5F68A

Drosophila melanogaster cycle w398a pas-b with bound ethylene glycol
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
molecule keywords Protein cycle
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f68A00
4I38A 2QJ5A 4KUKA 1D06A 1TS6A 3MQOA 4L9FA 1X0OA 3A0RA 2J80A 2Z6DA 3EWKA 2HV1A 3PHYA 4JGQA 3EEHA 3HJIA 4R3AA 4L9GA 3H7WA 5HDCA 1S66L 5DJUA 2YKHA 1TS8A 4R38A 1LSVA 4KUOA 3MR0A 4RQ9A 3RTYA 4EESA 1DP6A 2L4RA 1NWZA 2B02A 5F68A 5HDSA 2M1CA 4BBUA 2VV7A 4DJ2A 2W0NA 4LLOB 3CAXA 3LIDA 1T1AA 3LYXA 1OT6A 2PHYA 1T19A 4HOIA 3BY9A 4GHIA 5J4EA 2QWSA 3K3DA 4K08A 4XT2A 4H6JB 4E04A 1D7EA 5HD3A 1OT9A 3NJAA 4EETB 2V1AA 1S4RA 1ODVA 4WL9A 5TBMB 2A24A 3LIBA 1OTIA 2BASA 3C8CA 4EERA 1UGUA 4WLAA 4EEPA 5HWWA 3GDIA 3IS2A 4F3LA 1DP8A 1T18A 2ZOHA 5G4ZA 1EW0A 2Z6CA 5A8BA 1OTAA 3E4OA 2P7JA 4YWZA 2L0WA 2KX6A 5KIZA 2PD8A 1DRMA 3F1NB 3VE4A 2PR6A 3UB9A 3B33A 2VV6A 1WA9A 3UB7A 3CWFA 5AVFA 1LT0A 4NXFA 4HHDA 5J3WA 4EEUA 4F3LB 4EQ1A 1OTDA 4KQDA 4HH3A 2OWHA 1OJGA 3F1OB 4WN5A 1LL8A 1DP9A 4M4XA 4BBTA 2JHEA 1S1YA 3D72A 3T50A 3UMEA 3ZQ5A 3RH8B 3H82B 4MN6A 4XT2B 3SW1A 2PR5A 4NXEA 2PD7A 3LIEA 1XJ6A 2H28A 2EA9A 3E4PA 4HIAA 1JNUA 2QHKA 4HI4A 2QKPA 4HY8A 4HJ3A 2WKPA 2JN7A 4GCZA 3UE6A 2R78A 4GS9A 2W27A 5HDDA 1MZUA 1Y28A 2K7SA 2INWA 3FC7A 1N9NA 4HJ4A 4HP4A 1XFQA 2GJ3A 4HNBA 1XJ3A 5G4YA 4I39A 3F1PB 5HWTA 5I5LA 1P97A 4HQAA 1TS0A 2A24B 3P7NA 4R6LA 1S4SA 4EW7A 3NHQA 5F69A 2V0UA 2WKRA 1UWNX 2PDRA 1KOUA 1N9OA 2VLGA 4LRZE 5AVEA 5HD5A 1OTBA 1F9IA 2V9AA 2OWJA 3ICYA 4GS9B 3NOTC 4I3JA 4R70A 4HP9A 5DJTA 3G6OA 2L1MA 5EFWA 3VOLA 4B9OA 2V1BA 5J7EA 1TS7A 1XJ4A 3LIFA 3NOUC 4NXGA 3VE3A 1GSXA 5HZHA 1BYWA 1GSWA 1OJ5A 2PYPA 4I5SA 4JGRA 1V9ZA 3MQQA 4WUJA 4PKYG 3A0SA 1V9YA 4I3IA 2ZBBA 5F5YA 5F6AA 5HWVA 2VV8A 2D02A 3UMDA 1F98A 3MXQA 3IBRA 2CMNA 3BWLA 3LIAA 3LI8A 3LUQA 2YKFA 3PYPA 4MN5A 3UB6A 5IS1A 4EXOA 1T1BA 3C2WA 3LICA 4WF0A 4I3AA 3F1OA 1G28A 3OLOA 5DKKA 2QJ7A 2KDKA 2OOLA 1VB6A 1P0ZA 3BY8A 3UB8A 3H7WB 1S1ZA 3GECA 1UWPX 1T1CA 3MJQA 3H82A 2WKQA 3KX0X 3LI9A 3NOPC 4HH2A 4JGPA 3MFXA 5TBMA 3A0VA 1LSWA 1S67L 2D01A 2ZOIA 4HJ6A 4LPZA 3HJKA 1XJ2A 4LRXC 3H9WA 5DKLA 2PYRA 2I9VA 1OTEA 1XFNA 1LSXA 2VEAA 3CLOA 2V0WA 3E4QA 3F1NA 4H6JA 4L9EA 1N9LA 4GW9A 3FG8A 4NXBA 4GHIB 1GSVA 4PKYA 5IU1A 3ULFA 5HSQA 4JGOA 4DJ3A 3F1PA 4LRYC 3K3CA 3IS2B 4BBVA
chains in the Genus database with same CATH superfamily
4I38A 3IXHA 1W79A 1KE0A 1WYBA 3EGXC 1PIOA 2HDRA 3C4OA 3VSLA 3NY4A 2VGJA 3V50A 1DP6A 1BT5A 2M7UA 1STZA 2G2WA 3PR6A 5AJGA 4JF5A 5FAQA 3SH9A 1NRFA 1VQQA 1KE4A 4GJ4A 4U0TA 4OVDA 1GHMA 2WAFA 1DRMA 3VE4A 3BW6A 1HLUP 4HH3A 4X55A 5AQBA 3WWXA 5EVID 1K54C 1MKMA 3ZVTA 4FH2A 2J3WA 4HI4A 1K6RA 4WZ4A 2XFSA 4ZJ2A 1XGJA 2Q9MA 3N6IA 3TRCA 4E3JA 3HLBA 3DWZA 2WKIA 2Z2LB 4GS9B 2V9AA 4JXSA 4Y0UA 3PXPA 4D2OA 3NOUC 4EU0A 2ZC6B 2H5SA 1XGIA 5JYPA 3T4SA 3ISGA 1MWSA 3UB5P 3T4QA 2D02A 2ZC7A 2FH5A 3H7WB 2Y55A 3CG5A 3S1YA 2GZAA 4ARZA 2XGNA 1FQGA 2W3FA 2CC1A 1NY0A 4DMZA 2W3DA 3Q1FA 4UA7A 4FUWA 1VEUB 4JGQA 3OCNA 1XPBA 2HPBA 3RTYA 2L4RA 5HDSA 2WGWA 4KQRA 1MBLA 3VFFA 5FQQA 3B47A 1MY8A 2QWSA 3NIAA 4XT2A 4H6JB 2WK0A 1ES5A 3BFFA 4BENA 3IX8A 4EUZA 2KX6A 1S0WA 4OOMA 3ZHHA 5KIZA 4GOGA 2Y91A 3VP1A 2ZQ9A 1OJGA 3F1OB 5GLCA 1LI0A 3E0YA 1LL8A 5EVIC 1BLSA 4DE3A 4S2KA 4IJGA 1IYOA 5EVLA 3JVVA 3DAVA 3TW8A 4HJ3A 4GCZA 3UO9A 2Y4AA 4ETZA 1TDLA 4UQIS 3HCYA 1P97A 3M2JA 3QP5A 4MLLA 3V5MA 4S2JA 3JVUA 4JXVA 4QY6A 3G35A 3BJNA 1M6KA 1D1JA 5HWVA 2Y2QA 3IBRA 3BWLA 3DTEA 3IXGA 4UQIM 4LENA 3TG9A 3BY8A 3R4KA 4GB7A 4JXWA 2P08A 3HREA 4JGPA 2ZJ9A 4WELA 3FKWA 3G2ZA 1HVBA 3CUEC 2XF3A 4RX3A 4NXBA 3T1SA 1K0KA 4PKYA 3I7JA 5HSQA 4ESPA 3K3CA 3QNBA 3V3SA 4QPRA 1CJFA 3NC8A 3IH8A 2WKHA 2NUTC 1L2SA 3SZTA 1IKIA 4WEKA 5F68A 1CK3A 3ZCZA 5F82A 3S4XA 1OT6A 1ZG6A 2VGLS 5J4EA 3ZDJA 1FCNA 2PBYA 2BASA 3A3FA 3N8SA 3MZDA 4ZJ1A 4OOLA 3IBJA 2Q0OA 1YLPA 3UPOA 3N4IA 4JXGA 2WUQA 4ME4A 1YPRA 3D72A 3UMEA 5CGSA 2PD7A 4Z1WA 2VKSA 5FI6A 3Q7ZA 5HDDA 4HNBA 1EI5A 4NK3A 2PU2A 2VLGA 3KSHA 4LRZE 2AVXA 4LCMA 1YQSA 2L1MA 4B9OA 3LR4A 4IVKA 3GTCA 3CPTA 4I3IA 1CF0A 4NETA 5E2FA 1GCEA 4Y17A 4MN5A 3FKVA 5FL3A 5HPIA 2KDKA 5L07A 2PT7A 4B4ZA 3KX0X 4O0PA 3A3EA 1K4FA 5TR7A 5E43A 1W8YA 1CEGA 3V67A 3NDEA 4EQIA 2V0WA 3S7OA 5IU1A 4XUZA 2JCHA 4R1GA 3TOIA 1YMSA 2J9OA 4FTXA 3A0RA 1NYMA 4OH0A 4EV4A 4ZAMA 1BUEA 4RQ9A 1G68A 4G3KA 3Q81A 2XDMA 1YLZA 3C38A 4LLOB 2IWDA 1PYYA 4PM5A 5F1GA 3EOIA 3UDFA 5LBRA 1S4RA 2XFTA 5TBMB 1WE4A 2GX5A 2JKFA 3SS3A 5HAPA 4X6TA 4S2OA 2P7JA 3OPRA 2L0WA 4S2MA 5FEFA 1FIKA 1PRQA 2IWCA 1JWVA 3RH8B 1XP4A 5DVAA 2VA0A 4U3TA 2ZC4B 1XA7A 2JN7A 2WKEA 4OQIA 4F94A 3WS1A 1L0DA 5HL1A 1KVMA 4N1HA 4PAUA 5EV0A 3HBRA 4ARZB 1MXOA 4A5RA 4PM6A 2XROA 1OTBA 1ERMA 2OLVA 4NXGA 1P9WA 1SKOB 1BYWA 1OJ5A 1CI9A 3A0SA 4PKYG 1LI9A 3FPWA 1LLBA 2VZWA 3C2WA 3U4LP 4BL2A 3VP0A 1BLPA 1YSQA 2FFFB 1UWPX 4HH2A 5L10A 4OPRA 3EQVA 5EOOA 4LRXC 5FI2A 4H6JA 2QPNA 3MSHA 3KYZA 1C3BA 4JGOA 4GZBA 2JKTI 2QJ5A 1MKIA 5C5KA 3MXRA 1SHVA 4YINA 4K91A 3VMAA 1DJAA 4P6ZS 4BD1A 4X56A 1PWCA 1J9MA 2ZMVA 2HJEA 2EWWA 5CEBA 1TD5A 