4NXFA

Crystal structure of ilov-i486(2lt) at ph 8.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
105
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDGSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Flavoprotein, fluorescent protein
molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 32
structure length 105
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxfA00
4WUJA 3K3CA 1JNUA 4BBUA 2OOLA 4NXGA 2VLGA 3CWFA 5J3WA 2Z6DA 1TS7A 4NXEA 4HJ6A 2B02A 3ZQ5A 4LRXC 4XT2B 4JGRA 3A0SA 4HP9A 4WL9A 2V9AA 1GSWA 5HSQA 4I38A 3UE6A 2VV6A 1EW0A 1KOUA 2J80A 3VE4A 2VV8A 3C2WA 2V1AA 3LYXA 4NXBA 5KIZA 4DJ3A 1DP6A 5IS1A 1XJ2A 1OTBA 1OTDA 4KUOA 1T1AA 1V9ZA 1GSXA 2BASA 3NOPC 5EFWA 1LSWA 2GJ3A 4EERA 2A24A 1S1ZA 4DJ2A 2L0WA 5HD5A 4L9GA 4H6JB 3IS2A 3BWLA 3UMDA 1VB6A 4HOIA 3F1NA 1N9OA 4JGQA 1DP8A 3OLOA 3LIBA 5J4EA 2R78A 5HDSA 2ZBBA 5F6AA 5DKKA 2YKFA 2K7SA 4HH3A 3UB8A 3EEHA 4I3JA 3MQOA 4HQAA 1XJ6A 2QHKA 3PYPA 3UB7A 4L9FA 4F3LA 3E4QA 4XT2A 2WKPA 3FG8A 4R3AA 3GECA 3ULFA 3G6OA 4GHIB 2WKQA 4EETB 3LI8A 3CAXA 1TS0A 5AVEA 1DRMA 3NOUC 1S66L 3CLOA 4PKYA 2INWA 3LIAA 4HH2A 4I5SA 3ICYA 1T18A 4B9OA 4HHDA 4HJ4A 1OTEA 4I3IA 3IBRA 4YWZA 1LSVA 4K08A 3NJAA 5F68A 5HZHA 1X0OA 1T1CA 2L4RA 3A0RA 4HIAA 3H9WA 3MQQA 4JGOA 4GS9B 3H82A 5HDDA 2P7JA 4R70A 5A8BA 5HDCA 2PR6A 1XJ3A 4L9EA 1XFNA 2EA9A 4R38A 3C8CA 3F1OB 2Z6CA 3BY9A 3LI9A 3EWKA 2W27A 1D7EA 2JHEA 1S1YA 2V1BA 2CMNA 1Y28A 4R6LA 4JGPA 1F9IA 2I9VA 2WKRA 3LIEA 1NWZA 2PDRA 2M1CA 4LLOB 3HJKA 5F69A 3VOLA 5HWTA 2QJ5A 4HNBA 5HWWA 3BY8A 2VV7A 1GSVA 1OT6A 4WN5A 1MZUA 4GHIA 2ZOHA 3P7NA 3F1PB 4PKYG 4MN6A 5G4YA 3RH8B 2PHYA 2A24B 1OJGA 3UMEA 3GDIA 3KX0X 4LRYC 2QJ7A 2V0UA 1V9YA 5DKLA 1OT9A 4HP4A 3IS2B 5F5YA 3LIFA 5DJUA 4HJ3A 2KDKA 4EW7A 3PHYA 1G28A 1T19A 5IU1A 3SW1A 1TS8A 1DP9A 3UB9A 2D01A 4GS9A 5TBMB 1LL8A 3MXQA 3LICA 5DJTA 1T1BA 3F1OA 1UWNX 3E4OA 2ZOIA 4EESA 4H6JA 1WA9A 4KUKA 2D02A 4HI4A 3B33A 2VEAA 2QKPA 4NXFA 2V0WA 1D06A 4HY8A 4F3LB 2PD7A 3E4PA 3H7WB 3MR0A 1OTAA 3LIDA 1TS6A 2L1MA 4LPZA 1OJ5A 2KX6A 4BBTA 1UWPX 1N9NA 4EXOA 1XFQA 2PR5A 3MJQA 3FC7A 2W0NA 3LUQA 3NHQA 1N9LA 1P0ZA 3F1PA 4KQDA 2QWSA 2JN7A 4GW9A 4I39A 3UB6A 5I5LA 1XJ4A 4WLAA 2HV1A 4MN5A 3HJIA 1S4SA 3RTYA 4BBVA 4E04A 5HWVA 4I3AA 4WF0A 5AVFA 1F98A 1ODVA 1P97A 3NOTC 3H82B 4EEUA 1S67L 1BYWA 4LRZE 5TBMA 5J7EA 2PD8A 2OWHA 2PYRA 4RQ9A 1LSXA 1UGUA 3D72A 3F1NB 1LT0A 4EEPA 4EQ1A 4M4XA 1OTIA 3K3DA 3T50A 1S4RA 2YKHA 2OWJA 3H7WA 4GCZA 2PYPA 3VE3A 5HD3A 5G4ZA 3MFXA 2H28A 3A0VA
chains in the Genus database with same CATH superfamily
3B47A 2VLGA 4BL2A 2Y2GA 3CWFA 3KYEA 2Z6DA 4JXVA 4BWIA 4KZ7A 4XT2B 2HGVA 3A0SA 3NDGA 4HP9A 4WL9A 5FQMA 3UDFA 2E8JA 4I38A 1K25A 3KYZA 2VV6A 3N6IA 2ACGA 4OQIA 1KOUA 1YLPA 3C2WA 5KIZA 5HAIA 2Y2HA 4OOLA 4UA7A 1ES3A 1MY8A 1AXBA 2ZQ9A 2XDMA 2Y59A 2BASA 3D4FA 5EFWA 4JF4A 3CUEA 2O0YA 2P08A 4KZ5A 4BJPA 1MPLA 3KO6A 4H6JB 4HBUA 4OH0A 1VB6A 4K91A 1K38A 4OOMA 3IF6A 4BD0A 1DP8A 2ZBBA 4R0QA 2V2FF 5EV0A 4OPYA 1IYSA 4UEYA 3ITAA 5CTMA 4HH3A 1ZG6A 4E6WA 3MKEA 3T12B 1NZOA 4KQQA 1RGZA 3T4OA 4HQAA 1FR6A 3M6BA 2QHKA 5E2GA 4GN2A 4N1XA 2XROA 4CQHA 1RGYA 4F3LA 4WEKA 5EVIB 4Y5FA 3E4QA 4EBLA 1KDWA 4EUZA 1RCJA 4M3KA 2ZM0A 4KG2A 1SZVA 3FG8A 4QHCA 2HP9A 3EOIA 3G6OA 1PWDA 3GMWA 5AVEA 5FAOA 1PI4A 3U4LP 3NOUC 2ZC6B 1RP5A 3CLOA 4PKYA 3OPLA 1MBLA 3ZGAB 2INWA 4HH2A 4Q0HA 4HJ4A 5FDSA 3TOIA 1ZHHB 5E2EA 1OTEA 1MC0A 4UQIM 1CI8A 2HDUA 1BZAA 3IBRA 4YWZA 3FPWA 2W3HA 1YLZA 5F68A 1XP4A 2IWCA 1T1CA 4LFUA 3QNBA 1YPRA 4XUXA 1BLCA 3S7PA 4DKIA 4HEFA 1O07A 3H9WA 4RX2A 1K6SA 1W63Q 3BFFA 4R70A 5HDCA 1XJ3A 1KVLA 4YNRA 3S7QA 4R38A 1E3UD 1YSPA 3QP2A 2Y2NA 3BY9A 5HPFA 2W27A 2DRWA 5GLBA 2I9VA 1NWZA 5GHXA 4LLOB 5F69A 2HDQA 4K0XA 4WELA 4X25A 3BFDA 4HNBA 5HWWA 3OPPA 3FV7A 1PWGA 1H0MA 2O9BA 2VV7A 5FI6A 1YT4A 4NEED 1VQQA 1GSVA 4BLMA 4GHIA 4OP8A 4O01A 3P7NA 4JLFA 4KG6A 3Q7VA 1G5UA 1VETA 1M40A 3BYDA 3F1PB 3PBRA 2JCHA 1YM1A 4MN6A 1NLYA 4S2JA 1ESUA 4P6BA 3ZNTA 4X55A 2PHYA 4OPZA 3QHYA 1LL5A 5DKLA 2J3TC 1FCMA 1ZC2A 1TDLA 1K55A 3GV9A 3V67A 2EX2A 3IF6B 5L10A 3MZDA 1LI0A 2KDKA 2JE5A 5HAQA 2ZMFA 4Q0JA 4N1HA 1E3UA 5IU1A 3SW1A 1KGGA 5M18A 1TS8A 3UN7A 2I72A 1TDGA 4LENA 4P85A 4GS9A 3O86A 3DTIA 1D1JA 1KDSA 3LICA 4QB8A 4WZ5C 4A5RA 4N92A 3E4OA 4X6TA 3E2KA 2E8IA 1K4EA 3NC8A 1BLHA 4Y17A 1EROA 5KMWA 4F3LB 2XK1A 4R4RA 3A3JA 3E4PA 4QJGA 3CITA 1TS6A 3QNCA 4DE3A 2A49A 2Y2JA 4LPZA 3IHAA 2Y2PA 1UWPX 5DVAA 3R7WB 2PBYA 2V1ZA 1XFQA 2PR5A 4PM5A 1NRJA 4P0MA 4CLCD 4EUVA 4E3JA 2JN7A 2ZC3B 3BRMA 1VEUB 1J9MA 5BOHA 3MMHA 3TW8A 4FSFA 4UHUA 3RTYA 5IT5A 3MBZA 2EFXA 2A2LA 4GD6A 2EWVA 2XFTA 4Y7PA 3VSKA 3W4QA 3HLBA 4EV4A 4LV1A 1VM1A 3TJZC 4RVAA 4OONA 3UDIA 2HJ9C 3UO9A 3ZYTA 4RA7A 4D60A 4KZ8A 3T4TA 2OSUA 5TBMA 1AWIA 3Q82A 3OPHA 5EVEA 2PD8A 2Y2MA 2OWHA 3D72A 3F1NB 1LT0A 3MKFA 3MF0A 3VMAA 1N4OA 3LR0A 4M4XA 4OP5A 3K3DA 2PU4A 3T50A 2HJEA 2OWJA 4EWFA 2Y79A 1ERMA 2JC7A 4CLCA 4OOYA 4E3IA 2WK0A 1BUEA 3D3OA 5CGWA 4JBFA 3M6HA 2H28A 3CPTB 2OOLA 3Q7VB 1VETB 2HF6A 4II7A 2BLSA 3LR3A 4S2NA 3FKWA 1YLWA 1TS7A 4NXEA 1KE3A 2B02A 1G6AA 1IFQA 