5F68A

Drosophila melanogaster cycle w398a pas-b with bound ethylene glycol
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Circadian clock protein
molecule keywords Protein cycle
publication title Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
rcsb
source organism Drosophila melanogaster
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f68A00
1T1AA 3HJIA 3IS2A 4YWZA 1GSVA 4F3LA 2HV1A 2ZBBA 4DJ2A 2CMNA 1DP6A 3NHQA 3UB8A 4GW9A 5J7EA 1UWPX 4GHIB 2J80A 1Y28A 3G6OA 5I5LA 4H6JB 2H28A 2B02A 2A24B 4L9GA 5DJUA 5IS1A 5F69A 3F1OA 2OOLA 2V1BA 3F1NB 4HY8A 1T18A 2KDKA 3VOLA 1OT6A 3LI8A 2V0UA 5G4ZA 4HH3A 1T19A 2PR6A 4L9EA 1UWNX 3K3DA 3NOTC 1EW0A 2PD8A 1VB6A 1V9ZA 1OJ5A 4HP9A 1S67L 2P7JA 1WA9A 1X0OA 2VV7A 4LRYC 2VV8A 5AVEA 1OTDA 4JGOA 2INWA 4HHDA 4HI4A 2PDRA 3A0VA 4NXBA 2YKFA 3NOPC 4B9OA 1LSVA 3H9WA 3HJKA 5DJTA 1TS8A 4XT2A 1BYWA 3E4QA 3IBRA 4MN6A 1S4SA 3LIAA 2WKRA 3VE4A 5HZHA 4EETB 3BY8A 2OWJA 4I5SA 3UB6A 3LIDA 1XFQA 3LI9A 3GECA 4EEPA 4E04A 2WKPA 3UB9A 3H7WA 4I38A 1F98A 4L9FA 1D06A 1N9LA 3CWFA 4HH2A 2D02A 5HD5A 3LIEA 3A0RA 5IU1A 5F6AA 4M4XA 5F5YA 3RTYA 1G28A 2Z6CA 3H82B 1OTBA 3MQQA 4LPZA 5G4YA 1S4RA 4NXFA 3F1PB 4WF0A 1JNUA 1S66L 1N9NA 4KQDA 1XJ2A 4LRXC 5F68A 3MFXA 1DRMA 3NJAA 4KUKA 4HOIA 5DKKA 1N9OA 3E4OA 2L0WA 3FC7A 3A0SA 4BBUA 5HD3A 3P7NA 3UE6A 2W27A 4PKYG 4GS9B 4WL9A 3LUQA 3GDIA 2PHYA 1T1BA 3K3CA 4BBTA 2D01A 1UGUA 5TBMA 2KX6A 4EESA 3ZQ5A 3LICA 4WUJA 1TS7A 5J3WA 3EEHA 3IS2B 4F3LB 5HDCA 2ZOHA 1DP8A 1MZUA 2QKPA 1NWZA 2OWHA 2L1MA 4JGQA 3LIFA 4EQ1A 4GHIA 2W0NA 4HIAA 1V9YA 3CAXA 1TS0A 2QJ7A 1KOUA 4R6LA 1OJGA 3SW1A 1XJ4A 1LSXA 2QWSA 1S1YA 2A24A 2V0WA 4PKYA 4EXOA 4BBVA 4I3AA 3F1NA 5AVFA 1OTAA 3F1OB 4HJ3A 5HDSA 4HP4A 1ODVA 4R38A 2EA9A 2WKQA 1GSXA 1OTIA 3MJQA 1DP9A 1XFNA 2I9VA 3PHYA 5J4EA 2PYPA 5DKLA 4K08A 4GCZA 3EWKA 3UMDA 2ZOIA 2JN7A 3BY9A 2Z6DA 2PD7A 3FG8A 1XJ6A 3E4PA 4LLOB 1F9IA 2R78A 3UB7A 4WN5A 2JHEA 2QJ5A 5KIZA 5HWVA 4EERA 3PYPA 4JGRA 4NXGA 4I3JA 2VLGA 4HJ4A 4XT2B 1GSWA 1LSWA 5HDDA 5HWTA 3VE3A 4HNBA 3B33A 2PR5A 5A8BA 1S1ZA 1T1CA 4HJ6A 1TS6A 4DJ3A 5HSQA 2V9AA 3OLOA 1LL8A 4EEUA 2QHKA 4R3AA 2GJ3A 1OT9A 3H7WB 1XJ3A 4R70A 3T50A 3UMEA 3C2WA 2K7SA 3LIBA 4HQAA 5EFWA 3RH8B 2BASA 3H82A 1P0ZA 4H6JA 4NXEA 3F1PA 3ULFA 3MR0A 3C8CA 2YKHA 4WLAA 2M1CA 2VV6A 2L4RA 4EW7A 3CLOA 3LYXA 2VEAA 3BWLA 3KX0X 4GS9A 4I39A 4KUOA 4I3IA 4MN5A 1LT0A 4JGPA 3D72A 3ICYA 1P97A 1D7EA 4RQ9A 3MQOA 4LRZE 1OTEA 3MXQA 5HWWA 2PYRA 3NOUC 2V1AA 5TBMB
chains in the Genus database with same CATH superfamily
4YWZA 3S7OA 3D4FA 3Q1FA 2ZBBA 4XUXA 2CMNA 5GLCA 1UWPX 1M40A 2WK0A 5FEGA 1SKFA 3QHYA 2C5WB 4X1LA 4R3JA 1K6SA 1XKZA 2WZZA 2B02A 4KQOA 2WAEA 2W3EA 4PM9A 1MKIA 2JE5A 1KGEA 3LY3A 2V1BA 4N1XA 4RVAA 4GN2A 4HY8A 3HLEA 3LI8A 3QP4A 3SH8A 1OMEA 1W8YA 5CX7A 5G4ZA 4DE0A 3T12B 3SH7A 3OBFA 2JKGA 1T19A 2Y2LA 4EBPA 4BLMA 4EBLA 1GA9A 4NETA 1KDWA 1S67L 2J9OA 2M7UA 2ZM8A 2P7JA 4OPYA 1HVBA 4PM7A 4IUKA 4B88A 5DTSA 2EX6A 2VV7A 3WWXA 2XR0A 4LRYC 4WMCD 4F94A 4ZDXA 3WS0A 3L9KA 5AVEA 1OTDA 2EXBA 5GLBA 2INWA 4HHDA 4HI4A 4ZBEA 3FV7A 3G2ZA 3JVVA 2YKFA 5F82A 1LSVA 2VGLS 2W3GA 4LV0A 3HJKA 4ARZB 5DJTA 5HPIA 2XFTA 4XT2A 5F1GA 1BYWA 3PR6A 4S2MA 2XRNA 4KQQA 3LIAA 3VE4A 3UE0A 4UAAA 2ZQ9A 3BY8A 2C6WB 2X02A 4X6TA 5TGFA 3TE8A 4S2LA 2FH5A 4QY6A 1W63M 2PBYA 3NI9A 1PZOA 1Q2QA 2V8CA 2WKPA 5M1AA 3H7WA 4I38A 1F98A 1N9LA 3DTIA 2PU2A 4WEKA 3GMWA 3CZDA 5HD5A 1L0GA 3LIEA 3QP2A 3A0RA 1H8ZA 3ZGAB 3QNBA 4NK3A 2G2WA 2Z6CA 3MQQA 4ZJ3A 5TR7A 1H8MA 4WF0A 1JNUA 1N9NA 2VZWA 1FCOA 2WGWA 1QMEA 5EVIB 2W3HA 3NJAA 5F83A 5CRFA 1FSWA 5AJGA 4P6ZM 3ZNYA 1L0DA 1MBLA 4BBUA 3UE6A 4FTXA 5FQKA 4LCLA 3UPPA 4IBRA 2J3WA 2XLNA 3GSGA 2P9VA 1PRQA 2EXAA 3IHAA 1K56D 4GJ4A 3ITAA 2HP9A 4BBTA 3OZHA 3GQZA 3DWZA 3MF0A 3UB5P 1PYYA 4BD1A 1UGUA 3R7WA 1SDNA 3ZQ5A 1MPLA 2AVXA 3EEHA 3GVBA 2B95A 2EFXA 1FOFA 2XDMA 4MNRA 4LFUA 3KSFA 4JBFA 4NKPA 1IFQA 4P87A 3GR2A 3T4KA 5EM0A 5FATA 1ES2A 3CAXA 2OAQ1 2EWWA 3LR3A 4RX2A 1KE4A 1LSXA 2K2NA 2HP6A 4OLDA 2A24A 2V0WA 4LCMA 2IWBA 4E3LA 4EXOA 3BECA 4RX3A 4BBVA 4FH2A 2NUTC 4MBFA 4D60A 1GCEA 3IXDA 1ODVA 3JVUA 4MN7A 2WKQA 1QMFA 3NULA 2W1RA 1A0KA 3FKWA 2Y2GA 1DP9A 2I9VA 5FQIA 3PBOA 2PYPA 3HLDA 4K08A 4GCZA 3TG9A 4UQIS 1I2SA 1SKOA 4DE2A 2CC1A 1BULA 3EGXC 5CERA 3FG8A 1XJ6A 1XP4A 3E4PA 1DY6A 1CQAA 3EQUA 3RJUA 3UB7A 4WN5A 2KOIA 3V39A 3OPPA 4B93A 5FAOA 1HTZA 2WGIA 5HPFA 4Y15A 3VP3A 4OLGA 4MBHA 3KYZA 3PYPA 4JGRA 3WS5A 4I3JA 3LR5A 4H8RA 4HEFA 5L07A 1NLYA 4XT2B 1GSWA 3T1XA 1LSWA 4CQHA 4X68A 3AGEA 1C3BA 2XA7M 4KZ7A 3T4OA 3M2JA 1KE3A 5HSQA 2XEPA 5CEDA 5CHUA 1YAXA 3U2AA 1E4DA 3H7WB 5E2EA 4KZ4A 3UMEA 3PTEA 5CGXA 4MLLA 2K7SA 4X53A 4HQAA 4IVKA 3A3FA 3S4XA 1RGZA 1N4OA 5E2FA 2IWCA 5HW3A 2HGVA 4XUZA 2ZM0A 4B4ZA 4UA9A 3C8CA 4YFMA 1XA7A 2WGWB 4LGWA 2VV6A 3T1SA 1SHVA 4KG6A 1W63Q 1BLHA 4FCFA 1BLCA 3BLSA 4BWIA 1TD5A 2P74A 1JTDA 3BWLA 2QZ6A 2XD5A 3CUEA 1VEUA 1FCNA 3KSHA 4DDSA 3D72A 4CJNA 4PM8A 1PW8A 1LI9A 1P97A 2Y79A 3Q81A 2P9VB 3UY6A 5FAQA 1VQQA 4KZBA 3NDEA 1ERQA 4MCWA 1KGFA 4LRZE 1OTEA 3MXQA 1YQSA 5HWWA 5DF8A 4KZAA 2HJEA 3T4TA 