2A49A

Crystal structure of clavulanic acid bound to e166a variant of shv-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of the trans-Enamine Intermediates Formed by Sulbactam and Clavulanic Acid and E166A SHV-1 {beta}-Lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2a49A00
4KZ3A 3W8KA 4WEJA 1TVFA 3Q82A 3ZDJA 4QJGA 3PBTA 1CI8A 5AQ9A 1WYCA 1I2WA 4KQQA 5GL9A 3G34A 5M19A 5EVIC 4P87A 3BFDA 2WGVA 3MFDA 1PI4A 4Y7PA 3MKEA 4KG6A 1YQSA 3G31A 3O86A 4OH0A 2PBYA 4R4SA 2HP6A 2RL3A 4OPYA 3O3VA 5HARA 5G18A 4WM9A 1LLBA 2Y2LA 4DXCA 4DE3A 1QMFA 2Z2MB 3AGDA 1FCOA 3A3FA 4OP8A 3VSLA 2OSUA 1FCMA 4OOLA 4KG2A 2WYXA 3VP2A 3MBZA 2BLSA 4KZAA 4E3IA 5HAIA 1KE4A 1JTDA 1LL5A 4RX2A 1KGGA 1DY6A 4GDNA 4LENA 1NXYA 5FI2A 1YLZA 4S2LA 2Y4AA 5FI6A 5FQQA 3AGFA 4KG5A 2Y2MA 4LV1A 4N92A 4U3TA 3NY4A 1IYQA 1DJBA 3PBSA 4IBXA 3WS2A 3IWIA 3BRMA 1LI0A 2OLVA 4QU3A 5F82A 3G2YA 1NZUA 5E2HA 3IWQA 5EUAA 1S0WA 2ZC3B 4QHCA 2Y2OA 1CK3A 3ISGA 2IWDA 2JCHA 3UDFA 4KQRA 2Y2PA 2ZD8A 1K55A 3VP1A 2P74A 3OPRA 1ONHA 3DTMA 4PM6A 1KE0A 4X55A 3IF6B 5L2FA 3A3EA 4MEZA 3Q07A 1NRFA 1M40A 4R23A 3IXGA 3S1YA 3D4FA 2ZM0A 1RCJA 4OONA 3ZHHA 4P85A 4JLFA 1TEMA 3HLEA 3LO7A 1E4DA 4QD4A 5E2EA 2ZM2A 1FCNA 1NJ4A 1SDNA 2V2FF 1FSYA 1BLSA 1Z6FA 1IKGA 1ZG6A 3MXSA 1O07A 3M2JA 4M3KA 4X68A 5IHVA 3IXDA 4OQGA 2OV5A 5GHYA 1H5XA 2Y59A 3NBLA 3OCNA 4RYEA 3UO9A 2FFFB 2XGNA 4E3KA 4OVDA 3BECA 3SS5A 2WADA 3G30A 4GD6A 5FDHA 3RXWA 1K4EA 1ZG4A 1IYSA 2DNSA 4DRTA 3W4OA 4FD8A 4PM8A 5CEDA 5J8XA 3C4OA 1YLPA 5HL1A 3IXBA 3G35A 5HFOA 1KVMA 3N7WA 5CEBA 5KSCA 3RXXA 3TOIA 5EE8A 3ITAA 1K25A 4B88A 1G6AA 1L2SA 1XPBA 3FKWA 3UDXA 4CPKA 4ZJ3A 2GDNA 1K6RA 3HUOA 3HLWA 4IVIA 4PMAA 3MXRA 3UNWA 4BL2A 4U0XA 1HZOA 2EX9A 4JXGA 3IXHA 4OLGA 3FKVA 4S2JA 2HPBA 3ITBA 4HBTA 4KZ5A 4OOMA 3NI9A 2Y2IA 3UPOA 1KVLA 5A91A 5FI7A 2WGIA 1ALQA 1O7EA 3VOYA 4R1GA 1ESUA 4DDSA 3OPHA 2XQZA 4S2MA 3ZGAB 3ZFZA 3LCEA 2Y2JA 4BD1A 5KSHA 3Q7VB 4KQOA 1PI5A 3FZCA 3UDIA 3M2KA 1YLWA 3N8RA 4F94A 3AGEA 4E3NA 1H8ZA 2IWCA 4WZ5C 4MBKA 3S4XA 2G2UA 4UA9A 3BFEA 3ZVWA 1LI9A 3BFFA 4JXSA 1FSWA 3QNCA 5E43A 5CHJA 3TSGA 2EXBA 3CMZA 1LHYA 2ZQDA 3ZG7B 3VOZA 4EWFA 1BT5A 1HVBA 1OMEA 1PW8A 3NDEA 2ZC6B 1L0FA 3CG5A 1IYOA 3E2LA 3P98A 3WS0A 4EUZA 1AXBA 1PWGA 3C4PA 3MZFA 3QNBA 1YLTA 3IF6C 1W5DA 5U47A 1CEFA 1YMSA 3M6HA 4HBUA 4HESA 4ZDXA 4IEDA 3G32A 4QY5A 3W4PA 4X53A 4FSFA 4E6XA 1XX2A 1KDSA 1Q2PA 3UY6A 4EBNA 3PBNA 4WMCA 5D3OA 1SCWA 3GQZA 4YINA 4LV2A 3V5MA 5TGFA 4XUZA 1PZPA 4GB7A 4WZ4A 2XR0A 1K38A 1K55C 5AQ7A 5FATA 5EVIB 4C3QA 1RGYA 3HREA 1JWVA 4DE1A 4K0WA 2Y2QA 4Q8IA 4ZAMA 3WWXA 1K57C 3GRJA 1EWZA 2EXAA 4ZBEA 2Q9MA 1XKZA 1WE4A 5KZHA 2V1ZA 1IKIA 5F83A 2WGWA 3PBOA 4PM9A 3HLDA 2C5WB 2J9OA 3FV7A 3HUMA 4D2OA 3IH8A 2CC1A 3JYIA 2WZXA 3IT9A 2WGWB 2Y2GA 4DF6A 3N8LA 5DTKA 2H0TA 3FWLA 1HD8A 4KZ8A 5AQAA 4LV3A 3NCKA 1ES2A 2J8YA 5DTSA 1GHMA 1BLPA 4OPRA 1ES3A 4BD0A 1L0DA 3WRTA 4JKTA 5EECA 4QY6A 4Y0UA 2I72A 2HP5A 2V20A 2ZC4B 1K56D 2P9VA 3N8SA 3UN7A 2ZQ7A 4WYYA 5JYOA 1FR1A 1XA7A 3VSKA 1MBLA 4EBLA 3OC2A 5GLCA 1KDWA 4JPMA 4UA7A 3SOIA 3V3RA 1GCEA 2WAFA 2WZZA 4XUXA 3OPLA 3BFGA 1U60A 1K54C 5FAOA 2QMIA 1W8YA 3BLMA 4DKIA 1K57A 3BEBA 3CJMA 3EQVA 5E2GA 2VGKA 3IF5A 5DF7A 1BSGA 3C7VA 3EQUA 3G2ZA 2HDUA 5I94A 3HLBA 1SKFA 3I7JA 2HDRA 4N1XA 3WS4A 1GA9A 4EV4A 4WMCD 3GMWA 4R0QA 4N1HA 3V39A 1CI9A 2H10A 1NY0A 4H8RA 1IEMA 4C75A 3PBQA 3G4PA 5FSRA 3ZVTA 1VQQA 2WK0A 3BFCA 5CECA 4WBGA 2EFUA 2JE5A 1K6SA 3GTCA 1ONGA 2E8IA 4WZ5A 3IHBA 3PBRA 4EQIA 5GLAA 2P9VB 3B3XA 3UE1A 1SHVA 3ZG5A 5KMWA 4UAAA 1FR6A 3ZNTA 1ERMA 3NIAA 5A93A 3UPNA 5EOOA 5M18A 4KZ6A 4JF6A 2Y55A 5DF9A 2QZ6A 1L0EA 4WELA 4PM7A 3ZG0A 1XA1A 5FQ9A 4FH2A 5DF8A 4LCMA 1HTZA 5GLBA 2ZQCA 1DJAA 2Y2NA 2Z2LB 4P6BA 4RX3A 1K4FA 3IF6A 3UE0A 4GOGA 4MNRA 4R3JA 5F1FA 2OLUA 3Q7VA 1GA0A 3LY3A 4IBRA 3N4IA 2X01A 1ES4A 4RVAA 4CJNA 1WYBA 1MWRA 3WS5A 2R9XA 2XFTA 3OZHA 5EOEA 4R4RA 5TR7A 4P0MA 5CTNA 4DE2A 1KE3A 1QMEA 3MKFA 3WS1A 3VFFA 4BL3A 3HUNA 1I5QA 5FASA 1BZAA 1GHIA 1KGEA 5GLDA 4PM5A 5CGWA 5EPHA 1YT4A 3IH9A 3OCLA 1BUEA 2H5SA 2ZQ8A 3ZG8B 1W7FA 4X56A 3VP3A 1E3UA 2RCXA 3A3JA 4A5RA 2EX8A 5CTMA 2XEPA 3NDGA 2ZM8A 1Y54A 4BENA 1JWZA 2C6WB 1PIOA 1RGZA 1ERQA 1S6RA 1CEGA 3C7UA 3LEZA 4S2KA 1J9MA 4GZBA 4EBPA 5CERA 5GHXA 5E2FA 3MZEA 4S2NC 1MKIA 2B5RA 3A3IA 2XK1A 3IQAA 1BLHA 2X02A 2ZMAA 3BLSA 2ZQAA 1YLJA 1N4OA 3P09A 1XGJA 1NYMA 3HL9A 4LCLA 4RA7A 5HX9A 4MLLA 1BTLA 5FQMA 4UHUA 2DRWA 5TFQA 5JYPA 3C5AA 3HLCA 4Y0TA 4ID4A 5EVLA 1BLCA 1W79A 3IWOA 4K0XA 5CXWA 1YMXA 5HAQA 1TDLA 3ZCZA 3VMAA 2X71A 3Q81A 1JWPA 5A92A 2XF3A 4DXBA 4ZJ1A 1PYYA 4E3JA 2EX2A 5FQKA 1MWUA 3ZG9B 3CZDA 5FAQA 1E25A 2EX6A 4OPQA 3SH9A 3HVFA 3Q7ZA 1E3UD 2EFXA 4E6WA 3MZDA 1TDGA 2A3UA 3HBRA 1K54A 3N6IA 4NK3A 1XXMA 4JF5A 4S2PA 5FQIA 3SH7A 4JXWA 4UA6A 5EVID 1GHPA 4GNUA 2H0YA 3OPPA 2BG1A 5A90A 2J9PA 4N9KA 5AQBA 1YLYA 4B4XA 4OQHA 4B4ZA 2XH9A 3VP4A 2JBFA 2QPNA 5FAPA 2HDQA 3SH8A 5M1AA 2Y2KA 4C6YA 4KENB 4S2IA 4Y0OA 4QB8A 1PWDA 3A3DA 1C3BA 3DWKA 2ZLYA 5CHMA 1M6KA 3O88A 3M6BA 5CHUA 4NETA 1L0GA 4S2NA 2A49A 4HEFA 1MWSA 2Y91A 1XP4A 5HAPA 4OQ0A 2R9WA 1EROA 3V50A 1K56A 1MWTA 1XGIA 2ZQ9A 3DW0A 4KZ4A 1JVJA 4R3BA 5GHZA 3GR2A 4BJPA 4GD8A 4KZ9A 2WKIA 2XFSA 1PWCA 2XLNA 2JC7A 4GKUA 2WKEA 4X6TA 3HLFA 2XD1A 3BM6A 4S2OA 4OQIA 4X69A 4E3OA 3ZNYA 4KZBA 5CGSA 2IWBA 3GSGA 1DJCA 4Z9QA 3VP0A 4K91A 1H8YA 1YM1A 3PTEA 1RP5A 1LL9A 1MY8A 4OKPA 2UWXA 4IVKA 4PPRA 3DWZA 4KZ7A 4E3LA 4LV0A 3FYZA 5F1GA 2FFYA 3V3SA 3SS3A 1ZC2A 4OOYA 5CGXA 2PU2A 1NZOA 4OLDA 2HDSA 5FA7A 1SDEA 3NC8A 4XXRA 3PAEA 2ZJ9A 4WEKA 4OPZA 4L0LA 3TG9A 3W4QA 1IYPA 4O7DA 4YFMA 4ZJ2A 1ESIA 3PAGA 2VGJA 3Q1FA 4OP5A 5EVIA 4ZTKA 1KGFA 4N9LA 3WRZA 4FCFA 3GV9A 3IHAA 3VFHA 1PW1A 1BULA 5FQJA 1N9BA 1Q2QA 3HLGA 3LY4A 4FH4A 1IELA 1VM1A 1W8QA 2XDMA 4JF4A 2ZC7A 4BQMA 1PZOA 4GN2A 1FOFA 2XD5A 3SS4A 2G2WA 2DCFA 3QHYA 4DDYA 2WUQA 3O87A 2Y2HA 4GDBA 2WAEA 2ZC5B 2WKHA 4DE0A 1FQGA 3GVBA 5DVAA 5DTTA 3BYDA 1G68A 2Q9NA 5BOHA 4MBHA 3S22A 1ZKJA 1MXOA 3UE3A 1ES5A 4JXVA 1I2SA 4E3MA 5CRFA 1EI5A 2J7VA 2PU4A 5HW3A 1JTGA 2HP9A 1MPLA 4JBFA 3E2KA 4MBFA 4BLMA 4U0TA 3RJUA 1NYYA 3UPPA
chains in the Genus database with same CATH superfamily
