5F68A

Drosophila melanogaster cycle w398a pas-b with bound ethylene glycol
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
b'MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cycle
publication title Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f68A00
3SW1A 4KQDA 4H6JA 3LIDA 1V9YA 5DJUA 2QHKA 3UB7A 1Y28A 4EETB 5HDSA 2I9VA 2PHYA 4I3AA 5HSQA 3CLOA 4GS9B 2D01A 4R6LA 2GJ3A 3P7NA 5HZHA 2JHEA 1JNUA 3BWLA 1KOUA 1N9OA 4GHIA 1S4RA 2OWHA 2D02A 1UWNX 2H28A 2PDRA 4WF0A 2CMNA 3MFXA 3ULFA 4JGPA 4GCZA 3LYXA 3LIBA 4WL9A 3C8CA 2VV6A 5KIZA 5F69A 3IS2A 3CWFA 1VB6A 4MN5A 3PYPA 1XFNA 4R70A 3NHQA 2V0UA 4HOIA 1T1BA 4NXEA 5TBMB 1T1AA 1D7EA 2VEAA 3UB9A 4WLAA 1T19A 3PHYA 4HNBA 3H82A 4XT2B 3F1OB 1OTDA 3T50A 4I3JA 3MJQA 1LSWA 4L9FA 3BY8A 5HWWA 1S1YA 3RTYA 4HP4A 4F3LA 1F9IA 5J7EA 1N9LA 4L9GA 4NXGA 1XJ2A 2OOLA 2V0WA 4HP9A 2L0WA 1OTEA 1GSXA 5IS1A 3MXQA 2HV1A 2QKPA 3EEHA 4E04A 3GDIA 2ZOHA 1MZUA 3GECA 4GS9A 3E4QA 2ZOIA 4BBUA 1D06A 1BYWA 4I3IA 2INWA 2K7SA 2VV7A 1OTBA 1S67L 5HWTA 1XJ4A 1N9NA 2YKHA 4BBTA 2QJ5A 2OWJA 5G4YA 1P97A 4I38A 3VOLA 5J4EA 1LSXA 3LI8A 1ODVA 5IU1A 3FG8A 4DJ2A 4LRZE 3F1NB 1TS7A 1TS0A 3UE6A 3UMEA 3NOPC 4LLOB 1GSVA 2KDKA 3LIAA 4NXBA 2KX6A 5HD3A 4HI4A 2V9AA 4WN5A 4EEUA 3ICYA 1OT6A 5J3WA 1XJ3A 3RH8B 3VE3A 2VLGA 1TS6A 2PR5A 5TBMA 5DKKA 3C2WA 1NWZA 3UB8A 5F68A 1DP6A 2WKPA 4LRYC 5DJTA 4XT2A 3F1OA 2VV8A 1S4SA 3OLOA 2A24B 4HH2A 4HHDA 1EW0A 4EXOA 2YKFA 2PR6A 4YWZA 1F98A 4HJ3A 3E4PA 3A0SA 4EERA 1LT0A 2PYPA 3K3DA 2P7JA 2R78A 1S66L 2V1AA 4MN6A 1XJ6A 4JGRA 1UWPX 1LL8A 3H7WB 4KUOA 3MQOA 2WKRA 4L9EA 1T1CA 4EEPA 2L1MA 4RQ9A 1G28A 1DP8A 3FC7A 3CAXA 4PKYA 1LSVA 5G4ZA 2W0NA 2V1BA 3F1PB 4PKYG 1OTIA 4HIAA 5I5LA 5AVFA 4GW9A 2B02A 3LIEA 2ZBBA 3BY9A 3F1NA 3HJKA 3VE4A 4H6JB 2EA9A 3MR0A 4R38A 5EFWA 3LIFA 3H9WA 4HQAA 4EQ1A 3NOTC 3UMDA 4NXFA 1UGUA 2JN7A 1P0ZA 1OT9A 1V9ZA 4EESA 2PD8A 1WA9A 3NJAA 3IBRA 2QWSA 3LI9A 2PYRA 1TS8A 4KUKA 2M1CA 3KX0X 4GHIB 2BASA 3LUQA 5DKLA 4LRXC 2WKQA 4WUJA 2Z6CA 4I39A 2A24A 4M4XA 4BBVA 2QJ7A 4DJ3A 4LPZA 4I5SA 4HJ4A 3LICA 2L4RA 1DP9A 5HDCA 1DRMA 5HWVA 3IS2B 2J80A 1OJ5A 4JGOA 3E4OA 5HD5A 3EWKA 3MQQA 3H7WA 2PD7A 4HJ6A 5A8BA 1T18A 3A0VA 3G6OA 4EW7A 3D72A 2W27A 3H82B 5F5YA 3HJIA 1XFQA 3NOUC 1OTAA 3F1PA 1GSWA 4K08A 4HH3A 1OJGA 3ZQ5A 4HY8A 4R3AA 3K3CA 3UB6A 4JGQA 5F6AA 5AVEA 5HDDA 1X0OA 1S1ZA 4B9OA 2Z6DA 4F3LB 3A0RA 3B33A
chains in the Genus database with same CATH superfamily
1TDGA 4KQDA 4ZRRA 2Q9MA 1FR1A 4FD8A 5U47A 3LO7A 1V9YA 3JVVA 3G35A 3SH8A 3T1SA 3IT9A 5HDSA 1YLWA 3N8SA 3LY3A 2HP6A 2RL3A 4U0TA 4NETA 5JYPA 3UNWA 3CLOA 4KQQA 2ZC4B 2Y2HA 4LV3A 4MEZA 4IBRA 4S2MA 5HZHA 4JBFA 2W1RA 2JHEA 3OPPA 3KYEA 3BWLA 4JF5A 4KZ3A 4ARZB 2WADA 4GD8A 3WRTA 4R0QA 1FCNA 4L0LA 1G68A 3LIBA 4Q0IA 4WL9A 1NRJA 5M18A 4KQRA 4EUVA 4GB7A 3O87A 5DFYA 5EUAA 5F69A 1IOUA 3UPNA 4E3LA 4MN5A 4WMCA 3C7UA 3GR2A 3IXHA 4DXBA 3SH7A 3LGOA 1STZA 3FYZA 2BLSA 5EM0A 3VP0A 3D4FA 4NXEA 1S6RA 5TBMB 4CLCB 4ETXA 1T1AA 4ESPA 1WYCA 1T19A 4LV2A 3PHYA 1BLCA 2JC7A 5BOHA 3ITAA 1FILA 3ZG8B 4YNRA 2HDQA 3F1OB 4KG5A 4QWOA 5FEGA 2QYBA 4DE2A 4P87A 4L9FA 1VQQA 3A3IA 2PBYA 5HWWA 1O7EA 4HP4A 4F3LA 1F9IA 3PBNA 1ES5A 5TFQA 4L9GA 4NXGA 2OOLA 4DMZA 3W8KA 1GSXA 3QP8A 4DKIA 3JPUA 2WAEA 5CX7A 5FQKA 2ZQ9A 1KDSA 3EEHA 4P0MA 4E04A 1CJFA 5LBRA 1MZUA 1KGFA 5M1AA 4WEKA 3W4OA 4S2LA 2XA7M 1BYWA 4XXRA 1MBLA 2G2WA 4AFIA 5CEDA 2INWA 2K7SA 5DFXA 4E6XA 1IYOA 3AGFA 1ES2A 1JTGA 4BBTA 4PM8A 2G2UA 5G4YA 3W4PA 4S2IA 3NECA 2ZJ9A 3FG8A 3G4PA 5GLAA 4K0WA 4WMCD 2K31A 2HDSA 3IXGA 4NK3A 2PAVP 3DTMA 3NOPC 5FQJA 4ZAMA 4MBKA 1L0FA 2KDKA 3LR5A 3VFHA 4ZDXA 1FCOA 3Q07A 4HI4A 1CF0A 2BG1A 1C3BA 2ZC5B 2PT7A 4LCMA 2VA0A 1OT6A 5KMWA 2FFYA 2IA2A 1KE4A 1TF1A 3MF0A 1NWZA 5CTNA 3UB8A 1CI8A 4LV1A 4XT2A 4OLDA 3RXWA 1S4SA 1TVFA 1YSPA 4NEED 1EW0A 3HUMA 2FZ0A 3V3SA 3E4PA 3G30A 1ALQA 2J9OA 2V1AA 4BENA 2QPNA 5A90A 1XJ6A 4JKTA 1FIKA 2I72A 3I7JA 2ZMAA 1Z6FA 2P74A 3V67A 3UO9A 3EOIA 1YLJA 1L0EA 4C75A 1H8MA 1I2WA 2WKRA 5KZHA 1G6AA 1SZVA 3QNCA 3NBLA 2R9WA 2EX8A 4YFMA 2ZQAA 3CAXA 3UPPA 3N8RA 3S4XA 5E2GA 3NIAA 4H8RA 5E2HA 3A3EA 4X1MA 2EX9A 2HP5A 4WZ5C 3F1PB 2C6WB 2RCXA 4OQ0A 1CEFA 4S2NC 2HGVA 2Y2GA 3LR3A 2J3TD 4KZ7A 2FFFB 1MKIA 1HD8A 2B02A 1ONGA 4HBUA 1E3UA 3V5MA 2V1ZA 5DF9A 3BY9A 1I5QA 2WGIA 2PRFA 4HESA 4RA7A 4H6JB 5C5KA 2ZL1A 4LV0A 4E3OA 3IH9A 3HBRA 1A0KA 3MBZA 1LI9A 1PWGA 3LIFA 4EQ1A 4IVIA 3UMDA 3C4OA 3KSHA 2G7UA 4FCFA 3BECA 1V9ZA 4KZ8A 2M7UA 1KVMA 3TW8A 5DTKA 1Y4OA 3S7QA 2XK1A 2Y2IA 3LFVA 3B47A 3OPRA 2IWDA 3W4QA 1BLHA 1ACFA 2WZZA 4II7A 5DKLA 1JVJA 1NJ4A 3N4IA 5FQIA 2VZWA 4WBGA 4WZ5A 4DE3A 2L4RA 3Q7ZA 3EQUA 4S2NA 5EVLA 2MJ6A 3L7HA 3FKWA 1L0GA 1OJ5A 2IWBA 3E4OA 3PBRA 2W1TA 3H7WA 3Q7VB 4KZ6A 5FDHA 2PD7A 4HJ6A 4UQIM 4LGWA 3MKEA 3NULA 4PM9A 4R4SA 4OPRA 4A5RA 5EOOA 3HJIA 2M7VA 5L07A 4IVKA 1E3UD 4K08A 3SOIA 3FKVA 4ZJ2A 1O07A 4MBHA 5L2FA 5HDDA 1ES4A 5DVAA 3ZVWA 5CRFA 5HFOA 4D2OA 2W3HA 3R4KA 4B9OA 1CI9A 1NZUA 1YKDA 1Q2QA 3A3FA 4Y7PA 4DE0A 2Y8HA 3UB5P 1J9MA 5DJUA 2QHKA 4WM9A 1Y28A 3BQ8A 1PI5A 3IH8A 2OSUA 4I3AA 4KQOA 3FPVA 