1MZUA 3QP6A 3HJIA 3T4QA 1GSVA 3R7WB 5I94A 4JLFA 5FQJA 5F1FA 5FQQA 4GB7A 3NIAA 5FI6A 2J8YA 4DJ2A 2GNXA 1H8YA 2MJ6A 3NHQA 2ZM2A 3UB8A 4GW9A 3E2LA 3C30A 4IJGA 3HLFA 1VETA 2G2UA 4KZ8A 1IYOA 4R4RA 3BFDA 1NXYA 4QD4A 5CGWA 1PWDA 2Q9NA 4JXSA 3G6OA 4H6JB 3OC2A 3UDXA 2H28A 1YSQA 5EE8A 5EUAA 3VSLA 2A24B 2X71A 4S2OA 5IS1A 2VJWA 5F69A 2OAP1 1MWTA 4BQMA 1NZOA 4OKPA 3MXSA 1T18A 1VM1A 3KSIA 3BFEA 3MZDA 3ZNTA 3LEQA 5HL1A 4HH3A 1GHIA 5L8MA 3HLGA 4L9EA 1UWNX 3K3DA 2PBDP 3VFFA 1XA1A 5HAPA 1SKOB 1OJ5A 2H0YA 1F2KA 5IT5A 1MKMA 1HD8A 3LCEA 1BLSA 3WS2A 1X0OA 5EV0A 3V67A 2HJ9C 4ZJ1A 1FR6A 1NRJA 1E3UD 3IXBA 3G35A 2XA7S 4JGOA 1IKIA 1BLPA 4ZAMA 2PDRA 1PW1A 2FZ0A 2R9XA 4S2KA 3TOIA 4LV2A 2PT7A 3E4QA 3DBAA 4YOFA 2JKFA 3C7UA 3IBRA 4MN6A 3SS4A 5JYOA 4C75A 3O88A 3CHWP 5HZHA 4EETB 1DJAA 3G4PA 3ISGA 3E2KA 3S7PA 4I5SA 3UB6A 3ZFZA 4JF6A 1PFLA 4GDBA 4EEPA 3GECA 4OPRA 4E04A 3UO9A 3DW0A 2WZXA 4K0WA 4DMZA 4L9FA 3Q7VA 4HH2A 3DTEA 3WS1A 4GZBA 1I2WA 3HUMA 4II7A 4JF5A 2Y2OA 3AGDA 5HAQA 2XF3A 5G4YA 5CGSA 2LB9A 3IH8A 1CJFA 1S4RA 4C3QA 1ZC2A 3O87A 1XJ2A 4KUKA 4HOIA 3E4OA 3MSHA 2L0WA 4PHTA 5HD3A 3IX8A 4WYYA 4Q8IA 5GLDA 3O86A 1WYBA 2JKRI 1NRFA 4WL9A 1VEUB 1CEGA 2G7UA 2XH9A 3MKFA 3PAEA 3HBRA 4OQHA 1AXBA 1JWZA 1T1BA 3P09A 3IWIA 3CUEC 2XQZA 2D01A 3G34A 4Z1WA 4S2PA 1TDLA 2KX6A 3WRZA 5M18A 2VGJA 2VX8A 4OPQA 2W3DA 1JWVA 1TS7A 3HLBA 4PAUA 5EVEA 5HDCA 2ZOHA 1H0MA 1SZVA 3ZG0A 3N8LA 4LV3A 3ZCZA 4CLCE 3C4OA 3HVFA 4NG2A 1VETB 4GHIA 1S0WA 1V9YA 3EOIA 3IXHA 2QJ7A 2HDSA 2O0YA 1TEMA 1L2SA 1XJ4A 3WS4A 4CLCD 2A49A 5GHYA 2H5SA 5IHVA 1SDEA 3BFGA 3G2YA 4PKYA 1K0KA 4OQIA 2QPNA 2WKEA 5CEBA 1OTAA 3JPUA 4G3KA 5EPHA 5CXWA 2DMWA 5AQBA 5CTNA 3VOYA 5KSHA 4L0LA 3QP1A 1OTIA 3RXWA 1XFNA 4IVIA 3VFHA 2P08A 5DKLA 2UWXA 2W3FA 3UMDA 1YKDA 2ZOIA 4OP5A 5DTTA 1XXMA 1FR1A 4DDYA 4WMCA 4GD8A 4EUVA 2PD7A 1OPXA 3M6HA 5G18A 1K4FA 3C5AA 3UPOA 1IELA 3MS6A 4NEED 3V5MA 4A5RA 2QJ5A 5JYPA 5HWVA 4MEZA 2UV0E 5L10A 4GD6A 1Y54A 1GA0A 3IH9A 4UEYA 1NLZA 4NXGA 3O3VA 3NECA 1CI9A 1K4EA 4HJ4A 2FFYA 4EU0A 1XPBA 3LR4A 3VE3A 2H10A 4HNBA 1MXOA 4Y0OA 1RCJA 3V3RA 1T1CA 3NY4A 1TS6A 2P04A 4MBKA 4FD8A 4G3WA 1DJCA 1CI8A 1LL8A 3T4JA 3UN7A 1XJ3A 3ZG5A 3LO7A 2Q9MA 4R70A 3T50A 4CPKA 2NUPC 3C2WA 2JKTI 3Q7VB 1Y4OA 3S22A 3LIBA 3RH8B 3AGFA 1N9BA 1LLBA 4OOYA 3IF6C 1P0ZA 1ONHA 3MKEA 3BJNA 4H6JA 5EECA 4LENA 4P6BA 5A91A 3Q07A 1ES5A 1KVLA 3NBLA 2HDQA 4Z9QA 3TSGA 4PMAA 4WLAA 1MC0A 3OPLA 2WGVA 4IBXA 4ID4A 3MQ0A 4QY5A 5MC7A 1K56A 4GS9A 4I3IA 1LT0A 3ZVTA 3IWQA 3ZG9B 4X55A 3ICYA 4DE1A 4O7DA 1O7EA 4E3JA 4Y7PA 5A93A 1YLYA 2W1TA 3ZHHA 4ME4A 2EWVA 1K54A 3LFVA 3NOUC 3IS2A 4F3LA 1XGIA 4X25A 3UE1A 4OQ0A 4HBTA 4OVDA 2KLIA 5CHMA 5L2FA 4GNUA 1DP6A 1NY0A 5CTMA 4C6YA 4R23A 5U47A 4E6WA 2GDNA 2ZC6B 1S6RA 1YSPA 4GHIB 4FSFA 2J80A 2XROA 3PBRA 1G6AA 5I5LA 3CITA 3QNCA 3HUOA 4EV4A 1L3LA 1Q2PA 1D1JA 1YLJA 2PU4A 4L9GA 5DJUA 3N7WA 3F1OA 2OOLA 3VOLA 1OT6A 2R9WA 5FI2A 1IYQA 2WADA 3MBZA 4OH0A 4DXBA 1IYPA 3HUNA 1VB6A 1V9ZA 4HP9A 5CHJA 4P6ZS 4UA7A 4JF4A 2JKTM 1WA9A 3CI6A 3K2NA 2Z2LB 4RA7A 3ZDJA 2X01A 3N8SA 2I72A 5HAIA 5GL9A 3VMAA 1MWRA 3HREA 5DVAA 1IOUA 3A0VA 4NXBA 4CLCB 1ES4A 2Y91A 5FA7A 4QB8A 4U0XA 4ESPA 1YLPA 1YLWA 5J8XA 4OOMA 4CLCC 1VHMA 1S4SA 2WKRA 1LL5A 3EGDC 1JVJA 1LL9A 5HFOA 3ZG8B 2OWJA 4PM6A 3LIDA 1XFQA 3LI9A 3VP0A 2BLSA 1YMXA 1G5UA 3G32A 3MFDA 3IX3A 4BENA 2ZC3B 1D06A 1XGJA 3UNWA 2J7VA 3CWFA 2D02A 1MWSA 5IU1A 5F6AA 4M4XA 3BEBA 5F5YA 3T1RA 1H3QA 2ZC4B 1KGGA 3RTYA 2Y2QA 4E3IA 1OTBA 3A3IA 1HLUP 4G3VA 3NC8A 4NXFA 5FEFA 1S66L 2Y2JA 4OONA 4BL2A 3GV9A 5F68A 1W7FA 2Y59A 4EQIA 1CK3A 3DTKA 1G68A 1N9OA 1ONGA 3FC7A 2V8FA 4HBUA 5EVID 1E25A 5FSRA 4WELA 2Y2IA 3HLWA 3KO6A 4WZ4A 5GLAA 2VGKA 1YT4A 4PKYG 2WUQA 3VOZA 4ZJ2A 3KSGA 4GS9B 1PWGA 1H5XA 1BZAA 5FQ9A 4E3NA 3LUQA 2Y2PA 2PHYA 5EM1A 4E3OA 5EVLA 2W1TB 4JPMA 1K55C 5TBMA 2BG1A 4FH4A 1ESIA 4WUJA 5J3WA 2O9AA 1G6OA 3IS2B 3RFBA 4F3LB 1K54C 4QHCA 4OPZA 1EWZA 3U4LP 1WE4A 2HDUA 2L1MA 2HDRA 4WEJA 4Q0IA 3CMZA 4JXWA 3W4OA 4QU3A 3LIFA 3A3EA 3C4PA 2PRFA 4EUZA 1SCWA 1TS0A 1LI0A 1KOUA 4Q0HA 1OJGA 3SW1A 2QWSA 3EEAA 1STZA 4Y0UA 5FAPA 4XXRA 2HP5A 4X1MA 3HCYA 3W8KA 1IEMA 2XK1A 3MZFA 4I3AA 3F1NA 4R0QA 5AVFA 2ZQAA 3F1OB 4HJ3A 5HDSA 1RP5A 1BT5A 2ZD8A 4R38A 4WM9A 2VKSA 2EA9A 1YLTA 2EX2A 2VK3A 3FYZA 3PHYA 2VA0A 5J4EA 3IF6A 5GHZA 4O0PA 1NYYA 5BOHA 2LB5A 3EWKA 4U3TA 2K31A 3CJMA 3W4PA 4OP8A 5FDHA 4PM5A 3BY9A 2Z6DA 2ZC7A 3JYIA 3MXRA 1E3UA 1ZHHB 3DWKA 1PNEA 4LLOB 3R4KA 2M7VA 4O8GA 5KIZA 3O5YA 4EERA 2V2FF 5D3OA 1TDGA 3VV4A 1ZG6A 3IWOA 3D9YA 1Z6FA 2ZLYA 4DXCA 2ZQCA 4ZTKA 1BUEA 1ES3A 2VLGA 5A90A 1K6RA 5AQ7A 5HDDA 3M2KA 4PPRA 3B33A 2E8JA 5DFXA 3BW6A 1S1ZA 4DN0A 3DAVA 4N92A 4DJ3A 3A3DA 3N4IA 1PWCA 3BYDA 3KYEA 4Y13A 2ZQDA 3V3SA 4GDNA 1OT9A 3FPVA 3IXGA 4BL3A 3S1YA 4R3BA 1ALQA 2QMIA 4GLQA 3C7VA 3E0YA 5EFWA 2O9CA 4Q0JA 4M3KA 2H0TA 2V20A 3H82A 3I7JA 2XGNA 4P0MA 3VP2A 5KSCA 3F1PA 3ULFA 3KYQA 1K25A 5FL3A 3TW8A 4UQIM 2YKHA 1FSYA 4ETXA 4JXGA 5KZHA 2GX5A 4S2JA 2Y2KA 3TRCA 3W2ZA 5M19A 1NZUA 2L4RA 4EW7A 2J3TD 4R1GA 3ZYTA 4QWOA 2ZMAA 2OLVA 3CLOA 3CG5A 1GHMA 4P85A 3UDIA 