4WEJA 3LYXA 3ZDJA 4H6JA 3DAVA 3B47A 5GL9A 3G34A 5IU1A 2VV6A 5DKLA 3O86A 4OH0A 2PBYA 2HP6A 4OPYA 5HARA 1OJGA 4X25A 1TS8A 1QMFA 3AGDA 3JVVA 3VSLA 2B18A 3MXQA 3R7WB 3FPWA 5G4YA 2BLSA 5CX7A 5FI2A 2JN7A 5F69A 2YKHA 1IYQA 3WS2A 2JKFA 2OLVA 1YPRA 4QU3A 2Y2OA 3MS6A 2OAP1 1K55A 3KSHA 3OPRA 2PYPA 3EEHA 1FSYA 1T1AA 1Z6FA 1IKGA 5A8BA 3FG8A 4M3KA 3BJNA 1TS0A 3QP8A 5K5BA 4CLCC 4ARZA 3UO9A 2KX6A 2FFFB 4OVDA 3BECA 2WADA 2VGLS 4DN0A 1ZG4A 1IYSA 2DNSA 4FD8A 3C4OA 3PHYA 1G6OA 5HD3A 3IXBA 5HFOA 1KVMA 4EXOA 1XPBA 3QP1A 3IS2B 5FDSA 2EX9A 4JXGA 3IXHA 3T4JA 4O01A 3KYEA 3ITBA 2PR6A 3UPOA 3LUQA 5A91A 5FI7A 2WGIA 1ALQA 3HJKA 3VE3A 2XQZA 4BD1A 3F1PA 3Q7VB 3UDIA 2A24A 1YLWA 4E3NA 2PRFA 1H8ZA 4WZ5C 3UB7A 2G2UA 1LI9A 5CHJA 2W1TA 3ZG7B 1OMEA 3KSGA 1L0FA 5HD5A 3WS0A 1PWGA 3MZFA 1SZVA 1YLTA 1W5DA 3NOUC 1CEFA 4HBUA 4IEDA 3G32A 1YSQA 2V9AA 2J80A 2JKRM 3EGXC 4YINA 3W2ZA 1S4RA 4C3QA 1H3QA 3CITA 3HREA 3U2AA 2XRNA 4Q0JA 4ZAMA 1P9WA 3QP6A 1IKIA 5F83A 1YSPA 5MC7A 3PBOA 1LSWA 4AFIA 3FV7A 3HUMA 3OBFA 3BQ8A 1PRQA 5FL3A 3JYIA 2Y2GA 2FH5A 4IUKA 1F2KA 1ES2A 2J8YA 5HSQA 5DTSA 1GHMA 1YAXA 1ES3A 3WRTA 4QY6A 3JVUA 3HJIA 2I72A 4NEED 1D06A 2ZC4B 3N8SA 5HZHA 4WYYA 1XA7A 4YWZA 1S66L 1KDWA 4JPMA 3T1SA 1LT0A 1K54C 2QMIA 3OLOA 4R70A 1W8YA 4PHTA 4DKIA 3BEBA 3KSFA 5E2GA 4EERA 3T4LA 1ZTUA 1BSGA 1Z09A 3UMEA 4N1HA 5EM0A 1CI9A 4H8RA 4C75A 3PBQA 4EEPA 3BFCA 5AVEA 2INWA 2JE5A 4IHQA 2E8IA 4EQIA 1N9OA 2P9VB 3BWLA 2XSSA 5EOOA 4JF6A 1T1BA 3H82A 1NLYA 1L0EA 4WELA 3ZG0A 3S7NA 1XA1A 2W1RA 4FH2A 4GS9A 3QP5A 4LCMA 1HTZA 5GLBA 2Y2NA 2Z2LB 4P6BA 4ZRRA 3IF6A 2OLUA 3LFVA 3Q7VA 1GA0A 2X01A 4RVAA 5EFWA 3WS5A 5EOEA 4R4RA 5TR7A 4P0MA 5CTNA 4HY8A 1KE3A 3MKFA 3HUNA 5GLDA 3EOIA 5CGWA 1F98A 3IH9A 1BUEA 1W7FA 1XJ2A 4A5RA 3A3JA 2WKQA 2QKPA 5HL6A 1JWZA 1J9MA 5E2FA 2B5RA 1N4OA 5F6AA 3HL9A 1UGUA 5FQMA 4EETB 3HLCA 3T4OA 1K0KA 1GSVA 4K0XA 1TDLA 3ZCZA 3VMAA 2X71A 5A92A 2EX2A 4CLCD 3ZG9B 2EX6A 3EWKA 1E3UD 2EFXA 2A3UA 3SH7A 4S2PA 4MN5A 3HBRA 4JXWA 4UA6A 4GNUA 2KOIA 5AQBA 1YLYA 2W3HA 4B4ZA 2XA7M 2Y2KA 4CQHA 1C3BA 3NHQA 4I3AA 5CHMA 4ETZA 4F3LA 3M6BA 2GNXA 2Y91A 2A24B 2W3FA 5HAPA 3V50A 2ZQ9A 3DW0A 4I3JA 3DTKA 4KZ9A 1PWCA 5FEFA 2XLNA 3O5YA 5J7EA 3LI8A 3C2WA 4E3OA 3ZNYA 2PR5A 4O8GA 3VP0A 1YM1A 3E98A 1RP5A 1LL9A 1MY8A 4IVKA 4PPRA 4LV0A 3CPTB 3BW6A 2PU2A 1NZOA 3NC8A 5AJGA 4ZJ2A 3PAGA 3GECA 1CQAA 4DJ3A 1KGFA 4IUHA 4HJ4A 4LRZE 4FCFA 3S7QA 3IHAA 3WRZA 5FQJA 1BYWA 1VM1A 2K7SA 2DCFA 3MF0A 2Y2HA 4GDBA 2V0UA 1G68A 3BQAA 3GDIA 4Y15A 5HWWA 4E3MA 3L9KA 1JTGA 4UQIS 4JBFA 5HWTA 3UPPA 3Q82A 1LSXA 1J3WA 4YOFA 1WYCA 3E0YA 4Y17A 3KO6A 2WGVA 2ZL1A 1PI4A 3MKEA 4GCZA 4R4SA 5TBMB 3O3VA 5G18A 3RTYA 5HPIA 2Y2LA 4DXCA 5J3WA 4DE3A 4WLAA 4OOLA 2WYXA 3C30A 3VP2A 1TD5A 5HAIA 5HDCA 3U4LP 1JTDA 1D1JA 1DY6A 4GDNA 2BASA 1YLZA 2Y4AA 5FQQA 2Y2MA 3NY4A 5F82A 3G2YA 2HV1A 3NOTC 5E2HA 5EUAA 2OOLA 2ZC3B 4QHCA 1CK3A 2IWDA 1YKDA 4KUKA 4GJ4A 1ONHA 3DTMA 4PM6A 3IF6B 4MEZA 4R23A 1NRFA 1M40A 3S1YA 3D4FA 3ZHHA 4B93A 2W3EA 3LO7A 1W63M 2ZM2A 1NJ4A 1SDNA 3TRCA 1ZG6A 3M2JA 4X68A 1OJ5A 1NWZA 3IXDA 5IHVA 1Y28A 3F1OB 3MJQA 3NBLA 3OCNA 1TS6A 3TJZC 3CHWP 4E3KA 4XT2B 4NXGA 5CEDA 1YLPA 3S7OA 3N7WA 5CEBA 2V1BA 3RXXA 5EE8A 3ITAA 2W1TB 4B88A 4JGOA 5EVEA 4CPKA 3LIBA 4ZJ3A 3HUOA 3HLWA 3MXRA 3UNWA 4G3KA 1HZOA 3FKVA 3LIEA 2HPBA 1JNUA 3BY9A 3QP2A 4HBTA 4KZ5A 3L7HA 2Y2IA 3NI9A 4IJGA 4ESPA 4FUWA 2ACGA 2EWVA 4O0PA 3AGEA 3KX0X 2HJ9C 3QNCA 2P7JA 1BT5A 3NDEA 3VOLA 2ZC6B 1IYOA 3LIDA 5L07A 3QNBA 3IF6C 5U47A 4QY5A 5HDSA 4E6XA 1XX2A 1KDSA 1Q2PA 1T18A 4WMCA 5D3OA 3V5MA 3MQ0A 4XUZA 5EVIB 1JWVA 2Y2QA 3GRJA 1EWZA 4P6ZS 2Q9MA 2EWWA 5KZHA 2WGWA 4PM9A 3HLDA 2O0YA 2WKRA 5G4ZA 3UB6A 1GSWA 2CC1A 3IT9A 2D01A 2H0TA 4I5SA 4KZ8A 5AQAA 4LV3A 4M4XA 3NCKA 2P9VA 4CLCB 3UN7A 2ZQ7A 5JYOA 1FR1A 1VETA 3VSKA 1OTEA 4EBLA 3OC2A 5GLCA 3H82B 4NXFA 1GCEA 2WAFA 2WZZA 3OPLA 3BFGA 2QWSA 3F1NB 3F1OA 1K57A 2NUPC 3CJMA 3EQVA 1XFQA 3IF5A 1IFQA 3EGDC 3EQUA 1SKFA 3I7JA 3ZYTA 3UE6A 1V9ZA 4N1XA 3WS4A 3S7PA 3B42A 4JGRA 3V39A 2H10A 2GX5A 3CWFA 3NECA 4WN5A 5FSRA 2WK0A 2O9BA 1WA9A 3DTIA 2EFUA 3IHBA 1SHVA 1Y4OA 5M18A 4D60A 5DF9A 3SW1A 2JKRI 4FOFA 2VJWA 3OOVA 2PD8A 1K4FA 3IX8A 4PAUA 4R3JA 2J3WA 1F5MA 3LY3A 4EU0A 4L9FA 1MC0A 2R78A 2VLGA 1WYBA 1SKOA 1VB6A 2Q0OA 1QMEA 3WS1A 4BL3A 1I5QA 2E8JA 3RFBA 4B9OA 1NLZA 2XA7S 3UB8A 4BENA 1PIOA 3LEZA 5DFXA 4GZBA 1PNEA 3P7NA 5CERA 1BLHA 2ZMAA 5HX9A 2ZQAA 4LCLA 2A2LA 1BTLA 2ZOHA 4UHUA 5JYPA 2ZL1B 3IBJA 5AVFA 3Q81A 4E3JA 1ODVA 5FQKA 1E25A 1TS7A 3HVFA 2OWJA 4E6WA 4G3WA 4NK3A 1XXMA 5EVID 3K3CA 4LRYC 3CAXA 5A90A 2J9PA 4HQAA 3CPTA 2HZ5A 3VP4A 2HDQA 3SH8A 4KENB 4Y0OA 2QJ7A 4MMNA 4QB8A 3ULFA 3DWKA 2ZLYA 4FTXA 5CHUA 1L0GA 4S2NA 4HEFA 2J3TC 3UB9A 4OQ0A 4DJ2A 1EROA 1K56A 1XGIA 5TBMA 5L09A 4KZ4A 4R3BA 4QWOA 4BJPA 2WKIA 2XFSA 4R3AA 2V8FA 1CF0A 1UWNX 4X6TA 3HLFA 2JKGA 3BM6A 4X69A 4KZBA 2UV0E 5CGSA 1DJCA 2PBDP 4OKPA 4KZ7A 4HP4A 3V3SA 4OOYA 4OPZA 1IYPA 2LB5A 4O7DA 2VA0A 5EVIA 4N9LA 2M7UA 3JPUA 3GV9A 3VFHA 1BULA 1N9BA 3HLGA 3LY4A 4FH4A 2V0WA 2XDMA 2ZC7A 4GN2A 1FOFA 4DDYA 5I5LA 3O87A 2WAEA 4EQ1A 4LFUA 2K2NA 5DVAA 5DTTA 2Q9NA 5BOHA 4MBHA 3S22A 3UE3A 1UWPX 5HW3A 3MSHA 2PU4A 3UB5P 4WF0A 4MBFA 4BLMA 1OTAA 3H7WB 3W8KA 1TVFA 4HH2A 3KYQA 1I2WA 4KQQA 2Y8HA 4Q0HA 3T4TA 4P87A 3BFDA 3MFDA 2MJ6A 3F1NA 4Y7PA 4KG6A 1YQSA 3G31A 3T1XA 1LL8A 2RL3A 2PYRA 3PXPA 1DP6A 5EM1A 3P01A 4OP8A 1FCOA 1HLUP 2OSUA 4KG2A 3MBZA 4E3IA 4RX2A 3T12B 3FC7A 3DBAA 4S2LA 5FI6A 2VV8A 4N92A 4LV1A 1OTDA 3PBSA 4BBUA 2VK3A 4XT2A 1NZUA 3MQQA 3CI6A 4R6LA 2GZAA 1S0WA 3ISGA 2JCHA 3UDFA 4KQDA 2Y2PA 4KQRA 2ZD8A 3NJAA 3VP1A 3CUEA 2P74A 3PR6A 3MFXA 4X55A 4NXBA 5J4EA 5L2FA 2Y79A 3IXGA 1N9LA 2ZM0A 5DJTA 4OONA 4QD4A 1FCNA 2V2FF 2W3GA 3A0SA 1ACFA 4PKYA 2P08A 4LPZA 3SZTA 5HPFA 2Y59A 4RYEA 3G30A 4DRTA 5FDHA 1K4EA 3A0VA 4PM8A 5J8XA 3IS2A 5HL1A 3LIAA 5KSCA 2K31A 4P6ZM 1G6AA 3UDXA 1K6RA 4QPRA 4GHIA 4BL2A 4U0XA 1H8MA 2NUTC 2OWHA 1MKMA 4S2JA 2PHYA 2AVXA 2VGLM 1O7EA 3VOYA 4HI4A 4S2MA 3ZFZA 3LCEA 2Y2JA 2W27A 2P04A 4KQOA 1PI5A 3N8RA 3MMHA 2Z6CA 3FPVA 1L3LA 1ZHHB 4MBKA 4UA9A 3ZVWA 4JXSA 1FSWA 5E43A 3TSGA 5DJUA 3CMZA 2KDKA 1LHYA 2ZQDA 4EWFA 1HVBA 4MN6A 3CG5A 3P98A 3E2LA 4EUZA 3C4PA 4ZDXA 4HESA 4Y3IA 3W4PA 4X53A 3ZQ5A 4EBNA 3UY6A 3B33A 1PFLA 3IX3A 1SCWA 3GQZA 4LV2A 4X1LA 1PZPA 4GB7A 4WZ4A 5FATA 5AQ7A 3C38A 1RGYA 5F68A 2ZMVA 3WWXA 5C5KA 1T19A 2EXAA 4HIAA 4ZBEA 5FEGA 1DRMA 2C5WB 2J9OA 4Q0IA 3LR0A 3NULA 1G28A 3IX4A 3IH8A 2WZXA 4DF6A 5DTKA 1HD8A 3T50A 4OPRA 4BD0A 4JKTA 5DFYA 4X1MA 2V20A 4L9EA 3K2NA 4UA7A 3V3RA 4XUXA 1U60A 3BLMA 1FILA 3C7VA 4LLOB 2HDUA 2ZBBA 4GW9A 2B02A 2BTFP 2HDRA 3V67A 4EV4A 5HWVA 5IS1A 3GMWA 4R0QA 1NY0A 1IEMA 4MDZA 3ZVTA 5CECA 4JGQA 1ONGA 4WZ5A 3A0RA 3PBRA 5GLAA 3B3XA 1S1ZA 2HJEA 1OTBA 3DTEA 5A93A 5FQ9A 4E04A 2HF6A 4JGPA 2G7UA 3UE0A 3LR5A 3T1RA 4GOGA 4MNRA 3VV4A 5F1FA 1ES4A 4CLCE 4CJNA 4BBTA 1MWRA 1NRJA 1V9YA 3MR0A 4UQIM 2KLIA 4DE2A 5FASA 1KGEA 1GHIA 1YT4A 4X56A 1S1YA 3VP3A 2EX8A 3NDGA 2ZM8A 2H28A 2M7VA 5IT5A 2O9CA 3K3DA 1ERQA 3C7UA 4HP9A 4EBPA 1VHMA 3MZEA 1MKIA 3T4SA 3IQAA 2X02A 1XGJA 5TFQA 3C5AA 5EVLA 3T4KA 1W79A 3IWOA 5CXWA 1YMXA 5HAQA 1JWPA 2XF3A 4DXBA 4ZJ1A 1PYYA 3CZDA 4OPQA 3MZDA 1TDGA 5FQIA 1K54A 3D72A 4JF5A 1GHPA 2H0YA 3OPPA 4DMZA 2WKPA 2BG1A 4Y13A 4N9KA 2PAVP 4BBVA 4B4XA 4OQHA 3D3OA 4F3LB 2QPNA 5FAPA 5M1AA 3CLOA 3A3DA 1M6KA 4NETA 4NXEA 5DKKA 2JKTI 3ICYA 1MZUA 2R9WA 1MWTA 1P0ZA 4GD8A 2JC7A 4GKUA 2FZ0A 4OQIA 2JHEA 4EEUA 4HNBA 4Z9QA 4K91A 3PTEA 2O9AA 4E3LA 5F1GA 1XJ4A 2FFYA 1ZC2A 2HDSA 1SDEA 3TG9A 3PAEA 2ZJ9A 4WEKA 3W4QA 1GSXA 2IA2A 