2A2LA

Crystal structure of klebsiella pneumoniae protein orfy, pfam duf336
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
b'SLMNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown
publication title Crystal Structure of Klebsiella Pneumoniae Hypothetical Protein Orfy
rcsb
source organism Klebsiella pneumoniae
molecule tags Structural genomics, unknown function
total genus 41
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2a2lA00
4CLCA 4CLCE 3FPWA 2A2LA 5CX7A 4CLCB 3FPVA 4BMWA 4NKPA 4CLCD 4CLCC
chains in the Genus database with same CATH superfamily
3KSFA 4S2JA 3FC7A 4KQRA 3BEBA 4Y0UA 3QNBA 1KGFA 1H3QA 1DP6A 1FILA 3KSIA 3IHBA 5FQKA 3CI6A 1DP8A 2ZBBA 2XQZA 1YLWA 5CERA 3KSGA 4R3BA 3LFVA 4HBTA 4OONA 2Z2MB 2WKEA 5TGFA 4PM7A 2OSUA 1M40A 3P01A 1K54C 1Y28A 1CEFA 1SDNA 3SS5A 4EESA 5M18A 3NULA 3CUEA 4OQIA 1PZOA 2V20A 2X71A 4N1XA 2ZLYA 3OPPA 2ZC5B 5EVLA 2HDRA 4WMCA 3MJQA 4JXVA 3LI9A 1I2WA 2G2WA 4HBUA 4R6LA 3E0YA 3ITAA 1F2KA 1WYCA 1OTDA 4EWFA 2V8CA 3IQAA 1ZHHB 3I7JA 2ZMAA 3OPHA 3WS5A 2FFFB 5KSHA 4GDBA 3MF0A 3VFHA 3G34A 4MN6A 3TRCA 4UA6A 1ES2A 3O87A 3L9KA 4XT2A 1ERQA 3MXSA 3TJZC 1NRFA 3SS4A 3B42A 1Q2QA 4X1MA 1ONGA 4IUHA 4X53A 2VGJA 3S1YA 3PBRA 3H82B 1XPBA 5HPFA 1YKDA 4LCLA 1Y54A 1ES5A 5CECA 4WL9A 2JKGA 2J9OA 3Q81A 4JF5A 1N4OA 5HWVA 4Q0JA 3QP5A 1KE3A 1WYBA 3NC8A 4GLQA 4MCWA 4O8GA 1TVFA 1DRMA 5A90A 2JKRM 1NWZA 1MKMA 4E3MA 3H7WA 1SHVA 4GS9B 4BQMA 2Q0OA 4KUOA 5FEFA 1TDGA 1D06A 1EWZA 1JVJA 2G7UA 3ZCZA 3ZGAB 2PD8A 3G2ZA 1FQGA 5HPIA 3NI9A 3S7QA 2P74A 5J7EA 1HZOA 4EBLA 4P6ZM 3B3XA 4KZ8A 5D3OA 3NIAA 5AVFA 3S7OA 3VOYA 4OP8A 3GMWA 3WRTA 2ZM2A 5F1GA 3HLFA 4Y2FA 3RJUA 3LI8A 2WADA 1LSXA 4X1LA 4JGPA 4EXOA 3HUNA 4X68A 4I3AA 4Y0OA 4E3NA 1DP9A 2GDNA 1XA1A 4JBFA 4E3OA 1N9BA 2YKHA 4E3KA 2GZAA 3BW6A 3EOIA 5AQAA 1SDEA 2XFTA 2FFYA 3N8RA 1JTDA 2ZL1A 3HJIA 3T1SA 4S2PA 1MWUA 1VEUB 3D4FA 3NECA 3UDXA 1YSQA 2Q9NA 3IXBA 4O01A 4PM9A 5HX9A 4EQIA 2IWCA 2XDMA 2Z6CA 5E2GA 4B4XA 4EQ1A 4MMNA 3E98A 4DE1A 3R7WB 4ID4A 1LHYA 3U4LP 4OOYA 3WWXA 5DTKA 2OAQ1 4EEUA 3LO7A 5AQBA 1Q2PA 3BFEA 4X25A 2WKQA 1FCOA 3AGDA 3HLCA 1K57C 2ZQ7A 1OJGA 5E2HA 3UE0A 4FUWA 1JWPA 4CPKA 2ZQ9A 2O9AA 3HVFA 1XP4A 5IHVA 5CGXA 5FEGA 2ZQAA 2Z2LB 1K25A 2JCHA 1Z09A 3K3CA 4Y15A 1ZKJA 3A3JA 5AVEA 4JGOA 4HJ3A 1E3UA 1XFQA 1LL5A 3CJMA 2V1ZA 1VHMA 4ARZA 3EEHA 4KG5A 5J8XA 4EUZA 1XFNA 3DTEA 3IF6B 5CX7A 3G35A 3E2KA 4R3JA 4CLCC 2XH9A 1NLZA 1TD5A 4PKYG 1T1CA 3UB6A 1YM1A 3LIEA 2XA7M 4KQQA 1YMSA 3MS6A 4S2IA 4OQHA 2HDSA 3T4TA 2WGWB 4DJ2A 2OWJA 4OPYA 1XXMA 1L0FA 1IYPA 3MFXA 4D2OA 3ICYA 5FI7A 1HTZA 2DMWA 1ZG6A 4RA7A 4WM9A 3V67A 1SCWA 3PBQA 4ETXA 2Z6DA 5GLBA 4LRYC 1MBLA 4EBPA 4E3JA 2XLNA 3TSGA 2LB9A 5F1FA 1PNEA 5F69A 1K6SA 1YLJA 4ZJ1A 4FH4A 2M7VA 2W27A 2EX6A 3MMHA 3Q7ZA 1LLBA 3PBNA 3M6BA 2A24B 4E6XA 1SKOB 4DDSA 2VJWA 3W8KA 5DFXA 3IX3A 4KZ9A 1H5XA 3FWLA 3Q1FA 1K4FA 3NHQA 1KOUA 4II7A 2PR5A 2H28A 4JXSA 3BRMA 3O3VA 3G31A 2UV0E 1VM1A 4KG6A 4ZTKA 3HCYA 5HAQA 4MNRA 2PR6A 1MKIA 4KQDA 5HL6A 1TS7A 2A24A 1D7EA 5CGWA 4QPRA 2GNXA 1WE4A 5EVID 1S1YA 5IS1A 5F6AA 1CEGA 3Q07A 1J9MA 2P9VA 3ZHHA 5M19A 5CHUA 1LT0A 4ZJ3A 4GNUA 5DTSA 2PU4A 3C8CA 1A0KA 4I5SA 4IBRA 1E4DA 3HREA 2J9PA 3VE3A 5EM0A 3LEZA 2VLGA 4UAAA 5IU1A 1TEMA 1TS0A 2RL3A 3LIAA 3V50A 1F98A 3DWZA 2ZM0A 1VB6A 4BBVA 5F68A 3MFDA 4HH3A 4B4ZA 2EWWA 3OCNA 3FPVA 3HLGA 4NEED 3C38A 4QHCA 3SZTA 4BD0A 5HL1A 3D72A 2ZMFA 4PHTA 1E25A 3A3EA 3FKVA 2X01A 4EBNA 3AGEA 2EXBA 3T4JA 4WMCD 1ZTUA 4HY8A 1MWSA 3B33A 3IBRA 1T19A 3VMAA 4GW9A 3IT9A 1K56A 2PT7A 5A8BA 1YAXA 3NOUC 4O0PA 2Y2OA 3BY9A 1T18A 3QP6A 3VOZA 3V39A 4R70A 2OOLA 4H6JB 1PW1A 1FCNA 3UY6A 4P0MA 2W1RA 2QJ5A 1BT5A 4HIAA 5A91A 5HARA 2EX2A 3SS3A 1YMXA 2VV6A 2VV8A 3P7NA 1CI9A 4HI4A 4BBTA 1F9IA 2ZQ8A 3W4PA 1YSPA 3TOIA 3MZDA 3CMZA 4JGQA 3LYXA 4LENA 3QP8A 1ZC2A 1CF0A 1S66L 3OZHA 1K57A 3SH7A 5DKKA 1V9ZA 4KZBA 4CLCB 4DF6A 1XJ6A 1PRQA 4BWIA 1GSVA 5CTNA 1ES3A 2GX5A 4XUXA 2HP9A 2OWHA 4M3KA 3VV4A 5GHXA 3EWKA 3ZG9B 1YQSA 5HDSA 3VSLA 4S2OA 2XA7S 4PAUA 2IWBA 4QD4A 1GSWA 5BOHA 2V1BA 3UN7A 3G4PA 4YNRA 1YPRA 5HD3A 3E4QA 1F5MA 2I72A 3ZNYA 2W3GA 4HP4A 5FAPA 3LR0A 2JBFA 3LICA 1MPLA 3PBTA 5HFOA 3IX4A 5FAQA 1XGIA 4CLCA 2XK1A 3M2JA 4BJPA 5C5KA 1IKIA 1W63Q 5EPHA 3SOIA 5GLCA 3UDFA 1RGYA 3LR4A 4EW7A 5HDCA 3T1XA 5L07A 4PMAA 1IOUA 4OPRA 3IXDA 4P87A 3MZEA 4F3LA 3PBOA 2R9WA 5DFYA 5HWWA 1PIOA 1W79A 2XEPA 5TR7A 3N4IA 3NJAA 4XT2B 2BLSA 4NXBA 2EWVA 4MBFA 3LR3A 3OPRA 1AWIA 