4WZ5A 2ZQ8A 4MN5A 2RCXA 3Q7ZA 3V50A 4JGPA 3FWLA 1TVFA 1D7EA 1BSGA 2Y2HA 3BLMA 1HZOA 1K38A 4RQ9A 1IKGA 4S2NA 2V1AA 5TBMB 1KE0A 1T1AA 1DJBA 2Y55A 3PBSA 2HV1A 5DF9A 1K57A 2DRWA 3T4LA 2E8IA 4Y3IA 5HX9A 5J7EA 3SS3A 4CLCA 2GZAA 3EQVA 4K0XA 4EBNA 1Y28A 2EX9A 3FPWA 4N9LA 4EWFA 4MDZA 2JC7A 5C5KA 3IT9A 2A2LA 3Q82A 1W5DA 4E3MA 3TJZC 2JKRM 3F1NB 5EOOA 2KDKA 5EVIC 5KMWA 3T4SA 1JWPA 1J3WA 2XFSA 2RL3A 2V0UA 3IX4A 1L0FA 5DTKA 1CEFA 1FIKA 3RXXA 5DF7A 4KZ5A 4HESA 1EI5A 2PR6A 3IF6B 1WYCA 3NOTC 3WRTA 3IBJA 1EW0A 2PD8A 5EOEA 3PXPA 1IYSA 1FQGA 2JCHA 4K91A 2OLUA 2ZL1A 5E43A 3QP5A 4B4XA 4MMNA 2VV8A 2O99A 3DTMA 2Y4AA 3B3XA 2XD1A 5AQ9A 4WBGA 3SH9A 3NOPC 4B9OA 3H9WA 3VP1A 1ZG4A 1TS8A 1KVMA 3N8RA 1K55A 3PBQA 3G31A 4QPRA 2DNSA 1BTLA 3D3OA 1ZTUA 2B5RA 1YLZA 3OCLA 4X56A 3UB9A 4FOFA 1XX2A 4ETZA 3CPTA 3ZG7B 5FDSA 5FASA 3PAGA 4KZ3A 2DCFA 3GTCA 1W79A 2Y2NA 1O07A 1G28A 3H82B 2Z2MB 2B18A 3HLCA 4LPZA 2ZMVA 3VSKA 1KDSA 2HZ5A 1JTGA 1PZPA 3C38A 2EFUA 3F1PB 3ZVWA 4KG2A 1MY8A 2OSUA 5K5BA 4GOGA 4KQDA 5E2HA 4LRXC 3MFXA 4OOLA 1DRMA 1FILA 5DKKA 4X69A 3LEZA 2ZC5B 3A0SA 1ACFA 3FZCA 2O9BA 3P7NA 2W27A 2WYXA 1P9RA 3BFCA 4Y5FA 3OPHA 2WKHA 3ITBA 1J9MA 4FUWA 3GDIA 3K3CA 5FI7A 4WZ5C 1TF1A 3N6IA 3OOVA 5FQMA 4N1HA 4EESA 3LICA 1P9WA 1DP8A 4IUHA 2QKPA 5A92A 3W4QA 4S2NC 1NWZA 2OWHA 4JGQA 1I5QA 1YM1A 2BTFP 4EQ1A 2W0NA 4HIAA 1K57C 3P01A 1AWIA 2J9PA 4IHQA 2WAFA 4R6LA 1MWUA 2EX8A 1PIOA 4JXVA 2WKIA 3E98A 5E2GA 1S1YA 3UDFA 4UA6A 2ACGA 4RYEA 4BD0A 4ZRRA 4KENB 3HL9A 5TFQA 1YMSA 2J3TC 4HP4A 2HPBA 5L09A 1Z09A 3LR0A 4O01A 1GSXA 4KQRA 3MJQA 1M6KA 2XSSA 3OPRA 1F5MA 3NCKA 3BRMA 3UPNA 3B47A 4DE3A 2FFFB 2JBFA 2A3UA 2JN7A 4AFIA 4OQGA 1L0EA 1PI5A 3QP8A 4KZ6A 2V1ZA 2ZL1B 1ESUA 2ZQ7A 4Y0TA 1F9IA 2R78A 3LY4A 2JHEA 1CF0A 4N9KA 3NDGA 2IA2A 3OCNA 3M6BA 4R4SA 4JKTA 4DRTA 3IF5A 4ARZA 3FKVA 2Q0OA 3MZEA 5HARA 3UE3A 5DFYA 4GKUA 2ZMFA 4BJPA 1FCMA 5AQAA 2PAVP 3BQ8A 5HWTA 1ERMA 3IQAA 2PR5A 5TJJA 5A8BA 2VGLM 4HJ6A 4Y2FA 2Y8HA 1NYMA 2Y2MA 3PBNA 4LV1A 4U0TA 2V9AA 3OLOA 4BMWA 4EEUA 2QHKA 4R3AA 2GJ3A 1PI4A 3BM6A 5LBRA 3SS5A 2HF6A 2OV5A 3CPTB 3IHBA 1U60A 4IEDA 4Y17A 3B42A 2ZJ9A 2BASA 4D2OA 1ZKJA 3MMHA 4S2IA 4DF6A 3VP4A 4KG5A 4NXEA 5HL6A 2IWDA 3L7HA 4YNRA 3MR0A 3A3JA 5EVIA 3S7NA 2QYBA 4UHUA 2M1CA 3P98A 1LHYA 3PBTA 1RGYA 3LYXA 3SOIA 2VEAA 3G30A 4KZ9A 4YINA 1W8QA 4QJGA 3KX0X 4KUOA 4I39A 4DKIA 5CECA 1EROA 3SZTA 3LGOA 5GHXA 3T1QB 1NJ4A 3BFFA 1YPRA 3S7QA 4E6XA 3MQOA 3BQAA 1GHPA 4E3KA 3GRJA 2PYRA
chains in the Genus database with same CATH topology
1T1AA 3HJIA 3IS2A 4YWZA 1GSVA 3R7WB 3T4QA 3S7OA 4F3LA 3PBSA 2HV1A 2ZBBA 5DF9A 2KLIA 3T4LA 4DJ2A 2CMNA 2GNXA 1DP6A 2MJ6A 3NHQA 4Y3IA 3UB8A 4GW9A 3C30A 4IJGA 5J7EA 1UWPX 4CLCA 2GZAA 3EQVA 1YSPA 4GHIB 4FSFA 2J80A 1Y28A 3G6OA 3PBRA 3FPWA 2XROA 5I5LA 4H6JB 3OC2A 3CITA 4MDZA 2H28A 5C5KA 2B02A 4KQOA 1YSQA 2A2LA 2A24B 4L9GA 2W3EA 5DJUA 3TJZC 2JKRM 5IS1A 2VJWA 5F69A 3F1OA 2OAP1 2OOLA 2V1BA 3F1NB 4HY8A 1T18A 2KDKA 3VOLA 1OT6A 3T4SA 3KSIA 3LI8A 2V0UA 5CX7A 4HH3A 5G4ZA 3OBFA 1T19A 5L8MA 2PR6A 4L9EA 1UWNX 3K3DA 3NOTC 3IBJA 1EW0A 2PD8A 1VB6A 1V9ZA 1OJ5A 3PXPA 4HP9A 1S67L 4P6ZS 2M7UA 5IT5A 2P7JA 1MKMA 2JKTM 1WA9A 3CI6A 1X0OA 3V67A 3K2NA 2HJ9C 4IUKA 2VV7A 4LRYC 4MMNA 2VV8A 2O99A 1NRJA 5AVEA 1OTDA 2XA7S 4JGOA 2INWA 4HHDA 4HI4A 1IOUA 2PDRA 3A0VA 3JVVA 4NXBA 2FZ0A 2YKFA 3NOPC 4B9OA 1LSVA 4CLCB 2VGLS 3H9WA 2W3GA 3HJKA 4ARZB 5DJTA 5HPIA 1TS8A 4XT2A 2PT7A 1BYWA 3DBAA 3E4QA 3PR6A 4OOMA 4YOFA 4CLCC 3IBRA 2XRNA 4MN6A 1VHMA 1S4SA 3LIAA 2WKRA 3PBQA 4QPRA 3VE4A 3EGDC 5HZHA 4EETB 3D3OA 3BY8A 1ZTUA 3TE8A 2FH5A 3OCLA 1W63M 3S7PA 2OWJA 4I5SA 3UB6A 3LIDA 1XFQA 3LI9A 3GECA 4EEPA 4E04A 2WKPA 3UB9A 3H7WA 4FOFA 4DMZA 4I38A 4ETZA 1F98A 4L9FA 1D06A 1N9LA 3CWFA 4HH2A 4WEKA 2D02A 5HD5A 3LIEA 4II7A 3A0RA 5IU1A 5F6AA 4M4XA 5F5YA 1H3QA 3RTYA 1G28A 2Z6CA 3H82B 1OTBA 3MQQA 2B18A 4LPZA 2ZMVA 5G4YA 2LB9A 4G3VA 1S4RA 3C38A 1H8MA 4NXFA 3F1PB 4WF0A 1JNUA 1S66L 1N9NA 2VZWA 5K5BA 4KQDA 1XJ2A 4LRXC 2W3HA 5F68A 3MFXA 4OOLA 1DRMA 3NJAA 4KUKA 4HOIA 5DKKA 1N9OA 3E4OA 2L0WA 3FC7A 5AJGA 4P6ZM 4PHTA 3A0SA 4BBUA 2O9BA 4WELA 5HD3A 3P7NA 3UE6A 3KO6A 2W27A 1P9RA 2JKRI 4PKYG 4Y5FA 3KSGA 4GS9B 4WL9A 2J3WA 2G7UA 3LUQA 3GDIA 2PHYA 4GJ4A 1T1BA 3K3CA 4BBTA 3CUEC 1TF1A 2D01A 3OOVA 4Z1WA 3MF0A 2W1TB 1UGUA 5TBMA 2KX6A 2VX8A 3R7WA 4EESA 3ZQ5A 3LICA 4WUJA 2W3DA 1TS7A 1P9WA 5J3WA 3EEHA 4PAUA 2O9AA 1G6OA 3IS2B 3RFBA 4F3LB 5HDCA 2ZOHA 1DP8A 1MZUA 2QKPA 4IUHA 1NWZA 2OWHA 3KSFA 4NKPA 1IFQA 2L1MA 4JGQA 4CLCE 4WEJA 4Q0IA 3LIFA 3T4KA 4EQ1A 4GHIA 2W0NA 4HIAA 3P01A 3EOIA 1V9YA 3CAXA 2OAQ1 1TS0A 2QJ7A 4IHQA 1KOUA 2EWWA 3LR3A 4R6LA 2O0YA 4Q0HA 1OJGA 3SW1A 1XJ4A 4CLCD 1LSXA 2QWSA 3EEAA 1STZA 2K2NA 3E98A 1S1YA 2A24A 2V0WA 3HCYA 4PKYA 4ZRRA 4EXOA 4BBVA 4I3AA 2NUTC 3F1NA 5AVFA 1OTAA 3F1OB 4HJ3A 5HDSA 2J3TC 4HP4A 4G3KA 2DMWA 1ODVA 5KSHA 3LR0A 4R38A 3JVUA 4MN7A 2VKSA 2EA9A 2WKQA 4O01A 2W1RA 4L0LA 1GSXA 1OTIA 3MJQA 1DP9A 2XSSA 1XFNA 2I9VA 3PHYA 1F5MA 2VA0A 5J4EA 3PBOA 2P08A 2PYPA 5DKLA 4O0PA 4K08A 4GCZA 2LB5A 3B47A 2W3FA 3EWKA 4UQIS 2K31A 3UMDA 1YKDA 