5AQAA 1NYYA 5HSQA 3ZG9B 4O01A 3G2YA 1IEMA 4OLGA 3OPLA 1ONHA 3VV4A 2Y79A 2ZMFA 4OKPA 1W63M 4IUKA 3PBSA 2JKTI 4P6ZM 3KO6A 4ME4A 4GHIA 2Y4AA 2O0YA 4R3JA 2D02A 5AQ7A 1UWNX 2H28A 2PDRA 1ZKJA 2P9VA 3HUOA 3L9KA 1L2SA 3CUEC 3ULFA 3LYXA 2B95A 3UDFA 3S1YA 1TEMA 3ZDJA 5F83A 4OH0A 1SHVA 3T4QA 3CWFA 2X02A 3PYPA 1FR6A 4BJPA 3NHQA 3LEQA 2Y2QA 1IFQA 4OP5A 3DTKA 3G2ZA 4X53A 3K2NA 3GTCA 4WLAA 3UB9A 4P6ZS 3CI6A 4MDZA 4OOLA 3Q81A 3GSGA 4KZ4A 4EBLA 4I3JA 3WS5A 1LSWA 3SS4A 4QPRA 1S1YA 5JYOA 3CPTA 5TJJA 5GLBA 4YOFA 2AVXA 1KVLA 2FH5A 4GOGA 4HP9A 3HCYA 1SKOB 3M6BA 5IS1A 4X25A 3E0YA 3MXQA 1PIOA 2BTFP 1MY8A 3OBFA 5I94A 3ZG7B 3GDIA 3GECA 5HAPA 1VETA 4GS9A 3E4QA 4KZ5A 2O9BA 2VX8A 2DRWA 3O5YA 3UE1A 1XXMA 3HUNA 3ZFZA 4Y2FA 2VV7A 5DF8A 4Y0TA 1EI5A 1OTBA 3OPHA 1S67L 5HWTA 1PRQA 2W3FA 1XJ4A 3MZFA 2J9PA 2VGKA 4O8GA 2YKHA 3QP4A 5E2EA 2QJ5A 4I38A 3QP2A 4CQHA 1H8YA 5AJGA 3VOLA 2HZ5A 2E8JA 5EVIB 1IKIA 4DJ2A 2LB9A 4X6TA 1DJAA 1Z09A 1ZC2A 5EV0A 2NUPC 3HLFA 1SCWA 4XUXA 3UMEA 2R9XA 1OMEA 4EUZA 2B18A 3LIAA 4NXBA 5HD3A 2H0TA 3ICYA 1VHMA 2W3DA 4OQHA 3PBQA 1YLPA 3T4JA 1K54C 4KZAA 1AXBA 5CGSA 3VE3A 1BULA 1OPXA 3IF6C 1TS6A 4Y13A 5DKKA 4OOMA 2JKTM 3VOZA 3DWZA 3NI9A 5KSHA 1ESUA 3LR0A 5F68A 5A92A 2UV0E 5FAQA 5FI2A 3ZVTA 2OAP1 3VSLA 1VM1A 2A24B 4HHDA 4EXOA 1F98A 4HJ3A 1BZAA 2WKHA 2VGLM 2PYPA 3K3DA 4UAAA 4IEDA 2R78A 1XA1A 1VEUB 1K4EA 2GNXA 3HLEA 5CERA 4MN6A 3GRJA 4Y17A 1UWPX 1YT4A 1LL8A 1PW1A 3V50A 1IKGA 2O99A 1HZOA 2XDMA 2HDUA 3CG5A 4KUOA 3ZNYA 3VP1A 1H5XA 1G28A 4XUZA 1DP8A 3FC7A 3MS6A 4PKYA 1LSVA 1PZPA 2E8IA 4S2PA 4JXGA 2O9AA 2B5RA 1FOFA 3BYDA 3V3RA 2HDRA 2WGWA 1M6KA 2V20A 5AVFA 1HLUP 4BWIA 3M2JA 2VGLS 4EWFA 3F1NA 3KYQA 5HPIA 1LI0A 4PAUA 5DTSA 2EA9A 4Z1WA 3MR0A 1H3QA 4RYEA 4Y3IA 4M3KA 4HQAA 3LY4A 3CZDA 4RX3A 1QMFA 4NXFA 2PBDP 3GVBA 2JN7A 2XQZA 2JCHA 1EROA 1AWIA 3IWOA 2PD8A 4EESA 3BFFA 3FWLA 4KG2A 1WA9A 3IBRA 4KZBA 1NYMA 1PNEA 1PWDA 4R4RA 3LEZA 5FA7A 2BASA 2ZLYA 4YINA 4ZJ1A 3BM6A 1NXYA 3LUQA 4LRXC 1ERMA 2CC1A 4BBVA 5AQBA 3ZCZA 1GHIA 1K57C 2QJ7A 4F94A 4OONA 2XD1A 1DP9A 5EM1A 3MMHA 5HWVA 1YMSA 4JXWA 1IYSA 2ZM8A 1YMXA 2K2NA 3TG9A 3S7OA 3QP1A 1PW8A 3N8LA 3G34A 4G3WA 2WKIA 1DJBA 3VP3A 3FV7A 3EGXC 1CK3A 2Y2KA 3ZGAB 1ZG6A 3G6OA 3NDEA 3S7PA 3LR4A 5TR7A 3TRCA 1CEGA 1XFQA 1MWUA 3NOUC 3GQZA 4HH3A 1K0KA 4MBFA 4Y0UA 3QHYA 3NCKA 1PFLA 4KZ9A 4Q0JA 2NUTC 4OP8A 1FSYA 4IUHA 5FL3A 4F3LB 2PU4A 3R7WA 4IBXA 4O7DA 1MXOA 3W2ZA 5GLDA 4GLQA 3BFDA 1K57A 3UB7A 1J3WA 3WS4A 1I2SA 3UPOA 2PHYA 4UHUA 3BFEA 2Y2LA 1XPBA 2XROA 3MZDA 4R6LA 3LCEA 3G31A 3ZG5A 3UY6A 1PI4A 3NDGA 4B88A 4Y0OA 1LHYA 1JNUA 1N9OA 1TD5A 2WGWB 3E2LA 3KSGA 5L8MA 5FASA 4JLFA 4DN0A 2CMNA 1D1JA 1RGZA 3WS0A 4JGPA 3T1QB 2H5SA 4ETZA 3IQAA 5FSRA 2EXAA 4S2KA 4BQMA 4GN2A 4JXSA 3BEBA 1PWCA 3CJMA 3IS2A 1VB6A 3SH9A 2XLNA 1K4FA 2EXBA 5CXWA 4ZJ3A 3N7WA 4DDYA 1EWZA 1T1BA 3TE8A 3D3OA 5HPFA 4DF6A 2VEAA 4Y15A 3H82A 3A3JA 2X71A 5F1FA 4IHQA 2EFUA 4XT2B 1OTDA 1XA7A 2A3UA 3DWKA 3T50A 4GDBA 2XRNA 3IF5A 3BY8A 4MLLA 1K55C 3RTYA 3GV9A 3E98A 1DY6A 2HJ9C 5GHYA 2Q0OA 4LENA 4IJGA 5J7EA 2OLVA 4OPQA 3MXRA 2V0WA 2JE5A 2XGNA 3IX8A 4PM7A 1OTEA 1W7FA 5IT5A 4N1XA 4CLCC 2ZQDA 4P85A 2J7VA 4N92A 4X1LA 3BW6A 5HW3A 5K5BA 4FOFA 3P09A 2ZOIA 1GA9A 4BBUA 1ESIA 4WYYA 3P98A 4I3IA 1XKZA 4E3NA 4OVDA 3O3VA 1LLBA 4PM5A 2V2FF 2WAFA 5DF7A 1KDWA 4ARZA 3BQAA 1BLPA 2EX6A 4GD6A 2H10A 4RX2A 3R7WB 1P97A 5G18A 2WYXA 3EGDC 1CQAA 5J4EA 5GHZA 1WE4A 1BSGA 2JKGA 5IU1A 2A2LA 2KLIA 2Z2LB 4LRZE 2HPBA 1TS7A 1TS0A 3ZG0A 2ZMVA 3ISGA 2ZL1B 1DJCA 2XD5A 3IX4A 2Y55A 1K6SA 4X56A 1GSVA 2P04A 1K55A 4S2OA 4OQGA 3PAGA 1BLSA 3UDXA 4P6BA 5J3WA 3RH8B 5CGXA 3PAEA 2VLGA 4K91A 5TBMA 4CLCA 2Y2NA 5DJTA 3F1OA 4DE1A 2JKRI 5CTMA 5KSCA 5HX9A 4HH2A 1N4OA 2PR6A 2YKFA 4MNRA 4YWZA 2ZM2A 3PXPA 1YLZA 4FH4A 3WS1A 1MWSA 3MQ0A 1LT0A 2XEPA 2LB5A 3P01A 1IELA 2P7JA 1S66L 3JVUA 3OCNA 1XP4A 1F5MA 1L0DA 2Y2PA 4E3MA 1MWRA 1K56A 2WGVA 3E2KA 4JGRA 4N9KA 2W1TB 1S0WA 3H7WB 4NKPA 2A49A 2IWCA 4GDNA 1RGYA 3VMAA 3MQOA 2XF3A 3CUEA 4L9EA 4O0PA 4EEPA 2Q9NA 2L1MA 4U0XA 3IXBA 3BLSA 3U2AA 2HJEA 3ZHHA 3D9YA 3KSIA 4E3IA 1U60A 2WUQA 5G4ZA 3TJZC 2W0NA 2OLUA 2V1BA 3WRZA 1SDEA 3NY4A 4R23A 1FCMA 4JXVA 2VJWA 4HIAA 5I5LA 4UA6A 5CHJA 3FZCA 3N6IA 1ES3A 1MPLA 4Z9QA 2DNSA 3PR6A 2XFSA 3B42A 3HJKA 2W3GA 3TSGA 5EOEA 3VE4A 3QNBA 3WWXA 4PMAA 3SS3A 3VOYA 4JF6A 4K0XA 5D3OA 1M40A 4JF4A 3H9WA 4CLCD 2XH9A 4NG2A 1UGUA 1GA0A 4KENB 4PPRA 4E6WA 1P0ZA 4BLMA 1OT9A 5IHVA 5GLCA 2QWSA 3LI9A 1RP5A 4QU3A 4KUKA 1JTDA 1KGEA 1ZG4A 4GHIB 3SS5A 1E4DA 2P9VB 1HVBA 1K38A 1NRFA 4EV4A 4FTXA 3FPWA 4BMWA 3T1RA 1K56D 4DJ3A 4LPZA 1JWVA 4I5SA 5J8XA 5HDCA 2Z2MB 3PBOA 5DTTA 2EFXA 4RVAA 4GZBA 2Y2JA 4CJNA 3MQQA 1NLZA 1E25A 3VFFA 4CLCE 3MSHA 4QD4A 3MZEA 5CGWA 1K6RA 3C38A 2ZC7A 3CITA 5A8BA 1ZHHB 4X55A 2C5WB 3OOVA 1T18A 3M6HA 3A0VA 3Q1FA 3OZHA 4QY5A 2J3TC 3D72A 2ZD8A 3HLGA 4S2JA 1PZOA 4DRTA 5M19A 3F1PA 4WEJA 2JKRM 1OJGA 3ZQ5A 3C5AA 3K3CA 4FSFA 4N9LA 3UB6A 5F6AA 5AVEA 1X0OA 5CEBA 4N1HA 1K54A 3TOIA 3CPTB 3Q82A 3HLWA 4X68A 3BFGA 3IF6A 4QJGA 3SW1A 3AGEA 2EX2A 2GZAA 3DTIA 4H6JA 3UE3A 