3G35A 4FH4A 4LRXC 3OCNA 1H8ZA 3VP3A 3HREA 1NZUA 4QY5A 1GSWA 5HSQA 3IBJA 1KE4A 3VP4A 1JWVA 1CEFA 3UB5P 3WS0A 4UQIS 2VV8A 4NXBA 2GX5A 4IHQA 2EX6A 2WZXA 3HLGA 4KZBA 1OTDA 1U60A 1DJAA 1T1AA 3N8LA 2ZC5B 1V9ZA 5GLCA 3BLMA 1IYQA 2OAQ1 4QU3A 2ZMAA 3ZG9B 3RJUA 4S2MA 5A91A 1S1ZA 4DJ2A 2L0WA 5HD5A 3ZG8B 1NYMA 3KYQA 3DAVA 2OAP1 3PR6A 4YINA 1N9OA 4WM9A 1H8YA 1GA0A 5HDSA 3KSFA 1NY0A 1NYYA 1GHPA 1Y4OA 3HUNA 2IWBA 1P9WA 5K5BA 2WUQA 1C3BA 5AJGA 4AFIA 2YKFA 3T4QA 2K7SA 2WGIA 2WAEA 2ZQAA 4FOFA 3EEHA 3TG9A 3KSHA 4E3MA 5L07A 2Y91A 1XJ6A 3PYPA 1YQSA 3T4LA 5AQ7A 3TE8A 1MWTA 1CJFA 3O87A 1IKIA 1I2SA 2XD1A 5I94A 2C6WB 4S2IA 3G32A 2Q0OA 4S2LA 5EPHA 2VK3A 1PI5A 2HDRA 3GECA 3BFEA 5GHZA 1SCWA 1MWUA 4Q0IA 2WKQA 5E2FA 4JXWA 2WKEA 2ZC7A 1TS0A 1TVFA 2Q9NA 3ICYA 5EVLA 4HESA 5EUAA 4HHDA 4OLGA 4B9OA 1CK3A 4Z9QA 1YKDA 4HBTA 4OQGA 4I3IA 5A93A 2K2NA 2W1RA 3PXPA 1LSVA 2ZL1A 5M19A 2BTFP 2PT7A 3HBRA 1BTLA 3HLFA 3WS1A 4OQHA 2KOIA 1FILA 4HIAA 2WZZA 3PBOA 4ARZB 5HPIA 1FR1A 2AVXA 4CLCB 1NJ4A 1XX2A 5FQIA 5HDDA 2P7JA 5E2HA 5A8BA 1HTZA 4KENB 2PR6A 1GCEA 4Y0TA 3C8CA 2J3TD 3EWKA 4IUKA 3JVVA 2JKTI 3AGFA 2CMNA 1Y28A 4L0LA 1F9IA 2WKRA 2PDRA 1TF1A 2M1CA 1YLYA 3VOLA 3PBQA 3S4XA 4ZBEA 3UE0A 4GDNA 3G31A 2QJ5A 5DTTA 4MBFA 2V20A 4E3OA 3S7NA 3BY8A 1WYCA 2VJWA 3NULA 4WN5A 1MZUA 1S6RA 3QP8A 5L09A 2OLVA 3BFGA 4X1MA 1I5QA 3MQ0A 5DF9A 5G4YA 5A92A 3UMEA 3GDIA 3IWOA 3KX0X 2QJ7A 3ZCZA 4S2OA 1F2KA 2XFSA 1L0EA 5F5YA 5DJUA 5F1GA 2H5SA 5FEGA 3PHYA 1NXYA 2X71A 2H10A 3AGEA 2G7UA 2ZD8A 4P87A 4U3TA 2G2WA 3EQVA 4QWOA 3D9YA 1K54C 1BLPA 3T1RA 4PMAA 4RX3A 1XGJA 1ZKJA 3M2KA 4JXSA 3LY4A 4Y2FA 3MXQA 2R9WA 4NK3A 4N9LA 3F1OA 1NLZA 1N9BA 5EM0A 4FTXA 4EESA 4KUKA 3B33A 2VEAA 4NXFA 2Y2LA 3Q81A 2V0WA 3IX3A 5C5KA 4HY8A 3N8RA 4G3KA 5L8MA 2ZQCA 4WZ5A 3A3DA 2PD7A 2MJ6A 3H7WB 3MFDA 2LB5A 3LIDA 2L1MA 1S0WA 4OPQA 4BBTA 5CEDA 3MJQA 2XEPA 2VX8A 2W0NA 2K31A 3GTCA 3LUQA 5TR7A 3NHQA 3LEQA 4MCWA 4RYEA 4WMCD 2P9VA 4KQDA 5U47A 1P9RA 4JPMA 3UPPA 3UB6A 5I5LA 1H8MA 5DF8A 4G3WA 4DDYA 3P98A 2ZL1B 5CECA 5KSHA 1LL9A 1ONHA 5CEBA 4F94A 4KZ4A 2HV1A 3ITBA 3ZFZA 3NBLA 3NY4A 2XLNA 4R4SA 2UV0E 5CXWA 2J9OA 1IYOA 3AGDA 1YAXA 1L0FA 4I3AA 1MKMA 4Y0OA 4EU0A 4CPKA 4IBRA 3EEAA 4GZBA 3TSGA 1L0DA 1HZOA 3S1YA 4UA6A 4YOFA 1BYWA 1TEMA 4EBNA 2EFUA 4DXBA 2X02A 2LB9A 5J7EA 4LV2A 5AQAA 1LSXA 2IA2A 3BEBA 4O0PA 2WYXA 4NKPA 3IH8A 4IEDA 4EEPA 1PNEA 5CHMA 3DBAA 1JTGA 1FQGA 4EQ1A 3E2LA 5EE8A 1OTIA 2JKTM 4P6ZM 2HPBA 2WGVA 2X01A 3P01A 5GHYA 4R3BA 3V39A 4WMCA 3FZCA 5HD3A 2ZM2A 3MZFA 3C38A 3NECA 4LCMA 3E0YA 4WUJA 1JWZA 1JNUA 1TD5A 1XA7A 4NXGA 4DE2A 2XSSA 5FI7A 4ETZA 1ACFA 5FAQA 1MXOA 4LGWA 1G6OA 4PM6A 3VV4A 3NI9A 1PFLA 4B4ZA 3O3VA 1OMEA 2PU2A 3G4PA 4KZ6A 3QP1A 4U0TA 3UPOA 4JKTA 4WEJA 2V9AA 3DTMA 3OC2A 2H0TA 2W3GA 3UE6A 5D3OA 1BLSA 5FATA 3TRCA 2DMWA 3UPNA 1JTDA 5LBRA 1WYBA 4GNUA 1BULA 1H5XA 3S7OA 2JKFA 1W8QA 1GSXA 3G30A 2A3UA 2J3WA 3ZG0A 1CEGA 1LSWA 4IUHA 4ME4A 4EERA 2A24A 1L2SA 1XPBA 4L9GA 4MBHA 5GLAA 2XR0A 4HOIA 4OPRA 4IVKA 4MLLA 3OLOA 5DTKA 5J4EA 1SHVA 4EQIA 3SS3A 4O8GA 2Z2MB 5EM1A 4DF6A 5F6AA 3EGDC 3FKVA 4ETXA 3MXRA 1QMEA 5DTSA 1HLUP 3B3XA 5CHJA 3FWLA 1BSGA 2UWXA 2FFFB 2QZ6A 1J3WA 4I3JA 3MQOA 4BL3A 4OQ0A 2ZQ7A 4LCLA 2P9VB 4H8RA 4KZAA 5CERA 1PZPA 5FAPA 4XT2A 4FCFA 2W3EA 1ESIA 4R3AA 5TJJA 1FIKA 1PW8A 1HD8A 3BQ8A 4GHIB 4EETB 3LI8A 4X69A 4MN7A 5F82A 3SS4A 3WS5A 4DN0A 3CAXA 4C3QA 2CC1A 3VP1A 4E3LA 4Y13A 3CZDA 3LIAA 1T18A 3HLWA 2VGJA 5FQQA 1OPXA 1O7EA 2NUTC 3HCYA 2JKRI 3CHWP 1X0OA 4OLDA 4X53A 3PAEA 1GHIA 5HFOA 4DXCA 1A0KA 3C7UA 2O9AA 2XA7M 1DJCA 3KSIA 3HUMA 3VOYA 4LV0A 1VHMA 3MQQA 4JGOA 4GS9B 3H82A 3QP6A 5HAPA 4OVDA 1FCNA 2EA9A 3ZNYA 2Z6CA 3SS5A 2JHEA 3LGOA 1IOUA 4X68A 3IXHA 3IWIA 4JGPA 3C5AA 5HARA 3HJKA 3ZG5A 2FH5A 4FH2A 3GVBA 4DE0A 3HUOA 1KVMA 1K6RA 4FUWA 1LLBA 5JYOA 4E3KA 4Q8IA 4K0WA 3Q07A 2FFYA 3DWKA 3ZDJA 4ZAMA 3L9KA 4XUZA 3UE3A 4ID4A 3WS2A 4PKYG 5M1AA 3BFCA 2XD5A 4MNRA 2A24B 1Z6FA 3WS4A 2G2UA 1V9YA 4HP4A 1W79A 3V50A 3C4OA 3LIFA 4E6XA 4QD4A 4HJ3A 2VZWA 4LV3A 4EW7A 1PWCA 5FSRA 1G28A 1T19A 1LHYA 4QPRA 5E43A 1F5MA 1ALQA 1FSWA 3DWZA 1SKFA 4B93A 5DFXA 1SDEA 4Z1WA 2ZC4B 2J9PA 3LR5A 3UB9A 3Q7ZA 5TBMB 2ZMVA 1K57C 1LL8A 4B88A 1Q2QA 1T1BA 1W63M 4P6ZS 4Y0UA 4ZTKA 4PHTA 3T4KA 3CG5A 1K54A 1WA9A 3QP4A 4HI4A 2QKPA 3EQUA 2QYBA 2WGWA 1D06A 4ZJ1A 2GZAA 2IWDA 3O88A 3ISGA 2V8CA 3B42A 3VSLA 2KX6A 2JKGA 3K2NA 3IT9A 1N9NA 4DE1A 3PAGA 2HP5A 2P74A 3HL9A 4BQMA 4ZJ3A 3MS6A 2Z2LB 1XA1A 3A3FA 3T4JA 5EVIC 3VFHA 2C5WB 1N9LA 4IBXA 4PPRA 3UY6A 1P0ZA 3F1PA 1SKOA 2OLUA 4GW9A 4I39A 4ESPA 1ZG4A 3T4SA 2VA0A 3RFBA 3IXGA 3KSGA 4O7DA 2EXBA 5KSCA 2Y2QA 3W4OA 3HJIA 1S4SA 3JVUA 3CI6A 3VP2A 2JKRM 1K4FA 4E04A 5DF7A 2WADA 2M7UA 5FQKA 3RXWA 3BM6A 1F98A 1P97A 3H82B 1Y54A 5F1FA 4EEUA 4LRZE 1Q2PA 4GJ4A 2B95A 4PM9A 3V3SA 2PYRA 3FPVA 1UGUA 3C4PA 3DTEA 3HVFA 3IQAA 4Y3IA 1ONGA 3BLSA 4B4XA 3IF5A 5FI2A 1E25A 4GCZA 4KZ9A 5CX7A 4WYYA 3NDEA 3RXXA 3R7WA 3A0VA 3JPUA 3K3CA 4BBUA 4D2OA 3E98A 3OZHA 3WRZA 2PRFA 5J3WA 4WZ4A 4HJ6A 3ZQ5A 3LO7A 4NETA 4GLQA 1FOFA 1VEUA 4JGRA 3C30A 3IHBA 1IEMA 4JXGA 2VGKA 3G2ZA 1EW0A 