2A49A

Crystal structure of clavulanic acid bound to e166a variant of shv-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title High Resolution Crystal Structures of the trans-Enamine Intermediates Formed by Sulbactam and Clavulanic Acid and E166A SHV-1 {beta}-Lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2a49A00
1FOFA 1MWRA 2Q9MA 5CERA 5CTNA 3V5MA 4X69A 4OP5A 3AGFA 4IVKA 1TEMA 2XFSA 4KZ6A 3C4OA 5GHYA 5CHUA 2JC7A 4X55A 5U47A 1K54A 3ITBA 1K54C 3S1YA 4U0XA 3ZG8B 1DY6A 2ZD8A 4U3TA 5EVIC 3CZDA 2HP5A 4GOGA 5AQ9A 3IWIA 3RJUA 4CPKA 1BZAA 2WZXA 3HLGA 2R9WA 3Q7VA 5HX9A 2PBYA 3D4FA 3MZEA 2Y2MA 1YMSA 1YLWA 4S2MA 1ERQA 1DJCA 1K56A 2ZQAA 4X68A 2HP9A 4E3LA 4Y0TA 1JWZA 3GV9A 2X02A 2J7VA 4P0MA 3WS0A 4B88A 2R9XA 2EX8A 1YLPA 4GD6A 4N9KA 5FAQA 3ZG5A 5J8XA 4UHUA 2WAFA 1K6SA 4E3IA 1C3BA 3HLCA 1MBLA 2V1ZA 3FZCA 4MEZA 4O7DA 4QY6A 3VP2A 3HUMA 1ES5A 1S0WA 3ZDJA 3IT9A 4S2NA 1YLZA 3A3JA 4S2NC 3Q1FA 3FWLA 2PU2A 3GMWA 1BSGA 2Q9NA 1NRFA 2ZQ8A 2J8YA 5FI2A 3UO9A 2HPBA 3O87A 4WMCD 4KZ5A 3BM6A 1JVJA 4LV2A 3N7WA 2HDQA 4P6BA 1SHVA 1BTLA 3N8LA 1HVBA 1TVFA 5M1AA 5HAPA 1RGZA 5F1FA 4PM6A 1ALQA 3NC8A 3IXGA 5E2GA 3W4PA 3RXXA 5I94A 3WS1A 4IBXA 5FDHA 5DVAA 3SH9A 2EXAA 3BRMA 1W8QA 3OZHA 1KE0A 1ONGA 2XEPA 3IQAA 4WZ4A 5A90A 1LI0A 1S6RA 4R4RA 4RVAA 1Q2PA 4XUZA 3HLFA 2WUQA 4UA6A 4BD1A 3V3SA 2Y91A 4R23A 4KZ3A 1PWGA 2X01A 3IF6A 3MKFA 1FCMA 2G2WA 3NI9A 1ES3A 1YLYA 4FH4A 3S4XA 4KZ9A 4HEFA 2EX6A 4LCMA 2X71A 5FSRA 2QPNA 4EWFA 4IVIA 1BLSA 3ZGAB 4WBGA 3DWKA 3ISGA 1M6KA 5E2EA 2HDSA 2Y2JA 3PAEA 1JTDA 3NY4A 4GD8A 5FQ9A 5A93A 4GN2A 5CTMA 2GDNA 3W8KA 2BG1A 3GQZA 4PM8A 3WRTA 2WZZA 3TSGA 3HREA 3BFGA 3UY6A 1RCJA 1L0DA 4UAAA 4X6TA 1MXOA 1ES2A 3W4QA 4BENA 3BECA 4RA7A 3I7JA 1GA0A 1GA9A 5FQQA 3ZVTA 5HAQA 4BL3A 4OPQA 5F1GA 2XDMA 5E2FA 5GHXA 1K57A 3O88A 2Y2OA 4KZ4A 1K57C 2ZQCA 5JYOA 2XFTA 2EFXA 3IWQA 2ZC5B 1XX2A 3P09A 4RYEA 2XGNA 1XPBA 4EUZA 1BT5A 3EQVA 3IXHA 3DTMA 2ZC6B 3S22A 1NYMA 3ZG7B 3TG9A 4GDNA 1CK3A 2BLSA 4OP8A 3MFDA 1N4OA 3A3EA 3C7UA 3PBOA 2Y55A 2IWBA 4YFMA 1Z6FA 1PWDA 1NYYA 2E8IA 3M2JA 4E6WA 2EX9A 5M18A 3OPLA 1KE3A 4JF5A 3M6HA 4X53A 4N1HA 3FYZA 4ZJ3A 3VOYA 1ZG4A 1G6AA 3BFFA 3C4PA 3AGEA 1IYSA 1IEMA 3G34A 4WZ5A 2OLVA 3ZVWA 1U60A 4WZ5C 4S2OA 3IHBA 4FH2A 2G2UA 4E3NA 2PU4A 3PAGA 4F94A 1SDNA 2JCHA 1XP4A 4KZBA 5DF7A 3GVBA 4U0TA 5F82A 1MWUA 1XGJA 4KZ7A 2WKHA 1WYCA 5EVIB 3LCEA 2WGWB 2IWCA 1IKIA 3UPNA 5GLAA 3AGDA 1PIOA 4MNRA 4K0XA 1MPLA 2Y2NA 1VM1A 3WS5A 5FQJA 3W4OA 4HESA 4OOLA 4OQHA 2OLUA 2H10A 1YLJA 4EBPA 5A92A 4JBFA 1IYOA 4JXVA 3VFHA 3ZHHA 2XR0A 1KDSA 4EBNA 1K4FA 3CJMA 3OPHA 3ZNYA 2H0TA 2WGWA 3PBTA 1M40A 3PTEA 1JWPA 2A49A 1NY0A 4DE3A 3UDFA 1L0EA 2Y59A 3G35A 1O07A 3G2ZA 2RCXA 4NK3A 1KE4A 5KMWA 1PI5A 4XXRA 4KZ8A 3G32A 1HD8A 1EWZA 1BULA 1SDEA 4KZAA 2ZM2A 3G4PA 1WYBA 4JF4A 2FFYA 2C5WB 1N9BA 1NXYA 1QMEA 3VP4A 2Y4AA 3BFCA 1GHPA 3O86A 4MBHA 3VMAA 3HLBA 1ZC2A 3BFDA 3Q82A 1RP5A 4IBRA 1LHYA 3UPOA 3E2LA 4S2KA 4DE0A 2RL3A 5KSHA 5HFOA 4DXBA 4KG2A 5EVID 3WWXA 4MLLA 1VQQA 2DRWA 4KQQA 2A3UA 4KG5A 4WELA 4QB8A 4PPRA 5FA7A 3OC2A 3MZFA 5KZHA 5KSCA 3IF5A 4DE1A 5AQ7A 3IF6C 2ZC3B 4Y7PA 1L0GA 5F83A 5G18A 4ZAMA 5FAPA 1I5QA 5EE8A 4LV1A 2WKEA 3NCKA 5D3OA 2XLNA 5FQKA 5L2FA 2B5RA 5CECA 3BEBA 1FCNA 1KVMA 2ZC7A 2OV5A 3HLDA 4E6XA 3GRJA 3MKEA 1BLCA 2XK1A 3SS4A 2Y2KA 5JYPA 2V20A 3HLWA 1G68A 1IYPA 2FFFB 1YT4A 4S2JA 4S2PA 1NZUA 2ZQ9A 5EPHA 5FATA 1FR6A 4QHCA 4YINA 1KGGA 3G30A 1MWTA 2XD1A 1YLTA 4QU3A 4OQ0A 4WM9A 3QHYA 4KG6A 1LL5A 1LL9A 2JE5A 4JPMA 3VOZA 2WGVA 2HP6A 4DDYA 5FAOA 2DCFA 4E3JA 3MBZA 5CGXA 5BOHA 4D2OA 5GHZA 4OONA 4ZTKA 2HDRA 3UE1A 3ZNTA 4C3QA 5FI7A 1LI9A 4MBFA 4A5RA 2ZC4B 4E3KA 5CRFA 1PYYA 5HAIA 3BLSA 1ZG6A 2Y2IA 1BUEA 3HL9A 3QNBA 4R3BA 4ZJ2A 4K0WA 4E3MA 3UE3A 4ZDXA 5HW3A 3JYIA 1GCEA 5HL1A 4QD4A 3Q7ZA 5A91A 2XF3A 3IWOA 1JTGA 3ZFZA 2P9VB 4B4XA 1L2SA 1PW1A 4OQIA 5EOEA 4DKIA 3WS2A 1L0FA 3OCNA 2UWXA 3SH7A 1XA7A 4BQMA 1FR1A 4KQRA 4R1GA 2ZM0A 1E25A 1K25A 3PBQA 1W7FA 4BLMA 1TDLA 1ES4A 3CG5A 1FQGA 3IXDA 4EBLA 4OLDA 2XD5A 2Y2QA 3ZG0A 2VGJA 3EQUA 2WKIA 3V50A 3M2KA 1ESIA 4WMCA 4OOMA 5EOOA 2WK0A 1K55A 3O3VA 3P98A 4K91A 1K55C 1I2SA 2ZQDA 4DDSA 5M19A 1H8ZA 4R3JA 3UE0A 4PM5A 1ERMA 4PM9A 2H0YA 2WAEA 4GB7A 3Q7VB 3IXBA 2HDUA 4C6YA 4CJNA 2ZJ9A 5DTKA 3NDEA 3A3FA 2JBFA 4OPZA 2EX2A 4GZBA 4RX2A 5CHJA 1E3UD 3FKWA 3LY4A 4R4SA 1JWVA 4X56A 3RXWA 1FSYA 4ZJ1A 4FCFA 1FCOA 1NJ4A 1QMFA 2IWDA 5CGWA 2OSUA 4L0LA 4ZBEA 5GLDA 5EVIA 1KVLA 3M6BA 2P74A 3SS5A 2XH9A 2QMIA 4DXCA 1IELA 4PM7A 4JKTA 4N9LA 1MWSA 1OMEA 5HARA 3HUNA 4OPYA 3WS4A 2Y2PA 4WYYA 1EI5A 3LEZA 4EQIA 1W5DA 4UA7A 1I2WA 4GNUA 3HUOA 4BJPA 4S2IA 2ZLYA 3N8RA 3N4IA 1XXMA 4KENB 4UA9A 5TFQA 5CEDA 3ZCZA 1YM1A 5GLCA 2VGKA 1DJAA 2J9PA 4DF6A 4JLFA 1IKGA 2Z2MB 1KGFA 3DW0A 3OCLA 1K4EA 3QNCA 4QY5A 4S2LA 1YMXA 5EVLA 4OOYA 1EROA 3MXRA 4R0QA 4OH0A 3V3RA 3WRZA 2I72A 1XKZA 5IHVA 1BLHA 3V39A 3IH9A 1E4DA 2V2FF 1XGIA 4WEJA 3UNWA 1CEFA 3HVFA 4QJGA 5DTSA 3PBNA 3N6IA 1W8YA 1SKFA 1RGYA 3C5AA 1GHIA 4B4ZA 3OPRA 4JF6A 2H5SA 2XQZA 4M3KA 3DWZA 4PMAA 2EFUA 5GLBA 1CI9A 4Q8IA 1CI8A 2WGIA 2Z2LB 4OPRA 3IF6B 1W79A 1KDWA 2DNSA 4LCLA 1K56D 3IHAA 4RX3A 2CC1A 2Y2LA 3HLEA 4P85A 3GTCA 5CGSA 4ID4A 2WYXA 5DF8A 3B3XA 5CEBA 3NBLA 3NDGA 5DF9A 3PBSA 4OLGA 4C75A 1LLBA 5TR7A 1Y54A 4GKUA 4JXSA 1PZPA 4HBTA 4E3OA 1FSWA 2ZM8A 5EUAA 4OKPA 3UDIA 2WADA 2Y2GA 3BYDA 1PZOA 3N8SA 1K6RA 1NZOA 3FV7A 5GL9A 5CXWA 3LO7A 4OVDA 4LENA 1O7EA 4MBKA 4OQGA 4LV0A 3OPPA 5FQMA 4DRTA 1MY8A 1GHMA 3SH8A 1PI4A 1HZOA 4FD8A 3BLMA 3HBRA 1H5XA 1IYQA 3VP3A 3PBRA 4FSFA 4BD0A 3SOIA 5CHMA 2C6WB 5DTTA 5EECA 1ONHA 3FKVA 3VSKA 1AXBA 4N1XA 5TGFA 4Y0OA 3ZG9B 1Q2QA 4WEKA 5E43A 1E3UA 4JXGA 2EXBA 4Y0UA 3Q81A 1CEGA 1K38A 3UDXA 2QZ6A 4BL2A 3E2KA 4IEDA 1YQSA 3NIAA 5E2HA 4XUXA 4JXWA 1ESUA 5AQBA 1SCWA 3Q07A 3SS3A 1PW8A 2Y2HA 1ZKJA 4Z9QA 3GR2A 1XA1A 2ZQ7A 5FQIA 4N92A 3CMZA 3VFFA 1WE4A 4KQOA 2J9OA 1BLPA 2ZMAA 4LV3A 2P9VA 3VP0A 3ITAA 1J9MA 1PWCA 3VSLA 4NETA 1TDGA 3G2YA 1H8YA 4DE2A 5FI6A 3A3DA 3A3IA 5AQAA 3BFEA 3LY3A 3TOIA 1KGEA 3UPPA 1HTZA 3C7VA 5FASA 3VP1A 1DJBA 4P87A 1MKIA 3IH8A 4HBUA 3MZDA 4EV4A 3GSGA 4H8RA 3UN7A 3MXSA 3G31A 4GDBA
chains in the Genus database with same CATH superfamily