3LIDA 1N9BA 4LFUA 4FUWA 3HVFA 4B93A 4ZBEA 3S7NA 3O88A 4EETB 2I9VA 5FDSA 5CECA 1YM1A 1VETB 1H0MA 4GS9B 2D01A 1XX2A 2GJ3A 4EQIA 3P7NA 1HTZA 3T4LA 5FQ9A 1KOUA 3HLBA 4QHCA 1JWPA 2Y2OA 1S4RA 2OWHA 3RXXA 4C3QA 1Y54A 4LCLA 5FI6A 4MCWA 4WF0A 4EU0A 1KE3A 3IX3A 3MFXA 1W79A 4GCZA 4OPZA 5TGFA 4OQIA 3T12B 3EQVA 5E2FA 3C8CA 3HL9A 1F2KA 2VV6A 5KIZA 4KG6A 1TDLA 2XA7S 5FQMA 5HARA 1GHPA 1XFNA 4R70A 3Q7VA 1GHMA 5L10A 1FSWA 2V0UA 4X69A 1W8QA 5FAPA 4HOIA 4MMNA 5CHMA 4QB8A 2J3WA 3MXSA 2ACGA 4U3TA 3M2KA 2UWXA 4Y5FA 1D7EA 3S22A 2VKSA 2XSSA 5HAQA 3QP6A 4HNBA 3UDIA 3ITBA 4UEYA 5L09A 1LL9A 3UE0A 4QY6A 4MN7A 4C6YA 4EBPA 3MJQA 4HBTA 3O86A 1MWTA 3GMWA 2GX5A 5F1GA 4CPKA 1N9LA 2VK3A 1L3LA 1XJ2A 1NY0A 2DCFA 2L0WA 1K25A 1WYBA 2OAQ1 2EWVA 2O9CA 2GDNA 2HV1A 4UA9A 3T4OA 2QKPA 2KOIA 2W3EA 5GHXA 2ZOHA 2JKFA 1JWZA 1YLYA 5FATA 1D06A 2WZXA 4BL2A 3CHWP 3C7VA 5A93A 3SZTA 4OPYA 1N9NA 3DTEA 4E3JA 2ZC6B 3IF6B 2ZQ7A 3PBTA 1IYPA 2OWJA 1LSXA 3LI8A 2H0YA 1IYQA 1ODVA 3C30A 3HLCA 1GCEA 1H8ZA 3VSKA 4OOYA 4Q8IA 3F1NB 3DAVA 3UE6A 2WKEA 3RFBA 3BRMA 4LLOB 3B3XA 5FEFA 2Y91A 2KX6A 2VGJA 2V9AA 4WN5A 4EEUA 1QMEA 3WS2A 1LL5A 1XJ3A 4DDSA 5HAIA 4G3KA 2V8FA 2J8YA 4BD0A 3G32A 3MKFA 2ZM0A 2PR5A 3C2WA 4GJ4A 3VP4A 5FQQA 1YQSA 5EVIC 1XGIA 1DP6A 2WKPA 4LRYC 3IBJA 2XR0A 3C4PA 2VV8A 4ID4A 4B4ZA 3OLOA 2QZ6A 3EEAA 3IXDA 3HLDA 3A0SA 3DBAA 4EERA 1NLYA 1W5DA 1YAXA 3UN7A 3U4LP 4JPMA 5EVEA 3V39A 3QP5A 3ZNTA 1SKOA 3ZYTA 3CMZA 4HEFA 1BUEA 2ZQCA 5MC7A 3BFCA 1T1CA 3RJUA 4RQ9A 1MKMA 2HP9A 3NC8A 3MFDA 4UA7A 5HL1A 5F82A 2DMWA 2EWWA 1BT5A 3T1XA 1KE0A 3PTEA 4PKYG 1OTIA 3T4TA 1G5UA 4GW9A 3LIEA 5EVIA 2ZBBA 4GKUA 4G3VA 2XFTA 2PU2A 4DXCA 3DW0A 3IWQA 5FI7A 4UQIS 4BD1A 3OCLA 4R38A 5A91A 5EFWA 1XGJA 4WZ4A 3NOTC 2HF6A 1SDNA 5AQ9A 3BLMA 1SKFA 5CHUA 2ZC3B 3NJAA 1NZOA 2PYRA 1P9RA 4GNUA 1TS8A 2M1CA 4FH2A 4E3KA 3KX0X 1YLTA 3BJNA 1G6OA 1Q2PA 1ZTUA 2QMIA 3T4SA 4BL3A 2WK0A 2WKQA 4WUJA 2Z6CA 4I39A 5E43A 4R1GA 2A24A 4M4XA 2OV5A 2Y59A 1P9WA 4R3BA 3JYIA 4HJ4A 3LICA 4ZTKA 1DRMA 1ERQA 1VEUA 5EECA 3HREA 3IS2B 2J80A 3AGDA 4Q0HA 4PHTA 4JGOA 5HD5A 3EWKA 4B4XA 1FQGA 1BTLA 3IHAA 3OC2A 2ZQ8A 2Y2MA 5FAOA 1YSQA 3VP2A 5EPHA 3A3DA 1MC0A 4PM6A 3KSFA 1PYYA 5EE8A 1RCJA 1KGGA 1W63Q 4EW7A 4EBNA 3IWIA 2W27A 3KYZA 3H82B 5F5YA 1OTAA 1GSWA 5EVID 3T4KA 4HY8A 3IHBA 4R3AA 4JGQA 2X01A 2V8CA 4D60A 5HL6A 2P08A 1S1ZA 4WELA 1YPRA 1W8YA 2JBFA 5GL9A 2Z6DA 3A0RA 3B33A
chains in the Genus database with same CATH topology
3R7WA 3SW1A 4KQDA 2GZAA 1YKDA 4ZRRA 4H6JA 3UE3A 3LIDA 1V9YA 3W2ZA 3JVVA 4GLQA 2Y8HA 5DJUA 2QHKA 3UB7A 4B93A 3S7NA 1Y28A 3BQ8A 4EETB 5HDSA 2I9VA 2PHYA 4I3AA 4KQOA 3FPVA 5HSQA 4O01A 3CLOA 2XROA 4GS9B 2D01A 4R6LA 3VV4A 2Y79A 2ZMFA 2GJ3A 1W63M 4IUKA 3P7NA 5HZHA 2W1RA 2JHEA 3PBSA 3T4LA 1JNUA 3BWLA 1KOUA 1N9OA 2JKTI 4P6ZM 1TD5A 3KO6A 4ME4A 4GHIA 4ARZB 3KSGA 5L8MA 1S4RA 2O0YA 2OWHA 2D02A 1UWNX 2H28A 2PDRA 4DN0A 4MCWA 2CMNA 4WF0A 4EU0A 3MFXA 3CUEC 3ULFA 4JGPA 4L0LA 4GCZA 3LYXA 4ETZA 3LIBA 4Q0IA 4WL9A 1NRJA 4EUVA 3EQVA 3C8CA 2VV6A 5KIZA 5DFYA 5F69A 3IS2A 3T4QA 1IOUA 3CWFA 1VB6A 2XA7S 4MN5A 3PYPA 4BJPA 1XFNA 4R70A 3NHQA 2V0UA 1STZA 1IFQA 4HOIA 1T1BA 4MMNA 3TE8A 2J3WA 3D3OA 4NXEA 5HPFA 5TBMB 4CLCB 4ETXA 4Y5FA 1T1AA 3K2NA 1D7EA 2VEAA 4WLAA 3UB9A 1T19A 4P6ZS 2VKSA 2XSSA 3CI6A 3PHYA 4MDZA 4HNBA 3H82A 4UEYA 4IHQA 4OOLA 4XT2B 4YNRA 3F1OB 1OTDA 4MN7A 4I3JA 3T50A 3MJQA 2QYBA 2XRNA 1LSWA 4L9FA 3BY8A 5HWWA 4QPRA 1S1YA 2GX5A 3RTYA 5TJJA 4YOFA 4HP4A 3E98A 4F3LA 1F9IA 3PBNA 2HJ9C 2FH5A 5J7EA 4IJGA 1N9LA 4L9GA 4NXGA 1XJ2A 2OOLA 2V0WA 3HCYA 4HP9A 2L0WA 4DMZA 1OTEA 1GSXA 5IS1A 3E0YA 2OAQ1 2EWVA 3MXQA 5IT5A 2O9CA 4CLCC 2HV1A 5CX7A 3T4OA 3OBFA 2QKPA 3EEHA 2KOIA 2W3EA 4E04A 3GDIA 3BW6A 5LBRA 5K5BA 2ZOHA 1MZUA 4FOFA 3GECA 4GS9A 3E4QA 2ZOIA 4WEKA 4BBUA 1D06A 2XA7M 2O9BA 2VX8A 1BYWA 4AFIA 3O5YA 4I3IA 2INWA 2K7SA 5DFXA 4Y2FA 2VV7A 1OTBA 1S67L 5HWTA 2W3FA 1XJ4A 1N9NA 4ARZA 3BQAA 4O8GA 2YKHA 3PBTA 4BBTA 2QJ5A 2OWJA 3R7WB 5G4YA 1P97A 4I38A 3EGDC 4CQHA 3VOLA 5AJGA 5J4EA 1LSXA 3LI8A 1ODVA 5IU1A 3C30A 3FG8A 2A2LA 2KLIA 4DJ2A 2LB9A 2NUPC 4LRZE 3F1NB 1TS7A 1TS0A 2K31A 2ZMVA 3UE6A 3UMEA 3NOPC 3RFBA 4LLOB 1GSVA 2P04A 2KDKA 3LR5A 2B18A 3LIAA 4NXBA 2KX6A 5HD3A 4HI4A 2V9AA 4WN5A 4EEUA 3ICYA 1VHMA 2W3DA 2PT7A 2VA0A 1OT6A 3PBQA 5J3WA 3T4JA 1XJ3A 3RH8B 3VE3A 4G3KA 2VLGA 1OPXA 2IA2A 1TS6A 1TF1A 2PR5A 3MF0A 5TBMA 5DKKA 4CLCA 3C2WA 4GJ4A 4OOMA 1NWZA 2JKTM 3UB8A 5KSHA 3LR0A 5F68A 1DP6A 2WKPA 4LRYC 3IBJA 5DJTA 4XT2A 3F1OA 2JKRI 2OAP1 2VV8A 1S4SA 1YSPA 3OLOA 4NEED 2A24B 4HH2A 4HHDA 1EW0A 4EXOA 2YKFA 2PR6A 3EEAA 1F98A 4YWZA 3PXPA 4HJ3A 2FZ0A 3E4PA 3A0SA 3DBAA 4EERA 1NLYA 3MQ0A 1LT0A 2VGLM 2PYPA 2LB5A 3P01A 3K3DA 2P7JA 1YAXA 2R78A 2GNXA 1S66L 3JVUA 3OCNA 2V1AA 1F5MA 4MN6A 1XJ6A 3ZYTA 3V67A 4JGRA 1UWPX 3EOIA 2W1TB 1LL8A 3H7WB 4NKPA 2O99A 1H8MA 4KUOA 3MQOA 5MC7A 2WKRA 3CUEA 4L9EA 4O0PA 1T1CA 4EEPA 2L1MA 3U2AA 4RQ9A 2HJEA 1G28A 1MKMA 1DP8A 3FC7A 3KSIA 3CAXA 4PKYA 1LSVA 5G4ZA 3TJZC 2O9AA 2W0NA 2V1BA 3F1PB 2DMWA 2EWWA 4PKYG 1OTIA 2VJWA 4HIAA 5I5LA 2HGVA 3T4TA 3LR3A 2J3TD 5AVFA 