2A2LA

Crystal structure of klebsiella pneumoniae protein orfy, pfam duf336
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
SLMNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords unknown
publication title Crystal Structure of Klebsiella Pneumoniae Hypothetical Protein Orfy
rcsb
source organism Klebsiella pneumoniae
total genus 41
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2a2lA00
4NKPA 4CLCC 4BMWA 4CLCD 2A2LA 3FPVA 5CX7A 4CLCB 4CLCE 4CLCA 3FPWA
chains in the Genus database with same CATH superfamily
4X68A 1BTLA 1YLJA 4FUWA 3UPOA 2XF3A 2JC7A 2XSSA 2KOIA 4K0XA 2V0UA 3AGDA 4GB7A 4EEUA 2JKRI 2XLNA 2QYBA 2K2NA 1LI0A 2H10A 3FC7A 3BLSA 2ZC3B 4BBVA 1P97A 4OLGA 5DTKA 3H7WB 1G5UA 3VOLA 4X55A 5DJUA 2WGIA 3G6OA 1Y28A 2WAEA 5HPIA 1OTEA 1E4DA 1U60A 3DTKA 3SS4A 5AQAA 3C30A 1VB6A 2J9PA 1OPXA 2W1RA 4I3IA 1KDWA 5L09A 4JXWA 1Y4OA 1ERMA 3UN7A 3LIDA 3BFGA 4Y7PA 2PRFA 2B5RA 2IWBA 4GOGA 2JE5A 1SKOA 2ZQDA 3NOUC 3C5AA 4WZ5A 5HD3A 4IUKA 5BOHA 2C6WB 1WYBA 1SDNA 3UE3A 4OVDA 1BYWA 1I5QA 1NXYA 4MN7A 3VP1A 4L0LA 3F1OA 4LRZE 3T1SA 4WL9A 4O8GA 3T4SA 2A49A 1DJAA 1N4OA 1K0KA 1G6OA 2O0YA 3C8CA 3EGDC 3V67A 1ALQA 3CJMA 3MXQA 4RQ9A 4CLCE 1HTZA 1PW1A 3FWLA 2LB5A 3KX0X 4R3BA 3Q82A 4DKIA 2ZJ9A 2H5SA 3JPUA 1OTBA 4R23A 3V3RA 4BBTA 3S1YA 3LEZA 4PHTA 1NZOA 1YSPA 2ZM0A 3Q07A 4H6JA 2L0WA 1N9OA 3LUQA 4N9LA 4OP8A 2XGNA 3H82A 4I3JA 3IF6A 2G7UA 4E3IA 1S1YA 1L0FA 4LV1A 1PWCA 3LIAA 3MXRA 4Y5FA 3W4OA 2INWA 3MKEA 1C3BA 1EROA 3HBRA 4RX3A 3L9KA 4DMZA 1BLHA 3U4LP 3M6BA 3CPTA 5DKLA 2Y55A 1FR1A 2Y2LA 3SW1A 2QJ7A 3HLCA 4OOLA 3S4XA 2E8JA 4JGOA 2IWCA 4WMCD 2JKFA 5EE8A 2VGLM 4A5RA 3IHAA 5EM0A 5L07A 4EQ1A 3KYEA 5I94A 2LB9A 2WGVA 5EOEA 4XT2B 4KUOA 3ZG5A 1JNUA 4Y0UA 4OH0A 4UA6A 1QMFA 2XR0A 3ZG8B 2EFUA 3OZHA 1DP6A 1FSYA 2O9AA 4R4RA 3LY4A 5FQIA 1M40A 3BY8A 3ZHHA 4ARZB 3NJAA 2BTFP 2Z2MB 1K38A 2PHYA 4E6XA 3WRZA 2VX8A 3B42A 4LCLA 2Y2PA 4G3WA 5GL9A 3UDFA 3OCLA 4S2LA 4JXGA 3TOIA 2Y91A 5E2GA 2PD8A 4HP4A 4CJNA 4QU3A 4DE1A 3Q7VA 5TBMB 4UA7A 1PI5A 4MBHA 2IA2A 3O3VA 1KGGA 3LIFA 1QMEA 4C6YA 4D60A 4EESA 3R4KA 2Y2OA 5GHYA 2WKRA 5LBRA 4PM9A 1XJ2A 3HLBA 2I9VA 3LICA 2EX6A 2ZLYA 5TR7A 3LR3A 3PXPA 1PI4A 3NY4A 2JN7A 5CERA 1YT4A 3N7WA 1VETA 2ZL1A 3LGOA 4N92A 1H8ZA 4EBLA 2EX9A 4FCFA 4OP5A 4NXFA 2QHKA 5HDCA 1XA7A 4NEED 5FATA 4Q0JA 2XQZA 3FYZA 2M1CA 3UE6A 3QP5A 4R3JA 3ZNYA 4X56A 3QP6A 3IX8A 3CZDA 5E2EA 1NJ4A 3JVVA 3UMDA 4KG6A 2QPNA 5CHJA 2ZBBA 2ZC5B 2EX2A 3TW8A 3ICYA 2MJ6A 1ES2A 3B47A 4OQIA 5KIZA 2PYPA 3V50A 5A93A 3BFEA 2RL3A 3CAXA 5FL3A 3PAGA 1EWZA 3F1PA 4JGRA 1F98A 3C7VA 2UV0E 1EI5A 1ES5A 2OV5A 4BENA 3C4OA 2W1TB 3IXDA 2Q0OA 1K4FA 4YFMA 1V9ZA 2PR5A 3W2ZA 4KQOA 4KZAA 3K2NA 3FKVA 1PYYA 3C7UA 3SOIA 4KQQA 2PAVP 2P9VA 5C5KA 2HJ9C 1KGEA 3BWLA 3A3EA 2XDMA 3OPHA 5FEFA 3T4OA 2WKQA 3OBFA 3VE4A 2L1MA 2K7SA 2OSUA 2O99A 3FPVA 5FDSA 1XA1A 2ZQ9A 3MR0A 3CMZA 4L9GA 4ZJ2A 3S7PA 4S2MA 2XRNA 3HLEA 4ZJ1A 4ESPA 2EA9A 1ESUA 1KE3A 4P85A 4EERA 4E3MA 3AGEA 1RGZA 1TF1A 2JKTM 2W3GA 2GNXA 2VZWA 3UDXA 4G3KA 4LENA 4FH4A 1BLSA 4PM5A 1YAXA 3N6IA 5CGXA 5F1GA 3P98A 1HZOA 3PYPA 5FI6A 4KQDA 1FOFA 5CEDA 3TE8A 5DJTA 3KYQA 3LR4A 4DN0A 2XROA 3BY9A 4PMAA 4KZ7A 2VGKA 1NY0A 3IWIA 4ZAMA 3I7JA 4FD8A 4E3OA 4IBXA 4NXEA 3C38A 1K4EA 4LV2A 1K56D 2Z2LB 2HP9A 2ZQAA 3G34A 3MF0A 3FG8A 5GLBA 1PW8A 3NBLA 5IHVA 2WKEA 4BD0A 3BLMA 3MBZA 4PM7A 5GLDA 3L7HA 4WEJA 2JBFA 1OJGA 4HIAA 2V1ZA 1YMXA 3UMEA 3WS1A 1JTDA 2ZQ7A 4QPRA 4DE2A 3VE3A 3IX4A 4F3LB 2EXAA 3P7NA 2VV7A 2HPBA 1YLTA 2PBDP 3O86A 2B18A 3V5MA 5FAQA 1SHVA 1E3UD 2OWHA 2Q9MA 5CTMA 3T1XA 3HJIA 2VGLS 1WE4A 2Z6CA 2ZM2A 4ARZA 3GTCA 3NULA 4Y3IA 1CEGA 3GECA 3ZGAB 1JVJA 3HL9A 3Q7ZA 5HZHA 3ZVTA 3ZNTA 4BBUA 1BZAA 4Z1WA 4UHUA 2GX5A 1J9MA 3T1QB 3A3IA 2VV8A 2NUPC 4KENB 1GA0A 1XJ3A 4CQHA 5GLAA 5HARA 4JF5A 4OPYA 2GJ3A 3BQ8A 1S66L 3MQQA 4Q0HA 4QY5A 3M6HA 1WYCA 2BLSA 3OC2A 4JLFA 4DDYA 2G2WA 5AVFA 1YSQA 3WS0A 2O9CA 1IEMA 4FH2A 3DWZA 4LRYC 3NDEA 1PRQA 2EWVA 5DFXA 1TS0A 4HBTA 3CG5A 3IXGA 1GHIA 4IVIA 1ZC2A 4IVKA 4PM8A 4HNBA 3MFXA 3T4QA 1YM1A 3VMAA 4S2NA 4OPQA 5F82A 2WKIA 1SDEA 4PKYG 3N8RA 4EW7A 2PDRA 1OT9A 3PBRA 3S7QA 1IKGA 1GHMA 5CGWA 4IJGA 4R3AA 3HLDA 1L3LA 1BSGA 2KX6A 4WUJA 3IT9A 4KZ8A 5U47A 2WUQA 4HEFA 4HBUA 3PBOA 1K55C 1NZUA 4S2KA 1X0OA 5DTSA 3SH9A 3ZG7B 2K31A 4B88A 2YKFA 1OMEA 3CI6A 2A24B 4MCWA 4NXBA 4R6LA 4DXBA 2ZQ8A 1FR6A 3UNWA 1BULA 1MKIA 1KE0A 3E4OA 4UA9A 1W79A 5EM1A 4ME4A 2V0WA 3G32A 2W1TA 3P09A 1H5XA 