4UQIS 4DXBA 3RXXA 2KX6A 2O9CA 4ME4A 1KGEA 4WLAA 1KVLA 2ZMVA 4Y17A 5TJJA 4PM6A 5CEBA 2QPNA 3G6OA 3OCLA 1U60A 3VP0A 5KMWA 4DE2A 4JF4A 1MWRA 4IVIA 2NUPC 3C5AA 5FQJA 1G68A 2KDKA 2BG1A 5J4EA 3H7WB 4LFUA 4MLLA 3ZVWA 4OP5A 3QP2A 3IH9A 1HD8A 3SH9A 5AQ7A 2K7SA 4GB7A 4OQGA 1D1JA 3RTYA 1K0KA 2INWA 5HZHA 3G32A 4WUJA 2QHKA 2QKPA 1FSYA 2L4RA 3LIBA 1E3UD 4BMWA 2D01A 3VP1A 1H8MA 4WBGA 1N9LA 1VQQA 2JKFA 4WEJA 1J3WA 5FI2A 2E8IA 4G3VA 3ZVTA 2VGLS 5FL3A 5CRFA 3DAVA 3A0RA 2MJ6A 3FKWA 4X69A 3MQ0A 2HF6A 3ISGA 2JN7A 2OAP1 4L9EA 3BLSA 3CLOA 1XGJA 3NDEA 2ZL1B 4UHUA 2VEAA 1PWCA 4OLDA 1FR6A 3QP4A 3N7WA 2WKHA 2Y2MA 4KZ4A 2XSSA 1LL8A 4HEFA 2A2LA 5E2FA 5U47A 1BYWA 1XJ4A 3UE1A 4DRTA 3OOVA 4L9GA 4QJGA 3D3OA 3LEQA 3T50A 3UE6A 1EI5A 1SKFA 2M7UA 1MC0A 2XFSA 5A93A 1SZVA 1RCJA 1NZOA 2Y2QA 5DKLA 4CQHA 3A3IA 1XJ3A 3IWIA 4WZ4A 2BTFP 4LV2A 4ZBEA 4BENA 3G2YA 3F1PA 4K08A 2WKPA 3HUMA 3MZFA 3CZDA 3KX0X 3S22A 3LY3A 4FD8A 1T1AA 5EE8A 4D60A 3UNWA 3MQQA 2ZC6B 2CMNA 1Y4OA 4ARZB 2O9BA 2O0YA 1KE0A 5M1AA 4NG2A 5K5BA 1S6RA 2WK0A 2Y79A 5FATA 4NETA 1ALQA 3BFDA 4DDYA 1BLCA 3KYQA 3SW1A 3PYPA 1S0WA 2W3HA 5EOOA 1X0OA 3GR2A 3MKFA 3BM6A 3V3RA 1S4RA 2PYPA 5G4ZA 3MSHA 3T4OA 2W3FA 1XA7A 1S1ZA 4N9KA 2J3TC 4IEDA 5MC7A 3HLBA 3WS4A 3ZDJA 2PHYA 1GSXA 4BBUA 3LY4A 3EQUA 3IS2B 3IXHA 1I2SA 4ZAMA 4Y3IA 4OOMA 5F83A 5GHYA 4WZ5A 3EEAA 2Y2GA 3TE8A 4X6TA 4X56A 5EVEA 1OJ5A 3VSKA 2VZWA 4LPZA 1LL9A 1GCEA 5J3WA 1GHPA 5E43A 3H9WA 3K3DA 3GRJA 3BFFA 2ZD8A 5GLDA 4GHIB 4GN2A 4BD1A 1MXOA 2VV7A 3DTKA 3T4LA 3IS2A 4R1GA 4L0LA 1K56D 2EXAA 3BFCA 1BLHA 3A3FA 3VOLA 2P7JA 1BUEA 3DBAA 1JTGA 2B18A 4GCZA 4MBHA 4WELA 2J8YA 5L10A 3DTMA 3MQOA 4OLGA 5FQIA 1CQAA 3EQVA 2PU2A 4QU3A 2X02A 4I38A 1KGGA 1KDSA 2OLVA 1YLYA 2VGKA 3JVVA 3U2AA 2O99A 1C3BA 2R78A 4RX2A 3BECA 4GHIA 2P9VB 4UQIM 4RX3A 3C30A 5JYOA 3OPLA 2W1TA 2XD5A 1WA9A 5DVAA 4GDNA 2PYRA 3OLOA 2ACGA 1LI9A 1RGZA 3RFBA 3A0SA 3PTEA 2VX8A 4HP9A 4XUZA 2V9AA 3GV9A 1OTBA 1YLZA 3LCEA 2QMIA 2XD1A 5HSQA 1ONHA 1OMEA 1BULA 4BL2A 3BLMA 5HAPA 4UA7A 5FA7A 4CJNA 3UMEA 2V0WA 5FAOA 4Y7PA 2J3TD 2PAVP 3BYDA 1FSWA 4R4SA 4ZRRA 1JNUA 3JPUA 1S67L 3L7HA 3W2ZA 4PM5A 1H0MA 4GJ4A 3CWFA 2XRNA 2E8JA 4CLCD 2JKTM 2V1AA 3FG8A 1V9YA 4KZAA 5CXWA 5JYPA 3HLEA 1ERMA 1H8YA 3BQ8A 1K38A 2V8FA 3VFFA 1K55C 1W8QA 3FYZA 2ZQDA 3DTIA 4N9LA 2WYXA 5EM1A 4M4XA 3C4PA 2VGLM 1BTLA 4IVKA 3UB7A 2A3UA 1STZA 2JE5A 4I3IA 1PI5A 3TW8A 1XJ2A 4GKUA 4JF6A 5HD5A 1CJFA 5CEDA 3PXPA 1W8YA 2JC7A 3KSHA 5LBRA 2Y2NA 1L0GA 4B9OA 2Y55A 1RP5A 2ZM8A 1H8ZA 2IWDA 2G2UA 4QY6A 2HV1A 2QZ6A 4ESPA 3KYEA 2M1CA 4I3JA 1N9NA 1UGUA 2W3DA 4HQAA 1NYYA 3IBJA 2EX9A 1W5DA 1PWGA 1MZUA 2ZQCA 3UB8A 4PKYA 5G18A 3ZYTA 5F82A 3CPTA 3ULFA 5HDDA 4HJ6A 1O07A 1FOFA 2R9XA 2Q9MA 4GD8A 5AQ9A 3ZG0A 4EU0A 4OOLA 4FCFA 5KSCA 1NY0A 1W7FA 3MBZA 5DF9A 1ES4A 1KE4A 4LCMA 4LLOB 1UWNX 2V0UA 3WRZA 1IKGA 3BWLA 4G3WA 4Q0IA 3BJNA 4B93A 3UPOA 2Y91A 3C7VA 4FOFA 2W3EA 2H0YA 4F3LB 3C7UA 3HL9A 1YLPA 3OBFA 2J3WA 3EGXC 1KDWA 1IELA 4HOIA 4E3IA 4IHQA 4KZ3A 5HW3A 3R4KA 3MXQA 1DJAA 1T1BA 4O7DA 4Y5FA 5FQQA 4S2KA 5I5LA 2UWXA 4WZ5C 3IF5A 3NY4A 1ACFA 1GA9A 1G28A 4Y0TA 4NXGA 1MWTA 1PWDA 3F1NA 4U0XA 2HJEA 4QY5A 3CG5A 4UEYA 4GZBA 3LIDA 3P09A 4JPMA 3A3DA 1PI4A 5GL9A 4QWOA 3VE4A 1OPXA 5FASA 1L2SA 1NXYA 2WKIA 4LV0A 3CHWP 3HJKA 2EFUA 3C2WA 4MDZA 1VETB 3HLWA 4R23A 2KOIA 1NJ4A 1IYOA 3BQAA 3IF6C 4N92A 3DWKA 4Q0HA 3T4QA 2PBYA 1L0EA 4HESA 3VP3A 3D9YA 5FI6A 3P98A 4H8RA 5CGSA 2HP5A 4IBXA 1HVBA 1BLSA 3N8LA 1G6OA 1P9WA 1FCMA 1TS8A 3HUOA 4R3AA 4KZ6A 4ETZA 3ZG5A 1VETA 3PAEA 2EX8A 2OLUA 5I94A 4U0TA 5EOEA 3MR0A 2WAFA 2W0NA 3E4PA 2L1MA 1YT4A 4OPQA 1EW0A 4LV3A 2Y2PA 4P85A 4S2NC 3WS1A 1XX2A 4UA9A 3NOTC 3IHAA 1BLPA 1OT6A 1DJBA 2K2NA 2WGVA 4NK3A 1CK3A 2ZC7A 4YINA 3MXRA 2HDQA 3W4QA 3FZCA 2OV5A 1M6KA 4LV1A 2DCFA 4DJ3A 1P9RA 5L8MA 4BLMA 5DF8A 1O7EA 1K55A 2LB5A 2Y8HA 3H82A 3ZNTA 1QMEA 2HP6A 4WF0A 1PFLA 4KZ5A 1PZPA 1DY6A 4K0WA 3ZG7B 1P0ZA 2ZC3B 4OKPA 2XF3A 3KO6A 1L0DA 1OTIA 3HBRA 3EGDC 1MY8A 1LSWA 4DE3A 4AFIA 3E2LA 4R4RA 1ZG4A 3E4OA 5FQMA 1JWVA 4E3LA 1OT9A 3F1PB 3WS0A 2B02A 5F5YA 3VP4A 3QP1A 3O5YA 2FH5A 2Y2JA 3Q82A 1HLUP 4MEZA 1TS6A 2ZJ9A 2JKTI 4GS9A 4U3TA 4B88A 3PHYA 2DNSA 4Z9QA 4L9FA 2KLIA 1NRJA 4G3KA 4E04A 4JGRA 2C6WB 3LGOA 4Z1WA 2K31A 2HDUA 2B95A 1I5QA 2CC1A 1N9OA 4FSFA 3V5MA 4S2LA 4KZ7A 3W4OA 4E6WA 1IFQA 4YWZA 4OVDA 4N1HA 1UWPX 1DJCA 2WZXA 3NOPC 3UB9A 5EFWA 2L0WA 3SH8A 1K6RA 4C6YA 3C4OA 2P04A 1ESUA 4X55A 4HHDA 1VEUA 2J7VA 1OTEA 3TG9A 