2D02A 4G3VA 1PW1A 4R38A 1W8QA 3LGOA 4JF4A 1S67L 3SS4A 5F5YA 2ZC5B 3GVBA 3BYDA 1ZKJA 1MXOA 1ES5A 4JXVA 1EI5A 2L4RA 1MPLA 3E2KA 1F9IA 3RJUA 2VKSA 3AGFA 4KZ3A 1STZA 4QJGA 3PBTA 4MCWA 1CI8A 5AQ9A 5M19A 4ARZB 5EVIC 2VEAA 4I38A 2GJ3A 4WM9A 4EUVA 1LLBA 2VZWA 2Z2MB 3A3FA 3MQOA 2Z6DA 1FCMA 4KZAA 1TF1A 2HGVA 4L9GA 1KE4A 1LL5A 1KGGA 4LENA 1NXYA 4CLCA 4KG5A 4U3TA 1DJBA 4IBXA 3IWIA 3BRMA 5L8MA 1LI0A 4RQ9A 2W0NA 3IWQA 4H6JB 4Y2FA 2B95A 2O99A 1KE0A 3A3EA 3Q07A 1EW0A 1RCJA 5KIZA 4P85A 4JLFA 1IOUA 1TEMA 3HLEA 1E4DA 5E2EA 4ETXA 1BLSA 3MXSA 1LSVA 4EW7A 1O07A 2VX8A 4OQGA 2OV5A 5GHYA 1H5XA 2L0WA 2XGNA 3SS5A 4GD6A 3RXWA 3W4OA 3LICA 4WUJA 3G35A 3TOIA 1K25A 1L2SA 3FKWA 2GDNA 1CJFA 4IVIA 4PMAA 4OLGA 4ME4A 1T1CA 3EEAA 5LBRA 4OOMA 5EV0A 1KVLA 2EA9A 3D9YA 4R1GA 1ESUA 4DDSA 3OPHA 3ZGAB 2OAQ1 5KSHA 3LEQA 5L10A 3FZCA 3M2KA 1N9NA 3PYPA 4F94A 2IWCA 3S4XA 3BFEA 3BFFA 2EXBA 3RH8B 3VOZA 1PW8A 1AXBA 3E4PA 1YMSA 3M6HA 4LRXC 4FSFA 3PBNA 3R4KA 5TGFA 2QJ5A 1K38A 1K55C 2XR0A 4BWIA 1VEUA 4DE1A 4K0WA 1XJ6A 4Q8IA 1K57C 1XKZA 1WE4A 2V1ZA 4D2OA 4K08A 2QYBA 2WGWB 3N8LA 3FWLA 4I39A 3TE8A 1BLPA 1L0DA 5EECA 1FIKA 4Y0UA 2HP5A 3IBRA 1K56D 3C8CA 3KYZA 1MBLA 3SOIA 4NG2A 3F1PB 5FAOA 1VETB 4KUOA 2VGKA 5DF7A 1W63Q 3G2ZA 1XJ3A 5I94A 3HLBA 4NKPA 1S4SA 1OT6A 1GA9A 3R7WA 2VV7A 4WMCD 2ZMFA 1OPXA 2QHKA 3G4PA 3TW8A 1VQQA 4WBGA 4HHDA 1K6SA 3GTCA 3UE1A 3ZG5A 5KMWA 4UAAA 1FR6A 3VE4A 3ZNTA 3UMDA 1ERMA 3NIAA 1H0MA 3UPNA 4KZ6A 2Y55A 4HJ3A 2QZ6A 3BY8A 4PM7A 1OT9A 2PD7A 3H7WA 1X0OA 1DP8A 5DF8A 2ZQCA 1DJAA 4RX3A 4BMWA 4WL9A 4I3IA 4IBRA 3N4IA 2W3DA 2R9XA 2XFTA 3OZHA 2V8CA 1P97A 3VFFA 1SKOB 1BZAA 4PM5A 5EPHA 3KSIA 3NOPC 3OCLA 2H5SA 2ZQ8A 3ZG8B 2CMNA 2JKTM 1E3UA 1DP9A 2RCXA 5CTMA 2XEPA 1Y54A 2PT7A 1OTIA 5HDDA 2C6WB 1RGZA 4PKYG 1S6RA 1CEGA 4S2KA 2YKFA 5GHXA 4S2NC 4HOIA 3A3IA 2XK1A 2DMWA 3BLSA 1YLJA 3P09A 4RA7A 1NYMA 4MLLA 2DRWA 2I9VA 4Y0TA 4ID4A 1BLCA 5TJJA 3T4QA 4MN7A 1MWUA 3HCYA 5FAQA 3SH9A 2L1MA 3LR4A 3Q7ZA 1P9RA 3N6IA 3E4QA 3LR3A 4UEYA 4HH3A 2XH9A 2JBFA 4YNRA 3LIFA 4C6YA 4S2IA 1PWDA 1AWIA 4GS9B 3O88A 1D7EA 1G5UA 2A49A 4HJ6A 1MWSA 4Z1WA 1XP4A 2J3TD 2PDRA 3G6OA 2LB9A 1JVJA 5GHZA 3GR2A 4GLQA 3T1QB 4GHIB 2WKEA 1XFNA 2XD1A 4S2OA 3CUEC 2IWBA 3GSGA 3QP4A 1H8YA 2UWXA 3DWZA 3FYZA 1A0KA 3SS3A 5CGXA 4OLDA 4LGWA 5FA7A 4XXRA 4L0LA 4YFMA 1KOUA 1ESIA 2VGJA 2M1CA 3Q1FA 4OP5A 4ZTKA 1VEUB 3LI9A 1Q2QA 2V1AA 1IELA 4BQMA 1PZOA 2XROA 2XD5A 3E4OA 2G2WA 3QHYA 2WUQA 2WKHA 4DE0A 1FQGA 3H9WA 4Y5FA 1I2SA 5CRFA 2J7VA 2ZOIA 2HP9A 4II7A 4U0TA 4EESA 1NYYA
chains in the Genus database with same CATH topology
4KZ3A 3W8KA 4WEJA 1TVFA 3Q82A 3ZDJA 4QJGA 3PBTA 1CI8A 5AQ9A 1WYCA 1I2WA 4KQQA 5GL9A 3G34A 5M19A 5EVIC 4P87A 3BFDA 2WGVA 3MFDA 1PI4A 4Y7PA 3MKEA 4KG6A 1YQSA 3G31A 3O86A 4OH0A 2PBYA 4R4SA 2HP6A 2RL3A 4OPYA 3O3VA 5HARA 5G18A 4WM9A 1LLBA 2Y2LA 4DXCA 4DE3A 1QMFA 2Z2MB 3AGDA 1FCOA 3A3FA 4OP8A 3VSLA 2OSUA 1FCMA 4OOLA 4KG2A 2WYXA 3VP2A 3MBZA 2BLSA 4KZAA 4E3IA 5HAIA 1KE4A 1JTDA 1LL5A 4RX2A 1KGGA 1DY6A 4GDNA 4LENA 1NXYA 5FI2A 1YLZA 4S2LA 2Y4AA 5FI6A 5FQQA 3AGFA 4KG5A 2Y2MA 4LV1A 4N92A 4U3TA 3NY4A 1IYQA 1DJBA 3PBSA 4IBXA 3WS2A 3IWIA 3BRMA 1LI0A 2OLVA 4QU3A 5F82A 3G2YA 1NZUA 5E2HA 3IWQA 5EUAA 1S0WA 2ZC3B 4QHCA 2Y2OA 1CK3A 3ISGA 2IWDA 2JCHA 3UDFA 4KQRA 2Y2PA 2ZD8A 1K55A 3VP1A 2P74A 3OPRA 1ONHA 3DTMA 4PM6A 1KE0A 4X55A 3IF6B 5L2FA 3A3EA 4MEZA 3Q07A 1NRFA 1M40A 4R23A 3IXGA 3S1YA 3D4FA 2ZM0A 1RCJA 4OONA 3ZHHA 4P85A 4JLFA 1TEMA 3HLEA 3LO7A 1E4DA 4QD4A 5E2EA 2ZM2A 1FCNA 1NJ4A 1SDNA 2V2FF 1FSYA 1BLSA 1Z6FA 1IKGA 1ZG6A 3MXSA 1O07A 3M2JA 4M3KA 4X68A 5IHVA 3IXDA 4OQGA 2OV5A 5GHYA 1H5XA 2Y59A 3NBLA 3OCNA 4RYEA 3UO9A 2FFFB 2XGNA 4E3KA 4OVDA 3BECA 3SS5A 2WADA 3G30A 4GD6A 5FDHA 3RXWA 1K4EA 1ZG4A 1IYSA 2DNSA 4DRTA 3W4OA 4FD8A 4PM8A 5CEDA 5J8XA 3C4OA 1YLPA 5HL1A 3IXBA 3G35A 5HFOA 1KVMA 3N7WA 5CEBA 5KSCA 3RXXA 3TOIA 5EE8A 3ITAA 1K25A 4B88A 1G6AA 1L2SA 1XPBA 3FKWA 3UDXA 4CPKA 4ZJ3A 2GDNA 1K6RA 3HUOA 3HLWA 4IVIA 4PMAA 3MXRA 3UNWA 4BL2A 4U0XA 1HZOA 2EX9A 4JXGA 3IXHA 4OLGA 3FKVA 4S2JA 2HPBA 3ITBA 4HBTA 4KZ5A 4OOMA 3NI9A 2Y2IA 3UPOA 1KVLA 5A91A 5FI7A 2WGIA 1ALQA 1O7EA 3VOYA 4R1GA 1ESUA 4DDSA 3OPHA 2XQZA 4S2MA 3ZGAB 3ZFZA 3LCEA 2Y2JA 4BD1A 5KSHA 3Q7VB 4KQOA 1PI5A 3FZCA 3UDIA 3M2KA 1YLWA 3N8RA 4F94A 3AGEA 4E3NA 1H8ZA 2IWCA 4WZ5C 4MBKA 3S4XA 2G2UA 4UA9A 3BFEA 3ZVWA 1LI9A 3BFFA 4JXSA 1FSWA 3QNCA 5E43A 5CHJA 3TSGA 2EXBA 3CMZA 1LHYA 2ZQDA 3ZG7B 3VOZA 4EWFA 1BT5A 1HVBA 1OMEA 1PW8A 3NDEA 2ZC6B 1L0FA 3CG5A 1IYOA 3E2LA 3P98A 3WS0A 4EUZA 1AXBA 1PWGA 3C4PA 3MZFA 3QNBA 1YLTA 3IF6C 1W5DA 5U47A 1CEFA 1YMSA 3M6HA 4HBUA 4HESA 4ZDXA 4IEDA 3G32A 4QY5A 3W4PA 4X53A 4FSFA 4E6XA 1XX2A 1KDSA 1Q2PA 3UY6A 4EBNA 3PBNA 4WMCA 5D3OA 1SCWA 3GQZA 4YINA 4LV2A 3V5MA 5TGFA 4XUZA 1PZPA 4GB7A 4WZ4A 2XR0A 1K38A 1K55C 5AQ7A 5FATA 5EVIB 4C3QA 1RGYA 3HREA 1JWVA 4DE1A 4K0WA 2Y2QA 4Q8IA 4ZAMA 3WWXA 1K57C 3GRJA 1EWZA 2EXAA 4ZBEA 2Q9MA 1XKZA 1WE4A 5KZHA 2V1ZA 1IKIA 5F83A 2WGWA 3PBOA 4PM9A 3HLDA 2C5WB 2J9OA 3FV7A 3HUMA 4D2OA 3IH8A 2CC1A 3JYIA 2WZXA 3IT9A 2WGWB 2Y2GA 4DF6A 3N8LA 5DTKA 2H0TA 3FWLA 1HD8A 4KZ8A 5AQAA 4LV3A 3NCKA 1ES2A 2J8YA 5DTSA 1GHMA 1BLPA 4OPRA 1ES3A 4BD0A 1L0DA 3WRTA 4JKTA 5EECA 4QY6A 4Y0UA 2I72A 2HP5A 2V20A 2ZC4B 1K56D 2P9VA 3N8SA 3UN7A 2ZQ7A 4WYYA 5JYOA 1FR1A 1XA7A 3VSKA 1MBLA 4EBLA 3OC2A 5GLCA 1KDWA 4JPMA 4UA7A 3SOIA 3V3RA 1GCEA 2WAFA 2WZZA 4XUXA 3OPLA 3BFGA 1U60A 1K54C 5FAOA 2QMIA 1W8YA 3BLMA 4DKIA 1K57A 3BEBA 3CJMA 3EQVA 5E2GA 2VGKA 3IF5A 5DF7A 1BSGA 3C7VA 3EQUA 3G2ZA 2HDUA 5I94A 3HLBA 1SKFA 3I7JA 2HDRA 4N1XA 3WS4A 1GA9A 4EV4A 4WMCD 3GMWA 4R0QA 4N1HA 3V39A 1CI9A 2H10A 1NY0A 4H8RA 1IEMA 4C75A 3PBQA 3G4PA 5FSRA 3ZVTA 1VQQA 2WK0A 3BFCA 5CECA 4WBGA 2EFUA 2JE5A 1K6SA 3GTCA 1ONGA 2E8IA 4WZ5A 3IHBA 3PBRA 4EQIA 5GLAA 2P9VB 3B3XA 3UE1A 1SHVA 3ZG5A 5KMWA 4UAAA 1FR6A 3ZNTA 1ERMA 3NIAA 5A93A 3UPNA 5EOOA 5M18A 4KZ6A 4JF6A 2Y55A 5DF9A 2QZ6A 1L0EA 4WELA 4PM7A 3ZG0A 1XA1A 5FQ9A 4FH2A 5DF8A 4LCMA 1HTZA 5GLBA 2ZQCA 1DJAA 2Y2NA 2Z2LB 4P6BA 4RX3A 1K4FA 3IF6A 3UE0A 4GOGA 4MNRA 4R3JA 5F1FA 2OLUA 3Q7VA 1GA0A 3LY3A 4IBRA 3N4IA 2X01A 1ES4A 4RVAA 4CJNA 1WYBA 1MWRA 3WS5A 2R9XA 2XFTA 3OZHA 5EOEA 4R4RA 5TR7A 4P0MA 5CTNA 4DE2A 1KE3A 1QMEA 3MKFA 3WS1A 3VFFA 4BL3A 3HUNA 1I5QA 5FASA 1BZAA 1GHIA 1KGEA 5GLDA 4PM5A 5CGWA 5EPHA 1YT4A 3IH9A 3OCLA 1BUEA 2H5SA 2ZQ8A 3ZG8B 1W7FA 4X56A 3VP3A 1E3UA 2RCXA 3A3JA 4A5RA 2EX8A 5CTMA 2XEPA 3NDGA 2ZM8A 1Y54A 4BENA 1JWZA 2C6WB 1PIOA 1RGZA 1ERQA 1S6RA 1CEGA 3C7UA 3LEZA 4S2KA 1J9MA 4GZBA 4EBPA 5CERA 5GHXA 5E2FA 3MZEA 4S2NC 1MKIA 2B5RA 3A3IA 2XK1A 3IQAA 1BLHA 2X02A 2ZMAA 3BLSA 2ZQAA 1YLJA 1N4OA 3P09A 1XGJA 1NYMA 3HL9A 4LCLA 4RA7A 5HX9A 4MLLA 1BTLA 5FQMA 4UHUA 2DRWA 5TFQA 5JYPA 3C5AA 3HLCA 4Y0TA 4ID4A 5EVLA 1BLCA 1W79A 3IWOA 4K0XA 5CXWA 1YMXA 5HAQA 1TDLA 3ZCZA 3VMAA 2X71A 3Q81A 1JWPA 5A92A 2XF3A 