y2JA 4JXGA 4ZJ1A 2BG1A 3IF6B 5M1AA 3ZDJA 4EQIA 3IXHA 2WGWB 3AGEA 4OPQA 3NI9A 1L0FA 2RCXA 1L0GA 3NY4A 3NDGA 1NXYA 3VP4A 4FD8A 3N8LA 3OCLA 4MBHA 4IVIA 4JF5A 1SHVA 3W4QA 1RP5A 3RXXA 3SS5A 4U3TA 4KZ3A 3VP1A 2XF3A 1ERMA 1BUEA 1K6RA 1FCOA 4RX2A 1VM1A 4E3NA 4FCFA 4P6BA 4P87A 2OV5A 1BSGA 1LHYA 2XGNA 1FCNA 2HPBA 1IYSA 2J7VA 4UHUA 4OH0A 2B5RA 3LEZA 3S4XA 2ZQ8A 3UDIA 4OOMA 3HUOA 3SOIA 3AGFA 1JTGA 1SCWA 4GD8A 2HDQA 4DE2A 1NY0A 3G30A 1JWZA 3IWOA 2Y2OA 5HX9A 4YFMA 1G6AA 5IHVA 4DE3A 1XKZA 2GDNA 5FQJA 5EE8A 1RCJA 1YLYA 1I2WA 3G32A 3LY4A 4X55A 5M19A 1XA1A 4LV1A 3EQUA 5CXWA 3VSLA 4OP8A 1QMEA 2ZJ9A 3EQVA 5CEBA 5FQ9A 3FWLA 4KZ6A 1TVFA 3MBZA 4ZBEA 4R4RA 1ES5A 1MPLA 3Q1FA 1JWVA 2XH9A 1E4DA 4ZTKA 3UY6A 5CECA 4KZ9A 1GA0A 2ZC4B 3PBSA 3VFHA 4XXRA 1MY8A 4OPZA 5CGSA 1BT5A 1BTLA 2WADA 4N1HA 3V3SA 5EVLA 2CC1A 4HBUA 4N9LA 1FR6A 4DDSA 1L0DA 5I94A 2EXAA 1JTDA 2P74A 3MKEA 3GMWA 1LL5A 3UO9A 2WKEA 3ITBA 4GB7A 1DJBA 1K55A 4NETA 5FASA 4LV0A 5FQIA 3N4IA 4PM7A 5KZHA 2H0YA 4R3JA 1K4FA 3O3VA 4HBTA 4X53A 3TSGA 4ZAMA 1K55C 2Y4AA 2EX8A 3V50A 2I72A 3O86A 2DNSA 2ZM2A 1H8ZA 1PYYA 3E2KA 3MZEA 2EX9A 4OQGA 1PWGA 1K56A 1LI9A 4GDNA 5DF9A 3NC8A 3P98A 5JYOA 4RVAA 1YLPA 2V20A 4EBLA 3OZHA 4UA7A 3PBNA 1ZG4A 3BFCA 2ZQCA 1XGJA 4K0WA 3DWZA 4PM6A 1XPBA 2ZC3B 4GDBA 4KZ4A 1NYYA 1M6KA 4WELA 5G18A 4E3LA 1EI5A 4BD0A 1HVBA 5CTMA 1RGZA 5E2EA 2HDSA 3MXRA 4UA6A 4OQ0A 4K0XA 3VP2A 3BECA 3OC2A 2EFXA 1M40A 1LI0A 5GL9A 1KE4A 1FSWA 2ZM0A 2XQZA 4ID4A 3W4PA 2WK0A 3BLMA 2C6WB 2WGIA 2Y2IA 2Y2MA 1TDLA 1K57A 3PAEA 4PMAA 3BEBA 4HEFA 4DE0A 1XGIA 3HVFA 1FCMA 5F1GA 3E2LA 4JLFA 4X6TA 4Q8IA 1K57C 2BLSA 1XXMA 1VQQA 3MZFA 4JPMA 4UA9A 4WMCD 3UE3A 4DE1A 2R9XA 1MBLA 3QNCA 4C3QA 2Y55A 1XP4A 1E3UA 2WZXA 2Q9NA 4E3IA 3M6HA 2OSUA 4KQRA 4X69A 5AQ7A 5CGXA 4KQOA 3SH7A 5BOHA 1FSYA 3O88A 1TDGA 2R9WA 4FH4A 5TR7A 3VP0A 1Q2QA 5CEDA 5DF8A 1KVLA 2PU2A 4N92A 5CHMA 5CERA 4BENA 5HL1A 3HBRA 1SDNA 4S2KA 3UN7A 3ZNTA 2V1ZA 2JC7A 3IH8A 4GNUA 1DJAA 4OOLA 4E6XA 1IKIA 1YLZA 4JXSA 2H0TA 2PBYA 1EROA 2Y2KA 3NIAA 3M6BA 1BLPA 3HLFA 3MFDA 3BM6A 2E8IA 4JKTA 2ZC5B 3VSKA 3ZFZA 2WAFA 4S2NA 2XK1A 1CEFA 1HD8A 2ZD8A 5EVIB 4WM9A 1ESIA 2QZ6A 4QB8A 5FQKA 2Y2PA 3TOIA 5HAPA 3IHBA 3C4PA 1W8QA 4WBGA 1L0EA 1GHPA 1YM1A 3AGDA 1IYQA 1HTZA 2QMIA 3V5MA 3P09A 5GHYA 2P9VB 3B3XA 1W5DA 3C4OA 3HLWA 4MBFA 3IF5A 1IKGA 3LY3A 4OP5A 2Y2NA 3HLGA 3GSGA 1ONHA 3CJMA 1MWSA 5AQ9A 3G34A 3UNWA 4KG6A 4MEZA 4S2OA 2HP5A 1KGGA 4OLGA 4E6WA 3V3RA 2JBFA 2WKHA 1I2SA 2EXBA 3WS2A 1J9MA 1NYMA 4D2OA 5DTKA 4S2PA 4ZJ3A 3UPPA 4OLDA 4PM5A 1NJ4A 3Q7ZA 2WUQA 2QPNA 3SH8A 3FKVA 4IVKA 4E3JA 3A3EA 1ES4A 5FA7A 3NDEA 3Q7VA 3IQAA 4FH2A 3OPHA 2Y2QA 5KMWA 4DDYA 3HLCA 4PPRA 1JWPA 4C75A 2IWCA 4R4SA 3HL9A 5FQMA 1BLHA 5GHZA 1PIOA 3WS5A 2WGVA 3BFGA 3IWIA 2WYXA 4NK3A 3OPLA 4L0LA 4C6YA 3ITAA 3W4OA 3N6IA 4JXVA 4QHCA 4S2JA 4Y0TA 1HZOA 1QMFA 1JVJA 4RA7A 5JYPA 3UDXA 1WE4A 1ONGA 3NCKA 2EFUA 2VGJA 4BL3A 5EPHA 3BFFA 3G4PA 3G2ZA 2C5WB 2PU4A 3BFDA 3DTMA 5DVAA 4JF4A 1PWCA 4E3MA 5M18A 5FATA 3MXSA 4DXBA 4MLLA 3HUMA 3S1YA 4S2LA 5KSCA 4DKIA 5GLDA 3PTEA 1N4OA 1XA7A 5F1FA 2DCFA 5KSHA 1CEGA 5EVID 2WKIA 1E25A 3HREA 5CHUA 2J9PA 3C7UA 4N1XA 4U0XA 5DTTA 1MWRA 3GR2A 1WYBA 3I7JA 2XD5A 4MNRA 5GLBA 3GTCA 5FAOA 4WZ5A 1TEMA 4LV2A 3WS4A 5FAQA 3VOYA 5FI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ5 C;  2FFY A;  2V2F F;  3IF6 A;  3OPP A;  4ZJ2 A;  1AXB A;  4IED A;  2WGW A;  3QNB A;  5F83 A;  1W79 A;  4GKU A;  2ZMA A;  3SS3 A;  2A3U A;  2Y2H A;  3IHA A;  3GVB A;  2RL3 A;  4HES A;  1H5X A;  3N7W A;  2EX2 A;  1BLS A;  3IT9 A;  4F94 A;  4ZDX A;  3WRZ A;  3JYI A;  3LO7 A;  5DF7 A;  3ZG0 A;  3C5A A;  1Z6F A;  4XUZ A;  3N8S A;  3GQZ A;  4DRT A;  1GHM A;  2Y2G A;  3M2K A;  2XFT A;  1NZO A;  3M2J A;  4RYE A;  4QJG A;  4WMC A;  2UWX A;  1SDE A;  4S2I A;  2ZQD A;  1KVM A;  4RX3 A;  3PAG A;  1G68 A;  5AQB A;  4EWF A;  3N8R A;  4R0Q A;  1O07 A;  2H10 A;  3BLS A;  1KE0 A;  4K91 A;  4KZA A;  3ISG A;  1ES2 A;  4LCM A;  1BLC A;  5F82 A;  5GLC A;  1H8Y A;  4B88 A;  4CPK A;  2Y59 A;  4BJP A;  5L2F A;  4R1G A;  4KZ7 A;  2Y91 A;  3FZC A;  1RGY A;  1KGF A;  3CG5 A;  3UDF A;  3Q81 A;  1WYC A;  4S2N C;  4S2M A;  3BRM A;  3V39 A;  1CI9 A;  4R23 A;  4X68 A;  5U47 A;  1W7F A;  4IBX A;  4GOG A;  5TFQ A;  1KDS A;  1PZO A;  1PZP A;  3D4F A;  2JCH A;  4KG5 A;  3LCE A;  4JBF A;  4OQH A;  1LL9 A;  1CI8 A;  3VMA A;  4DF6 A;  3PBR A;  3ZGA B;  1MXO A;  2HP9 A;  4WYY A;  1IYO A;  4H8R A;  4OOY A;  3WS1 A;  5FSR