1FOFA 3V5MA 4L9EA 4IVKA 1TEMA 4YWZA 3T4LA 1KOUA 3ITBA 3S1YA 3ZG8B 4U0XA 1DY6A 4U3TA 5AQ9A 2AVXA 2WZXA 3MZEA 4LPZA 3NOPC 1YMSA 4LLOB 1ERQA 4X68A 2R9XA 1YLPA 2WAFA 4QY6A 4O7DA 1ES5A 1S0WA 4S2NA 4BBTA 3T1QB 3GMWA 1BSGA 4DJ2A 3TW8A 5FI2A 3UO9A 4WMCD 3FC7A 4G3KA 4KZ5A 3BM6A 4LV2A 3N7WA 5M1AA 1ALQA 2ZL1B 3NC8A 4B93A 4IBXA 1PRQA 2EXAA 3BRMA 1W8QA 1MZUA 3EGDC 4XUZA 4LGWA 4R4RA 4WF0A 4BD1A 3LEQA 4R23A 2X01A 2V8CA 3T50A 1FCMA 3K3CA 2G2WA 3NI9A 1ES3A 1ODVA 2QPNA 5AVFA 3UB9A 4RQ9A 3KO6A 4WBGA 4GD8A 1JTDA 1DP6A 4GN2A 3BQAA 1GSXA 3UY6A 4FUWA 1L0DA 2W3HA 1MXOA 1VETA 3W4QA 4BENA 3I7JA 1GA9A 4UQIM 3ZVTA 5GHXA 1K57A 5L07A 2ACGA 4MCWA 4Q0HA 3P09A 3CLOA 4NEED 3EQVA 3IXHA 1TS7A 4DJ3A 2BLSA 3MFDA 2DMWA 2IWBA 2QYBA 2E8IA 3LR3A 4E6WA 5M18A 3OPLA 4N1HA 3UB7A 3BFFA 1IYSA 1IEMA 3G34A 5TJJA 3F1OA 3ZVWA 2KDKA 4WZ5C 4S2OA 3OBFA 4E3NA 5EM1A 4CLCE 1S4SA 2JCHA 1XP4A 5DFYA 5DF7A 3GVBA 2HJ9C 3T12B 5EVIB 3T4JA 4HNBA 1PIOA 4MNRA 3T4KA 2Y2NA 1YLJA 3VFHA 1KDSA 2GX5A 1CQAA 3ZNYA 1OPXA 2JKRI 2Y79A 4X25A 2XA7S 3P01A 3G35A 3G2ZA 2VX8A 4XXRA 3CITA 3GDIA 4KZ8A 1UWNX 1HD8A 2JKTM 2ZBBA 3G4PA 4JF4A 4EESA 2GJ3A 3U4LP 1NXYA 2V0WA 5IT5A 1L3LA 2B02A 3BFCA 3BY8A 2OAP1 1YPRA 2KX6A 1LHYA 3E2LA 4S2KA 1VQQA 2A3UA 3T4TA 4QB8A 4F3LB 5AQ7A 2ZC3B 2O9BA 1I5QA 3NCKA 1S4RA 2ZC7A 2OV5A 3GRJA 5HWTA 2XK1A 2Y2KA 2V20A 3HLWA 5HWWA 3E4PA 1G68A 2FFFB 1YT4A 1YLTA 3H82A 4QU3A 2K7SA 3QHYA 1LL5A 1LL9A 2O99A 3VOZA 2QJ5A 3C30A 3V67A 4E3JA 4O01A 2QKPA 3R7WA 4OONA 4C3QA 2WKRA 4G3VA 4A5RA 4JGQA 3CUEA 4E3KA 2R78A 2Y2IA 3HL9A 3UE3A 2J3WA 3JYIA 1GCEA 2W1RA 3PR6A 2FH5A 5HDCA 5HL1A 4HY8A 3IWOA 1LSXA 4IHQA 4OQIA 3LIFA 1L0FA 3NHQA 4GCZA 3SH7A 1XA7A 3TRCA 4KQRA 2ZM0A 1TDLA 3ULFA 3ZG0A 2PD7A 4HP9A 4I39A 2WK0A 3O3VA 4WL9A 1K55C 2ZQDA 4R3JA 4PM5A 3OLOA 3F1NA 2KOIA 4GB7A 3A3FA 4RX2A 3BW6A 4ZJ1A 4ZBEA 4GS9A 1OT6A 2QMIA 3IS2A 1MWSA 1SZVA 3WS4A 2IA2A 1YSPA 4NXBA 2KLIA 5F69A 3ZCZA 1YM1A 3OCLA 2VZWA 5I5LA 1YMXA 3UMDA 3MXRA 3V3RA 3WRZA 1OT9A 5IHVA 4QJGA 5FEGA 2VK3A 4LFUA 2YKFA 1SKFA 4KUOA 1RGYA 3C2WA 4M3KA 3DWZA 3G6OA 4PMAA 1CI9A 5C5KA 1W79A 2DNSA 1K56D 1VEUB 4P85A 3GTCA 5CGSA 2WYXA 4E04A 1TD5A 3NBLA 5DF9A 4OLGA 1LLBA 3FG8A 5TR7A 1Y54A 3CWFA 1XFQA 2ZM8A 1DRMA 3EGXC 3BYDA 2P7JA 3MS6A 1K6RA 1NZOA 3LO7A 2W1TA 4LRYC 3SH8A 3JVUA 5DTTA 2O9CA 4Y0OA 2HF6A 4JXGA 2EXBA 3CPTB 4Y0UA 2QZ6A 2L0WA 1DP8A 3LI8A 5AQBA 2W3DA 1ESUA 1SCWA 2Z6DA 2PD8A 4Z9QA 1D06A 4HI4A 1T1AA 2QJ7A 2D01A 2P9VA 3VP0A 1ACFA 1PWCA 4NETA 1TDGA 1VB6A 1H8YA 3G2YA 2W3EA 5FI6A 3TOIA 1DJBA 3MSHA 4P87A 1MKIA 4HBUA 3BQ8A 3GSGA 3UN7A 5CTNA 4KZ6A 5GHYA 2JHEA 4X55A 2ZD8A 5EVIC 2HJEA 1OTDA 2OOLA 4CPKA 3HLGA 5HX9A 1Z09A 4EETB 2ZQAA 2HP9A 1OJGA 3S7NA 4Y0TA 2X02A 2J7VA 3ZG5A 2XRNA 2Y8HA 1K6SA 1C3BA 3HLCA 1MBLA 2V1ZA 1XJ3A 3EEAA 1H0MA 5L8MA 1YLZA 3A3JA 4S2NC 2PU2A 1H8MA 1NRFA 2HDQA 4P6BA 3KSGA 1SHVA 1BTLA 1HVBA 4PM6A 3EEHA 3IXGA 3W4PA 4IUKA 2K31A 4XT2B 4NXEA 3LR0A 5FDHA 1TS0A 4M4XA 1P97A 5A90A 3TE8A 1NLYA 2ZL1A 1T18A 2PYRA 1PWGA 3IF6A 3MKFA 5DKLA 5FSRA 4EWFA 2HZ5A 1BLSA 3IX8A 1M6KA 3PAEA 2Y2JA 2BG1A 3WRTA 2WZZA 3TSGA 3BFGA 3DTIA 1YSQA 5FQQA 3D9YA 3E98A 5HAQA 2XDMA 4KZ4A 1K57C 2XFTA 1XX2A 4RYEA 2XGNA 3DTMA 3S22A 2M1CA 4WLAA 1CK3A 4DN0A 4YFMA 1PWDA 3M2JA 5A8BA 2HGVA 1KE3A 4O8GA 4X53A 5HPIA 4ZJ3A 3VOYA 1F98A 3AGEA 3PYPA 5DJTA 2O0YA 1SKOB 2XA7M 3IHBA 4FH2A 5DJUA 4F94A 4KZBA 4HHDA 2E8JA 4U0TA 2VEAA 1A0KA 4JGOA 2IWCA 3AGDA 4PAUA 4K0XA 1MPLA 4PKYG 1MKMA 4JXVA 1K4FA 3CJMA 5AVEA 3QP2A 1M40A 4DE3A 3UDFA 1O07A 2QHKA 2RCXA 5KMWA 4NXGA 1PI5A 1BULA 1SDEA 3DBAA 5DKKA 3HLBA 1RP5A 1OTBA 5KSHA 4KG2A 5EVID 2DRWA 4WELA 4PPRA 5KZHA 5KSCA 4DE1A 4Y7PA 5F83A 5G18A 4ZAMA 5EE8A 4HJ3A 1XJ2A 5FQKA 4E6XA 5EM0A 4F3LA 5EV0A 2B95A 3DTEA 1FR6A 4QHCA 1MWTA 1OTAA 5HDDA 4OQ0A 4KG6A 3PXPA 2JE5A 4JPMA 2WGVA 2HP6A 4HQAA 5FAOA 4R6LA 1S66L 3MBZA 2OAQ1 5CGXA 5GHZA 3UE1A 2HDRA 4CLCB 1LI9A 4MBFA 5CRFA 3JVVA 4GHIA 4QD4A 2XF3A 3ZFZA 1L2SA 4DKIA 3WS2A 2L1MA 1E25A 1K25A 1W7FA 2A24B 3NOUC 3H7WB 2Q0OA 4II7A 4NKPA 3P98A 5M19A 1I2SA 1T1BA 2WAEA 3IXBA 2HDUA 4C6YA 4CJNA 2ZJ9A 4Y3IA 2JBFA 1E3UD 1T19A 1JWVA 2IWDA 5GLDA 2OSUA 2P74A 3SS5A 3E4QA 4PM7A 2VLGA 4GW9A 5EFWA 1OMEA 4WUJA 1EI5A 2MJ6A 3NECA 4UA7A 3HUOA 2ZLYA 5K5BA 5TFQA 1LT0A 1XXMA 1P9RA 1P9WA 4UA9A 2V1AA 5GLCA 1DJAA 4JLFA 3DW0A 4QY5A 4S2LA 4R0QA 1BLHA 3V39A 3IH9A 4MN6A 3KX0X 1XGIA 1CEFA 2J80A 1GSVA 4H6JA 1W8YA 2EWVA 3C5AA 1GHIA 3MQOA 4B4ZA 4K08A 3T1SA 2EFUA 5GLBA 4Q8IA 1CI8A 2Z2LB 1KDWA 4LCLA 2PHYA 4NG2A 3HLEA 1OTEA 5CEBA 3NDGA 3PBSA 2PYPA 1IFQA 1PZPA 4HBTA 1FSWA 5EUAA 1YKDA 1J3WA 4QWOA 1VETB 3FV7A 4P6ZM 3LR4A 1O7EA 4OQGA 5HD3A 3OPPA 5FQMA 1GHMA 3BLMA 3HBRA 1H5XA 3VP3A 4FSFA 5MC7A 1Y4OA 1XJ6A 5CHMA 2O9AA 1STZA 4N1XA 1Q2QA 3Q81A 1K38A 3UDXA 4FTXA 4BL2A 3NIAA 3SS3A 1PW8A 2Y2HA 5G4ZA 3GR2A 4NXFA 1V9ZA 4KQOA 2J9OA 3RFBA 1BLPA 3ITAA 2WKQA 3CPTA 3NULA 3A3DA 1KGEA 1S67L 2ZOHA 3MZDA 4EV4A 4H8RA 3MXSA 1CJFA 4GDBA 2Q9MA 4OP5A 3C4OA 5CX7A 2JC7A 5U47A 1K54A 5TBMA 3RJUA 1CF0A 4ETZA 3Q7VA 2W0NA 2PBYA 2H28A 2Y2MA 4LRXC 4AFIA 4ARZA 1K56A 3JPUA 5BOHA 5J4EA 1JWZA 4HP4A 4P0MA 4B88A 5J8XA 4E3IA 3FZCA 2PR5A 3B42A 3VP2A 3ZDJA 1F2KA 4EU0A 3FWLA 1IOUA 4HJ6A 2Q9NA 2ZQ8A 2J8YA 2K2NA 3QP8A 3O87A 4Z1WA 3SW1A 1RGZA 3RXXA 3UB5P 2XROA 3D3OA 3EWKA 3WS1A 4IJGA 5DVAA 3SH9A 3OZHA 1KE0A 4WZ4A 1LI0A 2V1BA 2WUQA 3A0VA 2Y91A 4KZ3A 4UEYA 3UB6A 2OWJA 4PHTA 1H3QA 4FH4A 1YLYA 4HEFA 4LCMA 2LB5A 3DWKA 3ISGA 3LFVA 5FL3A 2HDSA 3D72A 5FQ9A 5A93A 5CTMA 1HLUP 3GQZA 1WA9A 1LL8A 3R7WB 3HREA 1RCJA 2PT7A 4X6TA 3F1PA 1DP9A 1GA0A 2ZMFA 4BL3A 4OPQA 2YKHA 2VV6A 5E2FA 1UGUA 2ZQCA 4CLCC 2EFXA 2W3GA 3IWQA 1PFLA 3IBRA 4P6ZS 4EUZA 4Y17A 2ZC6B 3QP1A 3C7UA 2Y55A 3ZQ5A 4L9FA 4CQHA 1G6AA 2J3TC 1LSVA 3KYEA 2OLVA 1W63Q 3F1NB 3FPWA 1U60A 5HDSA 2NUTC 3PAGA 5HWVA 1SDNA 3T4QA 1FIKA 1MWUA 4I3JA 1XGJA 3A0RA 4KZ7A 3IX3A 2WKHA 1WYCA 1K0KA 3LCEA 3E4OA 4GS9B 2WGWB 3E0YA 5GLAA 3RTYA 3IS2B 1VM1A 3W4OA 1SKOA 2ZMVA 4HESA 3MFXA 4OOLA 4EBPA 5A92A 1IYOA 2P04A 4EBNA 2XR0A 2JKTI 2P08A 3T1RA 2H0TA 5EVEA 1NY0A 1Y28A 3QP4A 5HZHA 3H9WA 4KZAA 3MJQA 2C5WB 1G28A 2Y4AA 4MBHA 1ZC2A 3IX4A 4IBRA 3UPOA 4DE0A 3B47A 4DXBA 4MLLA 4I3IA 3LGOA 4KQQA 5FA7A 3OC2A 4GLQA 1F5MA 4LV1A 3T1XA 5D3OA 5L2FA 2B5RA 3BEBA 1KVMA 1OJ5A 3HLDA 2W1TB 2VGLM 5JYPA 2B18A 4S2JA 4S2PA 1NZUA 2ZQ9A 5EPHA 4B9OA 5FATA 1KGGA 2OWHA 3G30A 2XD1A 3HCYA 5FDSA 4DDYA 2DCFA 4D2OA 2PRFA 4ZTKA 5FI7A 4I3AA 3LICA 5CEDA 5HAIA 1ZG6A 4R3BA 3W2ZA 4ZDXA 5HW3A 3BY9A 3KYQA 1JTGA 2P9VB 4B4XA 1PW1A 1BYWA 2UWXA 1G6OA 1X0OA 1FR1A 4R1GA 3EOIA 3R4KA 3UMEA 1ES4A 1FQGA 4EBLA 2JKGA 4OLDA 2GNXA 2VGJA 2WKIA 3M2KA 5HPFA 1ESIA 1JNUA 4WMCA 4OOMA 2UV0E 5EOOA 1GSWA 5F5YA 4K91A 2BTFP 4DDSA 1N9LA 3UE0A 4HH2A 1ERMA 3H7WA 3LIAA 3NDEA 2EX2A 4GZBA 3LY4A 3T4OA 4R3AA 4X56A 3RXWA 1FSYA 4CLCD 1FCOA 1QMFA 5CGWA 1TS6A 5EVIA 1S1YA 4ZRRA 2XH9A 4DXCA 4X1LA 4JKTA 4N9LA 5HARA 4OPYA 4WYYA 1UWPX 4EQIA 1W5DA 4Y5FA 1I2WA 4L9GA 4PKYA 4BJPA 3S7PA 4R70A 3N8RA 2J3TD 2J9PA 4DF6A 1N9NA 2Z2MB 1KGFA 1K4EA 5EVLA 4OOYA 4OH0A 1XKZA 2V2FF 3UNWA 2XSSA 2L4RA 5DTSA 4HJ4A 3PBNA 4D60A 4JF6A 3KSHA 1T1CA 4Y2FA 3IF6B 4RX3A 2CC1A 4EERA 5J7EA 5DF8A 4MMNA 4C75A 4WN5A 4DMZA 4JXSA 4E3OA 1W63M 2WADA 4Y13A 2Y2GA 3N8SA 5F6AA 3VE3A 5CXWA 4MBKA 5AJGA 4FD8A 3CUEC 1IYQA 5J3WA 3PBRA 2EWWA 3SOIA 4BBVA 5EECA 5L10A 1AXBA 5TGFA 3ZG9B 2VGLS 1F9IA 3KSIA 1E3UA 3VV4A 1CEGA 3E2KA 5F68A 4JXWA 1ZKJA 1XA1A 2ZQ7A 3CMZA 3VFFA 2ZMAA 4LV3A 4EW7A 1J9MA 3VSLA 4HIAA 3A3IA 2D02A 3C7VA 3NJAA 5FASA 3VP1A 3IH8A 3BJNA 1MWRA 1TF1A 5CERA 4X69A 2PBDP 