4DXBA 4ZJ1A 1PYYA 4E3JA 2EX2A 5FQKA 1MWUA 3ZG9B 3CZDA 5FAQA 1E25A 2EX6A 4OPQA 3SH9A 3HVFA 3Q7ZA 1E3UD 2EFXA 4E6WA 3MZDA 1TDGA 2A3UA 3HBRA 1K54A 3N6IA 4NK3A 1XXMA 4JF5A 4S2PA 5FQIA 3SH7A 4JXWA 4UA6A 5EVID 1GHPA 4GNUA 2H0YA 3OPPA 2BG1A 5A90A 2J9PA 4N9KA 5AQBA 1YLYA 4B4XA 4OQHA 4B4ZA 2XH9A 3VP4A 2JBFA 2QPNA 5FAPA 2HDQA 3SH8A 5M1AA 2Y2KA 4C6YA 4KENB 4S2IA 4Y0OA 4QB8A 1PWDA 3A3DA 1C3BA 3DWKA 2ZLYA 5CHMA 1M6KA 3O88A 3M6BA 5CHUA 4NETA 1L0GA 4S2NA 2A49A 4HEFA 1MWSA 2Y91A 1XP4A 5HAPA 4OQ0A 2R9WA 1EROA 3V50A 1K56A 1MWTA 1XGIA 2ZQ9A 3DW0A 4KZ4A 1JVJA 4R3BA 5GHZA 3GR2A 4BJPA 4GD8A 4KZ9A 2WKIA 2XFSA 1PWCA 2XLNA 2JC7A 4GKUA 2WKEA 4X6TA 3HLFA 2XD1A 3BM6A 4S2OA 4OQIA 4X69A 4E3OA 3ZNYA 4KZBA 5CGSA 2IWBA 3GSGA 1DJCA 4Z9QA 3VP0A 4K91A 1H8YA 1YM1A 3PTEA 1RP5A 1LL9A 1MY8A 4OKPA 2UWXA 4IVKA 4PPRA 3DWZA 4KZ7A 4E3LA 4LV0A 3FYZA 5F1GA 2FFYA 3V3SA 3SS3A 1ZC2A 4OOYA 5CGXA 2PU2A 1NZOA 4OLDA 2HDSA 5FA7A 1SDEA 3NC8A 4XXRA 3PAEA 2ZJ9A 4WEKA 4OPZA 4L0LA 3TG9A 3W4QA 1IYPA 4O7DA 4YFMA 4ZJ2A 1ESIA 3PAGA 2VGJA 3Q1FA 4OP5A 5EVIA 4ZTKA 1KGFA 4N9LA 3WRZA 4FCFA 3GV9A 3IHAA 3VFHA 1PW1A 1BULA 5FQJA 1N9BA 1Q2QA 3HLGA 3LY4A 4FH4A 1IELA 1VM1A 1W8QA 2XDMA 4JF4A 2ZC7A 4BQMA 1PZOA 4GN2A 1FOFA 2XD5A 3SS4A 2G2WA 2DCFA 3QHYA 4DDYA 2WUQA 3O87A 2Y2HA 4GDBA 2WAEA 2ZC5B 2WKHA 4DE0A 1FQGA 3GVBA 5DVAA 5DTTA 3BYDA 1G68A 2Q9NA 5BOHA 4MBHA 3S22A 1ZKJA 1MXOA 3UE3A 1ES5A 4JXVA 1I2SA 4E3MA 5CRFA 1EI5A 2J7VA 2PU4A 5HW3A 1JTGA 2HP9A 1MPLA 4JBFA 3E2KA 4MBFA 4BLMA 4U0TA 3RJUA 1NYYA 3UPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ3 A;  3W8K A;  4WEJ A;  1TVF A;  3Q82 A;  3ZDJ A;  4QJG A;  3PBT A;  1CI8 A;  5AQ9 A;  1WYC A;  1I2W A;  4KQQ A;  5GL9 A;  3G34 A;  5M19 A;  5EVI C;  4P87 A;  3BFD A;  2WGV A;  3MFD A;  1PI4 A;  4Y7P A;  3MKE A;  4KG6 A;  1YQS A;  3G31 A;  3O86 A;  4OH0 A;  2PBY A;  4R4S A;  2HP6 A;  2RL3 A;  4OPY A;  3O3V A;  5HAR A;  5G18 A;  4WM9 A;  1LLB A;  2Y2L A;  4DXC A;  4DE3 A;  1QMF A;  2Z2M B;  3AGD A;  1FCO A;  3A3F A;  4OP8 A;  3VSL A;  2OSU A;  1FCM A;  4OOL A;  4KG2 A;  2WYX A;  3VP2 A;  3MBZ A;  2BLS A;  4KZA A;  4E3I A;  5HAI A;  1KE4 A;  1JTD A;  1LL5 A;  4RX2 A;  1KGG A;  1DY6 A;  4GDN A;  4LEN A;  1NXY A;  5FI2 A;  1YLZ A;  4S2L A;  2Y4A A;  5FI6 A;  5FQQ A;  3AGF A;  4KG5 A;  2Y2M A;  4LV1 A;  4N92 A;  4U3T A;  3NY4 A;  1IYQ A;  1DJB A;  3PBS A;  4IBX A;  3WS2 A;  3IWI A;  3BRM A;  1LI0 A;  2OLV A;  4QU3 A;  5F82 A;  3G2Y A;  1NZU A;  5E2H A;  3IWQ A;  5EUA A;  1S0W A;  2ZC3 B;  4QHC A;  2Y2O A;  1CK3 A;  3ISG A;  2IWD A;  2JCH A;  3UDF A;  4KQR A;  2Y2P A;  2ZD8 A;  1K55 A;  3VP1 A;  2P74 A;  3OPR A;  1ONH A;  3DTM A;  4PM6 A;  1KE0 A;  4X55 A;  3IF6 B;  5L2F A;  3A3E A;  4MEZ A;  3Q07 A;  1NRF A;  1M40 A;  4R23 A;  3IXG A;  3S1Y A;  3D4F A;  2ZM0 A;  1RCJ A;  4OON A;  3ZHH A;  4P85 A;  4JLF A;  1TEM A;  3HLE A;  3LO7 A;  1E4D A;  4QD4 A;  5E2E A;  2ZM2 A;  1FCN A;  1NJ4 A;  1SDN A;  2V2F F;  1FSY A;  1BLS A;  1Z6F A;  1IKG A;  1ZG6 A;  3MXS A;  1O07 A;  3M2J A;  4M3K A;  4X68 A;  5IHV A;  3IXD A;  4OQG A;  2OV5 A;  5GHY A;  1H5X A;  2Y59 A;  3NBL A;  3OCN A;  4RYE A;  3UO9 A;  2FFF B;  2XGN A;  4E3K A;  4OVD A;  3BEC A;  3SS5 A;  2WAD A;  3G30 A;  4GD6 A;  5FDH A;  3RXW A;  1K4E A;  1ZG4 A;  1IYS A;  2DNS A;  4DRT A;  3W4O A;  4FD8 A;  4PM8 A;  5CED A;  5J8X A;  3C4O A;  1YLP A;  5HL1 A;  3IXB A;  3G35 A;  5HFO A;  1KVM A;  3N7W A;  5CEB A;  5KSC A;  3RXX A;  3TOI A;  5EE8 A;  3ITA A;  1K25 A;  4B88 A;  1G6A A;  1L2S A;  1XPB A;  3FKW A;  3UDX A;  4CPK A;  4ZJ3 A;  2GDN A;  1K6R A;  3HUO A;  3HLW A;  4IVI A;  4PMA A;  3MXR A;  3UNW A;  4BL2 A;  4U0X A;  1HZO A;  2EX9 A;  4JXG A;  3IXH A;  4OLG A;  3FKV A;  4S2J A;  2HPB A;  3ITB A;  4HBT A;  4KZ5 A;  4OOM A;  3NI9 A;  2Y2I A;  3UPO A;  1KVL A;  5A91 A;  5FI7 A;  2WGI A;  1ALQ A;  1O7E A;  3VOY A;  4R1G A;  1ESU A;  4DDS A;  3OPH A;  2XQZ A;  4S2M A;  3ZGA B;  3ZFZ A;  3LCE A;  2Y2J A;  4BD1 A;  5KSH A;  3Q7V B;  4KQO A;  1PI5 A;  3FZC A;  3UDI A;  3M2K A;  1YLW A;  3N8R A;  4F94 A;  3AGE A;  4E3N A;  1H8Z A;  2IWC A;  4WZ5 C;  4MBK A;  3S4X A;  2G2U A;  4UA9 A;  3BFE A;  3ZVW A;  1LI9 A;  3BFF A;  4JXS A;  1FSW A;  3QNC A;  5E43 A;  5CHJ A;  3TSG A;  2EXB A;  3CMZ A;  1LHY A;  2ZQD A;  3ZG7 B;  3VOZ A;  4EWF A;  1BT5 A;  1HVB A;  1OME A;  1PW8 A;  3NDE A;  2ZC6 B;  1L0F A;  3CG5 A;  1IYO A;  3E2L A;  3P98 A;  3WS0 A;  4EUZ A;  1AXB A;  1PWG A;  3C4P A;  3MZF A;  3QNB A;  1YLT A;  3IF6 C;  1W5D A;  5U47 A;  1CEF A;  1YMS A;  3M6H A;  4HBU A;  4HES A;  4ZDX A;  4IED A;  3G32 A;  4QY5 A;  3W4P A;  4X53 A;  4FSF A;  4E6X A;  1XX2 A;  1KDS A;  1Q2P A;  3UY6 A;  4EBN A;  3PBN A;  4WMC A;  5D3O A;  1SCW A;  3GQZ A;  4YIN A;  4LV2 A;  3V5M A;  5TGF A;  4XUZ A;  1PZP A;  4GB7 A;  4WZ4 A;  2XR0 A;  1K38 A;  1K55 C;  5AQ7 A;  5FAT A;  5EVI B;  4C3Q A;  1RGY A;  3HRE A;  1JWV A;  4DE1 A;  4K0W A;  2Y2Q A;  4Q8I A;  4ZAM A;  3WWX A;  1K57 C;  3GRJ A;  1EWZ A;  2EXA A;  4ZBE A;  2Q9M A;  1XKZ A;  1WE4 A;  5KZH A;  2V1Z A;  1IKI A;  5F83 A;  2WGW A;  3PBO A;  4PM9 A;  3HLD A;  2C5W B;  2J9O A;  3FV7 A;  3HUM A;  4D2O A;  3IH8 A;  2CC1 A;  3JYI A;  2WZX A;  3IT9 A;  2WGW B;  2Y2G A;  4DF6 A;  3N8L A;  5DTK A;  2H0T A;  3FWL A;  1HD8 A;  4KZ8 A;  5AQA A;  4LV3 A;  3NCK A;  1ES2 A;  2J8Y A;  5DTS A;  1GHM A;  1BLP A;  4OPR A;  1ES3 A;  4BD0 A;  1L0D A;  3WRT A;  4JKT A;  5EEC A;  4QY6 A;  4Y0U A;  2I72 A;  2HP5 A;  2V20 A;  2ZC4 B;  1K56 D;  2P9V A;  3N8S A;  3UN7 A;  2ZQ7 A;  4WYY A;  5JYO A;  1FR1 A;  1XA7 A;  3VSK A;  1MBL A;  4EBL A;  3OC2 A;  5GLC A;  1KDW A;  4JPM A;  4UA7 A;  3SOI A;  3V3R A;  1GCE A;  2WAF A;  2WZZ A;  4XUX A;  3OPL A;  3BFG A;  1U60 A;  1K54 C;  5FAO A;  2QMI A;  1W8Y A;  3BLM A;  4DKI A;  1K57 A;  3BEB A;  3CJM A;  3EQV A;  5E2G A;  2VGK A;  3IF5 A;  5DF7 A;  1BSG A;  3C7V A;  3EQU A;  3G2Z A;  2HDU A;  5I94 A;  3HLB A;  1SKF A;  3I7J A;  2HDR A;  4N1X A;  3WS4 A;  1GA9 A;  4EV4 A;  4WMC D;  3GMW A;  4R0Q A;  4N1H A;  3V39 A;  1CI9 A;  2H10 A;  1NY0 A;  4H8R A;  1IEM A;  4C75 A;  3PBQ A;  3G4P A;  5FSR A;  3ZVT A;  1VQQ A;  2WK0 A;  3BFC A;  5CEC A;  4WBG A;  2EFU A;  2JE5 A;  1K6S A;  3GTC A;  1ONG A;  2E8I A;  4WZ5 A;  3IHB A;  3PBR A;  4EQI A;  5GLA A;  2P9V B;  3B3X A;  3UE1 A;  1SHV A;  3ZG5 A;  5KMW A;  4UAA A;  1FR6 A;  3ZNT A;  1ERM A;  3NIA A;  5A93 A;  3UPN A;  5EOO A;  5M18 A;  4KZ6 A;  4JF6 A;  2Y55 A;  5DF9 A;  2QZ6 A;  1L0E A;  4WEL A;  4PM7 A;  3ZG0 A;  1XA1 A;  5FQ9 A;  4FH2 A;  5DF8 A;  4LCM A;  1HTZ A;  5GLB A;  2ZQC A;  1DJA A;  2Y2N A;  2Z2L B;  4P6B A;  4RX3 A;  1K4F A;  3IF6 A;  3UE0 A;  4GOG A;  4MNR A;  4R3J A;  5F1F A;  2OLU A;  3Q7V A;  1GA0 A;  3LY3 A;  4IBR A;  3N4I A;  2X01 