4NXFA

Crystal structure of ilov-i486(2lt) at ph 8.0
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
105
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDGSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein, fluorescent protein
total genus 32
structure length 105
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxfA00
3F1PA 2K7SA 5TBMB 4LRZE 3F1OA 4L9EA 1OTBA 3PYPA 4PKYA 1N9LA 5J3WA 3VOLA 4HJ3A 1G28A 3F1NB 4HH3A 1GSVA 4HP4A 2JN7A 1GSXA 3MQQA 2VEAA 4I5SA 5TBMA 3HJIA 4DJ3A 4LRXC 2OOLA 4WL9A 4R70A 5F69A 2PYPA 1P0ZA 5J7EA 4I38A 3BWLA 3G6OA 3K3DA 3LIEA 2W0NA 5EFWA 3F1NA 3FG8A 2D01A 5IU1A 1XJ6A 4M4XA 2H28A 2J80A 3C8CA 1OJ5A 2PR6A 1D7EA 3OLOA 4EEUA 5HDDA 2INWA 3C2WA 2Z6CA 1S67L 4HNBA 2A24B 4E04A 5HDCA 3UE6A 2WKRA 1LSVA 4NXFA 4BBUA 1JNUA 4L9FA 1OTDA 5F5YA 4GS9B 1XFNA 2WKQA 3ULFA 2V1AA 4WN5A 1XFQA 3A0RA 4KUKA 2QJ5A 5DKLA 2QWSA 3FC7A 3MJQA 3LIAA 5DKKA 3A0VA 3LYXA 3BY8A 1T1BA 5A8BA 3RTYA 1TS0A 3E4PA 3A0SA 3IBRA 4R38A 4EESA 3LIDA 2QHKA 1OTEA 1EW0A 2B02A 3HJKA 1UWNX 1OTAA 4F3LB 5HSQA 5AVEA 4GCZA 1V9YA 4HJ6A 3VE3A 1VB6A 3T50A 3UMDA 3NJAA 4MN5A 5G4YA 1UWPX 3EWKA 4H6JB 2PD7A 4LPZA 4JGPA 4GHIB 3UMEA 2VV6A 2VLGA 5F68A 2R78A 4HH2A 3UB7A 3D72A 3B33A 4F3LA 4LRYC 4R6LA 4WLAA 2VV8A 1P97A 1ODVA 1S1YA 4KQDA 4R3AA 5J4EA 5HD3A 3E4OA 2OWHA 2ZBBA 5HDSA 2V1BA 4H6JA 4GHIA 1T1AA 2GJ3A 3P7NA 4RQ9A 1Y28A 3RH8B 4NXEA 1N9OA 5DJTA 4L9GA 3LUQA 3LIFA 1XJ2A 2ZOIA 3UB9A 4HI4A 1OTIA 1T18A 2QKPA 5G4ZA 3NOUC 5KIZA 4XT2A 2W27A 4JGRA 3UB6A 1TS6A 3VE4A 2PDRA 4HP9A 4HQAA 4HIAA 3ICYA 1T1CA 5IS1A 1LL8A 2P7JA 5I5LA 2PHYA 4DJ2A 1T19A 3H9WA 4HJ4A 5HD5A 3LI9A 1S4SA 5HWVA 2WKPA 1OT9A 5HWWA 3MFXA 4BBVA 4LLOB 2L4RA 1S66L 1TS8A 1UGUA 4NXGA 3LIBA 1S1ZA 4JGQA 4KUOA 2QJ7A 4EEPA 4K08A 4HY8A 4I3JA 3NHQA 3MR0A 3CLOA 1N9NA 3PHYA 2KDKA 1BYWA 2D02A 2M1CA 1OT6A 3GECA 2V0UA 3H82B 3NOPC 4HOIA 4EXOA 1DRMA 3EEHA 4EW7A 1GSWA 4EQ1A 3MXQA 4NXBA 5HZHA 3E4QA 2PYRA 2ZOHA 2V9AA 3IS2A 1DP9A 2YKFA 1WA9A 2JHEA 1XJ4A 1XJ3A 5AVFA 4EERA 4I3AA 2Z6DA 3H82A 2PD8A 1X0OA 2L0WA 3KX0X 4XT2B 1D06A 1OJGA 4YWZA 3LI8A 5F6AA 1NWZA 3H7WB 2HV1A 1V9ZA 4WF0A 3CAXA 1KOUA 4EETB 1TS7A 3LICA 4B9OA 3GDIA 2OWJA 1S4RA 1F98A 2BASA 1MZUA 4WUJA 2VV7A 4JGOA 4GW9A 3NOTC 4BBTA 2V0WA 3H7WA 5HWTA 2YKHA 2EA9A 3K3CA 2I9VA 2L1MA 4HHDA 3ZQ5A 1LSWA 1LSXA 1LT0A 2PR5A 3F1PB 4MN6A 3MQOA 3F1OB 1DP8A 4I3IA 4I39A 2A24A 3CWFA 1F9IA 2KX6A 2CMNA 4GS9A 3SW1A 3BY9A 3IS2B 1DP6A 5DJUA 4PKYG 3UB8A
chains in the Genus database with same CATH superfamily
4EWFA 1KE4A 4GN2A 3MZDA 4S2PA 1BTLA 4WM9A 3QP2A 3VP0A 4AFIA 4QY5A 1TDLA 3IHBA 2W3EA 2Y2KA 4OVDA 4PKYA 1N9LA 5J3WA 4E6XA 1K38A 2ZQAA 1G28A 3CZDA 2H10A 3SOIA 3SH8A 4Y3IA 1TF1A 4DRTA 4Y7PA 1Q2PA 4Q8IA 2Y2JA 1QMEA 4DJ3A 4LRXC 4EBPA 4Z9QA 4S2LA 2Z2LB 1CF0A 2GX5A 3L9KA 2G7UA 3BWLA 3G6OA 5E2GA 4YINA 5EFWA 4N1HA 4R1GA 2LB5A 5IU1A 5TJJA 4ETXA 4IHQA 5HDDA 4BLMA 2INWA 3VOZA 2BG1A 1IKIA 4R23A 2KOIA 5CXWA 3UE6A 1JNUA 5G18A 2PAVP 5KMWA 4ZJ3A 1XFNA 1TDGA 2EXAA 2VJWA 1XFQA 2OAQ1 2VKSA 3BLMA 1W63M 5EM0A 4FTXA 5CEBA 2JKGA 1MWRA 2E8JA 5DKLA 5FEFA 1JVJA 1BULA 4G3KA 2P9VB 3LIAA 4Y15A 2W1TA 4UA6A 2XA7S 1T1BA 1XKZA 5TGFA 2HDUA 3HLFA 4N92A 3RTYA 3LIDA 5DFXA 5EVIC 3QP1A 4FCFA 3NIAA 1IKGA 4OH0A 4Y0UA 4PHTA 3LY3A 4LCMA 4WMCD 2P9VA 1YLZA 1IFQA 3VE3A 4KZAA 4N1XA 4EUZA 4MN5A 1YAXA 2Y2QA 5HX9A 1W7FA 3WS1A 3IF6B 1ZG6A 1YMXA 3QP6A 4EUVA 1YLWA 4K0XA 3D72A 3B33A 3RJUA 4WLAA 1P97A 1ODVA 4Z1WA 4KQDA 4LGWA 3G34A 2ZC5B 2QZ6A 2R9XA 4GOGA 3P09A 5HPFA 2NUPC 3IF6A 4QU3A 3RFBA 2Q9MA 3LR5A 2J7VA 2ZM2A 3RH8B 3MZFA 4IVIA 4BMWA 3N6IA 3TE8A 3T4OA 5DJTA 2WKHA 4JF5A 3EGDC 4C6YA 2JKTM 1WYCA 3IX8A 5G4ZA 2P04A 2WADA 4ID4A 2ZQ9A 4PM9A 2NUTC 4ZDXA 1SKOB 1H8ZA 1RGYA 1TS6A 1FIKA 4A5RA 2Y2NA 2VGLS 5L10A 1NZUA 3HLEA 3GSGA 3ZG5A 3FZCA 4HIAA 2ZC7A 3T1SA 5IS1A 2P7JA 4UAAA 1EWZA 1PWDA 5KZHA 4C75A 3LI9A 1S4SA 1KVLA 4P6ZS 4E3IA 1IELA 4WEJA 1CEGA 1RP5A 3MFXA 3BFFA 1SKOA 1E25A 3OPLA 4MCWA 3IXGA 3BECA 1S66L 1TS8A 1RCJA 2ZMAA 1ONHA 1S1ZA 5CEDA 3FPVA 4ME4A 4KUOA 4HESA 2HP6A 2QJ7A 2X71A 4OQ0A 3HLBA 4EBNA 3GMWA 4WBGA 4LFUA 5DF9A 1LLBA 2A2LA 3CLOA 4FD8A 3PHYA 2D02A 1SZVA 5EECA 1J3WA 1O07A 3LR4A 1IYPA 2VA0A 4MN7A 2FH5A 5D3OA 5A90A 1NYMA 5EM1A 4BQMA 3M2JA 3S7QA 3V50A 4O01A 1KDWA 3UN7A 2YKFA 4BENA 4MDZA 1ES3A 3Q07A 4Y2FA 3R4KA 3VSKA 3HLWA 4KQOA 5KSHA 2FFYA 4OPRA 3EOIA 3WRZA 3NI9A 2HV1A 3Q81A 3DTEA 1XX2A 4WF0A 1TS7A 3IF6C 4RX3A 1EI5A 1OMEA 1F98A 3HCYA 2VV7A 4P87A 4GW9A 1S6RA 4OPZA 3BQAA 1ONGA 4K91A 2BLSA 3CUEA 3VFHA 2EA9A 4X25A 1YLPA 1K55A 2JC7A 2I9VA 4GD6A 1K0KA 3UO9A 3NDGA 4X68A 2JE5A 3ZCZA 4EU0A 3MXRA 1PIOA 3DTKA 1E3UA 1LT0A 2PR5A 5GLAA 4PM5A 2HDSA 1N9BA 1K56A 4I3IA 3IWOA 1K57C 1NRJA 3AGDA 4UQIS 2PRFA 2A24A 3ZNTA 2GDNA 3CWFA 2DNSA 3MZEA 1F9IA 2HGVA 1JWPA 3SW1A 1NZOA 1HTZA 3BY9A 1MWUA 3EQVA 5GHXA 2Y4AA 4XUZA 4DE0A 4NK3A 5AQAA 5GLDA 1GA0A 3LCEA 1PW1A 2EX2A 3E2KA 5M1AA 3QHYA 3U2AA 3JYIA 2VGKA 3PTEA 4LRZE 1PRQA 1SDNA 1NYYA 3C30A 4MBHA 4DXCA 4IVKA 3SS4A 1L0DA 4FOFA 3VSLA 3HUNA 3CI6A 2J8YA 2JKRI 5F83A 4ZBEA 3F1NB 4JXWA 5EVEA 2I72A 4KQQA 2PT7A 