5F68A

Drosophila melanogaster cycle w398a pas-b with bound ethylene glycol
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cycle
publication title Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f68A00
4JGPA 1VB6A 4HP4A 4BBVA 4R38A 4WF0A 2ZOIA 1S4RA 4HNBA 3LI9A 1OT6A 5G4ZA 1GSXA 4EETB 4KQDA 1X0OA 3FC7A 1OJGA 4EEPA 2GJ3A 1KOUA 5HDCA 3UMEA 3K3CA 4F3LB 2PR6A 4MN6A 3LUQA 4NXEA 5A8BA 2WKRA 4HJ4A 3FG8A 2KDKA 2ZOHA 3RTYA 2A24B 1WA9A 3MJQA 4PKYA 3OLOA 3T50A 2A24A 1UWPX 1DP6A 4GCZA 1LT0A 3KX0X 1TS6A 5DJTA 5F69A 5G4YA 4HH2A 5KIZA 2L1MA 1N9LA 5HWWA 5HD3A 3F1OB 2YKFA 4E04A 3E4PA 2QWSA 3PYPA 2PYRA 4HP9A 3HJKA 1S66L 3MR0A 2PR5A 1GSVA 2VEAA 4LPZA 2V1AA 3ZQ5A 5IS1A 1LL8A 3B33A 3LIBA 4JGQA 4I5SA 1N9OA 3P7NA 2INWA 4I3JA 3G6OA 1Y28A 1D06A 2PYPA 4EW7A 3UB9A 3H82B 3LIAA 5HSQA 2L0WA 3K3DA 4LLOB 2OWJA 5HDSA 2PHYA 4JGOA 4I38A 4HHDA 2PD8A 1P0ZA 1TS7A 2EA9A 5HWTA 3H7WB 1F98A 1F9IA 1V9ZA 2J80A 3H7WA 1TS8A 4HI4A 3MQOA 3ULFA 4XT2B 2QJ7A 3F1PB 4GS9B 3A0VA 1MZUA 4XT2A 4EERA 5DKLA 3F1PA 3BY9A 4GS9A 3F1NA 2R78A 3IBRA 2HV1A 5HDDA 1XFNA 2W27A 3LYXA 4H6JB 4I3AA 1EW0A 4WL9A 1T1AA 2ZBBA 1T19A 2I9VA 1OTBA 3MFXA 4L9FA 4H6JA 3H9WA 2V0WA 3UB7A 4HIAA 2M1CA 3D72A 3UB8A 4EQ1A 1T1CA 4PKYG 4GHIB 1LSVA 1XJ6A 3NJAA 4LRYC 4GHIA 2Z6DA 4DJ2A 4DJ3A 1ODVA 2VLGA 4R3AA 5HZHA 1V9YA 3LIFA 3LIEA 4HJ6A 3VE3A 1UGUA 4HY8A 5F6AA 4BBUA 5EFWA 4LRZE 4YWZA 3CAXA 4L9EA 3E4OA 4K08A 2WKQA 1DRMA 1OT9A 4HOIA 5TBMA 4M4XA 3MXQA 2JHEA 4WUJA 2VV6A 1D7EA 2PD7A 2W0NA 3BY8A 3NOPC 4EEUA 2YKHA 2Z6CA 4R6LA 3A0RA 4HJ3A 2QKPA 3LIDA 3C2WA 4EXOA 1T18A 3GECA 3UMDA 3SW1A 3EWKA 3VOLA 3UE6A 2PDRA 3NHQA 1BYWA 3IS2B 2H28A 2L4RA 3F1NB 2D02A 4NXBA 3MQQA 4EESA 2VV8A 5AVFA 3IS2A 4RQ9A 3GDIA 1S1ZA 1XJ3A 3C8CA 3VE4A 1XJ2A 2D01A 3LI8A 4LRXC 4WLAA 1OJ5A 2OOLA 5DKKA 4F3LA 2WKPA 3NOTC 5I5LA 2OWHA 5HD5A 1DP9A 1OTAA 1T1BA 4HH3A 3E4QA 3CWFA 1TS0A 2B02A 4WN5A 5AVEA 3ICYA 5J7EA 4MN5A 4KUKA 2P7JA 1LSWA 5IU1A 5F5YA 3EEHA 4KUOA 1G28A 1JNUA 4NXGA 4R70A 3A0SA 2VV7A 1N9NA 4NXFA 5J3WA 4I3IA 2K7SA 1NWZA 1OTDA 3F1OA 4BBTA 2V0UA 4JGRA 5TBMB 1LSXA 5DJUA 2V9AA 2QJ5A 3CLOA 4L9GA 5HWVA 1DP8A 5J4EA 4I39A 3RH8B 3BWLA 3UB6A 3NOUC 3PHYA 3HJIA 1UWNX 1OTIA 2BASA 5F68A 2V1BA 4HQAA 3LICA 4GW9A 2QHKA 3H82A 1OTEA 1S1YA 1S67L 2JN7A 1P97A 1XFQA 1GSWA 1XJ4A 2KX6A 1S4SA 4B9OA 2CMNA
chains in the Genus database with same CATH superfamily
3ITAA 1VB6A 2B18A 5AQAA 4ZJ2A 4L0LA 4G3KA 3M6HA 4S2NC 3LI9A 2R9XA 3W2ZA 5G4ZA 2Z2LB 2IWCA 2P04A 1ES3A 1MXOA 2EXAA 4HESA 3IH8A 3SS4A 1K38A 4YINA 1PYYA 5EE8A 4Y3IA 3ZG9B 1L3LA 4CLCB 1BLPA 3HLDA 3LUQA 1H8YA 4X1MA 4NXEA 1TDLA 1DJCA 1PI5A 3WS1A 2KDKA 3B3XA 2ZD8A 2A24B 1E3UD 3GMWA 2HF6A 4KZBA 1HVBA 3T50A 4IBRA 3S1YA 3UDXA 1UWPX 1DP6A 1W79A 1NZUA 4YFMA 3NC8A 2X71A 1TS6A 5GLCA 4ID4A 4X56A 2JKFA 1IKGA 1WYBA 2L1MA 5KIZA 1ACFA 2W1RA 3OCNA 5HD3A 2ZMAA 3UPPA 3KYQA 4C3QA 4BENA 3LGOA 1IEMA 4E04A 3E4PA 2DNSA 4PM9A 5CEBA 1I2WA 3TG9A 3DTKA 1M40A 4Y0TA 1NRJA 1DJAA 3IWOA 1CI9A 5CXWA 5CGXA 4Q0IA 1FR6A 2Y2KA 2XD5A 4JGQA 2ZC3B 1LI9A 2HP5A 3P7NA 1L0DA 2INWA 1S0WA 1AWIA 3G6OA 1TF1A 3HREA 1D06A 2PYPA 4MCWA 3UB9A 3H82B 1CF0A 4XUXA 4LLOB 4BJPA 3ZYTA 2QZ6A 5HDSA 2PHYA 1KGEA 2PD8A 1L0GA 3PBOA 4KG5A 3BQ8A 3BW6A 3H7WB 3C30A 4S2LA 5KSCA 3HLCA 4R0QA 1TS8A 3QP1A 4LV3A 3S4XA 1XGJA 3ZNYA 2EWWA 2IWDA 4ESPA 4GS9B 2WGWB 3HVFA 3FYZA 3IHBA 4PM8A 4P87A 3BY9A 2J9PA 1FILA 2JC7A 4WBGA 4N92A 2IA2A 3RXWA 5HDDA 4UQIS 1SKOA 3ZNTA 2Y2OA 1EWZA 5L8MA 2W27A 2NUPC 4S2JA 1VHMA 4WL9A 5FQKA 1HD8A 1OTBA 2I9VA 3NY4A 4QB8A 4L9FA 1ZTUA 3H9WA 2CC1A 2HPBA 2V0WA 4KQRA 2M1CA 3NULA 3UB8A 4PM5A 3T4JA 3NJAA 4GHIA 3IQAA 2Z6DA 2HGVA 5EV0A 4ZTKA 1O07A 1SDEA 3IF6B 1J3WA 3L7HA 1W8YA 4RX3A 2GZAA 5DVAA 2XR0A 3ZVWA 5F6AA 5HL6A 3IXGA 5J8XA 4BBUA 3DTIA 3SZTA 3NDEA 2G2WA 1K4EA 5CX7A 5FASA 3BM6A 3S7OA 2JE5A 4A5RA 1W7FA 1ERMA 1KVLA 3FKVA 2VGKA 1DRMA 1HZOA 4B4ZA 1IYSA 5EVLA 2VKSA 2PAVP 3HUNA 3T12B 5TBMA 3GQZA 4OQGA 4WELA 3CPTB 1SZVA 3Q7ZA 4Y0UA 1RGYA 4FCFA 4UHUA 2VGLM 4IEDA 1YLJA 3NI9A 4E6WA 3MF0A 5L10A 4B4XA 4HJ3A 2MJ6A 3JVVA 3HLEA 2ZC5B 1PZOA 1T18A 4JF4A 3O86A 5L2FA 4E3JA 3T1SA 3UE6A 2PDRA 3BQAA 3DWKA 1BYWA 4RYEA 1TEMA 4PMAA 2L4RA 4UEYA 4R3JA 4IUKA 4RVAA 5F83A 5HW3A 3C38A 2WK0A 2HDQA 1YLZA 3T1QB 2EXBA 3A3DA 2ZM2A 1PRQA 4IVKA 2D01A 4PM7A 3LI8A 5FDSA 2DRWA 5GLBA 3JVUA 4LRXC 4F3LA 2WKPA 3JPUA 2WZZA 1PZPA 4ETZA 3SS5A 3KSFA 2NUTC 3UPOA 3VOYA 1LLBA 2PBYA 2HP6A 2Y4AA 1NXYA 3S7NA 1YLPA 3E4QA 4OPYA 1TS0A 5TJJA 4WN5A 5CECA 1NYYA 3O5YA 3ICYA 4CLCD 2W3EA 1GHMA 2ZC4B 3P09A 4BLMA 4KZ4A 1G28A 4NXGA 4R70A 5E2FA 2VV7A 1N9NA 1CK3A 2VK3A 4O0PA 1KGFA 4I3IA 1Z6FA 2K7SA 5FQ9A 5FQQA 4BBTA 2EWVA 2V0UA 3E2LA 3O3VA 3OPHA 5TBMB 2V9AA 1G68A 4I39A 3T4KA 3BWLA 5GLAA 3HJIA 2Y8HA 4GDNA 3MBZA 3D3OA 2Y2NA 5TFQA 1EI5A 4P6BA 2V1BA 2KLIA 4LV0A 4N9LA 1G5UA 3CHWP 1GSWA 1S4SA 3G30A 4BBVA 3T4TA 2ZOIA 1S4RA 4P0MA 3MQ0A 1LL9A 4HNBA 3PBSA 1VEUB 1OT6A 3T4SA 1GSXA 4QHCA 3FC7A 1OJGA 1JVJA 1W63Q 2V1ZA 2GJ3A 2EX8A 3U2AA 1KOUA 4ZJ3A 2VA0A 3UMEA 4F3LB 4K0XA 1OPXA 2RCXA 3TSGA 2QPNA 4IHQA 4X6TA 1NLZA 