A;  1ES4 A;  4RVA A;  4CJN A;  1WYB A;  1MWR A;  3WS5 A;  2R9X A;  2XFT A;  3OZH A;  5EOE A;  4R4R A;  5TR7 A;  4P0M A;  5CTN A;  4DE2 A;  1KE3 A;  1QME A;  3MKF A;  3WS1 A;  3VFF A;  4BL3 A;  3HUN A;  1I5Q A;  5FAS A;  1BZA A;  1GHI A;  1KGE A;  5GLD A;  4PM5 A;  5CGW A;  5EPH A;  1YT4 A;  3IH9 A;  3OCL A;  1BUE A;  2H5S A;  2ZQ8 A;  3ZG8 B;  1W7F A;  4X56 A;  3VP3 A;  1E3U A;  2RCX A;  3A3J A;  4A5R A;  2EX8 A;  5CTM A;  2XEP A;  3NDG A;  2ZM8 A;  1Y54 A;  4BEN A;  1JWZ A;  2C6W B;  1PIO A;  1RGZ A;  1ERQ A;  1S6R A;  1CEG A;  3C7U A;  3LEZ A;  4S2K A;  1J9M A;  4GZB A;  4EBP A;  5CER A;  5GHX A;  5E2F A;  3MZE A;  4S2N C;  1MKI A;  2B5R A;  3A3I A;  2XK1 A;  3IQA A;  1BLH A;  2X02 A;  2ZMA A;  3BLS A;  2ZQA A;  1YLJ A;  1N4O A;  3P09 A;  1XGJ A;  1NYM A;  3HL9 A;  4LCL A;  4RA7 A;  5HX9 A;  4MLL A;  1BTL A;  5FQM A;  4UHU A;  2DRW A;  5TFQ A;  5JYP A;  3C5A A;  3HLC A;  4Y0T A;  4ID4 A;  5EVL A;  1BLC A;  1W79 A;  3IWO A;  4K0X A;  5CXW A;  1YMX A;  5HAQ A;  1TDL A;  3ZCZ A;  3VMA A;  2X71 A;  3Q81 A;  1JWP A;  5A92 A;  2XF3 A;  4DXB A;  4ZJ1 A;  1PYY A;  4E3J A;  2EX2 A;  5FQK A;  1MWU A;  3ZG9 B;  3CZD A;  5FAQ A;  1E25 A;  2EX6 A;  4OPQ A;  3SH9 A;  3HVF A;  3Q7Z A;  1E3U D;  2EFX A;  4E6W A;  3MZD A;  1TDG A;  2A3U A;  3HBR A;  1K54 A;  3N6I A;  4NK3 A;  1XXM A;  4JF5 A;  4S2P A;  5FQI A;  3SH7 A;  4JXW A;  4UA6 A;  5EVI D;  1GHP A;  4GNU A;  2H0Y A;  3OPP A;  2BG1 A;  5A90 A;  2J9P A;  4N9K A;  5AQB A;  1YLY A;  4B4X A;  4OQH A;  4B4Z A;  2XH9 A;  3VP4 A;  2JBF A;  2QPN A;  5FAP A;  2HDQ A;  3SH8 A;  5M1A A;  2Y2K A;  4C6Y A;  4KEN B;  4S2I A;  4Y0O A;  4QB8 A;  1PWD A;  3A3D A;  1C3B A;  3DWK A;  2ZLY A;  5CHM A;  1M6K A;  3O88 A;  3M6B A;  5CHU A;  4NET A;  1L0G A;  4S2N A;  2A49 A;  4HEF A;  1MWS A;  2Y91 A;  1XP4 A;  5HAP A;  4OQ0 A;  2R9W A;  1ERO A;  3V50 A;  1K56 A;  1MWT A;  1XGI A;  2ZQ9 A;  3DW0 A;  4KZ4 A;  1JVJ A;  4R3B A;  5GHZ A;  3GR2 A;  4BJP A;  4GD8 A;  4KZ9 A;  2WKI A;  2XFS A;  1PWC A;  2XLN A;  2JC7 A;  4GKU A;  2WKE A;  4X6T A;  3HLF A;  2XD1 A;  3BM6 A;  4S2O A;  4OQI A;  4X69 A;  4E3O A;  3ZNY A;  4KZB A;  5CGS A;  2IWB A;  3GSG A;  1DJC A;  4Z9Q A;  3VP0 A;  4K91 A;  1H8Y A;  1YM1 A;  3PTE A;  1RP5 A;  1LL9 A;  1MY8 A;  4OKP A;  2UWX A;  4IVK A;  4PPR A;  3DWZ A;  4KZ7 A;  4E3L A;  4LV0 A;  3FYZ A;  5F1G A;  2FFY A;  3V3S A;  3SS3 A;  1ZC2 A;  4OOY A;  5CGX A;  2PU2 A;  1NZO A;  4OLD A;  2HDS A;  5FA7 A;  1SDE A;  3NC8 A;  4XXR A;  3PAE A;  2ZJ9 A;  4WEK A;  4OPZ A;  4L0L A;  3TG9 A;  3W4Q A;  1IYP A;  4O7D A;  4YFM A;  4ZJ2 A;  1ESI A;  3PAG A;  2VGJ A;  3Q1F A;  4OP5 A;  5EVI A;  4ZTK A;  1KGF A;  4N9L A;  3WRZ A;  4FCF A;  3GV9 A;  3IHA A;  3VFH A;  1PW1 A;  1BUL A;  5FQJ A;  1N9B A;  1Q2Q A;  3HLG A;  3LY4 A;  4FH4 A;  1IEL A;  1VM1 A;  1W8Q A;  2XDM A;  4JF4 A;  2ZC7 A;  4BQM A;  1PZO A;  4GN2 A;  1FOF A;  2XD5 A;  3SS4 A;  2G2W A;  2DCF A;  3QHY A;  4DDY A;  2WUQ A;  3O87 A;  2Y2H A;  4GDB A;  2WAE A;  2ZC5 B;  2WKH A;  4DE0 A;  1FQG A;  3GVB A;  5DVA A;  5DTT A;  3BYD A;  1G68 A;  2Q9N A;  5BOH A;  4MBH A;  3S22 A;  1ZKJ A;  1MXO A;  3UE3 A;  1ES5 A;  4JXV A;  1I2S A;  4E3M A;  5CRF A;  1EI5 A;  2J7V A;  2PU4 A;  5HW3 A;  1JTG A;  2HP9 A;  1MPL A;  4JBF A;  3E2K A;  4MBF A;  4BLM A;  4U0T A;  3RJU A;  1NYY A;  3UPP A; 
#chains in the Genus database with same CATH topology
 4WEJ A;  3LYX A;  3ZDJ A;  4H6J A;  3DAV A;  3B47 A;  5GL9 A;  3G34 A;  5IU1 A;  2VV6 A;  5DKL A;  3O86 A;  4OH0 A;  2PBY A;  2HP6 A;  4OPY A;  5HAR A;  1OJG A;  4X25 A;  1TS8 A;  1QMF A;  3AGD A;  3JVV A;  3VSL A;  2B18 A;  3MXQ A;  3R7W B;  3FPW A;  5G4Y A;  2BLS A;  5CX7 A;  5FI2 A;  2JN7 A;  5F69 A;  2YKH A;  1IYQ A;  3WS2 A;  2JKF A;  2OLV A;  1YPR A;  4QU3 A;  2Y2O A;  3MS6 A;  2OAP 1;  1K55 A;  3KSH A;  3OPR A;  2PYP A;  3EEH A;  1FSY A;  1T1A A;  1Z6F A;  1IKG A;  5A8B A;  3FG8 A;  4M3K A;  3BJN A;  1TS0 A;  3QP8 A;  5K5B A;  4CLC C;  4ARZ A;  3UO9 A;  2KX6 A;  2FFF B;  4OVD A;  3BEC A;  2WAD A;  2VGL S;  4DN0 A;  1ZG4 A;  1IYS A;  2DNS A;  4FD8 A;  3C4O A;  3PHY A;  1G6O A;  5HD3 A;  3IXB A;  5HFO A;  1KVM A;  4EXO A;  1XPB A;  3QP1 A;  3IS2 B;  5FDS A;  2EX9 A;  4JXG A;  3IXH A;  3T4J A;  4O01 A;  3KYE A;  3ITB A;  2PR6 A;  3UPO A;  3LUQ A;  5A91 A;  5FI7 A;  2WGI A;  1ALQ A;  3HJK A;  3VE3 A;  2XQZ A;  4BD1 A;  3F1P A;  3Q7V B;  3UDI A;  2A24 A;  1YLW A;  4E3N A;  2PRF A;  1H8Z A;  4WZ5 C;  3UB7 A;  2G2U A;  1LI9 A;  5CHJ A;  2W1T A;  3ZG7 B;  1OME A;  3KSG A;  1L0F A;  5HD5 A;  3WS0 A;  1PWG A;  3MZF A;  1SZV A;  1YLT A;  1W5D A;  3NOU C;  1CEF A;  4HBU A;  4IED A;  3G32 A;  1YSQ A;  2V9A A;  2J80 A;  2JKR M;  3EGX C;  4YIN A;  3W2Z A;  1S4R A;  4C3Q A;  1H3Q A;  3CIT A;  3HRE A;  3U2A A;  2XRN A;  4Q0J A;  4ZAM A;  1P9W A;  3QP6 A;  1IKI A;  5F83 A;  1YSP A;  5MC7 A;  3PBO A;  1LSW A;  4AFI A;  3FV7 A;  3HUM A;  3OBF A;  3BQ8 A;  1PRQ A;  5FL3 A;  3JYI A;  2Y2G A;  2FH5 A;  4IUK A;  1F2K A;  1ES2 A;  2J8Y A;  5HSQ A;  5DTS A;  1GHM A;  1YAX A;  1ES3 A;  3WRT A;  4QY6 A;  3JVU A;  3HJI A;  2I72 A;  4NEE D;  1D06 A;  2ZC4 B;  3N8S A;  5HZH A;  4WYY A;  1XA7 A;  4YWZ A;  1S66 L;  1KDW A;  4JPM A;  3T1S A;  1LT0 A;  1K54 C;  2QMI A;  3OLO A;  4R70 A;  1W8Y A;  4PHT A;  4DKI A;  3BEB A;  3KSF A;  5E2G A;  4EER A;  3T4L A;  1ZTU A;  1BSG A;  1Z09 A;  3UME A;  4N1H A;  5EM0 A;  1CI9 A;  4H8R A;  4C75 A;  3PBQ A;  4EEP A;  3BFC A;  5AVE A;  2INW A;  2JE5 A;  4IHQ A;  2E8I A;  4EQI A;  1N9O A;  2P9V B;  3BWL A;  2XSS A;  5EOO A;  4JF6 A;  1T1B A;  3H82 A;  1NLY A;  1L0E A;  4WEL A;  3ZG0 A;  3S7N A;  1XA1 A;  2W1R A;  4FH2 A;  4GS9 A;  3QP5 A;  4LCM A;  1HTZ A;  5GLB A;  2Y2N A;  2Z2L B;  4P6B A;  4ZRR A;  3IF6 A;  2OLU A;  3LFV A;  3Q7V A;  1GA0 A;  2X01 A;  4RVA A;  5EFW A;  3WS5 A;  5EOE A;  4R4R A;  5TR7 A;  4P0M A;  5CTN A;  4HY8 A;  1KE3 A;  3MKF A;  3HUN A;  5GLD A;  3EOI A;  5CGW A;  1F98 A;  3IH9 A;  1BUE A;  1W7F A;  1XJ2 A;  4A5R A;  3A3J A;  2WKQ A;  2QKP A;  5HL6 A;  1JWZ A;  1J9M A;  5E2F A;  2B5R A;  1N4O A;  5F6A A;  3HL9 A;  1UGU A;  5FQM A;  4EET B;  3HLC A;  3T4O A;  1K0K A;  1GSV A;  4K0X A;  1TDL A;  3ZCZ A;  3VMA A;  2X71 A;  5A92 A;  2EX2 A;  4CLC D;  3ZG9 B;  2EX6 A;  3EWK A;  1E3U D;  2EFX A;  2A3U A;  3SH7 A;  4S2P A;  4MN5 A;  3HBR A;  4JXW A;  4UA6 A;  4GNU A;  2KOI A;  5AQB A;  1YLY A;  2W3H A;  4B4Z A;  2XA7 M;  2Y2K A;  4CQH A;  1C3B A;  3NHQ A;  4I3A A;  5CHM A;  4ETZ A;  4F3L A;  3M6B A;  2GNX A;  2Y91 A;  2A24 B;  2W3F A;  5HAP A;  3V50 A;  2ZQ9 A;  3DW0 A;  4I3J A;  3DTK A;  4KZ9 A;  1PWC A;  5FEF A;  2XLN A;  3O5Y A;  5J7E A;  3LI8 A;  3C2W A;  4E3O A;  3ZNY A;  2PR5 A;  4O8G A;  3VP0 