3AGFA 2XFSA 2V9AA 4EXOA 3L9KA 5CHUA 1ZHHB 1K54C 5G4YA 3UE6A 3S7QA 3CZDA 2HP5A 4GOGA 3IWIA 1BZAA 2R9WA 3TJZC 3D4FA 3PHYA 4YNRA 1P0ZA 1YLWA 4S2MA 2BASA 1DJCA 4E3LA 3GV9A 3WS0A 2EX8A 4GD6A 4N9KA 5FAQA 2INWA 4UHUA 4MEZA 3HUMA 4X1MA 2I9VA 3IT9A 3Q1FA 3U2AA 4IUHA 2G7UA 3LUQA 2HPBA 1JVJA 3N8LA 1TVFA 5HAPA 2VJWA 5F1FA 3NOTC 5E2GA 5I94A 1VHMA 3VE4A 1ONGA 2XEPA 3IQAA 1S6RA 4RVAA 1Q2PA 3HLFA 1MC0A 4UA6A 3GECA 2VKSA 3V3SA 3OOVA 4G3WA 3LIEA 4EUVA 3S4XA 4KZ9A 2EX6A 1VEUA 2X71A 3A0SA 4IVIA 3ZGAB 5E2EA 3NY4A 2M7VA 2GDNA 3W8KA 2EA9A 4PM8A 4UAAA 1ES2A 4GHIB 3BECA 4RA7A 3MMHA 1FILA 1TS8A 5F1GA 3O88A 2Y2OA 4LRZE 5JYOA 1G5UA 2ZC5B 3B33A 1XPBA 3K2NA 1BT5A 1NYMA 3ZG7B 3TG9A 4GDNA 3F1OB 4OP8A 1N4OA 3A3EA 3PBOA 4I38A 2PAVP 1Z6FA 1NYYA 3QP5A 2EX9A 4JF5A 3M6HA 3FYZA 3C38A 1ZG4A 4Y15A 3C4PA 2W3FA 4JGRA 4UQIS 4WZ5A 2G2UA 2PU4A 2VV7A 2PDRA 5F82A 4EEUA 3QP6A 1IKIA 3UPNA 2V8FA 1S1ZA 4HH3A 3MR0A 3WS5A 5FQJA 4OQHA 2OLUA 2H10A 4JBFA 3ZHHA 4O0PA 3OPHA 5L09A 2WGWA 3PBTA 3PTEA 1JWPA 2A49A 1YAXA 1L0EA 2Y59A 4NK3A 1KE4A 3MF0A 2ZOIA 3G32A 3MQ0A 4HOIA 1EWZA 2ZM2A 1WYBA 4H6JB 2FFYA 1N9BA 3KYZA 1QMEA 3VP4A 2QWSA 5KIZA 5IS1A 3CHWP 2JKFA 1GHPA 2VA0A 3O86A 3VMAA 3BFDA 3Q82A 1NRJA 2RL3A 5HFOA 3WWXA 4EEPA 4KG5A 3LR5A 2CMNA 1ZTUA 3MZFA 4XT2A 3IF5A 1N9OA 3IF6C 1L0GA 5FAPA 2WKEA 3H82B 2XLNA 5CECA 4BWIA 1FCNA 3MKEA 1BLCA 3SS4A 1LSWA 4Q0JA 1IYPA 3MXQA 4YINA 4WM9A 3P7NA 3LI9A 4QPRA 3UB8A 3KSFA 3MQQA 3ZNTA 2ZC4B 1PYYA 2A2LA 4MN7A 3BLSA 1BUEA 3QNBA 4ZJ2A 4E3MA 2Z6CA 4K0WA 3DTKA 3Q7ZA 1OTIA 3RH8B 5A91A 1D7EA 3SZTA 5EOEA 1XFNA 3OCNA 4GJ4A 4BQMA 3PBQA 4BLMA 2VV8A 3BWLA 4Q0IA 3CG5A 2V0UA 3ICYA 3IXDA 2W27A 2XD5A 2Y2QA 3EQUA 3V50A 4ETXA 5IU1A 5TBMB 1K55A 2LB9A 1H8ZA 4PM9A 2H0YA 4FOFA 3Q7VB 3S7OA 5DTKA 4OPZA 4ARZB 5CHJA 3FKWA 3L7HA 5HD5A 4R4SA 4FCFA 1NJ4A 3LIBA 2FZ0A 4L0LA 1KVLA 2NUPC 3M6BA 5FEFA 2GZAA 1IELA 3HUNA 2Y2PA 3LEZA 1XJ4A 4YOFA 4GNUA 4S2IA 3DAVA 3HJKA 3CI6A 3N4IA 4KENB 4BBUA 3ZYTA 2PR6A 2JKRM 2VGKA 1IKGA 3QNCA 1EROA 2I72A 1NWZA 4EQ1A 1AWIA 1E4DA 3HJIA 4WEJA 2HV1A 3HVFA 3K3DA 3N6IA 4I5SA 3OPRA 2H5SA 2XQZA 4ESPA 3O5YA 1V9YA 1PNEA 3T4SA 2WGIA 4OPRA 2JN7A 3IHAA 2Y2LA 3IBJA 4ID4A 3B3XA 4ME4A 4KUKA 4MN5A 4GKUA 3LIDA 4OKPA 3UDIA 3CAXA 1PZOA 3F1PB 2M7UA 5GL9A 4OVDA 1D1JA 4LENA 5HL6A 3VOLA 4LV0A 5HSQA 4DRTA 1MY8A 1PI4A 1HZOA 5DFXA 5LBRA 4BD0A 2C6WB 1ONHA 3FKVA 3VSKA 1NLZA 4R38A 4MDZA 4WEKA 5E43A 4CLCA 2WKPA 4IEDA 3LYXA 1YQSA 5E2HA 4XUXA 3Q07A 5FQIA 4N92A 1WE4A 3C8CA 4JGPA 4BMWA 4DE2A 1EW0A 5AQAA 3BFEA 3LY3A 3UPPA 1HTZA 2A24A 4KQDA 3FPVA 3G31A
chains in the Genus database with same CATH topology
1FOFA 1MWRA 2Q9MA 5CERA 5CTNA 3V5MA 4X69A 4OP5A 3AGFA 4IVKA 1TEMA 2XFSA 4KZ6A 3C4OA 5GHYA 5CHUA 2JC7A 4X55A 5U47A 1K54A 3ITBA 1K54C 3S1YA 4U0XA 3ZG8B 1DY6A 2ZD8A 4U3TA 5EVIC 3CZDA 2HP5A 4GOGA 5AQ9A 3IWIA 3RJUA 4CPKA 1BZAA 2WZXA 3HLGA 2R9WA 3Q7VA 5HX9A 2PBYA 3D4FA 3MZEA 2Y2MA 1YMSA 1YLWA 4S2MA 1ERQA 1DJCA 1K56A 2ZQAA 4X68A 2HP9A 4E3LA 4Y0TA 1JWZA 3GV9A 2X02A 2J7VA 4P0MA 3WS0A 4B88A 2R9XA 2EX8A 1YLPA 4GD6A 4N9KA 5FAQA 3ZG5A 5J8XA 4UHUA 2WAFA 1K6SA 4E3IA 1C3BA 3HLCA 1MBLA 2V1ZA 3FZCA 4MEZA 4O7DA 4QY6A 3VP2A 3HUMA 1ES5A 1S0WA 3ZDJA 3IT9A 4S2NA 1YLZA 3A3JA 4S2NC 3Q1FA 3FWLA 2PU2A 3GMWA 1BSGA 2Q9NA 1NRFA 2ZQ8A 2J8YA 5FI2A 3UO9A 2HPBA 3O87A 4WMCD 4KZ5A 3BM6A 1JVJA 4LV2A 3N7WA 2HDQA 4P6BA 1SHVA 1BTLA 3N8LA 1HVBA 1TVFA 5M1AA 5HAPA 1RGZA 5F1FA 4PM6A 1ALQA 3NC8A 3IXGA 5E2GA 3W4PA 3RXXA 5I94A 3WS1A 4IBXA 5FDHA 5DVAA 3SH9A 2EXAA 3BRMA 1W8QA 3OZHA 1KE0A 1ONGA 2XEPA 3IQAA 4WZ4A 5A90A 1LI0A 1S6RA 4R4RA 4RVAA 1Q2PA 4XUZA 3HLFA 2WUQA 4UA6A 4BD1A 3V3SA 2Y91A 4R23A 4KZ3A 1PWGA 2X01A 3IF6A 3MKFA 1FCMA 2G2WA 3NI9A 1ES3A 1YLYA 4FH4A 3S4XA 4KZ9A 4HEFA 2EX6A 4LCMA 2X71A 5FSRA 2QPNA 4EWFA 4IVIA 1BLSA 3ZGAB 4WBGA 3DWKA 3ISGA 1M6KA 5E2EA 2HDSA 2Y2JA 3PAEA 1JTDA 3NY4A 4GD8A 5FQ9A 5A93A 4GN2A 5CTMA 2GDNA 3W8KA 2BG1A 3GQZA 4PM8A 3WRTA 2WZZA 3TSGA 3HREA 3BFGA 3UY6A 1RCJA 1L0DA 4UAAA 4X6TA 1MXOA 1ES2A 3W4QA 4BENA 3BECA 4RA7A 3I7JA 1GA0A 1GA9A 5FQQA 3ZVTA 5HAQA 4BL3A 4OPQA 5F1GA 2XDMA 5E2FA 5GHXA 1K57A 3O88A 2Y2OA 4KZ4A 1K57C 2ZQCA 5JYOA 2XFTA 2EFXA 3IWQA 2ZC5B 1XX2A 3P09A 4RYEA 2XGNA 1XPBA 4EUZA 1BT5A 3EQVA 3IXHA 3DTMA 2ZC6B 3S22A 1NYMA 3ZG7B 3TG9A 4GDNA 1CK3A 2BLSA 4OP8A 3MFDA 1N4OA 3A3EA 3C7UA 3PBOA 2Y55A 2IWBA 4YFMA 1Z6FA 1PWDA 1NYYA 2E8IA 3M2JA 4E6WA 2EX9A 5M18A 3OPLA 1KE3A 4JF5A 3M6HA 4X53A 4N1HA 3FYZA 4ZJ3A 3VOYA 1ZG4A 1G6AA 3BFFA 3C4PA 3AGEA 1IYSA 1IEMA 3G34A 4WZ5A 2OLVA 3ZVWA 1U60A 4WZ5C 4S2OA 3IHBA 4FH2A 2G2UA 4E3NA 2PU4A 3PAGA 4F94A 1SDNA 2JCHA 1XP4A 4KZBA 5DF7A 3GVBA 4U0TA 5F82A 1MWUA 1XGJA 4KZ7A 2WKHA 1WYCA 5EVIB 3LCEA 2WGWB 2IWCA 1IKIA 3UPNA 5GLAA 3AGDA 1PIOA 4MNRA 4K0XA 1MPLA 2Y2NA 1VM1A 3WS5A 5FQJA 3W4OA 4HESA 4OOLA 4OQHA 2OLUA 2H10A 1YLJA 4EBPA 5A92A 4JBFA 1IYOA 4JXVA 3VFHA 3ZHHA 2XR0A 1KDSA 4EBNA 1K4FA 3CJMA 3OPHA 3ZNYA 2H0TA 2WGWA 3PBTA 1M40A 3PTEA 1JWPA 2A49A 1NY0A 4DE3A 3UDFA 1L0EA 2Y59A 3G35A 1O07A 3G2ZA 2RCXA 4NK3A 1KE4A 5KMWA 1PI5A 4XXRA 4KZ8A 3G32A 1HD8A 1EWZA 1BULA 1SDEA 4KZAA 2ZM2A 3G4PA 1WYBA 4JF4A 2FFYA 2C5WB 1N9BA 1NXYA 1QMEA 3VP4A 2Y4AA 3BFCA 1GHPA 3O86A 4MBHA 3VMAA 3HLBA 1ZC2A 3BFDA 3Q82A 1RP5A 4IBRA 1LHYA 3UPOA 3E2LA 4S2KA 4DE0A 2RL3A 5KSHA 5HFOA 4DXBA 4KG2A 5EVID 3WWXA 4MLLA 1VQQA 2DRWA 4KQQA 2A3UA 4KG5A 4WELA 4QB8A 4PPRA 5FA7A 3OC2A 3MZFA 5KZHA 5KSCA 3IF5A 4DE1A 5AQ7A 3IF6C 2ZC3B 4Y7PA 1L0GA 5F83A 5G18A 4ZAMA 5FAPA 1I5QA 5EE8A 4LV1A 2WKEA 3NCKA 5D3OA 2XLNA 5FQKA 5L2FA 2B5RA 5CECA 3BEBA 1FCNA 1KVMA 2ZC7A 2OV5A 3HLDA 4E6XA 3GRJA 3MKEA 1BLCA 2XK1A 3SS4A 2Y2KA 5JYPA 2V20A 3HLWA 1G68A 1IYPA 2FFFB 1YT4A 4S2JA 4S2PA 1NZUA 2ZQ9A 5EPHA 5FATA 1FR6A 4QHCA 4YINA 1KGGA 3G30A 1MWTA 2XD1A 1YLTA 4QU3A 4OQ0A 4WM9A 3QHYA 4KG6A 1LL5A 1LL9A 2JE5A 4JPMA 3VOZA 2WGVA 2HP6A 4DDYA 5FAOA 2DCFA 4E3JA 3MBZA 5CGXA 5BOHA 4D2OA 5GHZA 4OONA 4ZTKA 2HDRA 3UE1A 3ZNTA 4C3QA 5FI7A 1LI9A 4MBFA 4A5RA 2ZC4B 4E3KA 5CRFA 1PYYA 5HAIA 3BLSA 1ZG6A 2Y2IA 1BUEA 3HL9A 3QNBA 4R3BA 4ZJ2A 4K0WA 4E3MA 3UE3A 4ZDXA 5HW3A 3JYIA 1GCEA 5HL1A 4QD4A 3Q7ZA 5A91A 2XF3A 3IWOA 1JTGA 3ZFZA 2P9VB 4B4XA 1L2SA 1PW1A 4OQIA 5EOEA 4DKIA 3WS2A 1L0FA 3OCNA 2UWXA 3SH7A 1XA7A 4BQMA 1FR1A 4KQRA 4R1GA 2ZM0A 1E25A 1K25A 3PBQA 1W7FA 4BLMA 1TDLA 1ES4A 3CG5A 1FQGA 3IXDA 4EBLA 4OLDA 2XD5A 2Y2QA 3ZG0A 2VGJA 3EQUA 2WKIA 3V50A 3M2KA 1ESIA 4WMCA 4OOMA 5EOOA 2WK0A 1K55A 3O3VA 3P98A 4K91A 1K55C 1I2SA 2ZQDA 4DDSA 5M19A 1H8ZA 4R3JA 3UE0A 4PM5A 1ERMA 4PM9A 2H0YA 2WAEA 4GB7A 3Q7VB 3IXBA 2HDUA 4C6YA 4CJNA 2ZJ9A 5DTKA 3NDEA 3A3FA 2JBFA 4OPZA 2EX2A 4GZBA 4RX2A 5CHJA 1E3UD 3FKWA 3LY4A 4R4SA 1JWVA 4X56A 3RXWA 1FSYA 4ZJ1A 4FCFA 1FCOA 1NJ4A 1QMFA 2IWDA 5CGWA 2OSUA 4L0LA 4ZBEA 5GLDA 5EVIA 1KVLA 3M6BA 2P74A 3SS5A 2XH9A 2QMIA 4DXCA 1IELA 4PM7A 4JKTA 4N9LA 1MWSA 1OMEA 5HARA 3HUNA 4OPYA 3WS4A 2Y2PA 4WYYA 1EI5A 