2ZOIA 2JN7A 3BY9A 4EUVA 4AFIA 2Z6DA 3EGXC 2PD7A 3FG8A 1ZHHB 1OPXA 1XJ6A 3E4PA 4LLOB 3R4KA 3EQUA 2M7VA 1F9IA 2R78A 3UB7A 4O8GA 4WN5A 2KOIA 4NEED 2JHEA 2QJ5A 5KIZA 5HWVA 4B93A 2IA2A 3O5YA 4EERA 5HPFA 3OCNA 3VV4A 3KYZA 4UEYA 3PYPA 4JGRA 4ARZA 1NLZA 4NXGA 4I3JA 3LR5A 2VLGA 4HJ4A 3UE3A 1NLYA 4XT2B 5DFYA 1GSWA 1LSWA 4EU0A 2ZMFA 4CQHA 4BJPA 5HDDA 3BQ8A 3LR4A 5HWTA 3VE3A 2XA7M 4HNBA 3B33A 5DFXA 2PR5A 5TJJA 3T4OA 5A8BA 3BW6A 1S1ZA 4DN0A 1T1CA 2VGLM 4HJ6A 4Y2FA 1TS6A 2P04A 2Y8HA 4DJ3A 4G3WA 3PBNA 5HSQA 2V9AA 3OLOA 4BMWA 1YAXA 1LL8A 4EEUA 3T4JA 3U2AA 2QHKA 4R3AA 2GJ3A 1OT9A 3FPVA 3H7WB 1XJ3A 5LBRA 2HF6A 4R70A 3T50A 2NUPC 3C2WA 3UMEA 2JKTI 4GLQA 2K7SA 3E0YA 3LIBA 4HQAA 5EFWA 3RH8B 3B42A 2O9CA 2BASA 4Q0JA 3H82A 3MMHA 1P0ZA 3BJNA 4H6JA 4NXEA 2HGVA 3F1PA 3ULFA 3KYQA 5HL6A 5FL3A 3TW8A 4YNRA 3MR0A 4UQIM 3C8CA 3S7NA 2YKHA 2QYBA 4WLAA 4ETXA 2M1CA 2GX5A 2VV6A 1MC0A 3PBTA 3TRCA 3W2ZA 2L4RA 4EW7A 1W63Q 2J3TD 3ZYTA 3MQ0A 3CLOA 3LYXA 2VEAA 4BWIA 1TD5A 3BWLA 5MC7A 3KX0X 3CUEA 4GS9A 4I39A 4I3IA 4KUOA 1LT0A 4MN5A 4JGPA 3KSHA 3D72A 3ICYA 1P97A 2Y79A 1D7EA 2W1TA 4MCWA 4RQ9A 3S7QA 3MQOA 3BQAA 4LRZE 4ME4A 2EWVA 1OTEA 3MXQA 5HWWA 3LFVA 2PYRA 2HJEA 3NOUC 3T4TA 2V1AA 5TBMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1A A;  3HJI A;  3IS2 A;  4YWZ A;  1GSV A;  4F3L A;  2HV1 A;  2ZBB A;  4DJ2 A;  2CMN A;  1DP6 A;  3NHQ A;  3UB8 A;  4GW9 A;  5J7E A;  1UWP X;  4GHI B;  2J80 A;  1Y28 A;  3G6O A;  5I5L A;  4H6J B;  2H28 A;  2B02 A;  2A24 B;  4L9G A;  5DJU A;  5IS1 A;  5F69 A;  3F1O A;  2OOL A;  2V1B A;  3F1N B;  4HY8 A;  1T18 A;  2KDK A;  3VOL A;  1OT6 A;  3LI8 A;  2V0U A;  5G4Z A;  4HH3 A;  1T19 A;  2PR6 A;  4L9E A;  1UWN X;  3K3D A;  3NOT C;  1EW0 A;  2PD8 A;  1VB6 A;  1V9Z A;  1OJ5 A;  4HP9 A;  1S67 L;  2P7J A;  1WA9 A;  1X0O A;  2VV7 A;  4LRY C;  2VV8 A;  5AVE A;  1OTD A;  4JGO A;  2INW A;  4HHD A;  4HI4 A;  2PDR A;  3A0V A;  4NXB A;  2YKF A;  3NOP C;  4B9O A;  1LSV A;  3H9W A;  3HJK A;  5DJT A;  1TS8 A;  4XT2 A;  1BYW A;  3E4Q A;  3IBR A;  4MN6 A;  1S4S A;  3LIA A;  2WKR A;  3VE4 A;  5HZH A;  4EET B;  3BY8 A;  2OWJ A;  4I5S A;  3UB6 A;  3LID A;  1XFQ A;  3LI9 A;  3GEC A;  4EEP A;  4E04 A;  2WKP A;  3UB9 A;  3H7W A;  4I38 A;  1F98 A;  4L9F A;  1D06 A;  1N9L A;  3CWF A;  4HH2 A;  2D02 A;  5HD5 A;  3LIE A;  3A0R A;  5IU1 A;  5F6A A;  4M4X A;  5F5Y A;  3RTY A;  1G28 A;  2Z6C A;  3H82 B;  1OTB A;  3MQQ A;  4LPZ A;  5G4Y A;  1S4R A;  4NXF A;  3F1P B;  4WF0 A;  1JNU A;  1S66 L;  1N9N A;  4KQD A;  1XJ2 A;  4LRX C;  5F68 A;  3MFX A;  1DRM A;  3NJA A;  4KUK A;  4HOI A;  5DKK A;  1N9O A;  3E4O A;  2L0W A;  3FC7 A;  3A0S A;  4BBU A;  5HD3 A;  3P7N A;  3UE6 A;  2W27 A;  4PKY G;  4GS9 B;  4WL9 A;  3LUQ A;  3GDI A;  2PHY A;  1T1B A;  3K3C A;  4BBT A;  2D01 A;  1UGU A;  5TBM A;  2KX6 A;  4EES A;  3ZQ5 A;  3LIC A;  4WUJ A;  1TS7 A;  5J3W A;  3EEH A;  3IS2 B;  4F3L B;  5HDC A;  2ZOH A;  1DP8 A;  1MZU A;  2QKP A;  1NWZ A;  2OWH A;  2L1M A;  4JGQ A;  3LIF A;  4EQ1 A;  4GHI A;  2W0N A;  4HIA A;  1V9Y A;  3CAX A;  1TS0 A;  2QJ7 A;  1KOU A;  4R6L A;  1OJG A;  3SW1 A;  1XJ4 A;  1LSX A;  2QWS A;  1S1Y A;  2A24 A;  2V0W A;  4PKY A;  4EXO A;  4BBV A;  4I3A A;  3F1N A;  5AVF A;  1OTA A;  3F1O B;  4HJ3 A;  5HDS A;  4HP4 A;  1ODV A;  4R38 A;  2EA9 A;  2WKQ A;  1GSX A;  1OTI A;  3MJQ A;  1DP9 A;  1XFN A;  2I9V A;  3PHY A;  5J4E A;  2PYP A;  5DKL A;  4K08 A;  4GCZ A;  3EWK A;  3UMD A;  2ZOI A;  2JN7 A;  3BY9 A;  2Z6D A;  2PD7 A;  3FG8 A;  1XJ6 A;  3E4P A;  4LLO B;  1F9I A;  2R78 A;  3UB7 A;  4WN5 A;  2JHE A;  2QJ5 A;  5KIZ A;  5HWV A;  4EER A;  3PYP A;  4JGR A;  4NXG A;  4I3J A;  2VLG A;  4HJ4 A;  4XT2 B;  1GSW A;  1LSW A;  5HDD A;  5HWT A;  3VE3 A;  4HNB A;  3B33 A;  2PR5 A;  5A8B A;  1S1Z A;  1T1C A;  4HJ6 A;  1TS6 A;  4DJ3 A;  5HSQ A;  2V9A A;  3OLO A;  1LL8 A;  4EEU A;  2QHK A;  4R3A A;  2GJ3 A;  1OT9 A;  3H7W B;  1XJ3 A;  4R70 A;  3T50 A;  3UME A;  3C2W A;  2K7S A;  3LIB A;  4HQA A;  5EFW A;  3RH8 B;  2BAS A;  3H82 A;  1P0Z A;  4H6J A;  4NXE A;  3F1P A;  3ULF A;  3MR0 A;  3C8C A;  2YKH A;  4WLA A;  2M1C A;  2VV6 A;  2L4R A;  4EW7 A;  3CLO A;  3LYX A;  2VEA A;  3BWL A;  3KX0 X;  4GS9 A;  4I39 A;  4KUO A;  4I3I A;  4MN5 A;  1LT0 A;  4JGP A;  3D72 A;  3ICY A;  1P97 A;  1D7E A;  4RQ9 A;  3MQO A;  4LRZ E;  1OTE A;  3MXQ A;  5HWW A;  2PYR A;  3NOU C;  2V1A A;  5TBM B; 
#chains in the Genus database with same CATH topology