A;  3IXD A;  5HAQ A;  4M3K A;  3VFF A;  3UE0 A;  1YLJ A;  5E2F A;  3MKF A;  4PM8 A;  3A3I A;  2FFF B;  3CZD A;  3WS0 A;  5CHJ A;  1EWZ A;  1ZC2 A;  1MWU A;  1PW8 A;  2XLN A;  3ZVW A;  2ZQ9 A;  2WZZ A;  4IBR A;  2Z2L B;  4A5R A;  3VOZ A;  4QY5 A;  4MBK A;  1LLB A;  4BQM A;  4KG2 A;  5EUA A;  3PBT A;  1ZG6 A;  3QHY A;  4Y0O A;  5FAP A;  4U0T A;  2G2U A;  1BUL A;  1FR1 A;  4CJN A;  3GV9 A;  5A92 A;  1GA9 A;  1GCE A;  3WWX A;  4QD4 A;  5HFO A;  2XR0 A;  3ZHH A;  5A90 A;  5D3O A;  3OCN A;  1BZA A;  3HLE A;  4OVD A;  3ZG9 B;  1C3B A;  2EX6 A;  5EOE A;  3S22 A;  4JXW A;  1O7E A;  2VGK A;  1FOF A;  1K4E A;  1S6R A;  3ZNY A;  4Z9Q A;  3ZCZ A;  4GZB A;  3ZVT A;  3ZG5 A;  4N9K A;  2H5S A;  4UAA A;  5CRF A;  2HP6 A;  1KE3 A;  3UE1 A;  3G35 A;  4P85 A;  1NZU A;  1ESU A;  4E3O A;  4EBP A;  2XFS A;  3IXB A;  1NRF A;  4BD1 A;  2Q9M A;  4FSF A;  1FQG A;  3Q07 A;  4JF6 A;  4BL2 A;  4EUZ A;  3FYZ A;  1XX2 A;  4KZ5 A;  3C7V A;  2IWB A;  3BYD A;  1KGE A;  3HLB A;  5E43 A;  1SKF A;  2HDU A;  5EOO A;  2X02 A;  4DXC A;  4Y7P A;  2OLU A;  1K38 A;  3SH9 A;  1MWT A;  5TGF A;  2ZQ7 A;  2XDM A;  1K56 D;  2ZQA A;  1DJC A;  5HAR A;  3ZG8 B;  5J8X A;  4BLM A;  3MZD A;  1MKI A;  4WEK A;  1KDW A;  5CTN A;  3FV7 A;  1IEM A;  1YQS A;  2ZLY A;  2XD1 A;  4GN2 A;  5E2G A;  1YT4 A;  2ZM8 A;  3A3D A;  5GLA A;  2OLV A;  2J8Y A;  2Z2M B;  4B4Z A;  1K25 A;  5GHX A;  5DTS A;  5EVI A;  4X56 A;  3ZG7 B;  4EV4 A;  1PI5 A;  2A49 A;  4KEN B;  3CMZ A;  3Q7V B;  3NBL A;  3OPR A;  3DWK A;  1PWD A;  5A91 A;  1YLW A;  1YMX A;  2Y2L A;  3IF6 C;  5EVI C;  3RJU A;  1ERQ A;  3PBQ A;  1U60 A;  3A3F A;  2P9V A;  2ZC6 B;  1GHI A;  5HAI A;  3GRJ A;  2X01 A;  4R3B A;  4OQI A;  5A93 A;  2X71 A;  4EBN A;  4WEJ A;  4Y0U A;  3FKW A;  5E2H A;  1ES3 A;  1Y54 A;  5FI6 A;  3PBO A;  1E3U D;  1N9B A;  4P0M A;  3HUN A;  4O7D A;  1ZKJ A;  3UPN A;  4QU3 A;  4WZ4 A;  2DRW A;  1PW1 A;  1OME A;  5AQA A;  4KZ8 A;  1ALQ A;  4LCL A;  1PI4 A;  3G2Y A;  4YIN A;  1IEL A;  2WAE A;  1YMS A;  5FI7 A;  3Q82 A;  4GD6 A;  4LEN A;  4PM9 A;  3HLD A;  4XUX A;  3IWQ A;  4OPY A;  2G2W A;  2ZC7 A;  3SS4 A;  3G31 A;  4B4X A;  4E3K A;  3DW0 A;  1DY6 A;  3A3J A;  1I5Q A;  1S0W A;  1CK3 A;  3BFE A;  4KZB A;  4OKP A;  2IWD A;  4OON A;  5CGW A;  5HW3 A;  2HDR A;  4OPR A;  3WRT A;  1IYP A;  2J9O A;  1YLT A;  3W8K A;  3RXW A;  1K54 A;  4LV3 A;  4KQQ A;  3TG9 A;  1Q2P A;  5FDH A;  3VP3 A;  3IXG A;  3IH9 A;  5EEC A;  1L2S A;  5FQQ A;  3UPO A;  2XEP A;  1K54 C;  2JE5 A;  1K6S A;  4QY6 A;  3O87 A;  1W8Y A;  2Y2J A;  4JXG A;  4ZJ1 A;  2BG1 A;  3IF6 B;  5M1A A;  3ZDJ A;  4EQI A;  3IXH A;  2WGW B;  3AGE A;  4OPQ A;  3NI9 A;  1L0F A;  2RCX A;  1L0G A;  3NY4 A;  3NDG A;  1NXY A;  3VP4 A;  4FD8 A;  3N8L A;  3OCL A;  4MBH A;  4IVI A;  4JF5 A;  1SHV A;  3W4Q A;  1RP5 A;  3RXX A;  3SS5 A;  4U3T A;  4KZ3 A;  3VP1 A;  2XF3 A;  1ERM A;  1BUE A;  1K6R A;  1FCO A;  4RX2 A;  1VM1 A;  4E3N A;  4FCF A;  4P6B A;  4P87 A;  2OV5 A;  1BSG A;  1LHY A;  2XGN A;  1FCN A;  2HPB A;  1IYS A;  2J7V A;  4UHU A;  4OH0 A;  2B5R A;  3LEZ A;  3S4X A;  2ZQ8 A;  3UDI A;  4OOM A;  3HUO A;  3SOI A;  3AGF A;  1JTG A;  1SCW A;  4GD8 A;  2HDQ A;  4DE2 A;  1NY0 A;  3G30 A;  1JWZ A;  3IWO A;  2Y2O A;  5HX9 A;  4YFM A;  1G6A A;  5IHV A;  4DE3 A;  1XKZ A;  2GDN A;  5FQJ A;  5EE8 A;  1RCJ A;  1YLY A;  1I2W A;  3G32 A;  3LY4 A;  4X55 A;  5M19 A;  1XA1 A;  4LV1 A;  3EQU A;  5CXW A;  3VSL A;  4OP8 A;  1QME A;  2ZJ9 A;  3EQV A;  5CEB A;  5FQ9 A;  3FWL A;  4KZ6 A;  1TVF A;  3MBZ A;  4ZBE A;  4R4R A;  1ES5 A;  1MPL A;  3Q1F A;  1JWV A;  2XH9 A;  1E4D A;  4ZTK A;  3UY6 A;  5CEC A;  4KZ9 A;  1GA0 A;  2ZC4 B;  3PBS A;  3VFH A;  4XXR A;  1MY8 A;  4OPZ A;  5CGS A;  1BT5 A;  1BTL A;  2WAD A;  4N1H A;  3V3S A;  5EVL A;  2CC1 A;  4HBU A;  4N9L A;  1FR6 A;  4DDS A;  1L0D A;  5I94 A;  2EXA A;  1JTD A;  2P74 A;  3MKE A;  3GMW A;  1LL5 A;  3UO9 A;  2WKE A;  3ITB A;  4GB7 A;  1DJB A;  1K55 A;  4NET A;  5FAS A;  4LV0 A;  5FQI A;  3N4I A;  4PM7 A;  5KZH A;  2H0Y A;  4R3J A;  1K4F A;  3O3V A;  4HBT A;  4X53 A;  3TSG A;  4ZAM A;  1K55 C;  2Y4A A;  2EX8 A;  3V50 A;  2I72 A;  3O86 A;  2DNS A;  2ZM2 A;  1H8Z A;  1PYY A;  3E2K A;  3MZE A;  2EX9 A;  4OQG A;  1PWG A;  1K56 A;  1LI9 A;  4GDN A;  5DF9 A;  3NC8 A;  3P98 A;  5JYO A;  4RVA A;  1YLP A;  2V20 A;  4EBL A;  3OZH A;  4UA7 A;  3PBN A;  1ZG4 A;  3BFC A;  2ZQC A;  1XGJ A;  4K0W A;  3DWZ A;  