3LEZA 4EQIA 1W5DA 4UA7A 1I2WA 4GNUA 3HUOA 4BJPA 4S2IA 2ZLYA 3N8RA 3N4IA 1XXMA 4KENB 4UA9A 5TFQA 5CEDA 3ZCZA 1YM1A 5GLCA 2VGKA 1DJAA 2J9PA 4DF6A 4JLFA 1IKGA 2Z2MB 1KGFA 3DW0A 3OCLA 1K4EA 3QNCA 4QY5A 4S2LA 1YMXA 5EVLA 4OOYA 1EROA 3MXRA 4R0QA 4OH0A 3V3RA 3WRZA 2I72A 1XKZA 5IHVA 1BLHA 3V39A 3IH9A 1E4DA 2V2FF 1XGIA 4WEJA 3UNWA 1CEFA 3HVFA 4QJGA 5DTSA 3PBNA 3N6IA 1W8YA 1SKFA 1RGYA 3C5AA 1GHIA 4B4ZA 3OPRA 4JF6A 2H5SA 2XQZA 4M3KA 3DWZA 4PMAA 2EFUA 5GLBA 1CI9A 4Q8IA 1CI8A 2WGIA 2Z2LB 4OPRA 3IF6B 1W79A 1KDWA 2DNSA 4LCLA 1K56D 3IHAA 4RX3A 2CC1A 2Y2LA 3HLEA 4P85A 3GTCA 5CGSA 4ID4A 2WYXA 5DF8A 3B3XA 5CEBA 3NBLA 3NDGA 5DF9A 3PBSA 4OLGA 4C75A 1LLBA 5TR7A 1Y54A 4GKUA 4JXSA 1PZPA 4HBTA 4E3OA 1FSWA 2ZM8A 5EUAA 4OKPA 3UDIA 2WADA 2Y2GA 3BYDA 1PZOA 3N8SA 1K6RA 1NZOA 3FV7A 5GL9A 5CXWA 3LO7A 4OVDA 4LENA 1O7EA 4MBKA 4OQGA 4LV0A 3OPPA 5FQMA 4DRTA 1MY8A 1GHMA 3SH8A 1PI4A 1HZOA 4FD8A 3BLMA 3HBRA 1H5XA 1IYQA 3VP3A 3PBRA 4FSFA 4BD0A 3SOIA 5CHMA 2C6WB 5DTTA 5EECA 1ONHA 3FKVA 3VSKA 1AXBA 4N1XA 5TGFA 4Y0OA 3ZG9B 1Q2QA 4WEKA 5E43A 1E3UA 4JXGA 2EXBA 4Y0UA 3Q81A 1CEGA 1K38A 3UDXA 2QZ6A 4BL2A 3E2KA 4IEDA 1YQSA 3NIAA 5E2HA 4XUXA 4JXWA 1ESUA 5AQBA 1SCWA 3Q07A 3SS3A 1PW8A 2Y2HA 1ZKJA 4Z9QA 3GR2A 1XA1A 2ZQ7A 5FQIA 4N92A 3CMZA 3VFFA 1WE4A 4KQOA 2J9OA 1BLPA 2ZMAA 4LV3A 2P9VA 3VP0A 3ITAA 1J9MA 1PWCA 3VSLA 4NETA 1TDGA 3G2YA 1H8YA 4DE2A 5FI6A 3A3DA 3A3IA 5AQAA 3BFEA 3LY3A 3TOIA 1KGEA 3UPPA 1HTZA 3C7VA 5FASA 3VP1A 1DJBA 4P87A 1MKIA 3IH8A 4HBUA 3MZDA 4EV4A 3GSGA 4H8RA 3UN7A 3MXSA 3G31A 4GDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOF A;  1MWR A;  2Q9M A;  5CER A;  5CTN A;  3V5M A;  4X69 A;  4OP5 A;  3AGF A;  4IVK A;  1TEM A;  2XFS A;  4KZ6 A;  3C4O A;  5GHY A;  5CHU A;  2JC7 A;  4X55 A;  5U47 A;  1K54 A;  3ITB A;  1K54 C;  3S1Y A;  4U0X A;  3ZG8 B;  1DY6 A;  2ZD8 A;  4U3T A;  5EVI C;  3CZD A;  2HP5 A;  4GOG A;  5AQ9 A;  3IWI A;  3RJU A;  4CPK A;  1BZA A;  2WZX A;  3HLG A;  2R9W A;  3Q7V A;  5HX9 A;  2PBY A;  3D4F A;  3MZE A;  2Y2M A;  1YMS A;  1YLW A;  4S2M A;  1ERQ A;  1DJC A;  1K56 A;  2ZQA A;  4X68 A;  2HP9 A;  4E3L A;  4Y0T A;  1JWZ A;  3GV9 A;  2X02 A;  2J7V A;  4P0M A;  3WS0 A;  4B88 A;  2R9X A;  2EX8 A;  1YLP A;  4GD6 A;  4N9K A;  5FAQ A;  3ZG5 A;  5J8X A;  4UHU A;  2WAF A;  1K6S A;  4E3I A;  1C3B A;  3HLC A;  1MBL A;  2V1Z A;  3FZC A;  4MEZ A;  4O7D A;  4QY6 A;  3VP2 A;  3HUM A;  1ES5 A;  1S0W A;  3ZDJ A;  3IT9 A;  4S2N A;  1YLZ A;  3A3J A;  4S2N C;  3Q1F A;  3FWL A;  2PU2 A;  3GMW A;  1BSG A;  2Q9N A;  1NRF A;  2ZQ8 A;  2J8Y A;  5FI2 A;  3UO9 A;  2HPB A;  3O87 A;  4WMC D;  4KZ5 A;  3BM6 A;  1JVJ A;  4LV2 A;  3N7W A;  2HDQ A;  4P6B A;  1SHV A;  1BTL A;  3N8L A;  1HVB A;  1TVF A;  5M1A A;  5HAP A;  1RGZ A;  5F1F A;  4PM6 A;  1ALQ A;  3NC8 A;  3IXG A;  5E2G A;  3W4P A;  3RXX A;  5I94 A;  3WS1 A;  4IBX A;  5FDH A;  5DVA A;  3SH9 A;  2EXA A;  3BRM A;  1W8Q A;  3OZH A;  1KE0 A;  1ONG A;  2XEP A;  3IQA A;  4WZ4 A;  5A90 A;  1LI0 A;  1S6R A;  4R4R A;  4RVA A;  1Q2P A;  4XUZ A;  3HLF A;  2WUQ A;  4UA6 A;  4BD1 A;  3V3S A;  2Y91 A;  4R23 A;  4KZ3 A;  1PWG A;  2X01 A;  3IF6 A;  3MKF A;  1FCM A;  2G2W A;  3NI9 A;  1ES3 A;  1YLY A;  4FH4 A;  3S4X A;  4KZ9 A;  4HEF A;  2EX6 A;  4LCM A;  2X71 A;  5FSR A;  2QPN A;  4EWF A;  4IVI A;  1BLS A;  3ZGA B;  4WBG A;  3DWK A;  3ISG A;  1M6K A;  5E2E A;  2HDS A;  2Y2J A;  3PAE A;  1JTD A;  3NY4 A;  4GD8 A;  5FQ9 A;  5A93 A;  4GN2 A;  5CTM A;  2GDN A;  3W8K A;  2BG1 A;  3GQZ A;  4PM8 A;  3WRT A;  2WZZ A;  3TSG A;  3HRE A;  3BFG A;  3UY6 A;  1RCJ A;  1L0D A;  4UAA A;  4X6T A;  1MXO A;  1ES2 A;  3W4Q A;  4BEN A;  3BEC A;  4RA7 A;  3I7J A;  1GA0 A;  1GA9 A;  5FQQ A;  3ZVT A;  5HAQ A;  4BL3 A;  4OPQ A;  5F1G A;  2XDM A;  5E2F A;  5GHX A;  1K57 A;  3O88 A;  2Y2O A;  4KZ4 A;  1K57 C;  2ZQC A;  5JYO A;  2XFT A;  2EFX A;  3IWQ A;  2ZC5 B;  1XX2 A;  3P09 A;  4RYE A;  2XGN A;  1XPB A;  4EUZ A;  1BT5 A;  3EQV A;  3IXH A;  3DTM A;  2ZC6 B;  3S22 A;  1NYM A;  3ZG7 B;  3TG9 A;  4GDN A;  1CK3 A;  2BLS A;  4OP8 A;  3MFD A;  1N4O A;  3A3E A;  3C7U A;  3PBO A;  2Y55 A;  2IWB A;  4YFM A;  1Z6F A;  1PWD A;  1NYY A;  2E8I A;  3M2J A;  4E6W A;  2EX9 A;  5M18 A;  3OPL A;  1KE3 A;  4JF5 A;  3M6H A;  4X53 A;  4N1H A;  3FYZ A;  4ZJ3 A;  3VOY A;  1ZG4 A;  1G6A A;  3BFF A;  3C4P A;  3AGE A;  1IYS A;  1IEM A;  3G34 A;  4WZ5 A;  2OLV A;  3ZVW A;  1U60 A;  4WZ5 C;  4S2O A;  3IHB A;  4FH2 A;  2G2U A;  4E3N A;  2PU4 A;  3PAG A;  4F94 A;  1SDN A;  2JCH A;  1XP4 A;  4KZB A;  5DF7 A;  3GVB A;  4U0T A;  5F82 A;  1MWU A;  1XGJ A;  4KZ7 A;  2WKH A;  1WYC A;  5EVI B;  3LCE A;  2WGW B;  2IWC A;  1IKI A;  3UPN A;  5GLA A;  3AGD A;  1PIO A;  4MNR A;  4K0X A;  1MPL A;  2Y2N A;  1VM1 A;  3WS5 A;  5FQJ A;  3W4O A;  4HES A;  4OOL A;  4OQH A;  2OLU A;  2H10 A;  1YLJ A;  4EBP A;  5A92 A;  4JBF A;  1IYO A;  4JXV A;  3VFH A;  3ZHH A;  2XR0 A;  1KDS A;  4EBN A;  1K4F A;  3CJM A;  3OPH A;  3ZNY A;  2H0T A;  2WGW A;  3PBT A;  1M40 A;  3PTE A;  1JWP A;  2A49 A;  1NY0 A;  4DE3 A;  3UDF A;  1L0E A;  2Y59 A;  3G35 A;  1O07 A;  3G2Z A;  2RCX A;  4NK3 A;  1KE4 A;  5KMW A;  1PI5 A;  4XXR A;  4KZ8 A;  3G32 A;  1HD8 A;  1EWZ A;  1BUL A;  1SDE A;  4KZA A;  2ZM2 A;  3G4P A;  1WYB A;  4JF4 A;  2FFY A;  2C5W B;  1N9B A;  1NXY A;  1QME A;  3VP4 A;  2Y4A A;  3BFC A;  1GHP A;  3O86 A;  4MBH A;  3VMA A;  3HLB A;  1ZC2 A;  3BFD A;  3Q82 A;  1RP5 A;  4IBR A;  1LHY A;  3UPO A;  3E2L A;  4S2K A;  4DE0 A;  2RL3 A;  5KSH A;  5HFO A;  4DXB A;  4KG2 A;  5EVI D;  3WWX A;  4MLL A;  1VQQ A;  2DRW A;  4KQQ A;  2A3U A;  4KG5 A;  4WEL A;  4QB8 A;  4PPR A;  5FA7 A;  3OC2 A;  3MZF A;  5KZH A;  5KSC A;  3IF5 A;  4DE1 A;  5AQ7 A;  3IF6 C;  2ZC3 B;  4Y7P A;  1L0G A;  5F83 A;  5G18 A;  4ZAM A;  5FAP A;  1I5Q A;  5EE8 A;  4LV1 A;  2WKE A;  3NCK A;  5D3O A;  2XLN A;  5FQK A;  5L2F A;  2B5R A;  5CEC A;  3BEB A;  1FCN A;  1KVM A;  2ZC7 A;  2OV5 A;  3HLD A;  4E6X A;  3GRJ A;  3MKE A;  1BLC A;  2XK1 A;  3SS4 A;  2Y2K A;  5JYP A;  2V20 A;  3HLW A;  1G68 A;  1IYP A;  2FFF B;  1YT4 A;  4S2J A;  4S2P A;  1NZU A;  2ZQ9 A;  5EPH A;  5FAT A;  1FR6 A;  4QHC A;  4YIN A;  1KGG A;  3G30 A;  1MWT A;  2XD1 A;  1YLT A;  4QU3 A;  4OQ0 A;  4WM9 A;  3QHY A;  4KG6 A;  1LL5 A;  1LL9 A;  2JE5 A;  4JPM A;  3VOZ A;  2WGV A;  2HP6 A;  4DDY A;  5FAO A;  2DCF A;  4E3J A;  3MBZ A;  5CGX A;  5BOH A;  4D2O A;  5GHZ A;  4OON A;  4ZTK A;  2HDR A;  3UE1 A;  3ZNT A;  4C3Q A;  5FI7 A;  1LI9 A;  4MBF A;  4A5R A;  2ZC4 B;  4E3K A;  5CRF A;  1PYY A;  5HAI A;  3BLS A;  1ZG6 A;  2Y2I A;  1BUE A;  3HL9 A;  3QNB A;  4R3B A;  4ZJ2 A;  4K0W A;  4E3M A;  3UE3 A;  4ZDX A;  5HW3 A;  3JYI A;  1GCE A;  5HL1 A;  4QD4 A;  3Q7Z A;  5A91 A;  2XF3 A;  3IWO A;  1JTG A;  3ZFZ A;  2P9V B;  