4GW9A 2B02A 3LIEA 2ZBBA 3PR6A 4BWIA 5DF9A 2VGLS 3BY9A 3F1NA 3KYQA 4G3VA 3B42A 3HJKA 2W3GA 5HPIA 3VE4A 4H6JB 4PAUA 5C5KA 2EA9A 4Z1WA 4UQIS 3MR0A 3OCLA 4R38A 1H3QA 4Y3IA 5EFWA 3LIFA 3H9WA 4HQAA 4EQ1A 3NOTC 2HF6A 3UMDA 4CLCD 4NXFA 1UGUA 3KSHA 2JN7A 2G7UA 1P0ZA 1OT9A 1V9ZA 2M7UA 4EESA 2PD8A 1WA9A 3NJAA 3IBRA 2QWSA 3TW8A 3LI9A 2PYRA 1P9RA 1TS8A 4KUKA 2M1CA 3S7QA 3KX0X 3LFVA 4GHIB 3B47A 3BJNA 2BASA 1G6OA 1ZTUA 3FPWA 3T4SA 3LUQA 4II7A 4LRXC 5DKLA 2WKQA 4WUJA 2Z6CA 4I39A 4BMWA 2A24A 4M4XA 4BBVA 1P9WA 2VZWA 2QJ7A 4DJ3A 4LPZA 4I5SA 4HJ4A 3LICA 2L4RA 1DP9A 5HDCA 3MMHA 3EQUA 3PBOA 1DRMA 5HWVA 2MJ6A 3IS2B 2J80A 4Q0HA 1OJ5A 4JGOA 4PHTA 3E4OA 3PBRA 5HD5A 3EWKA 2K2NA 2W1TA 3MQQA 1NLZA 3H7WA 3S7OA 4CLCE 2PD7A 4HJ6A 4UQIM 3OC2A 4G3WA 3C38A 1YSQA 3EGXC 3CITA 1MC0A 3KSFA 1ZHHB 5A8BA 3OOVA 1W63Q 1T18A 3A0VA 3G6OA 3S7PA 4EW7A 2J3TC 3D72A 3LR4A 2W27A 3KYZA 3TRCA 3H82B 5F5YA 3HJIA 2M7VA 1XFQA 3NOUC 1OTAA 3F1PA 4WEJA 1GSWA 4K08A 2JKRM 4HH3A 3T4KA 1OJGA 3ZQ5A 4HY8A 4R3AA 3K3CA 4FSFA 3UB6A 4JGQA 5F6AA 5AVEA 5HDDA 1X0OA 5HL6A 2P08A 4Q0JA 2NUTC 1S1ZA 4WELA 2W3HA 3R4KA 4IUHA 4B9OA 5FL3A 2Z6DA 4F3LB 3A0RA 3B33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW1 A;  4KQD A;  4H6J A;  3LID A;  1V9Y A;  5DJU A;  2QHK A;  3UB7 A;  1Y28 A;  4EET B;  5HDS A;  2I9V A;  2PHY A;  4I3A A;  5HSQ A;  3CLO A;  4GS9 B;  2D01 A;  4R6L A;  2GJ3 A;  3P7N A;  5HZH A;  2JHE A;  1JNU A;  3BWL A;  1KOU A;  1N9O A;  4GHI A;  1S4R A;  2OWH A;  2D02 A;  1UWN X;  2H28 A;  2PDR A;  4WF0 A;  2CMN A;  3MFX A;  3ULF A;  4JGP A;  4GCZ A;  3LYX A;  3LIB A;  4WL9 A;  3C8C A;  2VV6 A;  5KIZ A;  5F69 A;  3IS2 A;  3CWF A;  1VB6 A;  4MN5 A;  3PYP A;  1XFN A;  4R70 A;  3NHQ A;  2V0U A;  4HOI A;  1T1B A;  4NXE A;  5TBM B;  1T1A A;  1D7E A;  2VEA A;  3UB9 A;  4WLA A;  1T19 A;  3PHY A;  4HNB A;  3H82 A;  4XT2 B;  3F1O B;  1OTD A;  3T50 A;  4I3J A;  3MJQ A;  1LSW A;  4L9F A;  3BY8 A;  5HWW A;  1S1Y A;  3RTY A;  4HP4 A;  4F3L A;  1F9I A;  5J7E A;  1N9L A;  4L9G A;  4NXG A;  1XJ2 A;  2OOL A;  2V0W A;  4HP9 A;  2L0W A;  1OTE A;  1GSX A;  5IS1 A;  3MXQ A;  2HV1 A;  2QKP A;  3EEH A;  4E04 A;  3GDI A;  2ZOH A;  1MZU A;  3GEC A;  4GS9 A;  3E4Q A;  2ZOI A;  4BBU A;  1D06 A;  1BYW A;  4I3I A;  2INW A;  2K7S A;  2VV7 A;  1OTB A;  1S67 L;  5HWT A;  1XJ4 A;  1N9N A;  2YKH A;  4BBT A;  2QJ5 A;  2OWJ A;  5G4Y A;  1P97 A;  4I38 A;  3VOL A;  5J4E A;  1LSX A;  3LI8 A;  1ODV A;  5IU1 A;  3FG8 A;  4DJ2 A;  4LRZ E;  3F1N B;  1TS7 A;  1TS0 A;  3UE6 A;  3UME A;  3NOP C;  4LLO B;  1GSV A;  2KDK A;  3LIA A;  4NXB A;  2KX6 A;  5HD3 A;  4HI4 A;  2V9A A;  4WN5 A;  4EEU A;  3ICY A;  1OT6 A;  5J3W A;  1XJ3 A;  3RH8 B;  3VE3 A;  2VLG A;  1TS6 A;  2PR5 A;  5TBM A;  5DKK A;  3C2W A;  1NWZ A;  3UB8 A;  5F68 A;  1DP6 A;  2WKP A;  4LRY C;  5DJT A;  4XT2 A;  3F1O A;  2VV8 A;  1S4S A;  3OLO A;  2A24 B;  4HH2 A;  4HHD A;  1EW0 A;  4EXO A;  2YKF A;  2PR6 A;  4YWZ A;  1F98 A;  4HJ3 A;  3E4P A;  3A0S A;  4EER A;  1LT0 A;  2PYP A;  3K3D A;  2P7J A;  2R78 A;  1S66 L;  2V1A A;  4MN6 A;  1XJ6 A;  4JGR A;  1UWP X;  1LL8 A;  3H7W B;  4KUO A;  3MQO A;  2WKR A;  4L9E A;  1T1C A;  4EEP A;  2L1M A;  4RQ9 A;  1G28 A;  1DP8 A;  3FC7 A;  3CAX A;  4PKY A;  1LSV A;  5G4Z A;  2W0N A;  2V1B A;  3F1P B;  4PKY G;  1OTI A;  4HIA A;  5I5L A;  5AVF A;  4GW9 A;  2B02 A;  3LIE A;  2ZBB A;  3BY9 A;  3F1N A;  3HJK A;  3VE4 A;  4H6J B;  2EA9 A;  3MR0 A;  4R38 A;  5EFW A;  3LIF A;  3H9W A;  4HQA A;  4EQ1 A;  3NOT C;  3UMD A;  4NXF A;  1UGU A;  2JN7 A;  1P0Z A;  1OT9 A;  1V9Z A;  4EES A;  2PD8 A;  1WA9 A;  3NJA A;  3IBR A;  2QWS A;  3LI9 A;  2PYR A;  1TS8 A;  4KUK A;  2M1C A;  3KX0 X;  4GHI B;  2BAS A;  3LUQ A;  5DKL A;  4LRX C;  2WKQ A;  4WUJ A;  2Z6C A;  4I39 A;  2A24 A;  4M4X A;  4BBV A;  2QJ7 A;  4DJ3 A;  4LPZ A;  4I5S A;  4HJ4 A;  3LIC A;  2L4R A;  1DP9 A;  5HDC A;  1DRM A;  5HWV A;  3IS2 B;  2J80 A;  1OJ5 A;  4JGO A;  3E4O A;  5HD5 A;  3EWK A;  3MQQ A;  3H7W A;  2PD7 A;  4HJ6 A;  5A8B A;  1T18 A;  3A0V A;  3G6O A;  4EW7 A;  3D72 A;  2W27 A;  3H82 B;  5F5Y A;  3HJI A;  1XFQ A;  3NOU C;  1OTA A;  3F1P A;  1GSW A;  4K08 A;  4HH3 A;  1OJG A;  3ZQ5 A;  4HY8 A;  4R3A A;  3K3C A;  3UB6 A;  4JGQ A;  5F6A A;  5AVE A;  5HDD A;  1X0O A;  1S1Z A;  4B9O A;  2Z6D A;  4F3L B;  3A0R A;  3B33 A; 
#chains in the Genus database with same CATH topology