4IJGA 2W3DA 2J80A 3SH7A 3VE4A 2V1AA 3LYXA 3WWXA 3CUEC 4DJ3A 1DP6A 5IS1A 1XJ2A 2WKIA 1OTBA 4UA9A 4KUOA 5CGXA 4DRTA 3MZEA 3IF6C 5HW3A 2XA7S 3NOPC 2VGLM 2GJ3A 5HL6A 3CJMA 5J8XA 3SH9A 3IS2A 3ZG7B 3G34A 3BWLA 3UMDA 3UNWA 3F1NA 2WGWB 4GKUA 4JGQA 3LIBA 2R78A 4QY6A 1GHMA 5A90A 4GOGA 5DKKA 1XGIA 3PBNA 3N8SA 4ZRRA 1WE4A 5HL1A 5AQBA 2V8FA 3UB8A 2P04A 2W1TA 4S2KA 2H0YA 2Y2KA 3CPTA 2R9XA 2Y4AA 3SZTA 3QP5A 1SKOB 4KQRA 4MEZA 3PBSA 3UB7A 3M2JA 4L9FA 3HLCA 4ZJ2A 2QMIA 5IHVA 2WKPA 1DJBA 2EX9A 5KZHA 2XGNA 3BQAA 3ULFA 4BENA 2EX8A 3IX8A 2O9CA 1PRQA 3LY3A 2GDNA 1DRMA 1S66L 2OV5A 3R4KA 4I5SA 3VOZA 4MMNA 1YMXA 4BMWA 2W3FA 4GB7A 1GA9A 2M7VA 5MC7A 1QMFA 4DMZA 4K08A 3LR4A 3NJAA 3S22A 5HZHA 1PZOA 5HX9A 2HP6A 4R23A 4OKPA 4Y15A 1PYYA 4KG5A 2L4RA 3LCEA 1KGEA 3EGXC 1IELA 3A0RA 4PAUA 3HLEA 2J8YA 1MKIA 4MDZA 4CLCE 1CI9A 2ZQ8A 3C7VA 3DTKA 2GNXA 1W8YA 2XRNA 3IH9A 4L9EA 1XFNA 4KQOA 3ZVTA 3F1OB 3LI9A 3IXDA 1D7EA 1S1YA 5FQJA 3Q1FA 2V1BA 4R6LA 4PM8A 2ZM8A 1HVBA 3LIEA 2Y55A 1FSYA 4GD8A 3OOVA 3JYIA 1KE0A 3HLDA 2VKSA 2Y2OA 5HWTA 5CRFA 5G18A 3W4PA 1PW1A 3CMZA 5FQ9A 1ES4A 3ZVWA 4S2PA 3P09A 2RCXA 4E3NA 2KLIA 3DW0A 3A3EA 4GDBA 1OT6A 5DFYA 2ZOHA 1NRFA 5FL3A 4CJNA 1CF0A 5L2FA 1W7FA 4JF5A 1L0GA 1EWZA 1SDNA 3W8KA 1K55C 1I2WA 4G3VA 3RH8B 5TFQA 2XQZA 1OJGA 1W5DA 4LRYC 2V0UA 3N7WA 4U0XA 1OT9A 3IS2B 2Y2IA 1DY6A 1G68A 2HDSA 5GL9A 4X56A 1YLTA 5AQ9A 3T1QB 3GRJA 4C6YA 2J7VA 3T1XA 5EVID 2XF3A 5EECA 4XXRA 4ARZA 3IXBA 2Q9MA 1ES2A 1DP9A 1ES5A 2D01A 4DDSA 4R1GA 2W1TB 5DJTA 1JVJA 2EXAA 1UWNX 1STZA 5JYPA 2ZOIA 3VP0A 4H6JA 1KGFA 2D02A 2XH9A 2ZJ9A 2QPNA 3BW6A 2B5RA 5FEFA 1K57A 4X1LA 1CQAA 3PBTA 1K56D 5FDHA 3BJNA 1LI9A 2RL3A 3MSHA 3MR0A 4NG2A 1OTAA 1YSQA 4UAAA 1YLJA 3IX4A 1OJ5A 3OBFA 2PAVP 1EI5A 1Z09A 4EXOA 2WAFA 5TGFA 5CTNA 3FC7A 3V3RA 1M6KA 3GSGA 3O5YA 3SH8A 1ERQA 1L3LA 2DNSA 3NIAA 3T1SA 3ZHHA 5CHUA 3LEZA 2QWSA 3PTEA 3LFVA 2NUPC 2ZQDA 5EOEA 5EOOA 5EVIA 4MBKA 3U2AA 1XJ4A 4EBPA 3UDXA 4PM7A 2DCFA 2EWWA 4WLAA 4MN5A 4WBGA 3FYZA 4IVIA 1H3QA 4FD8A 3V5MA 2VGLS 3WRTA 4BBVA 3NCKA 2HZ5A 5HWVA 2B18A 3A3IA 3MXSA 4BD1A 4WF0A 4R3JA 4C75A 5AVFA 5FA7A 3VFFA 1ODVA 4N9KA 3NOTC 2JBFA 1PIOA 3BECA 1MWSA 2BG1A 1S67L 2O99A 2PBDP 4JF6A 1K56A 1JWPA 5GLDA 1IYPA 1FCOA 3L7HA 5F83A 5FASA 4RQ9A 1XXMA 4CLCC 3UE1A 1BT5A 4ZDXA 2ZLYA 2FZ0A 1XKZA 3N4IA 3SOIA 1E4DA 1K0KA 1S4RA 2YKHA 4YFMA 3IWQA 3G2YA 1IKGA 1YMSA 3H7WA 5CGSA 3I7JA 2PYPA 4KZ3A 3VE3A 2WKHA 3W2ZA 3GR2A 1MWRA 3OCLA 4S2NC 1ZTUA 2Y8HA 3GQZA 5G4ZA 3OPRA 3MFXA
chains in the Genus database with same CATH topology
3B47A 3K3CA 4WUJA 1JNUA 1TD5A 4BBUA 2OOLA 3E98A 4NXGA 2VLGA 2XSSA 4ETZA 2HF6A 4II7A 3CWFA 5J3WA 3LR3A 2Z6DA 1G6OA 3VV4A 1TS7A 4NXEA 4HJ6A 2B02A 3ZQ5A 4BWIA 1IFQA 4GLQA 4LRXC 4XT2B 3OCNA 2HGVA 4JGRA 3A0SA 4HP9A 4WL9A 3C30A 4WEJA 2V9AA 3OC2A 1GSWA 5HSQA 3IBJA 2W3GA 4I38A 3UE6A 3KYZA 2VV6A 1EW0A 4IJGA 2W3DA 1KOUA 2J80A 4UQIS 3VE4A 2VV8A 3TRCA 3C2WA 2V1AA 3LYXA 2DMWA 4NXBA 5KIZA 2GX5A 3CUEC 4IHQA 4DJ3A 5LBRA 1DP6A 4OOLA 5IS1A 1XJ2A 1OTBA 1OTDA 4KUOA 1T1AA 3S7OA 1V9ZA 1GSXA 2BASA 2J3WA 2OAQ1 2XA7S 3NOPC 1LSWA 5EFWA 3CUEA 2VGLM 2O0YA 2GJ3A 2P08A 2A24A 4IUHA 4ME4A 1S1ZA 4BJPA 5HL6A 4DJ2A 4EERA 2L0WA 5HD5A 3KO6A 3KYQA 4L9GA 4H6JB 3IS2A 3BWLA 3UMDA 2OAP1 1VB6A 3PR6A 4HOIA 3F1NA 1N9OA 4OOMA 4JGQA 1DP8A 3OLOA 3LIBA 5J4EA 2R78A 5HDSA 2ZBBA 3KSFA 4O8GA 1P9WA 5K5BA 5F6AA 3EGDC 5DKKA 4ETXA 4UEYA 5AJGA 4AFIA 3PBNA 2YKFA 3T4QA 2K7SA 4HH3A 4ZRRA 4FOFA 2P04A 3UB8A 3EEHA 3KSHA 2W1TA 4I3JA 3T4OA 3MQOA 4HQAA 1XJ6A 2QHKA 3PYPA 3T4LA 2XROA 4CQHA 3TE8A 3PBSA 3UB7A 4L9FA 4F3LA 4WEKA 4Y5FA 3E4QA 4XT2A 2WKPA 3FG8A 3BQAA 2W3EA 4R3AA 5TJJA 3GECA 3ULFA 3EOIA 3G6OA 3BQ8A 4GHIB 4Q0IA 2WKQA 4EETB 3LI8A 2O9CA 4MN7A 4DN0A 3CAXA 1TS0A 5AVEA 1DRMA 3NOUC 1S66L 3CLOA 3R4KA 4PKYA 2INWA 3LIAA 4HH2A 4I5SA 3ICYA 1T18A 4Q0HA 4MMNA 4HHDA 4B9OA 4HJ4A 1OPXA 1ZHHB 1OTEA 1MC0A 1YKDA 2NUTC 4UQIM 4BMWA 2W3FA 4I3IA 3HCYA 5MC7A 2K2NA 2W1RA 3IBRA 3PXPA 4YWZA 2JKRI 3FPWA 2M7VA 1LSVA 4DMZA 4K08A 3LR4A 2W3HA 3NJAA 5F68A 5HZHA 1X0OA 2PT7A 1T1CA 2KOIA 2O9AA 2XA7M 2L4RA 3S7PA 3EGXC 3KSIA 3A0RA 4HIAA 4PAUA 3PBOA 4ARZB 5HPIA 1VHMA 4CLCB 4MDZA 4CLCE 3H9WA 3MQQA 4JGOA 4GS9B 3H82A 1W63Q 2GNXA 5HDDA 2P7JA 4R70A 5A8BA 5HDCA 2XRNA 2PR6A 1XJ3A 4YNRA 3S7QA 4L9EA 1XFNA 2EA9A 4KQOA 3C8CA 3F1OB 4R38A 2Z6CA 1YSPA 3BY9A 3LI9A 2J3TD 3EWKA 5HPFA 2W27A 1D7EA 2JHEA 4IUKA 3JVVA 1IOUA 2JKTI 1S1YA 2V1BA 2CMNA 1Y28A 4R6LA 4JGPA 4L0LA 3LIEA 1F9IA 2I9VA 2WKRA 1NWZA 2PDRA 1TF1A 2M1CA 4LLOB 3HJKA 3OOVA 5F69A 3VOLA 3PBQA 2FH5A 2VKSA 5HWTA 4WELA 2QJ5A 4HNBA 5HWWA 2KLIA 3S7NA 3BY8A 2O9BA 2VV7A 4NEED 1GSVA 2VJWA 1OT6A 4WN5A 1MZUA 5DFYA 4GHIA 2ZOHA 5FL3A 4O01A 3P7NA 3UE3A 3F1PB 3PBRA 4PKYG 3MQ0A 4MN6A 5DF9A 1NLYA 4G3VA 5G4YA 3RH8B 2PHYA 2A24B 1OJGA 3UMEA 3GDIA 3KX0X 4LRYC 2QJ7A 2V0UA 1V9YA 5DKLA 1OT9A 4HP4A 3IS2B 5F5YA 2J3TC 3LIFA 5DJUA 3V67A 4HJ3A 2VZWA 2KDKA 4EW7A 3PHYA 1G28A 2ZMFA 1T19A 2G7UA 4Q0JA 4QPRA 5IU1A 1F5MA 3SW1A 4ARZA 3EQVA 1TS8A 4B93A 1DP9A 5DFXA 4Z1WA 3LR5A 3UB9A 2D01A 4GS9A 5TBMB 2ZMVA 1LL8A 4Y2FA 3MXQA 3LICA 2W1TB 