2DMWA 1HLUP 4OLDA 4RX2A 3QP2A 2NUTC 5FAPA 3ZFZA 1L0EA 2J3TD 3MZDA 1PZPA 1MZUA 1LL5A 3BW6A 4ZRRA 3ZDJA 3BFDA 4OOYA 2PR6A 4R38A 3A3DA 2W3DA 1E3UA 2W0NA 2R9WA 1W7FA 3NI9A 1OT6A 5CRFA 2CMNA 3E0YA 4DJ2A 1YMSA 4WZ4A 5FQMA 5F68A 2H28A 4GW9A 2VEAA 2OWJA 5G4ZA 1W8YA 2M7VA 1GHPA 1OTDA 5TGFA 1MBLA 4S2OA 1VQQA 1EW0A 5KSCA 1CI8A 3C2WA 4P6ZM 3DBAA 3VV4A 1G6AA 2HGVA 2PU2A 5CTNA 2J3TC 3R7WB 3FPWA 3LI8A 1CI9A 2A3UA 4KZ6A 1FCOA 1ZKJA 4MMNA 2J80A 1PWDA 1SCWA 5G18A 4LGWA 5A8BA 5E2FA 2QZ6A 1D06A 1TD5A 3VSLA 3QP4A 2P04A 1T19A 4PKYA 4DE0A 3UB5P 5IS1A 5HW3A 1PNEA 5HFOA 1JTGA 4XXRA 2Y2JA 4Z9QA 1TS7A 5E2HA 3IHBA 3G31A 2JCHA 3IS2B 3F1NA 2QWSA 2Y2HA 4I3AA 1NRFA 5CXWA 3QNBA 5EVIB 1Y54A 4B9OA 4WF0A 3LR0A 2O9BA 3P01A 2W27A 4KG2A 2ZMAA 1N9BA 4CLCB 3S7NA 4JGQA 2QJ5A 1TDLA 3OOVA 4MEZA 2OAQ1 1MXOA 1S6RA 1YPRA 2V20A 5TJJA 4Y0OA 4E6WA 1W63M 2JKRM 4DE3A 3EEAA 5HWTA 3GVBA 2WGWB 4YOFA 5HSQA 5KSHA 3LCEA 5HDDA 1KVMA 2Y59A 3Q81A 2ZMFA 3CUEC 4GCZA 4IHQA 4R1GA 3CLOA 3S7OA 4EUZA 1T1BA 3IXHA 3FKWA 4OQGA 3K3DA 1K57C 3OCNA 3LY3A 4XUXA 5IU1A 1YLPA 3K3CA 4BL3A 3UB7A 2FFFB 2W3FA 4NG2A 5EV0A 2G2UA 3IWOA 1K54C 4R0QA 4GZBA 4QY6A 4EETB 1NLYA 3H7WA 4N9KA 1STZA 2D01A 2WYXA 3V3SA 5A90A 3V39A 2P7JA 1GCEA 3IWQA 1FCMA 4PPRA 1RCJA 2V1BA 4PM6A 1GSVA 1O07A 4FSFA 4I5SA 3VFFA 5EVID 4NKPA 3SS5A 1VHMA 1BLPA 1KE4A 1ONHA 5F5YA 4E3KA 5CHMA 4WMCA 4F94A 3DTMA 4Y17A 1MY8A 1LL9A 2A24A 1CJFA 1HVBA 2C5WB 4CLCD 1H8MA 5HD5A 2J9OA 1SKOB 5L2FA 4U0XA 2HZ5A 2WZZA 1YLWA 4QD4A 2WK0A 4O7DA 4B93A 5AQBA 3MQOA 4G3VA 3UO9A 1CF0A 1MPLA 1DP8A 3LO7A 3VSKA 4LCMA 4OOMA 4EBPA 5FSRA 5CECA 3CWFA 1H3QA 1XPBA 3BJNA 1F9IA 4II7A 4UQIM 5EVIC 1ES4A 4Y0TA 2D02A 4HESA 4Y2FA 3D3OA 5I5LA 1TS6A 4CLCC 3OPPA 3HVFA 3DW0A 4P0MA 3H82B 4GKUA 4HJ4A 2ZC7A 4JBFA 1L2SA 3D72A 3T4KA 1MKMA 2HDSA 5J7EA 4B4ZA 1LSWA 5F6AA 3ZG0A 2W3EA 1ACFA 1D1JA 5CGSA 4WN5A 3DWKA 5GHZA 1P9RA 2J3WA 3BQAA 3R7WA 4JXVA 3MFDA 3HUOA 1FSWA 1PWGA 4B4XA 1J3WA 3E2LA 2I72A 4WBGA 5EVLA 3E2KA 4JKTA 1IYSA 2JHEA 4GHIB 3NECA 4NETA 4P6BA 4MBFA 3A3JA 3RTYA 1S4RA 2Y2GA 1P9WA 2FH5A 4BD1A 4P6ZS 2Y2NA 3FV7A 4HJ6A 4U0TA 4KZ4A 2PD7A 2XFTA 5J4EA 1KOUA 1ZG6A 4XT2A 2V2FF 1CQAA 3E98A 4BJPA 2XEPA 3T12B 5FQQA 1XX2A 4LV3A 3M2JA 3N8LA 3LIBA 5EVEA 4LRXC 5D3OA 5M19A 4L9FA 5CHUA 3O88A 5EUAA 3VP2A 3SH8A 3BFCA 2X71A 1A0KA 1TVFA 2ZQCA 4Q0IA 1IYOA 4EWFA 5CEBA 3ITBA 5G4YA 1IYPA 2X01A 3WWXA 4EEPA 2HV1A 3ITAA 3NOPC 4R4SA 2V8FA 2XFSA 4E04A 1ESIA 3ZCZA 4EXOA 1NYMA 2XA7M 2VJWA 4E3NA 2UWXA 1OTIA 2QKPA 3UY6A 1MWUA 1ZHHB 3BEBA 5TBMA 5HX9A 1SKFA 1YLZA 5M1AA 4WZ5C 2OOLA 2WGWA 3FZCA 3LFVA 3IF5A 2ZC6B 4QB8A 3T4TA 3MSHA 3EEHA 3GR2A 3G30A 3B33A 1ES3A 1FIKA 3VOYA 4NK3A 1XXMA 3LR5A 4I39A 4OQHA 4X1MA 3RFBA 5HAQA 2QMIA 4IEDA 2ZL1B 3ZYTA 3OPLA 5AVEA 5F1FA 4YINA 5MC7A 3NOTC 2GDNA 1VEUB 1LI9A 5HWWA 5DF8A 3CITA 3AGFA 5GLCA 3UE1A 2H0TA 3ZG9B 1TS8A 4GDBA 3G4PA 1IKIA 3W8KA 3IQAA 2HP5A 4E3LA 4WYYA 4QHCA 3LI9A 3A0VA 1NLZA 3IF6C 2Y8HA 3IXBA 4LFUA 5FASA 4GS9B 3NIAA 3ISGA 1S1ZA 2PU4A 4EU0A 4OPRA 4YWZA 3KO6A 2EXBA 1HD8A 5IT5A 1PFLA 3F1PB 3IH9A 1K56A 4DJ3A 4JXSA 5HL6A 2IWDA 5L8MA 1L0GA 2VKSA 3N4IA 5A92A 4E3JA 1LL8A 3ZVWA 1S4SA 3TG9A 4GN2A 5DF9A 5E43A 5HPFA 4OPZA 2P08A 2P9VB 2R78A 3GDIA 1YQSA 3VP3A 3HJKA 1F5MA 3QHYA 2FFYA 3A0RA 4X25A 1XJ6A 1XGJA 3VFHA 1LLBA 4ETXA 1CK3A 4GJ4A 3MMHA 3QP1A 2HDUA 4HHDA 2GZAA 1YKDA 3UB6A 3HLWA 1ZG4A 4FTXA 1LSXA 5FQ9A 4O0PA 1W8QA 5EFWA 1XGIA 4WEKA 1JWVA 1I2SA 1MWSA 1JWPA 4GD8A 2Y2QA 4EUVA 4M3KA 1K55A 3MJQA 2J7VA 5FAOA 2PBYA 1XKZA 4HOIA 4O01A 4DF6A 3UPNA 4Y13A 2XH9A 4WLAA 4UQIS 2RCXA 3IBJA 2WADA 4JF6A 5HAPA 1BLCA 3MXSA 4U3TA 4X53A 2E8IA 5FQJA 2WAFA 3NC8A 3H9WA 1FILA 3UDIA 3G2ZA 1KGFA 4LV0A 3HCYA 3MQ0A 2CC1A 5DF7A 1Z6FA 4ZTKA 4XUZA 1AWIA 4GHIA 5CX7A 2JKTI 1FCNA 2VLGA 3E4PA 3D4FA 3Q1FA 1ODVA 3O5YA 4BQMA 3DTIA 4R70A 4GDNA 4ZJ3A 4KZ5A 1N9LA 3LEQA 4BWIA 1BUEA 1IELA 3MKFA 2VGJA 4IBRA 4F3LA 4P87A 4AFIA 4ETZA 4KQRA 3PR6A 4K91A 1N9NA 3T50A 4HQAA 4I38A 3RXWA 2R9XA 3GMWA 3T1RA 5DFYA 2JKGA 1NRJA 2ZM8A 4LPZA 3SS3A 1TDGA 5FI2A 3T4LA 1D7EA 5FEGA 4PAUA 3UPPA 2DNSA 4UAAA 2AVXA 3ZQ5A 1TEMA 1OJ5A 1LT0A 1I2WA 1BT5A 1DJBA 3HLGA 4GLQA 4S2PA 5DTTA 4CPKA 5AJGA 4N1HA 3NDGA 4HH3A 5JYOA 1NYYA 1Q2PA 4OONA 5DVAA 3EQVA 2WKHA 1H8YA 1W5DA 1LSVA 3VOZA 4DDSA 2HJEA 3W4QA 4X6TA 1LHYA 1K6RA 2XA7S 3M2KA 3MZEA 3UB8A 3TRCA 1MWTA 3E4QA 1DRMA 3JYIA 2ZOHA 1RGYA 5FQKA 4MLLA 3TJZC 5TFQA 4MBKA 4M4XA 4X69A 2PT7A 1VEUA 3BYDA 5FA7A 3EWKA 5HL1A 1XP4A 