5D3OA 2XFTA 1YLTA 3WS5A 2VGLS 4CLCA 3KYZA 1N4OA 3MZDA 2XFSA 1E25A 4NKPA 4E3NA 2P74A 3MJQA 4PKYA 2OSUA 2A24A 3AGEA 2Q0OA 3S7PA 4DE3A 3UY6A 2ZM8A 3VP1A 5EPHA 3WRZA 3V5MA 4E3IA 1LT0A 3ITBA 4FUWA 4QU3A 5DJTA 4HBUA 5FQIA 3G2ZA 3UDFA 4E3MA 1YLYA 1LL5A 4Y0OA 1K6SA 5MC7A 5HWWA 2I72A 5FAOA 4GB7A 3B47A 3CI6A 3ZDJA 3SOIA 3G2YA 3HJKA 3D9YA 3EQVA 3MR0A 3GR2A 2JCHA 3HLFA 4LPZA 2OLVA 3ZQ5A 5EVIC 2EFXA 4OLGA 3LIBA 4OH0A 4BQMA 2FZ0A 1H3QA 2KOIA 5FATA 1K57C 5E2GA 2BG1A 3DTMA 4R4SA 4EW7A 4AFIA 2ZJ9A 2A3UA 5HSQA 1BSGA 4UQIM 4OPRA 4NETA 5C5KA 2OWJA 1CI8A 3KSIA 1JTDA 3IXDA 4G3VA 5HPIA 4DF6A 1TS7A 3GVBA 4NK3A 2EA9A 1F98A 2JBFA 5HAIA 3NDGA 3Q7VB 1IKIA 3SS3A 1V9ZA 1MWSA 3FPWA 1FR1A 2W3DA 3H7WA 1PW8A 2Y91A 3N8SA 3W4OA 4HI4A 3MQOA 3T4QA 1STZA 3ULFA 4ZBEA 4XT2B 2QJ7A 3CITA 3MXRA 2DMWA 5E2EA 1K6RA 1N9BA 3Q07A 2WADA 5K5BA 4S2OA 5DKLA 2ZC6B 1IOUA 4GS9A 3HLWA 4QY6A 2WGWA 4DXCA 3T4LA 4KG2A 3BLMA 1RGZA 1E4DA 3KSHA 2WUQA 1XFNA 1SCWA 3BECA 4HEFA 2XEPA 3LYXA 2WAFA 4I3AA 1EW0A 3FPVA 3KO6A 1KE3A 2ZBBA 1T19A 4OOYA 5A91A 3MFXA 1ESIA 3DTEA 1FQGA 4S2KA 3HLBA 4Y13A 1I5QA 3QP5A 4GN2A 1ERQA 1T1CA 2M7UA 1LSVA 3C4PA 3LY4A 2XQZA 3N8LA 1NRFA 3UO9A 3ZG8B 2BTFP 2ZQ8A 4U0TA 5DFXA 1MWTA 4DJ3A 4Y17A 1ODVA 2PBDP 2XGNA 5CGWA 5F1FA 3LIEA 1YMSA 4JXGA 3IF6A 3TW8A 4EV4A 4Q8IA 3E0YA 4YWZA 3HBRA 3JYIA 4L9EA 3E4OA 5A92A 3TJZC 4WZ5A 1FSWA 4MLLA 2EFUA 3UDIA 1TDGA 1OT9A 4HOIA 2ACGA 2E8JA 3GRJA 4M4XA 3MXQA 5EUAA 4WUJA 4D2OA 2VV6A 4KENB 4CJNA 2W0NA 4X1LA 1YT4A 2ZM0A 4EEUA 4QPRA 3SH8A 1YMXA 3CPTA 4R6LA 1IYOA 3A0RA 5HAQA 2QKPA 4BD1A 2E8IA 4D60A 4Y5FA 4EXOA 5FL3A 3OOVA 2O9AA 2J3TC 2Q9MA 4BD0A 3SW1A 3VOLA 4LV1A 1E3UA 1Z09A 3IX8A 3IS2B 2HZ5A 4EQIA 4N1XA 4MMNA 4EESA 5KMWA 4GZBA 1SHVA 1W5DA 2WAEA 4JBFA 1YKDA 3UE3A 3AGFA 2H0TA 2P08A 1XJ3A 3C8CA 4ARZB 2V2FF 1QMFA 2LB5A 4MN7A 1XJ2A 4X53A 5HFOA 2QMIA 4DN0A 4ME4A 3TRCA 5I94A 3HUMA 3LCEA 3MSHA 5DKKA 5AQ9A 1JWZA 1FCNA 4X25A 4DKIA 1H8ZA 5CTMA 3IXBA 4X69A 3MMHA 4KZ3A 4CLCE 5I5LA 1CQAA 1GCEA 3CUEA 3ZCZA 4LFUA 2ZMVA 4HH3A 4WEJA 4FSFA 3BEBA 1G6AA 4PHTA 3TOIA 1JWVA 5AVEA 1FCOA 1IYQA 1MWRA 1KDSA 1KE4A 4P6ZM 4ZDXA 5J7EA 2WGIA 3V67A 1L2SA 5DTTA 2XH9A 4KQOA 3A0SA 4S2MA 5J3WA 3IT9A 2IWBA 1NWZA 3ZG5A 4OOLA 2HDRA 3C7VA 2J3WA 3F1OA 4FH2A 2C6WB 5GHXA 4EU0A 2W3HA 1ES5A 2B95A 3U4LP 3ZG7B 2XK1A 1HLUP 2AVXA 2X02A 3OPPA 3RXXA 5A93A 1IELA 1H5XA 1DP8A 4KZ9A 3IXHA 3RH8B 3UB6A 3NOUC 1IFQA 2Y2MA 1XGIA 5KSHA 4PPRA 3GTCA 4GLQA 2PU2A 1UWNX 1XA7A 3RFBA 5A90A 4EUVA 1ES2A 1S1YA 3VFHA 2HJEA 2CMNA 1NYMA 1CEGA 3LR4A 2A49A 4NEED 4WF0A 5M18A 2GX5A 4MBFA 1DY6A 4BMWA 3TE8A 1K55A 1X0OA 1VEUA 1K4FA 5DF8A 2BLSA 4EEPA 1PIOA 2JKRI 1PWGA 2XA7M 3S22A 4GJ4A 1BZAA 1KDWA 2PR6A 4MN6A 5FAPA 4B88A 3PAEA 5A8BA 1YPRA 5CEDA 4HJ4A 5LBRA 3DAVA 3FG8A 4RX2A 5GHZA 5CRFA 3QNBA 4JF6A 3VSKA 3RTYA 1TD5A 1D1JA 3ZG0A 2ZMFA 4Y7PA 4X68A 4ZJ1A 4F94A 2JKTI 3Q1FA 1SDNA 3K2NA 4GCZA 2VGJA 2W3GA 4K0WA 4E6XA 1JWPA 1F5MA 2UV0E 3IWIA 3G34A 5DF7A 3W8KA 3F1OB 2YKFA 3PTEA 1ZHHB 5FQJA 4HP9A 3QP2A 4YOFA 4XXRA 5JYPA 2Y2GA 2ZQCA 5GHYA 2PR5A 4GD8A 2VEAA 4ZRRA 1MY8A 3N8RA 4E3KA 3LR3A 2V1AA 5M19A 5IS1A 1LL8A 4OQ0A 3ZFZA 1PWDA 3B33A 1O7EA 1N9OA 3M2JA 1PFLA 2Y2PA 4Q0HA 1Y28A 4WMCD 4GNUA 2WKIA 3QP4A 3QNCA 3A3IA 2L0WA 3NECA 4MBHA 4P6ZS 4LCMA 2Y2JA 1XXMA 2XSSA 3S7QA 2C5WB 1KVMA 1CJFA 4WEKA 1P0ZA 1XX2A 5HWTA 4LENA 1YAXA 3A3JA 3G32A 4Q0JA 2Y2HA 4M3KA 3ISGA 5TGFA 4R1GA 4R3BA 3Q7VA 1MBLA 1KGGA 3LR0A 3CZDA 1PNEA 5EVID 5L07A 1QMEA 5DF9A 3A3FA 4WZ4A 1PI4A 5G18A 3F1PB 1H0MA 4BWIA 3A0VA 1MZUA 4XT2A 1RCJA 4EERA 4OP5A 3WRTA 3PBQA 4CLCC 4BL3A 4DRTA 2R78A 3IBRA 2HV1A 3I7JA 1VETB 1MWUA 2V8FA 4DE0A 3DW0A 4H6JB 2HDUA 3CMZA 1T1AA 4U3TA 5CERA 2ZQAA 1BLCA 4JXVA 1WE4A 3D72A 3V3SA 3VP3A 1K25A 4EQ1A 3P01A 4PKYG 3VV4A 3C4OA 2G2UA 3G31A 2GNXA 3GSGA 4LRYC 4QY5A 4JF5A 2Z2MB 5E2HA 2XA7S 1EROA 4DJ2A 3EGDC 4EBPA 3PAGA 4R4RA 3VMAA 5HZHA 3UN7A 4OOMA 4DDYA 4HJ6A 5KZHA 2A2LA 1UGUA 4HY8A 2QYBA 2XLNA 2VX8A 4OVDA 3OZHA 1Y4OA 1FOFA 5HAPA 2FFFB 4OPZA 4KQQA 3E98A 4K08A 2WKQA 3UE0A 2Y79A 4EUZA 3EEAA 4GD6A 1KE0A 4U0XA 3MKFA 5HL1A 5EVEA 3B42A 3G4PA 4YNRA 5AJGA 5GLDA 1Q2PA 3BY8A 5F82A 4Y2FA 3GV9A 4ETXA 3C7UA 2WZXA 3ZHHA 2YKHA 4JLFA 3V50A 1ZC2A 1BTLA 1ZG4A 1GA9A 1SKFA 4R23A 3MXSA 3LY3A 3C2WA 5EM1A 1L0FA 2W1TB 3UMDA 1J9MA 1OMEA 3UB5P 4QWOA 4XUZA 3NHQA 2H28A 1ONHA 1K54A 1GHIA 5IHVA 3OPRA 5AVFA 3UPNA 3IS2A 4S2NA 4G3WA 3MFDA 1S1ZA 3E2KA 3W4PA 5HPFA 2WKHA 3FV7A 4JKTA 3O88A 2ZQ9A 3BFDA 3Q82A 4ARZA 5JYOA 3M2KA 4WLAA 5CHUA 4RA7A 1MC0A 2G7UA 4KZ6A 4CPKA 2O0YA 3IHAA 2OWHA 2J3TD 5HD5A 3QP6A 3LO7A 4OKPA 1OTAA 2WYXA 1T1BA 4E3LA 2ZC7A 2K31A 3AGDA 2B02A 2HDSA 1BUEA 4O01A 2M7VA 2Y2QA 4JPMA 4DDSA 2X01A 3IF6C 1LSWA 2FH5A 1PWCA 2WGVA 5IU1A 5F5YA 3HCYA 3BFGA 1S6RA 3NIAA 3R7WA 3BRMA 4NXFA 2RL3A 2EX2A 3PBTA 1A0KA 2ZL1B 1CEFA 1NZOA 2HP9A 3BLSA 4WZ5C 2XDMA 3IWQA 2Y2IA 5DJUA 5EVIB 2QJ5A 3FKWA 5J4EA 4N1HA 3PHYA 2OAQ1 4FD8A 4FOFA 3HL9A 2OV5A 3W4QA 1W63M 1YSQA 1LI0A 2H10A 5IT5A 3LICA 1FIKA 2QHKA 5DTKA 4Y15A 1YQSA 1P97A 1XFQA 1XJ4A 2KX6A 4JGPA 3FZCA 3LEQA 4HP4A 4R38A 1VQQA 