4B4X A;  1L2S A;  1PW1 A;  4OQI A;  5EOE A;  4DKI A;  3WS2 A;  1L0F A;  3OCN A;  2UWX A;  3SH7 A;  1XA7 A;  4BQM A;  1FR1 A;  4KQR A;  4R1G A;  2ZM0 A;  1E25 A;  1K25 A;  3PBQ A;  1W7F A;  4BLM A;  1TDL A;  1ES4 A;  3CG5 A;  1FQG A;  3IXD A;  4EBL A;  4OLD A;  2XD5 A;  2Y2Q A;  3ZG0 A;  2VGJ A;  3EQU A;  2WKI A;  3V50 A;  3M2K A;  1ESI A;  4WMC A;  4OOM A;  5EOO A;  2WK0 A;  1K55 A;  3O3V A;  3P98 A;  4K91 A;  1K55 C;  1I2S A;  2ZQD A;  4DDS A;  5M19 A;  1H8Z A;  4R3J A;  3UE0 A;  4PM5 A;  1ERM A;  4PM9 A;  2H0Y A;  2WAE A;  4GB7 A;  3Q7V B;  3IXB A;  2HDU A;  4C6Y A;  4CJN A;  2ZJ9 A;  5DTK A;  3NDE A;  3A3F A;  2JBF A;  4OPZ A;  2EX2 A;  4GZB A;  4RX2 A;  5CHJ A;  1E3U D;  3FKW A;  3LY4 A;  4R4S A;  1JWV A;  4X56 A;  3RXW A;  1FSY A;  4ZJ1 A;  4FCF A;  1FCO A;  1NJ4 A;  1QMF A;  2IWD A;  5CGW A;  2OSU A;  4L0L A;  4ZBE A;  5GLD A;  5EVI A;  1KVL A;  3M6B A;  2P74 A;  3SS5 A;  2XH9 A;  2QMI A;  4DXC A;  1IEL A;  4PM7 A;  4JKT A;  4N9L A;  1MWS A;  1OME A;  5HAR A;  3HUN A;  4OPY A;  3WS4 A;  2Y2P A;  4WYY A;  1EI5 A;  3LEZ A;  4EQI A;  1W5D A;  4UA7 A;  1I2W A;  4GNU A;  3HUO A;  4BJP A;  4S2I A;  2ZLY A;  3N8R A;  3N4I A;  1XXM A;  4KEN B;  4UA9 A;  5TFQ A;  5CED A;  3ZCZ A;  1YM1 A;  5GLC A;  2VGK A;  1DJA A;  2J9P A;  4DF6 A;  4JLF A;  1IKG A;  2Z2M B;  1KGF A;  3DW0 A;  3OCL A;  1K4E A;  3QNC A;  4QY5 A;  4S2L A;  1YMX A;  5EVL A;  4OOY A;  1ERO A;  3MXR A;  4R0Q A;  4OH0 A;  3V3R A;  3WRZ A;  2I72 A;  1XKZ A;  5IHV A;  1BLH A;  3V39 A;  3IH9 A;  1E4D A;  2V2F F;  1XGI A;  4WEJ A;  3UNW A;  1CEF A;  3HVF A;  4QJG A;  5DTS A;  3PBN A;  3N6I A;  1W8Y A;  1SKF A;  1RGY A;  3C5A A;  1GHI A;  4B4Z A;  3OPR A;  4JF6 A;  2H5S A;  2XQZ A;  4M3K A;  3DWZ A;  4PMA A;  2EFU A;  5GLB A;  1CI9 A;  4Q8I A;  1CI8 A;  2WGI A;  2Z2L B;  4OPR A;  3IF6 B;  1W79 A;  1KDW A;  2DNS A;  4LCL A;  1K56 D;  3IHA A;  4RX3 A;  2CC1 A;  2Y2L A;  3HLE A;  4P85 A;  3GTC A;  5CGS A;  4ID4 A;  2WYX A;  5DF8 A;  3B3X A;  5CEB A;  3NBL A;  3NDG A;  5DF9 A;  3PBS A;  4OLG A;  4C75 A;  1LLB A;  5TR7 A;  1Y54 A;  4GKU A;  4JXS A;  1PZP A;  4HBT A;  4E3O A;  1FSW A;  2ZM8 A;  5EUA A;  4OKP A;  3UDI A;  2WAD A;  2Y2G A;  3BYD A;  1PZO A;  3N8S A;  1K6R A;  1NZO A;  3FV7 A;  5GL9 A;  5CXW A;  3LO7 A;  4OVD A;  4LEN A;  1O7E A;  4MBK A;  4OQG A;  4LV0 A;  3OPP A;  5FQM A;  4DRT A;  1MY8 A;  1GHM A;  3SH8 A;  1PI4 A;  1HZO A;  4FD8 A;  3BLM A;  3HBR A;  1H5X A;  1IYQ A;  3VP3 A;  3PBR A;  4FSF A;  4BD0 A;  3SOI A;  5CHM A;  2C6W B;  5DTT A;  5EEC A;  1ONH A;  3FKV A;  3VSK A;  1AXB A;  4N1X A;  5TGF A;  4Y0O A;  3ZG9 B;  1Q2Q A;  4WEK A;  5E43 A;  1E3U A;  4JXG A;  2EXB A;  4Y0U A;  3Q81 A;  1CEG A;  1K38 A;  3UDX A;  2QZ6 A;  4BL2 A;  3E2K A;  4IED A;  1YQS A;  3NIA A;  5E2H A;  4XUX A;  4JXW A;  1ESU A;  5AQB A;  1SCW A;  3Q07 A;  3SS3 A;  1PW8 A;  2Y2H A;  1ZKJ A;  4Z9Q A;  3GR2 A;  1XA1 A;  2ZQ7 A;  5FQI A;  4N92 A;  3CMZ A;  3VFF A;  1WE4 A;  4KQO A;  2J9O A;  1BLP A;  2ZMA A;  4LV3 A;  2P9V A;  3VP0 A;  3ITA A;  1J9M A;  1PWC A;  3VSL A;  4NET A;  1TDG A;  3G2Y A;  1H8Y A;  4DE2 A;  5FI6 A;  3A3D A;  3A3I A;  5AQA A;  3BFE A;  3LY3 A;  3TOI A;  1KGE A;  3UPP A;  1HTZ A;  3C7V A;  5FAS A;  3VP1 A;  1DJB A;  4P87 A;  1MKI A;  3IH8 A;  4HBU A;  3MZD A;  4EV4 A;  3GSG A;  4H8R A;  3UN7 A;  3MXS A;  3G31 A;  4GDB A; 
#chains in the Genus database with same CATH topology
 1FOF A;  3V5M A;  4L9E A;  4IVK A;  1TEM A;  4YWZ A;  3T4L A;  1KOU A;  3ITB A;  3S1Y A;  3ZG8 B;  4U0X A;  1DY6 A;  4U3T A;  5AQ9 A;  2AVX A;  2WZX A;  3MZE A;  4LPZ A;  3NOP C;  1YMS A;  4LLO B;  1ERQ A;  4X68 A;  2R9X A;  1YLP A;  2WAF A;  4QY6 A;  4O7D A;  1ES5 A;  1S0W A;  4S2N A;  4BBT A;  3T1Q B;  3GMW A;  1BSG A;  4DJ2 A;  3TW8 A;  5FI2 A;  3UO9 A;  4WMC D;  3FC7 A;  4G3K A;  4KZ5 A;  3BM6 A;  4LV2 A;  3N7W A;  5M1A A;  1ALQ A;  2ZL1 B;  3NC8 A;  4B93 A;  4IBX A;  1PRQ A;  2EXA A;  3BRM A;  1W8Q A;  1MZU A;  3EGD C;  4XUZ A;  4LGW A;  4R4R A;  4WF0 A;  4BD1 A;  3LEQ A;  4R23 A;  2X01 A;  2V8C A;  3T50 A;  1FCM A;  3K3C A;  2G2W A;  3NI9 A;  1ES3 A;  1ODV A;  2QPN A;  5AVF A;  3UB9 A;  4RQ9 A;  3KO6 A;  4WBG A;  4GD8 A;  1JTD A;  1DP6 A;  4GN2 A;  3BQA A;  1GSX A;  3UY6 A;  4FUW A;  1L0D A;  2W3H A;  1MXO A;  1VET A;  3W4Q A;  4BEN A;  3I7J A;  1GA9 A;  4UQI M;  3ZVT A;  5GHX A;  1K57 A;  5L07 A;  2ACG A;  4MCW A;  4Q0H A;  3P09 A;  3CLO A;  4NEE D;  3EQV A;  3IXH A;  1TS7 A;  4DJ3 A;  2BLS A;  3MFD A;  2DMW A;  2IWB A;  2QYB A;  2E8I A;  3LR3 A;  4E6W A;  5M18 A;  3OPL A;  4N1H A;  3UB7 A;  3BFF A;  1IYS A;  1IEM A;  3G34 A;  5TJJ A;  3F1O A;  3ZVW A;  2KDK A;  4WZ5 C;  4S2O A;  3OBF A;  4E3N A;  5EM1 A;  4CLC E;  1S4S A;  2JCH A;  1XP4 A;  5DFY A;  5DF7 A;  3GVB A;  2HJ9 C;  3T12 B;  5EVI B;  3T4J A;  4HNB A;  1PIO A;  4MNR A;  3T4K A;  2Y2N A;  1YLJ A;  3VFH A;  1KDS A;  2GX5 A;  1CQA A;  3ZNY A;  1OPX A;  2JKR I;  2Y79 A;  4X25 A;  2XA7 S;  3P01 A;  3G35 A;  3G2Z A;  2VX8 A;  4XXR A;  3CIT A;  3GDI A;  4KZ8 A;  1UWN X;  1HD8 A;  2JKT M;  2ZBB A;  3G4P A;  4JF4 A;  4EES A;  2GJ3 A;  3U4L P;  1NXY A;  2V0W A;  5IT5 A;  1L3L A;  2B02 A;  3BFC A;  3BY8 A;  2OAP 1;  1YPR A;  2KX6 A;  1LHY A;  3E2L A;  4S2K A;  1VQQ A;  2A3U A;  3T4T A;  4QB8 A;  4F3L B;  5AQ7 A;  2ZC3 B;  2O9B A;  1I5Q A;  3NCK A;  1S4R A;  2ZC7 A;  2OV5 A;  3GRJ A;  5HWT A;  2XK1 A;  2Y2K A;  2V20 A;  3HLW A;  5HWW A;  3E4P A;  1G68 A;  2FFF B;  1YT4 A;  1YLT A;  3H82 A;  4QU3 A;  2K7S A;  3QHY A;  1LL5 A;  1LL9 A;  2O99 A;  3VOZ A;  2QJ5 A;  3C30 A;  3V67 A;  4E3J A;  4O01 A;  2QKP A;  3R7W A;  4OON A;  4C3Q A;  2WKR A;  4G3V A;  4A5R A;  4JGQ A;  3CUE A;  4E3K A;  2R78 A;  2Y2I A;  3HL9 A;  3UE3 A;  2J3W A;  3JYI A;  1GCE A;  2W1R A;  3PR6 A;  2FH5 A;  5HDC A;  5HL1 A;  4HY8 A;  3IWO A;  1LSX A;  4IHQ A;  4OQI A;  3LIF A;  1L0F A;  3NHQ A;  4GCZ A;  3SH7 A;  1XA7 A;  3TRC A;  4KQR A;  2ZM0 A;  1TDL A;  3ULF A;  3ZG0 A;  2PD7 A;  4HP9 A;  4I39 A;  2WK0 A;  3O3V A;  4WL9 A;  1K55 C;  2ZQD A;  4R3J A;  4PM5 A;  3OLO A;  3F1N A;  2KOI A;  4GB7 A;  3A3F A;  4RX2 A;  3BW6 A;  4ZJ1 A;  4ZBE A;  4GS9 A;  1OT6 A;  2QMI A;  3IS2 A;  1MWS A;  1SZV A;  3WS4 A;  2IA2 A;  1YSP A;  4NXB A;  2KLI A;  5F69 A;  3ZCZ A;  1YM1 A;  3OCL A;  2VZW A;  5I5L A;  1YMX A;  3UMD A;  3MXR A;  3V3R A;  3WRZ A;  1OT9 A;  5IHV A;  4QJG A;  5FEG A;  2VK3 A;  4LFU A;  2YKF A;  1SKF A;  4KUO A;  1RGY A;  3C2W A;  4M3K A;  3DWZ A;  3G6O A;  4PMA A;  1CI9 A;  5C5K A;  1W79 A;  2DNS A;  1K56 D;  1VEU B;  4P85 A;  3GTC A;  5CGS A;  2WYX A;  4E04 A;  1TD5 A;  3NBL A;  5DF9 A;  4OLG A;  1LLB A;  3FG8 A;  5TR7 A;  1Y54 A;  3CWF A;  1XFQ A;  2ZM8 A;  1DRM A;  3EGX C;  3BYD A;  