5DJTA 1T1BA 1W63M 4P6ZS 3F1OA 4PHTA 3T4KA 1NLZA 1UWNX 1STZA 3E4OA 2ZOIA 4EESA 4H6JA 1WA9A 4KUKA 2D02A 4HI4A 3B33A 2VEAA 2QKPA 4NXFA 3EQUA 3BW6A 2QYBA 2V0WA 5C5KA 1D06A 4HY8A 3PBTA 4G3KA 5L8MA 3BJNA 4F3LB 2GZAA 2PD7A 3E4PA 2MJ6A 3H7WB 3MR0A 2LB5A 1OTAA 3LIDA 3CITA 1TS6A 1YSQA 3B42A 2L1MA 4LPZA 1OJ5A 2KX6A 3OBFA 3K2NA 4BBTA 1UWPX 1N9NA 4EXOA 3R7WB 1XFQA 2PR5A 3MJQA 3FC7A 2VX8A 2W0NA 2K31A 1NRJA 3O5YA 3LUQA 3T4JA 3NHQA 1N9LA 4CLCD 1P0ZA 3F1PA 4MCWA 4KQDA 1P9RA 4EUVA 2QWSA 2JN7A 4GW9A 3LFVA 4I39A 2NUPC 5I5LA 3UB6A 3T4SA 2VA0A 1H8MA 3RFBA 4G3WA 3U2AA 1XJ4A 3KSGA 3MMHA 5KSHA 3TW8A 2EWWA 4WLAA 2HV1A 4MN5A 3HJIA 4FSFA 1S4SA 3JVUA 3CI6A 3RTYA 5IT5A 1H3QA 2A2LA 2VGLS 2JKRM 2EWVA 4BBVA 4E04A 1YAXA 5HWVA 4I3AA 1MKMA 2B18A 4EU0A 4WF0A 3TJZC 2M7UA 3EEAA 5AVFA 1F98A 1ODVA 1P97A 2HJ9C 3NOTC 3H82B 4YOFA 3ZYTA 4EEUA 1S67L 1BYWA 2O99A 4LRZE 3T4TA 5TBMA 4GJ4A 2LB9A 5J7EA 2PD8A 2OWHA 2PYRA 3FPVA 4RQ9A 1LSXA 2IA2A 1UGUA 3D72A 3F1NB 1LT0A 4O0PA 4CLCC 4EEPA 4NKPA 4Y3IA 3MF0A 2FZ0A 3DBAA 3LR0A 4EQ1A 4M4XA 1OTIA 3K3DA 2JKTM 3T50A 1S4RA 2YKHA 4P6ZM 2HJEA 2OWJA 3H7WA 4GCZA 2Y79A 5CX7A 4CLCA 3P01A 2PYPA 3VE3A 3W2ZA 3OCLA 1ZTUA 3D3OA 2Y8HA 5HD3A 5G4ZA 3R7WA 3C38A 3MFXA 2H28A 3A0VA 3E0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUJ A;  3K3C A;  1JNU A;  4BBU A;  2OOL A;  4NXG A;  2VLG A;  3CWF A;  5J3W A;  2Z6D A;  1TS7 A;  4NXE A;  4HJ6 A;  2B02 A;  3ZQ5 A;  4LRX C;  4XT2 B;  4JGR A;  3A0S A;  4HP9 A;  4WL9 A;  2V9A A;  1GSW A;  5HSQ A;  4I38 A;  3UE6 A;  2VV6 A;  1EW0 A;  1KOU A;  2J80 A;  3VE4 A;  2VV8 A;  3C2W A;  2V1A A;  3LYX A;  4NXB A;  5KIZ A;  4DJ3 A;  1DP6 A;  5IS1 A;  1XJ2 A;  1OTB A;  1OTD A;  4KUO A;  1T1A A;  1V9Z A;  1GSX A;  2BAS A;  3NOP C;  5EFW A;  1LSW A;  2GJ3 A;  4EER A;  2A24 A;  1S1Z A;  4DJ2 A;  2L0W A;  5HD5 A;  4L9G A;  4H6J B;  3IS2 A;  3BWL A;  3UMD A;  1VB6 A;  4HOI A;  3F1N A;  1N9O A;  4JGQ A;  1DP8 A;  3OLO A;  3LIB A;  5J4E A;  2R78 A;  5HDS A;  2ZBB A;  5F6A A;  5DKK A;  2YKF A;  2K7S A;  4HH3 A;  3UB8 A;  3EEH A;  4I3J A;  3MQO A;  4HQA A;  1XJ6 A;  2QHK A;  3PYP A;  3UB7 A;  4L9F A;  4F3L A;  3E4Q A;  4XT2 A;  2WKP A;  3FG8 A;  4R3A A;  3GEC A;  3ULF A;  3G6O A;  4GHI B;  2WKQ A;  4EET B;  3LI8 A;  3CAX A;  1TS0 A;  5AVE A;  1DRM A;  3NOU C;  1S66 L;  3CLO A;  4PKY A;  2INW A;  3LIA A;  4HH2 A;  4I5S A;  3ICY A;  1T18 A;  4B9O A;  4HHD A;  4HJ4 A;  1OTE A;  4I3I A;  3IBR A;  4YWZ A;  1LSV A;  4K08 A;  3NJA A;  5F68 A;  5HZH A;  1X0O A;  1T1C A;  2L4R A;  3A0R A;  4HIA A;  3H9W A;  3MQQ A;  4JGO A;  4GS9 B;  3H82 A;  5HDD A;  2P7J A;  4R70 A;  5A8B A;  5HDC A;  2PR6 A;  1XJ3 A;  4L9E A;  1XFN A;  2EA9 A;  4R38 A;  3C8C A;  3F1O B;  2Z6C A;  3BY9 A;  3LI9 A;  3EWK A;  2W27 A;  1D7E A;  2JHE A;  1S1Y A;  2V1B A;  2CMN A;  1Y28 A;  4R6L A;  4JGP A;  1F9I A;  2I9V A;  2WKR A;  3LIE A;  1NWZ A;  2PDR A;  2M1C A;  4LLO B;  3HJK A;  5F69 A;  3VOL A;  5HWT A;  2QJ5 A;  4HNB A;  5HWW A;  3BY8 A;  2VV7 A;  1GSV A;  1OT6 A;  4WN5 A;  1MZU A;  4GHI A;  2ZOH A;  3P7N A;  3F1P B;  4PKY G;  4MN6 A;  5G4Y A;  3RH8 B;  2PHY A;  2A24 B;  1OJG A;  3UME A;  3GDI A;  3KX0 X;  4LRY C;  2QJ7 A;  2V0U A;  1V9Y A;  5DKL A;  1OT9 A;  4HP4 A;  3IS2 B;  5F5Y A;  3LIF A;  5DJU A;  4HJ3 A;  2KDK A;  4EW7 A;  3PHY A;  1G28 A;  1T19 A;  5IU1 A;  3SW1 A;  1TS8 A;  1DP9 A;  3UB9 A;  2D01 A;  4GS9 A;  5TBM B;  1LL8 A;  3MXQ A;  3LIC A;  5DJT A;  1T1B A;  3F1O A;  1UWN X;  3E4O A;  2ZOI A;  4EES A;  4H6J A;  1WA9 A;  4KUK A;  2D02 A;  4HI4 A;  3B33 A;  2VEA A;  2QKP A;  4NXF A;  2V0W A;  1D06 A;  4HY8 A;  4F3L B;  2PD7 A;  3E4P A;  3H7W B;  3MR0 A;  1OTA A;  3LID A;  1TS6 A;  2L1M A;  4LPZ A;  1OJ5 A;  2KX6 A;  4BBT A;  1UWP X;  1N9N A;  4EXO A;  1XFQ A;  2PR5 A;  3MJQ A;  3FC7 A;  2W0N A;  3LUQ A;  3NHQ A;  1N9L A;  1P0Z A;  3F1P A;  4KQD A;  2QWS A;  2JN7 A;  4GW9 A;  4I39 A;  3UB6 A;  5I5L A;  1XJ4 A;  4WLA A;  2HV1 A;  4MN5 A;  3HJI A;  1S4S A;  3RTY A;  4BBV A;  4E04 A;  5HWV A;  4I3A A;  4WF0 A;  5AVF A;  1F98 A;  1ODV A;  1P97 A;  3NOT C;  3H82 B;  4EEU A;  1S67 L;  1BYW A;  4LRZ E;  5TBM A;  5J7E A;  2PD8 A;  2OWH A;  2PYR A;  4RQ9 A;  1LSX A;  1UGU A;  3D72 A;  3F1N B;  1LT0 A;  4EEP A;  4EQ1 A;  4M4X A;  1OTI A;  3K3D A;  3T50 A;  1S4R A;  2YKH A;  2OWJ A;  3H7W A;  4GCZ A;  2PYP A;  3VE3 A;  5HD3 A;  5G4Z A;  3MFX A;  2H28 A;  3A0V A; 
#chains in the Genus database with same CATH topology
