2A2LA

Crystal structure of klebsiella pneumoniae protein orfy, pfam duf336
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
SLMNKSQQVQTITLAAAQQMAAAVEKKATEINVAVVFSVVDRGGNTLLIQRMDEAFVSSCDISLNKAWSACSLKQGTHEITSAVQPGQSLYGLQLTNQQRIIIFGGGLPVIFNEQVIGAVGVSGGTVEQDQLLAQCALDCFSALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown
publication title Crystal Structure of Klebsiella Pneumoniae Hypothetical Protein Orfy
rcsb
source organism Klebsiella pneumoniae
molecule tags Structural genomics, unknown function
total genus 41
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2a2lA00
3FPVA 4BMWA 4CLCD 5CX7A 4CLCE 4CLCB 3FPWA 4NKPA 4CLCA 2A2LA 4CLCC
chains in the Genus database with same CATH superfamily
1CQAA 3Q81A 1CEFA 3MXSA 5EOEA 4YOFA 3UDXA 1KDSA 4Q0IA 2WGIA 1L3LA 1ONHA 1HVBA 4WEJA 3CUEA 3MZDA 3T4SA 3T4KA 4UAAA 2W27A 5HWVA 4BBUA 2X02A 5HARA 4RYEA 1S4RA 3LIFA 2J3WA 3LR0A 3UE0A 3A3IA 4IHQA 4JXVA 5FDSA 5G18A 2Z2MB 4JGPA 3TW8A 1W63Q 3UO9A 4WUJA 1FR1A 3M6HA 4UA7A 1TD5A 3QP5A 5GLCA 4DE2A 3H7WA 2YKHA 3DWKA 2UV0E 3O3VA 3T1QB 4IUKA 2JC7A 4X1MA 2V1AA 2WZXA 1Y54A 3WWXA 1GSWA 1GCEA 3LO7A 4D2OA 4B88A 3MKEA 3TG9A 4ARZA 4I3AA 1GA9A 5JYOA 1N9LA 4S2LA 1SKOB 5EM1A 2NUTC 1KGFA 2W3HA 3PBNA 4FTXA 1IYQA 5HAPA 4ZRRA 1BULA 5AQ9A 4BL3A 2ZJ9A 3LIBA 4BMWA 3NOTC 1JVJA 1DJBA 1P97A 3OPHA 3P09A 3UE1A 5F5YA 1JTDA 4KG5A 2HZ5A 4R3AA 4FH2A 1VB6A 3IHBA 4PM5A 3OCLA 3HUOA 3BQAA 2RL3A 3HCYA 3OLOA 3VP1A 2I72A 1MC0A 1JWZA 5KSHA 3CG5A 4HOIA 4GS9B 3IT9A 1PW8A 2VEAA 1ESUA 2P74A 1K56D 4JXWA 1SZVA 3K2NA 3EOIA 5HDDA 4Y7PA 4JGRA 2C5WB 2H0YA 3ZDJA 4JGQA 3JVVA 1YT4A 3CWFA 1H3QA 4P6ZS 2P9VB 5IU1A 1G6OA 1OT9A 3BM6A 3BYDA 3DTKA 3A3JA 1ERQA 2R78A 4PM9A 4EUZA 2J9OA 1PZOA 3KO6A 2FFYA 4L9FA 2IWDA 3LI9A 3F1NB 4OPYA 5EVEA 3U4LP 5FQIA 4R4RA 4WM9A 2K7SA 2Y2MA 1RP5A 3R7WA 3SZTA 1DJAA 3CJMA 2XH9A 1TDGA 2JKGA 5HWWA 4O0PA 1PZPA 4WZ4A 4BENA 4UQIS 3BLSA 1NRFA 4C75A 4U0TA 3UB6A 1IOUA 