2P7J A;  3MS6 A;  1K6R A;  1NZO A;  3LO7 A;  2W1T A;  4LRY C;  3SH8 A;  3JVU A;  5DTT A;  2O9C A;  4Y0O A;  2HF6 A;  4JXG A;  2EXB A;  3CPT B;  4Y0U A;  2QZ6 A;  2L0W A;  1DP8 A;  3LI8 A;  5AQB A;  2W3D A;  1ESU A;  1SCW A;  2Z6D A;  2PD8 A;  4Z9Q A;  1D06 A;  4HI4 A;  1T1A A;  2QJ7 A;  2D01 A;  2P9V A;  3VP0 A;  1ACF A;  1PWC A;  4NET A;  1TDG A;  1VB6 A;  1H8Y A;  3G2Y A;  2W3E A;  5FI6 A;  3TOI A;  1DJB A;  3MSH A;  4P87 A;  1MKI A;  4HBU A;  3BQ8 A;  3GSG A;  3UN7 A;  5CTN A;  4KZ6 A;  5GHY A;  2JHE A;  4X55 A;  2ZD8 A;  5EVI C;  2HJE A;  1OTD A;  2OOL A;  4CPK A;  3HLG A;  5HX9 A;  1Z09 A;  4EET B;  2ZQA A;  2HP9 A;  1OJG A;  3S7N A;  4Y0T A;  2X02 A;  2J7V A;  3ZG5 A;  2XRN A;  2Y8H A;  1K6S A;  1C3B A;  3HLC A;  1MBL A;  2V1Z A;  1XJ3 A;  3EEA A;  1H0M A;  5L8M A;  1YLZ A;  3A3J A;  4S2N C;  2PU2 A;  1H8M A;  1NRF A;  2HDQ A;  4P6B A;  3KSG A;  1SHV A;  1BTL A;  1HVB A;  4PM6 A;  3EEH A;  3IXG A;  3W4P A;  4IUK A;  2K31 A;  4XT2 B;  4NXE A;  3LR0 A;  5FDH A;  1TS0 A;  4M4X A;  1P97 A;  5A90 A;  3TE8 A;  1NLY A;  2ZL1 A;  1T18 A;  2PYR A;  1PWG A;  3IF6 A;  3MKF A;  5DKL A;  5FSR A;  4EWF A;  2HZ5 A;  1BLS A;  3IX8 A;  1M6K A;  3PAE A;  2Y2J A;  2BG1 A;  3WRT A;  2WZZ A;  3TSG A;  3BFG A;  3DTI A;  1YSQ A;  5FQQ A;  3D9Y A;  3E98 A;  5HAQ A;  2XDM A;  4KZ4 A;  1K57 C;  2XFT A;  1XX2 A;  4RYE A;  2XGN A;  3DTM A;  3S22 A;  2M1C A;  4WLA A;  1CK3 A;  4DN0 A;  4YFM A;  1PWD A;  3M2J A;  5A8B A;  2HGV A;  1KE3 A;  4O8G A;  4X53 A;  5HPI A;  4ZJ3 A;  3VOY A;  1F98 A;  3AGE A;  3PYP A;  5DJT A;  2O0Y A;  1SKO B;  2XA7 M;  3IHB A;  4FH2 A;  5DJU A;  4F94 A;  4KZB A;  4HHD A;  2E8J A;  4U0T A;  2VEA A;  1A0K A;  4JGO A;  2IWC A;  3AGD A;  4PAU A;  4K0X A;  1MPL A;  4PKY G;  1MKM A;  4JXV A;  1K4F A;  3CJM A;  5AVE A;  3QP2 A;  1M40 A;  4DE3 A;  3UDF A;  1O07 A;  2QHK A;  2RCX A;  5KMW A;  4NXG A;  1PI5 A;  1BUL A;  1SDE A;  3DBA A;  5DKK A;  3HLB A;  1RP5 A;  1OTB A;  5KSH A;  4KG2 A;  5EVI D;  2DRW A;  4WEL A;  4PPR A;  5KZH A;  5KSC A;  4DE1 A;  4Y7P A;  5F83 A;  5G18 A;  4ZAM A;  5EE8 A;  4HJ3 A;  1XJ2 A;  5FQK A;  4E6X A;  5EM0 A;  4F3L A;  5EV0 A;  2B95 A;  3DTE A;  1FR6 A;  4QHC A;  1MWT A;  1OTA A;  5HDD A;  4OQ0 A;  4KG6 A;  3PXP A;  2JE5 A;  4JPM A;  2WGV A;  2HP6 A;  4HQA A;  5FAO A;  4R6L A;  1S66 L;  3MBZ A;  2OAQ 1;  5CGX A;  5GHZ A;  3UE1 A;  2HDR A;  4CLC B;  1LI9 A;  4MBF A;  5CRF A;  3JVV A;  4GHI A;  4QD4 A;  2XF3 A;  3ZFZ A;  1L2S A;  4DKI A;  3WS2 A;  2L1M A;  1E25 A;  1K25 A;  1W7F A;  2A24 B;  3NOU C;  3H7W B;  2Q0O A;  4II7 A;  4NKP A;  3P98 A;  5M19 A;  1I2S A;  1T1B A;  2WAE A;  3IXB A;  2HDU A;  4C6Y A;  4CJN A;  2ZJ9 A;  4Y3I A;  2JBF A;  1E3U D;  1T19 A;  1JWV A;  2IWD A;  5GLD A;  2OSU A;  2P74 A;  3SS5 A;  3E4Q A;  4PM7 A;  2VLG A;  4GW9 A;  5EFW A;  1OME A;  4WUJ A;  1EI5 A;  2MJ6 A;  3NEC A;  4UA7 A;  3HUO A;  2ZLY A;  5K5B A;  5TFQ A;  1LT0 A;  1XXM A;  1P9R A;  1P9W A;  4UA9 A;  2V1A A;  5GLC A;  1DJA A;  4JLF A;  3DW0 A;  4QY5 A;  4S2L A;  4R0Q A;  1BLH A;  3V39 A;  3IH9 A;  4MN6 A;  3KX0 X;  1XGI A;  1CEF A;  2J80 A;  1GSV A;  4H6J A;  1W8Y A;  2EWV A;  3C5A A;  1GHI A;  3MQO A;  4B4Z A;  4K08 A;  3T1S A;  2EFU A;  5GLB A;  4Q8I A;  1CI8 A;  2Z2L B;  1KDW A;  4LCL A;  2PHY A;  4NG2 A;  3HLE A;  1OTE A;  5CEB A;  3NDG A;  3PBS A;  2PYP A;  1IFQ A;  1PZP A;  4HBT A;  1FSW A;  5EUA A;  1YKD A;  1J3W A;  4QWO A;  1VET B;  3FV7 A;  4P6Z M;  3LR4 A;  1O7E A;  4OQG A;  5HD3 A;  3OPP A;  5FQM A;  1GHM A;  3BLM A;  3HBR A;  1H5X A;  3VP3 A;  4FSF A;  5MC7 A;  1Y4O A;  1XJ6 A;  5CHM A;  2O9A A;  1STZ A;  4N1X A;  1Q2Q A;  3Q81 A;  1K38 A;  3UDX A;  4FTX A;  4BL2 A;  3NIA A;  3SS3 A;  1PW8 A;  2Y2H A;  5G4Z A;  3GR2 A;  4NXF A;  1V9Z A;  4KQO A;  2J9O A;  3RFB A;  1BLP A;  3ITA A;  2WKQ A;  3CPT A;  3NUL A;  3A3D A;  1KGE A;  1S67 L;  2ZOH A;  3MZD A;  4EV4 A;  4H8R A;  3MXS A;  1CJF A;  4GDB A;  2Q9M A;  4OP5 A;  3C4O A;  5CX7 A;  2JC7 A;  5U47 A;  1K54 A;  5TBM A;  3RJU A;  1CF0 A;  4ETZ A;  3Q7V A;  2W0N A;  2PBY A;  2H28 A;  2Y2M A;  4LRX C;  4AFI A;  4ARZ A;  1K56 A;  3JPU A;  5BOH A;  5J4E A;  1JWZ A;  4HP4 A;  4P0M A;  4B88 A;  5J8X A;  4E3I A;  3FZC A;  2PR5 A;  3B42 A;  3VP2 A;  3ZDJ A;  1F2K A;  4EU0 A;  3FWL A;  1IOU A;  4HJ6 A;  2Q9N A;  2ZQ8 A;  2J8Y A;  2K2N A;  3QP8 A;  3O87 A;  4Z1W A;  3SW1 A;  1RGZ A;  3RXX A;  3UB5 P;  2XRO A;  3D3O A;  3EWK A;  3WS1 A;  4IJG A;  5DVA A;  3SH9 A;  3OZH A;  1KE0 A;  4WZ4 A;  1LI0 A;  2V1B A;  2WUQ A;  3A0V A;  2Y91 A;  4KZ3 A;  4UEY A;  3UB6 A;  2OWJ A;  4PHT A;  1H3Q A;  4FH4 A;  1YLY A;  4HEF A;  4LCM A;  2LB5 A;  3DWK A;  3ISG A;  3LFV A;  5FL3 A;  2HDS A;  3D72 A;  5FQ9 A;  5A93 A;  5CTM A;  1HLU P;  3GQZ A;  1WA9 A;  1LL8 A;  3R7W B;  3HRE A;  1RCJ A;  2PT7 A;  4X6T A;  3F1P A;  1DP9 A;  1GA0 A;  2ZMF A;  4BL3 A;  4OPQ A;  2YKH A;  2VV6 A;  5E2F A;  1UGU A;  2ZQC A;  4CLC C;  2EFX A;  2W3G A;  3IWQ A;  1PFL A;  3IBR A;  4P6Z S;  4EUZ A;  4Y17 A;  2ZC6 B;  3QP1 A;  3C7U A;  2Y55 A;  3ZQ5 A;  4L9F A;  4CQH A;  1G6A A;  2J3T C;  1LSV A;  3KYE A;  2OLV A;  1W63 Q;  3F1N B;  3FPW A;  1U60 A;  5HDS A;  2NUT C;  3PAG A;  5HWV A;  1SDN A;  3T4Q A;  1FIK A;  1MWU A;  4I3J A;  1XGJ A;  3A0R A;  4KZ7 A;  3IX3 A;  2WKH A;  1WYC A;  1K0K A;  3LCE A;  3E4O A;  4GS9 B;  2WGW B;  3E0Y A;  5GLA A;  3RTY A;  3IS2 B;  1VM1 A;  3W4O A;  1SKO A;  2ZMV A;  4HES A;  3MFX A;  4OOL A;  4EBP A;  5A92 A;  1IYO A;  2P04 A;  4EBN A;  2XR0 A;  2JKT I;  2P08 A;  3T1R A;  2H0T A;  5EVE A;  1NY0 A;  1Y28 A;  3QP4 A;  5HZH A;  3H9W A;  4KZA A;  3MJQ A;  2C5W B;  1G28 A;  2Y4A A;  4MBH A;  1ZC2 A;  3IX4 A;  4IBR A;  3UPO A;  4DE0 A;  3B47 A;  4DXB A;  4MLL A;  4I3I A;  3LGO A;  4KQQ A;  5FA7 A;  3OC2 A;  4GLQ A;  1F5M A;  4LV1 A;  3T1X A;  5D3O A;  5L2F A;  2B5R A;  3BEB A;  1KVM A;  1OJ5 A;  3HLD A;  2W1T B;  2VGL M;  5JYP A;  2B18 A;  4S2J A;  4S2P A;  1NZU A;  2ZQ9 A;  5EPH A;  4B9O A;  5FAT A;  1KGG A;  2OWH A;  3G30 A;  2XD1 A;  3HCY A;  5FDS A;  4DDY A;  2DCF A;  4D2O A;  2PRF A;  4ZTK A;  5FI7 A;  4I3A A;  3LIC A;  5CED A;  5HAI A;  1ZG6 A;  4R3B A;  3W2Z A;  4ZDX A;  5HW3 A;  3BY9 A;  3KYQ A;  1JTG A;  2P9V B;  4B4X A;  1PW1 A;  1BYW A;  2UWX A;  1G6O A;  1X0O A;  1FR1 A;  4R1G A;  3EOI A;  3R4K A;  3UME A;  1ES4 A;  1FQG A;  4EBL A;  2JKG A;  4OLD A;  2GNX A;  2VGJ A;  2WKI A;  3M2K A;  5HPF A;  1ESI A;  1JNU A;  4WMC A;  4OOM A;  2UV0 E;  5EOO A;  1GSW A;  5F5Y A;  4K91 A;  2BTF P;  4DDS A;  1N9L A;  3UE0 A;  4HH2 A;  1ERM A;  3H7W A;  3LIA A;  3NDE A;  2EX2 A;  4GZB A;  3LY4 A;  3T4O A;  4R3A A;  4X56 A;  3RXW A;  1FSY A;  4CLC D;  1FCO A;  1QMF A;  5CGW A;  1TS6 A;  5EVI A;  1S1Y A;  