 3B47 A;  2VLG A;  4BL2 A;  2Y2G A;  3CWF A;  3KYE A;  2Z6D A;  4JXV A;  4BWI A;  4KZ7 A;  4XT2 B;  2HGV A;  3A0S A;  3NDG A;  4HP9 A;  4WL9 A;  5FQM A;  3UDF A;  2E8J A;  4I38 A;  1K25 A;  3KYZ A;  2VV6 A;  3N6I A;  2ACG A;  4OQI A;  1KOU A;  1YLP A;  3C2W A;  5KIZ A;  5HAI A;  2Y2H A;  4OOL A;  4UA7 A;  1ES3 A;  1MY8 A;  1AXB A;  2ZQ9 A;  2XDM A;  2Y59 A;  2BAS A;  3D4F A;  5EFW A;  4JF4 A;  3CUE A;  2O0Y A;  2P08 A;  4KZ5 A;  4BJP A;  1MPL A;  3KO6 A;  4H6J B;  4HBU A;  4OH0 A;  1VB6 A;  4K91 A;  1K38 A;  4OOM A;  3IF6 A;  4BD0 A;  1DP8 A;  2ZBB A;  4R0Q A;  2V2F F;  5EV0 A;  4OPY A;  1IYS A;  4UEY A;  3ITA A;  5CTM A;  4HH3 A;  1ZG6 A;  4E6W A;  3MKE A;  3T12 B;  1NZO A;  4KQQ A;  1RGZ A;  3T4O A;  4HQA A;  1FR6 A;  3M6B A;  2QHK A;  5E2G A;  4GN2 A;  4N1X A;  2XRO A;  4CQH A;  1RGY A;  4F3L A;  4WEK A;  5EVI B;  4Y5F A;  3E4Q A;  4EBL A;  1KDW A;  4EUZ A;  1RCJ A;  4M3K A;  2ZM0 A;  4KG2 A;  1SZV A;  3FG8 A;  4QHC A;  2HP9 A;  3EOI A;  3G6O A;  1PWD A;  3GMW A;  5AVE A;  5FAO A;  1PI4 A;  3U4L P;  3NOU C;  2ZC6 B;  1RP5 A;  3CLO A;  4PKY A;  3OPL A;  1MBL A;  3ZGA B;  2INW A;  4HH2 A;  4Q0H A;  4HJ4 A;  5FDS A;  3TOI A;  1ZHH B;  5E2E A;  1OTE A;  1MC0 A;  4UQI M;  1CI8 A;  2HDU A;  1BZA A;  3IBR A;  4YWZ A;  3FPW A;  2W3H A;  1YLZ A;  5F68 A;  1XP4 A;  2IWC A;  1T1C A;  4LFU A;  3QNB A;  1YPR A;  4XUX A;  1BLC A;  3S7P A;  4DKI A;  4HEF A;  1O07 A;  3H9W A;  4RX2 A;  1K6S A;  1W63 Q;  3BFF A;  4R70 A;  5HDC A;  1XJ3 A;  1KVL A;  4YNR A;  3S7Q A;  4R38 A;  1E3U D;  1YSP A;  3QP2 A;  2Y2N A;  3BY9 A;  5HPF A;  2W27 A;  2DRW A;  5GLB A;  2I9V A;  1NWZ A;  5GHX A;  4LLO B;  5F69 A;  2HDQ A;  4K0X A;  4WEL A;  4X25 A;  3BFD A;  4HNB A;  5HWW A;  3OPP A;  3FV7 A;  1PWG A;  1H0M A;  2O9B A;  2VV7 A;  5FI6 A;  1YT4 A;  4NEE D;  1VQQ A;  1GSV A;  4BLM A;  4GHI A;  4OP8 A;  4O01 A;  3P7N A;  4JLF A;  4KG6 A;  3Q7V A;  1G5U A;  1VET A;  1M40 A;  3BYD A;  3F1P B;  3PBR A;  2JCH A;  1YM1 A;  4MN6 A;  1NLY A;  4S2J A;  1ESU A;  4P6B A;  3ZNT A;  4X55 A;  2PHY A;  4OPZ A;  3QHY A;  1LL5 A;  5DKL A;  2J3T C;  1FCM A;  1ZC2 A;  1TDL A;  1K55 A;  3GV9 A;  3V67 A;  2EX2 A;  3IF6 B;  5L10 A;  3MZD A;  1LI0 A;  2KDK A;  2JE5 A;  5HAQ A;  2ZMF A;  4Q0J A;  4N1H A;  1E3U A;  5IU1 A;  3SW1 A;  1KGG A;  5M18 A;  1TS8 A;  3UN7 A;  2I72 A;  1TDG A;  4LEN A;  4P85 A;  4GS9 A;  3O86 A;  3DTI A;  1D1J A;  1KDS A;  3LIC A;  4QB8 A;  4WZ5 C;  4A5R A;  4N92 A;  3E4O A;  4X6T A;  3E2K A;  2E8I A;  1K4E A;  3NC8 A;  1BLH A;  4Y17 A;  1ERO A;  5KMW A;  4F3L B;  2XK1 A;  4R4R A;  3A3J A;  3E4P A;  4QJG A;  3CIT A;  1TS6 A;  3QNC A;  4DE3 A;  2A49 A;  2Y2J A;  4LPZ A;  3IHA A;  2Y2P A;  1UWP X;  5DVA A;  3R7W B;  2PBY A;  2V1Z A;  1XFQ A;  2PR5 A;  4PM5 A;  1NRJ A;  4P0M A;  4CLC D;  4EUV A;  4E3J A;  2JN7 A;  2ZC3 B;  3BRM A;  1VEU B;  1J9M A;  5BOH A;  3MMH A;  3TW8 A;  4FSF A;  4UHU A;  3RTY A;  5IT5 A;  3MBZ A;  2EFX A;  2A2L A;  4GD6 A;  2EWV A;  2XFT A;  4Y7P A;  3VSK A;  3W4Q A;  3HLB A;  4EV4 A;  4LV1 A;  1VM1 A;  3TJZ C;  4RVA A;  4OON A;  3UDI A;  2HJ9 C;  3UO9 A;  3ZYT A;  4RA7 A;  4D60 A;  4KZ8 A;  3T4T A;  2OSU A;  5TBM A;  1AWI A;  3Q82 A;  3OPH A;  5EVE A;  2PD8 A;  2Y2M A;  2OWH A;  3D72 A;  3F1N B;  1LT0 A;  3MKF A;  3MF0 A;  3VMA A;  1N4O A;  3LR0 A;  4M4X A;  4OP5 A;  3K3D A;  2PU4 A;  3T50 A;  2HJE A;  2OWJ A;  4EWF A;  2Y79 A;  1ERM A;  2JC7 A;  4CLC A;  4OOY A;  4E3I A;  2WK0 A;  1BUE A;  3D3O A;  5CGW A;  4JBF A;  3M6H A;  2H28 A;  3CPT B;  2OOL A;  3Q7V B;  1VET B;  2HF6 A;  4II7 A;  2BLS A;  3LR3 A;  4S2N A;  3FKW A;  1YLW A;  1TS7 A;  4NXE A;  1KE3 A;  2B02 A;  1G6A A;  1IFQ A;  3G35 A;  4FH4 A;  4LRX C;  3OCN A;  1H8Z A;  3VP3 A;  3HRE A;  1NZU A;  4QY5 A;  1GSW A;  5HSQ A;  3IBJ A;  1KE4 A;  3VP4 A;  1JWV A;  1CEF A;  3UB5 P;  3WS0 A;  4UQI S;  2VV8 A;  4NXB A;  2GX5 A;  4IHQ A;  2EX6 A;  2WZX A;  3HLG A;  4KZB A;  1OTD A;  1U60 A;  1DJA A;  1T1A A;  3N8L A;  2ZC5 B;  1V9Z A;  5GLC A;  3BLM A;  1IYQ A;  2OAQ 1;  4QU3 A;  2ZMA A;  3ZG9 B;  3RJU A;  4S2M A;  5A91 A;  1S1Z A;  4DJ2 A;  2L0W A;  5HD5 A;  3ZG8 B;  1NYM A;  3KYQ A;  3DAV A;  2OAP 1;  3PR6 A;  4YIN A;  1N9O A;  4WM9 A;  1H8Y A;  1GA0 A;  5HDS A;  3KSF A;  1NY0 A;  1NYY A;  1GHP A;  1Y4O A;  3HUN A;  2IWB A;  1P9W A;  5K5B A;  2WUQ A;  1C3B A;  5AJG A;  4AFI A;  2YKF A;  3T4Q A;  2K7S A;  2WGI A;  2WAE A;  2ZQA A;  4FOF A;  3EEH A;  3TG9 A;  3KSH A;  4E3M A;  5L07 A;  2Y91 A;  1XJ6 A;  3PYP A;  1YQS A;  3T4L A;  5AQ7 A;  3TE8 A;  1MWT A;  1CJF A;  3O87 A;  1IKI A;  1I2S A;  2XD1 A;  5I94 A;  2C6W B;  4S2I A;  3G32 A;  2Q0O A;  4S2L A;  5EPH A;  2VK3 A;  1PI5 A;  2HDR A;  3GEC A;  3BFE A;  5GHZ A;  1SCW A;  1MWU A;  4Q0I A;  2WKQ A;  5E2F A;  4JXW A;  2WKE A;  2ZC7 A;  1TS0 A;  1TVF A;  2Q9N A;  3ICY A;  5EVL A;  4HES A;  5EUA A;  4HHD A;  4OLG A;  4B9O A;  1CK3 A;  4Z9Q A;  1YKD A;  4HBT A;  4OQG A;  4I3I A;  5A93 A;  2K2N A;  2W1R A;  3PXP A;  1LSV A;  2ZL1 A;  5M19 A;  2BTF P;  2PT7 A;  3HBR A;  1BTL A;  3HLF A;  3WS1 A;  4OQH A;  2KOI A;  1FIL A;  4HIA A;  2WZZ A;  3PBO A;  4ARZ B;  5HPI A;  1FR1 A;  2AVX A;  4CLC B;  1NJ4 A;  1XX2 A;  5FQI A;  5HDD A;  2P7J A;  5E2H A;  5A8B A;  1HTZ A;  4KEN B;  2PR6 A;  1GCE A;  4Y0T A;  3C8C A;  2J3T D;  3EWK A;  4IUK A;  3JVV A;  2JKT I;  3AGF A;  2CMN A;  1Y28 A;  4L0L A;  1F9I A;  2WKR A;  2PDR A;  1TF1 A;  2M1C A;  1YLY A;  3VOL A;  3PBQ A;  3S4X A;  4ZBE A;  3UE0 A;  4GDN A;  3G31 A;  2QJ5 A;  5DTT A;  4MBF A;  2V20 A;  4E3O A;  