1BSGA 5FSRA 5HAIA 1IYSA 2WKRA 4EV4A 4MN7A 4OPZA 1NZUA 3R7WA 3UPPA 2PBDP 2VKSA 1CI8A 5EVIC 1KVMA 2QJ7A 1L3LA 3M6HA 5L09A 4P6BA 2EFXA 4PM8A 1PW8A 2RCXA 4GD6A 3ZFZA 5DF7A 4C75A 3GVBA 1GHIA 3FPWA 3O86A 4EEPA 3V3SA 4KQOA 4DMZA 2Y59A 4YFMA 2WUQA 3NDGA 2PDRA 2P08A 3HLDA 3A0VA 4R38A 5DTTA 2Y2HA 4KG2A 1K4EA 2Y2IA 5DJUA 4NXEA 2W1TB 1K54A 4LGWA 1NLYA 4HNBA 4MN5A 3CUEC 1S4SA 1FR1A 5E2EA 4QB8A 5FDSA 3PR6A 3IF6A 3S7NA 3RXWA 2WGIA 4WYYA 4IUKA 4WEKA 1P97A 2Y2KA 2XROA 3F1OB 5A92A 2WGWA 3OC2A 5EECA 2DRWA 1FIKA 5HWTA 2ZC4B 1ODVA 4Y13A 3UO9A 2HGVA 1GHMA 4S2MA 2XGNA 1NYMA 2D02A 2VK3A 2QWSA 2ZOHA 4JXGA 3QNCA 3RH8B 2HZ5A 4JLFA 4DE0A 2A49A 3S7PA 3B47A 2YKFA 4RVAA 4GOGA 5DJTA 4ZJ2A 4K91A 4S2NA 3F1OA 3Q7VB 1XKZA 3VP2A 3QHYA 1Z6FA 4A5RA 1SKOA 4KENB 3AGFA 4FH2A 4MBKA 2Y4AA 5CHJA 3N8SA 4R0QA 2C5WB 3UE3A 4OH0A 4YOFA 2AVXA 3NCKA 3DW0A 4P6ZS 3ZG8B 3IXGA 3JYIA 1BZAA 2XR0A 3JVUA 3ITBA 3Q7VA 4PPRA 3IWQA 4EUVA 5G4YA 2EA9A 5L2FA 2PD7A 4LRXC 1EROA 3T12B 4BL3A 3NBLA 4Q8IA 1G6AA 5AJGA 4JKTA 2NUTC 5EUAA 2FZ0A 1AXBA 2H0TA 5FDHA 4JXWA 3T4SA 3T1QB 2VA0A 5FQ9A 3BY8A 4EETB 3CPTB 3UMDA 2HPBA 4KUKA 4DKIA 2Y2LA 2BASA 2PRFA 3ZQ5A 3UB5P 3UDIA 3MKEA 1IYQA 2JKRI 2J80A 3LIFA 3GQZA 5GHZA 5EV0A 3T1RA 3LUQA 5KIZA 1PYYA 4NKPA 1W63M 3KYZA 2B5RA 3CITA 4C3QA 4OQ0A 5TFQA 1LI0A 2ZOIA 4K0XA 4LRZE 3O88A 4XXRA 3PAGA 1LSVA 2JHEA 3CAXA 2HJ9C 1IEMA 1QMFA 3WS2A 3GDIA 3GSGA 1TDLA 3GECA 4ZDXA 4DXCA 5CHMA 4DN0A 2WAEA 3M2KA 5TBMB 1TF1A 3GTCA 3S4XA 3K2NA 2H5SA 1ESIA 1OTAA 3IH8A 3FV7A 5EVIB 4HH2A 4I39A 3LR5A 4FTXA 2IA2A 2WZZA 4EERA 3N6IA 5KZHA 5IT5A 4RYEA 3G30A 4NXFA 3T4KA 2GJ3A 4IJGA 4F94A 4H6JA 2I9VA 2V2FF 3BFGA 5TBMA 3F1NB 3UPNA 3IWOA 3PBSA 5CTMA 1GA0A 4CLCE 1G5UA 2QYBA 3IX8A 4HJ4A 4WN5A 5EVIA 4RQ9A 1YLTA 2H10A 5GLAA 1JWZA
chains in the Genus database with same CATH topology
3KSFA 3FC7A 2PHYA 1GSXA 4BBUA 3VE3A 4DJ3A 3EQUA 1P9RA 3IS2B 5L8MA 2VLGA 5IU1A 1TS0A 3LIAA 1H3QA 2LB5A 1F98A 4Y3IA 4OOMA 1VB6A 2Y8HA 1DP6A 3H82A 3KSIA 4BBVA 5F68A 4HH3A 4WF0A 3EEAA 3TE8A 3CI6A 1DP8A 2EWWA 2ZBBA 1OJ5A 1P0ZA 2VZWA 4LPZA 3OCNA 3FPVA 3KSGA 5J3WA 3KO6A 4NEED 1OTIA 3C38A 3EGDC 1LSWA 3LFVA 4AFIA 3H9WA 3K3DA 3D72A 2ZMFA 3E4OA 4PHTA 1OT9A 3P01A 3F1PB 2B02A 1Y28A 5F5YA 4GHIB 2VV7A 3O5YA 3T4JA 3T4LA 4EESA 2FH5A 3IS2A 4L0LA 3CUEA 3VOLA 2P7JA 3DBAA 1ZTUA 1TS6A 4HY8A 2JKTI 2B18A 4GS9A 3B33A 3IBRA 3PHYA 1T19A 4GCZA 4WELA 4GW9A 3MJQA 4L9FA 2KLIA 2PT7A 3LI9A 1NRJA 3MQOA 4G3KA 3EQVA 5A8BA 1YAXA 4E04A 3NOUC 4R6LA 4O0PA 4I38A 4JGRA 3E0YA 4Z1WA 2K31A 3BY9A 1OTDA 1T18A 3JVVA 3U2AA 2O99A 4R70A 1N9OA 2OOLA 1ZHHB 2R78A 4FSFA 4H6JB 4GHIA 5KSHA 3MF0A 4UQIM 2W1RA 1IFQA 2QJ5A 4YWZA 4MN6A 3C30A 3TRCA 4HIAA 2W1TA 1WA9A 2PYRA 2VV6A 2VV8A 3P7NA 3OLOA 1UWPX 4HI4A 3NOPC 3UB9A 4XT2A 4BBTA 3RFBA 1F9IA 3A0SA 3TJZC 2VX8A 4HP9A 5EFWA 1YSPA 2L0WA 3B42A 2V9AA 4IUHA 1OTBA 3LYXA 4JGQA 1S66L 2P04A 3PBRA 3H82B 5HPFA 5DKKA 1YKDA 5HSQA 1V9ZA 4WL9A 4HHDA 1OTEA 4CLCB 1XJ6A 3UMEA 2V0WA 4BWIA 5HWVA 1GSVA 4Q0JA 2WKRA 2J3TD 2GX5A 4MN7A 4GLQA 4ZRRA 1JNUA 2OWHA 4MCWA 3R7WA 3VV4A 1S67L 4O8GA 3EWKA 1DRMA 5HDSA 2VKSA 3W2ZA 2JKRM 2XA7S 4PAUA 4GJ4A 3CWFA 2XRNA 1NWZA 1MKMA 4CLCD 3H7WA 2JKTM 2V1AA 1GSWA 2QJ7A 2V1BA 3FG8A 4YNRA 1V9YA 5HD3A 3E4QA 4GS9B 1F5MA 4KUOA 2W3GA 4HP4A 1D06A 3LR0A 2G7UA 3BQ8A 2PD8A 3LICA 3PBTA 3S7QA 5HPIA 5J7EA 4CLCA 4EEPA 3FPWA 4BJPA 5C5KA 1W63Q 4KQOA 4DMZA 4P6ZM 4M4XA 2VGLM 3LR4A 4EW7A 5HDCA 2PDRA 2P08A 3A0VA 5AVFA 3S7OA 1IOUA 3UB7A 4R38A 1STZA 4Y2FA 4I3IA 4F3LA 3PBOA 3LI8A 5DJUA 5DFYA 5HWWA 3TW8A 1LSXA 4NXEA 1XJ2A 2W1TB 4JGPA 4EXOA 4I3AA 1DP9A 5HD5A 1NLYA 4HNBA 4MN5A 3NJAA 3CUEC 3PXPA 4XT2B 1S4SA 2YKHA 3KSHA 2GZAA 4NXBA 5LBRA 2EWVA 3LR3A 4B9OA 3PR6A 3BW6A 3EOIA 4UQIS 2KX6A 3S7NA 2O9CA 4ME4A 4WLAA 4IUKA 4WEKA 2HV1A 3HJIA 1P97A 2ZMVA 2XROA 2M1CA 3F1OB 5TJJA 4I3JA 1N9NA 3OC2A 1YSQA 1UGUA 4O01A 2W3DA 4HQAA 2Z6CA 3G6OA 3OCLA 5HWTA 4EQ1A 4MMNA 3E98A 3IBJA 1MZUA 3R7WB 1ODVA 2NUPC 3UB8A 4PKYA 2HGVA 2KDKA 3ZYTA 3ULFA 5HDDA 2OAQ1 4HJ6A 4EEUA 5J4EA 2D02A 3H7WB 2QWSA 2ZOHA 3RH8B 3S7PA 3B47A 2YKFA 2WKQA 5DJTA 2K7SA 4EU0A 4OOLA 3F1OA 3RTYA 1OJGA 2INWA 5DF9A 5HZHA 4WUJA 4LLOB 1UWNX 2QHKA 2O9AA 2V0UA 2QKPA 3BWLA 4G3WA 2L4RA 4Q0IA 3LIBA 3BJNA 4B93A 3K3CA 4BMWA 4FOFA 2W3EA 4F3LB 3UE3A 3OBFA 2D01A 2J3WA 1H8MA 5AVEA 3EGXC 4YOFA 1N9LA 4JGOA 4WEJA 4HOIA 4P6ZS 4IHQA 4HJ3A 1XFQA 4G3VA 2VGLS 3R4KA 3MXQA 5FL3A 1VHMA 4ARZA 1T1BA 3EEHA 3JVUA 1XFNA 4EUVA 4Y5FA 5G4YA 2EA9A 