4ZRR A;  2XH9 A;  4DXC A;  4X1L A;  4JKT A;  4N9L A;  5HAR A;  4OPY A;  4WYY A;  1UWP X;  4EQI A;  1W5D A;  4Y5F A;  1I2W A;  4L9G A;  4PKY A;  4BJP A;  3S7P A;  4R70 A;  3N8R A;  2J3T D;  2J9P A;  4DF6 A;  1N9N A;  2Z2M B;  1KGF A;  1K4E A;  5EVL A;  4OOY A;  4OH0 A;  1XKZ A;  2V2F F;  3UNW A;  2XSS A;  2L4R A;  5DTS A;  4HJ4 A;  3PBN A;  4D60 A;  4JF6 A;  3KSH A;  1T1C A;  4Y2F A;  3IF6 B;  4RX3 A;  2CC1 A;  4EER A;  5J7E A;  5DF8 A;  4MMN A;  4C75 A;  4WN5 A;  4DMZ A;  4JXS A;  4E3O A;  1W63 M;  2WAD A;  4Y13 A;  2Y2G A;  3N8S A;  5F6A A;  3VE3 A;  5CXW A;  4MBK A;  5AJG A;  4FD8 A;  3CUE C;  1IYQ A;  5J3W A;  3PBR A;  2EWW A;  3SOI A;  4BBV A;  5EEC A;  5L10 A;  1AXB A;  5TGF A;  3ZG9 B;  2VGL S;  1F9I A;  3KSI A;  1E3U A;  3VV4 A;  1CEG A;  3E2K A;  5F68 A;  4JXW A;  1ZKJ A;  1XA1 A;  2ZQ7 A;  3CMZ A;  3VFF A;  2ZMA A;  4LV3 A;  4EW7 A;  1J9M A;  3VSL A;  4HIA A;  3A3I A;  2D02 A;  3C7V A;  3NJA A;  5FAS A;  3VP1 A;  3IH8 A;  3BJN A;  1MWR A;  1TF1 A;  5CER A;  4X69 A;  2PBD P;  3AGF A;  2XFS A;  2V9A A;  4EXO A;  3L9K A;  5CHU A;  1ZHH B;  1K54 C;  5G4Y A;  3UE6 A;  3S7Q A;  3CZD A;  2HP5 A;  4GOG A;  3IWI A;  1BZA A;  2R9W A;  3TJZ C;  3D4F A;  3PHY A;  4YNR A;  1P0Z A;  1YLW A;  4S2M A;  2BAS A;  1DJC A;  4E3L A;  3GV9 A;  3WS0 A;  2EX8 A;  4GD6 A;  4N9K A;  5FAQ A;  2INW A;  4UHU A;  4MEZ A;  3HUM A;  4X1M A;  2I9V A;  3IT9 A;  3Q1F A;  3U2A A;  4IUH A;  2G7U A;  3LUQ A;  2HPB A;  1JVJ A;  3N8L A;  1TVF A;  5HAP A;  2VJW A;  5F1F A;  3NOT C;  5E2G A;  5I94 A;  1VHM A;  3VE4 A;  1ONG A;  2XEP A;  3IQA A;  1S6R A;  4RVA A;  1Q2P A;  3HLF A;  1MC0 A;  4UA6 A;  3GEC A;  2VKS A;  3V3S A;  3OOV A;  4G3W A;  3LIE A;  4EUV A;  3S4X A;  4KZ9 A;  2EX6 A;  1VEU A;  2X71 A;  3A0S A;  4IVI A;  3ZGA B;  5E2E A;  3NY4 A;  2M7V A;  2GDN A;  3W8K A;  2EA9 A;  4PM8 A;  4UAA A;  1ES2 A;  4GHI B;  3BEC A;  4RA7 A;  3MMH A;  1FIL A;  1TS8 A;  5F1G A;  3O88 A;  2Y2O A;  4LRZ E;  5JYO A;  1G5U A;  2ZC5 B;  3B33 A;  1XPB A;  3K2N A;  1BT5 A;  1NYM A;  3ZG7 B;  3TG9 A;  4GDN A;  3F1O B;  4OP8 A;  1N4O A;  3A3E A;  3PBO A;  4I38 A;  2PAV P;  1Z6F A;  1NYY A;  3QP5 A;  2EX9 A;  4JF5 A;  3M6H A;  3FYZ A;  3C38 A;  1ZG4 A;  4Y15 A;  3C4P A;  2W3F A;  4JGR A;  4UQI S;  4WZ5 A;  2G2U A;  2PU4 A;  2VV7 A;  2PDR A;  5F82 A;  4EEU A;  3QP6 A;  1IKI A;  3UPN A;  2V8F A;  1S1Z A;  4HH3 A;  3MR0 A;  3WS5 A;  5FQJ A;  4OQH A;  2OLU A;  2H10 A;  4JBF A;  3ZHH A;  4O0P A;  3OPH A;  5L09 A;  2WGW A;  3PBT A;  3PTE A;  1JWP A;  2A49 A;  1YAX A;  1L0E A;  2Y59 A;  4NK3 A;  1KE4 A;  3MF0 A;  2ZOI A;  3G32 A;  3MQ0 A;  4HOI A;  1EWZ A;  2ZM2 A;  1WYB A;  4H6J B;  2FFY A;  1N9B A;  3KYZ A;  1QME A;  3VP4 A;  2QWS A;  5KIZ A;  5IS1 A;  3CHW P;  2JKF A;  1GHP A;  2VA0 A;  3O86 A;  3VMA A;  3BFD A;  3Q82 A;  1NRJ A;  2RL3 A;  5HFO A;  3WWX A;  4EEP A;  4KG5 A;  3LR5 A;  2CMN A;  1ZTU A;  3MZF A;  4XT2 A;  3IF5 A;  1N9O A;  3IF6 C;  1L0G A;  5FAP A;  2WKE A;  3H82 B;  2XLN A;  5CEC A;  4BWI A;  1FCN A;  3MKE A;  1BLC A;  3SS4 A;  1LSW A;  4Q0J A;  1IYP A;  3MXQ A;  4YIN A;  4WM9 A;  3P7N A;  3LI9 A;  4QPR A;  3UB8 A;  3KSF A;  3MQQ A;  3ZNT A;  2ZC4 B;  1PYY A;  2A2L A;  4MN7 A;  3BLS A;  1BUE A;  3QNB A;  4ZJ2 A;  4E3M A;  2Z6C A;  4K0W A;  3DTK A;  3Q7Z A;  1OTI A;  3RH8 B;  5A91 A;  1D7E A;  3SZT A;  5EOE A;  1XFN A;  3OCN A;  4GJ4 A;  4BQM A;  3PBQ A;  4BLM A;  2VV8 A;  3BWL A;  4Q0I A;  3CG5 A;  2V0U A;  3ICY A;  3IXD A;  2W27 A;  2XD5 A;  2Y2Q A;  3EQU A;  3V50 A;  4ETX A;  5IU1 A;  5TBM B;  1K55 A;  2LB9 A;  1H8Z A;  4PM9 A;  2H0Y A;  4FOF A;  3Q7V B;  3S7O A;  5DTK A;  4OPZ A;  4ARZ B;  5CHJ A;  3FKW A;  3L7H A;  5HD5 A;  4R4S A;  4FCF A;  1NJ4 A;  3LIB A;  2FZ0 A;  4L0L A;  1KVL A;  2NUP C;  3M6B A;  5FEF A;  2GZA A;  1IEL A;  3HUN A;  2Y2P A;  3LEZ A;  1XJ4 A;  4YOF A;  4GNU A;  4S2I A;  3DAV A;  3HJK A;  3CI6 A;  3N4I A;  4KEN B;  4BBU A;  3ZYT A;  2PR6 A;  2JKR M;  2VGK A;  1IKG A;  3QNC A;  1ERO A;  2I72 A;  1NWZ A;  4EQ1 A;  1AWI A;  1E4D A;  3HJI A;  4WEJ A;  2HV1 A;  3HVF A;  3K3D A;  3N6I A;  4I5S A;  3OPR A;  2H5S A;  2XQZ A;  4ESP A;  3O5Y A;  1V9Y A;  1PNE A;  3T4S A;  2WGI A;  4OPR A;  2JN7 A;  3IHA A;  2Y2L A;  3IBJ A;  4ID4 A;  3B3X A;  4ME4 A;  4KUK A;  4MN5 A;  4GKU A;  3LID A;  4OKP A;  3UDI A;  3CAX A;  1PZO A;  3F1P B;  2M7U A;  5GL9 A;  4OVD A;  1D1J A;  4LEN A;  5HL6 A;  3VOL A;  4LV0 A;  5HSQ A;  4DRT A;  1MY8 A;  1PI4 A;  1HZO A;  5DFX A;  5LBR A;  4BD0 A;  2C6W B;  1ONH A;  3FKV A;  3VSK A;  1NLZ A;  4R38 A;  4MDZ A;  4WEK A;  5E43 A;  4CLC A;  2WKP A;  4IED A;  3LYX A;  1YQS A;  5E2H A;  4XUX A;  3Q07 A;  5FQI A;  4N92 A;  1WE4 A;  3C8C A;  4JGP A;  4BMW A;  4DE2 A;  1EW0 A;  5AQA A;  3BFE A;  3LY3 A;  3UPP A;  1HTZ A;  2A24 A;  4KQD A;  3FPV A;  3G31 A; 
#chains in the Genus database with same CATH homology
 1FOF A;  1MWR A;  2Q9M A;  5CER A;  5CTN A;  3V5M A;  4X69 A;  4OP5 A;  3AGF A;  4IVK A;  1TEM A;  2XFS A;  4KZ6 A;  3C4O A;  5GHY A;  5CHU A;  2JC7 A;  4X55 A;  5U47 A;  1K54 A;  3ITB A;  1K54 C;  3S1Y A;  4U0X A;  3ZG8 B;  1DY6 A;  2ZD8 A;  4U3T A;  5EVI C;  3CZD A;  2HP5 A;  4GOG A;  5AQ9 A;  3IWI A;  3RJU A;  4CPK A;  1BZA A;  2WZX A;  3HLG A;  2R9W A;  3Q7V A;  5HX9 A;  2PBY A;  3D4F A;  3MZE A;  2Y2M A;  1YMS A;  1YLW A;  4S2M A;  1ERQ A;  1DJC A;  1K56 A;  2ZQA A;  4X68 A;  2HP9 A;  4E3L A;  4Y0T A;  1JWZ A;  3GV9 A;  2X02 A;  2J7V A;  4P0M A;  3WS0 A;  4B88 A;  2R9X A;  2EX8 A;  1YLP A;  4GD6 A;  4N9K A;  5FAQ A;  3ZG5 A;  5J8X A;  4UHU A;  2WAF A;  1K6S A;  4E3I A;  1C3B A;  3HLC A;  1MBL A;  2V1Z A;  3FZC A;  4MEZ A;  4O7D A;  4QY6 A;  3VP2 A;  3HUM A;  1ES5 A;  1S0W A;  3ZDJ A;  3IT9 A;  4S2N A;  1YLZ A;  3A3J A;  4S2N C;  3Q1F A;  3FWL A;  2PU2 A;  3GMW A;  1BSG A;  2Q9N A;  1NRF A;  2ZQ8 A;  2J8Y A;  5FI2 A;  3UO9 A;  2HPB A;  3O87 A;  4WMC D;  4KZ5 A;  3BM6 A;  1JVJ A;  4LV2 A;  3N7W A;  2HDQ A;  4P6B A;  1SHV A;  1BTL A;  3N8L A;  1HVB A;  1TVF A;  5M1A A;  5HAP A;  1RGZ A;  5F1F A;  4PM6 A;  1ALQ A;  3NC8 A;  3IXG A;  5E2G A;  3W4P A;  3RXX A;  5I94 A;  3WS1 A;  4IBX A;  5FDH A;  5DVA A;  3SH9 A;  2EXA A;  3BRM A;  1W8Q A;  3OZH A;  1KE0 A;  1ONG A;  2XEP A;  3IQA A;  4WZ4 A;  5A90 A;  1LI0 A;  1S6R A;  4R4R A;  4RVA A;  1Q2P A;  4XUZ A;  3HLF A;  2WUQ A;  4UA6 A;  4BD1 A;  3V3S A;  2Y91 A;  4R23 A;  4KZ3 A;  1PWG A;  2X01 A;  3IF6 A;  3MKF A;  1FCM A;  2G2W A;  3NI9 A;  1ES3 A;  1YLY A;  4FH4 A;  3S4X A;  4KZ9 A;  4HEF A;  2EX6 A;  4LCM A;  2X71 A;  5FSR A;  2QPN A;  4EWF A;  4IVI A;  1BLS A;  3ZGA B;  4WBG A;  3DWK A;  3ISG A;  1M6K A;  5E2E A;  2HDS A;  2Y2J A;  3PAE A;  1JTD A;  3NY4 A;  4GD8 A;  5FQ9 A;  5A93 A;  4GN2 