2C6WB 3FC7A 2ZOIA 1WYCA 4EBPA 3BQ8A 3SH8A 3CLOA 2QJ5A 2PR5A 4YNRA 3DW0A 4FH4A 2XD5A 2ZL1B 1H5XA 5L8MA 3Q7VB 1FILA 1VQQA 1SDNA 2Y55A 4QB8A 4JKTA 4HIAA 2W3GA 4H6JB 4EW7A 2PHYA 4X25A 2ZMFA 1S1ZA 4RX2A 1YLJA 4S2NA 4R4SA 5CECA 4EBNA 2ZQ7A 4N92A 3VE4A 3FWLA 2VJWA 4RQ9A 1YMXA 3DWZA 4WEKA 2QYBA 3BFFA 4QPRA 3RXXA 2V20A 2XA7S 4KZ4A 3NULA 3PXPA 5L2FA 3HVFA 2H28A 1P0ZA 2V9AA 1K25A 3T4LA 4HJ6A 5F82A 4JF5A 3OPLA 5KIZA 3EEHA 4E3JA 1MY8A 4C3QA 4X6TA 3BFEA 5EFWA 5GHYA 1L0GA 3GRJA 4NG2A 1TS0A 1YLYA 4OP8A 4RX3A 5TBMB 4ID4A 3AGDA 1YLZA 1PI5A 3DBAA 5EVIA 3F1PA 3GECA 4YINA 4P0MA 2HP5A 2PBDP 4S2MA 3SW1A 4GD8A 4HEFA 4RVAA 3A3EA 2KLIA 1BLSA 5F6AA 4EBLA 2YKFA 1CEGA 3M2KA 3LR4A 1W7FA 1W5DA 5A90A 5JYPA 5E2EA 1A0KA 4KZ7A 1YSPA 2Y2IA 1TVFA 3MFDA 2CC1A 3GQZA 3HLCA 3K3CA 1E3UA 4G3KA 3D4FA 2ZQAA 3E4QA 1TEMA 4WMCD 4OPRA 1NLZA 1WA9A 5CHUA 2P04A 3D72A 3T1XA 5FEFA 4DN0A 4Q0HA 1OMEA 4DF6A 3ZVTA 3EQUA 2WZZA 4GN2A 2PU4A 1ONGA 3UMEA 1VETA 4P6ZM 3UDFA 4B9OA 3FG8A 1S6RA 2W1RA 1LHYA 5HW3A 2ZLYA 1DRMA 3IS2B 1OTDA 2XQZA 4QWOA 4X68A 4BD1A 1W8QA 5KSCA 2A2LA 2AVXA 2Y91A 1P9RA 4GB7A 2HJEA 1MWRA 2EFUA 4JBFA 4S2KA 2WYXA 4FSFA 3ZG9B 2B5RA 4OP5A 3W8KA 3GMWA 2VV8A 1XA1A 1ES4A 2PD7A 4UQIM 3B42A 2B02A 4F3LB 2B18A 4LV1A 3WS2A 4EEUA 3C7VA 1K55A 4ZJ2A 3RTYA 5F69A 2JKRI 3JYIA 4KQRA 1MKMA 3PBTA 4R0QA 1BLCA 1PIOA 4LLOB 4Y3IA 2XRNA 2XK1A 3GV9A 3OZHA 4QJGA 3NI9A 1IYPA 1OTBA 4R3BA 4MN6A 1KVLA 5HD3A 4I39A 4KQDA 5TGFA 1FCOA 3QP8A 3O88A 3N8RA 4ZJ1A 4F94A 2XA7M 3R4KA 4PHTA 1K4EA 3M6BA 2GX5A 4K08A 5J4EA 3MZFA 5MC7A 2Q9MA 1LSVA 4LV2A 3NDEA 1K57A 4Z9QA 3UMDA 1J9MA 2ZQ8A 3PBQA 3V3SA 1YLWA 5M1AA 4GD6A 4CLCD 4JF6A 2O0YA 3IXDA 4IEDA 4YWZA 1XPBA 3MQ0A 5LBRA 1D7EA 5FQMA 3IBJA 3ZG0A 3B3XA 5IHVA 2WGVA 4NK3A 5EPHA 5DJTA 3B33A 5EECA 4X69A 2BLSA 4XT2A 1NXYA 1YKDA 4Y5FA 1Y28A 2HP9A 1TS6A 3C2WA 3VOYA 3I7JA 1ZHHB 4EV4A 3WS0A 2NUPC 3ZFZA 4QY6A 3LR5A 1XJ3A 3W2ZA 2BTFP 4QHCA 2RCXA 2FFFB 3PBRA 3HLEA 5D3OA 4PMAA 1IYSA 2X71A 5L09A 1L2SA 5EM0A 5C5KA 5FSRA 4JXGA 1PNEA 4Z1WA 2EA9A 4HHDA 3IWOA 2HF6A 2PYPA 1TS7A 2K31A 3FPVA 2R9WA 3F1NA 3UDIA 4NEED 1LL5A 3FZCA 3MQQA 3E98A 4DRTA 1F2KA 4EUVA 4P87A 3N8LA 3H9WA 4WZ5A 3LEZA 4BL2A 4Y15A 3Q07A 2EX6A 3KSHA 5CGXA 4UEYA 1YQSA 1PW1A 5BOHA 1P9WA 1I2SA 3BEBA 1FOFA 4E3OA 1HZOA 4ETZA 2IA2A 4DE1A 5HD5A 3NOUC 4B93A 3VSLA 5A92A 4H6JA 1EROA 2O9BA 4GNUA 3G6OA 1FCMA 4LV0A 1JWVA 5EVLA 1XJ2A 4ETXA 2CMNA 3CPTA 2E8IA 3FV7A 2JKRM 4OPQA 3QNBA 3S7QA 4PKYA 1YPRA 3B47A 3P98A 3HBRA 3LGOA 4PM6A 3H82B 1G5UA 1KVMA 4GHIB 1YSQA 2E8JA 1MKIA 1K0KA 1ES3A 1NWZA 1NZOA 1W63M 3NY4A 5U47A 2ACGA 4MLLA 2Y4AA 2W1TA 3VSKA 5DF8A 2WKEA 1UGUA 4DJ3A 3MJQA 1TF1A 3ZCZA 5TBMA 3TJZC 1WE4A 2XF3A 2VGJA 2I9VA 4JPMA 4P6BA 3AGEA 3TOIA 2HGVA 3S22A 4HH3A 4MBHA 2G2UA 1HLUP 1CJFA 5CTNA 5AQ7A 3DTEA 1VEUA 2A49A 3MKFA 4HNBA 1J3WA 4EEPA 3VOZA 4JLFA 1M40A 2ZC6B 3FPWA 3WRZA 1LI0A 2L0WA 1OPXA 2ZM8A 3LICA 1G68A 3Q7ZA 1W79A 3ZQ5A 3RXWA 3WS1A 3OCNA 3FYZA 5TR7A 3E2LA 5AQBA 2ZM0A 5CRFA 1H8ZA 3PHYA 5EE8A 1XKZA 4ZAMA 4LRZE 4N1HA 2A3UA 4NXBA 4U3TA 5AVFA 4KG2A 5HAIA 2W3FA 3QP4A 2IWCA 2XD1A 1I5QA 4E04A 2DNSA 1XXMA 3ZHHA 2JKFA 2JE5A 2X01A 4KZ5A 2XDMA 3NDGA 2QZ6A 4PM7A 4EQIA 5FQ9A 2D01A 4DMZA 5HL6A 1XJ4A 2Y2LA 4N9LA 3KYEA 3UNWA 1JNUA 4HH2A 4MNRA 4XXRA 1PWDA 3BY8A 1K54C 3NBLA 4NXEA 1LL9A 3F1OA 3GVBA 4ZTKA 2J80A 3T4JA 1EI5A 2OSUA 1UWNX 2Y2NA 2K2NA 3W4PA 3ZYTA 2XGNA 1T1AA 1KE0A 3ULFA 1MPLA 2OAQ1 2J3TD 5CHJA 5AJGA 4BD0A 3N4IA 3G32A 1OTEA 4MMNA 3EQVA 4F3LA 4E3LA 1D06A 4O01A 5EVID 5E2GA 3UB8A 2VK3A 2H0TA 4HBUA 3DAVA 4LFUA 2VX8A 4Y2FA 1JTGA 2OV5A 3LY3A 2PU2A 1YMSA 5FL3A 2OWHA 2VLGA 2V1BA 1LI9A 5FEGA 2Z6DA 3T50A 1BUEA 4R23A 5FASA 3S7PA 2BG1A 3UB9A 3A0SA 4OVDA 3P01A 1BT5A 3C38A 4QD4A 3UB5P 3PTEA 4ZBEA 5I94A 2QWSA 3ZGAB 4B4ZA 4K0XA 5HAQA 3T4OA 3HLWA 4OQHA 4WL9A 3IF6A 1E3UD 4E3NA 3VP2A 5DF9A 2XSSA 1PYYA 4KZ3A 4KQOA 2HP6A 5IT5A 1W8YA 3C7UA 1H8MA 2HJ9C 1FSWA 3PAGA 1T18A 2H5SA 1BYWA 