3A0RA 5I5LA 2MJ6A 5CX7A 2PD7A 3MQ0A 2HF6A 4LRXC 2JN7A 2OAP1 4L9EA 4CLCC 1NLZA 1TD5A 3CLOA 4PKYG 1T1CA 1G28A 3UB6A 3LIEA 5AJGA 2XA7M 4NXGA 2NUTC 2VEAA 3T4TA 4DJ2A 2OWJA 2FZ0A 3F1NA 3MFXA 2HJEA 3ICYA 4UEYA 3LIDA 2DMWA 3T4SA 3V67A 2VA0A 3BY8A 4EETB 3UMDA 3PBQA 4ETXA 2Z6DA 3VE4A 1OPXA 4KUKA 2BASA 3ZQ5A 4LRYC 2JKRI 2XSSA 1LL8A 2A2LA 2J80A 1BYWA 3HJKA 3LIFA 3C2WA 1XJ4A 4MDZA 3OOVA 4L9GA 2LB9A 3D3OA 2KOIA 3LUQA 5KIZA 3T50A 5F69A 3UE6A 4NKPA 1W63M 3BQAA 3KYZA 2W27A 2M7VA 3MMHA 2M7UA 3CITA 1MC0A 4Q0HA 3PBNA 3T4QA 2ZOIA 2A24B 4LRZE 1LSVA 2JHEA 3CAXA 2HJ9C 5DKLA 4CQHA 1XJ3A 2VJWA 3GDIA 5DFXA 3GECA 4DN0A 3F1PA 1G6OA 4K08A 2WKPA 5TBMB 1P9WA 1TF1A 1TS8A 1KOUA 3NHQA 4II7A 3KX0X 2PR5A 3K2NA 2H28A 1T1AA 1OTAA 4R3AA 4ETZA 3MQQA 2CMNA 4HH2A 4I39A 4ARZB 3MR0A 2W0NA 3LR5A 2O9BA 2O0YA 3E4PA 3HCYA 2IA2A 2PR6A 2L1MA 4KQDA 5HL6A 1TS7A 5K5BA 2A24A 4EERA 1D7EA 1EW0A 4QPRA 2Y79A 2GNXA 3KYQA 3SW1A 3PYPA 5IT5A 2W3HA 1X0OA 4NXFA 3T4KA 1S1YA 5IS1A 3NOTC 5F6AA 2GJ3A 4IJGA 4H6JA 2I9VA 1S4RA 2PYPA 5TBMA 5G4ZA 1OT6A 3T4OA 2K2NA 2W3FA 3F1NB 3PBSA 1LT0A 1S1ZA 4CLCE 2QYBA 4HJ4A 4WN5A 4RQ9A 2J3TC 3C8CA 4I5SA 5MC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC A;  4CLC E;  3FPW A;  2A2L A;  5CX7 A;  4CLC B;  3FPV A;  4BMW A;  4NKP A;  4CLC D;  4CLC C; 
#chains in the Genus database with same CATH topology
 3KSF A;  4S2J A;  3FC7 A;  4KQR A;  3BEB A;  4Y0U A;  3QNB A;  1KGF A;  1H3Q A;  1DP6 A;  1FIL A;  3KSI A;  3IHB A;  5FQK A;  3CI6 A;  1DP8 A;  2ZBB A;  2XQZ A;  1YLW A;  5CER A;  3KSG A;  4R3B A;  3LFV A;  4HBT A;  4OON A;  2Z2M B;  2WKE A;  5TGF A;  4PM7 A;  2OSU A;  1M40 A;  3P01 A;  1K54 C;  1Y28 A;  1CEF A;  1SDN A;  3SS5 A;  4EES A;  5M18 A;  3NUL A;  3CUE A;  4OQI A;  1PZO A;  2V20 A;  2X71 A;  4N1X A;  2ZLY A;  3OPP A;  2ZC5 B;  5EVL A;  2HDR A;  4WMC A;  3MJQ A;  4JXV A;  3LI9 A;  1I2W A;  2G2W A;  4HBU A;  4R6L A;  3E0Y A;  3ITA A;  1F2K A;  1WYC A;  1OTD A;  4EWF A;  2V8C A;  3IQA A;  1ZHH B;  3I7J A;  2ZMA A;  3OPH A;  3WS5 A;  2FFF B;  5KSH A;  4GDB A;  3MF0 A;  3VFH A;  3G34 A;  4MN6 A;  3TRC A;  4UA6 A;  1ES2 A;  3O87 A;  3L9K A;  4XT2 A;  1ERQ A;  3MXS A;  3TJZ C;  1NRF A;  3SS4 A;  3B42 A;  1Q2Q A;  4X1M A;  1ONG A;  4IUH A;  4X53 A;  2VGJ A;  3S1Y A;  3PBR A;  3H82 B;  1XPB A;  5HPF A;  1YKD A;  4LCL A;  1Y54 A;  1ES5 A;  5CEC A;  4WL9 A;  2JKG A;  2J9O A;  3Q81 A;  4JF5 A;  1N4O A;  5HWV A;  4Q0J A;  3QP5 A;  1KE3 A;  1WYB A;  3NC8 A;  4GLQ A;  4MCW A;  4O8G A;  1TVF A;  1DRM A;  5A90 A;  2JKR M;  1NWZ A;  1MKM A;  4E3M A;  3H7W A;  1SHV A;  4GS9 B;  4BQM A;  2Q0O A;  4KUO A;  5FEF A;  1TDG A;  1D06 A;  1EWZ A;  1JVJ A;  2G7U A;  3ZCZ A;  3ZGA B;  2PD8 A;  3G2Z A;  1FQG A;  5HPI A;  3NI9 A;  3S7Q A;  2P74 A;  5J7E A;  1HZO A;  4EBL A;  4P6Z M;  3B3X A;  4KZ8 A;  5D3O A;  3NIA A;  5AVF A;  3S7O A;  3VOY A;  4OP8 A;  3GMW A;  3WRT A;  2ZM2 A;  5F1G A;  3HLF A;  4Y2F A;  3RJU A;  3LI8 A;  2WAD A;  1LSX A;  4X1L A;  4JGP A;  4EXO A;  3HUN A;  4X68 A;  4I3A A;  4Y0O A;  4E3N A;  1DP9 A;  2GDN A;  1XA1 A;  4JBF A;  4E3O A;  1N9B A;  2YKH A;  4E3K A;  2GZA A;  3BW6 A;  3EOI A;  5AQA A;  1SDE A;  2XFT A;  2FFY A;  3N8R A;  1JTD A;  2ZL1 A;  3HJI A;  3T1S A;  4S2P A;  1MWU A;  1VEU B;  3D4F A;  3NEC A;  3UDX A;  1YSQ A;  2Q9N A;  3IXB A;  4O01 A;  4PM9 A;  5HX9 A;  4EQI A;  2IWC A;  2XDM A;  2Z6C A;  5E2G A;  4B4X A;  4EQ1 A;  4MMN A;  3E98 A;  4DE1 A;  3R7W B;  4ID4 A;  1LHY A;  3U4L P;  4OOY A;  3WWX A;  5DTK A;  2OAQ 1;  4EEU A;  3LO7 A;  5AQB A;  1Q2P A;  3BFE A;  4X25 A;  2WKQ A;  1FCO A;  3AGD A;  3HLC A;  1K57 C;  2ZQ7 A;  1OJG A;  5E2H A;  3UE0 A;  4FUW A;  1JWP A;  4CPK A;  2ZQ9 A;  2O9A A;  3HVF A;  1XP4 A;  5IHV A;  5CGX A;  5FEG A;  2ZQA A;  2Z2L B;  1K25 A;  2JCH A;  1Z09 A;  3K3C A;  4Y15 A;  1ZKJ A;  3A3J A;  5AVE A;  4JGO A;  4HJ3 A;  1E3U A;  1XFQ A;  1LL5 A;  3CJM A;  2V1Z A;  1VHM A;  4ARZ A;  3EEH A;  4KG5 A;  5J8X A;  4EUZ A;  1XFN A;  3DTE A;  3IF6 B;  5CX7 A;  3G35 A;  3E2K A;  4R3J A;  4CLC C;  2XH9 A;  1NLZ A;  1TD5 A;  4PKY G;  1T1C A;  3UB6 A;  1YM1 A;  3LIE A;  2XA7 M;  4KQQ A;  1YMS A;  3MS6 A;  4S2I A;  4OQH A;  2HDS A;  3T4T A;  2WGW B;  4DJ2 A;  2OWJ A;  4OPY A;  1XXM A;  1L0F A;  1IYP A;  3MFX A;  4D2O A;  3ICY A;  5FI7 A;  1HTZ A;  2DMW A;  1ZG6 A;  4RA7 A;  4WM9 A;  3V67 A;  1SCW A;  3PBQ A;  4ETX A;  2Z6D A;  