 4YWZ A;  3S7O A;  3D4F A;  3Q1F A;  2ZBB A;  4XUX A;  2CMN A;  5GLC A;  1UWP X;  1M40 A;  2WK0 A;  5FEG A;  1SKF A;  3QHY A;  2C5W B;  4X1L A;  4R3J A;  1K6S A;  1XKZ A;  2WZZ A;  2B02 A;  4KQO A;  2WAE A;  2W3E A;  4PM9 A;  1MKI A;  2JE5 A;  1KGE A;  3LY3 A;  2V1B A;  4N1X A;  4RVA A;  4GN2 A;  4HY8 A;  3HLE A;  3LI8 A;  3QP4 A;  3SH8 A;  1OME A;  1W8Y A;  5CX7 A;  5G4Z A;  4DE0 A;  3T12 B;  3SH7 A;  3OBF A;  2JKG A;  1T19 A;  2Y2L A;  4EBP A;  4BLM A;  4EBL A;  1GA9 A;  4NET A;  1KDW A;  1S67 L;  2J9O A;  2M7U A;  2ZM8 A;  2P7J A;  4OPY A;  1HVB A;  4PM7 A;  4IUK A;  4B88 A;  5DTS A;  2EX6 A;  2VV7 A;  3WWX A;  2XR0 A;  4LRY C;  4WMC D;  4F94 A;  4ZDX A;  3WS0 A;  3L9K A;  5AVE A;  1OTD A;  2EXB A;  5GLB A;  2INW A;  4HHD A;  4HI4 A;  4ZBE A;  3FV7 A;  3G2Z A;  3JVV A;  2YKF A;  5F82 A;  1LSV A;  2VGL S;  2W3G A;  4LV0 A;  3HJK A;  4ARZ B;  5DJT A;  5HPI A;  2XFT A;  4XT2 A;  5F1G A;  1BYW A;  3PR6 A;  4S2M A;  2XRN A;  4KQQ A;  3LIA A;  3VE4 A;  3UE0 A;  4UAA A;  2ZQ9 A;  3BY8 A;  2C6W B;  2X02 A;  4X6T A;  5TGF A;  3TE8 A;  4S2L A;  2FH5 A;  4QY6 A;  1W63 M;  2PBY A;  3NI9 A;  1PZO A;  1Q2Q A;  2V8C A;  2WKP A;  5M1A A;  3H7W A;  4I38 A;  1F98 A;  1N9L A;  3DTI A;  2PU2 A;  4WEK A;  3GMW A;  3CZD A;  5HD5 A;  1L0G A;  3LIE A;  3QP2 A;  3A0R A;  1H8Z A;  3ZGA B;  3QNB A;  4NK3 A;  2G2W A;  2Z6C A;  3MQQ A;  4ZJ3 A;  5TR7 A;  1H8M A;  4WF0 A;  1JNU A;  1N9N A;  2VZW A;  1FCO A;  2WGW A;  1QME A;  5EVI B;  2W3H A;  3NJA A;  5F83 A;  5CRF A;  1FSW A;  5AJG A;  4P6Z M;  3ZNY A;  1L0D A;  1MBL A;  4BBU A;  3UE6 A;  4FTX A;  5FQK A;  4LCL A;  3UPP A;  4IBR A;  2J3W A;  2XLN A;  3GSG A;  2P9V A;  1PRQ A;  2EXA A;  3IHA A;  1K56 D;  4GJ4 A;  3ITA A;  2HP9 A;  4BBT A;  3OZH A;  3GQZ A;  3DWZ A;  3MF0 A;  3UB5 P;  1PYY A;  4BD1 A;  1UGU A;  3R7W A;  1SDN A;  3ZQ5 A;  1MPL A;  2AVX A;  3EEH A;  3GVB A;  2B95 A;  2EFX A;  1FOF A;  2XDM A;  4MNR A;  4LFU A;  3KSF A;  4JBF A;  4NKP A;  1IFQ A;  4P87 A;  3GR2 A;  3T4K A;  5EM0 A;  5FAT A;  1ES2 A;  3CAX A;  2OAQ 1;  2EWW A;  3LR3 A;  4RX2 A;  1KE4 A;  1LSX A;  2K2N A;  2HP6 A;  4OLD A;  2A24 A;  2V0W A;  4LCM A;  2IWB A;  4E3L A;  4EXO A;  3BEC A;  4RX3 A;  4BBV A;  4FH2 A;  2NUT C;  4MBF A;  4D60 A;  1GCE A;  3IXD A;  1ODV A;  3JVU A;  4MN7 A;  2WKQ A;  1QMF A;  3NUL A;  2W1R A;  1A0K A;  3FKW A;  2Y2G A;  1DP9 A;  2I9V A;  5FQI A;  3PBO A;  2PYP A;  3HLD A;  4K08 A;  4GCZ A;  3TG9 A;  4UQI S;  1I2S A;  1SKO A;  4DE2 A;  2CC1 A;  1BUL A;  3EGX C;  5CER A;  3FG8 A;  1XJ6 A;  1XP4 A;  3E4P A;  1DY6 A;  1CQA A;  3EQU A;  3RJU A;  3UB7 A;  4WN5 A;  2KOI A;  3V39 A;  3OPP A;  4B93 A;  5FAO A;  1HTZ A;  2WGI A;  5HPF A;  4Y15 A;  3VP3 A;  4OLG A;  4MBH A;  3KYZ A;  3PYP A;  4JGR A;  3WS5 A;  4I3J A;  3LR5 A;  4H8R A;  4HEF A;  5L07 A;  1NLY A;  4XT2 B;  1GSW A;  3T1X A;  1LSW A;  4CQH A;  4X68 A;  3AGE A;  1C3B A;  2XA7 M;  4KZ7 A;  3T4O A;  3M2J A;  1KE3 A;  5HSQ A;  2XEP A;  5CED A;  5CHU A;  1YAX A;  3U2A A;  1E4D A;  3H7W B;  5E2E A;  4KZ4 A;  3UME A;  3PTE A;  5CGX A;  4MLL A;  2K7S A;  4X53 A;  4HQA A;  4IVK A;  3A3F A;  3S4X A;  1RGZ A;  1N4O A;  5E2F A;  2IWC A;  5HW3 A;  2HGV A;  4XUZ A;  2ZM0 A;  4B4Z A;  4UA9 A;  3C8C A;  4YFM A;  1XA7 A;  2WGW B;  4LGW A;  2VV6 A;  3T1S A;  1SHV A;  4KG6 A;  1W63 Q;  1BLH A;  4FCF A;  1BLC A;  3BLS A;  4BWI A;  1TD5 A;  2P74 A;  1JTD A;  3BWL A;  2QZ6 A;  2XD5 A;  3CUE A;  1VEU A;  1FCN A;  3KSH A;  4DDS A;  3D72 A;  4CJN A;  4PM8 A;  1PW8 A;  1LI9 A;  1P97 A;  2Y79 A;  3Q81 A;  2P9V B;  3UY6 A;  5FAQ A;  1VQQ A;  4KZB A;  3NDE A;  1ERQ A;  4MCW A;  1KGF A;  4LRZ E;  1OTE A;  3MXQ A;  1YQS A;  5HWW A;  5DF8 A;  4KZA A;  2HJE A;  3T4T A;  1MZU A;  3QP6 A;  3HJI A;  3T4Q A;  1GSV A;  3R7W B;  5I94 A;  4JLF A;  5FQJ A;  5F1F A;  5FQQ A;  4GB7 A;  3NIA A;  5FI6 A;  2J8Y A;  4DJ2 A;  2GNX A;  1H8Y A;  2MJ6 A;  3NHQ A;  2ZM2 A;  3UB8 A;  4GW9 A;  3E2L A;  3C30 A;  4IJG A;  3HLF A;  1VET A;  2G2U A;  4KZ8 A;  1IYO A;  4R4R A;  3BFD A;  1NXY A;  4QD4 A;  5CGW A;  1PWD A;  2Q9N A;  4JXS A;  3G6O A;  4H6J B;  3OC2 A;  3UDX A;  2H28 A;  1YSQ A;  5EE8 A;  5EUA A;  3VSL A;  2A24 B;  2X71 A;  4S2O A;  5IS1 A;  2VJW A;  5F69 A;  2OAP 1;  1MWT A;  4BQM A;  1NZO A;  4OKP A;  3MXS A;  1T18 A;  1VM1 A;  3KSI A;  3BFE A;  3MZD A;  3ZNT A;  3LEQ A;  5HL1 A;  4HH3 A;  1GHI A;  5L8M A;  3HLG A;  4L9E A;  1UWN X;  3K3D A;  2PBD P;  3VFF A;  1XA1 A;  5HAP A;  1SKO B;  1OJ5 A;  2H0Y A;  1F2K A;  5IT5 A;  1MKM A;  1HD8 A;  3LCE A;  1BLS A;  3WS2 A;  1X0O A;  5EV0 A;  3V67 A;  2HJ9 C;  4ZJ1 A;  1FR6 A;  1NRJ A;  1E3U D;  3IXB A;  3G35 A;  2XA7 S;  4JGO A;  1IKI A;  1BLP A;  4ZAM A;  2PDR A;  1PW1 A;  2FZ0 A;  2R9X A;  4S2K A;  3TOI A;  4LV2 A;  2PT7 A;  3E4Q A;  3DBA A;  4YOF A;  2JKF A;  3C7U A;  3IBR A;  4MN6 A;  3SS4 A;  5JYO A;  4C75 A;  3O88 A;  3CHW P;  5HZH A;  4EET B;  1DJA A;  3G4P A;  3ISG A;  3E2K A;  3S7P A;  4I5S A;  3UB6 A;  3ZFZ A;  4JF6 A;  1PFL A;  4GDB A;  4EEP A;  3GEC A;  4OPR A;  4E04 A;  3UO9 A;  3DW0 A;  2WZX A;  4K0W A;  4DMZ A;  4L9F A;  3Q7V A;  4HH2 A;  3DTE A;  3WS1 A;  4GZB A;  1I2W A;  3HUM A;  4II7 A;  4JF5 A;  2Y2O A;  3AGD A;  5HAQ A;  2XF3 A;  5G4Y A;  5CGS A;  2LB9 A;  3IH8 A;  1CJF A;  1S4R A;  4C3Q A;  1ZC2 A;  3O87 A;  1XJ2 A;  4KUK A;  4HOI A;  3E4O A;  3MSH A;  2L0W A;  4PHT A;  5HD3 A;  3IX8 A;  4WYY A;  4Q8I A;  5GLD A;  3O86 A;  1WYB A;  2JKR I;  1NRF A;  4WL9 A;  1VEU B;  1CEG A;  2G7U A;  2XH9 A;  3MKF A;  3PAE A;  3HBR A;  4OQH A;  1AXB A;  1JWZ A;  1T1B A;  3P09 A;  3IWI A;  3CUE C;  2XQZ A;  2D01 A;  3G34 A;  4Z1W A;  4S2P A;  1TDL A;  2KX6 A;  3WRZ A;  5M18 A;  2VGJ A;  2VX8 A;  4OPQ A;  2W3D A;  1JWV A;  1TS7 A;  3HLB A;  4PAU A;  5EVE A;  5HDC A;  2ZOH A;  1H0M A;  1SZV A;  3ZG0 A;  3N8L A;  4LV3 A;  3ZCZ A;  4CLC E;  3C4O A;  3HVF A;  4NG2 A;  1VET B;  4GHI A;  1S0W A;  1V9Y A;  3EOI A;  3IXH A;  2QJ7 A;  2HDS A;  2O0Y A;  1TEM A;  1L2S A;  1XJ4 A;  3WS4 A;  4CLC D;  2A49 A;  5GHY A;  2H5S A;  5IHV A;  1SDE A;  3BFG A;  3G2Y A;  4PKY A;  1K0K A;  4OQI A;  2QPN A;  2WKE A;  5CEB A;  1OTA A;  3JPU A;  4G3K A;  5EPH A;  5CXW A;  2DMW A;  5AQB A;  5CTN A;  3VOY A;  5KSH A;  4L0L A;  3QP1 A;  1OTI A;  3RXW A;  1XFN A;  4IVI A;  3VFH A;  2P08 A;  5DKL A;  2UWX A;  2W3F A;  3UMD A;  1YKD A;  2ZOI A;  4OP5 A;  5DTT A;  1XXM A;  1FR1 A;  4DDY A;  4WMC A;  4GD8 A;  4EUV A;  2PD7 A;  1OPX A;  3M6H A;  5G18 A;  1K4F A;  3C5A A;  3UPO A;  1IEL A;  3MS6 A;  4NEE D;  3V5M A;  4A5R A;  2QJ5 A;  5JYP A;  5HWV A;  4MEZ A;  2UV0 E;  5L10 A;  4GD6 A;  1Y54 A;  1GA0 A;  3IH9 A;  4UEY A;  1NLZ A;  4NXG A;  3O3V A;  3NEC A;  1CI9 A;  1K4E A;  4HJ4 A;  2FFY A;  4EU0 A;  1XPB A;  3LR4 A;  3VE3 A;  2H10 A;  4HNB A;  1MXO A;  4Y0O A;  1RCJ A;  3V3R A;  1T1C A;  3NY4 A;  1TS6 A;  2P04 A;  4MBK A;  4FD8 A;  4G3W A;  1DJC A;  1CI8 A;  1LL8 A;  3T4J A;  3UN7 A;  1XJ3 A;  3ZG5 A;  3LO7 A;  2Q9M A;  4R70 A;  3T50 A;  4CPK A;  2NUP C;  3C2W A;  2JKT I;  3Q7V B;  1Y4O A;  3S22 A;  3LIB A;  3RH8 B;  3AGF A;  1N9B A;  1LLB A;  4OOY A;  3IF6 C;  1P0Z A;  1ONH A;  3MKE A;  3BJN A;  4H6J A;  5EEC A;  4LEN A;  4P6B A;  5A91 A;  3Q07 A;  1ES5 A;  1KVL A;  3NBL A;  2HDQ A;  4Z9Q A;  3TSG A;  4PMA A;  4WLA A;  1MC0 A;  3OPL A;  2WGV A;  4IBX A;  4ID4 A;  3MQ0 A;  4QY5 A;  5MC7 A;  1K56 A;  4GS9 A;  4I3I A;  1LT0 A;  3ZVT A;  3IWQ A;  3ZG9 B;  4X55 A;  3ICY A;  4DE1 A;  4O7D A;  1O7E A;  4E3J A;  4Y7P A;  5A93 A;  1YLY A;  2W1T A;  3ZHH A;  4ME4 A;  2EWV A;  1K54 A;  3LFV A;  3NOU C;  3IS2 A;  4F3L A;  1XGI A;  4X25 A;  3UE1 A;  4OQ0 A;  4HBT A;  4OVD A;  2KLI A;  5CHM A;  5L2F A;  4GNU A;  1DP6 A;  1NY0 A;  5CTM A;  4C6Y A;  4R23 A;  5U47 A;  4E6W A;  2GDN A;  2ZC6 B;  1S6R A;  1YSP A;  4GHI B;  4FSF A;  2J80 A;  2XRO A;  3PBR A;  1G6A A;  5I5L A;  3CIT A;  3QNC A;  3HUO A;  4EV4 A;  1L3L A;  1Q2P A;  1D1J A;  1YLJ A;  2PU4 A;  4L9G A;  5DJU A;  3N7W A;  3F1O A;  2OOL A;  3VOL A;  1OT6 A;  2R9W A;  5FI2 A;  1IYQ A;  2WAD A;  3MBZ A;  4OH0 A;  4DXB A;  1IYP A;  3HUN A;  1VB6 A;  1V9Z A;  4HP9 A;  5CHJ A;  4P6Z S;  4UA7 A;  4JF4 A;  2JKT M;  1WA9 A;  3CI6 A;  3K2N A;  2Z2L B;  4RA7 A;  3ZDJ A;  2X01 A;  3N8S A;  2I72 A;  5HAI A;  5GL9 A;  3VMA A;  1MWR A;  3HRE A;  5DVA A;  1IOU A;  3A0V A;  4NXB A;  4CLC B;  1ES4 A;  2Y91 A;  5FA7 A;  4QB8 A;  4U0X A;  4ESP A;  1YLP A;  1YLW A;  5J8X A;  4OOM A;  4CLC C;  1VHM A;  1S4S A;  2WKR A;  1LL5 A;  3EGD C;  1JVJ A;  1LL9 A;  5HFO A;  3ZG8 B;  2OWJ A;  4PM6 A;  3LID A;  1XFQ A;  3LI9 A;  3VP0 A;  2BLS A;  1YMX A;  1G5U A;  3G32 A;  3MFD A;  3IX3 A;  4BEN A;  2ZC3 B;  1D06 A;  1XGJ A;  3UNW A;  2J7V A;  3CWF A;  2D02 A;  1MWS A;  5IU1 A;  5F6A A;  4M4X A;  3BEB A;  5F5Y A;  3T1R A;  1H3Q A;  2ZC4 B;  1KGG A;  3RTY A;  2Y2Q A;  4E3I A;  1OTB A;  3A3I A;  1HLU P;  4G3V A;  3NC8 A;  4NXF A;  5FEF A;  1S66 L;  2Y2J A;  4OON A;  4BL2 A;  3GV9 A;  5F68 A;  1W7F A;  2Y59 A;  4EQI A;  1CK3 A;  3DTK A;  1G68 A;  1N9O A;  1ONG A;  3FC7 A;  2V8F A;  4HBU A;  5EVI D;  1E25 A;  5FSR A;  4WEL A;  2Y2I A;  3HLW A;  3KO6 A;  4WZ4 A;  5GLA A;  2VGK A;  1YT4 A;  4PKY G;  2WUQ A;  3VOZ A;  4ZJ2 A;  3KSG A;  4GS9 B;  1PWG A;  1H5X A;  1BZA A;  5FQ9 A;  4E3N A;  3LUQ A;  2Y2P A;  2PHY A;  5EM1 A;  4E3O A;  5EVL A;  2W1T B;  4JPM A;  1K55 C;  5TBM A;  2BG1 A;  4FH4 A;  1ESI A;  4WUJ A;  5J3W A;  2O9A A;  1G6O A;  3IS2 B;  3RFB A;  4F3L B;  1K54 C;  4QHC A;  4OPZ A;  1EWZ A;  3U4L P;  1WE4 A;  2HDU A;  2L1M A;  2HDR A;  4WEJ A;  4Q0I A;  3CMZ A;  4JXW A;  3W4O A;  4QU3 A;  3LIF A;  3A3E A;  3C4P A;  2PRF A;  4EUZ A;  1SCW A;  1TS0 A;  1LI0 A;  1KOU A;  4Q0H A;  1OJG A;  3SW1 A;  2QWS A;  3EEA A;  1STZ A;  4Y0U A;  5FAP A;  4XXR A;  2HP5 A;  4X1M A;  3HCY A;  3W8K A;  1IEM A;  2XK1 A;  3MZF A;  4I3A A;  3F1N A;  4R0Q A;  5AVF A;  2ZQA A;  3F1O B;  4HJ3 A;  5HDS A;  1RP5 A;  1BT5 A;  2ZD8 A;  4R38 A;  4WM9 A;  2VKS A;  2EA9 A;  1YLT A;  2EX2 A;  2VK3 A;  3FYZ A;  3PHY A;  2VA0 A;  5J4E A;  3IF6 A;  5GHZ A;  4O0P A;  1NYY A;  5BOH A;  2LB5 A;  3EWK A;  4U3T A;  2K31 A;  3CJM A;  3W4P A;  4OP8 A;  5FDH A;  4PM5 A;  3BY9 A;  2Z6D A;  2ZC7 A;  3JYI A;  3MXR A;  1E3U A;  1ZHH B;  3DWK A;  1PNE A;  4LLO B;  3R4K A;  2M7V A;  4O8G A;  5KIZ A;  3O5Y A;  4EER A;  2V2F F;  5D3O A;  1TDG A;  3VV4 A;  1ZG6 A;  3IWO A;  3D9Y A;  1Z6F A;  2ZLY A;  4DXC A;  2ZQC A;  4ZTK A;  1BUE A;  1ES3 A;  2VLG A;  5A90 A;  1K6R A;  5AQ7 A;  5HDD A;  3M2K A;  4PPR A;  3B33 A;  2E8J A;  5DFX