3S7N A;  3BY8 A;  1WYC A;  2VJW A;  3NUL A;  4WN5 A;  1MZU A;  1S6R A;  3QP8 A;  5L09 A;  2OLV A;  3BFG A;  4X1M A;  1I5Q A;  3MQ0 A;  5DF9 A;  5G4Y A;  5A92 A;  3UME A;  3GDI A;  3IWO A;  3KX0 X;  2QJ7 A;  3ZCZ A;  4S2O A;  1F2K A;  2XFS A;  1L0E A;  5F5Y A;  5DJU A;  5F1G A;  2H5S A;  5FEG A;  3PHY A;  1NXY A;  2X71 A;  2H10 A;  3AGE A;  2G7U A;  2ZD8 A;  4P87 A;  4U3T A;  2G2W A;  3EQV A;  4QWO A;  3D9Y A;  1K54 C;  1BLP A;  3T1R A;  4PMA A;  4RX3 A;  1XGJ A;  1ZKJ A;  3M2K A;  4JXS A;  3LY4 A;  4Y2F A;  3MXQ A;  2R9W A;  4NK3 A;  4N9L A;  3F1O A;  1NLZ A;  1N9B A;  5EM0 A;  4FTX A;  4EES A;  4KUK A;  3B33 A;  2VEA A;  4NXF A;  2Y2L A;  3Q81 A;  2V0W A;  3IX3 A;  5C5K A;  4HY8 A;  3N8R A;  4G3K A;  5L8M A;  2ZQC A;  4WZ5 A;  3A3D A;  2PD7 A;  2MJ6 A;  3H7W B;  3MFD A;  2LB5 A;  3LID A;  2L1M A;  1S0W A;  4OPQ A;  4BBT A;  5CED A;  3MJQ A;  2XEP A;  2VX8 A;  2W0N A;  2K31 A;  3GTC A;  3LUQ A;  5TR7 A;  3NHQ A;  3LEQ A;  4MCW A;  4RYE A;  4WMC D;  2P9V A;  4KQD A;  5U47 A;  1P9R A;  4JPM A;  3UPP A;  3UB6 A;  5I5L A;  1H8M A;  5DF8 A;  4G3W A;  4DDY A;  3P98 A;  2ZL1 B;  5CEC A;  5KSH A;  1LL9 A;  1ONH A;  5CEB A;  4F94 A;  4KZ4 A;  2HV1 A;  3ITB A;  3ZFZ A;  3NBL A;  3NY4 A;  2XLN A;  4R4S A;  2UV0 E;  5CXW A;  2J9O A;  1IYO A;  3AGD A;  1YAX A;  1L0F A;  4I3A A;  1MKM A;  4Y0O A;  4EU0 A;  4CPK A;  4IBR A;  3EEA A;  4GZB A;  3TSG A;  1L0D A;  1HZO A;  3S1Y A;  4UA6 A;  4YOF A;  1BYW A;  1TEM A;  4EBN A;  2EFU A;  4DXB A;  2X02 A;  2LB9 A;  5J7E A;  4LV2 A;  5AQA A;  1LSX A;  2IA2 A;  3BEB A;  4O0P A;  2WYX A;  4NKP A;  3IH8 A;  4IED A;  4EEP A;  1PNE A;  5CHM A;  3DBA A;  1JTG A;  1FQG A;  4EQ1 A;  3E2L A;  5EE8 A;  1OTI A;  2JKT M;  4P6Z M;  2HPB A;  2WGV A;  2X01 A;  3P01 A;  5GHY A;  4R3B A;  3V39 A;  4WMC A;  3FZC A;  5HD3 A;  2ZM2 A;  3MZF A;  3C38 A;  3NEC A;  4LCM A;  3E0Y A;  4WUJ A;  1JWZ A;  1JNU A;  1TD5 A;  1XA7 A;  4NXG A;  4DE2 A;  2XSS A;  5FI7 A;  4ETZ A;  1ACF A;  5FAQ A;  1MXO A;  4LGW A;  1G6O A;  4PM6 A;  3VV4 A;  3NI9 A;  1PFL A;  4B4Z A;  3O3V A;  1OME A;  2PU2 A;  3G4P A;  4KZ6 A;  3QP1 A;  4U0T A;  3UPO A;  4JKT A;  4WEJ A;  2V9A A;  3DTM A;  3OC2 A;  2H0T A;  2W3G A;  3UE6 A;  5D3O A;  1BLS A;  5FAT A;  3TRC A;  2DMW A;  3UPN A;  1JTD A;  5LBR A;  1WYB A;  4GNU A;  1BUL A;  1H5X A;  3S7O A;  2JKF A;  1W8Q A;  1GSX A;  3G30 A;  2A3U A;  2J3W A;  3ZG0 A;  1CEG A;  1LSW A;  4IUH A;  4ME4 A;  4EER A;  2A24 A;  1L2S A;  1XPB A;  4L9G A;  4MBH A;  5GLA A;  2XR0 A;  4HOI A;  4OPR A;  4IVK A;  4MLL A;  3OLO A;  5DTK A;  5J4E A;  1SHV A;  4EQI A;  3SS3 A;  4O8G A;  2Z2M B;  5EM1 A;  4DF6 A;  5F6A A;  3EGD C;  3FKV A;  4ETX A;  3MXR A;  1QME A;  5DTS A;  1HLU P;  3B3X A;  5CHJ A;  3FWL A;  1BSG A;  2UWX A;  2FFF B;  2QZ6 A;  1J3W A;  4I3J A;  3MQO A;  4BL3 A;  4OQ0 A;  2ZQ7 A;  4LCL A;  2P9V B;  4H8R A;  4KZA A;  5CER A;  1PZP A;  5FAP A;  4XT2 A;  4FCF A;  2W3E A;  1ESI A;  4R3A A;  5TJJ A;  1FIK A;  1PW8 A;  1HD8 A;  3BQ8 A;  4GHI B;  4EET B;  3LI8 A;  4X69 A;  4MN7 A;  5F82 A;  3SS4 A;  3WS5 A;  4DN0 A;  3CAX A;  4C3Q A;  2CC1 A;  3VP1 A;  4E3L A;  4Y13 A;  3CZD A;  3LIA A;  1T18 A;  3HLW A;  2VGJ A;  5FQQ A;  1OPX A;  1O7E A;  2NUT C;  3HCY A;  2JKR I;  3CHW P;  1X0O A;  4OLD A;  4X53 A;  3PAE A;  1GHI A;  5HFO A;  4DXC A;  1A0K A;  3C7U A;  2O9A A;  2XA7 M;  1DJC A;  3KSI A;  3HUM A;  3VOY A;  4LV0 A;  1VHM A;  3MQQ A;  4JGO A;  4GS9 B;  3H82 A;  3QP6 A;  5HAP A;  4OVD A;  1FCN A;  2EA9 A;  3ZNY A;  2Z6C A;  3SS5 A;  2JHE A;  3LGO A;  1IOU A;  4X68 A;  3IXH A;  3IWI A;  4JGP A;  3C5A A;  5HAR A;  3HJK A;  3ZG5 A;  2FH5 A;  4FH2 A;  3GVB A;  4DE0 A;  3HUO A;  1KVM A;  1K6R A;  4FUW A;  1LLB A;  5JYO A;  4E3K A;  4Q8I A;  4K0W A;  3Q07 A;  2FFY A;  3DWK A;  3ZDJ A;  4ZAM A;  3L9K A;  4XUZ A;  3UE3 A;  4ID4 A;  3WS2 A;  4PKY G;  5M1A A;  3BFC A;  2XD5 A;  4MNR A;  2A24 B;  1Z6F A;  3WS4 A;  2G2U A;  1V9Y A;  4HP4 A;  1W79 A;  3V50 A;  3C4O A;  3LIF A;  4E6X A;  4QD4 A;  4HJ3 A;  2VZW A;  4LV3 A;  4EW7 A;  1PWC A;  5FSR A;  1G28 A;  1T19 A;  1LHY A;  4QPR A;  5E43 A;  1F5M A;  1ALQ A;  1FSW A;  3DWZ A;  1SKF A;  4B93 A;  5DFX A;  1SDE A;  4Z1W A;  2ZC4 B;  2J9P A;  3LR5 A;  3UB9 A;  3Q7Z A;  5TBM B;  2ZMV A;  1K57 C;  1LL8 A;  4B88 A;  1Q2Q A;  1T1B A;  1W63 M;  4P6Z S;  4Y0U A;  4ZTK A;  4PHT A;  3T4K A;  3CG5 A;  1K54 A;  1WA9 A;  3QP4 A;  4HI4 A;  2QKP A;  3EQU A;  2QYB A;  2WGW A;  1D06 A;  4ZJ1 A;  2GZA A;  2IWD A;  3O88 A;  3ISG A;  2V8C A;  3B42 A;  3VSL A;  2KX6 A;  2JKG A;  3K2N A;  3IT9 A;  1N9N A;  4DE1 A;  3PAG A;  2HP5 A;  2P74 A;  3HL9 A;  4BQM A;  4ZJ3 A;  3MS6 A;  2Z2L B;  1XA1 A;  3A3F A;  3T4J A;  5EVI C;  3VFH A;  2C5W B;  1N9L A;  4IBX A;  4PPR A;  3UY6 A;  1P0Z A;  3F1P A;  1SKO A;  2OLU A;  4GW9 A;  4I39 A;  4ESP A;  1ZG4 A;  3T4S A;  2VA0 A;  3RFB A;  3IXG A;  3KSG A;  4O7D A;  2EXB A;  5KSC A;  2Y2Q A;  3W4O A;  3HJI A;  1S4S A;  3JVU A;  3CI6 A;  3VP2 A;  2JKR