4PM6 A;  1XPB A;  2ZC3 B;  4GDB A;  4KZ4 A;  1NYY A;  1M6K A;  4WEL A;  5G18 A;  4E3L A;  1EI5 A;  4BD0 A;  1HVB A;  5CTM A;  1RGZ A;  5E2E A;  2HDS A;  3MXR A;  4UA6 A;  4OQ0 A;  4K0X A;  3VP2 A;  3BEC A;  3OC2 A;  2EFX A;  1M40 A;  1LI0 A;  5GL9 A;  1KE4 A;  1FSW A;  2ZM0 A;  2XQZ A;  4ID4 A;  3W4P A;  2WK0 A;  3BLM A;  2C6W B;  2WGI A;  2Y2I A;  2Y2M A;  1TDL A;  1K57 A;  3PAE A;  4PMA A;  3BEB A;  4HEF A;  4DE0 A;  1XGI A;  3HVF A;  1FCM A;  5F1G A;  3E2L A;  4JLF A;  4X6T A;  4Q8I A;  1K57 C;  2BLS A;  1XXM A;  1VQQ A;  3MZF A;  4JPM A;  4UA9 A;  4WMC D;  3UE3 A;  4DE1 A;  2R9X A;  1MBL A;  3QNC A;  4C3Q A;  2Y55 A;  1XP4 A;  1E3U A;  2WZX A;  2Q9N A;  4E3I A;  3M6H A;  2OSU A;  4KQR A;  4X69 A;  5AQ7 A;  5CGX A;  4KQO A;  3SH7 A;  5BOH A;  1FSY A;  3O88 A;  1TDG A;  2R9W A;  4FH4 A;  5TR7 A;  3VP0 A;  1Q2Q A;  5CED A;  5DF8 A;  1KVL A;  2PU2 A;  4N92 A;  5CHM A;  5CER A;  4BEN A;  5HL1 A;  3HBR A;  1SDN A;  4S2K A;  3UN7 A;  3ZNT A;  2V1Z A;  2JC7 A;  3IH8 A;  4GNU A;  1DJA A;  4OOL A;  4E6X A;  1IKI A;  1YLZ A;  4JXS A;  2H0T A;  2PBY A;  1ERO A;  2Y2K A;  3NIA A;  3M6B A;  1BLP A;  3HLF A;  3MFD A;  3BM6 A;  2E8I A;  4JKT A;  2ZC5 B;  3VSK A;  3ZFZ A;  2WAF A;  4S2N A;  2XK1 A;  1CEF A;  1HD8 A;  2ZD8 A;  5EVI B;  4WM9 A;  1ESI A;  2QZ6 A;  4QB8 A;  5FQK A;  2Y2P A;  3TOI A;  5HAP A;  3IHB A;  3C4P A;  1W8Q A;  4WBG A;  1L0E A;  1GHP A;  1YM1 A;  3AGD A;  1IYQ A;  1HTZ A;  2QMI A;  3V5M A;  3P09 A;  5GHY A;  2P9V B;  3B3X A;  1W5D A;  3C4O A;  3HLW A;  4MBF A;  3IF5 A;  1IKG A;  3LY3 A;  4OP5 A;  2Y2N A;  3HLG A;  3GSG A;  1ONH A;  3CJM A;  1MWS A;  5AQ9 A;  3G34 A;  3UNW A;  4KG6 A;  4MEZ A;  4S2O A;  2HP5 A;  1KGG A;  4OLG A;  4E6W A;  3V3R A;  2JBF A;  2WKH A;  1I2S A;  2EXB A;  3WS2 A;  1J9M A;  1NYM A;  4D2O A;  5DTK A;  4S2P A;  4ZJ3 A;  3UPP A;  4OLD A;  4PM5 A;  1NJ4 A;  3Q7Z A;  2WUQ A;  2QPN A;  3SH8 A;  3FKV A;  4IVK A;  4E3J A;  3A3E A;  1ES4 A;  5FA7 A;  3NDE A;  3Q7V A;  3IQA A;  4FH2 A;  3OPH A;  2Y2Q A;  5KMW A;  4DDY A;  3HLC A;  4PPR A;  1JWP A;  4C75 A;  2IWC A;  4R4S A;  3HL9 A;  5FQM A;  1BLH A;  5GHZ A;  1PIO A;  3WS5 A;  2WGV A;  3BFG A;  3IWI A;  2WYX A;  4NK3 A;  3OPL A;  4L0L A;  4C6Y A;  3ITA A;  3W4O A;  3N6I A;  4JXV A;  4QHC A;  4S2J A;  4Y0T A;  1HZO A;  1QMF A;  1JVJ A;  4RA7 A;  5JYP A;  3UDX A;  1WE4 A;  1ONG A;  3NCK A;  2EFU A;  2VGJ A;  4BL3 A;  5EPH A;  3BFF A;  3G4P A;  3G2Z A;  2C5W B;  2PU4 A;  3BFD A;  3DTM A;  5DVA A;  4JF4 A;  1PWC A;  4E3M A;  5M18 A;  5FAT A;  3MXS A;  4DXB A;  4MLL A;  3HUM A;  3S1Y A;  4S2L A;  5KSC A;  4DKI A;  5GLD A;  3PTE A;  1N4O A;  1XA7 A;  5F1F A;  2DCF A;  5KSH A;  1CEG A;  5EVI D;  2WKI A;  1E25 A;  3HRE A;  5CHU A;  2J9P A;  3C7U A;  4N1X A;  4U0X A;  5DTT A;  1MWR A;  3GR2 A;  1WYB A;  3I7J A;  2XD5 A;  4MNR A;  5GLB A;  3GTC A;  5FAO A;  4WZ5 A;  1TEM A;  4LV2 A;  3WS4 A;  5FAQ A;  3VOY A;  5FI2 A; 
#chains in the Genus database with same CATH topology
 4IED A;  2J3W A;  2ZMA A;  2A3U A;  5F6A A;  1BLS A;  4EQ1 A;  3UME A;  4YOF A;  4ZDX A;  3WRZ A;  4DRT A;  3SW1 A;  2XFT A;  2UWX A;  4K08 A;  1OT6 A;  4S2I A;  4CPK A;  1H8Y A;  2Y91 A;  3EGD C;  4S2M A;  5U47 A;  4EER A;  4GOG A;  5TFQ A;  2JCH A;  5C5K A;  4WN5 A;  1OTD A;  4OQH A;  1LL9 A;  3VMA A;  3PBR A;  4WYY A;  5AJG A;  1P9R A;  4QPR A;  4F3L B;  3A3I A;  3QP6 A;  1ZC2 A;  1PW8 A;  5HDC A;  3CUE C;  3MR0 A;  4HIA A;  1ZG6 A;  4Y0O A;  4R38 A;  3A0R A;  4CJN A;  3GV9 A;  3QP1 A;  1GCE A;  3E4P A;  2M7V A;  3R7W A;  3ZHH A;  4OVD A;  4WF0 A;  5HDS A;  2VGK A;  2HP6 A;  1KE3 A;  3IS2 B;  4P85 A;  2GJ3 A;  3IXB A;  2Q9M A;  4H6J A;  4EUZ A;  2ZL1 A;  4MMN A;  2HDU A;  1GSV A;  2OLU A;  1K56 D;  4LGW A;  3QP4 A;  5J8X A;  4CLC E;  3PXP A;  4BLM A;  5L8M A;  1KDW A;  5CTN A;  1YQS A;  3HCY A;  5DTS A;  1YSQ A;  1OJG A;  4EV4 A;  2A49 A;  2PDR A;  1S1Y A;  2I9V A;  1YLW A;  3RJU A;  3PBQ A;  3A3F A;  5IT5 A;  2ACG A;  5A93 A;  2X71 A;  4EBN A;  1TS6 A;  4WEJ A;  3T4S A;  4Y0U A;  1CQA A;  5FI6 A;  1X0O A;  4I3A A;  1N9B A;  5FDS A;  3HUN A;  4O7D A;  2QYB A;  3P7N A;  2DRW A;  5AQA A;  1OT9 A;  4KZ8 A;  4YIN A;  3RTY A;  4LLO B;  4YWZ A;  1YMS A;  2WKR A;  4PM9 A;  2Y8H A;  3IWQ A;  2G2W A;  3LGO A;  1D06 A;  4E3K A;  1DY6 A;  2W3H A;  1S0W A;  3NEC A;  1CK3 A;  4KZB A;  3GEC A;  4L9G A;  2JKT M;  2V1A A;  3RXW A;  3IH9 A;  