4KZAA 5F1GA 2B5RA 4EETB 4KQDA 3WS4A 1U60A 1G6OA 3IX4A 2O9BA 5HDCA 3BFEA 3K3CA 3RJUA 2PT7A 1AXBA 4DXBA 2WKRA 1K0KA 5EOEA 3PBNA 1TVFA 2W3FA 2Y59A 4C6YA 3D4FA 4DE1A 4OQHA 1ZKJA 3G35A 3N7WA 1JTGA 4P85A 4FH4A 2ZOHA 1F2KA 3CUEC 3LEZA 3OBFA 1WA9A 3OLOA 4MEZA 3SH7A 1I2SA 5AQ7A 4DMZA 4UA6A 1Q2QA 3KX0X 3T4OA 3QP8A 1RP5A 1LHYA 3R7WB 4DE2A 2O99A 5F69A 5G4YA 3NBLA 4HH2A 1N9LA 5GL9A 1BT5A 3BFCA 2P9VA 4H8RA 2QWSA 3PYPA 2PYRA 3VP0A 3OCLA 4GOGA 1S66L 1P9RA 1GA0A 1GSVA 4KZ8A 2Y55A 2XRNA 3LFVA 4LV2A 1YM1A 3VFFA 5CHMA 3VOZA 4I5SA 4JXSA 2O9CA 5HX9A 1MKMA 4I3JA 2ZQ7A 4OQIA 4QJGA 5M1AA 5CGSA 4MBKA 3LIAA 3K3DA 3LR5A 4JGOA 3BFFA 4I38A 3C5AA 4HHDA 3VP2A 3ZGAB 4PAUA 1BULA 1HTZA 2XF3A 4S2PA 2XD1A 3IH9A 1F9IA 5FAQA 5E43A 1K55C 2J80A 1YLWA 1ZG6A 1L0EA 4EBNA 1GHPA 2J7VA 1DJBA 1BLSA 1YSPA 3F1PA 3F1NA 1SKOB 4FTXA 3HLGA 1ONGA 4JXWA 3MS6A 2FFYA 3M6BA 3Q81A 3KSGA 3VP4A 4S2IA 1VETA 3WS0A 2VJWA 4C75A 3OPLA 4H6JA 5FI2A 2V8CA 1ALQA 4WM9A 3UB7A 4HIAA 1BLHA 4UA7A 1NY0A 2P9VB 4GHIB 3DWZA 2OLUA 1XJ6A 4OLDA 2H0YA 4UAAA 2OAP1 2K2NA 3MZFA 3CJMA 2VLGA 4R3AA 3FWLA 1V9YA 4Z1WA 3T1XA 3IX3A 3LIFA 3BJNA 3A3EA 3VE3A 4KG6A 5FSRA 5EFWA 4LRZE 2J9OA 3MZEA 4KZ5A 5DTSA 3CAXA 2ZQDA 5BOHA 1Y54A 3MKEA 3N6IA 1K56D 4O8GA 3PXPA 1WYCA 3EGXC 4LCLA 2PU4A 3EOIA 1MPLA 2JHEA 1D7EA 4ZAMA 2GDNA 3HUOA 2PD7A 2EX6A 4Z9QA 3PR6A 1PW1A 3NOPC 1NJ4A 4B93A 2Z6CA 3OC2A 5FDHA 4QD4A 5EOOA 3LIDA 1H8MA 1XPBA 3ZVTA 1VM1A 5FI7A 1M6KA 3GECA 3V3RA 2VZWA 4OONA 5FQMA 3EWKA 2JKGA 1XA1A 4CQHA 5L09A 3IF5A 2W1TA 3F1NB 2D02A 3CG5A 1FCMA 4NXBA 3MQQA 5HARA 2VV8A 4BL2A 3BYDA 5EM0A 1IYPA 4RQ9A 3GDIA 4UA9A 2HJ9C 5AQBA 2DCFA 3VE4A 3V39A 5FEFA 3NCKA 1FSYA 3L9KA 1OJ5A 5CHJA 2OOLA 1W8QA 4GKUA 1ES4A 5FEGA 3NOTC 2Y2LA 1ESUA 5EECA 1DP9A 4IBXA 3PBRA 1XP4A 3KYEA 1P9WA 5FA7A 4IJGA 5TR7A 3CWFA 3O87A 4K91A 4KZ7A 4II7A 4EWFA 2H5SA 4WMCA 5U47A 3QHYA 4EBLA 4HBTA 5CTNA 2WKEA 4MN5A 4KUKA 1K56A 2P7JA 3UE1A 3DBAA 2JKRM 4PM6A 4X55A 3EEHA 4KUOA 3WWXA 2LB9A 1JNUA 4IUHA 3UNWA 3VSLA 3EQUA 1OTDA 3IBJA 4JGRA 4MNRA 2UWXA 4GDBA 4LGWA 4NG2A 2ZL1A 1LSXA 2PRFA 4OPQA 3CLOA 2EX9A 2R9WA 4MDZA 5FI6A 4L9GA 5HWVA 5EVIA 2ZLYA 1C3BA 2JKTM 3R4KA 1MKIA 2V20A 4OP8A 1K57A 3SH9A 2Q9NA 3N4IA 1OTIA 4O7DA 5DFYA 3WS2A 2BASA 4WYYA 5F68A 2XROA 3T1RA 4HQAA 4GW9A 3H82A 1OTEA 4IVIA 1S67L 2JN7A 4N9KA 4E3OA 1K54C 4B9OA 1NLYA 3P98A 1XKZA 2J8YA
chains in the Genus database with same CATH topology
4JGPA 1VB6A 2B18A 3LR4A 4HP4A 4L0LA 4G3KA 4BBVA 4NEED 4R38A 4WF0A 3T4TA 2GX5A 1S4RA 2ZOIA 3MQ0A 4HNBA 3LI9A 4BMWA 3PBSA 3TE8A 1OT6A 3W2ZA 3T4SA 5G4ZA 1GSXA 2P04A 4EETB 4KQDA 1X0OA 3FC7A 1OJGA 1G6OA 4EEPA 1W63Q 2JKRI 2GJ3A 2O9BA 2XA7M 3U2AA 4GJ4A 4Y3IA 1KOUA 5HDCA 2VA0A 3UMEA 3K3CA 2PT7A 2PR6A 4F3LB 4MN6A 4CLCB 1OPXA 3LUQA 4IHQA 4NXEA 1NLZA 5A8BA 2WKRA 3PBNA 2VGLS 2W3FA 4CLCA 4HJ4A 5LBRA 3FG8A 3KYZA 2KDKA 4NKPA 2ZOHA 3CUEC 3RTYA 2A24B 3OBFA 1TD5A 1WA9A 3MJQA 2HF6A 2ZMFA 4PKYA 3OLOA 3T50A 2A24A 3S7PA 2JKTI 1UWPX 3K2NA 4DMZA 1DP6A 4GCZA 1LT0A 3KX0X 1TS6A 3T4OA 2W3GA 5DJTA 3R7WB 2O99A 1F5MA 5F69A 5G4YA 4HH2A 5KIZA 2L1MA 1N9LA 5MC7A 2W1RA 3OCNA 5HWWA 5HD3A 3F1OB 2YKFA 3KYQA 1ZHHB 3B47A 4E04A 3CI6A 3E4PA 2QWSA 3PYPA 2PYRA 4HP9A 4YOFA 3HJKA 3OCLA 1S66L 3EQVA 1P9RA 3MR0A 2PR5A 1GSVA 2VEAA 2XRNA 4ZRRA 4LPZA 3LFVA 3LR3A 2V1AA 1NRJA 3ZQ5A 5IS1A 1LL8A 3B33A 4Q0IA 3LIBA 4JGQA 4I5SA 1N9OA 2O9CA 3P7NA 2INWA 1MKMA 2FZ0A 4I3JA 3G6OA 4Q0HA 1H3QA 1Y28A 1TF1A 2KOIA 1D06A 2PYPA 4MCWA 4EW7A 4AFIA 3UB9A 3H82B 3LIAA 5HSQA 2L0WA 4UQIM 3K3DA 3LR5A 5C5KA 4LLOB 4BJPA 3ZYTA 4P6ZS 2OWJA 5HDSA 2PHYA 2XSSA 3KSIA 3S7QA 4JGOA 4G3VA 4I38A 4HHDA 2PD8A 5HPIA 4WEKA 1P0ZA 1TS7A 3PBOA 4PAUA 2EA9A 5HWTA 3BQ8A 3BW6A 3H7WB 3C30A 1F98A 1YAXA 1F9IA 4Q0JA 1V9ZA 3FPWA 2W3DA 2J80A 3H7WA 1TS8A 3LR0A 4HI4A 3MQOA 5DF9A 3T4QA 1STZA 3ULFA 4XT2B 2QJ7A 3CITA 2EWWA 2DMWA 3F1PB 4GS9B 4BWIA 3A0VA 1MZUA 4XT2A 5K5BA 4EERA 5DKLA 1YSPA 3F1PA 3PBQA 3BY9A 4CLCC 1IOUA 4GS9A 3F1NA 3T4LA 2R78A 3IBRA 2HV1A 2IA2A 5HDDA 3KSHA 4UQIS 5L8MA 1XFNA 2W27A 2NUPC 3KSGA 3LYXA 1VHMA 4H6JB 2VJWA 4I3AA 1EW0A 3FPVA 4WL9A 1T1AA 3KO6A 2ZBBA 1T19A 2I9VA 1OTBA 3MFXA 4L9FA 4H6JA 1ZTUA 3H9WA 2V0WA 3UB7A 4HIAA 2M1CA 3D72A 3UB8A 4EQ1A 1T1CA 3P01A 4PKYG 4GHIB 2M7UA 1LSVA 1XJ6A 3VV4A 3T4JA 2GNXA 3NJAA 4LRYC 4GHIA 2OAP1 5DFXA 2K2NA 2XA7S 2Z6DA 2HGVA 4DJ2A 4DJ3A 3EGDC 1ODVA 2VLGA 4R3AA 5HZHA 1V9YA 4Z1WA 3LIFA 3LIEA 3BJNA 4OOMA 2GZAA 4HJ6A 3VE3A 2A2LA 1UGUA 4HY8A 2QYBA 5F6AA 5HL6A 3TW8A 4BBUA 2VX8A 5EFWA 4LRZE 5CX7A 3S7OA 3E0YA 4YWZA 3CAXA 4L9EA 3E98A 3E4OA 4K08A 2WKQA 3TJZC 2Y79A 1DRMA 4O8GA 2VKSA 3EEAA 3PXPA 1OT9A 3EGXC 4HOIA 5TBMA 4M4XA 3EOIA 3MXQA 2JHEA 4WUJA 3B42A 4WELA 4YNRA 2VV6A 1D7EA 5AJGA 2PD7A 2W0NA 3BY8A 3PR6A 4Y2FA 3NOPC 4ETXA 2VGLM 4EEUA 4B93A 4QPRA 2YKHA 2Z6CA 3OC2A 4R6LA 3MF0A 3A0RA 4HJ3A 2MJ6A 2QKPA 3LIDA 3JVVA 1H8MA 3C2WA 4Y5FA 4EXOA 5FL3A 1T18A 2O9AA 3GECA 2J3TC 2VZWA 3OOVA 2W1TB 3UMDA 3SW1A 3EWKA 3VOLA 3UE6A 2PDRA 3BQAA 4CQHA 3NHQA 1BYWA 3IS2B 2H28A 2W1TA 2L4RA 4UEYA 3F1NB 2D02A 4IUKA 4MMNA 3MQQA 4NXBA 4EESA 2VV8A 5AVFA 3C38A 