 1TDG A;  4KQD A;  4ZRR A;  2Q9M A;  1FR1 A;  4FD8 A;  5U47 A;  3LO7 A;  1V9Y A;  3JVV A;  3G35 A;  3SH8 A;  3T1S A;  3IT9 A;  5HDS A;  1YLW A;  3N8S A;  3LY3 A;  2HP6 A;  2RL3 A;  4U0T A;  4NET A;  5JYP A;  3UNW A;  3CLO A;  4KQQ A;  2ZC4 B;  2Y2H A;  4LV3 A;  4MEZ A;  4IBR A;  4S2M A;  5HZH A;  4JBF A;  2W1R A;  2JHE A;  3OPP A;  3KYE A;  3BWL A;  4JF5 A;  4KZ3 A;  4ARZ B;  2WAD A;  4GD8 A;  3WRT A;  4R0Q A;  1FCN A;  4L0L A;  1G68 A;  3LIB A;  4Q0I A;  4WL9 A;  1NRJ A;  5M18 A;  4KQR A;  4EUV A;  4GB7 A;  3O87 A;  5DFY A;  5EUA A;  5F69 A;  1IOU A;  3UPN A;  4E3L A;  4MN5 A;  4WMC A;  3C7U A;  3GR2 A;  3IXH A;  4DXB A;  3SH7 A;  3LGO A;  1STZ A;  3FYZ A;  2BLS A;  5EM0 A;  3VP0 A;  3D4F A;  4NXE A;  1S6R A;  5TBM B;  4CLC B;  4ETX A;  1T1A A;  4ESP A;  1WYC A;  1T19 A;  4LV2 A;  3PHY A;  1BLC A;  2JC7 A;  5BOH A;  3ITA A;  1FIL A;  3ZG8 B;  4YNR A;  2HDQ A;  3F1O B;  4KG5 A;  4QWO A;  5FEG A;  2QYB A;  4DE2 A;  4P87 A;  4L9F A;  1VQQ A;  3A3I A;  2PBY A;  5HWW A;  1O7E A;  4HP4 A;  4F3L A;  1F9I A;  3PBN A;  1ES5 A;  5TFQ A;  4L9G A;  4NXG A;  2OOL A;  4DMZ A;  3W8K A;  1GSX A;  3QP8 A;  4DKI A;  3JPU A;  2WAE A;  5CX7 A;  5FQK A;  2ZQ9 A;  1KDS A;  3EEH A;  4P0M A;  4E04 A;  1CJF A;  5LBR A;  1MZU A;  1KGF A;  5M1A A;  4WEK A;  3W4O A;  4S2L A;  2XA7 M;  1BYW A;  4XXR A;  1MBL A;  2G2W A;  4AFI A;  5CED A;  2INW A;  2K7S A;  5DFX A;  4E6X A;  1IYO A;  3AGF A;  1ES2 A;  1JTG A;  4BBT A;  4PM8 A;  2G2U A;  5G4Y A;  3W4P A;  4S2I A;  3NEC A;  2ZJ9 A;  3FG8 A;  3G4P A;  5GLA A;  4K0W A;  4WMC D;  2K31 A;  2HDS A;  3IXG A;  4NK3 A;  2PAV P;  3DTM A;  3NOP C;  5FQJ A;  4ZAM A;  4MBK A;  1L0F A;  2KDK A;  3LR5 A;  3VFH A;  4ZDX A;  1FCO A;  3Q07 A;  4HI4 A;  1CF0 A;  2BG1 A;  1C3B A;  2ZC5 B;  2PT7 A;  4LCM A;  2VA0 A;  1OT6 A;  5KMW A;  2FFY A;  2IA2 A;  1KE4 A;  1TF1 A;  3MF0 A;  1NWZ A;  5CTN A;  3UB8 A;  1CI8 A;  4LV1 A;  4XT2 A;  4OLD A;  3RXW A;  1S4S A;  1TVF A;  1YSP A;  4NEE D;  1EW0 A;  3HUM A;  2FZ0 A;  3V3S A;  3E4P A;  3G30 A;  1ALQ A;  2J9O A;  2V1A A;  4BEN A;  2QPN A;  5A90 A;  1XJ6 A;  4JKT A;  1FIK A;  2I72 A;  3I7J A;  2ZMA A;  1Z6F A;  2P74 A;  3V67 A;  3UO9 A;  3EOI A;  1YLJ A;  1L0E A;  4C75 A;  1H8M A;  1I2W A;  2WKR A;  5KZH A;  1G6A A;  1SZV A;  3QNC A;  3NBL A;  2R9W A;  2EX8 A;  4YFM A;  2ZQA A;  3CAX A;  3UPP A;  3N8R A;  3S4X A;  5E2G A;  3NIA A;  4H8R A;  5E2H A;  3A3E A;  4X1M A;  2EX9 A;  2HP5 A;  4WZ5 C;  3F1P B;  2C6W B;  2RCX A;  4OQ0 A;  1CEF A;  4S2N C;  2HGV A;  2Y2G A;  3LR3 A;  2J3T D;  4KZ7 A;  2FFF B;  1MKI A;  1HD8 A;  2B02 A;  1ONG A;  4HBU A;  1E3U A;  3V5M A;  2V1Z A;  5DF9 A;  3BY9 A;  1I5Q A;  2WGI A;  2PRF A;  4HES A;  4RA7 A;  4H6J B;  5C5K A;  2ZL1 A;  4LV0 A;  4E3O A;  3IH9 A;  3HBR A;  1A0K A;  3MBZ A;  1LI9 A;  1PWG A;  3LIF A;  4EQ1 A;  4IVI A;  3UMD A;  3C4O A;  3KSH A;  2G7U A;  4FCF A;  3BEC A;  1V9Z A;  4KZ8 A;  2M7U A;  1KVM A;  3TW8 A;  5DTK A;  1Y4O A;  3S7Q A;  2XK1 A;  2Y2I A;  3LFV A;  3B47 A;  3OPR A;  2IWD A;  3W4Q A;  1BLH A;  1ACF A;  2WZZ A;  4II7 A;  5DKL A;  1JVJ A;  1NJ4 A;  3N4I A;  5FQI A;  2VZW A;  4WBG A;  4WZ5 A;  4DE3 A;  2L4R A;  3Q7Z A;  3EQU A;  4S2N A;  5EVL A;  2MJ6 A;  3L7H A;  3FKW A;  1L0G A;  1OJ5 A;  2IWB A;  3E4O A;  3PBR A;  2W1T A;  3H7W A;  3Q7V B;  4KZ6 A;  5FDH A;  2PD7 A;  4HJ6 A;  4UQI M;  4LGW A;  3MKE A;  3NUL A;  4PM9 A;  4R4S A;  4OPR A;  4A5R A;  5EOO A;  3HJI A;  2M7V A;  5L07 A;  4IVK A;  1E3U D;  4K08 A;  3SOI A;  3FKV A;  4ZJ2 A;  1O07 A;  4MBH A;  5L2F A;  5HDD A;  1ES4 A;  5DVA A;  3ZVW A;  5CRF A;  5HFO A;  4D2O A;  2W3H A;  3R4K A;  4B9O A;  1CI9 A;  1NZU A;  1YKD A;  1Q2Q A;  3A3F A;  4Y7P A;  4DE0 A;  2Y8H A;  3UB5 P;  1J9M A;  5DJU A;  2QHK A;  4WM9 A;  1Y28 A;  3BQ8 A;  1PI5 A;  3IH8 A;  2OSU A;  4I3A A;  4KQO A;  3FPV A;  5AQA A;  1NYY A;  5HSQ A;  3ZG9 B;  4O01 A;  3G2Y A;  1IEM A;  4OLG A;  3OPL A;  1ONH A;  3VV4 A;  2Y79 A;  2ZMF A;  4OKP A;  1W63 M;  4IUK A;  3PBS A;  2JKT I;  4P6Z M;  3KO6 A;  4ME4 A;  4GHI A;  2Y4A A;  2O0Y A;  4R3J A;  2D02 A;  5AQ7 A;  1UWN X;  2H28 A;  2PDR A;  1ZKJ A;  2P9V A;  3HUO A;  3L9K A;  1L2S A;  3CUE C;  3ULF A;  3LYX A;  2B95 A;  3UDF A;  3S1Y A;  1TEM A;  3ZDJ A;  5F83 A;  4OH0 A;  1SHV A;  3T4Q A;  3CWF A;  2X02 A;  3PYP A;  1FR6 A;  4BJP A;  3NHQ A;  3LEQ A;  2Y2Q A;  1IFQ A;  4OP5 A;  3DTK A;  3G2Z A;  4X53 A;  3K2N A;  3GTC A;  4WLA A;  3UB9 A;  4P6Z S;  3CI6 A;  4MDZ A;  4OOL A;  3Q81 A;  3GSG A;  4KZ4 A;  4EBL A;  4I3J A;  3WS5 A;  1LSW A;  3SS4 A;  4QPR A;  1S1Y A;  5JYO A;  3CPT A;  5TJJ A;  5GLB A;  4YOF A;  2AVX A;  1KVL A;  2FH5 A;  4GOG A;  4HP9 A;  3HCY A;  1SKO B;  3M6B A;  5IS1 A;  4X25 A;  3E0Y A;  3MXQ A;  1PIO A;  2BTF P;  1MY8 A;  3OBF A;  5I94 A;  3ZG7 B;  3GDI A;  3GEC A;  5HAP A;  1VET A;  4GS9 A;  3E4Q A;  4KZ5 A;  2O9B A;  2VX8 A;  2DRW A;  3O5Y A;  3UE1 A;  1XXM A;  3HUN A;  3ZFZ A;  4Y2F A;  2VV7 A;  5DF8 A;  4Y0T A;  1EI5 A;  1OTB A;  3OPH A;  1S67 L;  5HWT A;  1PRQ A;  2W3F A;  1XJ4 A;  3MZF A;  2J9P A;  2VGK A;  4O8G A;  2YKH A;  3QP4 A;  5E2E A;  2QJ5 A;  4I38 A;  3QP2 A;  4CQH A;  1H8Y A;  5AJG A;  3VOL A;  2HZ5 A;  2E8J A;  5EVI B;  1IKI A;  4DJ2 A;  2LB9 A;  4X6T A;  1DJA A;  1Z09 A;  1ZC2 A;  5EV0 A;  2NUP C;  3HLF A;  1SCW A;  4XUX A;  3UME A;  2R9X A;  1OME A;  4EUZ A;  2B18 A;  3LIA A;  4NXB A;  5HD3 A;  2H0T A;  3ICY A;  1VHM A;  2W3D A;  4OQH A;  3PBQ A;  1YLP A;  3T4J A;  1K54 C;  4KZA A;  1AXB A;  5CGS A;  3VE3 A;  1BUL A;  1OPX A;  3IF6 C;  1TS6 A;  4Y13 A;  5DKK A;  4OOM A;  2JKT M;  