4WLA A;  2JE5 A;  1K6S A;  3ZDJ A;  2WGW B;  1L0G A;  3VP4 A;  2AVX A;  4IVI A;  4JF5 A;  1S1Z A;  1UWN X;  3VP1 A;  4MN7 A;  1K6R A;  1BSG A;  1FCN A;  2HPB A;  1T1C A;  2CMN A;  2B5R A;  3LEZ A;  1PRQ A;  2ZOI A;  2ZQ8 A;  3UDI A;  3AGF A;  1SCW A;  1JWZ A;  5HX9 A;  3CHW P;  1AWI A;  3R4K A;  3UE6 A;  4Y17 A;  4LV1 A;  3EQU A;  3VSL A;  3FWL A;  4KZ6 A;  4ESP A;  2XH9 A;  3UY6 A;  2ZC4 B;  3PBS A;  1F98 A;  2V1B A;  4OPZ A;  5CGS A;  4N1H A;  3MSH A;  4GS9 B;  2W3E A;  4N9L A;  2OWJ A;  2O9A A;  5I94 A;  2EXA A;  1JTD A;  2MJ6 A;  3GMW A;  1LL5 A;  4II7 A;  1K55 A;  3MS6 A;  5FAS A;  4LV0 A;  2H0Y A;  4P6Z S;  3FPV A;  4X53 A;  3TSG A;  2Y4A A;  5DKK A;  3V50 A;  3LR4 A;  2EX9 A;  3P01 A;  5G4Z A;  3NC8 A;  4UEY A;  3ICY A;  1OJ5 A;  1ZG4 A;  3EWK A;  2ZQC A;  3NJA A;  3MF0 A;  4KZ4 A;  1M6K A;  1T18 A;  3MMH A;  4E3L A;  1EI5 A;  1UWP X;  1HVB A;  1RGZ A;  2HDS A;  1K0K A;  3BEC A;  3UB9 A;  2EFX A;  2ZM0 A;  2XQZ A;  2WK0 A;  3T4O A;  2C6W B;  2WGI A;  1VEU B;  1MKM A;  4DE0 A;  1XGI A;  4HJ4 A;  1K57 C;  3MZF A;  4WMC D;  4JPM A;  2DMW A;  4C3Q A;  4CLC A;  1XP4 A;  1E3U A;  4E3I A;  2Q9N A;  2Z6D A;  2OSU A;  4KQO A;  4NEE D;  3O88 A;  1TDG A;  5TR7 A;  3VP0 A;  1KVL A;  4N92 A;  5HL1 A;  3ZNT A;  3MQQ A;  3F1N A;  3NIA A;  3HLF A;  3MFD A;  3VSK A;  2E8I A;  3LFV A;  4JKT A;  3S7N A;  2XK1 A;  2E8J A;  1HD8 A;  4WM9 A;  1NRJ A;  4QB8 A;  3TOI A;  3C4P A;  3K3C A;  3NOP C;  5HWV A;  1IYQ A;  1HTZ A;  2QMI A;  2GZA A;  3B3X A;  5TJJ A;  3KX0 X;  3C4O A;  3HLW A;  4MBF A;  3UMD A;  4OP5 A;  2PR5 A;  3UNW A;  3KSH A;  1YKD A;  4E6W A;  2W1T B;  3ZQ5 A;  4PM5 A;  1F5M A;  1A0K A;  1NJ4 A;  4IVK A;  1ES4 A;  3Q7V A;  1V9Y A;  3T1S A;  4FH2 A;  1JWP A;  4EEP A;  2JHE A;  4HI4 A;  5FEF A;  3V67 A;  2J80 A;  4ARZ B;  1N9L A;  4L0L A;  1T1B A;  4C6Y A;  3N6I A;  2B02 A;  2PD8 A;  4NXF A;  2EFU A;  1TD5 A;  3FG8 A;  3LIB A;  3OLO A;  3H7W A;  5DVA A;  4E3M A;  5FAT A;  4MLL A;  4Y2F A;  1J3W A;  4S2L A;  5L09 A;  1XA7 A;  5EVI D;  3B47 A;  5FL3 A;  4G3W A;  5GLB A;  2XD5 A;  3OOV A;  4ME4 A;  1TEM A;  4WZ5 C;  3L9K A;  2FFY A;  3EEH A;  3OPP A;  3QNB A;  5F83 A;  4GKU A;  1FIL A;  3B42 A;  3IHA A;  2VA0 A;  1D1J A;  4JGQ A;  2EX2 A;  4P6Z M;  5HDD A;  4NXG A;  1DP8 A;  2XRO A;  3LO7 A;  5DF7 A;  3ZG0 A;  4UQI S;  2Y2G A;  3M2K A;  1NZO A;  4RYE A;  1P97 A;  4RX3 A;  2H28 A;  5AQB A;  3LR0 A;  3BLS A;  2H10 A;  4KZA A;  1ES2 A;  5HPF A;  5GLC A;  5L2F A;  4BJP A;  4R1G A;  3FZC A;  1RGY A;  2V8C A;  1KGF A;  3CG5 A;  3Q81 A;  2K7S A;  1MZU A;  1W7F A;  3D4F A;  1CI8 A;  3ZGA B;  2VZW A;  5HAQ A;  3IXD A;  3VFF A;  5E2F A;  3CZD A;  2K2N A;  1MWU A;  2A2L A;  3CUE A;  4GCZ A;  2ZQ9 A;  2WZZ A;  4A5R A;  2W27 A;  3PBT A;  1V9Z A;  4U0T A;  1OPX A;  3B33 A;  4JGP A;  3WWX A;  3LR5 A;  3FPW A;  2XR0 A;  5HFO A;  5A90 A;  5D3O A;  4BBV A;  3CIT A;  2EX6 A;  5J3W A;  3IX4 A;  4JXW A;  3F1O A;  1K4E A;  1S6R A;  3NHQ A;  3K3D A;  3UB6 A;  3ZG5 A;  4N9K A;  4UAA A;  3UE1 A;  4ZRR A;  1NZU A;  4E3O A;  1TS0 A;  3T12 B;  2PHY A;  2Z6C A;  2EWV A;  4BL2 A;  4KZ5 A;  3T4T A;  5EOO A;  5TBM B;  2L1M A;  2X02 A;  4Y7P A;  5HD5 A;  3SH9 A;  1T1A A;  2ZQA A;  2D01 A;  3ZG8 B;  1ZHH B;  2INW A;  3MZD A;  2OAQ 1;  4NXB A;  4GN2 A;  2ZM8 A;  2OLV A;  2Z2M B;  1PI5 A;  3NBL A;  5A91 A;  5EVI C;  2V0W A;  4PHT A;  1ERQ A;  4HH3 A;  1ZTU A;  1GHI A;  4R3B A;  4OQI A;  3F1P B;  3C8C A;  1Y54 A;  4F3L A;  4MN6 A;  4EXO A;  1LSV A;  1PI4 A;  3VE3 A;  4XT2 A;  3QP8 A;  3LI9 A;  3Q82 A;  4GD6 A;  4LEN A;  4JGO A;  4LRX C;  4HP9 A;  2NUP C;  4OPY A;  2ZC7 A;  3DW0 A;  3A3J A;  3BFE A;  5CGW A;  2G7U A;  5L10 A;  4HJ6 A;  5HW3 A;  4OPR A;  3WRT A;  4MCW A;  4KQQ A;  3TG9 A;  1FIK A;  1N9N A;  5EEC A;  2W0N A;  5FQQ A;  3UPO A;  1K54 C;  4UQI M;  3O87 A;  3CI6 A;  4FTX A;  5F68 A;  3NDG A;  3OCL A;  1SHV A;  1RP5 A;  1LL8 A;  4FCF A;  1CF0 A;  4P6B A;  2J7V A;  1IYS A;  4HH2 A;  4UHU A;  3H82 A;  4X25 A;  4EUV A;  3SOI A;  2B18 A;  3BY9 A;  3S7P A;  1NY0 A;  1MC0 A;  2Y2O A;  3PR6 A;  1G6A A;  3ZYT A;  5EE8 A;  4MDZ A;  3G32 A;  1XJ2 A;  4OP8 A;  3EQV A;  5CEB A;  2HZ5 A;  1TVF A;  3T4L A;  4R4R A;  1ES5 A;  1MPL A;  4ZTK A;  1E4D A;  1S4R A;  4RQ9 A;  3VFH A;  3KYQ A;  4XXR A;  1MY8 A;  1BT5 A;  1BTL A;  2EA9 A;  4E04 A;  3V3S A;  4ETZ A;  3MKE A;  4LFU A;  3UO9 A;  1LSX A;  3W2Z A;  4GB7 A;  