1DY6A 2ZMFA 2XA7S 5EE8A 4X1LA 3IS2A 2EFUA 4GNUA 1HTZA 1EW0A 5EUAA 3E4OA 1E4DA 1SDEA 3GQZA 3NDGA 3OBFA 4KZ8A 4XXRA 2ZQCA 4H8RA 4MBHA 4O01A 3UPPA 2WGVA 4LV2A 4ZDXA 3OZHA 4DE1A 4QB8A 1XJ3A 3ZVWA 1HZOA 3A3IA 2XSSA 4EW7A 1FILA 4C6YA 1YLTA 4E3OA 5JYOA 1RGYA 5HD5A 1TVFA 4KG5A 5J7EA 1TS7A 1V9YA 3UMDA 5IT5A 3ITAA 3LI8A 5CRFA 3UB6A 4U0XA 3F1OA 2Y2PA 1LL9A 4JF4A 3ZG0A 3DW0A 4DRTA 4KZ5A 3SH7A 3LCEA 4Y15A 5DF9A 1YM1A 3O5YA 2ZQDA 3AGDA 5E2HA 2KOIA 1P9RA 3F1PA 2XLNA 1H0MA 4NKPA 3BM6A 1IYQA 4HEFA 3G2YA 4KZ6A 4B93A 5MC7A 5GLBA 4CLCC 5KSCA 3HLWA 3Q07A 4N9LA 2HDUA 4GHIA 2RL3A 2XH9A 4CPKA 1ES2A 1OTIA 4WYYA 3ZGAB 2ZQ8A 3EEAA 2ZQAA 5G4ZA 3Q7VB 4QJGA 1FCMA 3S7PA 2PD8A 4PHTA 3UN7A 4IUKA 3UE0A 4EQ1A 3L7HA 4BBTA 3MZFA 3BLSA 3NULA 5CEDA 3MMHA 1O07A 2QKPA 1TEMA 2V8CA 2K7SA 3KO6A 3KSIA 5GHYA 5G4YA 2XK1A 3F1PB 4DE0A 1PZOA 4E3LA 1F5MA 1F9IA 4ETXA 4Q0HA 2M7VA 5EOEA 3OPPA 3HLEA 1GSWA 1CQAA 4UAAA 4JGRA 3LIAA 1G28A 2EXBA 1MC0A 1M40A 1OMEA 3LEQA 1FSWA 3A0VA 3R7WB 5KMWA 3S22A 3M6HA 3H9WA 4O7DA 5D3OA 2VEAA 3C4PA 3E4QA 3G32A 4OOYA 3C7UA 3JPUA 3OOVA 2A2LA 4X68A 4LFUA 1K57C 2EX8A 1NXYA 3EWKA 4B88A 3H7WA 2YKHA 2W3GA 2Y79A 1ERQA 4QD4A 1H8ZA 3IHAA 3N7WA 1D7EA 3DTKA 3PBSA 5FQIA 4RVAA 4BWIA 4EERA 1YAXA 5HWWA 3GDIA 3G34A 3IX3A 1RGZA 3MKEA 3LY3A 2V2FF 3F1NB 1W8QA 2EX6A 5DTTA 5J3WA 4X1MA 3EQUA 3HLCA 3SS4A 4MN6A 1YLJA 4XT2B 4P87A 2QHKA 3LR3A 4NG2A 4Q0JA 1SDNA 2W27A 4KZBA 1SZVA 2ZM0A 4HJ4A 1L3LA 2P9VA 2WKRA 4II7A 3EGDC 2O9CA 3OCLA 3ICYA 2ZQ7A 5HL6A 4E6WA 3E98A 4OLDA 2ZBBA 5KSHA 3C30A 1BLCA 3MBZA 4EUVA 4Y2FA 1IELA 4OQGA 3UE3A 3M6BA 3QP6A 1Z6FA 1QMEA 3HJKA 2LB5A 3PAEA 2PYRA 2JE5A 1A0KA 4WBGA 2W1RA 5CHUA 4LRYC 4BD0A 3O3VA 3PBOA 2EX9A 1Y4OA 4UEYA 2C5WB 2HP6A 3LR5A 4S2NC 1JTDA 5M18A 1LSVA 3HVFA 3A3DA 1IEMA 1ONGA 2VV7A 2Y2JA 3FZCA 3VP2A 4FOFA 5CGXA 2OAQ1 1GHIA 2I72A 1EWZA 3BEBA 3FPVA 3GSGA 4WL9A 4ZTKA 1XKZA 3C8CA 4D60A 2H0TA 4YFMA 3O86A 5DTKA 3Q82A 4RX2A 3QHYA 2VV6A 4LV0A 1PW8A 1AWIA 1EROA 1KGGA 3T50A 4Q0IA 5EPHA 3ZQ5A 3M2KA 2H28A 1TDGA 5DFYA 3UE6A 3ZG8B 3FC7A 2GJ3A 5HWTA 5HFOA 1K38A 3BECA 3BFGA 1PI5A 3NHQA 4IEDA 2V0UA 5CTMA 2PDRA 1MPLA 2WZZA 5AVEA 2HDSA 3BQ8A 4HP9A 1XJ4A 3AGFA 2BTFP 3IF6B 5F5YA 3MKFA 4OP8A 2HP5A 3NBLA 3BRMA 3LUQA 2KLIA 1Z09A 2P74A 4WEJA 4JLFA 1O7EA 3MJQA 2WKQA 2UWXA 1PW1A 3IXBA 3AGEA 4E3KA 4WM9A 3HUOA 3ZYTA 1XFNA 4NXFA 1GSVA 4GKUA 1DJBA 5IHVA 3SH8A 5TGFA 5F1FA 4FCFA 2Z6DA 2HV1A 3EEHA 4L9GA 1TS8A 4EESA 3D9YA 3FV7A 2G7UA 1GHPA 4GN2A 4CQHA 4GLQA 4S2IA 4GDNA 2OLUA 3K3DA 4Y3IA 4EETB 1N9BA 5L2FA 2JKRI 4EBLA 1K6SA 1UGUA 1VETB 1W63M 4LCLA 2ZOHA 4HESA 1L0FA 3MF0A 3GMWA 3T4OA 2J3TC 2WYXA 1LT0A 4HHDA 3BQAA 3SS5A 4OQ0A 3WS2A 1K25A 4YNRA 3IF5A 3H82B 4OKPA 2W3EA 3SW1A 1ZC2A 2PR5A 3LIEA 1CEFA 4E6XA 3E4PA 5TBMA 4HP4A 1S6RA 4OP5A 3BYDA 1SKFA 2IWBA 2Y2HA 3OPLA 1BULA 1ZTUA 1NZUA 2VJWA 4UA9A 5HZHA 2OSUA 2VV8A 1F98A 3W4PA 4IHQA 4EXOA 1YT4A 1P0ZA 5HAIA 2V8FA 3CPTB 3LI9A 1L0EA 4R3JA 3NCKA 3QP1A 2O99A 2D01A 4JKTA 3DTMA 3QNCA 3QP4A 2MJ6A 3PBNA 2Y2KA 5J8XA 4MBKA 4Y13A 3OPHA 1FCOA 3PHYA 2GNXA 1ESUA 2ZLYA 3WS5A 3KYEA 2WZXA 3N8RA 4R38A 3FWLA 4JPMA 3UY6A 4KZ4A 4BBUA 4DJ2A 5FATA 2R9XA 4HOIA 4E04A 5HD3A 1GA0A 4R4SA 3O88A 2A24A 4WLAA 1DP8A 2J9PA 2PRFA 1NJ4A 3K2NA 4IBRA 3BLMA 2Z2MB 3HL9A 5AVFA 1ONHA 3ZG9B 4MCWA 2JHEA 1S1YA 3T4TA 4KENB 4HBTA 2O0YA 2FFYA 3TJZC 2ZM2A 2ZM8A 3T4KA 2WGIA 1JTGA 3IF6A 4JF6A 4DKIA 2HF6A 4E3NA 5DJTA 4BQMA 5FEGA 5EFWA 2V1BA 2A3UA 3L9KA 3LIFA 3GR2A 4KG2A 2J8YA 2H10A 5F6AA 4N9KA 2WADA 1T1BA 4MNRA 3CZDA 1G6OA 4GD6A 4NEED 3NOPC 3GRJA 1ES4A 3P01A 3CMZA 2LB9A 3ULFA 4K0XA 3W4OA 5FAOA 3PBQA 4BBVA 1YLWA 2NUPC 1TS6A 3CITA 5DJUA 1YSPA 3VV4A 2FZ0A 4C3QA 2B02A 5FDHA 3LYXA 4FD8A 1ZKJA 3B42A 5L8MA 3T4LA 2P9VB 1VEUA 3P09A 1IOUA 3G4PA 2BG1A 3IWQA 4DXBA 4RYEA 2PAVP 3QP8A 4OPQA 3DBAA 5DF8A 3MQ0A 4YWZA 2PR6A 1WYCA 2IA2A 2QMIA 3HLGA 2XQZA 1Q2PA 3IX4A 2Y2IA 1KDSA 1W5DA 1LHYA 1SKOA 2JC7A 3G30A 2W3HA 1XJ6A 5M19A 5I94A 1F2KA 3VOYA 1W63Q 4GS9A 5TFQA 4JBFA 5FI7A 4C75A 5FQKA 4N92A 5F69A 1IKGA 1I5QA 1UWNX 3C5AA 3QP2A 1N9OA 4EBPA 3NI9A 4WZ5C 3VOZA 4R70A 2PU4A 4HBUA 3LEZA 1NZOA 4EBNA 4DDYA 1CI8A 5HPFA 4Y7PA 1V9ZA 5CECA 2JKRM 2E8IA 3DWKA 3MXQA 5E2EA 3PYPA 5E2GA 3LICA 4E3IA 1LL5A 1ESIA 3KYQA 3JYIA 1IFQA 4K0WA 4LPZA 3CLOA 1LSXA 4BL3A 3V39A 1SCWA 1ZG4A 3DTIA 5EVEA 3VP4A 4MDZA 4L0LA 1FOFA 3S7QA 3HJIA 4P85A 4WMCD 4KUOA 4DDSA 5CHMA 3O87A 1K56A 3LIDA 5HAQA 2WAEA 3BY9A 1OT9A 3TSGA 2V1AA 3KSGA 2VGLM 3WS4A 3LIBA 2OV5A 4YOFA 2EFXA 5HARA 3LFVA 3S7NA 2XEPA 4F3LB 3CJMA 4WMCA 2OWHA 1BTLA 1K4EA 3GVBA 5AQ7A 2W1TB 4ZJ3A 2A49A 3PAGA 5FA7A 2EA9A 4P0MA 4PM9A 5GLAA 4E3MA 4KQOA 1HD8A 3IXDA 4Z9QA 5A91A 5GLDA 1NYYA 4OPYA 1JVJA 5DTSA 4AFIA 3NOTC 4QHCA 3IH9A 4P6ZM 1GSXA 1RP5A 5CHJA 4CLCB 4LGWA 2YKFA 5K5BA 3OC2A 3C7VA 4MMNA 2BLSA 3H82A 1PWDA 3LR0A 4ZBEA 2ZOIA 3IWIA 4RA7A 2C6WB 4N1XA 2J7VA 4FSFA 2GDNA 1VM1A 4GHIB 1IYSA 2JKTM 3UE1A 3N8LA 4Y5FA 1K54A 3BFDA 5L09A 4KQQA 3UDIA 2J80A 4KZ9A 4R3AA 3RFBA 3NECA 1JWPA 3IQAA 5GL9A 5FASA 1MWTA 1FR6A 3PBTA 3CAXA 2VK3A 4K08A 4G3VA 4PPRA 3NJAA 2EXAA 4R4RA 