3VOZ A;  3DWZ A;  3NI9 A;  5KSH A;  1ESU A;  3LR0 A;  5F68 A;  5A92 A;  2UV0 E;  5FAQ A;  5FI2 A;  3ZVT A;  2OAP 1;  3VSL A;  1VM1 A;  2A24 B;  4HHD A;  4EXO A;  1F98 A;  4HJ3 A;  1BZA A;  2WKH A;  2VGL M;  2PYP A;  3K3D A;  4UAA A;  4IED A;  2R78 A;  1XA1 A;  1VEU B;  1K4E A;  2GNX A;  3HLE A;  5CER A;  4MN6 A;  3GRJ A;  4Y17 A;  1UWP X;  1YT4 A;  1LL8 A;  1PW1 A;  3V50 A;  1IKG A;  2O99 A;  1HZO A;  2XDM A;  2HDU A;  3CG5 A;  4KUO A;  3ZNY A;  3VP1 A;  1H5X A;  1G28 A;  4XUZ A;  1DP8 A;  3FC7 A;  3MS6 A;  4PKY A;  1LSV A;  1PZP A;  2E8I A;  4S2P A;  4JXG A;  2O9A A;  2B5R A;  1FOF A;  3BYD A;  3V3R A;  2HDR A;  2WGW A;  1M6K A;  2V20 A;  5AVF A;  1HLU P;  4BWI A;  3M2J A;  2VGL S;  4EWF A;  3F1N A;  3KYQ A;  5HPI A;  1LI0 A;  4PAU A;  5DTS A;  2EA9 A;  4Z1W A;  3MR0 A;  1H3Q A;  4RYE A;  4Y3I A;  4M3K A;  4HQA A;  3LY4 A;  3CZD A;  4RX3 A;  1QMF A;  4NXF A;  2PBD P;  3GVB A;  2JN7 A;  2XQZ A;  2JCH A;  1ERO A;  1AWI A;  3IWO A;  2PD8 A;  4EES A;  3BFF A;  3FWL A;  4KG2 A;  1WA9 A;  3IBR A;  4KZB A;  1NYM A;  1PNE A;  1PWD A;  4R4R A;  3LEZ A;  5FA7 A;  2BAS A;  2ZLY A;  4YIN A;  4ZJ1 A;  3BM6 A;  1NXY A;  3LUQ A;  4LRX C;  1ERM A;  2CC1 A;  4BBV A;  5AQB A;  3ZCZ A;  1GHI A;  1K57 C;  2QJ7 A;  4F94 A;  4OON A;  2XD1 A;  1DP9 A;  5EM1 A;  3MMH A;  5HWV A;  1YMS A;  4JXW A;  1IYS A;  2ZM8 A;  1YMX A;  2K2N A;  3TG9 A;  3S7O A;  3QP1 A;  1PW8 A;  3N8L A;  3G34 A;  4G3W A;  2WKI A;  1DJB A;  3VP3 A;  3FV7 A;  3EGX C;  1CK3 A;  2Y2K A;  3ZGA B;  1ZG6 A;  3G6O A;  3NDE A;  3S7P A;  3LR4 A;  5TR7 A;  3TRC A;  1CEG A;  1XFQ A;  1MWU A;  3NOU C;  3GQZ A;  4HH3 A;  1K0K A;  4MBF A;  4Y0U A;  3QHY A;  3NCK A;  1PFL A;  4KZ9 A;  4Q0J A;  2NUT C;  4OP8 A;  1FSY A;  4IUH A;  5FL3 A;  4F3L B;  2PU4 A;  3R7W A;  4IBX A;  4O7D A;  1MXO A;  3W2Z A;  5GLD A;  4GLQ A;  3BFD A;  1K57 A;  3UB7 A;  1J3W A;  3WS4 A;  1I2S A;  3UPO A;  2PHY A;  4UHU A;  3BFE A;  2Y2L A;  1XPB A;  2XRO A;  3MZD A;  4R6L A;  3LCE A;  3G31 A;  3ZG5 A;  3UY6 A;  1PI4 A;  3NDG A;  4B88 A;  4Y0O A;  1LHY A;  1JNU A;  1N9O A;  1TD5 A;  2WGW B;  3E2L A;  3KSG A;  5L8M A;  5FAS A;  4JLF A;  4DN0 A;  2CMN A;  1D1J A;  1RGZ A;  3WS0 A;  4JGP A;  3T1Q B;  2H5S A;  4ETZ A;  3IQA A;  5FSR A;  2EXA A;  4S2K A;  4BQM A;  4GN2 A;  4JXS A;  3BEB A;  1PWC A;  3CJM A;  3IS2 A;  1VB6 A;  3SH9 A;  2XLN A;  1K4F A;  2EXB A;  5CXW A;  4ZJ3 A;  3N7W A;  4DDY A;  1EWZ A;  1T1B A;  3TE8 A;  3D3O A;  5HPF A;  4DF6 A;  2VEA A;  4Y15 A;  3H82 A;  3A3J A;  2X71 A;  5F1F A;  4IHQ A;  2EFU A;  4XT2 B;  1OTD A;  1XA7 A;  2A3U A;  3DWK A;  3T50 A;  4GDB A;  2XRN A;  3IF5 A;  3BY8 A;  4MLL A;  1K55 C;  3RTY A;  3GV9 A;  3E98 A;  1DY6 A;  2HJ9 C;  5GHY A;  2Q0O A;  4LEN A;  4IJG A;  5J7E A;  2OLV A;  4OPQ A;  3MXR A;  2V0W A;  2JE5 A;  2XGN A;  3IX8 A;  4PM7 A;  1OTE A;  1W7F A;  5IT5 A;  4N1X A;  4CLC C;  2ZQD A;  4P85 A;  2J7V A;  4N92 A;  4X1L A;  3BW6 A;  5HW3 A;  5K5B A;  4FOF A;  3P09 A;  2ZOI A;  1GA9 A;  4BBU A;  1ESI A;  4WYY A;  3P98 A;  4I3I A;  1XKZ A;  4E3N A;  4OVD A;  3O3V A;  1LLB A;  4PM5 A;  2V2F F;  2WAF A;  5DF7 A;  1KDW A;  4ARZ A;  3BQA A;  1BLP A;  2EX6 A;  4GD6 A;  2H10 A;  4RX2 A;  3R7W B;  1P97 A;  5G18 A;  2WYX A;  3EGD C;  1CQA A;  5J4E A;  5GHZ A;  1WE4 A;  1BSG A;  2JKG A;  5IU1 A;  2A2L A;  2KLI A;  2Z2L B;  4LRZ E;  2HPB A;  1TS7 A;  1TS0 A;  3ZG0 A;  2ZMV A;  3ISG A;  2ZL1 B;  1DJC A;  2XD5 A;  3IX4 A;  2Y55 A;  1K6S A;  4X56 A;  1GSV A;  2P04 A;  1K55 A;  4S2O A;  4OQG A;  3PAG A;  1BLS A;  3UDX A;  4P6B A;  5J3W A;  3RH8 B;  5CGX A;  3PAE A;  2VLG A;  4K91 A;  5TBM A;  4CLC A;  2Y2N A;  5DJT A;  3F1O A;  4DE1 A;  2JKR I;  5CTM A;  5KSC A;  5HX9 A;  4HH2 A;  1N4O A;  2PR6 A;  2YKF A;  4MNR A;  4YWZ A;  2ZM2 A;  3PXP A;  1YLZ A;  4FH4 A;  3WS1 A;  1MWS A;  3MQ0 A;  1LT0 A;  2XEP A;  2LB5 A;  3P01 A;  1IEL A;  2P7J A;  1S66 L;  3JVU A;  3OCN A;  1XP4 A;  1F5M A;  1L0D A;  2Y2P A;  4E3M A;  1MWR A;  1K56 A;  2WGV A;  3E2K A;  4JGR A;  4N9K A;  2W1T B;  1S0W A;  3H7W B;  4NKP A;  2A49 A;  2IWC A;  4GDN A;  1RGY A;  3VMA A;  3MQO A;  2XF3 A;  3CUE A;  4L9E A;  4O0P A;  4EEP A;  2Q9N A;  2L1M A;  4U0X A;  3IXB A;  3BLS A;  3U2A A;  2HJE A;  3ZHH A;  3D9Y A;  3KSI A;  4E3I A;  1U60 A;  2WUQ A;  5G4Z A;  3TJZ C;  2W0N A;  2OLU A;  2V1B A;  3WRZ A;  1SDE A;  3NY4 A;  4R23 A;  1FCM A;  4JXV A;  2VJW A;  4HIA A;  5I5L A;  4UA6 A;  5CHJ A;  3FZC A;  3N6I A;  1ES3 A;  1MPL A;  4Z9Q A;  2DNS A;  3PR6 A;  2XFS A;  3B42 A;  3HJK A;  2W3G A;  3TSG A;  5EOE A;  3VE4 A;  3QNB A;  3WWX A;  4PMA A;  3SS3 A;  3VOY A;  4JF6 A;  4K0X A;  5D3O A;  1M40 A;  4JF4 A;  3H9W A;  4CLC D;  2XH9 A;  4NG2 A;  1UGU A;  1GA0 A;  4KEN B;  4PPR A;  4E6W A;  1P0Z A;  4BLM A;  1OT9 A;  5IHV A;  5GLC A;  2QWS A;  3LI9 A;  1RP5 A;  4QU3 A;  4KUK A;  1JTD A;  1KGE A;  1ZG4 A;  4GHI B;  3SS5 A;  1E4D A;  2P9V B;  1HVB A;  1K38 A;  1NRF A;  4EV4 A;  4FTX A;  3FPW A;  4BMW A;  