5JYPA 2W3HA 1GSXA 2XD5A 5K5BA 1H0MA 2V9AA 5A91A 5KMWA 1G28A 1K6SA 1RP5A 4K08A 1WA9A 1S0WA 3HUNA 3BRMA 1Q2QA 4BLMA 3PAEA 1JWZA 5J8XA 3GQZA 4NXGA 3EGXC 2ZOIA 1ZTUA 1NWZA 2HP6A 4GS9A 2KDKA 2OAP1 4EV4A 4QJGA 2VV6A 1SZVA 1ONGA 3RXXA 3QP8A 1P0ZA 2Y2IA 4DRTA 3IBRA 3QNCA 3T4JA 4Q8IA 3G2YA 2Y2KA 4OQ0A 4EQIA 5HWVA 4X1LA 3SZTA 1T18A 1PIOA 1PZOA 4EBNA 2OLVA 3UE0A 4H8RA 2X02A 4UEYA 4JF4A 4S2IA 3CUEA 2M7UA 3BM6A 3C4PA 4MN6A 4BMWA 3F1OB 3TSGA 2Z6DA 4L9EA 2VK3A 1T1AA 2PYRA 4MNRA 3UB9A 2DCFA 1S67L 1K57A 4C75A 5HDSA 2L4RA 1UGUA 2DRWA 3HUMA 4RA7A 3EOIA 1DP9A 1CEFA 3N8SA 2ZD8A 1IFQA 3U2AA 2HDRA 5GHXA 2WZXA 5EOOA 3WRTA 2Q9NA 3A3FA 3WS2A 3PBSA 4HH2A 1DY6A 1T1CA 3RJUA 2BASA 2XK1A 5F69A 5L10A 3O87A 4H6JB 2WKPA 3A0SA 2HF6A 2Y4AA 4DXCA 3KSGA 1K54A 3PBQA 4JGPA 1VM1A 3IF6B 4FOFA 1GA9A 3PBTA 2EWWA 4IUHA 3GSGA 3PBNA 3HREA 4GNUA 4HY8A 5AQ7A 2YKHA 1V9YA 2ZMVA 2H0YA 4ID4A 3BFFA 1W63Q 3NHQA 2A2LA 5DKKA 1GSWA 1YLYA 1AXBA 3CPTB 3KYZA 2HDQA 3WS4A 2J8YA 4KUKA 5M18A 1K25A 5J3WA 4RYEA 1FQGA 4WM9A 1UWPX 3KSFA 5EECA 2VA0A 4JPMA 5HAIA 3OLOA 2FZ0A 2KLIA 1XFQA 3MZFA 3CHWP 1DJCA 4C3QA 5AQ9A 5FI7A 1F2KA 3JVUA 2XD1A 2V8CA 4HJ3A 4WELA 2V1AA 3LYXA 3RH8B 3OPRA 1ERQA 3BECA 4S2NC 4BL2A 3G35A 2B02A 3W4PA 2EX8A 1M6KA 3B3XA 3F1NB 3HLFA 3PTEA 1IYQA 3IS2A 3WS5A 2B95A 4HP9A 2BG1A 3IX3A 5EVIA 2ZC4B 2ACGA 3KSHA 3DTEA 1KVLA 3EQUA 3S22A 4MDZA 2Y79A 3SH7A 1O7EA 4QWOA 1MWRA 4KZ9A 4N1XA 4CLCA 1XFNA 5FDHA 1E25A 3GRJA 3VP4A 2EFXA 1KDSA 1UWNX 3NCKA 3Q7VB 4KZ3A 4K0WA 2OLUA 2Y2MA 1MC0A 5EPHA 1XJ4A 1IOUA 3MS6A 1OTAA 4LLOB 4RVAA 3PHYA 5F83A 4ZDXA 1G68A 4MN5A 4KZBA 4ZBEA 1L0DA 2P74A 3GV9A 3KSIA 4YNRA 3DAVA 4S2JA 1VETB 3D9YA 5KZHA 4HI4A 3IH8A 4Y15A 4D2OA 3ULFA 3LIEA 1Z09A 4OKPA 4GD6A 4KG5A 3VP0A
chains in the Genus database with same CATH topology
4EUVA 4KQDA 3MJQA 3TE8A 4HOIA 3UB7A 5DJTA 4O01A 3KYQA 2XSSA 3LR4A 4DN0A 2KOIA 2V0UA 2XROA 3BY9A 4EEUA 2JKRI 2W3FA 4UQIS 4WLAA 3IBJA 2QYBA 2K2NA 3FC7A 4NXEA 3C38A 4BBVA 1P97A 3H7WB 3H9WA 3VOLA 4EETB 1NLYA 3H7WA 1STZA 2D01A 5DJUA 3G6OA 3HCYA 3MQ0A 1Y28A 5HPIA 1OTEA 2P7JA 3MF0A 3FG8A 4GHIA 5CX7A 2JKTI 2VLGA 3E4PA 1ODVA 3O5YA 2V1BA 4R70A 1GSVA 4FSFA 4I5SA 3C30A 4NKPA 1N9LA 1VHMA 4WEJA 1OJGA 1VB6A 4BWIA 4HIAA 3UMEA 5F5YA 1OPXA 4QPRA 2W1RA 3VE3A 4F3LB 4I3IA 4F3LA 2A24A 3P7NA 2VV7A 4CLCD 1H8MA 5HD5A 3LIDA 4AFIA 2B18A 4ETZA 3PR6A 1N9NA 3NOUC 3T50A 4HQAA 4I38A 5HD3A 4IUKA 2OWHA 3UE3A 5DFYA 3HJIA 2VGLS 1NRJA 4LPZA 2Z6CA 1BYWA 3T4LA 1D7EA 4ARZA 4Y3IA 4PAUA 3GECA 4MN7A 4L0LA 4B93A 3F1OA 3ZQ5A 3MQOA 4LRZE 4WL9A 4G3VA 4O8GA 3T4SA 5HZHA 1DP8A 1G6OA 1OJ5A 4BBUA 2O0YA 3C8CA 1LT0A 3EGDC 4OOMA 4Z1WA 3V67A 3MXQA 4RQ9A 4CLCE 3CWFA 2GX5A 2LB5A 1H3QA 4GLQA 3KX0X 2VV8A 3BJNA 1F9IA 2NUPC 4II7A 4UQIM 5AJGA 1XJ3A 2D02A 4HH3A 4CQHA 1OTBA 4Y2FA 4BBTA 3D3OA 2GJ3A 5I5LA 3BQ8A 1S66L 3MQQA 1TS6A 4PHTA 3EQVA 4Q0HA 1YSPA 3OC2A 4H6JA 4CLCC 2L0WA 1N9OA 3LUQA 5AVFA 1LSVA 1YSQA 2HJEA 2O9CA 3H82B 3H82A 4HJ4A 4LRYC 4I3JA 2G7UA 3D72A 2EWVA 5DFXA 3T4KA 2XA7S 1TS0A 1S1YA 1MKMA 5J7EA 3UB8A 3TRCA 3E4QA 1DRMA 2ZOHA 1LSWA 5F6AA 3LIAA 4Y5FA 3TJZC 4HNBA 2W3EA 3MFXA 2INWA 3T4QA 4WN5A 4M4XA 2PT7A 1P9RA 2J3WA 3EWKA 3BQAA 3R7WA 2W3HA 1GSXA 4PKYG 4DMZA 4EW7A 2PDRA 1OT9A 5K5BA 2V9AA 3PBRA 3S7QA 1G28A 5DKLA 4K08A 3SW1A 1WA9A 2QJ7A 4OOLA 2JHEA 4IJGA 4GHIB 4R3AA 4JGOA 2KX6A 4WUJA 3RTYA 2VGLM 1S4RA 4NXGA 3EGXC 1P9WA 2FH5A 3PBOA 2ZOIA 1ZTUA 1NWZA 4P6ZS 4EQ1A 4GS9A 2KDKA 2OAP1 2LB9A 4HJ6A 2PD7A 1X0OA 5J4EA 4XT2B 1KOUA 4KUOA 2K31A 2YKFA 4XT2A 2VV6A 3CI6A 2A24B 3E98A 4BJPA 4MCWA 4NXBA 1JNUA 1P0ZA 4R6LA 3IBRA 3T4JA 3LIBA 4LRXC 1DP6A 4L9FA 5HWVA 2O9AA 1T18A 3E4OA 3BY8A 4ME4A 2V0WA 4UEYA 4Q0IA 3CUEA 3NJAA 2W1TA 2M7UA 4ARZB 2DMWA 4MN6A 4BMWA 3F1OB 5G4YA 2NUTC 2PHYA 2Z6DA 2J3TD 4L9EA 1MZUA 4EEPA 1T1AA 2VX8A 2PYRA 2HV1A 3B42A 3UB9A 3NOPC 3BW6A 1S67L 4ZRRA 5HDSA 2L4RA 1UGUA 4G3WA 4E04A 3EOIA 1DP9A 4EXOA 3OCLA 2XA7M 2PR6A 4R38A 2VJWA 1IFQA 1OTIA 2QKPA 2PD8A 3U2AA 4HP4A 2W3DA 1ZHHB 5TBMB 2W0NA 5TBMA 2IA2A 3PBSA 1OT6A 3LIFA 2CMNA 4HH2A 1T1CA 2BASA 3E0YA 4DJ2A 2OOLA 5F69A 5F68A 3LFVA 4EESA 3R4KA 3T4TA 4H6JB 2WKPA 3A0SA 2HF6A 2WKRA 3EEHA 3KSGA 5LBRA 1XJ2A 3B33A 2H28A 3PBQA 4JGPA 4FOFA 2I9VA 4GW9A 3PBTA 3LICA 2EWWA 4IUHA 2VEAA 3LR3A 3PBNA 3PXPA 2OWJA 2JN7A 5G4ZA 3LR5A 4I39A 3RFBA 2M7VA 1OTDA 4HY8A 2YKHA 3ZYTA 1V9YA 2ZMVA 1EW0A 5AVEA 3C2WA 4P6ZM 3DBAA 3VV4A 5MC7A 2HGVA 1W63Q 3NOTC 4NXFA 2QHKA 5HDCA 3NHQA 2A2LA 2J3TC 5DKKA 3R7WB 