1GSXA 4I5SA 3HJIA 2RL3A 3NCKA 4IBRA 3OCLA 3A3EA 4WL9A 1P9RA 5FQ9A 4R70A 1K4EA 3G31A 5F69A 5DTKA 1VETB 2XF3A 3LEZA 3WS0A 1BLPA 3PBNA 4OLGA 2WKEA 3F1NA 3FG8A 3UDXA 4M4XA 2H28A 2EX6A 4FUWA 4IEDA 5F82A 5AQ9A 3IBJA 4EEUA 1KGFA 2G2UA 1FILA 3C2WA 4KZBA 4NG2A 4Y0TA 1K54A 1VETA 2Z6CA 3Q7ZA 5FQQA 5EVIB 1FSWA 2M7VA 3SH9A 3NBLA 4HNBA 5HDCA 2WKRA 3OZHA 4IUKA 4BBUA 4NXFA 2W3HA 4DE3A 2Y2LA 4X1LA 5F5YA 4GS9B 5EOEA 3ULFA 3WWXA 4D2OA 1NLYA 4ZRRA 3CUEC 1I2WA 4KUKA 2QJ5A 1K55C 4JPMA 5HAIA 4E3LA 1LHYA 2GNXA 5A91A 2DRWA 3TW8A 3FC7A 3BQ8A 5DKKA 3T4QA 3LYXA 1XGIA 5E2EA 4IBXA 2WGVA 2W1RA 3BFEA 4Y5FA 3IX3A 1TS0A 3BRMA 3A0SA 3IBRA 3T1QB 1ES2A 4RA7A 3HJKA 2IA2A 5FASA 1UWNX 3BFCA 2ZQ7A 5L8MA 3SS5A 3ZVTA 4QD4A 4XXRA 3B47A 2B5RA 1V9YA 2WGIA 3A3IA 1H3QA 3B3XA 2ZC4B 1HLUP 1LL5A 1VB6A 3NJAA 3O3VA 4MBFA 5G4YA 1UWPX 3G2ZA 5L2FA 2QPNA 4H6JB 2PD7A 3Q7VA 4X53A 4GHIB 2WKIA 2VV6A 2VLGA 4BWIA 3TJZC 4LRYC 5EE8A 3IHAA 1S1YA 5K5BA 2EWWA 2VGLM 2V8FA 3VFFA 5J4EA 1ES4A 1P9WA 4L0LA 4S2KA 4OQIA 4KG2A 3V67A 3DW0A 1RGZA 4Y17A 4H6JA 1TEMA 1KVMA 5I94A 4GHIA 1T1AA 1L0GA 3P7NA 2A49A 4P6ZM 4OOMA 4NXEA 1J9MA 1N9OA 1PI5A 1Y4OA 3ITBA 5CERA 2EX9A 2ZC6B 1WE4A 3EEAA 2Y55A 1XJ2A 2FZ0A 2ZOIA 3UB9A 1OTIA 1T18A 2XFTA 2W1TB 3OBFA 4PM8A 3UY6A 5FQIA 4H8RA 1PFLA 4EQIA 4JGRA 1K54C 3C4PA 3OOVA 3IWIA 1NY0A 3N8SA 4HP9A 4OONA 2XROA 1D1JA 5L09A 3BEBA 3ICYA 1Y54A 5AQ7A 3U4LP 4LV3A 3UNWA 4OP8A 5I5LA 2PHYA 4DJ2A 3E98A 4HJ4A 4GZBA 3DAVA 2OLUA 2HPBA 5HWVA 2MJ6A 3QP5A 4S2NA 4B4ZA 5HWWA 2JKFA 2QMIA 4LLOB 1I2SA 5A92A 2O9BA 5FQKA 4NXGA 3SZTA 1VM1A 3M6HA 2EFUA 4JGQA 3ZG8B 2K2NA 3CG5A 3WS5A 3S7NA 3W4PA 1ACFA 4KZ4A 4EEPA 1W8YA 3BW6A 5DTTA 5FDHA 2J9OA 1K6RA 2R9WA 2KDKA 1H5XA 1OT6A 5CGWA 3ISGA 2W3FA 1ZTUA 3GRJA 4EXOA 2ZC3B 4KG6A 1ALQA 3EEHA 1FR6A 5FI6A 4QPRA 1BUEA 3NY4A 2JKTI 4NXBA 5HZHA 1F2KA 3E4QA 1PWCA 4WELA 2PYRA 4ZJ1A 3G32A 4JXVA 1WA9A 2JHEA 1XJ4A 4YFMA 3B42A 3PBQA 2W3GA 4BD0A 5DFYA 3UPNA 3VMAA 4I3AA 2Z6DA 4ESPA 4R4SA 2BTFP 2WAFA 2Y8HA 1HD8A 4YNRA 1IEMA 3SS3A 1X0OA 3KX0X 4GB7A 2Y2HA 5F6AA 1NWZA 2XEPA 4QWOA 3H7WB 3K2NA 1V9ZA 1MKIA 3OC2A 4EETB 4UQIM 5HL6A 4B9OA 4KZ8A 3LEQA 1W8QA 3BLSA 2OWJA 3HLDA 1MZUA 1MKMA 4M3KA 2HZ5A 4GJ4A 4JGOA 2VK3A 5FQMA 3ZDJA 1MPLA 3H7WA 2UV0E 4KZ7A 1LI9A 3ZHHA 5L07A 3CPTB 1IOUA 4OQHA 1YMSA 3T1RA 2Y2PA 4MMNA 4QY6A 2XQZA 3K3CA 3RXXA 1XP4A 4WYYA 1K57A 2L1MA 4HHDA 5CECA 4OP5A 4WMCA 2C6WB 3A3FA 3IH9A 4P6BA 5GLBA 4E6WA 3F1PB 4PAUA 1G68A 3F1OB 2Y2OA 2XFSA 1BZAA 3CPTA 4I39A 5FQJA 4E3OA 4E3NA 3TSGA 2ZQCA 4CLCD 1VHMA 1KGGA 5EVLA 1C3BA 4S2NC 4PKYG 4LCLA 4CPKA 3HUOA 3IWQA 2WZXA 3F1PA 4Y0OA 3WS2A 2HJEA 2K7SA 1ERQA 4R3JA 2IWBA 3F1OA 4U3TA 3ITAA 1OTBA 5E2FA 3PYPA 3VOLA 4HJ3A 4HH3A 1GSVA 5FAQA 2JN7A 1I5QA 1GHIA 2ZMFA 3N4IA 2DCFA 2J3TD 1VEUA 2PYPA 1FCOA 1P0ZA 1G6OA 4OOYA 3Q1FA 3LIEA 3K3DA 4DXBA 2XDMA 2W0NA 3RXWA 1JTGA 3CMZA 3PR6A 3C8CA 1OJ5A 4Q0HA 1D7EA 4BL3A 2Q0OA 3OLOA 1CQAA 3G2YA 2H5SA 1FR1A 3FV7A 3T4JA 1XA7A 5AJGA 3OPHA 3IF5A 2O9AA 4JBFA 2Y79A 4E04A 2A24B 3PAEA 4DE2A 2XK1A 4B88A 2C5WB 4S2MA 1W79A 4L9FA 1LL9A 2WKQA 2HDQA 2XSSA 4CLCA 3GQZA 3GVBA 4K0WA 3A0RA 3EGXC 4PM7A 1EROA 1PYYA 4CLCE 3LO7A 4X56A 4JF6A 1L2SA 5EUAA 3ZG7B 3MJQA 5HAPA 3VP4A 3A0VA 4R3BA 1K4FA 5FATA 4X55A 2O0YA 2XGNA 3NULA 4R38A 3S7PA 5GLCA 2QHKA 2ZL1A 4GDBA 3FPWA 2J3WA 3W2ZA 2PBDP 4II7A 3AGEA 3LY4A 4G3WA 3V3RA 1ZC2A 1OTAA 2XLNA 5HSQA 3DWKA 3TG9A 3UE3A 1PI4A 2P74A 4U0XA 4HJ6A 4DMZA 2ZD8A 4JXGA 1YQSA 1H8MA 3GTCA 1BT5A 2Y59A 2EXBA 3PXPA 2A3UA 1ES5A 4LPZA 3NC8A 1FCNA 5M18A 3QP4A 1DJAA 5FA7A 3HLCA 5KSCA 3TOIA 5F68A 4HH2A 3VP2A 4PMAA 5BOHA 2VV8A 1YLTA 4PM6A 1IYSA 4KZ6A 5HD3A 3E4OA 1NRFA 2OWHA 3C7UA 3HL9A 5HDSA 3C7VA 4QJGA 2V1BA 3LGOA 3UDFA 2WUQA 4S2JA 4X1MA 5C5KA 3V5MA 2GJ3A 5GL9A 1XA1A 3S22A 2QYBA 1Y28A 4DKIA 2WGWA 4DF6A 2ACGA 3FKVA 3BYDA 5CGSA 3LUQA 4JLFA 2EWVA 4HI4A 4LENA 4R4RA 3S1YA 3HUMA 1OPXA 2QKPA 1XPBA 2JKRM 3NOUC 4XT2A 4IUHA 3IXBA 2W27A 3OPRA 1ESIA 3G30A 3UB6A 3BFDA 3KSGA 3VE4A 2PDRA 4KG5A 4HQAA 4CQHA 3IXDA 1NLZA 1T1CA 5CHMA 1PW8A 2WZZA 3UE0A 2H0TA 5HD5A 2Z2MB 4CLCC 3KYQA 5CX7A 1NXYA 4Q0IA 1YPRA 3ZG0A 2WKPA 1OT9A 4PPRA 3Q7VB 2Y2IA 2L4RA 4MBKA 1PWGA 4LV2A 3MSHA 4GNUA 1CI8A 3CHWP 1QMFA 4HY8A 1FCMA 1N9NA 3D9YA 2M1CA 2Y2GA 3MS6A 3GECA 2V0UA 4EBLA 1CEFA 1DRMA 4Q0JA 3QNBA 3OPPA 5GHYA 4EQ1A 5HFOA 2VGJA 2ZQDA 2V9AA 2J3TC 3MQ0A 3IS2A 3IXHA 3VV4A 4EERA 5GHZA 4WZ4A 2PD8A 5FAOA 1D06A 1OJGA 1YSPA 4RX2A 1IYOA 1YLJA 3JVVA 3IT9A 1NJ4A 1ESUA 2XD5A 2OLVA 3CAXA 1KOUA 2OAP1 4FH2A 5HAQA 3GDIA 4OPQA 1DY6A 5HARA 2KLIA 5E43A 5JYOA 2BASA 2ZM8A 3S7OA 2HDRA 3GR2A 1L0FA 3PAGA 2V0WA 4UA7A 2Q9NA 1KE0A 4QB8A 3BFGA 5TFQA 3O5YA 3AGFA 3WRTA 2HP9A 4D60A 3LFVA 3ZQ5A 2ZM0A 5FAPA 1LSWA 2ZJ9A 3N8LA 4DE1A 3T12B 5MC7A 1HZOA 2PU4A 4E3MA 3TRCA 3G35A 3V39A 1MC0A 2PU2A 4RVAA 3G4PA 3DTMA 5CGXA 3VOYA 1FQGA 3IH8A 4HBUA 1SCWA 5HL1A 2ZQ8A 2KX6A 2CMNA 5CTMA 1MBLA 5A93A 3O88A 3O87A 3UB8A 5LBRA 1CK3A 3EQUA 3UPPA 1YKDA 2Y91A 4DN0A 3T4LA 5TBMB 2G2WA 1YM1A 4LV1A 2K31A 4ZTKA 3ZYTA 1SHVA 4L9EA 1M40A 1AWIA 4UEYA 4XUXA 4E3KA 3W4OA 3ZG9B 1W5DA 1H8YA 4MNRA 4OKPA 