5GLB A;  4LRY C;  1MBL A;  4EBP A;  4E3J A;  2XLN A;  3TSG A;  2LB9 A;  5F1F A;  1PNE A;  5F69 A;  1K6S A;  1YLJ A;  4ZJ1 A;  4FH4 A;  2M7V A;  2W27 A;  2EX6 A;  3MMH A;  3Q7Z A;  1LLB A;  3PBN A;  3M6B A;  2A24 B;  4E6X A;  1SKO B;  4DDS A;  2VJW A;  3W8K A;  5DFX A;  3IX3 A;  4KZ9 A;  1H5X A;  3FWL A;  3Q1F A;  1K4F A;  3NHQ A;  1KOU A;  4II7 A;  2PR5 A;  2H28 A;  4JXS A;  3BRM A;  3O3V A;  3G31 A;  2UV0 E;  1VM1 A;  4KG6 A;  4ZTK A;  3HCY A;  5HAQ A;  4MNR A;  2PR6 A;  1MKI A;  4KQD A;  5HL6 A;  1TS7 A;  2A24 A;  1D7E A;  5CGW A;  4QPR A;  2GNX A;  1WE4 A;  5EVI D;  1S1Y A;  5IS1 A;  5F6A A;  1CEG A;  3Q07 A;  1J9M A;  2P9V A;  3ZHH A;  5M19 A;  5CHU A;  1LT0 A;  4ZJ3 A;  4GNU A;  5DTS A;  2PU4 A;  3C8C A;  1A0K A;  4I5S A;  4IBR A;  1E4D A;  3HRE A;  2J9P A;  3VE3 A;  5EM0 A;  3LEZ A;  2VLG A;  4UAA A;  5IU1 A;  1TEM A;  1TS0 A;  2RL3 A;  3LIA A;  3V50 A;  1F98 A;  3DWZ A;  2ZM0 A;  1VB6 A;  4BBV A;  5F68 A;  3MFD A;  4HH3 A;  4B4Z A;  2EWW A;  3OCN A;  3FPV A;  3HLG A;  4NEE D;  3C38 A;  4QHC A;  3SZT A;  4BD0 A;  5HL1 A;  3D72 A;  2ZMF A;  4PHT A;  1E25 A;  3A3E A;  3FKV A;  2X01 A;  4EBN A;  3AGE A;  2EXB A;  3T4J A;  4WMC D;  1ZTU A;  4HY8 A;  1MWS A;  3B33 A;  3IBR A;  1T19 A;  3VMA A;  4GW9 A;  3IT9 A;  1K56 A;  2PT7 A;  5A8B A;  1YAX A;  3NOU C;  4O0P A;  2Y2O A;  3BY9 A;  1T18 A;  3QP6 A;  3VOZ A;  3V39 A;  4R70 A;  2OOL A;  4H6J B;  1PW1 A;  1FCN A;  3UY6 A;  4P0M A;  2W1R A;  2QJ5 A;  1BT5 A;  4HIA A;  5A91 A;  5HAR A;  2EX2 A;  3SS3 A;  1YMX A;  2VV6 A;  2VV8 A;  3P7N A;  1CI9 A;  4HI4 A;  4BBT A;  1F9I A;  2ZQ8 A;  3W4P A;  1YSP A;  3TOI A;  3MZD A;  3CMZ A;  4JGQ A;  3LYX A;  4LEN A;  3QP8 A;  1ZC2 A;  1CF0 A;  1S66 L;  3OZH A;  1K57 A;  3SH7 A;  5DKK A;  1V9Z A;  4KZB A;  4CLC B;  4DF6 A;  1XJ6 A;  1PRQ A;  4BWI A;  1GSV A;  5CTN A;  1ES3 A;  2GX5 A;  4XUX A;  2HP9 A;  2OWH A;  4M3K A;  3VV4 A;  5GHX A;  3EWK A;  3ZG9 B;  1YQS A;  5HDS A;  3VSL A;  4S2O A;  2XA7 S;  4PAU A;  2IWB A;  4QD4 A;  1GSW A;  5BOH A;  2V1B A;  3UN7 A;  3G4P A;  4YNR A;  1YPR A;  5HD3 A;  3E4Q A;  1F5M A;  2I72 A;  3ZNY A;  2W3G A;  4HP4 A;  5FAP A;  3LR0 A;  2JBF A;  3LIC A;  1MPL A;  3PBT A;  5HFO A;  3IX4 A;  5FAQ A;  1XGI A;  4CLC A;  2XK1 A;  3M2J A;  4BJP A;  5C5K A;  1IKI A;  1W63 Q;  5EPH A;  3SOI A;  5GLC A;  3UDF A;  1RGY A;  3LR4 A;  4EW7 A;  5HDC A;  3T1X A;  5L07 A;  4PMA A;  1IOU A;  4OPR A;  3IXD A;  4P87 A;  3MZE A;  4F3L A;  3PBO A;  2R9W A;  5DFY A;  5HWW A;  1PIO A;  1W79 A;  2XEP A;  5TR7 A;  3N4I A;  3NJA A;  4XT2 B;  2BLS A;  4NXB A;  2EWV A;  4MBF A;  3LR3 A;  3OPR A;  1AWI A;  4UQI S;  4DXB A;  3RXX A;  2KX6 A;  2O9C A;  4ME4 A;  1KGE A;  4WLA A;  1KVL A;  2ZMV A;  4Y17 A;  5TJJ A;  4PM6 A;  5CEB A;  2QPN A;  3G6O A;  3OCL A;  1U60 A;  3VP0 A;  5KMW A;  4DE2 A;  4JF4 A;  1MWR A;  4IVI A;  2NUP C;  3C5A A;  5FQJ A;  1G68 A;  2KDK A;  2BG1 A;  5J4E A;  3H7W B;  4LFU A;  4MLL A;  3ZVW A;  4OP5 A;  3QP2 A;  3IH9 A;  1HD8 A;  3SH9 A;  5AQ7 A;  2K7S A;  4GB7 A;  4OQG A;  1D1J A;  3RTY A;  1K0K A;  2INW A;  5HZH A;  3G32 A;  4WUJ A;  2QHK A;  2QKP A;  1FSY A;  2L4R A;  3LIB A;  1E3U D;  4BMW A;  2D01 A;  3VP1 A;  1H8M A;  4WBG A;  1N9L A;  1VQQ A;  2JKF A;  4WEJ A;  1J3W A;  5FI2 A;  2E8I A;  4G3V A;  3ZVT A;  2VGL S;  5FL3 A;  5CRF A;  3DAV A;  3A0R A;  2MJ6 A;  3FKW A;  4X69 A;  3MQ0 A;  2HF6 A;  3ISG A;  2JN7 A;  2OAP 1;  4L9E A;  3BLS A;  3CLO A;  1XGJ A;  3NDE A;  2ZL1 B;  4UHU A;  2VEA A;  1PWC A;  4OLD A;  1FR6 A;  3QP4 A;  3N7W A;  2WKH A;  2Y2M A;  4KZ4 A;  2XSS A;  1LL8 A;  4HEF A;  2A2L A;  5E2F A;  5U47 A;  1BYW A;  1XJ4 A;  3UE1 A;  4DRT A;  3OOV A;  4L9G A;  4QJG A;  3D3O A;  3LEQ A;  3T50 A;  3UE6 A;  1EI5 A;  1SKF A;  2M7U A;  1MC0 A;  2XFS A;  5A93 A;  1SZV A;  1RCJ A;  1NZO A;  2Y2Q A;  5DKL A;  4CQH A;  3A3I A;  1XJ3 A;  3IWI A;  4WZ4 A;  2BTF P;  4LV2 A;  4ZBE A;  4BEN A;  3G2Y A;  3F1P A;  4K08 A;  2WKP A;  3HUM A;  3MZF A;  3CZD A;  3KX0 X;  3S22 A;  3LY3 A;  4FD8 A;  1T1A A;  5EE8 A;  4D60 A;  3UNW A;  3MQQ A;  2ZC6 B;  2CMN A;  1Y4O A;  4ARZ B;  2O9B A;  2O0Y A;  1KE0 A;  5M1A A;  4NG2 A;  5K5B A;  1S6R A;  2WK0 A;  2Y79 A;  5FAT A;  4NET A;  1ALQ A;  3BFD A;  4DDY A;  1BLC A;  3KYQ A;  3SW1 A;  3PYP A;  1S0W A;  2W3H A;  5EOO A;  1X0O A;  3GR2 A;  3MKF A;  3BM6 A;  3V3R A;  1S4R A;  2PYP