3IS2A 4G3WA 1YKDA 3UE3A 4RQ9A 3GDIA 1S1ZA 2P08A 1XJ3A 3C8CA 2HJ9C 4ARZB 5HPFA 3VE4A 2LB5A 4MN7A 1XJ2A 2D01A 4ARZA 4DN0A 4ME4A 3LI8A 3TRCA 3JVUA 4LRXC 4WLAA 1MC0A 1OJ5A 2OOLA 5DKKA 2G7UA 4F3LA 2WKPA 3NOTC 4ETZA 3MMHA 3KSFA 2O0YA 2NUTC 4CLCE 5I5LA 2OWHA 2J3TD 5HD5A 1DP9A 3PBRA 3CUEA 1OTAA 2ZMVA 1T1BA 1P9WA 4IJGA 4HH3A 4WEJA 4FSFA 3S7NA 3E4QA 2K31A 3CWFA 1TS0A 4PHTA 2B02A 5TJJA 4II7A 4WN5A 5AVEA 4O01A 2M7VA 3O5YA 3ICYA 4CLCD 2W3EA 4P6ZM 5J7EA 4MN5A 4KUKA 2P7JA 3DBAA 3V67A 2JKRM 1LSWA 2FH5A 5IU1A 5F5YA 3EEHA 4KUOA 2LB9A 1G28A 1JNUA 3HCYA 4NXGA 4R70A 4KQOA 3R7WA 3A0SA 4IUHA 2VV7A 1N9NA 4NXFA 5J3WA 4O0PA 3PBTA 4I3IA 2K7SA 1NWZA 4OOLA 3EQUA 1OTDA 2J3WA 3F1OA 4BBTA 2EWVA 2V0UA 3IBJA 4JGRA 4EU0A 2W3HA 5TBMB 1LSXA 5DJUA 2V9AA 2QJ5A 3CLOA 4MDZA 4L9GA 5HWVA 1DP8A 5J4EA 4I39A 3T4KA 3RH8B 2JKTM 3BWLA 3UB6A 3NOUC 3PHYA 3R4KA 2OAQ1 3HJIA 1IFQA 2Y8HA 4FOFA 3D3OA 5KSHA 4GLQA 1UWNX 1W63M 1YSQA 3RFBA 1OTIA 5DFYA 2BASA 5F68A 2XROA 4EUVA 2V1BA 4HQAA 5IT5A 2KLIA 3LICA 4GW9A 2QHKA 3H82A 1OTEA 1S1YA 1S67L 2JN7A 1P97A 1XFQA 1GSWA 1XJ4A 2HJEA 1S4SA 2KX6A 1NLYA 4B9OA 2CMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGP A;  1VB6 A;  4HP4 A;  4BBV A;  4R38 A;  4WF0 A;  2ZOI A;  1S4R A;  4HNB A;  3LI9 A;  1OT6 A;  5G4Z A;  1GSX A;  4EET B;  4KQD A;  1X0O A;  3FC7 A;  1OJG A;  4EEP A;  2GJ3 A;  1KOU A;  5HDC A;  3UME A;  3K3C A;  4F3L B;  2PR6 A;  4MN6 A;  3LUQ A;  4NXE A;  5A8B A;  2WKR A;  4HJ4 A;  3FG8 A;  2KDK A;  2ZOH A;  3RTY A;  2A24 B;  1WA9 A;  3MJQ A;  4PKY A;  3OLO A;  3T50 A;  2A24 A;  1UWP X;  1DP6 A;  4GCZ A;  1LT0 A;  3KX0 X;  1TS6 A;  5DJT A;  5F69 A;  5G4Y A;  4HH2 A;  5KIZ A;  2L1M A;  1N9L A;  5HWW A;  5HD3 A;  3F1O B;  2YKF A;  4E04 A;  3E4P A;  2QWS A;  3PYP A;  2PYR A;  4HP9 A;  3HJK A;  1S66 L;  3MR0 A;  2PR5 A;  1GSV A;  2VEA A;  4LPZ A;  2V1A A;  3ZQ5 A;  5IS1 A;  1LL8 A;  3B33 A;  3LIB A;  4JGQ A;  4I5S A;  1N9O A;  3P7N A;  2INW A;  4I3J A;  3G6O A;  1Y28 A;  1D06 A;  2PYP A;  4EW7 A;  3UB9 A;  3H82 B;  3LIA A;  5HSQ A;  2L0W A;  3K3D A;  4LLO B;  2OWJ A;  5HDS A;  2PHY A;  4JGO A;  4I38 A;  4HHD A;  2PD8 A;  1P0Z A;  1TS7 A;  2EA9 A;  5HWT A;  3H7W B;  1F98 A;  1F9I A;  1V9Z A;  2J80 A;  3H7W A;  1TS8 A;  4HI4 A;  3MQO A;  3ULF A;  4XT2 B;  2QJ7 A;  3F1P B;  4GS9 B;  3A0V A;  1MZU A;  4XT2 A;  4EER A;  5DKL A;  3F1P A;  3BY9 A;  4GS9 A;  3F1N A;  2R78 A;  3IBR A;  2HV1 A;  5HDD A;  1XFN A;  2W27 A;  3LYX A;  4H6J B;  4I3A A;  1EW0 A;  4WL9 A;  1T1A A;  2ZBB A;  1T19 A;  2I9V A;  1OTB A;  3MFX A;  4L9F A;  4H6J A;  3H9W A;  2V0W A;  3UB7 A;  4HIA A;  2M1C A;  3D72 A;  3UB8 A;  4EQ1 A;  1T1C A;  4PKY G;  4GHI B;  1LSV A;  1XJ6 A;  3NJA A;  4LRY C;  4GHI A;  2Z6D A;  4DJ2 A;  4DJ3 A;  1ODV A;  2VLG A;  4R3A A;  5HZH A;  1V9Y A;  3LIF A;  3LIE A;  4HJ6 A;  3VE3 A;  1UGU A;  4HY8 A;  5F6A A;  4BBU A;  5EFW A;  4LRZ E;  4YWZ A;  3CAX A;  4L9E A;  3E4O A;  4K08 A;  2WKQ A;  1DRM A;  1OT9 A;  4HOI A;  5TBM A;  4M4X A;  3MXQ A;  2JHE A;  4WUJ A;  2VV6 A;  1D7E A;  2PD7 A;  2W0N A;  3BY8 A;  3NOP C;  4EEU A;  2YKH A;  2Z6C A;  4R6L A;  3A0R A;  4HJ3 A;  2QKP A;  3LID A;  3C2W A;  4EXO A;  1T18 A;  3GEC A;  3UMD A;  3SW1 A;  3EWK A;  3VOL A;  3UE6 A;  2PDR A;  3NHQ A;  1BYW A;  3IS2 B;  2H28 A;  2L4R A;  3F1N B;  2D02 A;  4NXB A;  3MQQ A;  4EES A;  2VV8 A;  5AVF A;  3IS2 A;  4RQ9 A;  3GDI A;  1S1Z A;  1XJ3 A;  3C8C A;  3VE4 A;  1XJ2 A;  2D01 A;  3LI8 A;  4LRX C;  4WLA A;  1OJ5 A;  2OOL A;  5DKK A;  4F3L A;  2WKP A;  3NOT C;  5I5L A;  2OWH A;  5HD5 A;  1DP9 A;  1OTA A;  1T1B A;  4HH3 A;  3E4Q A;  3CWF A;  1TS0 A;  2B02 A;  4WN5 A;  5AVE A;  3ICY A;  5J7E A;  4MN5 A;  4KUK A;  2P7J A;  1LSW A;  5IU1 A;  5F5Y A;  3EEH A;  4KUO A;  1G28 A;  1JNU A;  4NXG A;  4R70 A;  3A0S A;  2VV7 A;  1N9N A;  4NXF A;  5J3W A;  4I3I A;  2K7S A;  1NWZ A;  1OTD A;  3F1O A;  4BBT A;  2V0U A;  4JGR A;  5TBM B;  1LSX A;  5DJU A;  2V9A A;  2QJ5 A;  3CLO A;  4L9G A;  5HWV A;  1DP8 A;  5J4E A;  4I39 A;  3RH8 B;  3BWL A;  3UB6 A;  3NOU C;  3PHY A;  3HJI A;  1UWN X;  1OTI A;  2BAS A;  5F68 A;  2V1B A;  4HQA A;  3LIC A;  4GW9 A;  2QHK A;  3H82 A;  1OTE A;  1S1Y A;  1S67 L;  2JN7 A;  1P97 A;  1XFQ A;  1GSW A;  1XJ4 A;  2KX6 A;  1S4S A;  4B9O A;  2CMN A; 
#chains in the Genus database with same CATH topology