4R0QA 1L0EA 1YT4A 4OPYA 4HP4A 4KENB 4BL2A 1XGJA 5HW3A 4N9LA 3MQQA 2VEAA 5TBMA 5F1FA 3QNCA 2OSUA 2OOLA 1M6KA 5FSRA 3PBTA 2VZWA 4BJPA 1LI0A 4C3QA 5J7EA 1JWZA 4I38A 4P85A 3HBRA 4P0MA 4KQRA 4WZ5A 3NDEA 2D01A 2XH9A 1IYQA 1XJ6A 3DTIA 3DBAA 4X6TA 2J80A 4NETA 2PR6A 3WS4A 3KYEA 4FH4A 1BLCA 4JF4A 3S4XA 3MF0A 4Y13A 4OLDA 5FEGA 3JPUA 1Z6FA 3GV9A 5DF7A 5DF8A 4GKUA 3BM6A 5E2HA 1S67L 1JWVA 3MBZA 4MEZA 1LSVA 1YSQA 1OTDA 3M6BA 3KSHA 4OOLA 3MKEA 1SKFA 3T4SA 2V1AA 4WN5A 4JXSA 3LR0A 2V8CA 4DDSA 1YLYA 1KE3A 3IQAA 1L3LA 1HVBA 2V1ZA 2IWCA 2QWSA 4DDYA 2VX8A 2V2FF 1BLSA 3D3OA 2XR0A 1G5UA 3BY8A 3A3DA 5A8BA 2V20A 2O9CA 4EESA 3E4PA 4CJNA 3ZFZA 1OTEA 1EW0A 2B02A 1PZPA 5DTSA 4F94A 2HP5A 3PBOA 3MMHA 4MLLA 1KGEA 4GLQA 4KZ5A 3W4QA 2GZAA 4F3LB 2JCHA 2M7UA 1F5MA 5J8XA 5AVEA 4YOFA 4GCZA 4WEKA 4ZJ2A 1E3UD 1MWTA 3CJMA 3LR3A 1PZOA 1A0KA 1VEUB 3T50A 3UMDA 3NECA 1MXOA 2DMWA 3SH7A 1K56D 2WAEA 3EWKA 4FSFA 1ZHHB 1DJBA 4JGPA 3UMEA 3PBSA 3R7WB 1TD5A 2R78A 3UB7A 2RCXA 1GHPA 4F3LA 1G6AA 4R6LA 3VP1A 2W3DA 1Q2QA 2CC1A 3MKFA 4R3AA 3ZVWA 1GA9A 3KO6A 2ZBBA 1BLHA 4ETZA 3W8KA 3C5AA 5F1GA 4NEED 1U60A 2XRNA 3ZNYA 2J9PA 1DJCA 1XXMA 3R7WA 4CLCB 3UPOA 4RQ9A 1SDEA 5EV0A 1ZKJA 4L9GA 3LIFA 4WZ5C 3OCNA 3E2LA 3JVUA 4LV0A 2P08A 3A3JA 1FOFA 3QP8A 3MFDA 1FSYA 5KIZA 2FFFB 2OV5A 2UWXA 2E8IA 1GHMA 4ARZB 2ZL1B 3P98A 4EV4A 3C38A 1CJFA 4GDNA 3KSIA 3Q82A 4O8GA 4HBTA 1LL8A 4RYEA 1T19A 1ZG4A 4QHCA 2PBYA 3N7WA 3H9WA 5AQBA 3UB5P 2Y2MA 3N8RA 1Z09A 4BBVA 4ARZA 5JYPA 3O86A 1CI9A 1UGUA 5CHJA 1ERMA 3LIBA 3BJNA 3FWLA 3T4TA 3PBRA 1K6SA 4S2OA 1WYBA 5FL3A 1GCEA 4S2IA 5CHUA 4K08A 3IX4A 4I3JA 3NHQA 3MR0A 2WK0A 4ZAMA 2LB9A 1BYWA 4B93A 3L7HA 2HF6A 2AVXA 5EVID 3VP3A 3H82B 3D4FA 4NKPA 3NOPC 4HOIA 2IWDA 2B18A 5CTNA 1MY8A 4EW7A 4IJGA 5IHVA 1GSWA 3MXQA 4KZ3A 1AXBA 2WGWB 5TR7A 2ZOHA 4E3JA 3V3SA 1DP9A 2WYXA 1XJ3A 2X01A 5AVFA 3DWZA 2O99A 5DVAA 4G3VA 2X02A 4N9KA 3H82A 5FI7A 1O7EA 3C4OA 4XT2B 1STZA 2L0WA 3HVFA 4YWZA 3LI8A 3M2KA 4UHUA 1W63Q 3E0YA 5FI2A 2B95A 5HPIA 1TVFA 3LICA 2EFXA 5CRFA 3UDIA 1S4RA 2XA7M 3KSFA 1PNEA 4WUJA 2HJ9C 5IT5A 4KZ9A 3NOTC 4BBTA 1BSGA 5M19A 2ZLYA 5U47A 3T4KA 3CITA 3UE1A 5HWTA 2H0YA 2YKHA 3HLGA 4OQGA 4UA9A 1H0MA 4BD1A 5EOOA 4B4XA 3HREA 3I7JA 1E4DA 4U0TA 1LSXA 1MWSA 1S0WA 3FYZA 1JTDA 4O7DA 1KDSA 3P01A 1K25A 2EX8A 3MXSA 4O0PA 4MN6A 1VQQA 3MQOA 4HEFA 1DP8A 5EVIA 2ZMVA 5FDSA 3ZGAB 3T1XA 2JBFA 4X69A 4GS9A 3IS2B 4JKTA 1DP6A 1N4OA 3FKWA 5DJUA 5EPHA 2XD1A 3KYZA 4GD8A
chains in the Genus database with same CATH topology
1YKDA 3U2AA 3F1PA 4DN0A 3T4LA 2HJEA 2K7SA 5TBMB 4LRZE 3F1OA 3C30A 2K31A 4FOFA 4AFIA 3ZYTA 3CI6A 1OTBA 4L9EA 2W3EA 3PYPA 4PKYA 4UEYA 1N9LA 5J3WA 3VOLA 4HJ3A 2JKRI 1G28A 3F1NB 4HH3A 4Y3IA 1TF1A 1GSVA 4HP4A 2PT7A 2JN7A 1GSXA 3MQQA 2VEAA 4I5SA 5TBMA 3HJIA 4DJ3A 2ZMFA 4LRXC 2OOLA 3OCLA 4WL9A 1P9RA 4R70A 3PBTA 2VZWA 5F69A 4BJPA 2J3TD 2GX5A 2PYPA 1P0ZA 5J7EA 1G6OA 2G7UA 4I38A 3BWLA 3G6OA 3K3DA 3LIEA 3PBNA 2W0NA 5EFWA 3F1NA 2LB5A 3FG8A 2D01A 5IU1A 1XJ6A 3PR6A 4M4XA 2H28A 3DBAA 2J80A 3C8CA 1OJ5A 2PR6A 4Q0HA 1D7EA 5TJJA 4ETXA 4IHQA 3OLOA 3IBJA 4EEUA 5HDDA 2INWA 3T4JA 3MF0A 3C2WA 5AJGA 2Z6CA 2KOIA 2O9AA 2M7VA 2Y79A 1S67L 4HNBA 2A24B 4E04A 5HDCA 3UE6A 2WKRA 4IUKA 1LSVA 4NXFA 2W3HA 4BBUA 1YSQA 1JNUA 4L9FA 1OTDA 5F5YA 4GS9B 3KSHA 1XFNA 2WKQA 4OOLA 3ULFA 2XSSA 3T4SA 4CLCA 2V1AA 1NLYA 2VJWA 4WN5A 4ZRRA 1XFQA 2OAQ1 2VKSA 3A0RA 3EGXC 3CUEC 1W63M 3LR0A 4KUKA 2QJ5A 4CLCE 5DKLA 2GNXA 2QWSA 2VX8A 3TW8A 3FC7A 4G3KA 3MJQA 3BQ8A 3LIAA 5DKKA 3D3OA 2W1TA 3A0VA 3LYXA 3T4QA 2XA7S 3BY8A 1T1BA 2W1RA 5A8BA 4Y5FA 2O9CA 2O0YA 3RTYA 1TS0A 3E4PA 3A0SA 3IBRA 4R38A 4EESA 3LIDA 3S7PA 2QHKA 1OTEA 1EW0A 2B02A 3FPWA 3HJKA 2IA2A 5DFXA 2J3WA 1UWNX 3W2ZA 3PBOA 3MMHA 5L8MA 4II7A 4GLQA 4G3WA 2GZAA 1OTAA 4F3LB 2M7UA 4PHTA 1F5MA 3B47A 5HSQA 5AVEA 4YOFA 4GCZA 1V9YA 4WEKA 3UE3A 1H3QA 3LR3A 1IFQA 4HJ6A 3VE3A 1VB6A 3T50A 4DMZA 3UMDA 3NJAA 4MN5A 5G4YA 1UWPX 1YAXA 2DMWA 1H8MA 3EWKA 3PXPA 4H6JB 2PD7A 4FSFA 4LPZA 1ZHHB 4JGPA 4GHIB 3UMEA 3PBSA 4EUVA 2VV6A 2VLGA 4BWIA 3R7WB 3TJZC 5F68A 1TD5A 2R78A 4HH2A 3UB7A 3D72A 3B33A 4F3LA 4LRYC 4R6LA 4WLAA 2VV8A 1P97A 2W3DA 1ODVA 4Z1WA 1S1YA 4KQDA 4R3AA 5K5BA 2EWWA 2VGLM 5J4EA 5HD3A 3E4OA 1P9WA 4L0LA 2OWHA 3KO6A 2ZBBA 5HDSA 2V1BA 4ETZA 3V67A 5HPFA 2NUPC 4H6JA 4NEED 3RFBA 2XRNA 4GHIA 5C5KA 3LR5A 1T1AA 2GJ3A 3R7WA 4CLCB 3P7NA 2QYBA 4RQ9A 4P6ZM 1Y28A 3RH8B 4OOMA 4NXEA 4BMWA 1N9OA 3TE8A 3T4OA 5DJTA 4L9GA 3LUQA 3EEAA 3LIFA 3EGDC 1XJ2A 2EWVA 3OCNA 3JVUA 2FZ0A 2ZOIA 3UB9A 2JKTM 2P08A 4HI4A 1OTIA 1T18A 1OPXA 2QKPA 2W1TB 2JKRM 3OBFA 3NOUC 5G4ZA 5KIZA 4XT2A 4IUHA 2P04A 2W27A 4JGRA 3OOVA 2NUTC 3UB6A 4ARZB 3KSGA 1TS6A 3C38A 3VE4A 2PDRA 2VGLS 4HP9A 4HQAA 2XROA 4CQHA 1NLZA 3ICYA 4HIAA 1T1CA 3KSIA 4O8GA 5IS1A 1LL8A 2P7JA 5I5LA 2PHYA 4DJ2A 1T19A 3E98A 3H9WA 4HJ4A 5HD5A 4CLCC 3KYQA 5CX7A 3LI9A 4Q0IA 1S4SA 5HWVA 2MJ6A 4P6ZS 2WKPA 1OT9A 4WEJA 5HWWA 3MFXA 4BBVA 4LLOB 4ARZA 2O9BA 2L4RA 4MCWA 1S66L 1TS8A 1UGUA 4NXGA 3LIBA 1S1ZA 3BJNA 3T4TA 4JGQA 3PBRA 3FPVA 4ME4A 2K2NA 4KUOA 5FL3A 2QJ7A 3S7NA 4EEPA 4K08A 4HY8A 