A;  3BW6 A;  1S1Z A;  4DN0 A;  3DAV A;  4N92 A;  4DJ3 A;  3A3D A;  3N4I A;  1PWC A;  3BYD A;  3KYE A;  4Y13 A;  2ZQD A;  3V3S A;  4GDN A;  1OT9 A;  3FPV A;  3IXG A;  4BL3 A;  3S1Y A;  4R3B A;  1ALQ A;  2QMI A;  4GLQ A;  3C7V A;  3E0Y A;  5EFW A;  2O9C A;  4Q0J A;  4M3K A;  2H0T A;  2V20 A;  3H82 A;  3I7J A;  2XGN A;  4P0M A;  3VP2 A;  5KSC A;  3F1P A;  3ULF A;  3KYQ A;  1K25 A;  5FL3 A;  3TW8 A;  4UQI M;  2YKH A;  1FSY A;  4ETX A;  4JXG A;  5KZH A;  2GX5 A;  4S2J A;  2Y2K A;  3TRC A;  3W2Z A;  5M19 A;  1NZU A;  2L4R A;  4EW7 A;  2J3T D;  4R1G A;  3ZYT A;  4QWO A;  2ZMA A;  2OLV A;  3CLO A;  3CG5 A;  1GHM A;  4P85 A;  3UDI A;  4WZ5 A;  2ZQ8 A;  4MN5 A;  2RCX A;  3Q7Z A;  3V50 A;  4JGP A;  3FWL A;  1TVF A;  1D7E A;  1BSG A;  2Y2H A;  3BLM A;  1HZO A;  1K38 A;  4RQ9 A;  1IKG A;  4S2N A;  2V1A A;  5TBM B;  1KE0 A;  1T1A A;  1DJB A;  2Y55 A;  3PBS A;  2HV1 A;  5DF9 A;  1K57 A;  2DRW A;  3T4L A;  2E8I A;  4Y3I A;  5HX9 A;  5J7E A;  3SS3 A;  4CLC A;  2GZA A;  3EQV A;  4K0X A;  4EBN A;  1Y28 A;  2EX9 A;  3FPW A;  4N9L A;  4EWF A;  4MDZ A;  2JC7 A;  5C5K A;  3IT9 A;  2A2L A;  3Q82 A;  1W5D A;  4E3M A;  3TJZ C;  2JKR M;  3F1N B;  5EOO A;  2KDK A;  5EVI C;  5KMW A;  3T4S A;  1JWP A;  1J3W A;  2XFS A;  2RL3 A;  2V0U A;  3IX4 A;  1L0F A;  5DTK A;  1CEF A;  1FIK A;  3RXX A;  5DF7 A;  4KZ5 A;  4HES A;  1EI5 A;  2PR6 A;  3IF6 B;  1WYC A;  3NOT C;  3WRT A;  3IBJ A;  1EW0 A;  2PD8 A;  5EOE A;  3PXP A;  1IYS A;  1FQG A;  2JCH A;  4K91 A;  2OLU A;  2ZL1 A;  5E43 A;  3QP5 A;  4B4X A;  4MMN A;  2VV8 A;  2O99 A;  3DTM A;  2Y4A A;  3B3X A;  2XD1 A;  5AQ9 A;  4WBG A;  3SH9 A;  3NOP C;  4B9O A;  3H9W A;  3VP1 A;  1ZG4 A;  1TS8 A;  1KVM A;  3N8R A;  1K55 A;  3PBQ A;  3G31 A;  4QPR A;  2DNS A;  1BTL A;  3D3O A;  1ZTU A;  2B5R A;  1YLZ A;  3OCL A;  4X56 A;  3UB9 A;  4FOF A;  1XX2 A;  4ETZ A;  3CPT A;  3ZG7 B;  5FDS A;  5FAS A;  3PAG A;  4KZ3 A;  2DCF A;  3GTC A;  1W79 A;  2Y2N A;  1O07 A;  1G28 A;  3H82 B;  2Z2M B;  2B18 A;  3HLC A;  4LPZ A;  2ZMV A;  3VSK A;  1KDS A;  2HZ5 A;  1JTG A;  1PZP A;  3C38 A;  2EFU A;  3F1P B;  3ZVW A;  4KG2 A;  1MY8 A;  2OSU A;  5K5B A;  4GOG A;  4KQD A;  5E2H A;  4LRX C;  3MFX A;  4OOL A;  1DRM A;  1FIL A;  5DKK A;  4X69 A;  3LEZ A;  2ZC5 B;  3A0S A;  1ACF A;  3FZC A;  2O9B A;  3P7N A;  2W27 A;  2WYX A;  1P9R A;  3BFC A;  4Y5F A;  3OPH A;  2WKH A;  3ITB A;  1J9M A;  4FUW A;  3GDI A;  3K3C A;  5FI7 A;  4WZ5 C;  1TF1 A;  3N6I A;  3OOV A;  5FQM A;  4N1H A;  4EES A;  3LIC A;  1P9W A;  1DP8 A;  4IUH A;  2QKP A;  5A92 A;  3W4Q A;  4S2N C;  1NWZ A;  2OWH A;  4JGQ A;  1I5Q A;  1YM1 A;  2BTF P;  4EQ1 A;  2W0N A;  4HIA A;  1K57 C;  3P01 A;  1AWI A;  2J9P A;  4IHQ A;  2WAF A;  4R6L A;  1MWU A;  2EX8 A;  1PIO A;  4JXV A;  2WKI A;  3E98 A;  5E2G A;  1S1Y A;  3UDF A;  4UA6 A;  2ACG A;  4RYE A;  4BD0 A;  4ZRR A;  4KEN B;  3HL9 A;  5TFQ A;  1YMS A;  2J3T C;  4HP4 A;  2HPB A;  5L09 A;  1Z09 A;  3LR0 A;  4O01 A;  1GSX A;  4KQR A;  3MJQ A;  1M6K A;  2XSS A;  3OPR A;  1F5M A;  3NCK A;  3BRM A;  3UPN A;  3B47 A;  4DE3 A;  2FFF B;  2JBF A;  2A3U A;  2JN7 A;  4AFI A;  4OQG A;  1L0E A;  1PI5 A;  3QP8 A;  4KZ6 A;  2V1Z A;  2ZL1 B;  1ESU A;  2ZQ7 A;  4Y0T A;  1F9I A;  2R78 A;  3LY4 A;  2JHE A;  1CF0 A;  4N9K A;  3NDG A;  2IA2 A;  3OCN A;  3M6B A;  4R4S A;  4JKT A;  4DRT A;  3IF5 A;  4ARZ A;  3FKV A;  2Q0O A;  3MZE A;  5HAR A;  3UE3 A;  5DFY A;  4GKU A;  2ZMF A;  4BJP A;  1FCM A;  5AQA A;  2PAV P;  3BQ8 A;  5HWT A;  1ERM A;  3IQA A;  2PR5 A;  5TJJ A;  5A8B A;  2VGL M;  4HJ6 A;  4Y2F A;  2Y8H A;  1NYM A;  2Y2M A;  3PBN A;  4LV1 A;  4U0T A;  2V9A A;  3OLO A;  4BMW A;  4EEU A;  2QHK A;  4R3A A;  2GJ3 A;  1PI4 A;  3BM6 A;  5LBR A;  3SS5 A;  2HF6 A;  2OV5 A;  3CPT B;  3IHB A;  1U60 A;  4IED A;  4Y17 A;  3B42 A;  2ZJ9 A;  2BAS A;  4D2O A;  1ZKJ A;  3MMH A;  4S2I A;  4DF6 A;  3VP4 A;  4KG5 A;  4NXE A;  5HL6 A;  2IWD A;  3L7H A;  4YNR A;  3MR0 A;  3A3J A;  5EVI A;  3S7N A;  2QYB A;  4UHU A;  2M1C A;  3P98 A;  1LHY A;  3PBT A;  1RGY A;  3LYX A;  3SOI A;  2VEA A;  3G30 A;  4KZ9 A;  4YIN A;  1W8Q A;  4QJG A;  3KX0 X;  4KUO A;  4I39 A;  4DKI A;  5CEC A;  1ERO A;  3SZT A;  3LGO A;  5GHX A;  3T1Q B;  1NJ4 A;  3BFF A;  1YPR A;  3S7Q A;  4E6X A;  3MQO A;  3BQA A;  1GHP A;  4E3K A;  3GRJ A;  2PYR A; 
#chains in the Genus database with same CATH homology