2X71A 3T1QB 1H3QA 5FSRA 4LV3A 5FQJA 2UV0E 4F3LA 1NLZA 4UA6A 1W7FA 2HJ9C 3UDXA 5F83A 3IHBA 5DFXA 3UB7A 2JKGA 1H5XA 2K31A 5M1AA 1OTDA 3GV9A 4KZAA 4WN5A 4DF6A 3T1XA 1XX2A 3RJUA 4HIAA 3MXSA 2Y2OA 1JNUA 3WRZA 2WKPA 5U47A 1Y28A 4S2LA 1N9NA 1NRJA 1TS0A 1YLYA 4PM7A 1H8MA 5CXWA 2R9WA 3W2ZA 4DN0A 1PWGA 2PYPA 4I5SA 3MQQA 1E25A 4OPZA 3U2AA 4M3KA 5IS1A 5A90A 3PBRA 4I3AA 2O9BA 1GA9A 3OLOA 3B3XA 1PI4A 1T1CA 4S2PA 3SOIA 1LSWA 4HJ6A 4PMAA 2I9VA 4L9EA 5EM1A 3R7WA 5CX7A 2VGKA 3TE8A 3UB9A 5EM0A 4KUKA 1XXMA 4DE2A 5BOHA 3MR0A 3KSFA 2DNSA 4OLGA 3WS0A 1FR1A 2W0NA 3IF6C 2PHYA 1T19A 2B18A 3T1RA 2Y2LA 1AXBA 3IT9A 3IWOA 2G2UA 1T18A 4KZ3A 2W1TA 2O9AA 4BJPA 1XA1A 1VHMA 3B33A 3LY4A 4R3BA 4O8GA 3UNWA 5AQAA 4Y0OA 2H0YA 1G5UA 4NXEA 1VETA 2R78A 1MZUA 1ACFA 3VSKA 4I39A 2E8JA 4HQAA 2A24B 4QWOA 4R6LA 1BLHA 2ZMAA 5CERA 1KOUA 4MBFA 2XR0A 4EWFA 1L0GA 3G6OA 2Y2MA 5DF7A 5EECA 3LO7A 1BZAA 1OPXA 4X53A 4CLCE 4IUHA 1PZPA 2XD5A 4BLMA 2CMNA 5EVIA 3D3OA 2PBDP 4MN7A 2QJ7A 1VB6A 3E2LA 3GECA 5A92A 3MFXA 3UPNA 5CGWA 4IVIA 1D06A 3V3RA 3MQOA 1KGEA 1X0OA 2HP9A 1FSYA 5HDCA 1S66L 3LGOA 1NWZA 4CLCD 1T1AA 1I2SA 3ZNYA 2K2NA 1ZHHB 2HZ5A 3CHWP 5FQ9A 3VP3A 3CUEA 1ODVA 3HLFA 3E2KA 5A93A 2XA7M 2WGWB 5A8BA 5GHZA 3HUMA 5CTNA 2ZC3B 3W4QA 3ZFZA 2Q9NA 2HGVA 2QYBA 1WA9A 4EEUA 3RXXA 4KQDA 2ACGA 4GDBA 1TF1A 1BSGA 4CLCA 1Y54A 2P04A 1KVLA 1E3UD 2ZC5B 2Y59A 4B4XA 3MFDA 1J3WA 2V1ZA 5HX9A 2XD1A 1IYPA 4ID4A 4CJNA 1K55A 5FDSA 5TJJA 4FH4A 3ZG5A 2DRWA 3VOLA 5EVIB 5FQMA 4G3WA 4LV1A 1QMFA 3BFCA 3PTEA 4R0QA 3A3JA 1JWZA 2DMWA 2Y2NA 3MS6A 4WF0A 1G6AA 4Q8IA 2ZL1B 2OOLA 3UB8A 2OAP1 4KZ7A 1E3UA 4R23A 5KZHA 1S67L 2X01A 1YKDA 1ALQA 3HLDA 3F1NA 4ZRRA 1N9LA 4GW9A 3ITBA 4WZ5A 2HDQA 4P6BA 1MWRA 4GD8A 4L9FA 2RCXA 4X69A 1NLYA 3VFHA 5AQ9A 2Y8HA 3RXWA 1KGFA 2M1CA 2JBFA 4IBXA 2QZ6A 3MZEA 1U60A 3Q7VA 3D4FA 2ZD8A 4Y0TA 1H8YA 1N4OA 1KE3A 2Y2GA 4DXCA 2EX2A 4EEPA 1YMXA 3ZNTA 1ES3A 4MEZA 4OONA 4KG6A 2Z6CA 1OTAA 2X02A 1K57A 2J3TD 3CWFA 4QY5A 2V20A 1DP9A 1MWUA 4M4XA 3T12B 3G31A 3T4JA 2B95A 4X25A 4HY8A 1DJCA 2VX8A 2INWA 3FYZA 1XFQA 4QU3A 5I5LA 1Q2QA 3P7NA 1RCJA 1S4SA 3HUNA 4S2NA 4OQHA 4I3JA 2OWJA 3BFEA 1KDWA 3W8KA 2EWVA 3WRTA 3VE3A 4WUJA 1PNEA 4XUXA 1K56D 2ZL1A 3CI6A 3ZG7B 4UHUA 5DKKA 1S1ZA 5FAPA 4PM8A 1XJ2A 3P98A 5DKLA 5HW3A 5GHXA 1OTEA 1K55C 2DCFA 4BMWA 3FG8A 2XRNA 1I2WA 4DJ3A 2B5RA 5G18A 3IS2B 1PFLA
chains in the Genus database with same CATH topology
4I38A 2QJ5A 3EGXC 5C5KA 2J80A 2Z6DA 2HV1A 3EEHA 4R3AA 4L9GA 3RFBA 1TS8A 4EESA 1DP6A 4P6ZS 2G7UA 2M7UA 1STZA 3PBTA 4CQHA 4GLQA 3CAXA 3PR6A 5AJGA 3K3DA 4K08A 4Y3IA 4G3VA 2ZMVA 3NJAA 4EETB 2HJEA 2EWWA 1TD5A 2ZMFA 2JKRI 2XA7S 1UGUA 1H3QA 4GJ4A 1W63M 4F3LA 3IS2A 1NLZA 2ZOHA 1EW0A 2HJ9C 3E4OA 3MF0A 1DRMA 3VE4A 5DFXA 3T4OA 2J3TC 3OBFA 3UB7A 3BW6A 1LT0A 4HHDA 2K31A 1OTDA 3BQAA 4HH3A 4WN5A 1MKMA 4YNRA 4O01A 3H82B 2W3EA 3SW1A 2PR5A 3LIEA 2J3WA 4HIAA 3E4PA 1JNUA 4HI4A 2WKPA 5TBMA 1Y28A 4HP4A 1N9NA 1NRJA 1XJ3A 3TRCA 1TS0A 2XSSA 4EW7A 1H8MA 3W2ZA 5HD5A 4GS9B 2V9AA 4DN0A 3PXPA 1ZTUA 2VJWA 1TS7A 3NOUC 5J7EA 4EU0A 5HZHA 2PYPA 4I5SA 3T4SA 3MQQA 1V9YA 3U2AA 2VV8A 2D02A 3T4QA 3UMDA 1F98A 5IT5A 5IS1A 3LI8A 3UB6A 2FH5A 4IHQA 4EXOA 3PBRA 4I3AA 2O9BA 3F1OA 3OLOA 1P0ZA 3H7WB 1T1CA 3LI9A 2GZAA 4ARZA 1LSWA 2O99A 2D01A 4HJ6A 4Y5FA 5DF9A 2W3FA 3O5YA 2I9VA 4L9EA 2MJ6A 3PBNA 3R7WA 5CX7A 2KOIA 1P9RA 4DMZA 2W3DA 3F1PA 3TE8A 3UB9A 4KUKA 3PHYA 2GNXA 4JGQA 4NKPA 3OCNA 4R38A 3MR0A 3KSFA 3RTYA 2L4RA 5HDSA 4B93A 5MC7A 4BBUA 4DJ2A 2W0NA 4CLCC 3B47A 2PHYA 1T19A 4HOIA 2B18A 4GHIA 2QWSA 4XT2A 4H6JB 4E04A 5HD3A 2A24A 1OTIA 4WLAA 3EEAA 1DP8A 1T18A 5G4ZA 2W1TA 2O9AA 4BJPA 2KX6A 3K2NA 4OOMA 2PD8A 3S7PA 5KIZA 4PHTA 1VHMA 3B33A 5AVFA 4IUKA 4EQ1A 1OJGA 3F1OB 4O8GA 3E0YA 1LL8A 4BBTA 4MCWA 2JHEA 1S1YA 4IJGA 3T4TA 4NXEA 3MMHA 2O0YA 3JVVA 3TW8A 2QKPA 4HJ3A 3TJZC 4GCZA 2R78A 1MZUA 2K7SA 3KO6A 3KSIA 5G4YA 4ETZA 4I39A 3F1PB 4UQIS 3HCYA 1P97A 4HQAA 2A24B 1F5MA 4R6LA 3T4KA 1KOUA 2HF6A 3JVUA 1F9IA 5DJTA 4ETXA 4Q0HA 2M7VA 3G6OA 5EFWA 3BJNA 2V1BA 3LIFA 1GSWA 4JGRA 1OPXA 5F6AA 4CLCE 5HWVA 4IUHA 3IBRA 2CMNA 3BWLA 3LIAA 4UQIM 3D3OA 1T1BA 1G28A 4MN7A 2QJ7A 3BY8A 1VB6A 3R4KA 3GECA 1G6OA 4NEED 1MC0A 2P08A 3NOPC 4JGPA 3MFXA 3A0VA 3R7WB 3P01A 4WELA 3H9WA 3CUEC 2VEAA 3E4QA 4NXBA 2LB9A 4PKYA 3ULFA 5HSQA 3OOVA 2A2LA 3K3CA 3PBQA 4BBVA 4QPRA 2NUPC 1D06A 1TS6A 3MQOA 1X0OA 3CITA 3EWKA 3H7WA 2NUTC 5HDCA 1S66L 5DJUA 1YSPA 2W3GA 2FZ0A 2YKHA 3VV4A 4WEKA 5F68A 1NWZA 2B02A 2Y79A 4CLCD 1T1AA 3LYXA 3B42A 1OT6A 2K2NA 2VGLS 5J4EA 1D7EA 1ZHHB 3CUEA 5L8MA 3PBSA 1ODVA 3T4LA 4BWIA 4EERA 2BASA 1YAXA 2XA7M 1IOUA 5HWWA 3GDIA 3DBAA 4OOLA 5A8BA 3IBJA 3MQ0A 4YWZA 3F1NB 2HGVA 2PR6A 2QYBA 1WA9A 2IA2A 4EEUA 5J3WA 4KQDA 3EQUA 4ME4A 1TF1A 3D72A 3UMEA 4MN6A 4XT2B 4CLCA 2PD7A 2W3HA 1XJ6A 2P04A 2VKSA 4Z1WA 2QHKA 3LR3A 4Q0JA 1W63Q 4GS9A 2W27A 5HDDA 4HJ4A 4HNBA 5F69A 2WKRA 4II7A 1UWNX 1N9OA 3EGDC 2VLGA 3KSHA 2O9CA 4LRZE 5TJJA 3OCLA 3ICYA 4R70A 5HL6A 2L1MA 3VOLA 4B9OA 3E98A 3LR4A 5HPFA 4G3WA 1V9ZA 4I3IA 2JKRM 2ZBBA 5KSHA 2DMWA 3MXQA 3C30A 3PYPA 4MN5A 