3BW6A 4I3JA 3NHQA 5DF9A 3MR0A 2A2LA 3CLOA 1N9NA 2LB9A 2KDKA 1BYWA 3PHYA 2D02A 4B93A 2M1CA 2HF6A 1OT6A 3GECA 2V0UA 3H82B 2W3FA 3LR4A 4NKPA 1ZTUA 2VA0A 3NOPC 4HOIA 4MN7A 4EXOA 1DRMA 2B18A 3EEHA 4Q0JA 2FH5A 4EW7A 4IJGA 4QPRA 1GSWA 4EQ1A 3MXQA 3S7QA 2JKTI 4NXBA 5HZHA 3E4QA 4WELA 2PYRA 2ZOHA 2V9AA 2J3TC 3MQ0A 3IS2A 4O01A 1DP9A 2YKFA 1WA9A 2JHEA 1XJ4A 3VV4A 1XJ3A 4MDZA 3B42A 5AVFA 3PBQA 4EERA 2W3GA 5DFYA 4I3AA 2Z6DA 2O99A 4Y2FA 4G3VA 3R4KA 3H82A 2Y8HA 4YNRA 2PD8A 1STZA 1X0OA 2L0WA 3KX0X 4KQOA 4XT2B 5KSHA 1D06A 1OJGA 1YSPA 4YWZA 3LI8A 3EOIA 5F6AA 1NWZA 3JVVA 3H7WB 3K2NA 1W63Q 2HV1A 1V9ZA 3E0YA 4WF0A 3CAXA 1KOUA 5HPIA 3OC2A 4EETB 1TS7A 2OAP1 3LICA 4UQIM 5HL6A 4B9OA 3GDIA 2OWJA 1S4RA 1F98A 2KLIA 3HCYA 2XA7M 2BASA 3KSFA 1MZUA 1MKMA 2HJ9C 4WUJA 2VV7A 3S7OA 4GJ4A 5IT5A 4JGOA 4GW9A 3NOTC 4BBTA 3T4KA 3BQAA 3CITA 2V0WA 3H7WA 5HWTA 3CUEA 2YKHA 2EA9A 1IOUA 3O5YA 4MMNA 3K3CA 2I9VA 3LFVA 2L1MA 4HHDA 3ZQ5A 1LSWA 1LSXA 5MC7A 4EU0A 3TRCA 1LT0A 3P01A 1MC0A 2PR5A 4O0PA 3F1PB 4MN6A 4PAUA 3MQOA 3F1OB 1DP8A 4I3IA 2ZMVA 4I39A 1NRJA 4UQIS 2A24A 3CWFA 1F9IA 2HGVA 4CLCD 2KX6A 2CMNA 4GS9A 1VHMA 3BY9A 3EQVA 3IS2B 3SW1A 1DP6A 5DJUA 4PKYG 3KYZA 3UB8A 5LBRA 3EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1P A;  2K7S A;  5TBM B;  4LRZ E;  3F1O A;  4L9E A;  1OTB A;  3PYP A;  4PKY A;  1N9L A;  5J3W A;  3VOL A;  4HJ3 A;  1G28 A;  3F1N B;  4HH3 A;  1GSV A;  4HP4 A;  2JN7 A;  1GSX A;  3MQQ A;  2VEA A;  4I5S A;  5TBM A;  3HJI A;  4DJ3 A;  4LRX C;  2OOL A;  4WL9 A;  4R70 A;  5F69 A;  2PYP A;  1P0Z A;  5J7E A;  4I38 A;  3BWL A;  3G6O A;  3K3D A;  3LIE A;  2W0N A;  5EFW A;  3F1N A;  3FG8 A;  2D01 A;  5IU1 A;  1XJ6 A;  4M4X A;  2H28 A;  2J80 A;  3C8C A;  1OJ5 A;  2PR6 A;  1D7E A;  3OLO A;  4EEU A;  5HDD A;  2INW A;  3C2W A;  2Z6C A;  1S67 L;  4HNB A;  2A24 B;  4E04 A;  5HDC A;  3UE6 A;  2WKR A;  1LSV A;  4NXF A;  4BBU A;  1JNU A;  4L9F A;  1OTD A;  5F5Y A;  4GS9 B;  1XFN A;  2WKQ A;  3ULF A;  2V1A A;  4WN5 A;  1XFQ A;  3A0R A;  4KUK A;  2QJ5 A;  5DKL A;  2QWS A;  3FC7 A;  3MJQ A;  3LIA A;  5DKK A;  3A0V A;  3LYX A;  3BY8 A;  1T1B A;  5A8B A;  3RTY A;  1TS0 A;  3E4P A;  3A0S A;  3IBR A;  4R38 A;  4EES A;  3LID A;  2QHK A;  1OTE A;  1EW0 A;  2B02 A;  3HJK A;  1UWN X;  1OTA A;  4F3L B;  5HSQ A;  5AVE A;  4GCZ A;  1V9Y A;  4HJ6 A;  3VE3 A;  1VB6 A;  3T50 A;  3UMD A;  3NJA A;  4MN5 A;  5G4Y A;  1UWP X;  3EWK A;  4H6J B;  2PD7 A;  4LPZ A;  4JGP A;  4GHI B;  3UME A;  2VV6 A;  2VLG A;  5F68 A;  2R78 A;  4HH2 A;  3UB7 A;  3D72 A;  3B33 A;  4F3L A;  4LRY C;  4R6L A;  4WLA A;  2VV8 A;  1P97 A;  1ODV A;  1S1Y A;  4KQD A;  4R3A A;  5J4E A;  5HD3 A;  3E4O A;  2OWH A;  2ZBB A;  5HDS A;  2V1B A;  4H6J A;  4GHI A;  1T1A A;  2GJ3 A;  3P7N A;  4RQ9 A;  1Y28 A;  3RH8 B;  4NXE A;  1N9O A;  5DJT A;  4L9G A;  3LUQ A;  3LIF A;  1XJ2 A;  2ZOI A;  3UB9 A;  4HI4 A;  1OTI A;  1T18 A;  2QKP A;  5G4Z A;  3NOU C;  5KIZ A;  4XT2 A;  2W27 A;  4JGR A;  3UB6 A;  1TS6 A;  3VE4 A;  2PDR A;  4HP9 A;  4HQA A;  4HIA A;  3ICY A;  1T1C A;  5IS1 A;  1LL8 A;  2P7J A;  5I5L A;  2PHY A;  4DJ2 A;  1T19 A;  3H9W A;  4HJ4 A;  5HD5 A;  3LI9 A;  1S4S A;  5HWV A;  2WKP A;  1OT9 A;  5HWW A;  3MFX A;  4BBV A;  4LLO B;  2L4R A;  1S66 L;  1TS8 A;  1UGU A;  4NXG A;  3LIB A;  1S1Z A;  4JGQ A;  4KUO A;  2QJ7 A;  4EEP A;  4K08 A;  4HY8 A;  4I3J A;  3NHQ A;  3MR0 A;  3CLO A;  1N9N A;  3PHY A;  2KDK A;  1BYW A;  2D02 A;  2M1C A;  1OT6 A;  3GEC A;  2V0U A;  3H82 B;  3NOP C;  4HOI A;  4EXO A;  1DRM A;  3EEH A;  4EW7 A;  1GSW A;  4EQ1 A;  3MXQ A;  4NXB A;  5HZH A;  3E4Q A;  2PYR A;  2ZOH A;  2V9A A;  3IS2 A;  1DP9 A;  2YKF A;  1WA9 A;  2JHE A;  1XJ4 A;  1XJ3 A;  5AVF A;  4EER A;  4I3A A;  2Z6D A;  3H82 A;  2PD8 A;  1X0O A;  2L0W A;  3KX0 X;  4XT2 B;  1D06 A;  1OJG A;  4YWZ A;  3LI8 A;  5F6A A;  1NWZ A;  3H7W B;  2HV1 A;  1V9Z A;  4WF0 A;  3CAX A;  1KOU A;  4EET B;  1TS7 A;  3LIC A;  4B9O A;  3GDI A;  2OWJ A;  1S4R A;  1F98 A;  2BAS A;  1MZU A;  4WUJ A;  2VV7 A;  4JGO A;  4GW9 A;  3NOT C;  4BBT A;  2V0W A;  3H7W A;  5HWT A;  2YKH A;  2EA9 A;  3K3C A;  2I9V A;  2L1M A;  4HHD A;  3ZQ5 A;  1LSW A;  1LSX A;  1LT0 A;  2PR5 A;  3F1P B;  4MN6 A;  3MQO A;  3F1O B;  1DP8 A;  4I3I A;  4I39 A;  2A24 A;  3CWF A;  1F9I A;  2KX6 A;  2CMN A;  4GS9 A;  3SW1 A;  3BY9 A;  3IS2 B;  1DP6 A;  5DJU A;  4PKY G;  3UB8 A; 
#chains in the Genus database with same CATH topology