2WKHA 1FCNA 1ES5A 3UPNA 4OLDA 1ZG6A 2P7JA 1Z6FA 5A91A 3BY9A 2WUQA 2G7UA 3OC2A 3PBSA 4KZ9A 5GLBA 4BWIA 3HLFA 4WBGA 4HBTA 5E2HA 3SOIA 1BLHA 2WGWB 1PFLA 2Y2KA 4DJ2A 3EEAA 3HLBA 4E3IA 4KZ8A 4N9KA 2VV7A 4YFMA 5DFXA 3ITAA 3W4QA 2KX6A 2VA0A 3RH8B 2J8YA 5HPIA 3C4OA 4DE0A 5M18A 4HP4A 2UWXA 4K0WA 3MXRA 3UE6A 3WS4A 1GA0A 3MBZA 3LIDA 4AFIA 3ZG7B 3KSFA 3N8SA 2HPBA 3L9KA 3BFGA 4KUKA 2ZQ9A 4FD8A 3FKWA 4M4XA 5AQAA 5I5LA 2V8CA 5DTSA 4ZDXA 4EXOA 1H0MA 4GZBA 2ZQCA 2A24B 3S1YA 3ICYA 2M1CA 4DE3A 2PD8A 3BWLA 1XJ6A 2M7VA 2DRWA 1O7EA 2BASA 1K57C 4IVIA 4EESA 3G34A 3VMAA 5FAOA 5G4ZA 3BECA 1BLPA 2EFXA 1MXOA 2JHEA 4L0LA 3ZNTA 3ZVWA 5FATA 1S4SA 1M6KA 3HUNA 4OONA 2EWVA 4LENA 1YLPA 2W3EA 2GZAA 2O9AA 1ES2A 3CMZA 1Z09A 1L0EA 4IBXA 5HL1A 5FI6A 5CHMA 1VM1A 1L0FA 3CZDA 2VGLM 3IH9A 4NETA 2OLUA 2Y8HA 1SKOA 3ZG5A 4MDZA 4K91A 1LL8A 1DJCA 4CLCC 3C30A 2ZMAA 1Y4OA 3V39A 3V67A 5CERA 4II7A 3S4XA 4MCWA 1IYOA 3LUQA 5EVIB 3O5YA 3F1PB 3LI8A 1AXBA 4HI4A 3H82A 5GHZA 4GHIA 3ZNYA 4PM8A 2Y2QA 1MZUA 1EW0A 5J3WA 4KZAA 4EU0A 1ZTUA 3TSGA 4CQHA 4PAUA 2XFTA 3E2KA 1ERMA 1XFQA 3CUEC 4HESA 3SH7A 4BJPA 3NCKA 4GS9A 4I38A 4LCLA 2JKTI 2XFSA 2QKPA 3UPOA 3S7OA 1MWSA 2VZWA 3MZEA 1EWZA 3UPPA 5CGWA 1KGEA 2VV6A 5F1FA 3KYZA 5DKLA 2L4RA 1I2WA 2EX9A 2HDRA 1U60A 3T1SA 2PRFA 5DF7A 2Y2PA 1SDEA 2P9VA 3DTIA 3IWQA 2Y2OA 2V2FF 5FAPA 3HJIA 2O99A 3GDIA 1JWPA 1N9NA 2W3DA 1N9BA 3DTMA 3GSGA 5DTTA 1PWCA 4OLGA 3HL9A 1E4DA 1VETB 4EWFA 1DP6A 1MWUA 1ALQA 1STZA 3IX3A 4XUXA 3T1RA 3ISGA 3T4TA 3V50A 4GDBA 4X55A 3LY4A 3N7WA 4RA7A 3UE3A 5A93A 4BBTA 2KDKA 3IX4A 3PR6A 4Y13A 2Y2GA 3M2JA 4S2OA 4L9GA 2QJ7A 3IXGA 3OPPA 2ZL1A 1QMFA 3Q7VA 3LR3A 2O9CA 1GSVA 3RFBA 5CTMA 2JCHA 1TS8A 2JBFA 1IKIA 1HTZA 2PBYA 2WAEA 1YLTA 4NXFA 4EQ1A 3IX8A 4UA6A 1T1CA 4BLMA 4LV3A 2J9PA 3KYQA 1C3BA 3HUMA 3LFVA 2Y59A 4GLQA 1OTAA 1ZKJA 3BFDA 4CPKA 4MN7A 3MR0A 4R1GA 3VOLA 3IXBA 5KMWA 1K38A 3KSGA 3W4OA 3Q1FA 1F98A 2ZM2A 4G3VA 3EGXC 4X53A 4E3MA 5HSQA 