5EFW A;  4NET A;  3CPT A;  3O3V A;  4HBT A;  2O9B A;  4G3K A;  4HJ3 A;  2GX5 A;  2PBD P;  3O86 A;  2M7U A;  3E2K A;  1K56 A;  2HJE A;  4GDN A;  3P98 A;  5JYO A;  3OZH A;  3PBN A;  3R7W B;  1XGJ A;  3DWZ A;  4NG2 A;  3DTE A;  4HNB A;  4WEL A;  1XFN A;  4BD0 A;  2VV8 A;  3MXR A;  4UA6 A;  3SZT A;  4Z1W A;  4Y5F A;  1IFQ A;  2VEA A;  1FSW A;  5HD3 A;  1Z09 A;  3BLM A;  2Y2I A;  1K57 A;  3PAE A;  1W63 Q;  4HEF A;  1DRM A;  5F1G A;  3E2L A;  4JLF A;  3D9Y A;  4GHI A;  4Q8I A;  1VQQ A;  4DE1 A;  4H6J B;  3QNC A;  1MBL A;  2K31 A;  5DFX A;  2ZL1 B;  3PYP A;  4X69 A;  3KSI A;  3SH7 A;  4FH4 A;  1NLY A;  5DF8 A;  5CHM A;  4BEN A;  1VET A;  1SKO A;  1YLZ A;  2W3F A;  2H0T A;  3BJN A;  1STZ A;  2IA2 A;  2YKF A;  3ZFZ A;  2WAF A;  3LIF A;  4S2N A;  3TW8 A;  1CEF A;  1UGU A;  5FQK A;  1GHP A;  4YNR A;  2LB5 A;  3P09 A;  4R3A A;  2PYP A;  4L9F A;  2V0U A;  1MWS A;  4KG6 A;  2HP5 A;  2VJW A;  2HJ9 C;  3TE8 A;  4KUO A;  1I2S A;  1J9M A;  4IUH A;  4EES A;  2JN7 A;  2WKP A;  3UPP A;  5HWT A;  5L07 A;  2VGL M;  2WUQ A;  3SH8 A;  2XSS A;  3FKV A;  3IX8 A;  3NDE A;  4Y15 A;  5KMW A;  4DDY A;  4Y13 A;  4PPR A;  2IWC A;  5DKL A;  3HL9 A;  5GHZ A;  2WGV A;  2WYX A;  3OPL A;  1JNU A;  3ITA A;  3W4O A;  4JXV A;  4L9E A;  4QHC A;  4S2J A;  1QMF A;  1JVJ A;  1WE4 A;  1VEU A;  4WUJ A;  5K5B A;  2VGJ A;  4R6L A;  3BFF A;  2VV7 A;  3G2Z A;  3DTM A;  3DAV A;  4JF4 A;  3BWL A;  1OTI A;  3S1Y A;  1H3Q A;  4DKI A;  1S66 L;  1Y28 A;  2HGV A;  4DN0 A;  2WKI A;  3VOL A;  5CHU A;  3C7U A;  4U0X A;  5DTT A;  1MWR A;  3GR2 A;  2D02 A;  5FAO A;  1HLU P;  4CQH A;  4WZ5 A;  3A0V A;  4LV2 A;  3VOY A;  5FI2 A;  2V2F F;  3IF6 A;  4ZJ2 A;  2A24 A;  1W79 A;  3SS3 A;  4IHQ A;  2Y2H A;  1TS8 A;  3GVB A;  5HZH A;  4HES A;  1H5X A;  3MXQ A;  1G6O A;  2OOL A;  1XJ3 A;  5IS1 A;  3C5A A;  1Z6F A;  4ETX A;  3GQZ A;  1PFL A;  1GHM A;  2LB9 A;  1OTE A;  3T4Q A;  4QJG A;  4WMC A;  2JKR I;  2ZQD A;  3PAG A;  1G68 A;  4I5S A;  3LUQ A;  3N8R A;  1KE0 A;  4LCM A;  5F82 A;  4B88 A;  4I38 A;  4KZ7 A;  4S2N C;  1WYC A;  3V39 A;  1CI9 A;  1S67 L;  2ZMV A;  4X68 A;  3U2A A;  4IBX A;  1KDS A;  3E98 A;  5CX7 A;  1MXO A;  1XJ6 A;  1IYO A;  4H8R A;  4OOY A;  5EV0 A;  3UB7 A;  3WS1 A;  4LRZ E;  4M3K A;  4PM8 A;  3WS0 A;  2FFF B;  1S4S A;  2J3T D;  3ZVW A;  2XLN A;  2Z2L B;  3U4L P;  4MBK A;  1LLB A;  4KG2 A;  1YPR A;  2BTF P;  5FEG A;  2ZBB A;  5FAP A;  2VX8 A;  4CLC B;  2G2U A;  1FR1 A;  3KYE A;  2KDK A;  5A92 A;  1GA9 A;  4QD4 A;  1BZA A;  3HLE A;  3ZG9 B;  1C3B A;  3CLO A;  3S22 A;  1O7E A;  1FOF A;  3F1N B;  2VV6 A;  3ZNY A;  3T1Q B;  3ZVT A;  2P04 A;  2H5S A;  1D7E A;  1YSP A;  3BQA A;  5IU1 A;  2XFS A;  4FSF A;  3Q07 A;  4JF6 A;  2PT7 A;  4Q0J A;  1KGE A;  1SKF A;  5AVE A;  4DXC A;  5TGF A;  2XDM A;  2P08 A;  2P7J A;  1MKI A;  2VKS A;  3E4Q A;  2XD1 A;  5E2G A;  1YT4 A;  2QHK A;  2HV1 A;  5GLA A;  2J8Y A;  3DBA A;  4B4Z A;  5GHX A;  5EVI A;  4KEN B;  3Q7V B;  3DWK A;  4HQA A;  3IF6 C;  1U60 A;  2P9V A;  5DFY A;  2ZC6 B;  1G5U A;  3GRJ A;  2X01 A;  5HSQ A;  1Y4O A;  4BWI A;  1ES3 A;  4EU0 A;  1N9O A;  1YAX A;  3LIE A;  3EEA A;  4QU3 A;  4WZ4 A;  3H9W A;  1PW1 A;  1XJ4 A;  2FZ0 A;  3H7W B;  3D3O A;  2WAE A;  3IBJ A;  3LIC A;  2Y79 A;  4XUX A;  3SS4 A;  3G31 A;  3ULF A;  1F9I A;  1IOU A;  3CWF A;  3VV4 A;  2J9O A;  1YLT A;  2QKP A;  1K54 A;  1Q2P A;  3VP3 A;  4B9O A;  1L2S A;  2JKT I;  1W63 M;  3CAX A;  4JXG A;  2Y2J A;  4O0P A;  4DJ2 A;  4EQI A;  3IXH A;  3S7O A;  4BBU A;  3AGE A;  4OPQ A;  3D72 A;  1L0F A;  1NXY A;  4FD8 A;  3N8L A;  4MBH A;  3W4Q A;  3SS5 A;  2V9A A;  4U3T A;  4KZ3 A;  1H0M A;  2XF3 A;  1BUE A;  3IBR A;  1FCO A;  1VM1 A;  2OV5 A;  2J3T C;  1JTG A;  5EM0 A;  4GD8 A;  2HDQ A;  4DE2 A;  3IWO A;  4R70 A;  5FQJ A;  2O0Y A;  3QP2 A;  1RCJ A;  4X55 A;  5M19 A;  1XA1 A;  5CXW A;  3OBF A;  1QME A;  2ZJ9 A;  4O01 A;  5FQ9 A;  3MBZ A;  1CJF A;  5CEC A;  4KZ9 A;  3MQO A;  2WAD A;  5EVL A;  4HBU A;  4DDS A;  3G6O A;  2P74 A;  2WKE A;  5FQI A;  1P0Z A;  3N4I A;  4PM7 A;  4R3J A;  3MQ0 A;  2DNS A;  2ZM2 A;  1PYY A;  3MZE A;  4OQG A;  4UA7 A;  5DJT A;  4DMZ A;  4HY8 A;  4K0W A;  4PM6 A;  1XPB A;  2ZC3 B;  4GDB A;  1KOU A;  3C2W A;  1NYY A;  5F5Y A;  3QP5 A;  2XRN A;  3F1O B;  5CTM A;  1F2K A;  5E2E A;  4LRY C;  2OWH A;  4K0X A;  3VP2 A;  5GL9 A;  4ID4 A;  5MC7 A;  1TDL A;  4HHD A;  2EWW A;  4PMA A;  3BEB A;  3PHY A;  1FCM A;  