 3ITA A;  1VB6 A;  2B18 A;  5AQA A;  4ZJ2 A;  4L0L A;  4G3K A;  3M6H A;  4S2N C;  3LI9 A;  2R9X A;  3W2Z A;  5G4Z A;  2Z2L B;  2IWC A;  2P04 A;  1ES3 A;  1MXO A;  2EXA A;  4HES A;  3IH8 A;  3SS4 A;  1K38 A;  4YIN A;  1PYY A;  5EE8 A;  4Y3I A;  3ZG9 B;  1L3L A;  4CLC B;  1BLP A;  3HLD A;  3LUQ A;  1H8Y A;  4X1M A;  4NXE A;  1TDL A;  1DJC A;  1PI5 A;  3WS1 A;  2KDK A;  3B3X A;  2ZD8 A;  2A24 B;  1E3U D;  3GMW A;  2HF6 A;  4KZB A;  1HVB A;  3T50 A;  4IBR A;  3S1Y A;  3UDX A;  1UWP X;  1DP6 A;  1W79 A;  1NZU A;  4YFM A;  3NC8 A;  2X71 A;  1TS6 A;  5GLC A;  4ID4 A;  4X56 A;  2JKF A;  1IKG A;  1WYB A;  2L1M A;  5KIZ A;  1ACF A;  2W1R A;  3OCN A;  5HD3 A;  2ZMA A;  3UPP A;  3KYQ A;  4C3Q A;  4BEN A;  3LGO A;  1IEM A;  4E04 A;  3E4P A;  2DNS A;  4PM9 A;  5CEB A;  1I2W A;  3TG9 A;  3DTK A;  1M40 A;  4Y0T A;  1NRJ A;  1DJA A;  3IWO A;  1CI9 A;  5CXW A;  5CGX A;  4Q0I A;  1FR6 A;  2Y2K A;  2XD5 A;  4JGQ A;  2ZC3 B;  1LI9 A;  2HP5 A;  3P7N A;  1L0D A;  2INW A;  1S0W A;  1AWI A;  3G6O A;  1TF1 A;  3HRE A;  1D06 A;  2PYP A;  4MCW A;  3UB9 A;  3H82 B;  1CF0 A;  4XUX A;  4LLO B;  4BJP A;  3ZYT A;  2QZ6 A;  5HDS A;  2PHY A;  1KGE A;  2PD8 A;  1L0G A;  3PBO A;  4KG5 A;  3BQ8 A;  3BW6 A;  3H7W B;  3C30 A;  4S2L A;  5KSC A;  3HLC A;  4R0Q A;  1TS8 A;  3QP1 A;  4LV3 A;  3S4X A;  1XGJ A;  3ZNY A;  2EWW A;  2IWD A;  4ESP A;  4GS9 B;  2WGW B;  3HVF A;  3FYZ A;  3IHB A;  4PM8 A;  4P87 A;  3BY9 A;  2J9P A;  1FIL A;  2JC7 A;  4WBG A;  4N92 A;  2IA2 A;  3RXW A;  5HDD A;  4UQI S;  1SKO A;  3ZNT A;  2Y2O A;  1EWZ A;  5L8M A;  2W27 A;  2NUP C;  4S2J A;  1VHM A;  4WL9 A;  5FQK A;  1HD8 A;  1OTB A;  2I9V A;  3NY4 A;  4QB8 A;  4L9F A;  1ZTU A;  3H9W A;  2CC1 A;  2HPB A;  2V0W A;  4KQR A;  2M1C A;  3NUL A;  3UB8 A;  4PM5 A;  3T4J A;  3NJA A;  4GHI A;  3IQA A;  2Z6D A;  2HGV A;  5EV0 A;  4ZTK A;  1O07 A;  1SDE A;  3IF6 B;  1J3W A;  3L7H A;  1W8Y A;  4RX3 A;  2GZA A;  5DVA A;  2XR0 A;  3ZVW A;  5F6A A;  5HL6 A;  3IXG A;  5J8X A;  4BBU A;  3DTI A;  3SZT A;  3NDE A;  2G2W A;  1K4E A;  5CX7 A;  5FAS A;  3BM6 A;  3S7O A;  2JE5 A;  4A5R A;  1W7F A;  1ERM A;  1KVL A;  3FKV A;  2VGK A;  1DRM A;  1HZO A;  4B4Z A;  1IYS A;  5EVL A;  2VKS A;  2PAV P;  3HUN A;  3T12 B;  5TBM A;  3GQZ A;  4OQG A;  4WEL A;  3CPT B;  1SZV A;  3Q7Z A;  4Y0U A;  1RGY A;  4FCF A;  4UHU A;  2VGL M;  4IED A;  1YLJ A;  3NI9 A;  4E6W A;  3MF0 A;  5L10 A;  4B4X A;  4HJ3 A;  2MJ6 A;  3JVV A;  3HLE A;  2ZC5 B;  1PZO A;  1T18 A;  4JF4 A;  3O86 A;  5L2F A;  4E3J A;  3T1S A;  3UE6 A;  2PDR A;  3BQA A;  3DWK A;  1BYW A;  4RYE A;  1TEM A;  4PMA A;  2L4R A;  4UEY A;  4R3J A;  4IUK A;  4RVA A;  5F83 A;  5HW3 A;  3C38 A;  2WK0 A;  2HDQ A;  1YLZ A;  3T1Q B;  2EXB A;  3A3D A;  2ZM2 A;  1PRQ A;  4IVK A;  2D01 A;  4PM7 A;  3LI8 A;  5FDS A;  2DRW A;  5GLB A;  3JVU A;  4LRX C;  4F3L A;  2WKP A;  3JPU A;  2WZZ A;  1PZP A;  4ETZ A;  3SS5 A;  3KSF A;  2NUT C;  3UPO A;  3VOY A;  1LLB A;  2PBY A;  2HP6 A;  2Y4A A;  1NXY A;  3S7N A;  1YLP A;  3E4Q A;  4OPY A;  1TS0 A;  5TJJ A;  4WN5 A;  5CEC A;  1NYY A;  3O5Y A;  3ICY A;  4CLC D;  2W3E A;  1GHM A;  2ZC4 B;  3P09 A;  4BLM A;  4KZ4 A;  1G28 A;  4NXG A;  4R70 A;  5E2F A;  2VV7 A;  1N9N A;  1CK3 A;  2VK3 A;  4O0P A;  1KGF A;  4I3I A;  1Z6F A;  2K7S A;  5FQ9 A;  5FQQ A;  4BBT A;  2EWV A;  2V0U A;  3E2L A;  3O3V A;  3OPH A;  5TBM B;  2V9A A;  1G68 A;  4I39 A;  3T4K A;  3BWL A;  5GLA A;  3HJI A;  2Y8H A;  4GDN A;  3MBZ A;  3D3O A;  2Y2N A;  5TFQ A;  1EI5 A;  4P6B A;  2V1B A;  2KLI A;  4LV0 A;  4N9L A;  1G5U A;  3CHW P;  1GSW A;  1S4S A;  3G30 A;  4BBV A;  3T4T A;  2ZOI A;  1S4R A;  4P0M A;  3MQ0 A;  1LL9 A;  4HNB A;  3PBS A;  1VEU B;  1OT6 A;  3T4S A;  1GSX A;  4QHC A;  3FC7 A;  1OJG A;  1JVJ A;  1W63 Q;  2V1Z A;  2GJ3 A;  2EX8 A;  3U2A A;  1KOU A;  4ZJ3 A;  2VA0 A;  3UME A;  4F3L B;  4K0X A;  1OPX A;  2RCX A;  3TSG A;  2QPN A;  4IHQ A;  4X6T A;  1NLZ A;  5D3O A;  2XFT A;  1YLT A;  3WS5 A;  2VGL S;  4CLC A;  3KYZ A;  1N4O A;  3MZD A;  2XFS A;  1E25 A;  4NKP A;  4E3N A;  2P74 A;  3MJQ A;  4PKY A;  2OSU A;  2A24 A;  3AGE A;  2Q0O A;  3S7P A;  4DE3 A;  3UY6 A;  2ZM8 A;  3VP1 A;  5EPH A;  3WRZ A;  3V5M A;  4E3I A;  1LT0 A;  3ITB A;  4FUW A;  4QU3 A;  5DJT A;  4HBU A;  5FQI A;  3G2Z A;  3UDF A;  4E3M A;  1YLY A;  1LL5 A;  4Y0O A;  1K6S A;  5MC7 A;  5HWW A;  2I72 A;  5FAO A;  4GB7 A;  3B47 A;  3CI6 A;  3ZDJ A;  3SOI A;  3G2Y A;  3HJK A;  3D9Y A;  3EQV A;  3MR0 A;  3GR2 A;  2JCH A;  3HLF A;  4LPZ A;  2OLV A;  3ZQ5 A;  5EVI C;  2EFX A;  4OLG A;  3LIB A;  4OH0 A;  4BQM A;  2FZ0 A;  1H3Q A;  2KOI A;  5FAT A;  1K57 C;  5E2G A;  2BG1 A;  3DTM A;  4R4S A;  4EW7 A;  4AFI A;  2ZJ9 A;  2A3U A;  5HSQ A;  1BSG A;  4UQI M;  4OPR A;  4NET A;  5C5K A;  2OWJ A;  1CI8 A;  3KSI A;  1JTD A;  3IXD A;  4G3V A;  5HPI A;  4DF6 A;  1TS7 A;  3GVB A;  4NK3 A;  2EA9 A;  1F98 A;  2JBF A;  5HAI A;  3NDG A;  3Q7V B;  1IKI A;  3SS3 A;  1V9Z A;  1MWS A;  3FPW A;  1FR1 A;  2W3D A;  3H7W A;  1PW8 A;  2Y91 A;  3N8S A;  3W4O A;  4HI4 A;  3MQO A;  3T4Q A;  1STZ A;  3ULF A;  4ZBE A;  4XT2 B;  2QJ7 A;  3CIT A;  3MXR A;  2DMW A;  5E2E A;  1K6R A;  1N9B A;  3Q07 A;  2WAD A;  5K5B A;  4S2O A;  5DKL A;  2ZC6 B;  1IOU A;  4GS9 A;  3HLW A;  4QY6 A;  2WGW A;  4DXC A;  3T4L A;  4KG2 A;  3BLM A;  1RGZ A;  1E4D A;  3KSH A;  2WUQ A;  1XFN A;  1SCW A;  3BEC A;  4HEF A;  2XEP A;  3LYX A;  2WAF A;  4I3A A;  1EW0 A;  3FPV A;  3KO6 A;  1KE3 A;  2ZBB A;  1T19 A;  4OOY A;  5A91 A;  3MFX A;  1ESI A;  3DTE A;  1FQG A;  4S2K A;  3HLB A;  4Y13 A;  1I5Q A;  3QP5 A;  4GN2 A;  1ERQ A;  1T1C A;  2M7U A;  1LSV A;  3C4P