5HWWA 1GSWA 4NEED 3FPWA 4Q0JA 3CITA 2M1CA 3UE6A 3LI8A 3KYZA 1TS8A 4KUKA 5J3WA 4MMNA 2J80A 5A8BA 1UWPX 3KSFA 3JVVA 1D06A 3UMDA 2VA0A 3LI9A 3A0VA 1NLZA 1TD5A 3OLOA 2FZ0A 2Y8HA 2KLIA 2ZBBA 4GS9B 3TW8A 3ICYA 2P04A 2MJ6A 1XFQA 1T19A 3B47A 1S1ZA 4PKYA 4EU0A 4YWZA 3KO6A 5KIZA 3JVUA 2PYPA 4HJ3A 5IS1A 4WELA 2V1AA 3LYXA 3RH8B 3CAXA 5FL3A 5IT5A 2B02A 3F1PB 3F1PA 4JGRA 1F98A 1TS7A 4DJ3A 5HL6A 3F1NB 5L8MA 3IS2B 3F1NA 2QWSA 2VKSA 3IS2A 4I3AA 4HP9A 1LL8A 2W1TB 4B9OA 1S4SA 4WF0A 3KSHA 1V9ZA 2PR5A 3EQUA 5DF9A 3W2ZA 4KQOA 4MDZA 3LR0A 2Y79A 5HPFA 2O9BA 3P01A 2W27A 2P08A 3K2NA 2R78A 4CLCB 4CLCA 1XFNA 5C5KA 2HJ9C 3GDIA 3S7NA 4JGQA 3BWLA 3HJKA 1F5MA 2QJ5A 1UWNX 3OOVA 3T4OA 2WKQA 3OBFA 2OAQ1 3A0RA 3VE4A 1MC0A 1XJ4A 1XJ6A 5TJJA 1IOUA 1W63M 2JKRM 1OTAA 2L1MA 4LLOB 3PHYA 2K7SA 4ETXA 3EEAA 4GJ4A 2O99A 5HWTA 3FPVA 4YOFA 5HSQA 5KSHA 3MMHA 3MR0A 4HHDA 2GZAA 4MN5A 5HDDA 4L9GA 2ZMFA 1YKDA 3S7PA 3UB6A 2XRNA 3CUEC 4GCZA 3KSIA 4IHQA 4YNRA 2EA9A 3CLOA 3S7OA 1T1BA 4EERA 3K3DA 1LSXA 1TF1A 2JKTM 2W3GA 4HI4A 2GNXA 2VZWA 4O0PA 4G3KA 3ULFA 3OCNA 5EFWA 5IU1A 3LIEA 4WEKA 1YAXA 3PYPA 3K3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKP A;  4CLC C;  4BMW A;  4CLC D;  2A2L A;  3FPV A;  5CX7 A;  4CLC B;  4CLC E;  4CLC A;  3FPW A; 
#chains in the Genus database with same CATH topology
 4X68 A;  1BTL A;  1YLJ A;  4FUW A;  3UPO A;  2XF3 A;  2JC7 A;  2XSS A;  2KOI A;  4K0X A;  2V0U A;  3AGD A;  4GB7 A;  4EEU A;  2JKR I;  2XLN A;  2QYB A;  2K2N A;  1LI0 A;  2H10 A;  3FC7 A;  3BLS A;  2ZC3 B;  4BBV A;  1P97 A;  4OLG A;  5DTK A;  3H7W B;  1G5U A;  3VOL A;  4X55 A;  5DJU A;  2WGI A;  3G6O A;  1Y28 A;  2WAE A;  5HPI A;  1OTE A;  1E4D A;  1U60 A;  3DTK A;  3SS4 A;  5AQA A;  3C30 A;  1VB6 A;  2J9P A;  1OPX A;  2W1R A;  4I3I A;  1KDW A;  5L09 A;  4JXW A;  1Y4O A;  1ERM A;  3UN7 A;  3LID A;  3BFG A;  4Y7P A;  2PRF A;  2B5R A;  2IWB A;  4GOG A;  2JE5 A;  1SKO A;  2ZQD A;  3NOU C;  3C5A A;  4WZ5 A;  5HD3 A;  4IUK A;  5BOH A;  2C6W B;  1WYB A;  1SDN A;  3UE3 A;  4OVD A;  1BYW A;  1I5Q A;  1NXY A;  4MN7 A;  3VP1 A;  4L0L A;  3F1O A;  4LRZ E;  3T1S A;  4WL9 A;  4O8G A;  3T4S A;  2A49 A;  1DJA A;  1N4O A;  1K0K A;  1G6O A;  2O0Y A;  3C8C A;  3EGD C;  3V67 A;  1ALQ A;  3CJM A;  3MXQ A;  4RQ9 A;  4CLC E;  1HTZ A;  1PW1 A;  3FWL A;  2LB5 A;  3KX0 X;  4R3B A;  3Q82 A;  4DKI A;  2ZJ9 A;  2H5S A;  3JPU A;  1OTB A;  4R23 A;  3V3R A;  4BBT A;  3S1Y A;  3LEZ A;  4PHT A;  1NZO A;  1YSP A;  2ZM0 A;  3Q07 A;  4H6J A;  2L0W A;  1N9O A;  3LUQ A;  4N9L A;  4OP8 A;  2XGN A;  3H82 A;  4I3J A;  3IF6 A;  2G7U A;  4E3I A;  1S1Y A;  1L0F A;  4LV1 A;  1PWC A;  3LIA A;  3MXR A;  4Y5F A;  3W4O A;  2INW A;  3MKE A;  1C3B A;  1ERO A;  3HBR A;  4RX3 A;  3L9K A;  4DMZ A;  1BLH A;  3U4L P;  3M6B A;  3CPT A;  5DKL A;  2Y55 A;  1FR1 A;  2Y2L A;  3SW1 A;  2QJ7 A;  3HLC A;  4OOL A;  3S4X A;  2E8J A;  4JGO A;  2IWC A;  4WMC D;  2JKF A;  5EE8 A;  2VGL M;  4A5R A;  3IHA A;  5EM0 A;  5L07 A;  4EQ1 A;  3KYE A;  5I94 A;  2LB9 A;  2WGV A;  5EOE A;  4XT2 B;  4KUO A;  3ZG5 A;  1JNU A;  4Y0U A;  4OH0 A;  4UA6 A;  1QMF A;  2XR0 A;  3ZG8 B;  2EFU A;  3OZH A;  1DP6 A;  1FSY A;  2O9A A;  4R4R A;  3LY4 A;  5FQI A;  1M40 A;  3BY8 A;  3ZHH A;  4ARZ B;  3NJA A;  2BTF P;  2Z2M B;  1K38 A;  2PHY A;  4E6X A;  3WRZ A;  2VX8 A;  3B42 A;  4LCL A;  2Y2P A;  4G3W A;  5GL9 A;  3UDF A;  3OCL A;  4S2L A;  4JXG A;  3TOI A;  2Y91 A;  5E2G A;  2PD8 A;  4HP4 A;  4CJN A;  4QU3 A;  4DE1 A;  3Q7V A;  5TBM B;  4UA7 A;  1PI5 A;  4MBH A;  2IA2 A;  3O3V A;  1KGG A;  3LIF A;  1QME A;  4C6Y A;  4D60 A;  4EES A;  3R4K A;  2Y2O A;  5GHY A;  2WKR A;  5LBR A;  4PM9 A;  1XJ2 A;  3HLB A;  2I9V A;  3LIC A;  2EX6 A;  2ZLY A;  5TR7 A;  3LR3 A;  3PXP A;  1PI4 A;  3NY4 A;  2JN7 A;  5CER A;  1YT4 A;  3N7W A;  1VET A;  2ZL1 A;  3LGO A;  4N92 A;  1H8Z A;  4EBL A;  2EX9 A;  4FCF A;  4OP5 A;  4NXF A;  2QHK A;  5HDC A;  1XA7 A;  4NEE D;  5FAT A;  4Q0J A;  2XQZ A;  3FYZ A;  2M1C A;  3UE6 A;  3QP5 A;  4R3J A;  3ZNY A;  4X56 A;  3QP6 A;  3IX8 A;  3CZD A;  5E2E A;  1NJ4 A;  3JVV A;  3UMD A;  4KG6 A;  2QPN A;  5CHJ A;  2ZBB A;  2ZC5 B;  2EX2 A;  3TW8 A;  3ICY A;  2MJ6 A;  1ES2 A;  3B47 A;  4OQI A;  5KIZ A;  2PYP A;  3V50 A;  5A93 A;  3BFE A;  2RL3 A;  3CAX A;  5FL3 A;  3PAG A;  1EWZ A;  3F1P A;  4JGR A;  1F98 A;  3C7V A;  2UV0 E;  1EI5 A;  1ES5 A;  2OV5 A;  4BEN A;  3C4O