 4EWF A;  1KE4 A;  4GN2 A;  3MZD A;  4S2P A;  1BTL A;  4WM9 A;  3QP2 A;  3VP0 A;  4AFI A;  4QY5 A;  1TDL A;  3IHB A;  2W3E A;  2Y2K A;  4OVD A;  4PKY A;  1N9L A;  5J3W A;  4E6X A;  1K38 A;  2ZQA A;  1G28 A;  3CZD A;  2H10 A;  3SOI A;  3SH8 A;  4Y3I A;  1TF1 A;  4DRT A;  4Y7P A;  1Q2P A;  4Q8I A;  2Y2J A;  1QME A;  4DJ3 A;  4LRX C;  4EBP A;  4Z9Q A;  4S2L A;  2Z2L B;  1CF0 A;  2GX5 A;  3L9K A;  2G7U A;  3BWL A;  3G6O A;  5E2G A;  4YIN A;  5EFW A;  4N1H A;  4R1G A;  2LB5 A;  5IU1 A;  5TJJ A;  4ETX A;  4IHQ A;  5HDD A;  4BLM A;  2INW A;  3VOZ A;  2BG1 A;  1IKI A;  4R23 A;  2KOI A;  5CXW A;  3UE6 A;  1JNU A;  5G18 A;  2PAV P;  5KMW A;  4ZJ3 A;  1XFN A;  1TDG A;  2EXA A;  2VJW A;  1XFQ A;  2OAQ 1;  2VKS A;  3BLM A;  1W63 M;  5EM0 A;  4FTX A;  5CEB A;  2JKG A;  1MWR A;  2E8J A;  5DKL A;  5FEF A;  1JVJ A;  1BUL A;  4G3K A;  2P9V B;  3LIA A;  4Y15 A;  2W1T A;  4UA6 A;  2XA7 S;  1T1B A;  1XKZ A;  5TGF A;  2HDU A;  3HLF A;  4N92 A;  3RTY A;  3LID A;  5DFX A;  5EVI C;  3QP1 A;  4FCF A;  3NIA A;  1IKG A;  4OH0 A;  4Y0U A;  4PHT A;  3LY3 A;  4LCM A;  4WMC D;  2P9V A;  1YLZ A;  1IFQ A;  3VE3 A;  4KZA A;  4N1X A;  4EUZ A;  4MN5 A;  1YAX A;  2Y2Q A;  5HX9 A;  1W7F A;  3WS1 A;  3IF6 B;  1ZG6 A;  1YMX A;  3QP6 A;  4EUV A;  1YLW A;  4K0X A;  3D72 A;  3B33 A;  3RJU A;  4WLA A;  1P97 A;  1ODV A;  4Z1W A;  4KQD A;  4LGW A;  3G34 A;  2ZC5 B;  2QZ6 A;  2R9X A;  4GOG A;  3P09 A;  5HPF A;  2NUP C;  3IF6 A;  4QU3 A;  3RFB A;  2Q9M A;  3LR5 A;  2J7V A;  2ZM2 A;  3RH8 B;  3MZF A;  4IVI A;  4BMW A;  3N6I A;  3TE8 A;  3T4O A;  5DJT A;  2WKH A;  4JF5 A;  3EGD C;  4C6Y A;  2JKT M;  1WYC A;  3IX8 A;  5G4Z A;  2P04 A;  2WAD A;  4ID4 A;  2ZQ9 A;  4PM9 A;  2NUT C;  4ZDX A;  1SKO B;  1H8Z A;  1RGY A;  1TS6 A;  1FIK A;  4A5R A;  2Y2N A;  2VGL S;  5L10 A;  1NZU A;  3HLE A;  3GSG A;  3ZG5 A;  3FZC A;  4HIA A;  2ZC7 A;  3T1S A;  5IS1 A;  2P7J A;  4UAA A;  1EWZ A;  1PWD A;  5KZH A;  4C75 A;  3LI9 A;  1S4S A;  1KVL A;  4P6Z S;  4E3I A;  1IEL A;  4WEJ A;  1CEG A;  1RP5 A;  3MFX A;  3BFF A;  1SKO A;  1E25 A;  3OPL A;  4MCW A;  3IXG A;  3BEC A;  1S66 L;  1TS8 A;  1RCJ A;  2ZMA A;  1ONH A;  1S1Z A;  5CED A;  3FPV A;  4ME4 A;  4KUO A;  4HES A;  2HP6 A;  2QJ7 A;  2X71 A;  4OQ0 A;  3HLB A;  4EBN A;  3GMW A;  4WBG A;  4LFU A;  5DF9 A;  1LLB A;  2A2L A;  3CLO A;  4FD8 A;  3PHY A;  2D02 A;  1SZV A;  5EEC A;  1J3W A;  1O07 A;  3LR4 A;  1IYP A;  2VA0 A;  4MN7 A;  2FH5 A;  5D3O A;  5A90 A;  1NYM A;  5EM1 A;  4BQM A;  3M2J A;  3S7Q A;  3V50 A;  4O01 A;  1KDW A;  3UN7 A;  2YKF A;  4BEN A;  4MDZ A;  1ES3 A;  3Q07 A;  4Y2F A;  3R4K A;  3VSK A;  3HLW A;  4KQO A;  5KSH A;  2FFY A;  4OPR A;  3EOI A;  3WRZ A;  3NI9 A;  2HV1 A;  3Q81 A;  3DTE A;  1XX2 A;  4WF0 A;  1TS7 A;  3IF6 C;  4RX3 A;  1EI5 A;  1OME A;  1F98 A;  3HCY A;  2VV7 A;  4P87 A;  4GW9 A;  1S6R A;  4OPZ A;  3BQA A;  1ONG A;  4K91 A;  2BLS A;  3CUE A;  3VFH A;  2EA9 A;  4X25 A;  1YLP A;  1K55 A;  2JC7 A;  2I9V A;  4GD6 A;  1K0K A;  3UO9 A;  3NDG A;  4X68 A;  2JE5 A;  3ZCZ A;  4EU0 A;  3MXR A;  1PIO A;  3DTK A;  1E3U A;  1LT0 A;  2PR5 A;  5GLA A;  4PM5 A;  2HDS A;  1N9B A;  1K56 A;  4I3I A;  3IWO A;  1K57 C;  1NRJ A;  3AGD A;  4UQI S;  2PRF A;  2A24 A;  3ZNT A;  2GDN A;  3CWF A;  2DNS A;  3MZE A;  1F9I A;  2HGV A;  1JWP A;  3SW1 A;  1NZO A;  1HTZ A;  3BY9 A;  1MWU A;  3EQV A;  5GHX A;  2Y4A A;  4XUZ A;  4DE0 A;  4NK3 A;  5AQA A;  5GLD A;  1GA0 A;  3LCE A;  1PW1 A;  2EX2 A;  3E2K A;  5M1A A;  3QHY A;  3U2A A;  3JYI A;  2VGK A;  3PTE A;  4LRZ E;  1PRQ A;  1SDN A;  1NYY A;  3C30 A;  4MBH A;  4DXC A;  4IVK A;  3SS4 A;  1L0D A;  4FOF A;  3VSL A;  3HUN A;  3CI6 A;  2J8Y A;  2JKR I;  5F83 A;  4ZBE A;  3F1N B;  4JXW A;  5EVE A;  2I72 A;  4KQQ A;  2PT7 A;  1GSX A;  4I5S A;  3HJI A;  2RL3 A;  3NCK A;  4IBR A;  3OCL A;  3A3E A;  4WL9 A;  1P9R A;  5FQ9 A;  4R70 A;  1K4E A;  3G31 A;  5F69 A;  5DTK A;  1VET B;  2XF3 A;  3LEZ A;  3WS0 A;  1BLP A;  3PBN A;  4OLG A;  2WKE A;  3F1N A;  3FG8 A;  3UDX A;  4M4X A;  2H28 A;  2EX6 A;  4FUW A;  4IED A;  5F82 A;  5AQ9 A;  3IBJ A;  4EEU A;  1KGF A;  2G2U A;  1FIL A;  3C2W A;  4KZB A;  4NG2 A;  4Y0T A;  1K54 A;  1VET A;  2Z6C A;  3Q7Z A;  5FQQ A;  5EVI B;  1FSW A;  2M7V A;  3SH9 A;  3NBL A;  4HNB A;  5HDC A;  2WKR A;  3OZH A;  4IUK A;  4BBU A;  4NXF A;  2W3H A;  4DE3 A;  2Y2L A;  4X1L A;  5F5Y A;  4GS9 B;  5EOE A;  3ULF A;  3WWX A;  4D2O A;  1NLY A;  4ZRR A;  3CUE C;  1I2W A;  4KUK A;  2QJ5 A;  1K55 C;  4JPM A;  5HAI A;  4E3L A;  1LHY A;  2GNX A;  5A91 A;  2DRW A;  3TW8 A;  3FC7 A;  3BQ8 A;  5DKK A;  3T4Q A;  3LYX A;  1XGI A;  5E2E A;  4IBX A;  2WGV A;  2W1R A;  3BFE A;  4Y5F A;  3IX3 A;  1TS0 A;  3BRM A;  3A0S A;  3IBR A;  3T1Q B;  1ES2 A;  4RA7 A;  3HJK A;  2IA2 A;  5FAS A;  1UWN X;  3BFC A;  2ZQ7 A;  5L8M A;  3SS5 A;  3ZVT A;  4QD4 A;  4XXR A;  3B47 A;  2B5R A;  1V9Y A;  2WGI A;  3A3I A;  1H3Q A;  3B3X A;  2ZC4 B;  1HLU P;  1LL5 A;  1VB6 A;  3NJA A;  3O3V A;  4MBF A;  5G4Y A;  1UWP X;  3G2Z A;  5L2F A;  2QPN A;  4H6J B;  2PD7 A;  3Q7V A;  4X53 A;  4GHI B;  2WKI A;  2VV6 A;  2VLG A;  4BWI A;  3TJZ C;  4LRY C;  5EE8 A;  3IHA A;  1S1Y A;  5K5B A;  2EWW A;  2VGL M;  2V8F A;  3VFF A;  5J4E A;  1ES4 A;  1P9W A;  4L0L A;  4S2K A;  4OQI A;  4KG2 A;  3V67 A;  3DW0 A;  1RGZ A;  4Y17 A;  4H6J A;  1TEM A;  1KVM A;  5I94 A;  4GHI A;  1T1A A;  1L0G A;  3P7N A;  2A49 A;  4P6Z M;  4OOM A;  4NXE A;  1J9M A;  1N9O A;  1PI5 A;  1Y4O A;  3ITB A;  5CER A;  2EX9 A;  2ZC6 B;  1WE4 A;  3EEA A;  2Y55 A;  1XJ2 A;  2FZ0 A;  2ZOI A;  3UB9 A;  1OTI A;  