2R9X A;  2L0W A;  3M6H A;  2JKR M;  3E4O A;  5BOH A;  3T4J A;  2R9W A;  5CED A;  2PU2 A;  1SDN A;  2V8F A;  4GLQ A;  4S2K A;  3UN7 A;  2JC7 A;  3IH8 A;  4GNU A;  1DJA A;  2ZMF A;  4OOL A;  1IKI A;  4E6X A;  2QJ7 A;  3LYX A;  2PBY A;  3TRC A;  2VGL S;  2Y2K A;  3M6B A;  2JKF A;  2L4R A;  3IS2 A;  3JPU A;  5HAP A;  1W8Q A;  4WBG A;  1L0E A;  1YM1 A;  3AGD A;  1VHM A;  2O9C A;  1W5D A;  3LY3 A;  2Y2N A;  1ONH A;  3CJM A;  4BMW A;  2M1C A;  1XFQ A;  4MEZ A;  1KGG A;  3LR3 A;  3V3R A;  2JBF A;  2WKH A;  1NYM A;  5HPI A;  4D2O A;  5DTK A;  4S2P A;  4ZJ3 A;  3HJK A;  5KIZ A;  2JKG A;  4XT2 B;  2QPN A;  5FA7 A;  2PAV P;  3T50 A;  4I3I A;  3IWI A;  4NK3 A;  4Y3I A;  5JYP A;  3UDX A;  2FH5 A;  1ONG A;  3KO6 A;  3NCK A;  4BL3 A;  5EPH A;  3G4P A;  2PU4 A;  1WA9 A;  1PWC A;  5M18 A;  4B93 A;  3T1X A;  1DP9 A;  2GNX A;  4HOI A;  5KSC A;  3O5Y A;  3PTE A;  1N4O A;  5F1F A;  1OTA A;  4DJ3 A;  3RFB A;  5KSH A;  1CEG A;  3H82 B;  3HRE A;  5DJU A;  4N1X A;  3NUL A;  1WYB A;  4MNR A;  3GTC A;  3FC7 A;  1LT0 A;  5FAQ A;  2KOI A;  1AXB A;  2WGW A;  2RL3 A;  3N7W A;  2NUT C;  3IT9 A;  4F94 A;  3JYI A;  4XUZ A;  2W3D A;  3N8S A;  4KQD A;  3M2J A;  4EEU A;  2ZOH A;  1SDE A;  1KVM A;  3CPT B;  4BBT A;  4O8G A;  5HL6 A;  4EWF A;  4R0Q A;  1O07 A;  2BAS A;  4K91 A;  3ISG A;  1BLC A;  2Y59 A;  1ODV A;  4PKY G;  4I39 A;  3UDF A;  3BRM A;  4R23 A;  3JVU A;  2XA7 S;  1PZO A;  1PZP A;  4KG5 A;  4GS9 A;  3LCE A;  4JBF A;  2Q0O A;  4I3J A;  4DF6 A;  4KUK A;  2HP9 A;  5FSR A;  3UE0 A;  1YLJ A;  3MKF A;  5CHJ A;  1EWZ A;  4IBR A;  3VOZ A;  4QY5 A;  4FUW A;  4BQM A;  5EUA A;  4GHI B;  3QHY A;  3NOT C;  1BUL A;  2QJ5 A;  5J4E A;  3OCN A;  5EOE A;  1VET B;  1SKO B;  4Z9Q A;  3ZCZ A;  4GZB A;  3BY8 A;  2PYR A;  3UB5 P;  5CRF A;  5J7E A;  4IJG A;  3G35 A;  4HP4 A;  1ESU A;  4EBP A;  1NRF A;  4MN5 A;  4BD1 A;  1NLZ A;  1FQG A;  3LID A;  3FYZ A;  1XX2 A;  2PR6 A;  3C7V A;  2IWB A;  3BYD A;  3HLB A;  5E43 A;  1K38 A;  2WKQ A;  1MWT A;  3VE4 A;  2ZQ7 A;  5G4Y A;  3RH8 B;  1DJC A;  5HAR A;  1P9W A;  4WEK A;  3FV7 A;  3BW6 A;  4GJ4 A;  1IEM A;  1ACF A;  2ZLY A;  2UV0 E;  3A3D A;  1K25 A;  1BYW A;  4X56 A;  3ZG7 B;  5AVF A;  3CMZ A;  3NOU C;  4G3V A;  1TF1 A;  5A8B A;  3OPR A;  1PWD A;  1YMX A;  2Y2L A;  3DTI A;  1G28 A;  5HAI A;  3FKW A;  5E2H A;  4GW9 A;  4CLC D;  3PBO A;  1E3U D;  4P0M A;  1ZKJ A;  3UPN A;  1L3L A;  3E0Y A;  3C38 A;  1OME A;  2W1T A;  1ALQ A;  4LCL A;  3G2Y A;  1IEL A;  2PD7 A;  4LPZ A;  5FI7 A;  3HLD A;  1T19 A;  4B4X A;  1I5Q A;  4OKP A;  2IWD A;  4OON A;  2HDR A;  2OAP 1;  3EOI A;  4ARZ A;  1IYP A;  5I5L A;  3W8K A;  4LV3 A;  1OTB A;  3MFX A;  5FDH A;  3IXG A;  2XEP A;  5HWW A;  3KSG A;  4QY6 A;  1W8Y A;  3MJQ A;  4ZJ1 A;  2BG1 A;  3IF6 B;  5M1A A;  1H8M A;  3K2N A;  2A24 B;  3NI9 A;  2RCX A;  3NY4 A;  3DTK A;  1SZV A;  3RXX A;  4PKY A;  4QWO A;  1ERM A;  4Q0H A;  4RX2 A;  4E3N A;  4P87 A;  1LHY A;  2XGN A;  3BQ8 A;  2W1R A;  4OH0 A;  3S4X A;  4NKP A;  4OOM A;  3HUO A;  3C30 A;  2XA7 M;  3G30 A;  5IHV A;  4DE3 A;  4YFM A;  2VLG A;  1XKZ A;  2GDN A;  1YLY A;  1I2W A;  3LY4 A;  4NXE A;  4ZBE A;  1PNE A;  3Q1F A;  1JWV A;  1GA0 A;  4IUK A;  5LBR A;  2CC1 A;  1FR6 A;  1L0D A;  5F69 A;  2PRF A;  3ITB A;  1DJB A;  3JVV A;  5KZH A;  1K4F A;  3KSF A;  4ZAM A;  1K55 C;  2EX8 A;  3EGX C;  4WL9 A;  2I72 A;  1H8Z A;  1PWG A;  1LI9 A;  5DF9 A;  2R78 A;  4RVA A;  1YLP A;  2V20 A;  4EBL A;  1NWZ A;  3BFC A;  1TS7 A;  5G18 A;  2YKH A;  3A0S A;  4OQ0 A;  3LIA A;  2B95 A;  3OC2 A;  1M40 A;  1LI0 A;  1KE4 A;  1GSX A;  3W4P A;  2Y2M A;  3S7Q A;  2KX6 A;  3HVF A;  4X6T A;  3T1R A;  2BLS A;  1LSW A;  1XXM A;  4UA9 A;  3UE3 A;  3L7H A;  2Y55 A;  2WZX A;  4KQR A;  5AQ7 A;  5EM1 A;  5CGX A;  2VK3 A;  4CLC C;  4X1M A;  1FSY A;  1Q2Q A;  5CER A;  3HBR A;  1EW0 A;  3GDI A;  2V1Z A;  4X1L A;  2QWS A;  4JXS A;  1ERO A;  1BLP A;  1VB6 A;  5EVE A;  3BM6 A;  2ZC5 B;  2ZD8 A;  5EVI B;  1ESI A;  2QZ6 A;  4FOF A;  2Y2P A;  3IHB A;  3V5M A;  5GHY A;  2P9V B;  3T4K A;  4AFI A;  3IF5 A;  1IKG A;  4M4X A;  3HLG A;  3GSG A;  5TBM A;  3KYZ A;  4Q0I A;  4JGR A;  5AQ9 A;  3G34 A;  4S2O A;  4OLG A;  3HJI A;  3UB8 A;  2EXB A;  3WS2 A;  4OLD A;  3Q7Z A;  4E3J A;  3A3E A;  2KLI A;  3LI8 A;  3IQA A;  3OPH A;  2Y2Q A;  3HLC A;  1GSW A;  4C75 A;  4R4S A;  4EW7 A;  5FQM A;  1BLH A;  3F1P A;  1PIO A;  3WS5 A;  3BFG A;  4D60 A;  3IX3 A;  3LEQ A;  4Y0T A;  1HZO A;  4RA7 A;  2W3G A;  3TJZ C;  4EET B;  2C5W B;  3BFD A;  3MXS A;  4DXB A;  3HUM A;  5GLD A;  1DP6 A;  4PAU A;  2DCF A;  1E25 A;  2J9P A;  2O99 A;  3I7J A;  2HF6 A;  3WS4 A; 