4WF0A 3LICA 5FL3A 5HPIA 2KDKA 2OOLA 4EUVA 2PT7A 3UB8A 4Y2FA 3UE3A 2OAP1 3KX0X 3KYQA 4O0PA 1IFQA 1S67L 4LPZA 1YKDA 3HJKA 2LB5A 2PYRA 3V67A 3CLOA 1LSXA 3F1NA 2V0WA 4ZRRA 1N9LA 4GW9A 5IU1A 3S7OA 2W1RA 4LRYC 3PBOA 4UEYA 4MDZA 4L0LA 3S7QA 4L9FA 3A0RA 3LR5A 3HJIA 1NLYA 4RQ9A 1LSVA 4G3KA 4KUOA 2Y8HA 3C38A 2M1CA 2VV7A 4LLOB 3LIDA 4FOFA 3EOIA 3BY9A 2OAQ1 5LBRA 1OT9A 2V1AA 1S4RA 3FPVA 4WL9A 3KSGA 2VGLM 5TBMB 3LIBA 3C8CA 2GX5A 4EEPA 4YOFA 3LFVA 2Z6CA 1OTAA 3S7NA 2P7JA 2L0WA 2J3TD 2VV6A 4F3LB 3CWFA 2OWHA 1DP9A 4M4XA 2W1TB 4Q0IA 3T4JA 3T50A 3RH8B 3ZQ5A 2H28A 2VA0A 2EA9A 5DFYA 4HY8A 2JN7A 3UE6A 2VX8A 3FC7A 2INWA 4KQOA 1XFQA 2GJ3A 5I5LA 5HWTA 3P7NA 1S4SA 4PAUA 3NHQA 2V0UA 4ARZB 2PDRA 4AFIA 5AVEA 2XROA 1OTBA 4I3JA 2OWJA 3BQ8A 3NOTC 4HP9A 2EWVA 1XJ4A 4P6ZM 4NXGA 1P9WA 3VE3A 1GSXA 1BYWA 1OJ5A 4WUJA 4PKYG 3A0SA 5F5YA 3FPWA 4CLCB 2VZWA 3LUQA 3CI6A 2YKFA 2KLIA 3C2WA 5DKKA 5K5BA 4WEJA 3OC2A 1S1ZA 1YSQA 4MMNA 1UWPX 3MJQA 4HH2A 3H82A 2WKQA 3LR0A 3EQVA 2ZOIA 1XJ2A 4LRXC 5DKLA 3ZYTA 1XFNA 1OTEA 4NXFA 4H6JA 4BMWA 3FG8A 4FSFA 4GHIB 1GSVA 2XRNA 3KYZA 4JGOA 4DJ3A 2JKTM 3IS2B 2JKTI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I38 A;  2QJ5 A;  4KUK A;  1D06 A;  1TS6 A;  3MQO A;  4L9F A;  1X0O A;  3A0R A;  2J80 A;  2Z6D A;  3EWK A;  2HV1 A;  3PHY A;  4JGQ A;  3EEH A;  3HJI A;  4R3A A;  4L9G A;  3H7W A;  5HDC A;  1S66 L;  5DJU A;  2YKH A;  1TS8 A;  4R38 A;  1LSV A;  4KUO A;  3MR0 A;  4RQ9 A;  3RTY A;  4EES A;  1DP6 A;  2L4R A;  1NWZ A;  2B02 A;  5F68 A;  5HDS A;  2M1C A;  4BBU A;  2VV7 A;  4DJ2 A;  2W0N A;  4LLO B;  3CAX A;  3LID A;  1T1A A;  3LYX A;  1OT6 A;  2PHY A;  1T19 A;  4HOI A;  3BY9 A;  4GHI A;  5J4E A;  2QWS A;  3K3D A;  4K08 A;  4XT2 A;  4H6J B;  4E04 A;  1D7E A;  5HD3 A;  1OT9 A;  3NJA A;  4EET B;  2V1A A;  1S4R A;  1ODV A;  4WL9 A;  5TBM B;  2A24 A;  3LIB A;  1OTI A;  2BAS A;  3C8C A;  4EER A;  1UGU A;  4WLA A;  4EEP A;  5HWW A;  3GDI A;  3IS2 A;  4F3L A;  1DP8 A;  1T18 A;  2ZOH A;  5G4Z A;  1EW0 A;  2Z6C A;  5A8B A;  1OTA A;  3E4O A;  2P7J A;  4YWZ A;  2L0W A;  2KX6 A;  5KIZ A;  2PD8 A;  1DRM A;  3F1N B;  3VE4 A;  2PR6 A;  3UB9 A;  3B33 A;  2VV6 A;  1WA9 A;  3UB7 A;  3CWF A;  5AVF A;  1LT0 A;  4NXF A;  4HHD A;  5J3W A;  4EEU A;  4F3L B;  4EQ1 A;  1OTD A;  4KQD A;  4HH3 A;  2OWH A;  1OJG A;  3F1O B;  4WN5 A;  1LL8 A;  1DP9 A;  4M4X A;  4BBT A;  2JHE A;  1S1Y A;  3D72 A;  3T50 A;  3UME A;  3ZQ5 A;  3RH8 B;  3H82 B;  4MN6 A;  4XT2 B;  3SW1 A;  2PR5 A;  4NXE A;  2PD7 A;  3LIE A;  1XJ6 A;  2H28 A;  2EA9 A;  3E4P A;  4HIA A;  1JNU A;  2QHK A;  4HI4 A;  2QKP A;  4HY8 A;  4HJ3 A;  2WKP A;  2JN7 A;  4GCZ A;  3UE6 A;  2R78 A;  4GS9 A;  2W27 A;  5HDD A;  1MZU A;  1Y28 A;  2K7S A;  2INW A;  3FC7 A;  1N9N A;  4HJ4 A;  4HP4 A;  1XFQ A;  2GJ3 A;  4HNB A;  1XJ3 A;  5G4Y A;  4I39 A;  3F1P B;  5HWT A;  5I5L A;  1P97 A;  4HQA A;  1TS0 A;  2A24 B;  3P7N A;  4R6L A;  1S4S A;  4EW7 A;  3NHQ A;  5F69 A;  2V0U A;  2WKR A;  1UWN X;  2PDR A;  1KOU A;  1N9O A;  2VLG A;  4LRZ E;  5AVE A;  5HD5 A;  1OTB A;  1F9I A;  2V9A A;  2OWJ A;  3ICY A;  4GS9 B;  3NOT C;  4I3J A;  4R70 A;  4HP9 A;  5DJT A;  3G6O A;  2L1M A;  5EFW A;  3VOL A;  4B9O A;  2V1B A;  5J7E A;  1TS7 A;  1XJ4 A;  3LIF A;  3NOU C;  4NXG A;  3VE3 A;  1GSX A;  5HZH A;  1BYW A;  1GSW A;  1OJ5 A;  2PYP A;  4I5S A;  4JGR A;  1V9Z A;  3MQQ A;  4WUJ A;  4PKY G;  3A0S A;  1V9Y A;  4I3I A;  2ZBB A;  5F5Y A;  5F6A A;  5HWV A;  2VV8 A;  2D02 A;  3UMD A;  1F98 A;  3MXQ A;  3IBR A;  2CMN A;  3BWL A;  3LIA A;  3LI8 A;  3LUQ A;  2YKF A;  3PYP A;  4MN5 A;  3UB6 A;  5IS1 A;  4EXO A;  1T1B A;  3C2W A;  3LIC A;  4WF0 A;  4I3A A;  3F1O A;  1G28 A;  3OLO A;  5DKK A;  2QJ7 A;  2KDK A;  2OOL A;  1VB6 A;  1P0Z A;  3BY8 A;  3UB8 A;  3H7W B;  1S1Z A;  3GEC A;  1UWP X;  1T1C A;  3MJQ A;  3H82 A;  2WKQ A;  3KX0 X;  3LI9 A;  3NOP C;  4HH2 A;  4JGP A;  3MFX A;  5TBM A;  3A0V A;  1LSW A;  1S67 L;  2D01 A;  2ZOI A;  4HJ6 A;  4LPZ A;  3HJK A;  1XJ2 A;  4LRX C;  3H9W A;  5DKL A;  2PYR A;  2I9V A;  1OTE A;  1XFN A;  1LSX A;  2VEA A;  3CLO A;  2V0W A;  3E4Q A;  3F1N A;  4H6J A;  4L9E A;  1N9L A;  4GW9 A;  3FG8 A;  4NXB A;  4GHI B;  1GSV A;  4PKY A;  5IU1 A;  3ULF A;  5HSQ A;  4JGO A;  4DJ3 A;  3F1P A;  4LRY C;  3K3C A;  3IS2 B;  4BBV A; 
#chains in the Genus database with same CATH topology