A;  5CTM A;  2GDN A;  3W8K A;  2BG1 A;  3GQZ A;  4PM8 A;  3WRT A;  2WZZ A;  3TSG A;  3HRE A;  3BFG A;  3UY6 A;  1RCJ A;  1L0D A;  4UAA A;  4X6T A;  1MXO A;  1ES2 A;  3W4Q A;  4BEN A;  3BEC A;  4RA7 A;  3I7J A;  1GA0 A;  1GA9 A;  5FQQ A;  3ZVT A;  5HAQ A;  4BL3 A;  4OPQ A;  5F1G A;  2XDM A;  5E2F A;  5GHX A;  1K57 A;  3O88 A;  2Y2O A;  4KZ4 A;  1K57 C;  2ZQC A;  5JYO A;  2XFT A;  2EFX A;  3IWQ A;  2ZC5 B;  1XX2 A;  3P09 A;  4RYE A;  2XGN A;  1XPB A;  4EUZ A;  1BT5 A;  3EQV A;  3IXH A;  3DTM A;  2ZC6 B;  3S22 A;  1NYM A;  3ZG7 B;  3TG9 A;  4GDN A;  1CK3 A;  2BLS A;  4OP8 A;  3MFD A;  1N4O A;  3A3E A;  3C7U A;  3PBO A;  2Y55 A;  2IWB A;  4YFM A;  1Z6F A;  1PWD A;  1NYY A;  2E8I A;  3M2J A;  4E6W A;  2EX9 A;  5M18 A;  3OPL A;  1KE3 A;  4JF5 A;  3M6H A;  4X53 A;  4N1H A;  3FYZ A;  4ZJ3 A;  3VOY A;  1ZG4 A;  1G6A A;  3BFF A;  3C4P A;  3AGE A;  1IYS A;  1IEM A;  3G34 A;  4WZ5 A;  2OLV A;  3ZVW A;  1U60 A;  4WZ5 C;  4S2O A;  3IHB A;  4FH2 A;  2G2U A;  4E3N A;  2PU4 A;  3PAG A;  4F94 A;  1SDN A;  2JCH A;  1XP4 A;  4KZB A;  5DF7 A;  3GVB A;  4U0T A;  5F82 A;  1MWU A;  1XGJ A;  4KZ7 A;  2WKH A;  1WYC A;  5EVI B;  3LCE A;  2WGW B;  2IWC A;  1IKI A;  3UPN A;  5GLA A;  3AGD A;  1PIO A;  4MNR A;  4K0X A;  1MPL A;  2Y2N A;  1VM1 A;  3WS5 A;  5FQJ A;  3W4O A;  4HES A;  4OOL A;  4OQH A;  2OLU A;  2H10 A;  1YLJ A;  4EBP A;  5A92 A;  4JBF A;  1IYO A;  4JXV A;  3VFH A;  3ZHH A;  2XR0 A;  1KDS A;  4EBN A;  1K4F A;  3CJM A;  3OPH A;  3ZNY A;  2H0T A;  2WGW A;  3PBT A;  1M40 A;  3PTE A;  1JWP A;  2A49 A;  1NY0 A;  4DE3 A;  3UDF A;  1L0E A;  2Y59 A;  3G35 A;  1O07 A;  3G2Z A;  2RCX A;  4NK3 A;  1KE4 A;  5KMW A;  1PI5 A;  4XXR A;  4KZ8 A;  3G32 A;  1HD8 A;  1EWZ A;  1BUL A;  1SDE A;  4KZA A;  2ZM2 A;  3G4P A;  1WYB A;  4JF4 A;  2FFY A;  2C5W B;  1N9B A;  1NXY A;  1QME A;  3VP4 A;  2Y4A A;  3BFC A;  1GHP A;  3O86 A;  4MBH A;  3VMA A;  3HLB A;  1ZC2 A;  3BFD A;  3Q82 A;  1RP5 A;  4IBR A;  1LHY A;  3UPO A;  3E2L A;  4S2K A;  4DE0 A;  2RL3 A;  5KSH A;  5HFO A;  4DXB A;  4KG2 A;  5EVI D;  3WWX A;  4MLL A;  1VQQ A;  2DRW A;  4KQQ A;  2A3U A;  4KG5 A;  4WEL A;  4QB8 A;  4PPR A;  5FA7 A;  3OC2 A;  3MZF A;  5KZH A;  5KSC A;  3IF5 A;  4DE1 A;  5AQ7 A;  3IF6 C;  2ZC3 B;  4Y7P A;  1L0G A;  5F83 A;  5G18 A;  4ZAM A;  5FAP A;  1I5Q A;  5EE8 A;  4LV1 A;  2WKE A;  3NCK A;  5D3O A;  2XLN A;  5FQK A;  5L2F A;  2B5R A;  5CEC A;  3BEB A;  1FCN A;  1KVM A;  2ZC7 A;  2OV5 A;  3HLD A;  4E6X A;  3GRJ A;  3MKE A;  1BLC A;  2XK1 A;  3SS4 A;  2Y2K A;  5JYP A;  2V20 A;  3HLW A;  1G68 A;  1IYP A;  2FFF B;  1YT4 A;  4S2J A;  4S2P A;  1NZU A;  2ZQ9 A;  5EPH A;  5FAT A;  1FR6 A;  4QHC A;  4YIN A;  1KGG A;  3G30 A;  1MWT A;  2XD1 A;  1YLT A;  4QU3 A;  4OQ0 A;  4WM9 A;  3QHY A;  4KG6 A;  1LL5 A;  1LL9 A;  2JE5 A;  4JPM A;  3VOZ A;  2WGV A;  2HP6 A;  4DDY A;  5FAO A;  2DCF A;  4E3J A;  3MBZ A;  5CGX A;  5BOH A;  4D2O A;  5GHZ A;  4OON A;  4ZTK A;  2HDR A;  3UE1 A;  3ZNT A;  4C3Q A;  5FI7 A;  1LI9 A;  4MBF A;  4A5R A;  2ZC4 B;  4E3K A;  5CRF A;  1PYY A;  5HAI A;  3BLS A;  1ZG6 A;  2Y2I A;  1BUE A;  3HL9 A;  3QNB A;  4R3B A;  4ZJ2 A;  4K0W A;  4E3M A;  3UE3 A;  4ZDX A;  5HW3 A;  3JYI A;  1GCE A;  5HL1 A;  4QD4 A;  3Q7Z A;  5A91 A;  2XF3 A;  3IWO A;  1JTG A;  3ZFZ A;  2P9V B;  4B4X A;  1L2S A;  1PW1 A;  4OQI A;  5EOE A;  4DKI A;  3WS2 A;  1L0F A;  3OCN A;  2UWX A;  3SH7 A;  1XA7 A;  4BQM A;  1FR1 A;  4KQR A;  4R1G A;  2ZM0 A;  1E25 A;  1K25 A;  3PBQ A;  1W7F A;  4BLM A;  1TDL A;  1ES4 A;  3CG5 A;  1FQG A;  3IXD A;  4EBL A;  4OLD A;  2XD5 A;  2Y2Q A;  3ZG0 A;  2VGJ A;  3EQU A;  2WKI A;  3V50 A;  3M2K A;  1ESI A;  4WMC A;  4OOM A;  5EOO A;  2WK0 A;  1K55 A;  3O3V A;  3P98 A;  4K91 A;  1K55 C;  1I2S A;  2ZQD A;  4DDS A;  5M19 A;  1H8Z A;  4R3J A;  3UE0 A;  4PM5 A;  1ERM A;  4PM9 A;  2H0Y A;  2WAE A;  4GB7 A;  3Q7V B;  3IXB A;  2HDU A;  4C6Y A;  4CJN A;  2ZJ9 A;  5DTK A;  3NDE A;  3A3F A;  2JBF A;  4OPZ A;  2EX2 A;  4GZB A;  4RX2 A;  5CHJ A;  1E3U D;  3FKW A;  3LY4 A;  4R4S A;  1JWV A;  4X56 A;  3RXW A;  1FSY A;  4ZJ1 A;  4FCF A;  1FCO A;  1NJ4 A;  1QMF A;  2IWD A;  5CGW A;  2OSU A;  4L0L A;  4ZBE A;  5GLD A;  5EVI A;  1KVL A;  3M6B A;  2P74 A;  3SS5 A;  2XH9 A;  2QMI A;  4DXC A;  1IEL A;  4PM7 A;  4JKT A;  4N9L A;  1MWS A;  1OME A;  5HAR A;  3HUN A;  4OPY A;  3WS4 A;  2Y2P A;  4WYY A;  1EI5 A;  3LEZ A;  4EQI A;  1W5D A;  4UA7 A;  1I2W A;  4GNU A;  3HUO A;  4BJP A;  4S2I A;  2ZLY A;  3N8R A;  3N4I A;  1XXM A;  4KEN B;  4UA9 A;  5TFQ A;  5CED A;  3ZCZ A;  1YM1 A;  5GLC A;  2VGK A;  1DJA A;  2J9P A;  4DF6 A;  4JLF A;  1IKG A;  2Z2M B;  1KGF A;  3DW0 A;  3OCL A;  1K4E A;  3QNC A;  4QY5 A;  4S2L A;  1YMX A;  5EVL A;  4OOY A;  1ERO A;  3MXR A;  4R0Q A;  4OH0 A;  3V3R A;  3WRZ A;  2I72 A;  1XKZ A;  5IHV A;  1BLH A;  3V39 A;  3IH9 A;  1E4D A;  2V2F F;  1XGI A;  4WEJ A;  3UNW A;  1CEF A;  3HVF A;  4QJG A;  5DTS A;  3PBN A;  3N6I A;  1W8Y A;  1SKF A;  1RGY A;  3C5A A;  1GHI A;  4B4Z A;  3OPR A;  4JF6 A;  2H5S A;  2XQZ A;  4M3K A;  3DWZ A;  4PMA A;  2EFU A;  5GLB A;  1CI9 A;  4Q8I A;  1CI8 A;  2WGI A;  2Z2L B;  4OPR A;  3IF6 B;  1W79 A;  1KDW A;  2DNS A;  4LCL A;  1K56 D;  3IHA A;  4RX3 A;  2CC1 A;  2Y2L A;  3HLE A;  4P85 A;  3GTC A;  5CGS A;  4ID4 A;  2WYX A;  5DF8 A;  3B3X A;  5CEB A;  3NBL A;  3NDG A;  5DF9 A;  3PBS A;  4OLG A;  4C75 A;  1LLB A;  5TR7 A;  1Y54 A;  4GKU A;  4JXS A;  1PZP A;  4HBT A;  4E3O A;  1FSW A;  2ZM8 A;  5EUA A;  4OKP A;  3UDI A;  2WAD A;  2Y2G A;  3BYD A;  1PZO A;  3N8S A;  1K6R A;  1NZO A;  3FV7 A;  5GL9 A;  5CXW A;  3LO7 A;  4OVD A;  4LEN A;  1O7E A;  4MBK A;  4OQG A;  4LV0 A;  3OPP A;  5FQM A;  4DRT A;  1MY8 A;  1GHM A;  3SH8 A;  1PI4 A;  1HZO A;  4FD8 A;  3BLM A;  3HBR A;  1H5X A;  1IYQ A;  3VP3 A;  3PBR A;  4FSF A;  4BD0 A;  3SOI A;  5CHM A;  2C6W B;  5DTT A;  5EEC A;  1ONH A;  3FKV A;  3VSK A;  1AXB A;  4N1X A;  5TGF A;  4Y0O A;  3ZG9 B;  1Q2Q A;  4WEK A;  5E43 A;  1E3U A;  4JXG A;  2EXB A;  4Y0U A;  3Q81 A;  1CEG A;  1K38 A;  3UDX A;  2QZ6 A;  4BL2 A;  3E2K A;  4IED A;  1YQS A;  3NIA A;  5E2H A;  4XUX A;  4JXW A;  1ESU A;  5AQB A;  1SCW A;  3Q07 A;  3SS3 A;  1PW8 A;  2Y2H A;  1ZKJ A;  4Z9Q A;  3GR2 A;  1XA1 A;  2ZQ7 A;  5FQI A;  4N92 A;  3CMZ A;  3VFF A;  1WE4 A;  4KQO A;  2J9O A;  1BLP A;  2ZMA A;  4LV3 A;  2P9V A;  3VP0 A;  3ITA A;  1J9M A;  1PWC A;  3VSL A;  4NET A;  1TDG A;  3G2Y A;  1H8Y A;  4DE2 A;  5FI6 A;  3A3D A;  3A3I A;  5AQA A;  3BFE A;  3LY3 A;  3TOI A;  1KGE A;  3UPP A;  1HTZ A;  3C7V A;  5FAS A;  3VP1 A;  1DJB A;  4P87 A;  1MKI A;  3IH8 A;  4HBU A;  3MZD A;  4EV4 A;  3GSG A;  4H8R A;  3UN7 A;  3MXS A;  3G31 A;  4GDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...