#chains in the Genus database with same CATH homology
 4WZ5 C;  2FFY A;  2V2F F;  3IF6 A;  3OPP A;  4ZJ2 A;  1AXB A;  4IED A;  2WGW A;  3QNB A;  5F83 A;  1W79 A;  4GKU A;  2ZMA A;  3SS3 A;  2A3U A;  2Y2H A;  3IHA A;  3GVB A;  2RL3 A;  4HES A;  1H5X A;  3N7W A;  2EX2 A;  1BLS A;  3IT9 A;  4F94 A;  4ZDX A;  3WRZ A;  3JYI A;  3LO7 A;  5DF7 A;  3ZG0 A;  3C5A A;  1Z6F A;  4XUZ A;  3N8S A;  3GQZ A;  4DRT A;  1GHM A;  2Y2G A;  3M2K A;  2XFT A;  1NZO A;  3M2J A;  4RYE A;  4QJG A;  4WMC A;  2UWX A;  1SDE A;  4S2I A;  2ZQD A;  1KVM A;  4RX3 A;  3PAG A;  1G68 A;  5AQB A;  4EWF A;  3N8R A;  4R0Q A;  1O07 A;  2H10 A;  3BLS A;  1KE0 A;  4K91 A;  4KZA A;  3ISG A;  1ES2 A;  4LCM A;  1BLC A;  5F82 A;  5GLC A;  1H8Y A;  4B88 A;  4CPK A;  2Y59 A;  4BJP A;  5L2F A;  4R1G A;  4KZ7 A;  2Y91 A;  3FZC A;  1RGY A;  1KGF A;  3CG5 A;  3UDF A;  3Q81 A;  1WYC A;  4S2N C;  4S2M A;  3BRM A;  3V39 A;  1CI9 A;  4R23 A;  4X68 A;  5U47 A;  1W7F A;  4IBX A;  4GOG A;  5TFQ A;  1KDS A;  1PZO A;  1PZP A;  3D4F A;  2JCH A;  4KG5 A;  3LCE A;  4JBF A;  4OQH A;  1LL9 A;  1CI8 A;  3VMA A;  4DF6 A;  3PBR A;  3ZGA B;  1MXO A;  2HP9 A;  4WYY A;  1IYO A;  4H8R A;  4OOY A;  3WS1 A;  5FSR A;  3IXD A;  5HAQ A;  4M3K A;  3VFF A;  3UE0 A;  1YLJ A;  5E2F A;  3MKF A;  4PM8 A;  3A3I A;  2FFF B;  3CZD A;  3WS0 A;  5CHJ A;  1EWZ A;  1ZC2 A;  1MWU A;  1PW8 A;  2XLN A;  3ZVW A;  2ZQ9 A;  2WZZ A;  4IBR A;  2Z2L B;  4A5R A;  3VOZ A;  4QY5 A;  4MBK A;  1LLB A;  4BQM A;  4KG2 A;  5EUA A;  3PBT A;  1ZG6 A;  3QHY A;  4Y0O A;  5FAP A;  4U0T A;  2G2U A;  1BUL A;  1FR1 A;  4CJN A;  3GV9 A;  5A92 A;  1GA9 A;  1GCE A;  3WWX A;  4QD4 A;  5HFO A;  2XR0 A;  3ZHH A;  5A90 A;  5D3O A;  3OCN A;  1BZA A;  3HLE A;  4OVD A;  3ZG9 B;  1C3B A;  2EX6 A;  5EOE A;  3S22 A;  4JXW A;  1O7E A;  2VGK A;  1FOF A;  1K4E A;  1S6R A;  3ZNY A;  4Z9Q A;  3ZCZ A;  4GZB A;  3ZVT A;  3ZG5 A;  4N9K A;  2H5S A;  4UAA A;  5CRF A;  2HP6 A;  1KE3 A;  3UE1 A;  3G35 A;  4P85 A;  1NZU A;  1ESU A;  4E3O A;  4EBP A;  2XFS A;  3IXB A;  1NRF A;  4BD1 A;  2Q9M A;  4FSF A;  1FQG A;  3Q07 A;  4JF6 A;  4BL2 A;  4EUZ A;  3FYZ A;  1XX2 A;  4KZ5 A;  3C7V A;  2IWB A;  3BYD A;  1KGE A;  3HLB A;  5E43 A;  1SKF A;  2HDU A;  5EOO A;  2X02 A;  4DXC A;  4Y7P A;  2OLU A;  1K38 A;  3SH9 A;  1MWT A;  5TGF A;  2ZQ7 A;  2XDM A;  1K56 D;  2ZQA A;  1DJC A;  5HAR A;  3ZG8 B;  5J8X A;  4BLM A;  3MZD A;  1MKI A;  4WEK A;  1KDW A;  5CTN A;  3FV7 A;  1IEM A;  1YQS A;  2ZLY A;  2XD1 A;  4GN2 A;  5E2G A;  1YT4 A;  2ZM8 A;  3A3D A;  5GLA A;  2OLV A;  2J8Y A;  2Z2M B;  4B4Z A;  1K25 A;  5GHX A;  5DTS A;  5EVI A;  4X56 A;  3ZG7 B;  4EV4 A;  1PI5 A;  2A49 A;  4KEN B;  3CMZ A;  3Q7V B;  3NBL A;  3OPR A;  3DWK A;  1PWD A;  5A91 A;  1YLW A;  1YMX A;  2Y2L A;  3IF6 C;  5EVI C;  3RJU A;  1ERQ A;  3PBQ A;  1U60 A;  3A3F A;  2P9V A;  2ZC6 B;  1GHI A;  5HAI A;  3GRJ A;  2X01 A;  4R3B A;  4OQI A;  5A93 A;  2X71 A;  4EBN A;  4WEJ A;  4Y0U A;  3FKW A;  5E2H A;  1ES3 A;  1Y54 A;  5FI6 A;  3PBO A;  1E3U D;  1N9B A;  4P0M A;  3HUN A;  4O7D A;  1ZKJ A;  3UPN A;  4QU3 A;  4WZ4 A;  2DRW A;  1PW1 A;  1OME A;  5AQA A;  4KZ8 A;  1ALQ A;  4LCL A;  1PI4 A;  3G2Y A;  4YIN A;  1IEL A;  2WAE A;  1YMS A;  5FI7 A;  3Q82 A;  4GD6 A;  4LEN A;  4PM9 A;  3HLD A;  4XUX A;  3IWQ A;  4OPY A;  2G2W A;  2ZC7 A;  3SS4 A;  3G31 A;  4B4X A;  4E3K A;  3DW0 A;  1DY6 A;  3A3J A;  1I5Q A;  1S0W A;  1CK3 A;  3BFE A;  4KZB A;  4OKP A;  2IWD A;  4OON A;  5CGW A;  5HW3 A;  2HDR A;  4OPR A;  3WRT A;  1IYP A;  2J9O A;  1YLT A;  3W8K A;  3RXW A;  1K54 A;  4LV3 A;  4KQQ A;  3TG9 A;  1Q2P A;  5FDH A;  3VP3 A;  3IXG A;  3IH9 A;  5EEC A;  1L2S A;  5FQQ A;  3UPO A;  2XEP A;  1K54 C;  2JE5 A;  1K6S A;  4QY6 A;  3O87 A;  1W8Y A;  2Y2J A;  4JXG A;  4ZJ1 A;  2BG1 A;  3IF6 B;  5M1A A;  3ZDJ A;  4EQI A;  3IXH A;  2WGW B;  3AGE A;  4OPQ A;  3NI9 A;  1L0F A;  2RCX A;  1L0G A;  3NY4 A;  3NDG A;  1NXY A;  3VP4 A;  4FD8 A;  3N8L A;  3OCL A;  4MBH A;  4IVI A;  4JF5 A;  1SHV A;  3W4Q A;  1RP5 A;  3RXX A;  3SS5 A;  4U3T A;  4KZ3 A;  3VP1 A;  2XF3 A;  1ERM A;  1BUE A;  1K6R A;  1FCO A;  4RX2 A;  1VM1 A;  4E3N A;  4FCF A;  4P6B A;  4P87 A;  2OV5 A;  1BSG A;  1LHY A;  2XGN A;  1FCN