A;  2W1T B;  3IXD A;  2Q0O A;  1K4F A;  4YFM A;  1V9Z A;  2PR5 A;  3W2Z A;  4KQO A;  4KZA A;  3K2N A;  3FKV A;  1PYY A;  3C7U A;  3SOI A;  4KQQ A;  2PAV P;  2P9V A;  5C5K A;  2HJ9 C;  1KGE A;  3BWL A;  3A3E A;  2XDM A;  3OPH A;  5FEF A;  3T4O A;  2WKQ A;  3OBF A;  3VE4 A;  2L1M A;  2K7S A;  2OSU A;  2O99 A;  3FPV A;  5FDS A;  1XA1 A;  2ZQ9 A;  3MR0 A;  3CMZ A;  4L9G A;  4ZJ2 A;  3S7P A;  4S2M A;  2XRN A;  3HLE A;  4ZJ1 A;  4ESP A;  2EA9 A;  1ESU A;  1KE3 A;  4P85 A;  4EER A;  4E3M A;  3AGE A;  1RGZ A;  1TF1 A;  2JKT M;  2W3G A;  2GNX A;  2VZW A;  3UDX A;  4G3K A;  4LEN A;  4FH4 A;  1BLS A;  4PM5 A;  1YAX A;  3N6I A;  5CGX A;  5F1G A;  3P98 A;  1HZO A;  3PYP A;  5FI6 A;  4KQD A;  1FOF A;  5CED A;  3TE8 A;  5DJT A;  3KYQ A;  3LR4 A;  4DN0 A;  2XRO A;  3BY9 A;  4PMA A;  4KZ7 A;  2VGK A;  1NY0 A;  3IWI A;  4ZAM A;  3I7J A;  4FD8 A;  4E3O A;  4IBX A;  4NXE A;  3C38 A;  1K4E A;  4LV2 A;  1K56 D;  2Z2L B;  2HP9 A;  2ZQA A;  3G34 A;  3MF0 A;  3FG8 A;  5GLB A;  1PW8 A;  3NBL A;  5IHV A;  2WKE A;  4BD0 A;  3BLM A;  3MBZ A;  4PM7 A;  5GLD A;  3L7H A;  4WEJ A;  2JBF A;  1OJG A;  4HIA A;  2V1Z A;  1YMX A;  3UME A;  3WS1 A;  1JTD A;  2ZQ7 A;  4QPR A;  4DE2 A;  3VE3 A;  3IX4 A;  4F3L B;  2EXA A;  3P7N A;  2VV7 A;  2HPB A;  1YLT A;  2PBD P;  3O86 A;  2B18 A;  3V5M A;  5FAQ A;  1SHV A;  1E3U D;  2OWH A;  2Q9M A;  5CTM A;  3T1X A;  3HJI A;  2VGL S;  1WE4 A;  2Z6C A;  2ZM2 A;  4ARZ A;  3GTC A;  3NUL A;  4Y3I A;  1CEG A;  3GEC A;  3ZGA B;  1JVJ A;  3HL9 A;  3Q7Z A;  5HZH A;  3ZVT A;  3ZNT A;  4BBU A;  1BZA A;  4Z1W A;  4UHU A;  2GX5 A;  1J9M A;  3T1Q B;  3A3I A;  2VV8 A;  2NUP C;  4KEN B;  1GA0 A;  1XJ3 A;  4CQH A;  5GLA A;  5HAR A;  4JF5 A;  4OPY A;  2GJ3 A;  3BQ8 A;  1S66 L;  3MQQ A;  4Q0H A;  4QY5 A;  3M6H A;  1WYC A;  2BLS A;  3OC2 A;  4JLF A;  4DDY A;  2G2W A;  5AVF A;  1YSQ A;  3WS0 A;  2O9C A;  1IEM A;  4FH2 A;  3DWZ A;  4LRY C;  3NDE A;  1PRQ A;  2EWV A;  5DFX A;  1TS0 A;  4HBT A;  3CG5 A;  3IXG A;  1GHI A;  4IVI A;  1ZC2 A;  4IVK A;  4PM8 A;  4HNB A;  3MFX A;  3T4Q A;  1YM1 A;  3VMA A;  4S2N A;  4OPQ A;  5F82 A;  2WKI A;  1SDE A;  4PKY G;  3N8R A;  4EW7 A;  2PDR A;  1OT9 A;  3PBR A;  3S7Q A;  1IKG A;  1GHM A;  5CGW A;  4IJG A;  4R3A A;  3HLD A;  1L3L A;  1BSG A;  2KX6 A;  4WUJ A;  3IT9 A;  4KZ8 A;  5U47 A;  2WUQ A;  4HEF A;  4HBU A;  3PBO A;  1K55 C;  1NZU A;  4S2K A;  1X0O A;  5DTS A;  3SH9 A;  3ZG7 B;  2K31 A;  4B88 A;  2YKF A;  1OME A;  3CI6 A;  2A24 B;  4MCW A;  4NXB A;  4R6L A;  4DXB A;  2ZQ8 A;  1FR6 A;  3UNW A;  1BUL A;  1MKI A;  1KE0 A;  3E4O A;  4UA9 A;  1W79 A;  5EM1 A;  4ME4 A;  2V0W A;  3G32 A;  2W1T A;  3P09 A;  1H5X A;  2DMW A;  1HLU P;  4OLD A;  4RX2 A;  3QP2 A;  2NUT C;  5FAP A;  3ZFZ A;  1L0E A;  2J3T D;  3MZD A;  1PZP A;  1MZU A;  1LL5 A;  3BW6 A;  4ZRR A;  3ZDJ A;  3BFD A;  4OOY A;  2PR6 A;  4R38 A;  3A3D A;  2W3D A;  1E3U A;  2W0N A;  2R9W A;  1W7F A;  3NI9 A;  1OT6 A;  5CRF A;  2CMN A;  3E0Y A;  4DJ2 A;  1YMS A;  4WZ4 A;  5FQM A;  5F68 A;  2H28 A;  4GW9 A;  2VEA A;  2OWJ A;  5G4Z A;  1W8Y A;  2M7V A;  1GHP A;  1OTD A;  5TGF A;  1MBL A;  4S2O A;  1VQQ A;  1EW0 A;  5KSC A;  1CI8 A;  3C2W A;  4P6Z M;  3DBA A;  3VV4 A;  1G6A A;  2HGV A;  2PU2 A;  5CTN A;  2J3T C;  3R7W B;  3FPW A;  3LI8 A;  1CI9 A;  2A3U A;  4KZ6 A;  1FCO A;  1ZKJ A;  4MMN A;  2J80 A;  1PWD A;  1SCW A;  5G18 A;  4LGW A;  5A8B A;  5E2F A;  2QZ6 A;  1D06 A;  1TD5 A;  3VSL A;  3QP4 A;  2P04 A;  1T19 A;  4PKY A;  4DE0 A;  3UB5 P;  5IS1 A;  5HW3 A;  1PNE A;  5HFO A;  1JTG A;  4XXR A;  2Y2J A;  4Z9Q A;  1TS7 A;  5E2H A;  3IHB A;  3G31 A;  2JCH A;  3IS2 B;  3F1N A;  2QWS A;  2Y2H A;  4I3A A;  1NRF A;  5CXW A;  3QNB A;  5EVI B;  1Y54 A;  4B9O A;  4WF0 A;  3LR0 A;  2O9B A;  3P01 A;  2W27 A;  4KG2 A;  2ZMA A;  1N9B A;  4CLC B;  3S7N A;  4JGQ A;  2QJ5 A;  1TDL A;  3OOV A;  4MEZ A;  2OAQ 1;  1MXO A;  1S6R A;  1YPR A;  2V20 A;  5TJJ A;  4Y0O A;  4E6W A;  1W63 M;  2JKR M;  4DE3 A;  3EEA A;  5HWT A;  3GVB A;  2WGW B;  4YOF A;  5HSQ A;  5KSH A;  3LCE A;  5HDD A;  1KVM A;  2Y59 A;  3Q81 A;  2ZMF A;  3CUE C;  4GCZ A;  4IHQ A;  4R1G A;  3CLO A;  3S7O A;  4EUZ A;  1T1B A;  3IXH A;  3FKW A;  4OQG A;  3K3D A;  1K57 C;  3OCN A;  3LY3 A;  4XUX A;  5IU1 A;  1YLP A;  3K3C A;  4BL3 A;  3UB7 A;  2FFF B;  2W3F A;  4NG2 A;  5EV0 A;  2G2U A;  3IWO A;  1K54 C;  4R0Q A;  4GZB