 4I38 A;  3IXH A;  1W79 A;  1KE0 A;  1WYB A;  3EGX C;  1PIO A;  2HDR A;  3C4O A;  3VSL A;  3NY4 A;  2VGJ A;  3V50 A;  1DP6 A;  1BT5 A;  2M7U A;  1STZ A;  2G2W A;  3PR6 A;  5AJG A;  4JF5 A;  5FAQ A;  3SH9 A;  1NRF A;  1VQQ A;  1KE4 A;  4GJ4 A;  4U0T A;  4OVD A;  1GHM A;  2WAF A;  1DRM A;  3VE4 A;  3BW6 A;  1HLU P;  4HH3 A;  4X55 A;  5AQB A;  3WWX A;  5EVI D;  1K54 C;  1MKM A;  3ZVT A;  4FH2 A;  2J3W A;  4HI4 A;  1K6R A;  4WZ4 A;  2XFS A;  4ZJ2 A;  1XGJ A;  2Q9M A;  3N6I A;  3TRC A;  4E3J A;  3HLB A;  3DWZ A;  2WKI A;  2Z2L B;  4GS9 B;  2V9A A;  4JXS A;  4Y0U A;  3PXP A;  4D2O A;  3NOU C;  4EU0 A;  2ZC6 B;  2H5S A;  1XGI A;  5JYP A;  3T4S A;  3ISG A;  1MWS A;  3UB5 P;  3T4Q A;  2D02 A;  2ZC7 A;  2FH5 A;  3H7W B;  2Y55 A;  3CG5 A;  3S1Y A;  2GZA A;  4ARZ A;  2XGN A;  1FQG A;  2W3F A;  2CC1 A;  1NY0 A;  4DMZ A;  2W3D A;  3Q1F A;  4UA7 A;  4FUW A;  1VEU B;  4JGQ A;  3OCN A;  1XPB A;  2HPB A;  3RTY A;  2L4R A;  5HDS A;  2WGW A;  4KQR A;  1MBL A;  3VFF A;  5FQQ A;  3B47 A;  1MY8 A;  2QWS A;  3NIA A;  4XT2 A;  4H6J B;  2WK0 A;  1ES5 A;  3BFF A;  4BEN A;  3IX8 A;  4EUZ A;  2KX6 A;  1S0W A;  4OOM A;  3ZHH A;  5KIZ A;  4GOG A;  2Y91 A;  3VP1 A;  2ZQ9 A;  1OJG A;  3F1O B;  5GLC A;  1LI0 A;  3E0Y A;  1LL8 A;  5EVI C;  1BLS A;  4DE3 A;  4S2K A;  4IJG A;  1IYO A;  5EVL A;  3JVV A;  3DAV A;  3TW8 A;  4HJ3 A;  4GCZ A;  3UO9 A;  2Y4A A;  4ETZ A;  1TDL A;  4UQI S;  3HCY A;  1P97 A;  3M2J A;  3QP5 A;  4MLL A;  3V5M A;  4S2J A;  3JVU A;  4JXV A;  4QY6 A;  3G35 A;  3BJN A;  1M6K A;  1D1J A;  5HWV A;  2Y2Q A;  3IBR A;  3BWL A;  3DTE A;  3IXG A;  4UQI M;  4LEN A;  3TG9 A;  3BY8 A;  3R4K A;  4GB7 A;  4JXW A;  2P08 A;  3HRE A;  4JGP A;  2ZJ9 A;  4WEL A;  3FKW A;  3G2Z A;  1HVB A;  3CUE C;  2XF3 A;  4RX3 A;  4NXB A;  3T1S A;  1K0K A;  4PKY A;  3I7J A;  5HSQ A;  4ESP A;  3K3C A;  3QNB A;  3V3S A;  4QPR A;  1CJF A;  3NC8 A;  3IH8 A;  2WKH A;  2NUT C;  1L2S A;  3SZT A;  1IKI A;  4WEK A;  5F68 A;  1CK3 A;  3ZCZ A;  5F82 A;  3S4X A;  1OT6 A;  1ZG6 A;  2VGL S;  5J4E A;  3ZDJ A;  1FCN A;  2PBY A;  2BAS A;  3A3F A;  3N8S A;  3MZD A;  4ZJ1 A;  4OOL A;  3IBJ A;  2Q0O A;  1YLP A;  3UPO A;  3N4I A;  4JXG A;  2WUQ A;  4ME4 A;  1YPR A;  3D72 A;  3UME A;  5CGS A;  2PD7 A;  4Z1W A;  2VKS A;  5FI6 A;  3Q7Z A;  5HDD A;  4HNB A;  1EI5 A;  4NK3 A;  2PU2 A;  2VLG A;  3KSH A;  4LRZ E;  2AVX A;  4LCM A;  1YQS A;  2L1M A;  4B9O A;  3LR4 A;  4IVK A;  3GTC A;  3CPT A;  4I3I A;  1CF0 A;  4NET A;  5E2F A;  1GCE A;  4Y17 A;  4MN5 A;  3FKV A;  5FL3 A;  5HPI A;  2KDK A;  5L07 A;  2PT7 A;  4B4Z A;  3KX0 X;  4O0P A;  3A3E A;  1K4F A;  5TR7 A;  5E43 A;  1W8Y A;  1CEG A;  3V67 A;  3NDE A;  4EQI A;  2V0W A;  3S7O A;  5IU1 A;  4XUZ A;  2JCH A;  4R1G A;  3TOI A;  1YMS A;  2J9O A;  4FTX A;  3A0R A;  1NYM A;  4OH0 A;  4EV4 A;  4ZAM A;  1BUE A;  4RQ9 A;  1G68 A;  4G3K A;  3Q81 A;  2XDM A;  1YLZ A;  3C38 A;  4LLO B;  2IWD A;  1PYY A;  4PM5 A;  5F1G A;  3EOI A;  3UDF A;  5LBR A;  1S4R A;  2XFT A;  5TBM B;  1WE4 A;  2GX5 A;  2JKF A;  3SS3 A;  5HAP A;  4X6T A;  4S2O A;  2P7J A;  3OPR A;  2L0W A;  4S2M A;  5FEF A;  1FIK A;  1PRQ A;  2IWC A;  1JWV A;  3RH8 B;  1XP4 A;  5DVA A;  2VA0 A;  4U3T A;  2ZC4 B;  1XA7 A;  2JN7 A;  2WKE A;  4OQI A;  4F94 A;  3WS1 A;  1L0D A;  5HL1 A;  1KVM A;  4N1H A;  4PAU A;  5EV0 A;  3HBR A;  4ARZ B;  1MXO A;  4A5R A;  4PM6 A;  2XRO A;  1OTB A;  1ERM A;  2OLV A;  4NXG A;  1P9W A;  1SKO B;  1BYW A;  1OJ5 A;  1CI9 A;  3A0S A;  4PKY G;  1LI9 A;  3FPW A;  1LLB A;  2VZW A;  3C2W A;  3U4L P;  4BL2 A;  3VP0 A;  1BLP A;  1YSQ A;  2FFF B;  1UWP X;  4HH2 A;  5L10 A;  4OPR A;  3EQV A;  5EOO A;  4LRX C;  5FI2 A;  4H6J A;  2QPN A;  3MSH A;  3KYZ A;  1C3B A;  4JGO A;  4GZB A;  2JKT I;  2QJ5 A;  1MKI A;  5C5K A;  3MXR A;  1SHV A;  4YIN A;  4K91 A;  3VMA A;  1DJA A;  4P6Z S;  4BD1 A;  4X56 A;  1PWC A;  1J9M A;  2ZMV A;  2HJE A;  2EWW A;  5CEB A;  1TD5 A;  1DY6 A;  2ZMF A;  2XA7 S;  5EE8 A;  4X1L A;  3IS2 A;  2EFU A;  4GNU A;  1HTZ A;  1EW0 A;  5EUA A;  3E4O A;  1E4D A;  1SDE A;  3GQZ A;  3NDG A;  3OBF A;  4KZ8 A;  4XXR A;  2ZQC A;  4H8R A;  4MBH A;  4O01 A;  3UPP A;  2WGV A;  4LV2 A;  4ZDX A;  3OZH A;  4DE1 A;  4QB8 A;  1XJ3 A;  3ZVW A;  1HZO A;  3A3I A;  2XSS A;  4EW7 A;  1FIL A;  4C6Y A;  1YLT A;  4E3O A;  5JYO A;  1RGY A;  5HD5 A;  1TVF A;  4KG5 A;  5J7E A;  1TS7 A;  1V9Y A;  3UMD A;  5IT5 A;  3ITA A;  3LI8 A;  5CRF A;  3UB6 A;  4U0X A;  3F1O A;  2Y2P A;  1LL9 A;  4JF4 A;  3ZG0 A;  3DW0 A;  4DRT A;  4KZ5 A;  3SH7 A;  3LCE A;  4Y15 A;  5DF9 A;  1YM1 A;  3O5Y A;  2ZQD A;  3AGD A;  5E2H A;  2KOI A;  1P9R A;  3F1P A;  2XLN A;  1H0M A;  4NKP A;  3BM6 A;  1IYQ A;  4HEF A;  3G2Y A;  4KZ6 A;  4B93 A;  5MC7 A;  5GLB A;  4CLC C;  5KSC A;  3HLW A;  3Q07 A;  4N9L A;  2HDU A;  4GHI A;  2RL3 A;  2XH9 A;  4CPK A;  1ES2 A;  1OTI A;  4WYY A;  3ZGA B;  2ZQ8 A;  3EEA A;  2ZQA A;  5G4Z A;  3Q7V B;  4QJG A;  1FCM A;  3S7P A;  2PD8 A;  4PHT A;  3UN7 A;  4IUK A;  3UE0 A;  4EQ1 A;  3L7H A;  4BBT A;  3MZF A;  3BLS A;  3NUL A;  5CED A;  3MMH A;  1O07 A;  2QKP A;  1TEM A;  2V8C A;  2K7S A;  3KO6 A;  3KSI A;  5GHY A;  5G4Y A;  2XK1 A;  3F1P B;  4DE0 A;  1PZO A;  4E3L A;  1F5M A;  1F9I A;  4ETX A;  4Q0H A;  2M7V A;  5EOE A;  3OPP A;  3HLE A;  1GSW A;  1CQA A;  4UAA A;  4JGR A;  3LIA A;  1G28 A;  2EXB A;  1MC0 A;  1M40 A;  1OME A;  3LEQ A;  1FSW A;  3A0V A;  3R7W B;  5KMW A;  3S22 A;  3M6H A;  3H9W A;  4O7D A;  5D3O A;  2VEA A;  3C4P A;  3E4Q A;  3G32 A;  4OOY A;  3C7U A;  3JPU A;  3OOV A;  2A2L A;  4X68 A;  4LFU A;  1K57 C;  2EX8 A;  1NXY A;  3EWK A;  4B88 A;  3H7W A;  2YKH A;  