 1T1A A;  3HJI A;  3IS2 A;  4YWZ A;  1GSV A;  3R7W B;  3T4Q A;  3S7O A;  4F3L A;  3PBS A;  2HV1 A;  2ZBB A;  5DF9 A;  2KLI A;  3T4L A;  4DJ2 A;  2CMN A;  2GNX A;  1DP6 A;  2MJ6 A;  3NHQ A;  4Y3I A;  3UB8 A;  4GW9 A;  3C30 A;  4IJG A;  5J7E A;  1UWP X;  4CLC A;  2GZA A;  3EQV A;  1YSP A;  4GHI B;  4FSF A;  2J80 A;  1Y28 A;  3G6O A;  3PBR A;  3FPW A;  2XRO A;  5I5L A;  4H6J B;  3OC2 A;  3CIT A;  4MDZ A;  2H28 A;  5C5K A;  2B02 A;  4KQO A;  1YSQ A;  2A2L A;  2A24 B;  4L9G A;  2W3E A;  5DJU A;  3TJZ C;  2JKR M;  5IS1 A;  2VJW A;  5F69 A;  3F1O A;  2OAP 1;  2OOL A;  2V1B A;  3F1N B;  4HY8 A;  1T18 A;  2KDK A;  3VOL A;  1OT6 A;  3T4S A;  3KSI A;  3LI8 A;  2V0U A;  5CX7 A;  4HH3 A;  5G4Z A;  3OBF A;  1T19 A;  5L8M A;  2PR6 A;  4L9E A;  1UWN X;  3K3D A;  3NOT C;  3IBJ A;  1EW0 A;  2PD8 A;  1VB6 A;  1V9Z A;  1OJ5 A;  3PXP A;  4HP9 A;  1S67 L;  4P6Z S;  2M7U A;  5IT5 A;  2P7J A;  1MKM A;  2JKT M;  1WA9 A;  3CI6 A;  1X0O A;  3V67 A;  3K2N A;  2HJ9 C;  4IUK A;  2VV7 A;  4LRY C;  4MMN A;  2VV8 A;  2O99 A;  1NRJ A;  5AVE A;  1OTD A;  2XA7 S;  4JGO A;  2INW A;  4HHD A;  4HI4 A;  1IOU A;  2PDR A;  3A0V A;  3JVV A;  4NXB A;  2FZ0 A;  2YKF A;  3NOP C;  4B9O A;  1LSV A;  4CLC B;  2VGL S;  3H9W A;  2W3G A;  3HJK A;  4ARZ B;  5DJT A;  5HPI A;  1TS8 A;  4XT2 A;  2PT7 A;  1BYW A;  3DBA A;  3E4Q A;  3PR6 A;  4OOM A;  4YOF A;  4CLC C;  3IBR A;  2XRN A;  4MN6 A;  1VHM A;  1S4S A;  3LIA A;  2WKR A;  3PBQ A;  4QPR A;  3VE4 A;  3EGD C;  5HZH A;  4EET B;  3D3O A;  3BY8 A;  1ZTU A;  3TE8 A;  2FH5 A;  3OCL A;  1W63 M;  3S7P A;  2OWJ A;  4I5S A;  3UB6 A;  3LID A;  1XFQ A;  3LI9 A;  3GEC A;  4EEP A;  4E04 A;  2WKP A;  3UB9 A;  3H7W A;  4FOF A;  4DMZ A;  4I38 A;  4ETZ A;  1F98 A;  4L9F A;  1D06 A;  1N9L A;  3CWF A;  4HH2 A;  4WEK A;  2D02 A;  5HD5 A;  3LIE A;  4II7 A;  3A0R A;  5IU1 A;  5F6A A;  4M4X A;  5F5Y A;  1H3Q A;  3RTY A;  1G28 A;  2Z6C A;  3H82 B;  1OTB A;  3MQQ A;  2B18 A;  4LPZ A;  2ZMV A;  5G4Y A;  2LB9 A;  4G3V A;  1S4R A;  3C38 A;  1H8M A;  4NXF A;  3F1P B;  4WF0 A;  1JNU A;  1S66 L;  1N9N A;  2VZW A;  5K5B A;  4KQD A;  1XJ2 A;  4LRX C;  2W3H A;  5F68 A;  3MFX A;  4OOL A;  1DRM A;  3NJA A;  4KUK A;  4HOI A;  5DKK A;  1N9O A;  3E4O A;  2L0W A;  3FC7 A;  5AJG A;  4P6Z M;  4PHT A;  3A0S A;  4BBU A;  2O9B A;  4WEL A;  5HD3 A;  3P7N A;  3UE6 A;  3KO6 A;  2W27 A;  1P9R A;  2JKR I;  4PKY G;  4Y5F A;  3KSG A;  4GS9 B;  4WL9 A;  2J3W A;  2G7U A;  3LUQ A;  3GDI A;  2PHY A;  4GJ4 A;  1T1B A;  3K3C A;  4BBT A;  3CUE C;  1TF1 A;  2D01 A;  3OOV A;  4Z1W A;  3MF0 A;  2W1T B;  1UGU A;  5TBM A;  2KX6 A;  2VX8 A;  3R7W A;  4EES A;  3ZQ5 A;  3LIC A;  4WUJ A;  2W3D A;  1TS7 A;  1P9W A;  5J3W A;  3EEH A;  4PAU A;  2O9A A;  1G6O A;  3IS2 B;  3RFB A;  4F3L B;  5HDC A;  2ZOH A;  1DP8 A;  1MZU A;  2QKP A;  4IUH A;  1NWZ A;  2OWH A;  3KSF A;  4NKP A;  1IFQ A;  2L1M A;  4JGQ A;  4CLC E;  4WEJ A;  4Q0I A;  3LIF A;  3T4K A;  4EQ1 A;  4GHI A;  2W0N A;  4HIA A;  3P01 A;  3EOI A;  1V9Y A;  3CAX A;  2OAQ 1;  1TS0 A;  2QJ7 A;  4IHQ A;  1KOU A;  2EWW A;  3LR3 A;  4R6L A;  2O0Y A;  4Q0H A;  1OJG A;  3SW1 A;  1XJ4 A;  4CLC D;  1LSX A;  2QWS A;  3EEA A;  1STZ A;  2K2N A;  3E98 A;  1S1Y A;  2A24 A;  2V0W A;  3HCY A;  4PKY A;  4ZRR A;  4EXO A;  4BBV A;  4I3A A;  2NUT C;  3F1N A;  5AVF A;  1OTA A;  3F1O B;  4HJ3 A;  5HDS A;  2J3T C;  4HP4 A;  4G3K A;  2DMW A;  1ODV A;  5KSH A;  3LR0 A;  4R38 A;  3JVU A;  4MN7 A;  2VKS A;  2EA9 A;  2WKQ A;  4O01 A;  2W1R A;  4L0L A;  1GSX A;  1OTI A;  3MJQ A;  1DP9 A;  2XSS A;  1XFN A;  2I9V A;  3PHY A;  1F5M A;  2VA0 A;  5J4E A;  3PBO A;  2P08 A;  2PYP A;  5DKL A;  4O0P A;  4K08 A;  4GCZ A;  2LB5 A;  3B47 A;  2W3F A;  3EWK A;  4UQI S;  2K31 A;  3UMD A;  1YKD A;  2ZOI A;  2JN7 A;  3BY9 A;  4EUV A;  4AFI A;  2Z6D A;  3EGX C;  2PD7 A;  3FG8 A;  1ZHH B;  1OPX A;  1XJ6 A;  3E4P A;  4LLO B;  3R4K A;  3EQU A;  2M7V A;  1F9I A;  2R78 A;  3UB7 A;  4O8G A;  4WN5 A;  2KOI A;  4NEE D;  2JHE A;  2QJ5 A;  5KIZ A;  5HWV A;  4B93 A;  2IA2 A;  3O5Y A;  4EER A;  5HPF A;  3OCN A;  3VV4 A;  3KYZ A;  4UEY A;  3PYP A;  4JGR A;  4ARZ A;  1NLZ A;  4NXG A;  4I3J A;  3LR5 A;  2VLG A;  4HJ4 A;  3UE3 A;  1NLY A;  4XT2 B;  5DFY A;  1GSW A;  1LSW A;  4EU0 A;  2ZMF A;  4CQH A;  4BJP A;  5HDD A;  3BQ8 A;  3LR4 A;  5HWT A;  3VE3 A;  2XA7 M;  4HNB A;  3B33 A;  5DFX A;  2PR5 A;  5TJJ A;  3T4O A;  5A8B A;  3BW6 A;  1S1Z A;  4DN0 A;  1T1C A;  2VGL M;  4HJ6 A;  4Y2F A;  1TS6 A;  2P04 A;  2Y8H A;  4DJ3 A;  4G3W A;  3PBN A;  5HSQ A;  2V9A A;  3OLO A;  4BMW A;  1YAX A;  1LL8 A;  4EEU A;  3T4J A;  3U2A A;  2QHK A;  4R3A A;  2GJ3 A;  1OT9 A;  3FPV A;  3H7W B;  1XJ3 A;  5LBR A;  2HF6 A;  4R70 A;  3T50 A;  2NUP C;  3C2W A;  3UME A;  2JKT I;  4GLQ A;  2K7S A;  3E0Y A;  3LIB A;  4HQA A;  5EFW A;  3RH8 B;  3B42 A;  2O9C A;  2BAS A;  4Q0J A;  3H82 A;  3MMH A;  1P0Z A;  3BJN A;  4H6J A;  4NXE A;  2HGV A;  3F1P A;  3ULF A;  3KYQ A;  5HL6 A;  5FL3 A;  3TW8 A;  4YNR A;  3MR0 A;  4UQI M;  3C8C A;  3S7N A;  2YKH A;  2QYB A;  4WLA A;  4ETX A;  2M1C A;  2GX5 A;  2VV6 A;  1MC0 A;  3PBT A;  3TRC A;  3W2Z A;  2L4R A;  4EW7 A;  1W63 Q;  2J3T D;  3ZYT A;  3MQ0 A;  3CLO A;  3LYX A;  2VEA A;  4BWI A;  1TD5 A;  3BWL A;  5MC7 A;  3KX0 X;  3CUE A;  4GS9 A;  4I39 A;  4I3I A;  4KUO A;  1LT0 A;  4MN5 A;  4JGP A;  3KSH A;  3D72 A;  3ICY A;  1P97 A;  2Y79 A;  1D7E A;  2W1T A;  4MCW A;  4RQ9 A;  3S7Q A;  3MQO A;  3BQA A;  4LRZ E;  4ME4 A;  2EWV A;  1OTE A;  3MXQ A;  5HWW A;  3LFV A;  2PYR A;  2HJE A;  3NOU C;  3T4T A;  2V1A A;  5TBM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...