A;  3LY4 A;  2XQZ A;  3N8L A;  1NRF A;  3UO9 A;  3ZG8 B;  2BTF P;  2ZQ8 A;  4U0T A;  5DFX A;  1MWT A;  4DJ3 A;  4Y17 A;  1ODV A;  2PBD P;  2XGN A;  5CGW A;  5F1F A;  3LIE A;  1YMS A;  4JXG A;  3IF6 A;  3TW8 A;  4EV4 A;  4Q8I A;  3E0Y A;  4YWZ A;  3HBR A;  3JYI A;  4L9E A;  3E4O A;  5A92 A;  3TJZ C;  4WZ5 A;  1FSW A;  4MLL A;  2EFU A;  3UDI A;  1TDG A;  1OT9 A;  4HOI A;  2ACG A;  2E8J A;  3GRJ A;  4M4X A;  3MXQ A;  5EUA A;  4WUJ A;  4D2O A;  2VV6 A;  4KEN B;  4CJN A;  2W0N A;  4X1L A;  1YT4 A;  2ZM0 A;  4EEU A;  4QPR A;  3SH8 A;  1YMX A;  3CPT A;  4R6L A;  1IYO A;  3A0R A;  5HAQ A;  2QKP A;  4BD1 A;  2E8I A;  4D60 A;  4Y5F A;  4EXO A;  5FL3 A;  3OOV A;  2O9A A;  2J3T C;  2Q9M A;  4BD0 A;  3SW1 A;  3VOL A;  4LV1 A;  1E3U A;  1Z09 A;  3IX8 A;  3IS2 B;  2HZ5 A;  4EQI A;  4N1X A;  4MMN A;  4EES A;  5KMW A;  4GZB A;  1SHV A;  1W5D A;  2WAE A;  4JBF A;  1YKD A;  3UE3 A;  3AGF A;  2H0T A;  2P08 A;  1XJ3 A;  3C8C A;  4ARZ B;  2V2F F;  1QMF A;  2LB5 A;  4MN7 A;  1XJ2 A;  4X53 A;  5HFO A;  2QMI A;  4DN0 A;  4ME4 A;  3TRC A;  5I94 A;  3HUM A;  3LCE A;  3MSH A;  5DKK A;  5AQ9 A;  1JWZ A;  1FCN A;  4X25 A;  4DKI A;  1H8Z A;  5CTM A;  3IXB A;  4X69 A;  3MMH A;  4KZ3 A;  4CLC E;  5I5L A;  1CQA A;  1GCE A;  3CUE A;  3ZCZ A;  4LFU A;  2ZMV A;  4HH3 A;  4WEJ A;  4FSF A;  3BEB A;  1G6A A;  4PHT A;  3TOI A;  1JWV A;  5AVE A;  1FCO A;  1IYQ A;  1MWR A;  1KDS A;  1KE4 A;  4P6Z M;  4ZDX A;  5J7E A;  2WGI A;  3V67 A;  1L2S A;  5DTT A;  2XH9 A;  4KQO A;  3A0S A;  4S2M A;  5J3W A;  3IT9 A;  2IWB A;  1NWZ A;  3ZG5 A;  4OOL A;  2HDR A;  3C7V A;  2J3W A;  3F1O A;  4FH2 A;  2C6W B;  5GHX A;  4EU0 A;  2W3H A;  1ES5 A;  2B95 A;  3U4L P;  3ZG7 B;  2XK1 A;  1HLU P;  2AVX A;  2X02 A;  3OPP A;  3RXX A;  5A93 A;  1IEL A;  1H5X A;  1DP8 A;  4KZ9 A;  3IXH A;  3RH8 B;  3UB6 A;  3NOU C;  1IFQ A;  2Y2M A;  1XGI A;  5KSH A;  4PPR A;  3GTC A;  4GLQ A;  2PU2 A;  1UWN X;  1XA7 A;  3RFB A;  5A90 A;  4EUV A;  1ES2 A;  1S1Y A;  3VFH A;  2HJE A;  2CMN A;  1NYM A;  1CEG A;  3LR4 A;  2A49 A;  4NEE D;  4WF0 A;  5M18 A;  2GX5 A;  4MBF A;  1DY6 A;  4BMW A;  3TE8 A;  1K55 A;  1X0O A;  1VEU A;  1K4F A;  5DF8 A;  2BLS A;  4EEP A;  1PIO A;  2JKR I;  1PWG A;  2XA7 M;  3S22 A;  4GJ4 A;  1BZA A;  1KDW A;  2PR6 A;  4MN6 A;  5FAP A;  4B88 A;  3PAE A;  5A8B A;  1YPR A;  5CED A;  4HJ4 A;  5LBR A;  3DAV A;  3FG8 A;  4RX2 A;  5GHZ A;  5CRF A;  3QNB A;  4JF6 A;  3VSK A;  3RTY A;  1TD5 A;  1D1J A;  3ZG0 A;  2ZMF A;  4Y7P A;  4X68 A;  4ZJ1 A;  4F94 A;  2JKT I;  3Q1F A;  1SDN A;  3K2N A;  4GCZ A;  2VGJ A;  2W3G A;  4K0W A;  4E6X A;  1JWP A;  1F5M A;  2UV0 E;  3IWI A;  3G34 A;  5DF7 A;  3W8K A;  3F1O B;  2YKF A;  3PTE A;  1ZHH B;  5FQJ A;  4HP9 A;  3QP2 A;  4YOF A;  4XXR A;  5JYP A;  2Y2G A;  2ZQC A;  5GHY A;  2PR5 A;  4GD8 A;  2VEA A;  4ZRR A;  1MY8 A;  3N8R A;  4E3K A;  3LR3 A;  2V1A A;  5M19 A;  5IS1 A;  1LL8 A;  4OQ0 A;  3ZFZ A;  1PWD A;  3B33 A;  1O7E A;  1N9O A;  3M2J A;  1PFL A;  2Y2P A;  4Q0H A;  1Y28 A;  4WMC D;  4GNU A;  2WKI A;  3QP4 A;  3QNC A;  3A3I A;  2L0W A;  3NEC A;  4MBH A;  4P6Z S;  4LCM A;  2Y2J A;  1XXM A;  2XSS A;  3S7Q A;  2C5W B;  1KVM A;  1CJF A;  4WEK A;  1P0Z A;  1XX2 A;  5HWT A;  4LEN A;  1YAX A;  3A3J A;  3G32 A;  4Q0J A;  2Y2H A;  4M3K A;  3ISG A;  5TGF A;  4R1G A;  4R3B A;  3Q7V A;  1MBL A;  1KGG A;  3LR0 A;  3CZD A;  1PNE A;  5EVI D;  5L07 A;  1QME A;  5DF9 A;  3A3F A;  4WZ4 A;  1PI4 A;  5G18 A;  3F1P B;  1H0M A;  4BWI A;  3A0V A;  1MZU A;  4XT2 A;  1RCJ A;  4EER A;  4OP5 A;  3WRT A;  3PBQ A;  4CLC C;  4BL3 A;  4DRT A;  2R78 A;  3IBR A;  2HV1 A;  3I7J A;  1VET B;  1MWU A;  2V8F A;  4DE0 A;  3DW0 A;  4H6J B;  2HDU A;  3CMZ A;  1T1A A;  4U3T A;  5CER A;  2ZQA A;  1BLC A;  4JXV A;  1WE4 A;  3D72 A;  3V3S A;  3VP3 A;  1K25 A;  4EQ1 A;  3P01 A;  4PKY G;  3VV4 A;  3C4O A;  2G2U A;  3G31 A;  2GNX A;  3GSG A;  4LRY C;  4QY5 A;  4JF5 A;  2Z2M B;  5E2H A;  2XA7 S;  1ERO A;  4DJ2 A;  3EGD C;  4EBP A;  3PAG A;  4R4R A;  3VMA A;  5HZH A;  3UN7 A;  4OOM A;  4DDY A;  4HJ6 A;  5KZH A;  2A2L A;  1UGU A;  4HY8 A;  2QYB A;  2XLN A;  2VX8 A;  4OVD A;  3OZH A;  1Y4O A;  1FOF A;  5HAP A;  2FFF B;  4OPZ A;  4KQQ A;  3E98 A;  4K08 A;  2WKQ A;  3UE0 A;  2Y79 A;  4EUZ A;  3EEA A;  4GD6 A;  1KE0 A;  4U0X A;  3MKF A;  5HL1 A;  5EVE A;  3B42 A;  3G4P A;  4YNR A;  5AJG A;  5GLD A;  1Q2P A;  3BY8 A;  5F82 A;  4Y2F A;  3GV9 A;  4ETX A;  3C7U A;  2WZX A;  3ZHH A;  2YKH A;  4JLF A;  3V50 A;  1ZC2 A;  1BTL A;  1ZG4 A;  1GA9 A;  1SKF A;  4R23 A;  3MXS A;  3LY3 A;  3C2W A;  5EM1 A;  1L0F A;  2W1T B;  3UMD A;  1J9M A;  1OME A;  3UB5 P;  4QWO A;  4XUZ A;  3NHQ A;  2H28 A;  1ONH A;  1K54 A;  1GHI A;  5IHV A;  3OPR A;  5AVF A;  3UPN A;  3IS2 A;  4S2N A;  4G3W A;  3MFD A;  1S1Z A;  3E2K A;  3W4P A;  5HPF A;  2WKH A;  3FV7 A;  4JKT A;  3O88 A;  2ZQ9 A;  3BFD A;  3Q82 A;  4ARZ A;  5JYO A;  3M2K A;  4WLA A;  5CHU A;  4RA7 A;  1MC0 A;  2G7U A;  4KZ6 A;  4CPK A;  2O0Y