A;  4QY6 A;  4EET B;  1NLY A;  3H7W A;  4N9K A;  1STZ A;  2D01 A;  2WYX A;  3V3S A;  5A90 A;  3V39 A;  2P7J A;  1GCE A;  3IWQ A;  1FCM A;  4PPR A;  1RCJ A;  2V1B A;  4PM6 A;  1GSV A;  1O07 A;  4FSF A;  4I5S A;  3VFF A;  5EVI D;  4NKP A;  3SS5 A;  1VHM A;  1BLP A;  1KE4 A;  1ONH A;  5F5Y A;  4E3K A;  5CHM A;  4WMC A;  4F94 A;  3DTM A;  4Y17 A;  1MY8 A;  1LL9 A;  2A24 A;  1CJF A;  1HVB A;  2C5W B;  4CLC D;  1H8M A;  5HD5 A;  2J9O A;  1SKO B;  5L2F A;  4U0X A;  2HZ5 A;  2WZZ A;  1YLW A;  4QD4 A;  2WK0 A;  4O7D A;  4B93 A;  5AQB A;  3MQO A;  4G3V A;  3UO9 A;  1CF0 A;  1MPL A;  1DP8 A;  3LO7 A;  3VSK A;  4LCM A;  4OOM A;  4EBP A;  5FSR A;  5CEC A;  3CWF A;  1H3Q A;  1XPB A;  3BJN A;  1F9I A;  4II7 A;  4UQI M;  5EVI C;  1ES4 A;  4Y0T A;  2D02 A;  4HES A;  4Y2F A;  3D3O A;  5I5L A;  1TS6 A;  4CLC C;  3OPP A;  3HVF A;  3DW0 A;  4P0M A;  3H82 B;  4GKU A;  4HJ4 A;  2ZC7 A;  4JBF A;  1L2S A;  3D72 A;  3T4K A;  1MKM A;  2HDS A;  5J7E A;  4B4Z A;  1LSW A;  5F6A A;  3ZG0 A;  2W3E A;  1ACF A;  1D1J A;  5CGS A;  4WN5 A;  3DWK A;  5GHZ A;  1P9R A;  2J3W A;  3BQA A;  3R7W A;  4JXV A;  3MFD A;  3HUO A;  1FSW A;  1PWG A;  4B4X A;  1J3W A;  3E2L A;  2I72 A;  4WBG A;  5EVL A;  3E2K A;  4JKT A;  1IYS A;  2JHE A;  4GHI B;  3NEC A;  4NET A;  4P6B A;  4MBF A;  3A3J A;  3RTY A;  1S4R A;  2Y2G A;  1P9W A;  2FH5 A;  4BD1 A;  4P6Z S;  2Y2N A;  3FV7 A;  4HJ6 A;  4U0T A;  4KZ4 A;  2PD7 A;  2XFT A;  5J4E A;  1KOU A;  1ZG6 A;  4XT2 A;  2V2F F;  1CQA A;  3E98 A;  4BJP A;  2XEP A;  3T12 B;  5FQQ A;  1XX2 A;  4LV3 A;  3M2J A;  3N8L A;  3LIB A;  5EVE A;  4LRX C;  5D3O A;  5M19 A;  4L9F A;  5CHU A;  3O88 A;  5EUA A;  3VP2 A;  3SH8 A;  3BFC A;  2X71 A;  1A0K A;  1TVF A;  2ZQC A;  4Q0I A;  1IYO A;  4EWF A;  5CEB A;  3ITB A;  5G4Y A;  1IYP A;  2X01 A;  3WWX A;  4EEP A;  2HV1 A;  3ITA A;  3NOP C;  4R4S A;  2V8F A;  2XFS A;  4E04 A;  1ESI A;  3ZCZ A;  4EXO A;  1NYM A;  2XA7 M;  2VJW A;  4E3N A;  2UWX A;  1OTI A;  2QKP A;  3UY6 A;  1MWU A;  1ZHH B;  3BEB A;  5TBM A;  5HX9 A;  1SKF A;  1YLZ A;  5M1A A;  4WZ5 C;  2OOL A;  2WGW A;  3FZC A;  3LFV A;  3IF5 A;  2ZC6 B;  4QB8 A;  3T4T A;  3MSH A;  3EEH A;  3GR2 A;  3G30 A;  3B33 A;  1ES3 A;  1FIK A;  3VOY A;  4NK3 A;  1XXM A;  3LR5 A;  4I39 A;  4OQH A;  4X1M A;  3RFB A;  5HAQ A;  2QMI A;  4IED A;  2ZL1 B;  3ZYT A;  3OPL A;  5AVE A;  5F1F A;  4YIN A;  5MC7 A;  3NOT C;  2GDN A;  1VEU B;  1LI9 A;  5HWW A;  5DF8 A;  3CIT A;  3AGF A;  5GLC A;  3UE1 A;  2H0T A;  3ZG9 B;  1TS8 A;  4GDB A;  3G4P A;  1IKI A;  3W8K A;  3IQA A;  2HP5 A;  4E3L A;  4WYY A;  4QHC A;  3LI9 A;  3A0V A;  1NLZ A;  3IF6 C;  2Y8H A;  3IXB A;  4LFU A;  5FAS A;  4GS9 B;  3NIA A;  3ISG A;  1S1Z A;  2PU4 A;  4EU0 A;  4OPR A;  4YWZ A;  3KO6 A;  2EXB A;  1HD8 A;  5IT5 A;  1PFL A;  3F1P B;  3IH9 A;  1K56 A;  4DJ3 A;  4JXS A;  5HL6 A;  2IWD A;  5L8M A;  1L0G A;  2VKS A;  3N4I A;  5A92 A;  4E3J A;  1LL8 A;  3ZVW A;  1S4S A;  3TG9 A;  4GN2 A;  5DF9 A;  5E43 A;  5HPF A;  4OPZ A;  2P08 A;  2P9V B;  2R78 A;  3GDI A;  1YQS A;  3VP3 A;  3HJK A;  1F5M A;  3QHY A;  2FFY A;  3A0R A;  4X25 A;  1XJ6 A;  1XGJ A;  3VFH A;  1LLB A;  4ETX A;  1CK3 A;  4GJ4 A;  3MMH A;  3QP1 A;  2HDU A;  4HHD A;  2GZA A;  1YKD A;  3UB6 A;  3HLW A;  1ZG4 A;  4FTX A;  1LSX A;  5FQ9 A;  4O0P A;  1W8Q A;  5EFW A;  1XGI A;  4WEK A;  1JWV A;  1I2S A;  1MWS A;  1JWP A;  4GD8 A;  2Y2Q A;  4EUV A;  4M3K A;  1K55 A;  3MJQ A;  2J7V A;  5FAO A;  2PBY A;  1XKZ A;  4HOI A;  4O01 A;  4DF6 A;  3UPN A;  4Y13 A;  2XH9 A;  4WLA A;  4UQI S;  2RCX A;  3IBJ A;  2WAD A;  4JF6 A;  5HAP A;  1BLC A;  3MXS A;  4U3T A;  4X53 A;  2E8I A;  5FQJ A;  2WAF A;  3NC8 A;  3H9W A;  1FIL A;  3UDI A;  3G2Z A;  1KGF A;  4LV0 A;  3HCY A;  3MQ0 A;  2CC1 A;  5DF7 A;  1Z6F A;  4ZTK A;  4XUZ A;  1AWI A;  4GHI A;  5CX7 A;  2JKT I;  1FCN A;  2VLG A;  3E4P A;  3D4F A;  3Q1F A;  1ODV A;  3O5Y A;  4BQM A;  3DTI A;  4R70 A;  4GDN A;  4ZJ3 A;  4KZ5 A;  1N9L A;  3LEQ A;  4BWI A;  1BUE A;  1IEL A;  3MKF A;  2VGJ A;  4IBR A;  4F3L A;  4P87 A;  4AFI A;  4ETZ A;  4KQR A;  3PR6 A;  4K91 A;  1N9N A;  3T50 A;  4HQA A;  4I38 A;  3RXW A;  2R9X A;  3GMW A;  3T1R A;  5DFY A;  2JKG A;  1NRJ A;  2ZM8 A;  4LPZ A;  3SS3 A;  1TDG A;  5FI2 A;  3T4L A;  1D7E A;  5FEG A;  4PAU A;  3UPP A;  2DNS A;  4UAA A;  2AVX A;  3ZQ5 A;  1TEM A;  1OJ5 A;  1LT0 A;  1I2W A;  1BT5 