A;  5G4Z A;  3MSH A;  3T4O A;  2W3F A;  1XA7 A;  1S1Z A;  4N9K A;  2J3T C;  4IED A;  5MC7 A;  3HLB A;  3WS4 A;  3ZDJ A;  2PHY A;  1GSX A;  4BBU A;  3LY4 A;  3EQU A;  3IS2 B;  3IXH A;  1I2S A;  4ZAM A;  4Y3I A;  4OOM A;  5F83 A;  5GHY A;  4WZ5 A;  3EEA A;  2Y2G A;  3TE8 A;  4X6T A;  4X56 A;  5EVE A;  1OJ5 A;  3VSK A;  2VZW A;  4LPZ A;  1LL9 A;  1GCE A;  5J3W A;  1GHP A;  5E43 A;  3H9W A;  3K3D A;  3GRJ A;  3BFF A;  2ZD8 A;  5GLD A;  4GHI B;  4GN2 A;  4BD1 A;  1MXO A;  2VV7 A;  3DTK A;  3T4L A;  3IS2 A;  4R1G A;  4L0L A;  1K56 D;  2EXA A;  3BFC A;  1BLH A;  3A3F A;  3VOL A;  2P7J A;  1BUE A;  3DBA A;  1JTG A;  2B18 A;  4GCZ A;  4MBH A;  4WEL A;  2J8Y A;  5L10 A;  3DTM A;  3MQO A;  4OLG A;  5FQI A;  1CQA A;  3EQV A;  2PU2 A;  4QU3 A;  2X02 A;  4I38 A;  1KGG A;  1KDS A;  2OLV A;  1YLY A;  2VGK A;  3JVV A;  3U2A A;  2O99 A;  1C3B A;  2R78 A;  4RX2 A;  3BEC A;  4GHI A;  2P9V B;  4UQI M;  4RX3 A;  3C30 A;  5JYO A;  3OPL A;  2W1T A;  2XD5 A;  1WA9 A;  5DVA A;  4GDN A;  2PYR A;  3OLO A;  2ACG A;  1LI9 A;  1RGZ A;  3RFB A;  3A0S A;  3PTE A;  2VX8 A;  4HP9 A;  4XUZ A;  2V9A A;  3GV9 A;  1OTB A;  1YLZ A;  3LCE A;  2QMI A;  2XD1 A;  5HSQ A;  1ONH A;  1OME A;  1BUL A;  4BL2 A;  3BLM A;  5HAP A;  4UA7 A;  5FA7 A;  4CJN A;  3UME A;  2V0W A;  5FAO A;  4Y7P A;  2J3T D;  2PAV P;  3BYD A;  1FSW A;  4R4S A;  4ZRR A;  1JNU A;  3JPU A;  1S67 L;  3L7H A;  3W2Z A;  4PM5 A;  1H0M A;  4GJ4 A;  3CWF A;  2XRN A;  2E8J A;  4CLC D;  2JKT M;  2V1A A;  3FG8 A;  1V9Y A;  4KZA A;  5CXW A;  5JYP A;  3HLE A;  1ERM A;  1H8Y A;  3BQ8 A;  1K38 A;  2V8F A;  3VFF A;  1K55 C;  1W8Q A;  3FYZ A;  2ZQD A;  3DTI A;  4N9L A;  2WYX A;  5EM1 A;  4M4X A;  3C4P A;  2VGL M;  1BTL A;  4IVK A;  3UB7 A;  2A3U A;  1STZ A;  2JE5 A;  4I3I A;  1PI5 A;  3TW8 A;  1XJ2 A;  4GKU A;  4JF6 A;  5HD5 A;  1CJF A;  5CED A;  3PXP A;  1W8Y A;  2JC7 A;  3KSH A;  5LBR A;  2Y2N A;  1L0G A;  4B9O A;  2Y55 A;  1RP5 A;  2ZM8 A;  1H8Z A;  2IWD A;  2G2U A;  4QY6 A;  2HV1 A;  2QZ6 A;  4ESP A;  3KYE A;  2M1C A;  4I3J A;  1N9N A;  1UGU A;  2W3D A;  4HQA A;  1NYY A;  3IBJ A;  2EX9 A;  1W5D A;  1PWG A;  1MZU A;  2ZQC A;  3UB8 A;  4PKY A;  5G18 A;  3ZYT A;  5F82 A;  3CPT A;  3ULF A;  5HDD A;  4HJ6 A;  1O07 A;  1FOF A;  2R9X A;  2Q9M A;  4GD8 A;  5AQ9 A;  3ZG0 A;  4EU0 A;  4OOL A;  4FCF A;  5KSC A;  1NY0 A;  1W7F A;  3MBZ A;  5DF9 A;  1ES4 A;  1KE4 A;  4LCM A;  4LLO B;  1UWN X;  2V0U A;  3WRZ A;  1IKG A;  3BWL A;  4G3W A;  4Q0I A;  3BJN A;  4B93 A;  3UPO A;  2Y91 A;  3C7V A;  4FOF A;  2W3E A;  2H0Y A;  4F3L B;  3C7U A;  3HL9 A;  1YLP A;  3OBF A;  2J3W A;  3EGX C;  1KDW A;  1IEL A;  4HOI A;  4E3I A;  4IHQ A;  4KZ3 A;  5HW3 A;  3R4K A;  3MXQ A;  1DJA A;  1T1B A;  4O7D A;  4Y5F A;  5FQQ A;  4S2K A;  5I5L A;  2UWX A;  4WZ5 C;  3IF5 A;  3NY4 A;  1ACF A;  1GA9 A;  1G28 A;  4Y0T A;  4NXG A;  1MWT A;  1PWD A;  3F1N A;  4U0X A;  2HJE A;  4QY5 A;  3CG5 A;  4UEY A;  4GZB A;  3LID A;  3P09 A;  4JPM A;  3A3D A;  1PI4 A;  5GL9 A;  4QWO A;  3VE4 A;  1OPX A;  5FAS A;  1L2S A;  1NXY A;  2WKI A;  4LV0 A;  3CHW P;  3HJK A;  2EFU A;  3C2W A;  4MDZ A;  1VET B;  3HLW A;  4R23 A;  2KOI A;  1NJ4 A;  1IYO A;  3BQA A;  3IF6 C;  4N92 A;  3DWK A;  4Q0H A;  3T4Q A;  2PBY A;  1L0E A;  4HES A;  3VP3 A;  3D9Y A;  5FI6 A;  3P98 A;  4H8R A;  5CGS A;  2HP5 A;  4IBX A;  1HVB A;  1BLS A;  3N8L A;  1G6O A;  1P9W A;  1FCM A;  1TS8 A;  3HUO A;  4R3A A;  4KZ6 A;  4ETZ A;  3ZG5 A;  1VET A;  3PAE A;  2EX8 A;  2OLU A;  5I94 A;  4U0T A;  5EOE A;  3MR0 A;  2WAF A;  2W0N A;  3E4P A;  2L1M A;  1YT4 A;  4OPQ A;  1EW0 A;  4LV3 A;  2Y2P A;  4P85 A;  4S2N C;  3WS1 A;  1XX2 A;  4UA9 A;  3NOT C;  3IHA A;  1BLP A;  1OT6 A;  1DJB A;  2K2N A;  2WGV A;  4NK3 A;  1CK3 A;  2ZC7 A;  4YIN A;  3MXR A;  2HDQ A;  3W4Q A;  3FZC A;  2OV5 A;  1M6K A;  4LV1 A;  2DCF A;  4DJ3 A;  1P9R A;  5L8M A;  4BLM A;  5DF8 A;  1O7E A;  1K55 A;  2LB5 A;  2Y8H A;  3H82 A;  3ZNT A;  1QME A;  2HP6 A;  4WF0 A;  1PFL A;  4KZ5 A;  1PZP A;  1DY6 A;  4K0W A;  3ZG7 B;  1P0Z A;  2ZC3 B;  4OKP A;  2XF3 A;  3KO6 A;  1L0D A;  1OTI A;  3HBR A;  3EGD C;  1MY8 A;  1LSW A;  4DE3 A;  4AFI A;  3E2L A;  4R4R A;  1ZG4 A;  3E4O A;  5FQM A;  1JWV A;  4E3L A;  1OT9 A;  3F1P B;  3WS0 A;  2B02 A;  5F5Y A;  3VP4 A;  3QP1 A;  3O5Y A;  2FH5 A;  2Y2J A;  3Q82 A;  1HLU P;  4MEZ A;  1TS6 A;  2ZJ9 A;  2JKT I;  4GS9 A;  