2W3G A;  2Y79 A;  1ERQ A;  4QD4 A;  1H8Z A;  3IHA A;  3N7W A;  1D7E A;  3DTK A;  3PBS A;  5FQI A;  4RVA A;  4BWI A;  4EER A;  1YAX A;  5HWW A;  3GDI A;  3G34 A;  3IX3 A;  1RGZ A;  3MKE A;  3LY3 A;  2V2F F;  3F1N B;  1W8Q A;  2EX6 A;  5DTT A;  5J3W A;  4X1M A;  3EQU A;  3HLC A;  3SS4 A;  4MN6 A;  1YLJ A;  4XT2 B;  4P87 A;  2QHK A;  3LR3 A;  4NG2 A;  4Q0J A;  1SDN A;  2W27 A;  4KZB A;  1SZV A;  2ZM0 A;  4HJ4 A;  1L3L A;  2P9V A;  2WKR A;  4II7 A;  3EGD C;  2O9C A;  3OCL A;  3ICY A;  2ZQ7 A;  5HL6 A;  4E6W A;  3E98 A;  4OLD A;  2ZBB A;  5KSH A;  3C30 A;  1BLC A;  3MBZ A;  4EUV A;  4Y2F A;  1IEL A;  4OQG A;  3UE3 A;  3M6B A;  3QP6 A;  1Z6F A;  1QME A;  3HJK A;  2LB5 A;  3PAE A;  2PYR A;  2JE5 A;  1A0K A;  4WBG A;  2W1R A;  5CHU A;  4LRY C;  4BD0 A;  3O3V A;  3PBO A;  2EX9 A;  1Y4O A;  4UEY A;  2C5W B;  2HP6 A;  3LR5 A;  4S2N C;  1JTD A;  5M18 A;  1LSV A;  3HVF A;  3A3D A;  1IEM A;  1ONG A;  2VV7 A;  2Y2J A;  3FZC A;  3VP2 A;  4FOF A;  5CGX A;  2OAQ 1;  1GHI A;  2I72 A;  1EWZ A;  3BEB A;  3FPV A;  3GSG A;  4WL9 A;  4ZTK A;  1XKZ A;  3C8C A;  4D60 A;  2H0T A;  4YFM A;  3O86 A;  5DTK A;  3Q82 A;  4RX2 A;  3QHY A;  2VV6 A;  4LV0 A;  1PW8 A;  1AWI A;  1ERO A;  1KGG A;  3T50 A;  4Q0I A;  5EPH A;  3ZQ5 A;  3M2K A;  2H28 A;  1TDG A;  5DFY A;  3UE6 A;  3ZG8 B;  3FC7 A;  2GJ3 A;  5HWT A;  5HFO A;  1K38 A;  3BEC A;  3BFG A;  1PI5 A;  3NHQ A;  4IED A;  2V0U A;  5CTM A;  2PDR A;  1MPL A;  2WZZ A;  5AVE A;  2HDS A;  3BQ8 A;  4HP9 A;  1XJ4 A;  3AGF A;  2BTF P;  3IF6 B;  5F5Y A;  3MKF A;  4OP8 A;  2HP5 A;  3NBL A;  3BRM A;  3LUQ A;  2KLI A;  1Z09 A;  2P74 A;  4WEJ A;  4JLF A;  1O7E A;  3MJQ A;  2WKQ A;  2UWX A;  1PW1 A;  3IXB A;  3AGE A;  4E3K A;  4WM9 A;  3HUO A;  3ZYT A;  1XFN A;  4NXF A;  1GSV A;  4GKU A;  1DJB A;  5IHV A;  3SH8 A;  5TGF A;  5F1F A;  4FCF A;  2Z6D A;  2HV1 A;  3EEH A;  4L9G A;  1TS8 A;  4EES A;  3D9Y A;  3FV7 A;  2G7U A;  1GHP A;  4GN2 A;  4CQH A;  4GLQ A;  4S2I A;  4GDN A;  2OLU A;  3K3D A;  4Y3I A;  4EET B;  1N9B A;  5L2F A;  2JKR I;  4EBL A;  1K6S A;  1UGU A;  1VET B;  1W63 M;  4LCL A;  2ZOH A;  4HES A;  1L0F A;  3MF0 A;  3GMW A;  3T4O A;  2J3T C;  2WYX A;  1LT0 A;  4HHD A;  3BQA A;  3SS5 A;  4OQ0 A;  3WS2 A;  1K25 A;  4YNR A;  3IF5 A;  3H82 B;  4OKP A;  2W3E A;  3SW1 A;  1ZC2 A;  2PR5 A;  3LIE A;  1CEF A;  4E6X A;  3E4P A;  5TBM A;  4HP4 A;  1S6R A;  4OP5 A;  3BYD A;  1SKF A;  2IWB A;  2Y2H A;  3OPL A;  1BUL A;  1ZTU A;  1NZU A;  2VJW A;  4UA9 A;  5HZH A;  2OSU A;  2VV8 A;  1F98 A;  3W4P A;  4IHQ A;  4EXO A;  1YT4 A;  1P0Z A;  5HAI A;  2V8F A;  3CPT B;  3LI9 A;  1L0E A;  4R3J A;  3NCK A;  3QP1 A;  2O99 A;  2D01 A;  4JKT A;  3DTM A;  3QNC A;  3QP4 A;  2MJ6 A;  3PBN A;  2Y2K A;  5J8X A;  4MBK A;  4Y13 A;  3OPH A;  1FCO A;  3PHY A;  2GNX A;  1ESU A;  2ZLY A;  3WS5 A;  3KYE A;  2WZX A;  3N8R A;  4R38 A;  3FWL A;  4JPM A;  3UY6 A;  4KZ4 A;  4BBU A;  4DJ2 A;  5FAT A;  2R9X A;  4HOI A;  4E04 A;  5HD3 A;  1GA0 A;  4R4S A;  3O88 A;  2A24 A;  4WLA A;  1DP8 A;  2J9P A;  2PRF A;  1NJ4 A;  3K2N A;  4IBR A;  3BLM A;  2Z2M B;  3HL9 A;  5AVF A;  1ONH A;  3ZG9 B;  4MCW A;  2JHE A;  1S1Y A;  3T4T A;  4KEN B;  4HBT A;  2O0Y A;  2FFY A;  3TJZ C;  2ZM2 A;  2ZM8 A;  3T4K A;  2WGI A;  1JTG A;  3IF6 A;  4JF6 A;  4DKI A;  2HF6 A;  4E3N A;  5DJT A;  4BQM A;  5FEG A;  5EFW A;  2V1B A;  2A3U A;  3L9K A;  3LIF A;  3GR2 A;  4KG2 A;  2J8Y A;  2H10 A;  5F6A A;  4N9K A;  2WAD A;  1T1B A;  4MNR A;  3CZD A;  1G6O A;  4GD6 A;  4NEE D;  3NOP C;  3GRJ A;  1ES4 A;  3P01 A;  3CMZ A;  2LB9 A;  3ULF A;  4K0X A;  3W4O A;  5FAO A;  3PBQ A;  4BBV A;  1YLW A;  2NUP C;  1TS6 A;  3CIT A;  5DJU A;  1YSP A;  3VV4 A;  2FZ0 A;  4C3Q A;  2B02 A;  5FDH A;  3LYX A;  4FD8 A;  1ZKJ A;  3B42 A;  5L8M A;  3T4L A;  2P9V B;  1VEU A;  3P09 A;  1IOU A;  3G4P A;  2BG1 A;  3IWQ A;  4DXB A;  4RYE A;  2PAV P;  3QP8 A;  4OPQ A;  3DBA A;  5DF8 A;  3MQ0 A;  4YWZ A;  2PR6 A;  1WYC A;  2IA2 A;  2QMI A;  3HLG A;  2XQZ A;  1Q2P A;  3IX4 A;  2Y2I A;  1KDS A;  1W5D A;  1LHY A;  1SKO A;  2JC7 A;  3G30 A;  2W3H A;  1XJ6 A;  5M19 A;  5I94 A;  1F2K A;  3VOY A;  1W63 Q;  4GS9 A;  5TFQ A;  4JBF A;  5FI7 A;  4C75 A;  5FQK A;  4N92 A;  5F69 A;  1IKG A;  1I5Q A;  1UWN X;  3C5A A;  3QP2 A;  1N9O A;  4EBP A;  3NI9 A;  4WZ5 C;  3VOZ A;  4R70 A;  2PU4 A;  4HBU A;  3LEZ A;  1NZO A;  4EBN A;  4DDY A;  1CI8 A;  5HPF A;  4Y7P A;  1V9Z A;  5CEC A;  2JKR M;  2E8I A;  3DWK A;  3MXQ A;  5E2E A;  3PYP A;  5E2G A;  3LIC A;  4E3I A;  1LL5 A;  1ESI A;  3KYQ A;  3JYI A;  1IFQ A;  4K0W A;  4LPZ A;  3CLO A;  1LSX A;  4BL3 A;  3V39 A;  1SCW A;  1ZG4 A;  3DTI A;  5EVE A;  3VP4 A;  4MDZ A;  4L0L A;  1FOF A;  3S7Q A;  3HJI A;  4P85 A;  4WMC D;  4KUO A;  4DDS A;  5CHM A;  3O87 A;  1K56 A;  3LID A;  5HAQ A;  2WAE A;  3BY9 A;  1OT9 A;  3TSG A;  2V1A A;  3KSG A;  2VGL M;  3WS4 A;  3LIB A;  2OV5 A;  4YOF A;  2EFX A;  5HAR A;  3LFV A;  3S7N A;  2XEP A;  4F3L B;  3CJM A;  4WMC A;  2OWH A;  