A;  1DJB A;  3HLG A;  4GLQ A;  4S2P A;  5DTT A;  4CPK A;  5AJG A;  4N1H A;  3NDG A;  4HH3 A;  5JYO A;  1NYY A;  1Q2P A;  4OON A;  5DVA A;  3EQV A;  2WKH A;  1H8Y A;  1W5D A;  1LSV A;  3VOZ A;  4DDS A;  2HJE A;  3W4Q A;  4X6T A;  1LHY A;  1K6R A;  2XA7 S;  3M2K A;  3MZE A;  3UB8 A;  3TRC A;  1MWT A;  3E4Q A;  1DRM A;  3JYI A;  2ZOH A;  1RGY A;  5FQK A;  4MLL A;  3TJZ C;  5TFQ A;  4MBK A;  4M4X A;  4X69 A;  2PT7 A;  1VEU A;  3BYD A;  5FA7 A;  3EWK A;  5HL1 A;  1XP4 A;  5JYP A;  2W3H A;  1GSX A;  2XD5 A;  5K5B A;  1H0M A;  2V9A A;  5A91 A;  5KMW A;  1G28 A;  1K6S A;  1RP5 A;  4K08 A;  1WA9 A;  1S0W A;  3HUN A;  3BRM A;  1Q2Q A;  4BLM A;  3PAE A;  1JWZ A;  5J8X A;  3GQZ A;  4NXG A;  3EGX C;  2ZOI A;  1ZTU A;  1NWZ A;  2HP6 A;  4GS9 A;  2KDK A;  2OAP 1;  4EV4 A;  4QJG A;  2VV6 A;  1SZV A;  1ONG A;  3RXX A;  3QP8 A;  1P0Z A;  2Y2I A;  4DRT A;  3IBR A;  3QNC A;  3T4J A;  4Q8I A;  3G2Y A;  2Y2K A;  4OQ0 A;  4EQI A;  5HWV A;  4X1L A;  3SZT A;  1T18 A;  1PIO A;  1PZO A;  4EBN A;  2OLV A;  3UE0 A;  4H8R A;  2X02 A;  4UEY A;  4JF4 A;  4S2I A;  3CUE A;  2M7U A;  3BM6 A;  3C4P A;  4MN6 A;  4BMW A;  3F1O B;  3TSG A;  2Z6D A;  4L9E A;  2VK3 A;  1T1A A;  2PYR A;  4MNR A;  3UB9 A;  2DCF A;  1S67 L;  1K57 A;  4C75 A;  5HDS A;  2L4R A;  1UGU A;  2DRW A;  3HUM A;  4RA7 A;  3EOI A;  1DP9 A;  1CEF A;  3N8S A;  2ZD8 A;  1IFQ A;  3U2A A;  2HDR A;  5GHX A;  2WZX A;  5EOO A;  3WRT A;  2Q9N A;  3A3F A;  3WS2 A;  3PBS A;  4HH2 A;  1DY6 A;  1T1C A;  3RJU A;  2BAS A;  2XK1 A;  5F69 A;  5L10 A;  3O87 A;  4H6J B;  2WKP A;  3A0S A;  2HF6 A;  2Y4A A;  4DXC A;  3KSG A;  1K54 A;  3PBQ A;  4JGP A;  1VM1 A;  3IF6 B;  4FOF A;  1GA9 A;  3PBT A;  2EWW A;  4IUH A;  3GSG A;  3PBN A;  3HRE A;  4GNU A;  4HY8 A;  5AQ7 A;  2YKH A;  1V9Y A;  2ZMV A;  2H0Y A;  4ID4 A;  3BFF A;  1W63 Q;  3NHQ A;  2A2L A;  5DKK A;  1GSW A;  1YLY A;  1AXB A;  3CPT B;  3KYZ A;  2HDQ A;  3WS4 A;  2J8Y A;  4KUK A;  5M18 A;  1K25 A;  5J3W A;  4RYE A;  1FQG A;  4WM9 A;  1UWP X;  3KSF A;  5EEC A;  2VA0 A;  4JPM A;  5HAI A;  3OLO A;  2FZ0 A;  2KLI A;  1XFQ A;  3MZF A;  3CHW P;  1DJC A;  4C3Q A;  5AQ9 A;  5FI7 A;  1F2K A;  3JVU A;  2XD1 A;  2V8C A;  4HJ3 A;  4WEL A;  2V1A A;  3LYX A;  3RH8 B;  3OPR A;  1ERQ A;  3BEC A;  4S2N C;  4BL2 A;  3G35 A;  2B02 A;  3W4P A;  2EX8 A;  1M6K A;  3B3X A;  3F1N B;  3HLF A;  3PTE A;  1IYQ A;  3IS2 A;  3WS5 A;  2B95 A;  4HP9 A;  2BG1 A;  3IX3 A;  5EVI A;  2ZC4 B;  2ACG A;  3KSH A;  3DTE A;  1KVL A;  3EQU A;  3S22 A;  4MDZ A;  2Y79 A;  3SH7 A;  1O7E A;  4QWO A;  1MWR A;  4KZ9 A;  4N1X A;  4CLC A;  1XFN A;  5FDH A;  1E25 A;  3GRJ A;  3VP4 A;  2EFX A;  1KDS A;  1UWN X;  3NCK A;  3Q7V B;  4KZ3 A;  4K0W A;  2OLU A;  2Y2M A;  1MC0 A;  5EPH A;  1XJ4 A;  1IOU A;  3MS6 A;  1OTA A;  4LLO B;  4RVA A;  3PHY A;  5F83 A;  4ZDX A;  1G68 A;  4MN5 A;  4KZB A;  4ZBE A;  1L0D A;  2P74 A;  3GV9 A;  3KSI A;  4YNR A;  3DAV A;  4S2J A;  1VET B;  3D9Y A;  5KZH A;  4HI4 A;  3IH8 A;  4Y15 A;  4D2O A;  3ULF A;  3LIE A;  1Z09 A;  4OKP A;  4GD6 A;  4KG5 A;  3VP0 A; 
#chains in the Genus database with same CATH homology
 4EUV A;  4KQD A;  3MJQ A;  3TE8 A;  4HOI A;  3UB7 A;  5DJT A;  4O01 A;  3KYQ A;  2XSS A;  3LR4 A;  4DN0 A;  2KOI A;  2V0U A;  2XRO A;  3BY9 A;  4EEU A;  2JKR I;  2W3F A;  4UQI S;  4WLA A;  3IBJ A;  2QYB A;  2K2N A;  3FC7 A;  4NXE A;  3C38 A;  4BBV A;  1P97 A;  3H7W B;  3H9W A;  3VOL A;  4EET B;  1NLY A;  3H7W A;  1STZ A;  2D01 A;  5DJU A;  3G6O A;  3HCY A;  3MQ0 A;  1Y28 A;  5HPI A;  1OTE A;  2P7J A;  3MF0 A;  3FG8 A;  4GHI A;  5CX7 A;  2JKT I;  2VLG A;  3E4P A;  1ODV A;  3O5Y A;  2V1B A;  4R70 A;  1GSV A;  4FSF A;  4I5S A;  3C30 A;  4NKP A;  1N9L A;  1VHM A;  4WEJ A;  1OJG A;  1VB6 A;  4BWI A;  4HIA A;  3UME A;  5F5Y A;  1OPX A;  4QPR A;  2W1R A;  3VE3 A;  4F3L B;  4I3I A;  4F3L A;  2A24 A;  3P7N A;  2VV7 A;  4CLC D;  1H8M A;  5HD5 A;  3LID A;  4AFI A;  2B18 A;  4ETZ A;  3PR6 A;  1N9N A;  3NOU C;  3T50 A;  4HQA A;  4I38 A;  5HD3 A;  4IUK A;  2OWH A;  3UE3 A;  5DFY A;  3HJI A;  2VGL S;  1NRJ A;  4LPZ A;  2Z6C A;  1BYW A;  3T4L A;  1D7E A;  4ARZ A;  4Y3I A;  4PAU A;  3GEC A;  4MN7 A;  4L0L A;  4B93 A;  3F1O A;  3ZQ5 A;  3MQO A;  4LRZ E;  4WL9 A;  4G3V A;  4O8G A;  3T4S A;  5HZH A;  1DP8 A;  1G6O A;  1OJ5 A;  4BBU A;  2O0Y A;  3C8C A;  1LT0 A;  3EGD C;  4OOM A;  4Z1W A;  3V67 