A;  2HPB A;  1IYS A;  2J7V A;  4UHU A;  4OH0 A;  2B5R A;  3LEZ A;  3S4X A;  2ZQ8 A;  3UDI A;  4OOM A;  3HUO A;  3SOI A;  3AGF A;  1JTG A;  1SCW A;  4GD8 A;  2HDQ A;  4DE2 A;  1NY0 A;  3G30 A;  1JWZ A;  3IWO A;  2Y2O A;  5HX9 A;  4YFM A;  1G6A A;  5IHV A;  4DE3 A;  1XKZ A;  2GDN A;  5FQJ A;  5EE8 A;  1RCJ A;  1YLY A;  1I2W A;  3G32 A;  3LY4 A;  4X55 A;  5M19 A;  1XA1 A;  4LV1 A;  3EQU A;  5CXW A;  3VSL A;  4OP8 A;  1QME A;  2ZJ9 A;  3EQV A;  5CEB A;  5FQ9 A;  3FWL A;  4KZ6 A;  1TVF A;  3MBZ A;  4ZBE A;  4R4R A;  1ES5 A;  1MPL A;  3Q1F A;  1JWV A;  2XH9 A;  1E4D A;  4ZTK A;  3UY6 A;  5CEC A;  4KZ9 A;  1GA0 A;  2ZC4 B;  3PBS A;  3VFH A;  4XXR A;  1MY8 A;  4OPZ A;  5CGS A;  1BT5 A;  1BTL A;  2WAD A;  4N1H A;  3V3S A;  5EVL A;  2CC1 A;  4HBU A;  4N9L A;  1FR6 A;  4DDS A;  1L0D A;  5I94 A;  2EXA A;  1JTD A;  2P74 A;  3MKE A;  3GMW A;  1LL5 A;  3UO9 A;  2WKE A;  3ITB A;  4GB7 A;  1DJB A;  1K55 A;  4NET A;  5FAS A;  4LV0 A;  5FQI A;  3N4I A;  4PM7 A;  5KZH A;  2H0Y A;  4R3J A;  1K4F A;  3O3V A;  4HBT A;  4X53 A;  3TSG A;  4ZAM A;  1K55 C;  2Y4A A;  2EX8 A;  3V50 A;  2I72 A;  3O86 A;  2DNS A;  2ZM2 A;  1H8Z A;  1PYY A;  3E2K A;  3MZE A;  2EX9 A;  4OQG A;  1PWG A;  1K56 A;  1LI9 A;  4GDN A;  5DF9 A;  3NC8 A;  3P98 A;  5JYO A;  4RVA A;  1YLP A;  2V20 A;  4EBL A;  3OZH A;  4UA7 A;  3PBN A;  1ZG4 A;  3BFC A;  2ZQC A;  1XGJ A;  4K0W A;  3DWZ A;  4PM6 A;  1XPB A;  2ZC3 B;  4GDB A;  4KZ4 A;  1NYY A;  1M6K A;  4WEL A;  5G18 A;  4E3L A;  1EI5 A;  4BD0 A;  1HVB A;  5CTM A;  1RGZ A;  5E2E A;  2HDS A;  3MXR A;  4UA6 A;  4OQ0 A;  4K0X A;  3VP2 A;  3BEC A;  3OC2 A;  2EFX A;  1M40 A;  1LI0 A;  5GL9 A;  1KE4 A;  1FSW A;  2ZM0 A;  2XQZ A;  4ID4 A;  3W4P A;  2WK0 A;  3BLM A;  2C6W B;  2WGI A;  2Y2I A;  2Y2M A;  1TDL A;  1K57 A;  3PAE A;  4PMA A;  3BEB A;  4HEF A;  4DE0 A;  1XGI A;  3HVF A;  1FCM A;  5F1G A;  3E2L A;  4JLF A;  4X6T A;  4Q8I A;  1K57 C;  2BLS A;  1XXM A;  1VQQ A;  3MZF A;  4JPM A;  4UA9 A;  4WMC D;  3UE3 A;  4DE1 A;  2R9X A;  1MBL A;  3QNC A;  4C3Q A;  2Y55 A;  1XP4 A;  1E3U A;  2WZX A;  2Q9N A;  4E3I A;  3M6H A;  2OSU A;  4KQR A;  4X69 A;  5AQ7 A;  5CGX A;  4KQO A;  3SH7 A;  5BOH A;  1FSY A;  3O88 A;  1TDG A;  2R9W A;  4FH4 A;  5TR7 A;  3VP0 A;  1Q2Q A;  5CED A;  5DF8 A;  1KVL A;  2PU2 A;  4N92 A;  5CHM A;  5CER A;  4BEN A;  5HL1 A;  3HBR A;  1SDN A;  4S2K A;  3UN7 A;  3ZNT A;  2V1Z A;  2JC7 A;  3IH8 A;  4GNU A;  1DJA A;  4OOL A;  4E6X A;  1IKI A;  1YLZ A;  4JXS A;  2H0T A;  2PBY A;  1ERO A;  2Y2K A;  3NIA A;  3M6B A;  1BLP A;  3HLF A;  3MFD A;  3BM6 A;  2E8I A;  4JKT A;  2ZC5 B;  3VSK A;  3ZFZ A;  2WAF A;  4S2N A;  2XK1 A;  1CEF A;  1HD8 A;  2ZD8 A;  5EVI B;  4WM9 A;  1ESI A;  2QZ6 A;  4QB8 A;  5FQK A;  2Y2P A;  3TOI A;  5HAP A;  3IHB A;  3C4P A;  1W8Q A;  4WBG A;  1L0E A;  1GHP A;  1YM1 A;  3AGD A;  1IYQ A;  1HTZ A;  2QMI A;  3V5M A;  3P09 A;  5GHY A;  2P9V B;  3B3X A;  1W5D A;  3C4O A;  3HLW A;  4MBF A;  3IF5 A;  1IKG A;  3LY3 A;  4OP5 A;  2Y2N A;  3HLG A;  3GSG A;  1ONH A;  3CJM A;  1MWS A;  5AQ9 A;  3G34 A;  3UNW A;  4KG6 A;  4MEZ A;  4S2O A;  2HP5 A;  1KGG A;  4OLG A;  4E6W A;  3V3R A;  2JBF A;  2WKH A;  1I2S A;  2EXB A;  3WS2 A;  1J9M A;  1NYM A;  4D2O A;  5DTK A;  4S2P A;  4ZJ3 A;  3UPP A;  4OLD A;  4PM5 A;  1NJ4 A;  3Q7Z A;  2WUQ A;  2QPN A;  3SH8 A;  3FKV A;  4IVK A;  4E3J A;  3A3E A;  1ES4 A;  5FA7 A;  3NDE A;  3Q7V A;  3IQA A;  4FH2 A;  3OPH A;  2Y2Q A;  5KMW A;  4DDY A;  3HLC A;  4PPR A;  1JWP A;  4C75 A;  2IWC A;  4R4S A;  3HL9 A;  5FQM A;  1BLH A;  5GHZ A;  1PIO A;  3WS5 A;  2WGV A;  3BFG A;  3IWI A;  2WYX A;  4NK3 A;  3OPL A;  4L0L A;  4C6Y A;  3ITA A;  3W4O A;  3N6I A;  4JXV A;  4QHC A;  4S2J A;  4Y0T A;  1HZO A;  1QMF A;  1JVJ A;  4RA7 A;  5JYP A;  3UDX A;  1WE4 A;  1ONG A;  3NCK A;  2EFU A;  2VGJ A;  4BL3 A;  5EPH A;  3BFF A;  3G4P A;  3G2Z A;  2C5W B;  2PU4 A;  3BFD A;  3DTM A;  5DVA A;  4JF4 A;  1PWC A;  4E3M A;  5M18 A;  5FAT A;  3MXS A;  4DXB A;  4MLL A;  3HUM A;  3S1Y A;  4S2L A;  5KSC A;  4DKI A;  5GLD A;  3PTE A;  1N4O A;  1XA7 A;  5F1F A;  2DCF A;  5KSH A;  1CEG A;  5EVI D;  2WKI A;  1E25 A;  3HRE A;  5CHU A;  2J9P A;  3C7U A;  4N1X A;  4U0X A;  5DTT A;  1MWR A;  3GR2 A;  1WYB A;  3I7J A;  2XD5 A;  4MNR A;  5GLB A;  3GTC A;  5FAO A;  4WZ5 A;  1TEM A;  4LV2 A;  3WS4 A;  5FAQ A;  3VOY A;  5FI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...