1BTL A;  1K4E A;  3GVB A;  5AQ7 A;  2W1T B;  4ZJ3 A;  2A49 A;  3PAG A;  5FA7 A;  2EA9 A;  4P0M A;  4PM9 A;  5GLA A;  4E3M A;  4KQO A;  1HD8 A;  3IXD A;  4Z9Q A;  5A91 A;  5GLD A;  1NYY A;  4OPY A;  1JVJ A;  5DTS A;  4AFI A;  3NOT C;  4QHC A;  3IH9 A;  4P6Z M;  1GSX A;  1RP5 A;  5CHJ A;  4CLC B;  4LGW A;  2YKF A;  5K5B A;  3OC2 A;  3C7V A;  4MMN A;  2BLS A;  3H82 A;  1PWD A;  3LR0 A;  4ZBE A;  2ZOI A;  3IWI A;  4RA7 A;  2C6W B;  4N1X A;  2J7V A;  4FSF A;  2GDN A;  1VM1 A;  4GHI B;  1IYS A;  2JKT M;  3UE1 A;  3N8L A;  4Y5F A;  1K54 A;  3BFD A;  5L09 A;  4KQQ A;  3UDI A;  2J80 A;  4KZ9 A;  4R3A A;  3RFB A;  3NEC A;  1JWP A;  3IQA A;  5GL9 A;  5FAS A;  1MWT A;  1FR6 A;  3PBT A;  3CAX A;  2VK3 A;  4K08 A;  4G3V A;  4PPR A;  3NJA A;  2EXA A;  4R4R A;  2X71 A;  3T1Q B;  1H3Q A;  5FSR A;  4LV3 A;  5FQJ A;  2UV0 E;  4F3L A;  1NLZ A;  4UA6 A;  1W7F A;  2HJ9 C;  3UDX A;  5F83 A;  3IHB A;  5DFX A;  3UB7 A;  2JKG A;  1H5X A;  2K31 A;  5M1A A;  1OTD A;  3GV9 A;  4KZA A;  4WN5 A;  4DF6 A;  3T1X A;  1XX2 A;  3RJU A;  4HIA A;  3MXS A;  2Y2O A;  1JNU A;  3WRZ A;  2WKP A;  5U47 A;  1Y28 A;  4S2L A;  1N9N A;  1NRJ A;  1TS0 A;  1YLY A;  4PM7 A;  1H8M A;  5CXW A;  2R9W A;  3W2Z A;  4DN0 A;  1PWG A;  2PYP A;  4I5S A;  3MQQ A;  1E25 A;  4OPZ A;  3U2A A;  4M3K A;  5IS1 A;  5A90 A;  3PBR A;  4I3A A;  2O9B A;  1GA9 A;  3OLO A;  3B3X A;  1PI4 A;  1T1C A;  4S2P A;  3SOI A;  1LSW A;  4HJ6 A;  4PMA A;  2I9V A;  4L9E A;  5EM1 A;  3R7W A;  5CX7 A;  2VGK A;  3TE8 A;  3UB9 A;  5EM0 A;  4KUK A;  1XXM A;  4DE2 A;  5BOH A;  3MR0 A;  3KSF A;  2DNS A;  4OLG A;  3WS0 A;  1FR1 A;  2W0N A;  3IF6 C;  2PHY A;  1T19 A;  2B18 A;  3T1R A;  2Y2L A;  1AXB A;  3IT9 A;  3IWO A;  2G2U A;  1T18 A;  4KZ3 A;  2W1T A;  2O9A A;  4BJP A;  1XA1 A;  1VHM A;  3B33 A;  3LY4 A;  4R3B A;  4O8G A;  3UNW A;  5AQA A;  4Y0O A;  2H0Y A;  1G5U A;  4NXE A;  1VET A;  2R78 A;  1MZU A;  1ACF A;  3VSK A;  4I39 A;  2E8J A;  4HQA A;  2A24 B;  4QWO A;  4R6L A;  1BLH A;  2ZMA A;  5CER A;  1KOU A;  4MBF A;  2XR0 A;  4EWF A;  1L0G A;  3G6O A;  2Y2M A;  5DF7 A;  5EEC A;  3LO7 A;  1BZA A;  1OPX A;  4X53 A;  4CLC E;  4IUH A;  1PZP A;  2XD5 A;  4BLM A;  2CMN A;  5EVI A;  3D3O A;  2PBD P;  4MN7 A;  2QJ7 A;  1VB6 A;  3E2L A;  3GEC A;  5A92 A;  3MFX A;  3UPN A;  5CGW A;  4IVI A;  1D06 A;  3V3R A;  3MQO A;  1KGE A;  1X0O A;  2HP9 A;  1FSY A;  5HDC A;  1S66 L;  3LGO A;  1NWZ A;  4CLC D;  1T1A A;  1I2S A;  3ZNY A;  2K2N A;  1ZHH B;  2HZ5 A;  3CHW P;  5FQ9 A;  3VP3 A;  3CUE A;  1ODV A;  3HLF A;  3E2K A;  5A93 A;  2XA7 M;  2WGW B;  5A8B A;  5GHZ A;  3HUM A;  5CTN A;  2ZC3 B;  3W4Q A;  3ZFZ A;  2Q9N A;  2HGV A;  2QYB A;  1WA9 A;  4EEU A;  3RXX A;  4KQD A;  2ACG A;  4GDB A;  1TF1 A;  1BSG A;  4CLC A;  1Y54 A;  2P04 A;  1KVL A;  1E3U D;  2ZC5 B;  2Y59 A;  4B4X A;  3MFD A;  1J3W A;  2V1Z A;  5HX9 A;  2XD1 A;  1IYP A;  4ID4 A;  4CJN A;  1K55 A;  5FDS A;  5TJJ A;  4FH4 A;  3ZG5 A;  2DRW A;  3VOL A;  5EVI B;  5FQM A;  4G3W A;  4LV1 A;  1QMF A;  3BFC A;  3PTE A;  4R0Q A;  3A3J A;  1JWZ A;  2DMW A;  2Y2N A;  3MS6 A;  4WF0 A;  1G6A A;  4Q8I A;  2ZL1 B;  2OOL A;  3UB8 A;  2OAP 1;  4KZ7 A;  1E3U A;  4R23 A;  5KZH A;  1S67 L;  2X01 A;  1YKD A;  1ALQ A;  3HLD A;  3F1N A;  4ZRR A;  1N9L A;  4GW9 A;  3ITB A;  4WZ5 A;  2HDQ A;  4P6B A;  1MWR A;  4GD8 A;  4L9F A;  2RCX A;  4X69 A;  1NLY A;  3VFH A;  5AQ9 A;  2Y8H A;  3RXW A;  1KGF A;  2M1C A;  2JBF A;  4IBX A;  2QZ6 A;  3MZE A;  1U60 A;  3Q7V A;  3D4F A;  2ZD8 A;  4Y0T A;  1H8Y A;  1N4O A;  1KE3 A;  2Y2G A;  4DXC A;  2EX2 A;  4EEP A;  1YMX A;  3ZNT A;  1ES3 A;  4MEZ A;  4OON A;  4KG6 A;  2Z6C A;  1OTA A;  2X02 A;  1K57 A;  2J3T D;  3CWF A;  4QY5 A;  2V20 A;  1DP9 A;  1MWU A;  4M4X A;  3T12 B;  3G31 A;  3T4J A;  2B95 A;  4X25 A;  4HY8 A;  1DJC A;  2VX8 A;  2INW A;  3FYZ A;  1XFQ A;  4QU3 A;  5I5L A;  1Q2Q A;  3P7N A;  1RCJ A;  1S4S A;  3HUN A;  4S2N A;  4OQH A;  4I3J A;  2OWJ A;  3BFE A;  1KDW A;  3W8K A;  2EWV A;  3WRT A;  3VE3 A;  4WUJ A;  1PNE A;  4XUX A;  1K56 D;  2ZL1 A;  3CI6 A;  3ZG7 B;  4UHU A;  5DKK A;  1S1Z A;  5FAP A;  4PM8 A;  1XJ2 A;  3P98 A;  5DKL A;  5HW3 A;  5GHX A;  1OTE A;  1K55 C;  2DCF A;  4BMW A;  3FG8 A;  2XRN A;  1I2W A;  4DJ3 A;  2B5R A;  5G18 A;  3IS2 B;  1PFL A; 
#chains in the Genus database with same CATH homology