3T1R A;  1K56 D;  4DJ3 A;  4LPZ A;  1JWV A;  4I5S A;  5J8X A;  5HDC A;  2Z2M B;  3PBO A;  5DTT A;  2EFX A;  4RVA A;  4GZB A;  2Y2J A;  4CJN A;  3MQQ A;  1NLZ A;  1E25 A;  3VFF A;  4CLC E;  3MSH A;  4QD4 A;  3MZE A;  5CGW A;  1K6R A;  3C38 A;  2ZC7 A;  3CIT A;  5A8B A;  1ZHH B;  4X55 A;  2C5W B;  3OOV A;  1T18 A;  3M6H A;  3A0V A;  3Q1F A;  3OZH A;  4QY5 A;  2J3T C;  3D72 A;  2ZD8 A;  3HLG A;  4S2J A;  1PZO A;  4DRT A;  5M19 A;  3F1P A;  4WEJ A;  2JKR M;  1OJG A;  3ZQ5 A;  3C5A A;  3K3C A;  4FSF A;  4N9L A;  3UB6 A;  5F6A A;  5AVE A;  1X0O A;  5CEB A;  4N1H A;  1K54 A;  3TOI A;  3CPT B;  3Q82 A;  3HLW A;  4X68 A;  3BFG A;  3IF6 A;  4QJG A;  3SW1 A;  3AGE A;  2EX2 A;  2GZA A;  3DTI A;  4H6J A;  3UE3 A;  3LID A;  1N9B A;  4LFU A;  4FUW A;  3HVF A;  4B93 A;  4ZBE A;  3S7N A;  3O88 A;  4EET B;  2I9V A;  5FDS A;  5CEC A;  1YM1 A;  1VET B;  1H0M A;  4GS9 B;  2D01 A;  1XX2 A;  2GJ3 A;  4EQI A;  3P7N A;  1HTZ A;  3T4L A;  5FQ9 A;  1KOU A;  3HLB A;  4QHC A;  1JWP A;  2Y2O A;  1S4R A;  2OWH A;  3RXX A;  4C3Q A;  1Y54 A;  4LCL A;  5FI6 A;  4MCW A;  4WF0 A;  4EU0 A;  1KE3 A;  3IX3 A;  3MFX A;  1W79 A;  4GCZ A;  4OPZ A;  5TGF A;  4OQI A;  3T12 B;  3EQV A;  5E2F A;  3C8C A;  3HL9 A;  1F2K A;  2VV6 A;  5KIZ A;  4KG6 A;  1TDL A;  2XA7 S;  5FQM A;  5HAR A;  1GHP A;  1XFN A;  4R70 A;  3Q7V A;  1GHM A;  5L10 A;  1FSW A;  2V0U A;  4X69 A;  1W8Q A;  5FAP A;  4HOI A;  4MMN A;  5CHM A;  4QB8 A;  2J3W A;  3MXS A;  2ACG A;  4U3T A;  3M2K A;  2UWX A;  4Y5F A;  1D7E A;  3S22 A;  2VKS A;  2XSS A;  5HAQ A;  3QP6 A;  4HNB A;  3UDI A;  3ITB A;  4UEY A;  5L09 A;  1LL9 A;  3UE0 A;  4QY6 A;  4MN7 A;  4C6Y A;  4EBP A;  3MJQ A;  4HBT A;  3O86 A;  1MWT A;  3GMW A;  2GX5 A;  5F1G A;  4CPK A;  1N9L A;  2VK3 A;  1L3L A;  1XJ2 A;  1NY0 A;  2DCF A;  2L0W A;  1K25 A;  1WYB A;  2OAQ 1;  2EWV A;  2O9C A;  2GDN A;  2HV1 A;  4UA9 A;  3T4O A;  2QKP A;  2KOI A;  2W3E A;  5GHX A;  2ZOH A;  2JKF A;  1JWZ A;  1YLY A;  5FAT A;  1D06 A;  2WZX A;  4BL2 A;  3CHW P;  3C7V A;  5A93 A;  3SZT A;  4OPY A;  1N9N A;  3DTE A;  4E3J A;  2ZC6 B;  3IF6 B;  2ZQ7 A;  3PBT A;  1IYP A;  2OWJ A;  1LSX A;  3LI8 A;  2H0Y A;  1IYQ A;  1ODV A;  3C30 A;  3HLC A;  1GCE A;  1H8Z A;  3VSK A;  4OOY A;  4Q8I A;  3F1N B;  3DAV A;  3UE6 A;  2WKE A;  3RFB A;  3BRM A;  4LLO B;  3B3X A;  5FEF A;  2Y91 A;  2KX6 A;  2VGJ A;  2V9A A;  4WN5 A;  4EEU A;  1QME A;  3WS2 A;  1LL5 A;  1XJ3 A;  4DDS A;  5HAI A;  4G3K A;  2V8F A;  2J8Y A;  4BD0 A;  3G32 A;  3MKF A;  2ZM0 A;  2PR5 A;  3C2W A;  4GJ4 A;  3VP4 A;  5FQQ A;  1YQS A;  5EVI C;  1XGI A;  1DP6 A;  2WKP A;  4LRY C;  3IBJ A;  2XR0 A;  3C4P A;  2VV8 A;  4ID4 A;  4B4Z A;  3OLO A;  2QZ6 A;  3EEA A;  3IXD A;  3HLD A;  3A0S A;  3DBA A;  4EER A;  1NLY A;  1W5D A;  1YAX A;  3UN7 A;  3U4L P;  4JPM A;  5EVE A;  3V39 A;  3QP5 A;  3ZNT A;  1SKO A;  3ZYT A;  3CMZ A;  4HEF A;  1BUE A;  2ZQC A;  5MC7 A;  3BFC A;  1T1C A;  3RJU A;  4RQ9 A;  1MKM A;  2HP9 A;  3NC8 A;  3MFD A;  4UA7 A;  5HL1 A;  5F82 A;  2DMW A;  2EWW A;  1BT5 A;  3T1X A;  1KE0 A;  3PTE A;  4PKY G;  1OTI A;  3T4T A;  1G5U A;  4GW9 A;  3LIE A;  5EVI A;  2ZBB A;  4GKU A;  4G3V A;  2XFT A;  2PU2 A;  4DXC A;  3DW0 A;  3IWQ A;  5FI7 A;  4UQI S;  4BD1 A;  3OCL A;  4R38 A;  5A91 A;  5EFW A;  1XGJ A;  4WZ4 A;  3NOT C;  2HF6 A;  1SDN A;  5AQ9 A;  3BLM A;  1SKF A;  5CHU A;  2ZC3 B;  3NJA A;  1NZO A;  2PYR A;  1P9R A;  4GNU A;  1TS8 A;  2M1C A;  4FH2 A;  4E3K A;  3KX0 X;  1YLT A;  3BJN A;  1G6O A;  1Q2P A;  1ZTU A;  2QMI A;  3T4S A;  4BL3 A;  2WK0 A;  2WKQ A;  4WUJ A;  2Z6C A;  4I39 A;  5E43 A;  4R1G A;  2A24 A;  4M4X A;  2OV5 A;  2Y59 A;  1P9W A;  4R3B A;  3JYI A;  4HJ4 A;  3LIC A;  4ZTK A;  1DRM A;  1ERQ A;  1VEU A;  5EEC A;  3HRE A;  3IS2 B;  2J80 A;  3AGD A;  4Q0H A;  4PHT A;  4JGO A;  5HD5 A;  3EWK A;  4B4X A;  1FQG A;  1BTL A;  3IHA A;  3OC2 A;  2ZQ8 A;  2Y2M A;  5FAO A;  1YSQ A;  3VP2 A;  5EPH A;  3A3D A;  1MC0 A;  4PM6 A;  3KSF A;  1PYY A;  5EE8 A;  1RCJ A;  1KGG A;  1W63 Q;  4EW7 A;  4EBN A;  3IWI A;  2W27 A;  3KYZ A;  3H82 B;  5F5Y A;  1OTA A;  1GSW A;  5EVI D;  3T4K A;  4HY8 A;  3IHB A;  4R3A A;  4JGQ A;  2X01 A;  2V8C A;  4D60 A;  5HL6 A;  2P08 A;  1S1Z A;  4WEL A;  1YPR A;  1W8Y A;  2JBF A;  5GL9 A;  2Z6D A;  3A0R A;  3B33 A; 
#chains in the Genus database with same CATH homology