A;  3MXQ A;  4RQ9 A;  4CLC E;  3CWF A;  2GX5 A;  2LB5 A;  1H3Q A;  4GLQ A;  3KX0 X;  2VV8 A;  3BJN A;  1F9I A;  2NUP C;  4II7 A;  4UQI M;  5AJG A;  1XJ3 A;  2D02 A;  4HH3 A;  4CQH A;  1OTB A;  4Y2F A;  4BBT A;  3D3O A;  2GJ3 A;  5I5L A;  3BQ8 A;  1S66 L;  3MQQ A;  1TS6 A;  4PHT A;  3EQV A;  4Q0H A;  1YSP A;  3OC2 A;  4H6J A;  4CLC C;  2L0W A;  1N9O A;  3LUQ A;  5AVF A;  1LSV A;  1YSQ A;  2HJE A;  2O9C A;  3H82 B;  3H82 A;  4HJ4 A;  4LRY C;  4I3J A;  2G7U A;  3D72 A;  2EWV A;  5DFX A;  3T4K A;  2XA7 S;  1TS0 A;  1S1Y A;  1MKM A;  5J7E A;  3UB8 A;  3TRC A;  3E4Q A;  1DRM A;  2ZOH A;  1LSW A;  5F6A A;  3LIA A;  4Y5F A;  3TJZ C;  4HNB A;  2W3E A;  3MFX A;  2INW A;  3T4Q A;  4WN5 A;  4M4X A;  2PT7 A;  1P9R A;  2J3W A;  3EWK A;  3BQA A;  3R7W A;  2W3H A;  1GSX A;  4PKY G;  4DMZ A;  4EW7 A;  2PDR A;  1OT9 A;  5K5B A;  2V9A A;  3PBR A;  3S7Q A;  1G28 A;  5DKL A;  4K08 A;  3SW1 A;  1WA9 A;  2QJ7 A;  4OOL A;  2JHE A;  4IJG A;  4GHI B;  4R3A A;  4JGO A;  2KX6 A;  4WUJ A;  3RTY A;  2VGL M;  1S4R A;  4NXG A;  3EGX C;  1P9W A;  2FH5 A;  3PBO A;  2ZOI A;  1ZTU A;  1NWZ A;  4P6Z S;  4EQ1 A;  4GS9 A;  2KDK A;  2OAP 1;  2LB9 A;  4HJ6 A;  2PD7 A;  1X0O A;  5J4E A;  4XT2 B;  1KOU A;  4KUO A;  2K31 A;  2YKF A;  4XT2 A;  2VV6 A;  3CI6 A;  2A24 B;  3E98 A;  4BJP A;  4MCW A;  4NXB A;  1JNU A;  1P0Z A;  4R6L A;  3IBR A;  3T4J A;  3LIB A;  4LRX C;  1DP6 A;  4L9F A;  5HWV A;  2O9A A;  1T18 A;  3E4O A;  3BY8 A;  4ME4 A;  2V0W A;  4UEY A;  4Q0I A;  3CUE A;  3NJA A;  2W1T A;  2M7U A;  4ARZ B;  2DMW A;  4MN6 A;  4BMW A;  3F1O B;  5G4Y A;  2NUT C;  2PHY A;  2Z6D A;  2J3T D;  4L9E A;  1MZU A;  4EEP A;  1T1A A;  2VX8 A;  2PYR A;  2HV1 A;  3B42 A;  3UB9 A;  3NOP C;  3BW6 A;  1S67 L;  4ZRR A;  5HDS A;  2L4R A;  1UGU A;  4G3W A;  4E04 A;  3EOI A;  1DP9 A;  4EXO A;  3OCL A;  2XA7 M;  2PR6 A;  4R38 A;  2VJW A;  1IFQ A;  1OTI A;  2QKP A;  2PD8 A;  3U2A A;  4HP4 A;  2W3D A;  1ZHH B;  5TBM B;  2W0N A;  5TBM A;  2IA2 A;  3PBS A;  1OT6 A;  3LIF A;  2CMN A;  4HH2 A;  1T1C A;  2BAS A;  3E0Y A;  4DJ2 A;  2OOL A;  5F69 A;  5F68 A;  3LFV A;  4EES A;  3R4K A;  3T4T A;  4H6J B;  2WKP A;  3A0S A;  2HF6 A;  2WKR A;  3EEH A;  3KSG A;  5LBR A;  1XJ2 A;  3B33 A;  2H28 A;  3PBQ A;  4JGP A;  4FOF A;  2I9V A;  4GW9 A;  3PBT A;  3LIC A;  2EWW A;  4IUH A;  2VEA A;  3LR3 A;  3PBN A;  3PXP A;  2OWJ A;  2JN7 A;  5G4Z A;  3LR5 A;  4I39 A;  3RFB A;  2M7V A;  1OTD A;  4HY8 A;  2YKH A;  3ZYT A;  1V9Y A;  2ZMV A;  1EW0 A;  5AVE A;  3C2W A;  4P6Z M;  3DBA A;  3VV4 A;  5MC7 A;  2HGV A;  1W63 Q;  3NOT C;  4NXF A;  2QHK A;  5HDC A;  3NHQ A;  2A2L A;  2J3T C;  5DKK A;  3R7W B;  5HWW A;  1GSW A;  4NEE D;  3FPW A;  4Q0J A;  3CIT A;  2M1C A;  3UE6 A;  3LI8 A;  3KYZ A;  1TS8 A;  4KUK A;  5J3W A;  4MMN A;  2J80 A;  5A8B A;  1UWP X;  3KSF A;  3JVV A;  1D06 A;  3UMD A;  2VA0 A;  3LI9 A;  3A0V A;  1NLZ A;  1TD5 A;  3OLO A;  2FZ0 A;  2Y8H A;  2KLI A;  2ZBB A;  4GS9 B;  3TW8 A;  3ICY A;  2P04 A;  2MJ6 A;  1XFQ A;  1T19 A;  3B47 A;  1S1Z A;  4PKY A;  4EU0 A;  4YWZ A;  3KO6 A;  5KIZ A;  3JVU A;  2PYP A;  4HJ3 A;  5IS1 A;  4WEL A;  2V1A A;  3LYX A;  3RH8 B;  3CAX A;  5FL3 A;  5IT5 A;  2B02 A;  3F1P B;  3F1P A;  4JGR A;  1F98 A;  1TS7 A;  4DJ3 A;  5HL6 A;  3F1N B;  5L8M A;  3IS2 B;  3F1N A;  2QWS A;  2VKS A;  3IS2 A;  4I3A A;  4HP9 A;  1LL8 A;  2W1T B;  4B9O A;  1S4S A;  4WF0 A;  3KSH A;  1V9Z A;  2PR5 A;  3EQU A;  5DF9 A;  3W2Z A;  4KQO A;  4MDZ A;  3LR0 A;  2Y79 A;  5HPF A;  2O9B A;  3P01 A;  2W27 A;  2P08 A;  3K2N A;  2R78 A;  4CLC B;  4CLC A;  1XFN A;  5C5K A;  2HJ9 C;  3GDI A;  3S7N A;  4JGQ A;  3BWL A;  3HJK A;  1F5M A;  2QJ5 A;  1UWN X;  3OOV A;  3T4O A;  2WKQ A;  3OBF A;  2OAQ 1;  3A0R A;  3VE4 A;  1MC0 A;  1XJ4 A;  1XJ6 A;  5TJJ A;  1IOU A;  1W63 M;  2JKR M;  1OTA A;  2L1M A;  4LLO B;  3PHY A;  2K7S A;  4ETX A;  3EEA A;  4GJ4 A;  2O99 A;  5HWT A;  3FPV A;  4YOF A;  5HSQ A;  5KSH A;  3MMH A;  3MR0 A;  4HHD A;  2GZA A;  4MN5 A;  5HDD A;  4L9G A;  2ZMF A;  1YKD A;  3S7P A;  3UB6 A;  2XRN A;  3CUE C;  4GCZ A;  3KSI A;  4IHQ A;  4YNR A;  2EA9 A;  3CLO A;  3S7O A;  1T1B A;  4EER A;  3K3D A;  1LSX A;  1TF1 A;  2JKT M;  2W3G A;  4HI4 A;  2GNX A;  2VZW A;  4O0P A;  4G3K A;  3ULF A;  3OCN A;  5EFW A;  5IU1 A;  3LIE A;  4WEK A;  1YAX A;  3PYP A;  3K3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...