1T18 A;  2XFT A;  2W1T B;  3OBF A;  4PM8 A;  3UY6 A;  5FQI A;  4H8R A;  1PFL A;  4EQI A;  4JGR A;  1K54 C;  3C4P A;  3OOV A;  3IWI A;  1NY0 A;  3N8S A;  4HP9 A;  4OON A;  2XRO A;  1D1J A;  5L09 A;  3BEB A;  3ICY A;  1Y54 A;  5AQ7 A;  3U4L P;  4LV3 A;  3UNW A;  4OP8 A;  5I5L A;  2PHY A;  4DJ2 A;  3E98 A;  4HJ4 A;  4GZB A;  3DAV A;  2OLU A;  2HPB A;  5HWV A;  2MJ6 A;  3QP5 A;  4S2N A;  4B4Z A;  5HWW A;  2JKF A;  2QMI A;  4LLO B;  1I2S A;  5A92 A;  2O9B A;  5FQK A;  4NXG A;  3SZT A;  1VM1 A;  3M6H A;  2EFU A;  4JGQ A;  3ZG8 B;  2K2N A;  3CG5 A;  3WS5 A;  3S7N A;  3W4P A;  1ACF A;  4KZ4 A;  4EEP A;  1W8Y A;  3BW6 A;  5DTT A;  5FDH A;  2J9O A;  1K6R A;  2R9W A;  2KDK A;  1H5X A;  1OT6 A;  5CGW A;  3ISG A;  2W3F A;  1ZTU A;  3GRJ A;  4EXO A;  2ZC3 B;  4KG6 A;  1ALQ A;  3EEH A;  1FR6 A;  5FI6 A;  4QPR A;  1BUE A;  3NY4 A;  2JKT I;  4NXB A;  5HZH A;  1F2K A;  3E4Q A;  1PWC A;  4WEL A;  2PYR A;  4ZJ1 A;  3G32 A;  4JXV A;  1WA9 A;  2JHE A;  1XJ4 A;  4YFM A;  3B42 A;  3PBQ A;  2W3G A;  4BD0 A;  5DFY A;  3UPN A;  3VMA A;  4I3A A;  2Z6D A;  4ESP A;  4R4S A;  2BTF P;  2WAF A;  2Y8H A;  1HD8 A;  4YNR A;  1IEM A;  3SS3 A;  1X0O A;  3KX0 X;  4GB7 A;  2Y2H A;  5F6A A;  1NWZ A;  2XEP A;  4QWO A;  3H7W B;  3K2N A;  1V9Z A;  1MKI A;  3OC2 A;  4EET B;  4UQI M;  5HL6 A;  4B9O A;  4KZ8 A;  3LEQ A;  1W8Q A;  3BLS A;  2OWJ A;  3HLD A;  1MZU A;  1MKM A;  4M3K A;  2HZ5 A;  4GJ4 A;  4JGO A;  2VK3 A;  5FQM A;  3ZDJ A;  1MPL A;  3H7W A;  2UV0 E;  4KZ7 A;  1LI9 A;  3ZHH A;  5L07 A;  3CPT B;  1IOU A;  4OQH A;  1YMS A;  3T1R A;  2Y2P A;  4MMN A;  4QY6 A;  2XQZ A;  3K3C A;  3RXX A;  1XP4 A;  4WYY A;  1K57 A;  2L1M A;  4HHD A;  5CEC A;  4OP5 A;  4WMC A;  2C6W B;  3A3F A;  3IH9 A;  4P6B A;  5GLB A;  4E6W A;  3F1P B;  4PAU A;  1G68 A;  3F1O B;  2Y2O A;  2XFS A;  1BZA A;  3CPT A;  4I39 A;  5FQJ A;  4E3O A;  4E3N A;  3TSG A;  2ZQC A;  4CLC D;  1VHM A;  1KGG A;  5EVL A;  1C3B A;  4S2N C;  4PKY G;  4LCL A;  4CPK A;  3HUO A;  3IWQ A;  2WZX A;  3F1P A;  4Y0O A;  3WS2 A;  2HJE A;  2K7S A;  1ERQ A;  4R3J A;  2IWB A;  3F1O A;  4U3T A;  3ITA A;  1OTB A;  5E2F A;  3PYP A;  3VOL A;  4HJ3 A;  4HH3 A;  1GSV A;  5FAQ A;  2JN7 A;  1I5Q A;  1GHI A;  2ZMF A;  3N4I A;  2DCF A;  2J3T D;  1VEU A;  2PYP A;  1FCO A;  1P0Z A;  1G6O A;  4OOY A;  3Q1F A;  3LIE A;  3K3D A;  4DXB A;  2XDM A;  2W0N A;  3RXW A;  1JTG A;  3CMZ A;  3PR6 A;  3C8C A;  1OJ5 A;  4Q0H A;  1D7E A;  4BL3 A;  2Q0O A;  3OLO A;  1CQA A;  3G2Y A;  2H5S A;  1FR1 A;  3FV7 A;  3T4J A;  1XA7 A;  5AJG A;  3OPH A;  3IF5 A;  2O9A A;  4JBF A;  2Y79 A;  4E04 A;  2A24 B;  3PAE A;  4DE2 A;  2XK1 A;  4B88 A;  2C5W B;  4S2M A;  1W79 A;  4L9F A;  1LL9 A;  2WKQ A;  2HDQ A;  2XSS A;  4CLC A;  3GQZ A;  3GVB A;  4K0W A;  3A0R A;  3EGX C;  4PM7 A;  1ERO A;  1PYY A;  4CLC E;  3LO7 A;  4X56 A;  4JF6 A;  1L2S A;  5EUA A;  3ZG7 B;  3MJQ A;  5HAP A;  3VP4 A;  3A0V A;  4R3B A;  1K4F A;  5FAT A;  4X55 A;  2O0Y A;  2XGN A;  3NUL A;  4R38 A;  3S7P A;  5GLC A;  2QHK A;  2ZL1 A;  4GDB A;  3FPW A;  2J3W A;  3W2Z A;  2PBD P;  4II7 A;  3AGE A;  3LY4 A;  4G3W A;  3V3R A;  1ZC2 A;  1OTA A;  2XLN A;  5HSQ A;  3DWK A;  3TG9 A;  3UE3 A;  1PI4 A;  2P74 A;  4U0X A;  4HJ6 A;  4DMZ A;  2ZD8 A;  4JXG A;  1YQS A;  1H8M A;  3GTC A;  1BT5 A;  2Y59 A;  2EXB A;  3PXP A;  2A3U A;  1ES5 A;  4LPZ A;  3NC8 A;  1FCN A;  5M18 A;  3QP4 A;  1DJA A;  5FA7 A;  3HLC A;  5KSC A;  3TOI A;  5F68 A;  4HH2 A;  3VP2 A;  4PMA A;  5BOH A;  2VV8 A;  1YLT A;  4PM6 A;  1IYS A;  4KZ6 A;  5HD3 A;  3E4O A;  1NRF A;  2OWH A;  3C7U A;  3HL9 A;  5HDS A;  3C7V A;  4QJG A;  2V1B A;  3LGO A;  3UDF A;  2WUQ A;  4S2J A;  4X1M A;  5C5K A;  3V5M A;  2GJ3 A;  5GL9 A;  1XA1 A;  3S22 A;  2QYB A;  1Y28 A;  4DKI A;  2WGW A;  4DF6 A;  2ACG A;  3FKV A;  3BYD A;  5CGS A;  3LUQ A;  4JLF A;  2EWV A;  4HI4 A;  4LEN A;  4R4R A;  3S1Y A;  3HUM A;  1OPX A;  2QKP A;  1XPB A;  2JKR M;  3NOU C;  4XT2 A;  4IUH A;  3IXB A;  2W27 A;  3OPR A;  1ESI A;  3G30 A;  3UB6 A;  3BFD A;  3KSG A;  3VE4 A;  2PDR A;  4KG5 A;  4HQA A;  4CQH A;  3IXD A;  1NLZ A;  1T1C A;  5CHM A;  1PW8 A;  2WZZ A;  3UE0 A;  2H0T A;  5HD5 A;  2Z2M B;  4CLC C;  3KYQ A;  5CX7 A;  1NXY A;  4Q0I A;  1YPR A;  3ZG0 A;  2WKP A;  1OT9 A;  4PPR A;  3Q7V B;  2Y2I A;  2L4R A;  4MBK A;  1PWG A;  4LV2 A;  3MSH A;  4GNU A;  1CI8 A;  3CHW P;  1QMF A;  4HY8 A;  1FCM A;  1N9N A;  3D9Y A;  2M1C A;  2Y2G A;  3MS6 A;  3GEC A;  2V0U A;  4EBL A;  1CEF A;  1DRM A;  4Q0J A;  3QNB A;  3OPP A;  5GHY A;  4EQ1 A;  5HFO A;  2VGJ A;  2ZQD A;  2V9A A;  2J3T C;  3MQ0 A;  3IS2 A;  3IXH A;  3VV4 A;  4EER A;  5GHZ A;  4WZ4 A;  2PD8 A;  5FAO A;  1D06 A;  1OJG A;  1YSP A;  4RX2 A;  1IYO A;  1YLJ A;  3JVV A;  3IT9 A;  1NJ4 A;  1ESU A;  2XD5 A;  2OLV A;  3CAX A;  1KOU A;  2OAP 1;  4FH2 A;  5HAQ A;  3GDI A;  4OPQ A;  1DY6 A;  5HAR A;  2KLI A;  5E43 A;  5JYO A;  2BAS A;  2ZM8 A;  3S7O A;  2HDR A;  3GR2 A;  1L0F A;  3PAG A;  2V0W A;  4UA7 A;  2Q9N A;  1KE0 A;  4QB8 A;  