 3R7W A;  3SW1 A;  4KQD A;  2GZA A;  1YKD A;  4ZRR A;  4H6J A;  3UE3 A;  3LID A;  1V9Y A;  3W2Z A;  3JVV A;  4GLQ A;  2Y8H A;  5DJU A;  2QHK A;  3UB7 A;  4B93 A;  3S7N A;  1Y28 A;  3BQ8 A;  4EET B;  5HDS A;  2I9V A;  2PHY A;  4I3A A;  4KQO A;  3FPV A;  5HSQ A;  4O01 A;  3CLO A;  2XRO A;  4GS9 B;  2D01 A;  4R6L A;  3VV4 A;  2Y79 A;  2ZMF A;  2GJ3 A;  1W63 M;  4IUK A;  3P7N A;  5HZH A;  2W1R A;  2JHE A;  3PBS A;  3T4L A;  1JNU A;  3BWL A;  1KOU A;  1N9O A;  2JKT I;  4P6Z M;  1TD5 A;  3KO6 A;  4ME4 A;  4GHI A;  4ARZ B;  3KSG A;  5L8M A;  1S4R A;  2O0Y A;  2OWH A;  2D02 A;  1UWN X;  2H28 A;  2PDR A;  4DN0 A;  4MCW A;  2CMN A;  4WF0 A;  4EU0 A;  3MFX A;  3CUE C;  3ULF A;  4JGP A;  4L0L A;  4GCZ A;  3LYX A;  4ETZ A;  3LIB A;  4Q0I A;  4WL9 A;  1NRJ A;  4EUV A;  3EQV A;  3C8C A;  2VV6 A;  5KIZ A;  5DFY A;  5F69 A;  3IS2 A;  3T4Q A;  1IOU A;  3CWF A;  1VB6 A;  2XA7 S;  4MN5 A;  3PYP A;  4BJP A;  1XFN A;  4R70 A;  3NHQ A;  2V0U A;  1STZ A;  1IFQ A;  4HOI A;  1T1B A;  4MMN A;  3TE8 A;  2J3W A;  3D3O A;  4NXE A;  5HPF A;  5TBM B;  4CLC B;  4ETX A;  4Y5F A;  1T1A A;  3K2N A;  1D7E A;  2VEA A;  4WLA A;  3UB9 A;  1T19 A;  4P6Z S;  2VKS A;  2XSS A;  3CI6 A;  3PHY A;  4MDZ A;  4HNB A;  3H82 A;  4UEY A;  4IHQ A;  4OOL A;  4XT2 B;  4YNR A;  3F1O B;  1OTD A;  4MN7 A;  4I3J A;  3T50 A;  3MJQ A;  2QYB A;  2XRN A;  1LSW A;  4L9F A;  3BY8 A;  5HWW A;  4QPR A;  1S1Y A;  2GX5 A;  3RTY A;  5TJJ A;  4YOF A;  4HP4 A;  3E98 A;  4F3L A;  1F9I A;  3PBN A;  2HJ9 C;  2FH5 A;  5J7E A;  4IJG A;  1N9L A;  4L9G A;  4NXG A;  1XJ2 A;  2OOL A;  2V0W A;  3HCY A;  4HP9 A;  2L0W A;  4DMZ A;  1OTE A;  1GSX A;  5IS1 A;  3E0Y A;  2OAQ 1;  2EWV A;  3MXQ A;  5IT5 A;  2O9C A;  4CLC C;  2HV1 A;  5CX7 A;  3T4O A;  3OBF A;  2QKP A;  3EEH A;  2KOI A;  2W3E A;  4E04 A;  3GDI A;  3BW6 A;  5LBR A;  5K5B A;  2ZOH A;  1MZU A;  4FOF A;  3GEC A;  4GS9 A;  3E4Q A;  2ZOI A;  4WEK A;  4BBU A;  1D06 A;  2XA7 M;  2O9B A;  2VX8 A;  1BYW A;  4AFI A;  3O5Y A;  4I3I A;  2INW A;  2K7S A;  5DFX A;  4Y2F A;  2VV7 A;  1OTB A;  1S67 L;  5HWT A;  2W3F A;  1XJ4 A;  1N9N A;  4ARZ A;  3BQA A;  4O8G A;  2YKH A;  3PBT A;  4BBT A;  2QJ5 A;  2OWJ A;  3R7W B;  5G4Y A;  1P97 A;  4I38 A;  3EGD C;  4CQH A;  3VOL A;  5AJG A;  5J4E A;  1LSX A;  3LI8 A;  1ODV A;  5IU1 A;  3C30 A;  3FG8 A;  2A2L A;  2KLI A;  4DJ2 A;  2LB9 A;  2NUP C;  4LRZ E;  3F1N B;  1TS7 A;  1TS0 A;  2K31 A;  2ZMV A;  3UE6 A;  3UME A;  3NOP C;  3RFB A;  4LLO B;  1GSV A;  2P04 A;  2KDK A;  3LR5 A;  2B18 A;  3LIA A;  4NXB A;  2KX6 A;  5HD3 A;  4HI4 A;  2V9A A;  4WN5 A;  4EEU A;  3ICY A;  1VHM A;  2W3D A;  2PT7 A;  2VA0 A;  1OT6 A;  3PBQ A;  5J3W A;  3T4J A;  1XJ3 A;  3RH8 B;  3VE3 A;  4G3K A;  2VLG A;  1OPX A;  2IA2 A;  1TS6 A;  1TF1 A;  2PR5 A;  3MF0 A;  5TBM A;  5DKK A;  4CLC A;  3C2W A;  4GJ4 A;  4OOM A;  1NWZ A;  2JKT M;  3UB8 A;  5KSH A;  3LR0 A;  5F68 A;  1DP6 A;  2WKP A;  4LRY C;  3IBJ A;  5DJT A;  4XT2 A;  3F1O A;  2JKR I;  2OAP 1;  2VV8 A;  1S4S A;  1YSP A;  3OLO A;  4NEE D;  2A24 B;  4HH2 A;  4HHD A;  1EW0 A;  4EXO A;  2YKF A;  2PR6 A;  3EEA A;  1F98 A;  4YWZ A;  3PXP A;  4HJ3 A;  2FZ0 A;  3E4P A;  3A0S A;  3DBA A;  4EER A;  1NLY A;  3MQ0 A;  1LT0 A;  2VGL M;  2PYP A;  2LB5 A;  3P01 A;  3K3D A;  2P7J A;  1YAX A;  2R78 A;  2GNX A;  1S66 L;  3JVU A;  3OCN A;  2V1A A;  1F5M A;  4MN6 A;  1XJ6 A;  3ZYT A;  3V67 A;  4JGR A;  1UWP X;  3EOI A;  2W1T B;  1LL8 A;  3H7W B;  4NKP A;  2O99 A;  1H8M A;  4KUO A;  3MQO A;  5MC7 A;  2WKR A;  3CUE A;  4L9E A;  4O0P A;  1T1C A;  4EEP A;  2L1M A;  3U2A A;  4RQ9 A;  2HJE A;  1G28 A;  1MKM A;  1DP8 A;  3FC7 A;  3KSI A;  3CAX A;  4PKY A;  1LSV A;  5G4Z A;  3TJZ C;  2O9A A;  2W0N A;  2V1B A;  3F1P B;  2DMW A;  2EWW A;  4PKY G;  1OTI A;  2VJW A;  4HIA A;  5I5L A;  2HGV A;  3T4T A;  3LR3 A;  2J3T D;  5AVF A;  4GW9 A;  2B02 A;  3LIE A;  2ZBB A;  3PR6 A;  4BWI A;  5DF9 A;  2VGL S;  3BY9 A;  3F1N A;  3KYQ A;  4G3V A;  3B42 A;  3HJK A;  2W3G A;  5HPI A;  3VE4 A;  4H6J B;  4PAU A;  5C5K A;  2EA9 A;  4Z1W A;  4UQI S;  3MR0 A;  3OCL A;  4R38 A;  1H3Q A;  4Y3I A;  5EFW A;  3LIF A;  3H9W A;  4HQA A;  4EQ1 A;  3NOT C;  2HF6 A;  3UMD A;  4CLC D;  4NXF A;  1UGU A;  3KSH A;  2JN7 A;  2G7U A;  1P0Z A;  1OT9 A;  1V9Z A;  2M7U A;  4EES A;  2PD8 A;  1WA9 A;  3NJA A;  3IBR A;  2QWS A;  3TW8 A;  3LI9 A;  2PYR A;  1P9R A;  1TS8 A;  4KUK A;  2M1C A;  3S7Q A;  3KX0 X;  3LFV A;  4GHI B;  3B47 A;  3BJN A;  2BAS A;  1G6O A;  1ZTU A;  3FPW A;  3T4S A;  3LUQ A;  4II7 A;  4LRX C;  5DKL A;  2WKQ A;  4WUJ A;  2Z6C A;  4I39 A;  4BMW A;  2A24 A;  4M4X A;  4BBV A;  1P9W A;  2VZW A;  2QJ7 A;  4DJ3 A;  4LPZ A;  4I5S A;  4HJ4 A;  3LIC A;  2L4R A;  1DP9 A;  5HDC A;  3MMH A;  3EQU A;  3PBO A;  1DRM A;  5HWV A;  2MJ6 A;  3IS2 B;  2J80 A;  4Q0H A;  1OJ5 A;  4JGO A;  4PHT A;  3E4O A;  3PBR A;  5HD5 A;  3EWK A;  2K2N A;  2W1T A;  3MQQ A;  1NLZ A;  3H7W A;  3S7O A;  4CLC E;  2PD7 A;  4HJ6 A;  4UQI M;  3OC2 A;  4G3W A;  3C38 A;  1YSQ A;  3EGX C;  3CIT A;  1MC0 A;  3KSF A;  1ZHH B;  5A8B A;  3OOV A;  1W63 Q;  1T18 A;  3A0V A;  3G6O A;  3S7P A;  4EW7 A;  2J3T C;  3D72 A;  3LR4 A;  2W27 A;  3KYZ A;  3TRC A;  3H82 B;  5F5Y A;  3HJI A;  2M7V A;  1XFQ A;  3NOU C;  1OTA A;  3F1P A;  4WEJ A;  1GSW A;  4K08 A;  2JKR M;  4HH3 A;  3T4K A;  1OJG A;  3ZQ5 A;  4HY8 A;  4R3A A;  3K3C A;  4FSF A;  3UB6 A;  4JGQ A;  5F6A A;  5AVE A;  5HDD A;  1X0O A;  5HL6 A;  2P08 A;  4Q0J A;  2NUT C;  1S1Z A;  4WEL A;  2W3H A;  3R4K A;  4IUH A;  4B9O A;  5FL3 A;  2Z6D A;  4F3L B;  3A0R A;  3B33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...