A;  1YM1 A;  3E98 A;  1RP5 A;  1LL9 A;  1MY8 A;  4IVK A;  4PPR A;  4LV0 A;  3CPT B;  3BW6 A;  2PU2 A;  1NZO A;  3NC8 A;  5AJG A;  4ZJ2 A;  3PAG A;  3GEC A;  1CQA A;  4DJ3 A;  1KGF A;  4IUH A;  4HJ4 A;  4LRZ E;  4FCF A;  3S7Q A;  3IHA A;  3WRZ A;  5FQJ A;  1BYW A;  1VM1 A;  2K7S A;  2DCF A;  3MF0 A;  2Y2H A;  4GDB A;  2V0U A;  1G68 A;  3BQA A;  3GDI A;  4Y15 A;  5HWW A;  4E3M A;  3L9K A;  1JTG A;  4UQI S;  4JBF A;  5HWT A;  3UPP A;  3Q82 A;  1LSX A;  1J3W A;  4YOF A;  1WYC A;  3E0Y A;  4Y17 A;  3KO6 A;  2WGV A;  2ZL1 A;  1PI4 A;  3MKE A;  4GCZ A;  4R4S A;  5TBM B;  3O3V A;  5G18 A;  3RTY A;  5HPI A;  2Y2L A;  4DXC A;  5J3W A;  4DE3 A;  4WLA A;  4OOL A;  2WYX A;  3C30 A;  3VP2 A;  1TD5 A;  5HAI A;  5HDC A;  3U4L P;  1JTD A;  1D1J A;  1DY6 A;  4GDN A;  2BAS A;  1YLZ A;  2Y4A A;  5FQQ A;  2Y2M A;  3NY4 A;  5F82 A;  3G2Y A;  2HV1 A;  3NOT C;  5E2H A;  5EUA A;  2OOL A;  2ZC3 B;  4QHC A;  1CK3 A;  2IWD A;  1YKD A;  4KUK A;  4GJ4 A;  1ONH A;  3DTM A;  4PM6 A;  3IF6 B;  4MEZ A;  4R23 A;  1NRF A;  1M40 A;  3S1Y A;  3D4F A;  3ZHH A;  4B93 A;  2W3E A;  3LO7 A;  1W63 M;  2ZM2 A;  1NJ4 A;  1SDN A;  3TRC A;  1ZG6 A;  3M2J A;  4X68 A;  1OJ5 A;  1NWZ A;  3IXD A;  5IHV A;  1Y28 A;  3F1O B;  3MJQ A;  3NBL A;  3OCN A;  1TS6 A;  3TJZ C;  3CHW P;  4E3K A;  4XT2 B;  4NXG A;  5CED A;  1YLP A;  3S7O A;  3N7W A;  5CEB A;  2V1B A;  3RXX A;  5EE8 A;  3ITA A;  2W1T B;  4B88 A;  4JGO A;  5EVE A;  4CPK A;  3LIB A;  4ZJ3 A;  3HUO A;  3HLW A;  3MXR A;  3UNW A;  4G3K A;  1HZO A;  3FKV A;  3LIE A;  2HPB A;  1JNU A;  3BY9 A;  3QP2 A;  4HBT A;  4KZ5 A;  3L7H A;  2Y2I A;  3NI9 A;  4IJG A;  4ESP A;  4FUW A;  2ACG A;  2EWV A;  4O0P A;  3AGE A;  3KX0 X;  2HJ9 C;  3QNC A;  2P7J A;  1BT5 A;  3NDE A;  3VOL A;  2ZC6 B;  1IYO A;  3LID A;  5L07 A;  3QNB A;  3IF6 C;  5U47 A;  4QY5 A;  5HDS A;  4E6X A;  1XX2 A;  1KDS A;  1Q2P A;  1T18 A;  4WMC A;  5D3O A;  3V5M A;  3MQ0 A;  4XUZ A;  5EVI B;  1JWV A;  2Y2Q A;  3GRJ A;  1EWZ A;  4P6Z S;  2Q9M A;  2EWW A;  5KZH A;  2WGW A;  4PM9 A;  3HLD A;  2O0Y A;  2WKR A;  5G4Z A;  3UB6 A;  1GSW A;  2CC1 A;  3IT9 A;  2D01 A;  2H0T A;  4I5S A;  4KZ8 A;  5AQA A;  4LV3 A;  4M4X A;  3NCK A;  2P9V A;  4CLC B;  3UN7 A;  2ZQ7 A;  5JYO A;  1FR1 A;  1VET A;  3VSK A;  1OTE A;  4EBL A;  3OC2 A;  5GLC A;  3H82 B;  4NXF A;  1GCE A;  2WAF A;  2WZZ A;  3OPL A;  3BFG A;  2QWS A;  3F1N B;  3F1O A;  1K57 A;  2NUP C;  3CJM A;  3EQV A;  1XFQ A;  3IF5 A;  1IFQ A;  3EGD C;  3EQU A;  1SKF A;  3I7J A;  3ZYT A;  3UE6 A;  1V9Z A;  4N1X A;  3WS4 A;  3S7P A;  3B42 A;  4JGR A;  3V39 A;  2H10 A;  2GX5 A;  3CWF A;  3NEC A;  4WN5 A;  5FSR A;  2WK0 A;  2O9B A;  1WA9 A;  3DTI A;  2EFU A;  3IHB A;  1SHV A;  1Y4O A;  5M18 A;  4D60 A;  5DF9 A;  3SW1 A;  2JKR I;  4FOF A;  2VJW A;  3OOV A;  2PD8 A;  1K4F A;  3IX8 A;  4PAU A;  4R3J A;  2J3W A;  1F5M A;  3LY3 A;  4EU0 A;  4L9F A;  1MC0 A;  2R78 A;  2VLG A;  1WYB A;  1SKO A;  1VB6 A;  2Q0O A;  1QME A;  3WS1 A;  4BL3 A;  1I5Q A;  2E8J A;  3RFB A;  4B9O A;  1NLZ A;  2XA7 S;  3UB8 A;  4BEN A;  1PIO A;  3LEZ A;  5DFX A;  4GZB A;  1PNE A;  3P7N A;  5CER A;  1BLH A;  2ZMA A;  5HX9 A;  2ZQA A;  4LCL A;  2A2L A;  1BTL A;  2ZOH A;  4UHU A;  5JYP A;  2ZL1 B;  3IBJ A;  5AVF A;  3Q81 A;  4E3J A;  1ODV A;  5FQK A;  1E25 A;  1TS7 A;  3HVF A;  2OWJ A;  4E6W A;  4G3W A;  4NK3 A;  1XXM A;  5EVI D;  3K3C A;  4LRY C;  3CAX A;  5A90 A;  2J9P A;  4HQA A;  3CPT A;  2HZ5 A;  3VP4 A;  2HDQ A;  3SH8 A;  4KEN B;  4Y0O A;  2QJ7 A;  4MMN A;  4QB8 A;  3ULF A;  3DWK A;  2ZLY A;  4FTX A;  5CHU A;  1L0G A;  4S2N A;  4HEF A;  2J3T C;  3UB9 A;  4OQ0 A;  4DJ2 A;  1ERO A;  1K56 A;  1XGI A;  5TBM A;  5L09 A;  4KZ4 A;  4R3B A;  4QWO A;  4BJP A;  2WKI A;  2XFS A;  4R3A A;  2V8F A;  1CF0 A;  1UWN X;  4X6T A;  3HLF A;  2JKG A;  3BM6 A;  4X69 A;  4KZB A;  2UV0 E;  5CGS A;  1DJC A;  2PBD P;  4OKP A;  4KZ7 A;  4HP4 A;  3V3S A;  4OOY A;  4OPZ A;  1IYP A;  2LB5 A;  4O7D A;  2VA0 A;  5EVI A;  4N9L A;  2M7U A;  3JPU A;  3GV9 A;  3VFH A;  1BUL A;  1N9B A;  3HLG A;  3LY4 A;  4FH4 A;  2V0W A;  2XDM A;  2ZC7 A;  4GN2 A;  1FOF A;  4DDY A;  5I5L A;  3O87 A;  2WAE A;  4EQ1 A;  4LFU A;  2K2N A;  5DVA A;  5DTT A;  2Q9N A;  5BOH A;  4MBH A;  3S22 A;  3UE3 A;  1UWP X;  5HW3 A;  3MSH A;  2PU4 A;  3UB5 P;  4WF0 A;  4MBF A;  4BLM A;  1OTA A;  3H7W B;  3W8K A;  1TVF A;  4HH2 A;  3KYQ A;  1I2W A;  4KQQ A;  2Y8H A;  4Q0H A;  3T4T A;  4P87 A;  3BFD A;  3MFD A;  2MJ6 A;  3F1N A;  4Y7P A;  4KG6 A;  1YQS A;  3G31 A;  3T1X A;  1LL8 A;  2RL3 A;  2PYR A;  3PXP A;  1DP6 A;  5EM1 A;  3P01 A;  4OP8 A;  1FCO A;  1HLU P;  2OSU A;  4KG2 A;  3MBZ A;  4E3I A;  4RX2 A;  3T12 B;  3FC7 A;  3DBA A;  4S2L A;  5FI6 A;  2VV8 A;  4N92 A;  4LV1 A;  1OTD A;  3PBS A;  4BBU A;  2VK3 A;  4XT2 A;  1NZU A;  3MQQ A;  3CI6 A;  4R6L A;  2GZA A;  1S0W A;  3ISG A;  2JCH A;  3UDF A;  4KQD A;  2Y2P A;  4KQR A;  2ZD8 A;  3NJA A;  3VP1 A;  3CUE A;  2P74 A;  3PR6 A;  3MFX A;  4X55 A;  4NXB A;  5J4E A;  5L2F A;  2Y79 A;  3IXG A;  1N9L A;  2ZM0 A;  5DJT A;  4OON A;  4QD4 A;  1FCN A;  2V2F F;  2W3G A;  3A0S A;  1ACF A;  4PKY A;  2P08 A;  4LPZ A;  3SZT A;  5HPF A;  2Y59 A;  4RYE A;  3G30 A;  4DRT A;  5FDH A;  1K4E A;  3A0V A;  4PM8 A;  5J8X A;  3IS2 A;  5HL1 A;  3LIA A;  5KSC A;  2K31 A;  4P6Z M;  1G6A A;  3UDX A;  1K6R A;  4QPR A;  4GHI A;  4BL2 A;  4U0X A;  1H8M A;  2NUT C;  2OWH A;  1MKM A;  4S2J A;  2PHY A;  2AVX A;  2VGL M;  1O7E A;  3VOY A;  4HI4 A;  4S2M A;  3ZFZ A;  3LCE A;  2Y2J A;  2W27 A;  2P04 A;  4KQO A;  1PI5 A;  3N8R A;  3MMH A;  2Z6C A;  3FPV A;  1L3L A;  1ZHH B;  4MBK A;  4UA9 A;  3ZVW A;  4JXS A;  1FSW A;  5E43 A;  3TSG A;  5DJU A;  3CMZ A;  2KDK A;  1LHY A;  2ZQD A;  4EWF A;  1HVB A;  4MN6 A;  3CG5 A;  3P98 A;  3E2L A;  4EUZ A;  3C4P A;  4ZDX A;  4HES A;  4Y3I A;  3W4P A;  4X53 A;  3ZQ5 A;  4EBN A;  3UY6 A;  3B33 A;  1PFL A;  3IX3 A;  1SCW A;  3GQZ A;  4LV2 A;  4X1L A;  1PZP A;  4GB7 A;  4WZ4 A;  5FAT A;  5AQ7 A;  3C38 A;  1RGY A;  5F68 A;  2ZMV A;  3WWX A;  5C5K A;  1T19 A;  2EXA A;  4HIA A;  4ZBE A;  5FEG A;  1DRM A;  2C5W B;  2J9O A;  4Q0I A;  3LR0 A;  3NUL A;  1G28 A;  3IX4 A;  3IH8 A;  2WZX A;  4DF6 A;  5DTK A;  1HD8 A;  3T50 A;  4OPR A;  4BD0 A;  4JKT A;  5DFY A;  4X1M A;  2V20 A;  4L9E A;  3K2N A;  4UA7 A;  3V3R A;  4XUX A;  1U60 A;  3BLM A;  1FIL A;  3C7V A;  4LLO B;  2HDU A;  2ZBB A;  4GW9 A;  2B02 A;  2BTF P;  2HDR A;  3V67 A;  4EV4 A;  5HWV A;  5IS1 A;  3GMW A;  4R0Q A;  1NY0 A;  1IEM A;  4MDZ A;  3ZVT A;  5CEC A;  4JGQ A;  1ONG A;  4WZ5 A;  3A0R A;  3PBR A;  5GLA A;  3B3X A;  1S1Z A;  2HJE A;  1OTB A;  3DTE A;  5A93 A;  5FQ9 A;  4E04 A;  2HF6 A;  4JGP A;  2G7U A;  3UE0 A;  3LR5 A;  3T1R A;  4GOG A;  4MNR A;  3VV4 A;  