A;  3IHA A;  2OWH A;  2J3T D;  5HD5 A;  3QP6 A;  3LO7 A;  4OKP A;  1OTA A;  2WYX A;  1T1B A;  4E3L A;  2ZC7 A;  2K31 A;  3AGD A;  2B02 A;  2HDS A;  1BUE A;  4O01 A;  2M7V A;  2Y2Q A;  4JPM A;  4DDS A;  2X01 A;  3IF6 C;  1LSW A;  2FH5 A;  1PWC A;  2WGV A;  5IU1 A;  5F5Y A;  3HCY A;  3BFG A;  1S6R A;  3NIA A;  3R7W A;  3BRM A;  4NXF A;  2RL3 A;  2EX2 A;  3PBT A;  1A0K A;  2ZL1 B;  1CEF A;  1NZO A;  2HP9 A;  3BLS A;  4WZ5 C;  2XDM A;  3IWQ A;  2Y2I A;  5DJU A;  5EVI B;  2QJ5 A;  3FKW A;  5J4E A;  4N1H A;  3PHY A;  2OAQ 1;  4FD8 A;  4FOF A;  3HL9 A;  2OV5 A;  3W4Q A;  1W63 M;  1YSQ A;  1LI0 A;  2H10 A;  5IT5 A;  3LIC A;  1FIK A;  2QHK A;  5DTK A;  4Y15 A;  1YQS A;  1P97 A;  1XFQ A;  1XJ4 A;  2KX6 A;  4JGP A;  3FZC A;  3LEQ A;  4HP4 A;  4R38 A;  1VQQ A;  4KZA A;  5F1G A;  2B5R A;  4EET B;  4KQD A;  3WS4 A;  1U60 A;  1G6O A;  3IX4 A;  2O9B A;  5HDC A;  3BFE A;  3K3C A;  3RJU A;  2PT7 A;  1AXB A;  4DXB A;  2WKR A;  1K0K A;  5EOE A;  3PBN A;  1TVF A;  2W3F A;  2Y59 A;  4C6Y A;  3D4F A;  4DE1 A;  4OQH A;  1ZKJ A;  3G35 A;  3N7W A;  1JTG A;  4P85 A;  4FH4 A;  2ZOH A;  1F2K A;  3CUE C;  3LEZ A;  3OBF A;  1WA9 A;  3OLO A;  4MEZ A;  3SH7 A;  1I2S A;  5AQ7 A;  4DMZ A;  4UA6 A;  1Q2Q A;  3KX0 X;  3T4O A;  3QP8 A;  1RP5 A;  1LHY A;  3R7W B;  4DE2 A;  2O99 A;  5F69 A;  5G4Y A;  3NBL A;  4HH2 A;  1N9L A;  5GL9 A;  1BT5 A;  3BFC A;  2P9V A;  4H8R A;  2QWS A;  3PYP A;  2PYR A;  3VP0 A;  3OCL A;  4GOG A;  1S66 L;  1P9R A;  1GA0 A;  1GSV A;  4KZ8 A;  2Y55 A;  2XRN A;  3LFV A;  4LV2 A;  1YM1 A;  3VFF A;  5CHM A;  3VOZ A;  4I5S A;  4JXS A;  2O9C A;  5HX9 A;  1MKM A;  4I3J A;  2ZQ7 A;  4OQI A;  4QJG A;  5M1A A;  5CGS A;  4MBK A;  3LIA A;  3K3D A;  3LR5 A;  4JGO A;  3BFF A;  4I38 A;  3C5A A;  4HHD A;  3VP2 A;  3ZGA B;  4PAU A;  1BUL A;  1HTZ A;  2XF3 A;  4S2P A;  2XD1 A;  3IH9 A;  1F9I A;  5FAQ A;  5E43 A;  1K55 C;  2J80 A;  1YLW A;  1ZG6 A;  1L0E A;  4EBN A;  1GHP A;  2J7V A;  1DJB A;  1BLS A;  1YSP A;  3F1P A;  3F1N A;  1SKO B;  4FTX A;  3HLG A;  1ONG A;  4JXW A;  3MS6 A;  2FFY A;  3M6B A;  3Q81 A;  3KSG A;  3VP4 A;  4S2I A;  1VET A;  3WS0 A;  2VJW A;  4C75 A;  3OPL A;  4H6J A;  5FI2 A;  2V8C A;  1ALQ A;  4WM9 A;  3UB7 A;  4HIA A;  1BLH A;  4UA7 A;  1NY0 A;  2P9V B;  4GHI B;  3DWZ A;  2OLU A;  1XJ6 A;  4OLD A;  2H0Y A;  4UAA A;  2OAP 1;  2K2N A;  3MZF A;  3CJM A;  2VLG A;  4R3A A;  3FWL A;  1V9Y A;  4Z1W A;  3T1X A;  3IX3 A;  3LIF A;  3BJN A;  3A3E A;  3VE3 A;  4KG6 A;  5FSR A;  5EFW A;  4LRZ E;  2J9O A;  3MZE A;  4KZ5 A;  5DTS A;  3CAX A;  2ZQD A;  5BOH A;  1Y54 A;  3MKE A;  3N6I A;  1K56 D;  4O8G A;  3PXP A;  1WYC A;  3EGX C;  4LCL A;  2PU4 A;  3EOI A;  1MPL A;  2JHE A;  1D7E A;  4ZAM A;  2GDN A;  3HUO A;  2PD7 A;  2EX6 A;  4Z9Q A;  3PR6 A;  1PW1 A;  3NOP C;  1NJ4 A;  4B93 A;  2Z6C A;  3OC2 A;  5FDH A;  4QD4 A;  5EOO A;  3LID A;  1H8M A;  1XPB A;  3ZVT A;  1VM1 A;  5FI7 A;  1M6K A;  3GEC A;  3V3R A;  2VZW A;  4OON A;  5FQM A;  3EWK A;  2JKG A;  1XA1 A;  4CQH A;  5L09 A;  3IF5 A;  2W1T A;  3F1N B;  2D02 A;  3CG5 A;  1FCM A;  4NXB A;  3MQQ A;  5HAR A;  2VV8 A;  4BL2 A;  3BYD A;  5EM0 A;  1IYP A;  4RQ9 A;  3GDI A;  4UA9 A;  2HJ9 C;  5AQB A;  2DCF A;  3VE4 A;  3V39 A;  5FEF A;  3NCK A;  1FSY A;  3L9K A;  1OJ5 A;  5CHJ A;  2OOL A;  1W8Q A;  4GKU A;  1ES4 A;  5FEG A;  3NOT C;  2Y2L A;  1ESU A;  5EEC A;  1DP9 A;  4IBX A;  3PBR A;  1XP4 A;  3KYE A;  1P9W A;  5FA7 A;  4IJG A;  5TR7 A;  3CWF A;  3O87 A;  4K91 A;  4KZ7 A;  4II7 A;  4EWF A;  2H5S A;  4WMC A;  5U47 A;  3QHY A;  4EBL A;  4HBT A;  5CTN A;  2WKE A;  4MN5 A;  4KUK A;  1K56 A;  2P7J A;  3UE1 A;  3DBA A;  2JKR M;  4PM6 A;  4X55 A;  3EEH A;  4KUO A;  3WWX A;  2LB9 A;  1JNU A;  4IUH A;  3UNW A;  3VSL A;  3EQU A;  1OTD A;  3IBJ A;  4JGR A;  4MNR A;  2UWX A;  4GDB A;  4LGW A;  4NG2 A;  2ZL1 A;  1LSX A;  2PRF A;  4OPQ A;  3CLO A;  2EX9 A;  2R9W A;  4MDZ A;  5FI6 A;  4L9G A;  5HWV A;  5EVI A;  2ZLY A;  1C3B A;  2JKT M;  3R4K A;  1MKI A;  2V20 A;  4OP8 A;  1K57 A;  3SH9 A;  2Q9N A;  3N4I A;  1OTI A;  4O7D A;  5DFY A;  3WS2 A;  2BAS A;  4WYY A;  5F68 A;  2XRO A;  3T1R A;  4HQA A;  4GW9 A;  3H82 A;  1OTE A;  4IVI A;  1S67 L;  2JN7 A;  4N9K A;  4E3O A;  1K54 C;  4B9O A;  1NLY A;  3P98 A;  1XKZ A;  2J8Y A; 
#chains in the Genus database with same CATH homology