3BFG A;  5TFQ A;  3O5Y A;  3AGF A;  3WRT A;  2HP9 A;  4D60 A;  3LFV A;  3ZQ5 A;  2ZM0 A;  5FAP A;  1LSW A;  2ZJ9 A;  3N8L A;  4DE1 A;  3T12 B;  5MC7 A;  1HZO A;  2PU4 A;  4E3M A;  3TRC A;  3G35 A;  3V39 A;  1MC0 A;  2PU2 A;  4RVA A;  3G4P A;  3DTM A;  5CGX A;  3VOY A;  1FQG A;  3IH8 A;  4HBU A;  1SCW A;  5HL1 A;  2ZQ8 A;  2KX6 A;  2CMN A;  5CTM A;  1MBL A;  5A93 A;  3O88 A;  3O87 A;  3UB8 A;  5LBR A;  1CK3 A;  3EQU A;  3UPP A;  1YKD A;  2Y91 A;  4DN0 A;  3T4L A;  5TBM B;  2G2W A;  1YM1 A;  4LV1 A;  2K31 A;  4ZTK A;  3ZYT A;  1SHV A;  4L9E A;  1M40 A;  1AWI A;  4UEY A;  4XUX A;  4E3K A;  3W4O A;  3ZG9 B;  1W5D A;  1H8Y A;  4MNR A;  4OKP A;  4R0Q A;  1L0E A;  1YT4 A;  4OPY A;  4HP4 A;  4KEN B;  4BL2 A;  1XGJ A;  5HW3 A;  4N9L A;  3MQQ A;  2VEA A;  5TBM A;  5F1F A;  3QNC A;  2OSU A;  2OOL A;  1M6K A;  5FSR A;  3PBT A;  2VZW A;  4BJP A;  1LI0 A;  4C3Q A;  5J7E A;  1JWZ A;  4I38 A;  4P85 A;  3HBR A;  4P0M A;  4KQR A;  4WZ5 A;  3NDE A;  2D01 A;  2XH9 A;  1IYQ A;  1XJ6 A;  3DTI A;  3DBA A;  4X6T A;  2J80 A;  4NET A;  2PR6 A;  3WS4 A;  3KYE A;  4FH4 A;  1BLC A;  4JF4 A;  3S4X A;  3MF0 A;  4Y13 A;  4OLD A;  5FEG A;  3JPU A;  1Z6F A;  3GV9 A;  5DF7 A;  5DF8 A;  4GKU A;  3BM6 A;  5E2H A;  1S67 L;  1JWV A;  3MBZ A;  4MEZ A;  1LSV A;  1YSQ A;  1OTD A;  3M6B A;  3KSH A;  4OOL A;  3MKE A;  1SKF A;  3T4S A;  2V1A A;  4WN5 A;  4JXS A;  3LR0 A;  2V8C A;  4DDS A;  1YLY A;  1KE3 A;  3IQA A;  1L3L A;  1HVB A;  2V1Z A;  2IWC A;  2QWS A;  4DDY A;  2VX8 A;  2V2F F;  1BLS A;  3D3O A;  2XR0 A;  1G5U A;  3BY8 A;  3A3D A;  5A8B A;  2V20 A;  2O9C A;  4EES A;  3E4P A;  4CJN A;  3ZFZ A;  1OTE A;  1EW0 A;  2B02 A;  1PZP A;  5DTS A;  4F94 A;  2HP5 A;  3PBO A;  3MMH A;  4MLL A;  1KGE A;  4GLQ A;  4KZ5 A;  3W4Q A;  2GZA A;  4F3L B;  2JCH A;  2M7U A;  1F5M A;  5J8X A;  5AVE A;  4YOF A;  4GCZ A;  4WEK A;  4ZJ2 A;  1E3U D;  1MWT A;  3CJM A;  3LR3 A;  1PZO A;  1A0K A;  1VEU B;  3T50 A;  3UMD A;  3NEC A;  1MXO A;  2DMW A;  3SH7 A;  1K56 D;  2WAE A;  3EWK A;  4FSF A;  1ZHH B;  1DJB A;  4JGP A;  3UME A;  3PBS A;  3R7W B;  1TD5 A;  2R78 A;  3UB7 A;  2RCX A;  1GHP A;  4F3L A;  1G6A A;  4R6L A;  3VP1 A;  2W3D A;  1Q2Q A;  2CC1 A;  3MKF A;  4R3A A;  3ZVW A;  1GA9 A;  3KO6 A;  2ZBB A;  1BLH A;  4ETZ A;  3W8K A;  3C5A A;  5F1G A;  4NEE D;  1U60 A;  2XRN A;  3ZNY A;  2J9P A;  1DJC A;  1XXM A;  3R7W A;  4CLC B;  3UPO A;  4RQ9 A;  1SDE A;  5EV0 A;  1ZKJ A;  4L9G A;  3LIF A;  4WZ5 C;  3OCN A;  3E2L A;  3JVU A;  4LV0 A;  2P08 A;  3A3J A;  1FOF A;  3QP8 A;  3MFD A;  1FSY A;  5KIZ A;  2FFF B;  2OV5 A;  2UWX A;  2E8I A;  1GHM A;  4ARZ B;  2ZL1 B;  3P98 A;  4EV4 A;  3C38 A;  1CJF A;  4GDN A;  3KSI A;  3Q82 A;  4O8G A;  4HBT A;  1LL8 A;  4RYE A;  1T19 A;  1ZG4 A;  4QHC A;  2PBY A;  3N7W A;  3H9W A;  5AQB A;  3UB5 P;  2Y2M A;  3N8R A;  1Z09 A;  4BBV A;  4ARZ A;  5JYP A;  3O86 A;  1CI9 A;  1UGU A;  5CHJ A;  1ERM A;  3LIB A;  3BJN A;  3FWL A;  3T4T A;  3PBR A;  1K6S A;  4S2O A;  1WYB A;  5FL3 A;  1GCE A;  4S2I A;  5CHU A;  4K08 A;  3IX4 A;  4I3J A;  3NHQ A;  3MR0 A;  2WK0 A;  4ZAM A;  2LB9 A;  1BYW A;  4B93 A;  3L7H A;  2HF6 A;  2AVX A;  5EVI D;  3VP3 A;  3H82 B;  3D4F A;  4NKP A;  3NOP C;  4HOI A;  2IWD A;  2B18 A;  5CTN A;  1MY8 A;  4EW7 A;  4IJG A;  5IHV A;  1GSW A;  3MXQ A;  4KZ3 A;  1AXB A;  2WGW B;  5TR7 A;  2ZOH A;  4E3J A;  3V3S A;  1DP9 A;  2WYX A;  1XJ3 A;  2X01 A;  5AVF A;  3DWZ A;  2O99 A;  5DVA A;  4G3V A;  2X02 A;  4N9K A;  3H82 A;  5FI7 A;  1O7E A;  3C4O A;  4XT2 B;  1STZ A;  2L0W A;  3HVF A;  4YWZ A;  3LI8 A;  3M2K A;  4UHU A;  1W63 Q;  3E0Y A;  5FI2 A;  2B95 A;  5HPI A;  1TVF A;  3LIC A;  2EFX A;  5CRF A;  3UDI A;  1S4R A;  2XA7 M;  3KSF A;  1PNE A;  4WUJ A;  2HJ9 C;  5IT5 A;  4KZ9 A;  3NOT C;  4BBT A;  1BSG A;  5M19 A;  2ZLY A;  5U47 A;  3T4K A;  3CIT A;  3UE1 A;  5HWT A;  2H0Y A;  2YKH A;  3HLG A;  4OQG A;  4UA9 A;  1H0M A;  4BD1 A;  5EOO A;  4B4X A;  3HRE A;  3I7J A;  1E4D A;  4U0T A;  1LSX A;  1MWS A;  1S0W A;  3FYZ A;  1JTD A;  4O7D A;  1KDS A;  3P01 A;  1K25 A;  2EX8 A;  3MXS A;  4O0P A;  4MN6 A;  1VQQ A;  3MQO A;  4HEF A;  1DP8 A;  5EVI A;  2ZMV A;  5FDS A;  3ZGA B;  3T1X A;  2JBF A;  4X69 A;  4GS9 A;  3IS2 B;  4JKT A;  1DP6 A;  1N4O A;  3FKW A;  5DJU A;  5EPH A;  2XD1 A;  3KYZ A;  4GD8 A; 
#chains in the Genus database with same CATH homology