 4I38 A;  2QJ5 A;  3EGX C;  5C5K A;  2J80 A;  2Z6D A;  2HV1 A;  3EEH A;  4R3A A;  4L9G A;  3RFB A;  1TS8 A;  4EES A;  1DP6 A;  4P6Z S;  2G7U A;  2M7U A;  1STZ A;  3PBT A;  4CQH A;  4GLQ A;  3CAX A;  3PR6 A;  5AJG A;  3K3D A;  4K08 A;  4Y3I A;  4G3V A;  2ZMV A;  3NJA A;  4EET B;  2HJE A;  2EWW A;  1TD5 A;  2ZMF A;  2JKR I;  2XA7 S;  1UGU A;  1H3Q A;  4GJ4 A;  1W63 M;  4F3L A;  3IS2 A;  1NLZ A;  2ZOH A;  1EW0 A;  2HJ9 C;  3E4O A;  3MF0 A;  1DRM A;  3VE4 A;  5DFX A;  3T4O A;  2J3T C;  3OBF A;  3UB7 A;  3BW6 A;  1LT0 A;  4HHD A;  2K31 A;  1OTD A;  3BQA A;  4HH3 A;  4WN5 A;  1MKM A;  4YNR A;  4O01 A;  3H82 B;  2W3E A;  3SW1 A;  2PR5 A;  3LIE A;  2J3W A;  4HIA A;  3E4P A;  1JNU A;  4HI4 A;  2WKP A;  5TBM A;  1Y28 A;  4HP4 A;  1N9N A;  1NRJ A;  1XJ3 A;  3TRC A;  1TS0 A;  2XSS A;  4EW7 A;  1H8M A;  3W2Z A;  5HD5 A;  4GS9 B;  2V9A A;  4DN0 A;  3PXP A;  1ZTU A;  2VJW A;  1TS7 A;  3NOU C;  5J7E A;  4EU0 A;  5HZH A;  2PYP A;  4I5S A;  3T4S A;  3MQQ A;  1V9Y A;  3U2A A;  2VV8 A;  2D02 A;  3T4Q A;  3UMD A;  1F98 A;  5IT5 A;  5IS1 A;  3LI8 A;  3UB6 A;  2FH5 A;  4IHQ A;  4EXO A;  3PBR A;  4I3A A;  2O9B A;  3F1O A;  3OLO A;  1P0Z A;  3H7W B;  1T1C A;  3LI9 A;  2GZA A;  4ARZ A;  1LSW A;  2O99 A;  2D01 A;  4HJ6 A;  4Y5F A;  5DF9 A;  2W3F A;  3O5Y A;  2I9V A;  4L9E A;  2MJ6 A;  3PBN A;  3R7W A;  5CX7 A;  2KOI A;  1P9R A;  4DMZ A;  2W3D A;  3F1P A;  3TE8 A;  3UB9 A;  4KUK A;  3PHY A;  2GNX A;  4JGQ A;  4NKP A;  3OCN A;  4R38 A;  3MR0 A;  3KSF A;  3RTY A;  2L4R A;  5HDS A;  4B93 A;  5MC7 A;  4BBU A;  4DJ2 A;  2W0N A;  4CLC C;  3B47 A;  2PHY A;  1T19 A;  4HOI A;  2B18 A;  4GHI A;  2QWS A;  4XT2 A;  4H6J B;  4E04 A;  5HD3 A;  2A24 A;  1OTI A;  4WLA A;  3EEA A;  1DP8 A;  1T18 A;  5G4Z A;  2W1T A;  2O9A A;  4BJP A;  2KX6 A;  3K2N A;  4OOM A;  2PD8 A;  3S7P A;  5KIZ A;  4PHT A;  1VHM A;  3B33 A;  5AVF A;  4IUK A;  4EQ1 A;  1OJG A;  3F1O B;  4O8G A;  3E0Y A;  1LL8 A;  4BBT A;  4MCW A;  2JHE A;  1S1Y A;  4IJG A;  3T4T A;  4NXE A;  3MMH A;  2O0Y A;  3JVV A;  3TW8 A;  2QKP A;  4HJ3 A;  3TJZ C;  4GCZ A;  2R78 A;  1MZU A;  2K7S A;  3KO6 A;  3KSI A;  5G4Y A;  4ETZ A;  4I39 A;  3F1P B;  4UQI S;  3HCY A;  1P97 A;  4HQA A;  2A24 B;  1F5M A;  4R6L A;  3T4K A;  1KOU A;  2HF6 A;  3JVU A;  1F9I A;  5DJT A;  4ETX A;  4Q0H A;  2M7V A;  3G6O A;  5EFW A;  3BJN A;  2V1B A;  3LIF A;  1GSW A;  4JGR A;  1OPX A;  5F6A A;  4CLC E;  5HWV A;  4IUH A;  3IBR A;  2CMN A;  3BWL A;  3LIA A;  4UQI M;  3D3O A;  1T1B A;  1G28 A;  4MN7 A;  2QJ7 A;  3BY8 A;  1VB6 A;  3R4K A;  3GEC A;  1G6O A;  4NEE D;  1MC0 A;  2P08 A;  3NOP C;  4JGP A;  3MFX A;  3A0V A;  3R7W B;  3P01 A;  4WEL A;  3H9W A;  3CUE C;  2VEA A;  3E4Q A;  4NXB A;  2LB9 A;  4PKY A;  3ULF A;  5HSQ A;  3OOV A;  2A2L A;  3K3C A;  3PBQ A;  4BBV A;  4QPR A;  2NUP C;  1D06 A;  1TS6 A;  3MQO A;  1X0O A;  3CIT A;  3EWK A;  3H7W A;  2NUT C;  5HDC A;  1S66 L;  5DJU A;  1YSP A;  2W3G A;  2FZ0 A;  2YKH A;  3VV4 A;  4WEK A;  5F68 A;  1NWZ A;  2B02 A;  2Y79 A;  4CLC D;  1T1A A;  3LYX A;  3B42 A;  1OT6 A;  2K2N A;  2VGL S;  5J4E A;  1D7E A;  1ZHH B;  3CUE A;  5L8M A;  3PBS A;  1ODV A;  3T4L A;  4BWI A;  4EER A;  2BAS A;  1YAX A;  2XA7 M;  1IOU A;  5HWW A;  3GDI A;  3DBA A;  4OOL A;  5A8B A;  3IBJ A;  3MQ0 A;  4YWZ A;  3F1N B;  2HGV A;  2PR6 A;  2QYB A;  1WA9 A;  2IA2 A;  4EEU A;  5J3W A;  4KQD A;  3EQU A;  4ME4 A;  1TF1 A;  3D72 A;  3UME A;  4MN6 A;  4XT2 B;  4CLC A;  2PD7 A;  2W3H A;  1XJ6 A;  2P04 A;  2VKS A;  4Z1W A;  2QHK A;  3LR3 A;  4Q0J A;  1W63 Q;  4GS9 A;  2W27 A;  5HDD A;  4HJ4 A;  4HNB A;  5F69 A;  2WKR A;  4II7 A;  1UWN X;  1N9O A;  3EGD C;  2VLG A;  3KSH A;  2O9C A;  4LRZ E;  5TJJ A;  3OCL A;  3ICY A;  4R70 A;  5HL6 A;  2L1M A;  3VOL A;  4B9O A;  3E98 A;  3LR4 A;  5HPF A;  4G3W A;  1V9Z A;  4I3I A;  2JKR M;  2ZBB A;  5KSH A;  2DMW A;  3MXQ A;  3C30 A;  3PYP A;  4MN5 A;  4WF0 A;  3LIC A;  5FL3 A;  5HPI A;  2KDK A;  2OOL A;  4EUV A;  2PT7 A;  3UB8 A;  4Y2F A;  3UE3 A;  2OAP 1;  3KX0 X;  3KYQ A;  4O0P A;  1IFQ A;  1S67 L;  4LPZ A;  1YKD A;  3HJK A;  2LB5 A;  2PYR A;  3V67 A;  3CLO A;  1LSX A;  3F1N A;  2V0W A;  4ZRR A;  1N9L A;  4GW9 A;  5IU1 A;  3S7O A;  2W1R A;  4LRY C;  3PBO A;  4UEY A;  4MDZ A;  4L0L A;  3S7Q A;  4L9F A;  3A0R A;  3LR5 A;  3HJI A;  1NLY A;  4RQ9 A;  1LSV A;  4G3K A;  4KUO A;  2Y8H A;  3C38 A;  2M1C A;  2VV7 A;  4LLO B;  3LID A;  4FOF A;  3EOI A;  3BY9 A;  2OAQ 1;  5LBR A;  1OT9 A;  2V1A A;  1S4R A;  3FPV A;  4WL9 A;  3KSG A;  2VGL M;  5TBM B;  3LIB A;  3C8C A;  2GX5 A;  4EEP A;  4YOF A;  3LFV A;  2Z6C A;  1OTA A;  3S7N A;  2P7J A;  2L0W A;  2J3T D;  2VV6 A;  4F3L B;  3CWF A;  2OWH A;  1DP9 A;  4M4X A;  2W1T B;  4Q0I A;  3T4J A;  3T50 A;  3RH8 B;  3ZQ5 A;  2H28 A;  2VA0 A;  2EA9 A;  5DFY A;  4HY8 A;  2JN7 A;  3UE6 A;  2VX8 A;  3FC7 A;  2INW A;  4KQO A;  1XFQ A;  2GJ3 A;  5I5L A;  5HWT A;  3P7N A;  1S4S A;  4PAU A;  3NHQ A;  2V0U A;  4ARZ B;  2PDR A;  4AFI A;  5AVE A;  2XRO A;  1OTB A;  4I3J A;  2OWJ A;  3BQ8 A;  3NOT C;  4HP9 A;  2EWV A;  1XJ4 A;  4P6Z M;  4NXG A;  1P9W A;  3VE3 A;  1GSX A;  1BYW A;  1OJ5 A;  4WUJ A;  4PKY G;  3A0S A;  5F5Y A;  3FPW A;  4CLC B;  2VZW A;  3LUQ A;  3CI6 A;  2YKF A;  2KLI A;  3C2W A;  5DKK A;  5K5B A;  4WEJ A;  3OC2 A;  1S1Z A;  1YSQ A;  4MMN A;  1UWP X;  3MJQ A;  4HH2 A;  3H82 A;  2WKQ A;  3LR0 A;  3EQV A;  2ZOI A;  1XJ2 A;  4LRX C;  5DKL A;  3ZYT A;  1XFN A;  1OTE A;  4NXF A;  4H6J A;  4BMW A;  3FG8 A;  4FSF A;  4GHI B;  1GSV A;  2XRN A;  3KYZ A;  4JGO A;  4DJ3 A;  2JKT M;  3IS2 B;  2JKT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...