M;  1K4F A;  4E04 A;  5DF7 A;  2WAD A;  2M7U A;  5FQK A;  3RXW A;  3BM6 A;  1F98 A;  1P97 A;  3H82 B;  1Y54 A;  5F1F A;  4EEU A;  4LRZ E;  1Q2P A;  4GJ4 A;  2B95 A;  4PM9 A;  3V3S A;  2PYR A;  3FPV A;  1UGU A;  3C4P A;  3DTE A;  3HVF A;  3IQA A;  4Y3I A;  1ONG A;  3BLS A;  4B4X A;  3IF5 A;  5FI2 A;  1E25 A;  4GCZ A;  4KZ9 A;  5CX7 A;  4WYY A;  3NDE A;  3RXX A;  3R7W A;  3A0V A;  3JPU A;  3K3C A;  4BBU A;  4D2O A;  3E98 A;  3OZH A;  3WRZ A;  2PRF A;  5J3W A;  4WZ4 A;  4HJ6 A;  3ZQ5 A;  3LO7 A;  4NET A;  4GLQ A;  1FOF A;  1VEU A;  4JGR A;  3C30 A;  3IHB A;  1IEM A;  4JXG A;  2VGK A;  3G2Z A;  1EW0 A;  4IJG A;  2W3D A;  2J80 A;  3SH7 A;  3VE4 A;  2V1A A;  3LYX A;  3WWX A;  3CUE C;  4DJ3 A;  1DP6 A;  5IS1 A;  1XJ2 A;  2WKI A;  1OTB A;  4UA9 A;  4KUO A;  5CGX A;  4DRT A;  3MZE A;  3IF6 C;  5HW3 A;  2XA7 S;  3NOP C;  2VGL M;  2GJ3 A;  5HL6 A;  3CJM A;  5J8X A;  3SH9 A;  3IS2 A;  3ZG7 B;  3G34 A;  3BWL A;  3UMD A;  3UNW A;  3F1N A;  2WGW B;  4GKU A;  4JGQ A;  3LIB A;  2R78 A;  4QY6 A;  1GHM A;  5A90 A;  4GOG A;  5DKK A;  1XGI A;  3PBN A;  3N8S A;  4ZRR A;  1WE4 A;  5HL1 A;  5AQB A;  2V8F A;  3UB8 A;  2P04 A;  2W1T A;  4S2K A;  2H0Y A;  2Y2K A;  3CPT A;  2R9X A;  2Y4A A;  3SZT A;  3QP5 A;  1SKO B;  4KQR A;  4MEZ A;  3PBS A;  3UB7 A;  3M2J A;  4L9F A;  3HLC A;  4ZJ2 A;  2QMI A;  5IHV A;  2WKP A;  1DJB A;  2EX9 A;  5KZH A;  2XGN A;  3BQA A;  3ULF A;  4BEN A;  2EX8 A;  3IX8 A;  2O9C A;  1PRQ A;  3LY3 A;  2GDN A;  1DRM A;  1S66 L;  2OV5 A;  3R4K A;  4I5S A;  3VOZ A;  4MMN A;  1YMX A;  4BMW A;  2W3F A;  4GB7 A;  1GA9 A;  2M7V A;  5MC7 A;  1QMF A;  4DMZ A;  4K08 A;  3LR4 A;  3NJA A;  3S22 A;  5HZH A;  1PZO A;  5HX9 A;  2HP6 A;  4R23 A;  4OKP A;  4Y15 A;  1PYY A;  4KG5 A;  2L4R A;  3LCE A;  1KGE A;  3EGX C;  1IEL A;  3A0R A;  4PAU A;  3HLE A;  2J8Y A;  1MKI A;  4MDZ A;  4CLC E;  1CI9 A;  2ZQ8 A;  3C7V A;  3DTK A;  2GNX A;  1W8Y A;  2XRN A;  3IH9 A;  4L9E A;  1XFN A;  4KQO A;  3ZVT A;  3F1O B;  3LI9 A;  3IXD A;  1D7E A;  1S1Y A;  5FQJ A;  3Q1F A;  2V1B A;  4R6L A;  4PM8 A;  2ZM8 A;  1HVB A;  3LIE A;  2Y55 A;  1FSY A;  4GD8 A;  3OOV A;  3JYI A;  1KE0 A;  3HLD A;  2VKS A;  2Y2O A;  5HWT A;  5CRF A;  5G18 A;  3W4P A;  1PW1 A;  3CMZ A;  5FQ9 A;  1ES4 A;  3ZVW A;  4S2P A;  3P09 A;  2RCX A;  4E3N A;  2KLI A;  3DW0 A;  3A3E A;  4GDB A;  1OT6 A;  5DFY A;  2ZOH A;  1NRF A;  5FL3 A;  4CJN A;  1CF0 A;  5L2F A;  1W7F A;  4JF5 A;  1L0G A;  1EWZ A;  1SDN A;  3W8K A;  1K55 C;  1I2W A;  4G3V A;  3RH8 B;  5TFQ A;  2XQZ A;  1OJG A;  1W5D A;  4LRY C;  2V0U A;  3N7W A;  4U0X A;  1OT9 A;  3IS2 B;  2Y2I A;  1DY6 A;  1G68 A;  2HDS A;  5GL9 A;  4X56 A;  1YLT A;  5AQ9 A;  3T1Q B;  3GRJ A;  4C6Y A;  2J7V A;  3T1X A;  5EVI D;  2XF3 A;  5EEC A;  4XXR A;  4ARZ A;  3IXB A;  2Q9M A;  1ES2 A;  1DP9 A;  1ES5 A;  2D01 A;  4DDS A;  4R1G A;  2W1T B;  5DJT A;  1JVJ A;  2EXA A;  1UWN X;  1STZ A;  5JYP A;  2ZOI A;  3VP0 A;  4H6J A;  1KGF A;  2D02 A;  2XH9 A;  2ZJ9 A;  2QPN A;  3BW6 A;  2B5R A;  5FEF A;  1K57 A;  4X1L A;  1CQA A;  3PBT A;  1K56 D;  5FDH A;  3BJN A;  1LI9 A;  2RL3 A;  3MSH A;  3MR0 A;  4NG2 A;  1OTA A;  1YSQ A;  4UAA A;  1YLJ A;  3IX4 A;  1OJ5 A;  3OBF A;  2PAV P;  1EI5 A;  1Z09 A;  4EXO A;  2WAF A;  5TGF A;  5CTN A;  3FC7 A;  3V3R A;  1M6K A;  3GSG A;  3O5Y A;  3SH8 A;  1ERQ A;  1L3L A;  2DNS A;  3NIA A;  3T1S A;  3ZHH A;  5CHU A;  3LEZ A;  2QWS A;  3PTE A;  3LFV A;  2NUP C;  2ZQD A;  5EOE A;  5EOO A;  5EVI A;  4MBK A;  3U2A A;  1XJ4 A;  4EBP A;  3UDX A;  4PM7 A;  2DCF A;  2EWW A;  4WLA A;  4MN5 A;  4WBG A;  3FYZ A;  4IVI A;  1H3Q A;  4FD8 A;  3V5M A;  2VGL S;  3WRT A;  4BBV A;  3NCK A;  2HZ5 A;  5HWV A;  2B18 A;  3A3I A;  3MXS A;  4BD1 A;  4WF0 A;  4R3J A;  4C75 A;  5AVF A;  5FA7 A;  3VFF A;  1ODV A;  4N9K A;  3NOT C;  2JBF A;  1PIO A;  3BEC A;  1MWS A;  2BG1 A;  1S67 L;  2O99 A;  2PBD P;  4JF6 A;  1K56 A;  1JWP A;  5GLD A;  1IYP A;  1FCO A;  3L7H A;  5F83 A;  5FAS A;  4RQ9 A;  1XXM A;  4CLC C;  3UE1 A;  1BT5 A;  4ZDX A;  2ZLY A;  2FZ0 A;  1XKZ A;  3N4I A;  3SOI A;  1E4D A;  1K0K A;  1S4R A;  2YKH A;  4YFM A;  3IWQ A;  3G2Y A;  1IKG A;  1YMS A;  3H7W A;  5CGS A;  3I7J A;  2PYP A;  4KZ3 A;  3VE3 A;  2WKH A;  3W2Z A;  3GR2 A;  1MWR A;  3OCL A;  4S2N C;  1ZTU A;  2Y8H A;  3GQZ A;  5G4Z A;  3OPR A;  3MFX A; 
#chains in the Genus database with same CATH homology