 4JGP A;  1VB6 A;  2B18 A;  3LR4 A;  4HP4 A;  4L0L A;  4G3K A;  4BBV A;  4NEE D;  4R38 A;  4WF0 A;  3T4T A;  2GX5 A;  1S4R A;  2ZOI A;  3MQ0 A;  4HNB A;  3LI9 A;  4BMW A;  3PBS A;  3TE8 A;  1OT6 A;  3W2Z A;  3T4S A;  5G4Z A;  1GSX A;  2P04 A;  4EET B;  4KQD A;  1X0O A;  3FC7 A;  1OJG A;  1G6O A;  4EEP A;  1W63 Q;  2JKR I;  2GJ3 A;  2O9B A;  2XA7 M;  3U2A A;  4GJ4 A;  4Y3I A;  1KOU A;  5HDC A;  2VA0 A;  3UME A;  3K3C A;  2PT7 A;  2PR6 A;  4F3L B;  4MN6 A;  4CLC B;  1OPX A;  3LUQ A;  4IHQ A;  4NXE A;  1NLZ A;  5A8B A;  2WKR A;  3PBN A;  2VGL S;  2W3F A;  4CLC A;  4HJ4 A;  5LBR A;  3FG8 A;  3KYZ A;  2KDK A;  4NKP A;  2ZOH A;  3CUE C;  3RTY A;  2A24 B;  3OBF A;  1TD5 A;  1WA9 A;  3MJQ A;  2HF6 A;  2ZMF A;  4PKY A;  3OLO A;  3T50 A;  2A24 A;  3S7P A;  2JKT I;  1UWP X;  3K2N A;  4DMZ A;  1DP6 A;  4GCZ A;  1LT0 A;  3KX0 X;  1TS6 A;  3T4O A;  2W3G A;  5DJT A;  3R7W B;  2O99 A;  1F5M A;  5F69 A;  5G4Y A;  4HH2 A;  5KIZ A;  2L1M A;  1N9L A;  5MC7 A;  2W1R A;  3OCN A;  5HWW A;  5HD3 A;  3F1O B;  2YKF A;  3KYQ A;  1ZHH B;  3B47 A;  4E04 A;  3CI6 A;  3E4P A;  2QWS A;  3PYP A;  2PYR A;  4HP9 A;  4YOF A;  3HJK A;  3OCL A;  1S66 L;  3EQV A;  1P9R A;  3MR0 A;  2PR5 A;  1GSV A;  2VEA A;  2XRN A;  4ZRR A;  4LPZ A;  3LFV A;  3LR3 A;  2V1A A;  1NRJ A;  3ZQ5 A;  5IS1 A;  1LL8 A;  3B33 A;  4Q0I A;  3LIB A;  4JGQ A;  4I5S A;  1N9O A;  2O9C A;  3P7N A;  2INW A;  1MKM A;  2FZ0 A;  4I3J A;  3G6O A;  4Q0H A;  1H3Q A;  1Y28 A;  1TF1 A;  2KOI A;  1D06 A;  2PYP A;  4MCW A;  4EW7 A;  4AFI A;  3UB9 A;  3H82 B;  3LIA A;  5HSQ A;  2L0W A;  4UQI M;  3K3D A;  3LR5 A;  5C5K A;  4LLO B;  4BJP A;  3ZYT A;  4P6Z S;  2OWJ A;  5HDS A;  2PHY A;  2XSS A;  3KSI A;  3S7Q A;  4JGO A;  4G3V A;  4I38 A;  4HHD A;  2PD8 A;  5HPI A;  4WEK A;  1P0Z A;  1TS7 A;  3PBO A;  4PAU A;  2EA9 A;  5HWT A;  3BQ8 A;  3BW6 A;  3H7W B;  3C30 A;  1F98 A;  1YAX A;  1F9I A;  4Q0J A;  1V9Z A;  3FPW A;  2W3D A;  2J80 A;  3H7W A;  1TS8 A;  3LR0 A;  4HI4 A;  3MQO A;  5DF9 A;  3T4Q A;  1STZ A;  3ULF A;  4XT2 B;  2QJ7 A;  3CIT A;  2EWW A;  2DMW A;  3F1P B;  4GS9 B;  4BWI A;  3A0V A;  1MZU A;  4XT2 A;  5K5B A;  4EER A;  5DKL A;  1YSP A;  3F1P A;  3PBQ A;  3BY9 A;  4CLC C;  1IOU A;  4GS9 A;  3F1N A;  3T4L A;  2R78 A;  3IBR A;  2HV1 A;  2IA2 A;  5HDD A;  3KSH A;  4UQI S;  5L8M A;  1XFN A;  2W27 A;  2NUP C;  3KSG A;  3LYX A;  1VHM A;  4H6J B;  2VJW A;  4I3A A;  1EW0 A;  3FPV A;  4WL9 A;  1T1A A;  3KO6 A;  2ZBB A;  1T19 A;  2I9V A;  1OTB A;  3MFX A;  4L9F A;  4H6J A;  1ZTU A;  3H9W A;  2V0W A;  3UB7 A;  4HIA A;  2M1C A;  3D72 A;  3UB8 A;  4EQ1 A;  1T1C A;  3P01 A;  4PKY G;  4GHI B;  2M7U A;  1LSV A;  1XJ6 A;  3VV4 A;  3T4J A;  2GNX A;  3NJA A;  4LRY C;  4GHI A;  2OAP 1;  5DFX A;  2K2N A;  2XA7 S;  2Z6D A;  2HGV A;  4DJ2 A;  4DJ3 A;  3EGD C;  1ODV A;  2VLG A;  4R3A A;  5HZH A;  1V9Y A;  4Z1W A;  3LIF A;  3LIE A;  3BJN A;  4OOM A;  2GZA A;  4HJ6 A;  3VE3 A;  2A2L A;  1UGU A;  4HY8 A;  2QYB A;  5F6A A;  5HL6 A;  3TW8 A;  4BBU A;  2VX8 A;  5EFW A;  4LRZ E;  5CX7 A;  3S7O A;  3E0Y A;  4YWZ A;  3CAX A;  4L9E A;  3E98 A;  3E4O A;  4K08 A;  2WKQ A;  3TJZ C;  2Y79 A;  1DRM A;  4O8G A;  2VKS A;  3EEA A;  3PXP A;  1OT9 A;  3EGX C;  4HOI A;  5TBM A;  4M4X A;  3EOI A;  3MXQ A;  2JHE A;  4WUJ A;  3B42 A;  4WEL A;  4YNR A;  2VV6 A;  1D7E A;  5AJG A;  2PD7 A;  2W0N A;  3BY8 A;  3PR6 A;  4Y2F A;  3NOP C;  4ETX A;  2VGL M;  4EEU A;  4B93 A;  4QPR A;  2YKH A;  2Z6C A;  3OC2 A;  4R6L A;  3MF0 A;  3A0R A;  4HJ3 A;  2MJ6 A;  2QKP A;  3LID A;  3JVV A;  1H8M A;  3C2W A;  4Y5F A;  4EXO A;  5FL3 A;  1T18 A;  2O9A A;  3GEC A;  2J3T C;  2VZW A;  3OOV A;  2W1T B;  3UMD A;  3SW1 A;  3EWK A;  3VOL A;  3UE6 A;  2PDR A;  3BQA A;  4CQH A;  3NHQ A;  1BYW A;  3IS2 B;  2H28 A;  2W1T A;  2L4R A;  4UEY A;  3F1N B;  2D02 A;  4IUK A;  4MMN A;  3MQQ A;  4NXB A;  4EES A;  2VV8 A;  5AVF A;  3C38 A;  3IS2 A;  4G3W A;  1YKD A;  3UE3 A;  4RQ9 A;  3GDI A;  1S1Z A;  2P08 A;  1XJ3 A;  3C8C A;  2HJ9 C;  4ARZ B;  5HPF A;  3VE4 A;  2LB5 A;  4MN7 A;  1XJ2 A;  2D01 A;  4ARZ A;  4DN0 A;  4ME4 A;  3LI8 A;  3TRC A;  3JVU A;  4LRX C;  4WLA A;  1MC0 A;  1OJ5 A;  2OOL A;  5DKK A;  2G7U A;  4F3L A;  2WKP A;  3NOT C;  4ETZ A;  3MMH A;  3KSF A;  2O0Y A;  2NUT C;  4CLC E;  5I5L A;  2OWH A;  2J3T D;  5HD5 A;  1DP9 A;  3PBR A;  3CUE A;  1OTA A;  2ZMV A;  1T1B A;  1P9W A;  4IJG A;  4HH3 A;  4WEJ A;  4FSF A;  3S7N A;  3E4Q A;  2K31 A;  3CWF A;  1TS0 A;  4PHT A;  2B02 A;  5TJJ A;  4II7 A;  4WN5 A;  5AVE A;  4O01 A;  2M7V A;  3O5Y A;  3ICY A;  4CLC D;  2W3E A;  4P6Z M;  5J7E A;  4MN5 A;  4KUK A;  2P7J A;  3DBA A;  3V67 A;  2JKR M;  1LSW A;  2FH5 A;  5IU1 A;  5F5Y A;  3EEH A;  4KUO A;  2LB9 A;  1G28 A;  1JNU A;  3HCY A;  4NXG A;  4R70 A;  4KQO A;  3R7W A;  3A0S A;  4IUH A;  2VV7 A;  1N9N A;  4NXF A;  5J3W A;  4O0P A;  3PBT A;  4I3I A;  2K7S A;  1NWZ A;  4OOL A;  3EQU A;  1OTD A;  2J3W A;  3F1O A;  4BBT A;  2EWV A;  2V0U A;  3IBJ A;  4JGR A;  4EU0 A;  2W3H A;  5TBM B;  1LSX A;  5DJU A;  2V9A A;  2QJ5 A;  3CLO A;  4MDZ A;  4L9G A;  5HWV A;  1DP8 A;  5J4E A;  4I39 A;  3T4K A;  3RH8 B;  2JKT M;  3BWL A;  3UB6 A;  3NOU C;  3PHY A;  3R4K A;  2OAQ 1;  3HJI A;  1IFQ A;  2Y8H A;  4FOF A;  3D3O A;  5KSH A;  4GLQ A;  1UWN X;  1W63 M;  1YSQ A;  3RFB A;  1OTI A;  5DFY A;  2BAS A;  5F68 A;  2XRO A;  4EUV A;  2V1B A;  4HQA A;  5IT5 A;  2KLI A;  3LIC A;  4GW9 A;  2QHK A;  3H82 A;  1OTE A;  1S1Y A;  1S67 L;  2JN7 A;  1P97 A;  1XFQ A;  1GSW A;  1XJ4 A;  2HJE A;  1S4S A;  2KX6 A;  1NLY A;  4B9O A;  2CMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...