4U3T A;  4B88 A;  3PHY A;  2DNS A;  4Z9Q A;  4L9F A;  2KLI A;  1NRJ A;  4G3K A;  4E04 A;  4JGR A;  2C6W B;  3LGO A;  4Z1W A;  2K31 A;  2HDU A;  2B95 A;  1I5Q A;  2CC1 A;  1N9O A;  4FSF A;  3V5M A;  4S2L A;  4KZ7 A;  3W4O A;  4E6W A;  1IFQ A;  4YWZ A;  4OVD A;  4N1H A;  1UWP X;  1DJC A;  2WZX A;  3NOP C;  3UB9 A;  5EFW A;  2L0W A;  3SH8 A;  1K6R A;  4C6Y A;  3C4O A;  2P04 A;  1ESU A;  4X55 A;  4HHD A;  1VEU A;  2J7V A;  1OTE A;  3TG9 A;  1BSG A;  5FSR A;  5HAI A;  1IYS A;  2WKR A;  4EV4 A;  4MN7 A;  4OPZ A;  1NZU A;  3R7W A;  3UPP A;  2PBD P;  2VKS A;  1CI8 A;  5EVI C;  1KVM A;  2QJ7 A;  1L3L A;  3M6H A;  5L09 A;  4P6B A;  2EFX A;  4PM8 A;  1PW8 A;  2RCX A;  4GD6 A;  3ZFZ A;  5DF7 A;  4C75 A;  3GVB A;  1GHI A;  3FPW A;  3O86 A;  4EEP A;  3V3S A;  4KQO A;  4DMZ A;  2Y59 A;  4YFM A;  2WUQ A;  3NDG A;  2PDR A;  2P08 A;  3HLD A;  3A0V A;  4R38 A;  5DTT A;  2Y2H A;  4KG2 A;  1K4E A;  2Y2I A;  5DJU A;  4NXE A;  2W1T B;  1K54 A;  4LGW A;  1NLY A;  4HNB A;  4MN5 A;  3CUE C;  1S4S A;  1FR1 A;  5E2E A;  4QB8 A;  5FDS A;  3PR6 A;  3IF6 A;  3S7N A;  3RXW A;  2WGI A;  4WYY A;  4IUK A;  4WEK A;  1P97 A;  2Y2K A;  2XRO A;  3F1O B;  5A92 A;  2WGW A;  3OC2 A;  5EEC A;  2DRW A;  1FIK A;  5HWT A;  2ZC4 B;  1ODV A;  4Y13 A;  3UO9 A;  2HGV A;  1GHM A;  4S2M A;  2XGN A;  1NYM A;  2D02 A;  2VK3 A;  2QWS A;  2ZOH A;  4JXG A;  3QNC A;  3RH8 B;  2HZ5 A;  4JLF A;  4DE0 A;  2A49 A;  3S7P A;  3B47 A;  2YKF A;  4RVA A;  4GOG A;  5DJT A;  4ZJ2 A;  4K91 A;  4S2N A;  3F1O A;  3Q7V B;  1XKZ A;  3VP2 A;  3QHY A;  1Z6F A;  4A5R A;  1SKO A;  4KEN B;  3AGF A;  4FH2 A;  4MBK A;  2Y4A A;  5CHJ A;  3N8S A;  4R0Q A;  2C5W B;  3UE3 A;  4OH0 A;  4YOF A;  2AVX A;  3NCK A;  3DW0 A;  4P6Z S;  3ZG8 B;  3IXG A;  3JYI A;  1BZA A;  2XR0 A;  3JVU A;  3ITB A;  3Q7V A;  4PPR A;  3IWQ A;  4EUV A;  5G4Y A;  2EA9 A;  5L2F A;  2PD7 A;  4LRX C;  1ERO A;  3T12 B;  4BL3 A;  3NBL A;  4Q8I A;  1G6A A;  5AJG A;  4JKT A;  2NUT C;  5EUA A;  2FZ0 A;  1AXB A;  2H0T A;  5FDH A;  4JXW A;  3T4S A;  3T1Q B;  2VA0 A;  5FQ9 A;  3BY8 A;  4EET B;  3CPT B;  3UMD A;  2HPB A;  4KUK A;  4DKI A;  2Y2L A;  2BAS A;  2PRF A;  3ZQ5 A;  3UB5 P;  3UDI A;  3MKE A;  1IYQ A;  2JKR I;  2J80 A;  3LIF A;  3GQZ A;  5GHZ A;  5EV0 A;  3T1R A;  3LUQ A;  5KIZ A;  1PYY A;  4NKP A;  1W63 M;  3KYZ A;  2B5R A;  3CIT A;  4C3Q A;  4OQ0 A;  5TFQ A;  1LI0 A;  2ZOI A;  4K0X A;  4LRZ E;  3O88 A;  4XXR A;  3PAG A;  1LSV A;  2JHE A;  3CAX A;  2HJ9 C;  1IEM A;  1QMF A;  3WS2 A;  3GDI A;  3GSG A;  1TDL A;  3GEC A;  4ZDX A;  4DXC A;  5CHM A;  4DN0 A;  2WAE A;  3M2K A;  5TBM B;  1TF1 A;  3GTC A;  3S4X A;  3K2N A;  2H5S A;  1ESI A;  1OTA A;  3IH8 A;  3FV7 A;  5EVI B;  4HH2 A;  4I39 A;  3LR5 A;  4FTX A;  2IA2 A;  2WZZ A;  4EER A;  3N6I A;  5KZH A;  5IT5 A;  4RYE A;  3G30 A;  4NXF A;  3T4K A;  2GJ3 A;  4IJG A;  4F94 A;  4H6J A;  2I9V A;  2V2F F;  3BFG A;  5TBM A;  3F1N B;  3UPN A;  3IWO A;  3PBS A;  5CTM A;  1GA0 A;  4CLC E;  1G5U A;  2QYB A;  3IX8 A;  4HJ4 A;  4WN5 A;  5EVI A;  4RQ9 A;  1YLT A;  2H10 A;  5GLA A;  1JWZ A; 
#chains in the Genus database with same CATH homology
 3KSF A;  3FC7 A;  2PHY A;  1GSX A;  4BBU A;  3VE3 A;  4DJ3 A;  3EQU A;  1P9R A;  3IS2 B;  5L8M A;  2VLG A;  5IU1 A;  1TS0 A;  3LIA A;  1H3Q A;  2LB5 A;  1F98 A;  4Y3I A;  4OOM A;  1VB6 A;  2Y8H A;  1DP6 A;  3H82 A;  3KSI A;  4BBV A;  5F68 A;  4HH3 A;  4WF0 A;  3EEA A;  3TE8 A;  3CI6 A;  1DP8 A;  2EWW A;  2ZBB A;  1OJ5 A;  1P0Z A;  2VZW A;  4LPZ A;  3OCN A;  3FPV A;  3KSG A;  5J3W A;  3KO6 A;  4NEE D;  1OTI A;  3C38 A;  3EGD C;  1LSW A;  3LFV A;  4AFI A;  3H9W A;  3K3D A;  3D72 A;  2ZMF A;  3E4O A;  4PHT A;  1OT9 A;  3P01 A;  3F1P B;  2B02 A;  1Y28 A;  5F5Y A;  4GHI B;  2VV7 A;  3O5Y A;  3T4J A;  3T4L A;  4EES A;  2FH5 A;  3IS2 A;  4L0L A;  3CUE A;  3VOL A;  2P7J A;  3DBA A;  1ZTU A;  1TS6 A;  4HY8 A;  2JKT I;  2B18 A;  4GS9 A;  3B33 A;  3IBR A;  3PHY A;  1T19 A;  4GCZ A;  4WEL A;  4GW9 A;  3MJQ A;  4L9F A;  2KLI A;  2PT7 A;  3LI9 A;  1NRJ A;  3MQO A;  4G3K A;  3EQV A;  5A8B A;  1YAX A;  4E04 A;  3NOU C;  4R6L A;  4O0P A;  4I38 A;  4JGR A;  3E0Y A;  4Z1W A;  2K31 A;  3BY9 A;  1OTD A;  1T18 A;  3JVV A;  3U2A A;  2O99 A;  4R70 A;  1N9O A;  2OOL A;  1ZHH B;  2R78 A;  4FSF A;  4H6J B;  4GHI A;  5KSH A;  3MF0 A;  4UQI M;  2W1R A;  1IFQ A;  2QJ5 A;  4YWZ A;  4MN6 A;  3C30 A;  