5F1F A;  1ES4 A;  4CLC E;  4CJN A;  4BBT A;  1MWR A;  1NRJ A;  1V9Y A;  3MR0 A;  4UQI M;  2KLI A;  4DE2 A;  5FAS A;  1KGE A;  1GHI A;  1YT4 A;  4X56 A;  1S1Y A;  3VP3 A;  2EX8 A;  3NDG A;  2ZM8 A;  2H28 A;  2M7V A;  5IT5 A;  2O9C A;  3K3D A;  1ERQ A;  3C7U A;  4HP9 A;  4EBP A;  1VHM A;  3MZE A;  1MKI A;  3T4S A;  3IQA A;  2X02 A;  1XGJ A;  5TFQ A;  3C5A A;  5EVL A;  3T4K A;  1W79 A;  3IWO A;  5CXW A;  1YMX A;  5HAQ A;  1JWP A;  2XF3 A;  4DXB A;  4ZJ1 A;  1PYY A;  3CZD A;  4OPQ A;  3MZD A;  1TDG A;  5FQI A;  1K54 A;  3D72 A;  4JF5 A;  1GHP A;  2H0Y A;  3OPP A;  4DMZ A;  2WKP A;  2BG1 A;  4Y13 A;  4N9K A;  2PAV P;  4BBV A;  4B4X A;  4OQH A;  3D3O A;  4F3L B;  2QPN A;  5FAP A;  5M1A A;  3CLO A;  3A3D A;  1M6K A;  4NET A;  4NXE A;  5DKK A;  2JKT I;  3ICY A;  1MZU A;  2R9W A;  1MWT A;  1P0Z A;  4GD8 A;  2JC7 A;  4GKU A;  2FZ0 A;  4OQI A;  2JHE A;  4EEU A;  4HNB A;  4Z9Q A;  4K91 A;  3PTE A;  2O9A A;  4E3L A;  5F1G A;  1XJ4 A;  2FFY A;  1ZC2 A;  2HDS A;  1SDE A;  3TG9 A;  3PAE A;  2ZJ9 A;  4WEK A;  3W4Q A;  1GSX A;  2IA2 A;  2D02 A;  4G3V A;  1PW1 A;  4R38 A;  1W8Q A;  3LGO A;  4JF4 A;  1S67 L;  3SS4 A;  5F5Y A;  2ZC5 B;  3GVB A;  3BYD A;  1ZKJ A;  1MXO A;  1ES5 A;  4JXV A;  1EI5 A;  2L4R A;  1MPL A;  3E2K A;  1F9I A;  3RJU A;  2VKS A;  3AGF A;  4KZ3 A;  1STZ A;  4QJG A;  3PBT A;  4MCW A;  1CI8 A;  5AQ9 A;  5M19 A;  4ARZ B;  5EVI C;  2VEA A;  4I38 A;  2GJ3 A;  4WM9 A;  4EUV A;  1LLB A;  2VZW A;  2Z2M B;  3A3F A;  3MQO A;  2Z6D A;  1FCM A;  4KZA A;  1TF1 A;  2HGV A;  4L9G A;  1KE4 A;  1LL5 A;  1KGG A;  4LEN A;  1NXY A;  4CLC A;  4KG5 A;  4U3T A;  1DJB A;  4IBX A;  3IWI A;  3BRM A;  5L8M A;  1LI0 A;  4RQ9 A;  2W0N A;  3IWQ A;  4H6J B;  4Y2F A;  2B95 A;  2O99 A;  1KE0 A;  3A3E A;  3Q07 A;  1EW0 A;  1RCJ A;  5KIZ A;  4P85 A;  4JLF A;  1IOU A;  1TEM A;  3HLE A;  1E4D A;  5E2E A;  4ETX A;  1BLS A;  3MXS A;  1LSV A;  4EW7 A;  1O07 A;  2VX8 A;  4OQG A;  2OV5 A;  5GHY A;  1H5X A;  2L0W A;  2XGN A;  3SS5 A;  4GD6 A;  3RXW A;  3W4O A;  3LIC A;  4WUJ A;  3G35 A;  3TOI A;  1K25 A;  1L2S A;  3FKW A;  2GDN A;  1CJF A;  4IVI A;  4PMA A;  4OLG A;  4ME4 A;  1T1C A;  3EEA A;  5LBR A;  4OOM A;  5EV0 A;  1KVL A;  2EA9 A;  3D9Y A;  4R1G A;  1ESU A;  4DDS A;  3OPH A;  3ZGA B;  2OAQ 1;  5KSH A;  3LEQ A;  5L10 A;  3FZC A;  3M2K A;  1N9N A;  3PYP A;  4F94 A;  2IWC A;  3S4X A;  3BFE A;  3BFF A;  2EXB A;  3RH8 B;  3VOZ A;  1PW8 A;  1AXB A;  3E4P A;  1YMS A;  3M6H A;  4LRX C;  4FSF A;  3PBN A;  3R4K A;  5TGF A;  2QJ5 A;  1K38 A;  1K55 C;  2XR0 A;  4BWI A;  1VEU A;  4DE1 A;  4K0W A;  1XJ6 A;  4Q8I A;  1K57 C;  1XKZ A;  1WE4 A;  2V1Z A;  4D2O A;  4K08 A;  2QYB A;  2WGW B;  3N8L A;  3FWL A;  4I39 A;  3TE8 A;  1BLP A;  1L0D A;  5EEC A;  1FIK A;  4Y0U A;  2HP5 A;  3IBR A;  1K56 D;  3C8C A;  3KYZ A;  1MBL A;  3SOI A;  4NG2 A;  3F1P B;  5FAO A;  1VET B;  4KUO A;  2VGK A;  5DF7 A;  1W63 Q;  3G2Z A;  1XJ3 A;  5I94 A;  3HLB A;  4NKP A;  1S4S A;  1OT6 A;  1GA9 A;  3R7W A;  2VV7 A;  4WMC D;  2ZMF A;  1OPX A;  2QHK A;  3G4P A;  3TW8 A;  1VQQ A;  4WBG A;  4HHD A;  1K6S A;  3GTC A;  3UE1 A;  3ZG5 A;  5KMW A;  4UAA A;  1FR6 A;  3VE4 A;  3ZNT A;  3UMD A;  1ERM A;  3NIA A;  1H0M A;  3UPN A;  4KZ6 A;  2Y55 A;  4HJ3 A;  2QZ6 A;  3BY8 A;  4PM7 A;  1OT9 A;  2PD7 A;  3H7W A;  1X0O A;  1DP8 A;  5DF8 A;  2ZQC A;  1DJA A;  4RX3 A;  4BMW A;  4WL9 A;  4I3I A;  4IBR A;  3N4I A;  2W3D A;  2R9X A;  2XFT A;  3OZH A;  2V8C A;  1P97 A;  3VFF A;  1SKO B;  1BZA A;  4PM5 A;  5EPH A;  3KSI A;  3NOP C;  3OCL A;  2H5S A;  2ZQ8 A;  3ZG8 B;  2CMN A;  2JKT M;  1E3U A;  1DP9 A;  2RCX A;  5CTM A;  2XEP A;  1Y54 A;  2PT7 A;  1OTI A;  5HDD A;  2C6W B;  1RGZ A;  4PKY G;  1S6R A;  1CEG A;  4S2K A;  2YKF A;  5GHX A;  4S2N C;  4HOI A;  3A3I A;  2XK1 A;  2DMW A;  3BLS A;  1YLJ A;  3P09 A;  4RA7 A;  1NYM A;  4MLL A;  2DRW A;  2I9V A;  4Y0T A;  4ID4 A;  1BLC A;  5TJJ A;  3T4Q A;  4MN7 A;  1MWU A;  3HCY A;  5FAQ A;  3SH9 A;  2L1M A;  3LR4 A;  3Q7Z A;  1P9R A;  3N6I A;  3E4Q A;  3LR3 A;  4UEY A;  4HH3 A;  2XH9 A;  2JBF A;  4YNR A;  3LIF A;  4C6Y A;  4S2I A;  1PWD A;  1AWI A;  4GS9 B;  3O88 A;  1D7E A;  1G5U A;  2A49 A;  4HJ6 A;  1MWS A;  4Z1W A;  1XP4 A;  2J3T D;  2PDR A;  3G6O A;  2LB9 A;  1JVJ A;  5GHZ A;  3GR2 A;  4GLQ A;  3T1Q B;  4GHI B;  2WKE A;  1XFN A;  2XD1 A;  4S2O A;  3CUE C;  2IWB A;  3GSG A;  3QP4 A;  1H8Y A;  2UWX A;  3DWZ A;  3FYZ A;  1A0K A;  3SS3 A;  5CGX A;  4OLD A;  4LGW A;  5FA7 A;  4XXR A;  4L0L A;  4YFM A;  1KOU A;  1ESI A;  2VGJ A;  2M1C A;  3Q1F A;  4OP5 A;  4ZTK A;  1VEU B;  3LI9 A;  1Q2Q A;  2V1A A;  1IEL A;  4BQM A;  1PZO A;  2XRO A;  2XD5 A;  3E4O A;  2G2W A;  3QHY A;  2WUQ A;  2WKH A;  4DE0 A;  1FQG A;  3H9W A;  4Y5F A;  1I2S A;  5CRF A;  2J7V A;  2ZOI A;  2HP9 A;  4II7 A;  4U0T A;  4EES A;  1NYY A; 
#chains in the Genus database with same CATH homology
 4KZ3 A;  3W8K A;  4WEJ A;  1TVF A;  3Q82 A;  3ZDJ A;  4QJG A;  3PBT A;  1CI8 A;  5AQ9 A;  1WYC A;  1I2W A;  4KQQ A;  5GL9 A;  3G34 A;  5M19 A;  5EVI C;  4P87 A;  3BFD A;  2WGV A;  3MFD A;  1PI4 A;  4Y7P A;  3MKE A;  4KG6 A;  1YQS A;  3G31 A;  3O86 A;  4OH0 A;  2PBY A;  4R4S A;  2HP6 A;  2RL3 A;  4OPY A;  3O3V A;  5HAR A;  5G18 A;  4WM9 A;  1LLB A;  2Y2L A;  4DXC A;  4DE3 A;  1QMF A;  2Z2M B;  3AGD A;  1FCO A;  3A3F A;  4OP8 A;  3VSL A;  2OSU A;  1FCM A;  4OOL A;  4KG2 A;  2WYX A;  3VP2 A;  3MBZ A;  2BLS A;  4KZA A;  4E3I A;  5HAI A;  1KE4 A;  1JTD A;  1LL5 A;  4RX2 A;  1KGG A;  1DY6 A;  4GDN A;  4LEN A;  1NXY A;  5FI2 A;  1YLZ A;  4S2L A;  2Y4A A;  5FI6 A;  5FQQ A;  3AGF A;  4KG5 A;  2Y2M A;  4LV1 A;  4N92 A;  4U3T A;  3NY4 A;  1IYQ A;  1DJB A;  3PBS A;  4IBX A;  3WS2 A;  3IWI A;  3BRM A;  1LI0 A;  2OLV A;  4QU3 A;  5F82 A;  3G2Y A;  1NZU A;  5E2H A;  3IWQ A;  5EUA A;  1S0W A;  2ZC3 B;  4QHC A;  2Y2O A;  1CK3 A;  3ISG A;  2IWD A;  2JCH A;  3UDF A;  4KQR A;  2Y2P A;  2ZD8 A;  1K55 A;  3VP1 A;  2P74 A;  3OPR A;  1ONH A;  3DTM A;  4PM6 A;  1KE0 A;  4X55 A;  3IF6 B;  5L2F A;  3A3E A;  4MEZ A;  3Q07 A;  1NRF A;  1M40 A;  4R23 A;  3IXG A;  3S1Y A;  3D4F A;  2ZM0 A;  1RCJ A;  4OON A;  3ZHH A;  4P85 A;  4JLF A;  1TEM A;  3HLE A;  3LO7 A;  1E4D A;  4QD4 A;  5E2E A;  2ZM2 A;  1FCN A;  1NJ4 A;  1SDN A;  2V2F F;  1FSY A;  1BLS A;  1Z6F A;  1IKG A;  1ZG6 A;  3MXS A;  1O07 A;  3M2J A;  4M3K A;  4X68 A;  5IHV A;  3IXD A;  4OQG A;  2OV5 A;  5GHY A;  1H5X A;  2Y59 A;  3NBL A;  3OCN A;  4RYE A;  3UO9 A;  2FFF B;  2XGN A;  4E3K A;  4OVD A;  3BEC A;  3SS5 A;  2WAD A;  3G30 A;  4GD6 A;  5FDH A;  3RXW A;  1K4E A;  1ZG4 A;  1IYS A;  2DNS A;  4DRT A;  3W4O A;  4FD8 A;  4PM8 A;  5CED A;  5J8X A;  3C4O A;  1YLP A;  5HL1 A;  3IXB A;  3G35 A;  5HFO A;  1KVM A;  3N7W A;  