 3B47 A;  3K3C A;  4WUJ A;  1JNU A;  1TD5 A;  4BBU A;  2OOL A;  3E98 A;  4NXG A;  2VLG A;  2XSS A;  4ETZ A;  2HF6 A;  4II7 A;  3CWF A;  5J3W A;  3LR3 A;  2Z6D A;  1G6O A;  3VV4 A;  1TS7 A;  4NXE A;  4HJ6 A;  2B02 A;  3ZQ5 A;  4BWI A;  1IFQ A;  4GLQ A;  4LRX C;  4XT2 B;  3OCN A;  2HGV A;  4JGR A;  3A0S A;  4HP9 A;  4WL9 A;  3C30 A;  4WEJ A;  2V9A A;  3OC2 A;  1GSW A;  5HSQ A;  3IBJ A;  2W3G A;  4I38 A;  3UE6 A;  3KYZ A;  2VV6 A;  1EW0 A;  4IJG A;  2W3D A;  1KOU A;  2J80 A;  4UQI S;  3VE4 A;  2VV8 A;  3TRC A;  3C2W A;  2V1A A;  3LYX A;  2DMW A;  4NXB A;  5KIZ A;  2GX5 A;  3CUE C;  4IHQ A;  4DJ3 A;  5LBR A;  1DP6 A;  4OOL A;  5IS1 A;  1XJ2 A;  1OTB A;  1OTD A;  4KUO A;  1T1A A;  3S7O A;  1V9Z A;  1GSX A;  2BAS A;  2J3W A;  2OAQ 1;  2XA7 S;  3NOP C;  1LSW A;  5EFW A;  3CUE A;  2VGL M;  2O0Y A;  2GJ3 A;  2P08 A;  2A24 A;  4IUH A;  4ME4 A;  1S1Z A;  4BJP A;  5HL6 A;  4DJ2 A;  4EER A;  2L0W A;  5HD5 A;  3KO6 A;  3KYQ A;  4L9G A;  4H6J B;  3IS2 A;  3BWL A;  3UMD A;  2OAP 1;  1VB6 A;  3PR6 A;  4HOI A;  3F1N A;  1N9O A;  4OOM A;  4JGQ A;  1DP8 A;  3OLO A;  3LIB A;  5J4E A;  2R78 A;  5HDS A;  2ZBB A;  3KSF A;  4O8G A;  1P9W A;  5K5B A;  5F6A A;  3EGD C;  5DKK A;  4ETX A;  4UEY A;  5AJG A;  4AFI A;  3PBN A;  2YKF A;  3T4Q A;  2K7S A;  4HH3 A;  4ZRR A;  4FOF A;  2P04 A;  3UB8 A;  3EEH A;  3KSH A;  2W1T A;  4I3J A;  3T4O A;  3MQO A;  4HQA A;  1XJ6 A;  2QHK A;  3PYP A;  3T4L A;  2XRO A;  4CQH A;  3TE8 A;  3PBS A;  3UB7 A;  4L9F A;  4F3L A;  4WEK A;  4Y5F A;  3E4Q A;  4XT2 A;  2WKP A;  3FG8 A;  3BQA A;  2W3E A;  4R3A A;  5TJJ A;  3GEC A;  3ULF A;  3EOI A;  3G6O A;  3BQ8 A;  4GHI B;  4Q0I A;  2WKQ A;  4EET B;  3LI8 A;  2O9C A;  4MN7 A;  4DN0 A;  3CAX A;  1TS0 A;  5AVE A;  1DRM A;  3NOU C;  1S66 L;  3CLO A;  3R4K A;  4PKY A;  2INW A;  3LIA A;  4HH2 A;  4I5S A;  3ICY A;  1T18 A;  4Q0H A;  4MMN A;  4HHD A;  4B9O A;  4HJ4 A;  1OPX A;  1ZHH B;  1OTE A;  1MC0 A;  1YKD A;  2NUT C;  4UQI M;  4BMW A;  2W3F A;  4I3I A;  3HCY A;  5MC7 A;  2K2N A;  2W1R A;  3IBR A;  3PXP A;  4YWZ A;  2JKR I;  3FPW A;  2M7V A;  1LSV A;  4DMZ A;  4K08 A;  3LR4 A;  2W3H A;  3NJA A;  5F68 A;  5HZH A;  1X0O A;  2PT7 A;  1T1C A;  2KOI A;  2O9A A;  2XA7 M;  2L4R A;  3S7P A;  3EGX C;  3KSI A;  3A0R A;  4HIA A;  4PAU A;  3PBO A;  4ARZ B;  5HPI A;  1VHM A;  4CLC B;  4MDZ A;  4CLC E;  3H9W A;  3MQQ A;  4JGO A;  4GS9 B;  3H82 A;  1W63 Q;  2GNX A;  5HDD A;  2P7J A;  4R70 A;  5A8B A;  5HDC A;  2XRN A;  2PR6 A;  1XJ3 A;  4YNR A;  3S7Q A;  4L9E A;  1XFN A;  2EA9 A;  4KQO A;  3C8C A;  3F1O B;  4R38 A;  2Z6C A;  1YSP A;  3BY9 A;  3LI9 A;  2J3T D;  3EWK A;  5HPF A;  2W27 A;  1D7E A;  2JHE A;  4IUK A;  3JVV A;  1IOU A;  2JKT I;  1S1Y A;  2V1B A;  2CMN A;  1Y28 A;  4R6L A;  4JGP A;  4L0L A;  3LIE A;  1F9I A;  2I9V A;  2WKR A;  1NWZ A;  2PDR A;  1TF1 A;  2M1C A;  4LLO B;  3HJK A;  3OOV A;  5F69 A;  3VOL A;  3PBQ A;  2FH5 A;  2VKS A;  5HWT A;  4WEL A;  2QJ5 A;  4HNB A;  5HWW A;  2KLI A;  3S7N A;  3BY8 A;  2O9B A;  2VV7 A;  4NEE D;  1GSV A;  2VJW A;  1OT6 A;  4WN5 A;  1MZU A;  5DFY A;  4GHI A;  2ZOH A;  5FL3 A;  4O01 A;  3P7N A;  3UE3 A;  3F1P B;  3PBR A;  4PKY G;  3MQ0 A;  4MN6 A;  5DF9 A;  1NLY A;  4G3V A;  5G4Y A;  3RH8 B;  2PHY A;  2A24 B;  1OJG A;  3UME A;  3GDI A;  3KX0 X;  4LRY C;  2QJ7 A;  2V0U A;  1V9Y A;  5DKL A;  1OT9 A;  4HP4 A;  3IS2 B;  5F5Y A;  2J3T C;  3LIF A;  5DJU A;  3V67 A;  4HJ3 A;  2VZW A;  2KDK A;  4EW7 A;  3PHY A;  1G28 A;  2ZMF A;  1T19 A;  2G7U A;  4Q0J A;  4QPR A;  5IU1 A;  1F5M A;  3SW1 A;  4ARZ A;  3EQV A;  1TS8 A;  4B93 A;  1DP9 A;  5DFX A;  4Z1W A;  3LR5 A;  3UB9 A;  2D01 A;  4GS9 A;  5TBM B;  2ZMV A;  1LL8 A;  4Y2F A;  3MXQ A;  3LIC A;  2W1T B;  5DJT A;  1T1B A;  1W63 M;  4P6Z S;  3F1O A;  4PHT A;  3T4K A;  1NLZ A;  1UWN X;  1STZ A;  3E4O A;  2ZOI A;  4EES A;  4H6J A;  1WA9 A;  4KUK A;  2D02 A;  4HI4 A;  3B33 A;  2VEA A;  2QKP A;  4NXF A;  3EQU A;  3BW6 A;  2QYB A;  2V0W A;  5C5K A;  1D06 A;  4HY8 A;  3PBT A;  4G3K A;  5L8M A;  3BJN A;  4F3L B;  2GZA A;  2PD7 A;  3E4P A;  2MJ6 A;  3H7W B;  3MR0 A;  2LB5 A;  1OTA A;  3LID A;  3CIT A;  1TS6 A;  1YSQ A;  3B42 A;  2L1M A;  4LPZ A;  1OJ5 A;  2KX6 A;  3OBF A;  3K2N A;  4BBT A;  1UWP X;  1N9N A;  4EXO A;  3R7W B;  1XFQ A;  2PR5 A;  3MJQ A;  3FC7 A;  2VX8 A;  2W0N A;  2K31 A;  1NRJ A;  3O5Y A;  3LUQ A;  3T4J A;  3NHQ A;  1N9L A;  4CLC D;  1P0Z A;  3F1P A;  4MCW A;  4KQD A;  1P9R A;  4EUV A;  2QWS A;  2JN7 A;  4GW9 A;  3LFV A;  4I39 A;  2NUP C;  5I5L A;  3UB6 A;  3T4S A;  2VA0 A;  1H8M A;  3RFB A;  4G3W A;  3U2A A;  1XJ4 A;  3KSG A;  3MMH A;  5KSH A;  3TW8 A;  2EWW A;  4WLA A;  2HV1 A;  4MN5 A;  3HJI A;  4FSF A;  1S4S A;  3JVU A;  3CI6 A;  3RTY A;  5IT5 A;  1H3Q A;  2A2L A;  2VGL S;  2JKR M;  2EWV A;  4BBV A;  4E04 A;  1YAX A;  5HWV A;  4I3A A;  1MKM A;  2B18 A;  4EU0 A;  4WF0 A;  3TJZ C;  2M7U A;  3EEA A;  5AVF A;  1F98 A;  1ODV A;  1P97 A;  2HJ9 C;  3NOT C;  3H82 B;  4YOF A;  3ZYT A;  4EEU A;  1S67 L;  1BYW A;  2O99 A;  4LRZ E;  3T4T A;  5TBM A;  4GJ4 A;  2LB9 A;  5J7E A;  2PD8 A;  2OWH A;  2PYR A;  3FPV A;  4RQ9 A;  1LSX A;  2IA2 A;  1UGU A;  3D72 A;  3F1N B;  1LT0 A;  4O0P A;  4CLC C;  4EEP A;  4NKP A;  4Y3I A;  3MF0 A;  2FZ0 A;  3DBA A;  3LR0 A;  4EQ1 A;  4M4X A;  1OTI A;  3K3D A;  2JKT M;  3T50 A;  1S4R A;  2YKH A;  4P6Z M;  2HJE A;  2OWJ A;  3H7W A;  4GCZ A;  2Y79 A;  5CX7 A;  4CLC A;  3P01 A;  2PYP A;  3VE3 A;  3W2Z A;  3OCL A;  1ZTU A;  3D3O A;  2Y8H A;  5HD3 A;  5G4Z A;  3R7W A;  3C38 A;  3MFX A;  2H28 A;  3A0V A;  3E0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...