3TRC A;  4HIA A;  2W1T A;  1WA9 A;  2PYR A;  2VV6 A;  2VV8 A;  3P7N A;  3OLO A;  1UWP X;  4HI4 A;  3NOP C;  3UB9 A;  4XT2 A;  4BBT A;  3RFB A;  1F9I A;  3A0S A;  3TJZ C;  2VX8 A;  4HP9 A;  5EFW A;  1YSP A;  2L0W A;  3B42 A;  2V9A A;  4IUH A;  1OTB A;  3LYX A;  4JGQ A;  1S66 L;  2P04 A;  3PBR A;  3H82 B;  5HPF A;  5DKK A;  1YKD A;  5HSQ A;  1V9Z A;  4WL9 A;  4HHD A;  1OTE A;  4CLC B;  1XJ6 A;  3UME A;  2V0W A;  4BWI A;  5HWV A;  1GSV A;  4Q0J A;  2WKR A;  2J3T D;  2GX5 A;  4MN7 A;  4GLQ A;  4ZRR A;  1JNU A;  2OWH A;  4MCW A;  3R7W A;  3VV4 A;  1S67 L;  4O8G A;  3EWK A;  1DRM A;  5HDS A;  2VKS A;  3W2Z A;  2JKR M;  2XA7 S;  4PAU A;  4GJ4 A;  3CWF A;  2XRN A;  1NWZ A;  1MKM A;  4CLC D;  3H7W A;  2JKT M;  2V1A A;  1GSW A;  2QJ7 A;  2V1B A;  3FG8 A;  4YNR A;  1V9Y A;  5HD3 A;  3E4Q A;  4GS9 B;  1F5M A;  4KUO A;  2W3G A;  4HP4 A;  1D06 A;  3LR0 A;  2G7U A;  3BQ8 A;  2PD8 A;  3LIC A;  3PBT A;  3S7Q A;  5HPI A;  5J7E A;  4CLC A;  4EEP A;  3FPW A;  4BJP A;  5C5K A;  1W63 Q;  4KQO A;  4DMZ A;  4P6Z M;  4M4X A;  2VGL M;  3LR4 A;  4EW7 A;  5HDC A;  2PDR A;  2P08 A;  3A0V A;  5AVF A;  3S7O A;  1IOU A;  3UB7 A;  4R38 A;  1STZ A;  4Y2F A;  4I3I A;  4F3L A;  3PBO A;  3LI8 A;  5DJU A;  5DFY A;  5HWW A;  3TW8 A;  1LSX A;  4NXE A;  1XJ2 A;  2W1T B;  4JGP A;  4EXO A;  4I3A A;  1DP9 A;  5HD5 A;  1NLY A;  4HNB A;  4MN5 A;  3NJA A;  3CUE C;  3PXP A;  4XT2 B;  1S4S A;  2YKH A;  3KSH A;  2GZA A;  4NXB A;  5LBR A;  2EWV A;  3LR3 A;  4B9O A;  3PR6 A;  3BW6 A;  3EOI A;  4UQI S;  2KX6 A;  3S7N A;  2O9C A;  4ME4 A;  4WLA A;  4IUK A;  4WEK A;  2HV1 A;  3HJI A;  1P97 A;  2ZMV A;  2XRO A;  2M1C A;  3F1O B;  5TJJ A;  4I3J A;  1N9N A;  3OC2 A;  1YSQ A;  1UGU A;  4O01 A;  2W3D A;  4HQA A;  2Z6C A;  3G6O A;  3OCL A;  5HWT A;  4EQ1 A;  4MMN A;  3E98 A;  3IBJ A;  1MZU A;  3R7W B;  1ODV A;  2NUP C;  3UB8 A;  4PKY A;  2HGV A;  2KDK A;  3ZYT A;  3ULF A;  5HDD A;  2OAQ 1;  4HJ6 A;  4EEU A;  5J4E A;  2D02 A;  3H7W B;  2QWS A;  2ZOH A;  3RH8 B;  3S7P A;  3B47 A;  2YKF A;  2WKQ A;  5DJT A;  2K7S A;  4EU0 A;  4OOL A;  3F1O A;  3RTY A;  1OJG A;  2INW A;  5DF9 A;  5HZH A;  4WUJ A;  4LLO B;  1UWN X;  2QHK A;  2O9A A;  2V0U A;  2QKP A;  3BWL A;  4G3W A;  2L4R A;  4Q0I A;  3LIB A;  3BJN A;  4B93 A;  3K3C A;  4BMW A;  4FOF A;  2W3E A;  4F3L B;  3UE3 A;  3OBF A;  2D01 A;  2J3W A;  1H8M A;  5AVE A;  3EGX C;  4YOF A;  1N9L A;  4JGO A;  4WEJ A;  4HOI A;  4P6Z S;  4IHQ A;  4HJ3 A;  1XFQ A;  4G3V A;  2VGL S;  3R4K A;  3MXQ A;  5FL3 A;  1VHM A;  4ARZ A;  1T1B A;  3EEH A;  3JVU A;  1XFN A;  4EUV A;  4Y5F A;  5G4Y A;  2EA9 A;  3A0R A;  5I5L A;  2MJ6 A;  5CX7 A;  2PD7 A;  3MQ0 A;  2HF6 A;  4LRX C;  2JN7 A;  2OAP 1;  4L9E A;  4CLC C;  1NLZ A;  1TD5 A;  3CLO A;  4PKY G;  1T1C A;  1G28 A;  3UB6 A;  3LIE A;  5AJG A;  2XA7 M;  4NXG A;  2NUT C;  2VEA A;  3T4T A;  4DJ2 A;  2OWJ A;  2FZ0 A;  3F1N A;  3MFX A;  2HJE A;  3ICY A;  4UEY A;  3LID A;  2DMW A;  3T4S A;  3V67 A;  2VA0 A;  3BY8 A;  4EET B;  3UMD A;  3PBQ A;  4ETX A;  2Z6D A;  3VE4 A;  1OPX A;  4KUK A;  2BAS A;  3ZQ5 A;  4LRY C;  2JKR I;  2XSS A;  1LL8 A;  2A2L A;  2J80 A;  1BYW A;  3HJK A;  3LIF A;  3C2W A;  1XJ4 A;  4MDZ A;  3OOV A;  4L9G A;  2LB9 A;  3D3O A;  2KOI A;  3LUQ A;  5KIZ A;  3T50 A;  5F69 A;  3UE6 A;  4NKP A;  1W63 M;  3BQA A;  3KYZ A;  2W27 A;  2M7V A;  3MMH A;  2M7U A;  3CIT A;  1MC0 A;  4Q0H A;  3PBN A;  3T4Q A;  2ZOI A;  2A24 B;  4LRZ E;  1LSV A;  2JHE A;  3CAX A;  2HJ9 C;  5DKL A;  4CQH A;  1XJ3 A;  2VJW A;  3GDI A;  5DFX A;  3GEC A;  4DN0 A;  3F1P A;  1G6O A;  4K08 A;  2WKP A;  5TBM B;  1P9W A;  1TF1 A;  1TS8 A;  1KOU A;  3NHQ A;  4II7 A;  3KX0 X;  2PR5 A;  3K2N A;  2H28 A;  1T1A A;  1OTA A;  4R3A A;  4ETZ A;  3MQQ A;  2CMN A;  4HH2 A;  4I39 A;  4ARZ B;  3MR0 A;  2W0N A;  3LR5 A;  2O9B A;  2O0Y A;  3E4P A;  3HCY A;  2IA2 A;  2PR6 A;  2L1M A;  4KQD A;  5HL6 A;  1TS7 A;  5K5B A;  2A24 A;  4EER A;  1D7E A;  1EW0 A;  4QPR A;  2Y79 A;  2GNX A;  3KYQ A;  3SW1 A;  3PYP A;  5IT5 A;  2W3H A;  1X0O A;  4NXF A;  3T4K A;  1S1Y A;  5IS1 A;  3NOT C;  5F6A A;  2GJ3 A;  4IJG A;  4H6J A;  2I9V A;  1S4R A;  2PYP A;  5TBM A;  5G4Z A;  1OT6 A;  3T4O A;  2K2N A;  2W3F A;  3F1N B;  3PBS A;  1LT0 A;  1S1Z A;  4CLC E;  2QYB A;  4HJ4 A;  4WN5 A;  4RQ9 A;  2J3T C;  3C8C A;  4I5S A;  5MC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...