5CEB A;  5KSC A;  3RXX A;  3TOI A;  5EE8 A;  3ITA A;  1K25 A;  4B88 A;  1G6A A;  1L2S A;  1XPB A;  3FKW A;  3UDX A;  4CPK A;  4ZJ3 A;  2GDN A;  1K6R A;  3HUO A;  3HLW A;  4IVI A;  4PMA A;  3MXR A;  3UNW A;  4BL2 A;  4U0X A;  1HZO A;  2EX9 A;  4JXG A;  3IXH A;  4OLG A;  3FKV A;  4S2J A;  2HPB A;  3ITB A;  4HBT A;  4KZ5 A;  4OOM A;  3NI9 A;  2Y2I A;  3UPO A;  1KVL A;  5A91 A;  5FI7 A;  2WGI A;  1ALQ A;  1O7E A;  3VOY A;  4R1G A;  1ESU A;  4DDS A;  3OPH A;  2XQZ A;  4S2M A;  3ZGA B;  3ZFZ A;  3LCE A;  2Y2J A;  4BD1 A;  5KSH A;  3Q7V B;  4KQO A;  1PI5 A;  3FZC A;  3UDI A;  3M2K A;  1YLW A;  3N8R A;  4F94 A;  3AGE A;  4E3N A;  1H8Z A;  2IWC A;  4WZ5 C;  4MBK A;  3S4X A;  2G2U A;  4UA9 A;  3BFE A;  3ZVW A;  1LI9 A;  3BFF A;  4JXS A;  1FSW A;  3QNC A;  5E43 A;  5CHJ A;  3TSG A;  2EXB A;  3CMZ A;  1LHY A;  2ZQD A;  3ZG7 B;  3VOZ A;  4EWF A;  1BT5 A;  1HVB A;  1OME A;  1PW8 A;  3NDE A;  2ZC6 B;  1L0F A;  3CG5 A;  1IYO A;  3E2L A;  3P98 A;  3WS0 A;  4EUZ A;  1AXB A;  1PWG A;  3C4P A;  3MZF A;  3QNB A;  1YLT A;  3IF6 C;  1W5D A;  5U47 A;  1CEF A;  1YMS A;  3M6H A;  4HBU A;  4HES A;  4ZDX A;  4IED A;  3G32 A;  4QY5 A;  3W4P A;  4X53 A;  4FSF A;  4E6X A;  1XX2 A;  1KDS A;  1Q2P A;  3UY6 A;  4EBN A;  3PBN A;  4WMC A;  5D3O A;  1SCW A;  3GQZ A;  4YIN A;  4LV2 A;  3V5M A;  5TGF A;  4XUZ A;  1PZP A;  4GB7 A;  4WZ4 A;  2XR0 A;  1K38 A;  1K55 C;  5AQ7 A;  5FAT A;  5EVI B;  4C3Q A;  1RGY A;  3HRE A;  1JWV A;  4DE1 A;  4K0W A;  2Y2Q A;  4Q8I A;  4ZAM A;  3WWX A;  1K57 C;  3GRJ A;  1EWZ A;  2EXA A;  4ZBE A;  2Q9M A;  1XKZ A;  1WE4 A;  5KZH A;  2V1Z A;  1IKI A;  5F83 A;  2WGW A;  3PBO A;  4PM9 A;  3HLD A;  2C5W B;  2J9O A;  3FV7 A;  3HUM A;  4D2O A;  3IH8 A;  2CC1 A;  3JYI A;  2WZX A;  3IT9 A;  2WGW B;  2Y2G A;  4DF6 A;  3N8L A;  5DTK A;  2H0T A;  3FWL A;  1HD8 A;  4KZ8 A;  5AQA A;  4LV3 A;  3NCK A;  1ES2 A;  2J8Y A;  5DTS A;  1GHM A;  1BLP A;  4OPR A;  1ES3 A;  4BD0 A;  1L0D A;  3WRT A;  4JKT A;  5EEC A;  4QY6 A;  4Y0U A;  2I72 A;  2HP5 A;  2V20 A;  2ZC4 B;  1K56 D;  2P9V A;  3N8S A;  3UN7 A;  2ZQ7 A;  4WYY A;  5JYO A;  1FR1 A;  1XA7 A;  3VSK A;  1MBL A;  4EBL A;  3OC2 A;  5GLC A;  1KDW A;  4JPM A;  4UA7 A;  3SOI A;  3V3R A;  1GCE A;  2WAF A;  2WZZ A;  4XUX A;  3OPL A;  3BFG A;  1U60 A;  1K54 C;  5FAO A;  2QMI A;  1W8Y A;  3BLM A;  4DKI A;  1K57 A;  3BEB A;  3CJM A;  3EQV A;  5E2G A;  2VGK A;  3IF5 A;  5DF7 A;  1BSG A;  3C7V A;  3EQU A;  3G2Z A;  2HDU A;  5I94 A;  3HLB A;  1SKF A;  3I7J A;  2HDR A;  4N1X A;  3WS4 A;  1GA9 A;  4EV4 A;  4WMC D;  3GMW A;  4R0Q A;  4N1H A;  3V39 A;  1CI9 A;  2H10 A;  1NY0 A;  4H8R A;  1IEM A;  4C75 A;  3PBQ A;  3G4P A;  5FSR A;  3ZVT A;  1VQQ A;  2WK0 A;  3BFC A;  5CEC A;  4WBG A;  2EFU A;  2JE5 A;  1K6S A;  3GTC A;  1ONG A;  2E8I A;  4WZ5 A;  3IHB A;  3PBR A;  4EQI A;  5GLA A;  2P9V B;  3B3X A;  3UE1 A;  1SHV A;  3ZG5 A;  5KMW A;  4UAA A;  1FR6 A;  3ZNT A;  1ERM A;  3NIA A;  5A93 A;  3UPN A;  5EOO A;  5M18 A;  4KZ6 A;  4JF6 A;  2Y55 A;  5DF9 A;  2QZ6 A;  1L0E A;  4WEL A;  4PM7 A;  3ZG0 A;  1XA1 A;  5FQ9 A;  4FH2 A;  5DF8 A;  4LCM A;  1HTZ A;  5GLB A;  2ZQC A;  1DJA A;  2Y2N A;  2Z2L B;  4P6B A;  4RX3 A;  1K4F A;  3IF6 A;  3UE0 A;  4GOG A;  4MNR A;  4R3J A;  5F1F A;  2OLU A;  3Q7V A;  1GA0 A;  3LY3 A;  4IBR A;  3N4I A;  2X01 A;  1ES4 A;  4RVA A;  4CJN A;  1WYB A;  1MWR A;  3WS5 A;  2R9X A;  2XFT A;  3OZH A;  5EOE A;  4R4R A;  5TR7 A;  4P0M A;  5CTN A;  4DE2 A;  1KE3 A;  1QME A;  3MKF A;  3WS1 A;  3VFF A;  4BL3 A;  3HUN A;  1I5Q A;  5FAS A;  1BZA A;  1GHI A;  1KGE A;  5GLD A;  4PM5 A;  5CGW A;  5EPH A;  1YT4 A;  3IH9 A;  3OCL A;  1BUE A;  2H5S A;  2ZQ8 A;  3ZG8 B;  1W7F A;  4X56 A;  3VP3 A;  1E3U A;  2RCX A;  3A3J A;  4A5R A;  2EX8 A;  5CTM A;  2XEP A;  3NDG A;  2ZM8 A;  1Y54 A;  4BEN A;  1JWZ A;  2C6W B;  1PIO A;  1RGZ A;  1ERQ A;  1S6R A;  1CEG A;  3C7U A;  3LEZ A;  4S2K A;  1J9M A;  4GZB A;  4EBP A;  5CER A;  5GHX A;  5E2F A;  3MZE A;  4S2N C;  1MKI A;  2B5R A;  3A3I A;  2XK1 A;  3IQA A;  1BLH A;  2X02 A;  2ZMA A;  3BLS A;  2ZQA A;  1YLJ A;  1N4O A;  3P09 A;  1XGJ A;  1NYM A;  3HL9 A;  4LCL A;  4RA7 A;  5HX9 A;  4MLL A;  1BTL A;  5FQM A;  4UHU A;  2DRW A;  5TFQ A;  5JYP A;  3C5A A;  3HLC A;  4Y0T A;  4ID4 A;  5EVL A;  1BLC A;  1W79 A;  3IWO A;  4K0X A;  5CXW A;  1YMX A;  5HAQ A;  1TDL A;  3ZCZ A;  3VMA A;  2X71 A;  3Q81 A;  1JWP A;  5A92 A;  2XF3 A;  4DXB A;  4ZJ1 A;  1PYY A;  4E3J A;  2EX2 A;  5FQK A;  1MWU A;  3ZG9 B;  3CZD A;  5FAQ A;  1E25 A;  2EX6 A;  4OPQ A;  3SH9 A;  3HVF A;  3Q7Z A;  1E3U D;  2EFX A;  4E6W A;  3MZD A;  1TDG A;  2A3U A;  3HBR A;  1K54 A;  3N6I A;  4NK3 A;  1XXM A;  4JF5 A;  4S2P A;  5FQI A;  3SH7 A;  4JXW A;  4UA6 A;  5EVI D;  1GHP A;  4GNU A;  2H0Y A;  3OPP A;  2BG1 A;  5A90 A;  2J9P A;  4N9K A;  5AQB A;  1YLY A;  4B4X A;  4OQH A;  4B4Z A;  2XH9 A;  3VP4 A;  2JBF A;  2QPN A;  5FAP A;  2HDQ A;  3SH8 A;  5M1A A;  2Y2K A;  4C6Y A;  4KEN B;  4S2I A;  4Y0O A;  4QB8 A;  1PWD A;  3A3D A;  1C3B A;  3DWK A;  2ZLY A;  5CHM A;  1M6K A;  3O88 A;  3M6B A;  5CHU A;  4NET A;  1L0G A;  4S2N A;  2A49 A;  4HEF A;  1MWS A;  2Y91 A;  1XP4 A;  5HAP A;  4OQ0 A;  2R9W A;  1ERO A;  3V50 A;  1K56 A;  1MWT A;  1XGI A;  2ZQ9 A;  3DW0 A;  4KZ4 A;  1JVJ A;  4R3B A;  5GHZ A;  3GR2 A;  4BJP A;  4GD8 A;  4KZ9 A;  2WKI A;  2XFS A;  1PWC A;  2XLN A;  2JC7 A;  4GKU A;  2WKE A;  4X6T A;  3HLF A;  2XD1 A;  3BM6 A;  4S2O A;  4OQI A;  4X69 A;  4E3O A;  3ZNY A;  4KZB A;  5CGS A;  2IWB A;  3GSG A;  1DJC A;  4Z9Q A;  3VP0 A;  4K91 A;  1H8Y A;  1YM1 A;  3PTE A;  1RP5 A;  1LL9 A;  1MY8 A;  4OKP A;  2UWX A;  4IVK A;  4PPR A;  3DWZ A;  4KZ7 A;  4E3L A;  4LV0 A;  3FYZ A;  5F1G A;  2FFY A;  3V3S A;  3SS3 A;  1ZC2 A;  4OOY A;  5CGX A;  2PU2 A;  1NZO A;  4OLD A;  2HDS A;  5FA7 A;  1SDE A;  3NC8 A;  4XXR A;  3PAE A;  2ZJ9 A;  4WEK A;  4OPZ A;  4L0L A;  3TG9 A;  3W4Q A;  1IYP A;  4O7D A;  4YFM A;  4ZJ2 A;  1ESI A;  3PAG A;  2VGJ A;  3Q1F A;  4OP5 A;  5EVI A;  4ZTK A;  1KGF A;  4N9L A;  3WRZ A;  4FCF A;  3GV9 A;  3IHA A;  3VFH A;  1PW1 A;  1BUL A;  5FQJ A;  1N9B A;  1Q2Q A;  3HLG A;  3LY4 A;  4FH4 A;  1IEL A;  1VM1 A;  1W8Q A;  2XDM A;  4JF4 A;  2ZC7 A;  4BQM A;  1PZO A;  4GN2 A;  1FOF A;  2XD5 A;  3SS4 A;  2G2W A;  2DCF A;  3QHY A;  4DDY A;  2WUQ A;  3O87 A;  2Y2H A;  4GDB A;  2WAE A;  2ZC5 B;  2WKH A;  4DE0 A;  1FQG A;  3GVB A;  5DVA A;  5DTT A;  3BYD A;  1G68 A;  2Q9N A;  5BOH A;  4MBH A;  3S22 A;  1ZKJ A;  1MXO A;  3UE3 A;  1ES5 A;  4JXV A;  1I2S A;  4E3M A;  5CRF A;  1EI5 A;  2J7V A;  2PU4 A;  5HW3 A;  1JTG A;  2HP9 A;  1MPL A;  4JBF A;  3E2K A;  4MBF A;  4BLM A;  4U0T A;  3RJU A;  1NYY A;  3UPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...