 1YKD A;  3U2A A;  3F1P A;  4DN0 A;  3T4L A;  2HJE A;  2K7S A;  5TBM B;  4LRZ E;  3F1O A;  3C30 A;  2K31 A;  4FOF A;  4AFI A;  3ZYT A;  3CI6 A;  1OTB A;  4L9E A;  2W3E A;  3PYP A;  4PKY A;  4UEY A;  1N9L A;  5J3W A;  3VOL A;  4HJ3 A;  2JKR I;  1G28 A;  3F1N B;  4HH3 A;  4Y3I A;  1TF1 A;  1GSV A;  4HP4 A;  2PT7 A;  2JN7 A;  1GSX A;  3MQQ A;  2VEA A;  4I5S A;  5TBM A;  3HJI A;  4DJ3 A;  2ZMF A;  4LRX C;  2OOL A;  3OCL A;  4WL9 A;  1P9R A;  4R70 A;  3PBT A;  2VZW A;  5F69 A;  4BJP A;  2J3T D;  2GX5 A;  2PYP A;  1P0Z A;  5J7E A;  1G6O A;  2G7U A;  4I38 A;  3BWL A;  3G6O A;  3K3D A;  3LIE A;  3PBN A;  2W0N A;  5EFW A;  3F1N A;  2LB5 A;  3FG8 A;  2D01 A;  5IU1 A;  1XJ6 A;  3PR6 A;  4M4X A;  2H28 A;  3DBA A;  2J80 A;  3C8C A;  1OJ5 A;  2PR6 A;  4Q0H A;  1D7E A;  5TJJ A;  4ETX A;  4IHQ A;  3OLO A;  3IBJ A;  4EEU A;  5HDD A;  2INW A;  3T4J A;  3MF0 A;  3C2W A;  5AJG A;  2Z6C A;  2KOI A;  2O9A A;  2M7V A;  2Y79 A;  1S67 L;  4HNB A;  2A24 B;  4E04 A;  5HDC A;  3UE6 A;  2WKR A;  4IUK A;  1LSV A;  4NXF A;  2W3H A;  4BBU A;  1YSQ A;  1JNU A;  4L9F A;  1OTD A;  5F5Y A;  4GS9 B;  3KSH A;  1XFN A;  2WKQ A;  4OOL A;  3ULF A;  2XSS A;  3T4S A;  4CLC A;  2V1A A;  1NLY A;  2VJW A;  4WN5 A;  4ZRR A;  1XFQ A;  2OAQ 1;  2VKS A;  3A0R A;  3EGX C;  3CUE C;  1W63 M;  3LR0 A;  4KUK A;  2QJ5 A;  4CLC E;  5DKL A;  2GNX A;  2QWS A;  2VX8 A;  3TW8 A;  3FC7 A;  4G3K A;  3MJQ A;  3BQ8 A;  3LIA A;  5DKK A;  3D3O A;  2W1T A;  3A0V A;  3LYX A;  3T4Q A;  2XA7 S;  3BY8 A;  1T1B A;  2W1R A;  5A8B A;  4Y5F A;  2O9C A;  2O0Y A;  3RTY A;  1TS0 A;  3E4P A;  3A0S A;  3IBR A;  4R38 A;  4EES A;  3LID A;  3S7P A;  2QHK A;  1OTE A;  1EW0 A;  2B02 A;  3FPW A;  3HJK A;  2IA2 A;  5DFX A;  2J3W A;  1UWN X;  3W2Z A;  3PBO A;  3MMH A;  5L8M A;  4II7 A;  4GLQ A;  4G3W A;  2GZA A;  1OTA A;  4F3L B;  2M7U A;  4PHT A;  1F5M A;  3B47 A;  5HSQ A;  5AVE A;  4YOF A;  4GCZ A;  1V9Y A;  4WEK A;  3UE3 A;  1H3Q A;  3LR3 A;  1IFQ A;  4HJ6 A;  3VE3 A;  1VB6 A;  3T50 A;  4DMZ A;  3UMD A;  3NJA A;  4MN5 A;  5G4Y A;  1UWP X;  1YAX A;  2DMW A;  1H8M A;  3EWK A;  3PXP A;  4H6J B;  2PD7 A;  4FSF A;  4LPZ A;  1ZHH B;  4JGP A;  4GHI B;  3UME A;  3PBS A;  4EUV A;  2VV6 A;  2VLG A;  4BWI A;  3R7W B;  3TJZ C;  5F68 A;  1TD5 A;  2R78 A;  4HH2 A;  3UB7 A;  3D72 A;  3B33 A;  4F3L A;  4LRY C;  4R6L A;  4WLA A;  2VV8 A;  1P97 A;  2W3D A;  1ODV A;  4Z1W A;  1S1Y A;  4KQD A;  4R3A A;  5K5B A;  2EWW A;  2VGL M;  5J4E A;  5HD3 A;  3E4O A;  1P9W A;  4L0L A;  2OWH A;  3KO6 A;  2ZBB A;  5HDS A;  2V1B A;  4ETZ A;  3V67 A;  5HPF A;  2NUP C;  4H6J A;  4NEE D;  3RFB A;  2XRN A;  4GHI A;  5C5K A;  3LR5 A;  1T1A A;  2GJ3 A;  3R7W A;  4CLC B;  3P7N A;  2QYB A;  4RQ9 A;  4P6Z M;  1Y28 A;  3RH8 B;  4OOM A;  4NXE A;  4BMW A;  1N9O A;  3TE8 A;  3T4O A;  5DJT A;  4L9G A;  3LUQ A;  3EEA A;  3LIF A;  3EGD C;  1XJ2 A;  2EWV A;  3OCN A;  3JVU A;  2FZ0 A;  2ZOI A;  3UB9 A;  2JKT M;  2P08 A;  4HI4 A;  1OTI A;  1T18 A;  1OPX A;  2QKP A;  2W1T B;  2JKR M;  3OBF A;  3NOU C;  5G4Z A;  5KIZ A;  4XT2 A;  4IUH A;  2P04 A;  2W27 A;  4JGR A;  3OOV A;  2NUT C;  3UB6 A;  4ARZ B;  3KSG A;  1TS6 A;  3C38 A;  3VE4 A;  2PDR A;  2VGL S;  4HP9 A;  4HQA A;  2XRO A;  4CQH A;  1NLZ A;  3ICY A;  4HIA A;  1T1C A;  3KSI A;  4O8G A;  5IS1 A;  1LL8 A;  2P7J A;  5I5L A;  2PHY A;  4DJ2 A;  1T19 A;  3E98 A;  3H9W A;  4HJ4 A;  5HD5 A;  4CLC C;  3KYQ A;  5CX7 A;  3LI9 A;  4Q0I A;  1S4S A;  5HWV A;  2MJ6 A;  4P6Z S;  2WKP A;  1OT9 A;  4WEJ A;  5HWW A;  3MFX A;  4BBV A;  4LLO B;  4ARZ A;  2O9B A;  2L4R A;  4MCW A;  1S66 L;  1TS8 A;  1UGU A;  4NXG A;  3LIB A;  1S1Z A;  3BJN A;  3T4T A;  4JGQ A;  3PBR A;  3FPV A;  4ME4 A;  2K2N A;  4KUO A;  5FL3 A;  2QJ7 A;  3S7N A;  4EEP A;  4K08 A;  4HY8 A;  3BW6 A;  4I3J A;  3NHQ A;  5DF9 A;  3MR0 A;  2A2L A;  3CLO A;  1N9N A;  2LB9 A;  2KDK A;  1BYW A;  3PHY A;  2D02 A;  4B93 A;  2M1C A;  2HF6 A;  1OT6 A;  3GEC A;  2V0U A;  3H82 B;  2W3F A;  3LR4 A;  4NKP A;  1ZTU A;  2VA0 A;  3NOP C;  4HOI A;  4MN7 A;  4EXO A;  1DRM A;  2B18 A;  3EEH A;  4Q0J A;  2FH5 A;  4EW7 A;  4IJG A;  4QPR A;  1GSW A;  4EQ1 A;  3MXQ A;  3S7Q A;  2JKT I;  4NXB A;  5HZH A;  3E4Q A;  4WEL A;  2PYR A;  2ZOH A;  2V9A A;  2J3T C;  3MQ0 A;  3IS2 A;  4O01 A;  1DP9 A;  2YKF A;  1WA9 A;  2JHE A;  1XJ4 A;  3VV4 A;  1XJ3 A;  4MDZ A;  3B42 A;  5AVF A;  3PBQ A;  4EER A;  2W3G A;  5DFY A;  4I3A A;  2Z6D A;  2O99 A;  4Y2F A;  4G3V A;  3R4K A;  3H82 A;  2Y8H A;  4YNR A;  2PD8 A;  1STZ A;  1X0O A;  2L0W A;  3KX0 X;  4KQO A;  4XT2 B;  5KSH A;  1D06 A;  1OJG A;  1YSP A;  4YWZ A;  3LI8 A;  3EOI A;  5F6A A;  1NWZ A;  3JVV A;  3H7W B;  3K2N A;  1W63 Q;  2HV1 A;  1V9Z A;  3E0Y A;  4WF0 A;  3CAX A;  1KOU A;  5HPI A;  3OC2 A;  4EET B;  1TS7 A;  2OAP 1;  3LIC A;  4UQI M;  5HL6 A;  4B9O A;  3GDI A;  2OWJ A;  1S4R A;  1F98 A;  2KLI A;  3HCY A;  2XA7 M;  2BAS A;  3KSF A;  1MZU A;  1MKM A;  2HJ9 C;  4WUJ A;  2VV7 A;  3S7O A;  4GJ4 A;  5IT5 A;  4JGO A;  4GW9 A;  3NOT C;  4BBT A;  3T4K A;  3BQA A;  3CIT A;  2V0W A;  3H7W A;  5HWT A;  3CUE A;  2YKH A;  2EA9 A;  1IOU A;  3O5Y A;  4MMN A;  3K3C A;  2I9V A;  3LFV A;  2L1M A;  4HHD A;  3ZQ5 A;  1LSW A;  1LSX A;  5MC7 A;  4EU0 A;  3TRC A;  1LT0 A;  3P01 A;  1MC0 A;  2PR5 A;  4O0P A;  3F1P B;  4MN6 A;  4PAU A;  3MQO A;  3F1O B;  1DP8 A;  4I3I A;  2ZMV A;  4I39 A;  1NRJ A;  4UQI S;  2A24 A;  3CWF A;  1F9I A;  2HGV A;  4CLC D;  2KX6 A;  2CMN A;  4GS9 A;  1VHM A;  3BY9 A;  3EQV A;  3IS2 B;  3SW1 A;  1DP6 A;  5DJU A;  4PKY G;  3KYZ A;  3UB8 A;  5LBR A;  3EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...