4H8RA 3WRTA 3C8CA 2INWA 4DXCA 1IEMA 3C4PA 3V3RA 2WKQA 2Q9NA 5G4YA 1IKGA 1ACFA 5J8XA 1BTLA 3JVUA 2L1MA 4BQMA 5KZHA 4I3IA 1CI8A 3QNCA 5FAQA 3S7NA 5DVAA 4HY8A 3MXQA 1FSYA 2WK0A 3CAXA 4L9EA 3IBRA 4ME4A 1QMEA 1ESIA 1GHIA 4XT2B 2GDNA 3G35A 3MMHA 3MQOA 4R3JA 3OOVA 1IELA 1HD8A 3GTCA 3BRMA 1G28A 2B95A 4X56A 1XP4A 5TFQA 1NJ4A 2J7VA 3A0VA 3O87A 3BFCA 4CLCB 2JKTM 4Q0JA 2FZ0A 4B4XA 5M19A 2ZMVA 4S2NC 5EUAA 4HQAA 1MBLA 2XEPA 4UHUA 5FQKA 4P85A 3NIAA 3MS6A 3UB7A 2WGWA 2G2WA 2Y79A 1K56A 4Y0OA 2Q0OA 5AVEA 2Z2LB 5DTKA 3UY6A 2WAFA 1NY0A 4E6XA 4DDYA 1N9OA 4HP9A 1SKFA 1CI9A 1L0DA 1GHMA 2ZC3B 3G2ZA 4NKPA 1MWTA 1WYBA 3EWKA 4Y0UA 2DCFA 2EX2A 1KE3A 2FH5A 3FKVA 5DFYA 3IS2A 2J3TC 1IFQA 1S1YA 4E6WA 1NZUA 4KZBA 3MSHA 1LLBA 5CGSA 5EVIC 1ZG4A 3A0RA 4S2PA 4LRYC 2VGLS 2MJ6A 5F68A 2WKPA 3H7WB 2ZC4B 3SS4A 3C5AA 3IF6C 1XGJA 3NOPC 1X0OA 3BW6A 2OLVA 2A24A 4HJ3A 4OOMA 3QP2A 4GDNA 1Q2PA 1OJ5A 4ARZB 2IWBA 1BSGA 2XLNA 2ZC5B 5L07A 5GLDA 2EXBA 3TE8A 4WF0A 1GSXA 3UN7A 3A3DA 4GKUA 3CPTB 5HWTA 4EETB 3A3FA 1LT0A 1F9IA 3ZG8B 1XX2A 1NYMA 3VE3A 4I3JA 1V9YA 3D9YA 3LIAA 5GHXA 4OQGA 4DXBA 4C6YA 3NHQA 1D1JA 4FOFA 1KE4A 4GW9A 2HDUA 2HV1A 3IQAA 1LSXA 1E25A 2R9XA 3E0YA 1FIKA 3EGDC 3VV4A 2W1TB 4OPZA 1K54A 3PAEA 4R70A 1NYYA 2D02A 3LCEA 3V5MA 2V0UA 4XUZA 5HFOA 2H10A 1KOUA 2OWJA 2ZQDA 3NJAA 2GNXA 5E43A 4DKIA 4O8GA 3QP6A 2M7UA 1XA7A 1FR6A 1N4OA 4LRXC 3E4PA 4KZ6A 4QY5A 5J7EA 1GHPA 1VEUB 2WKIA 4HJ4A 2WADA 3MF0A 4LGWA 3KSIA 5FQJA 5L10A 4S2JA 4OOLA 1RGZA 5K5BA 5CX7A 1RGYA 3T4QA 3CHWP 1SCWA 1Q2QA 5TJJA 4WLAA 2PT7A 3NECA 1VHMA 1ODVA 2KOIA 4KUOA 3BJNA 1O07A 3LEQA 3OPRA 3HJKA 2VKSA 3U2AA 4CJNA 1K55C 2V0WA 4IUHA 3WS5A 4JXSA 3R7WB 3VP4A 1S67L 4R6LA 3IWIA 3QHYA 4E3KA 4U0XA 4WYYA 3OBFA 5FI7A 5GL9A 2P08A 5GLAA 3VP3A 3SS5A 3D3OA 5HDCA 1YM1A 5E2FA 1NRJA 3QP1A 1DP8A 1SHVA 4D60A 2V1ZA 2QPNA 1RCJA 2PAVP 4PPRA 2WKRA 3BLMA 1PRQA 3CI6A 3HLDA 4G3WA 5F1GA 4WMCA 1PWGA 4OH0A 4ZJ3A 4NXGA 1NLYA 3GR2A 3PBOA 2V8FA 2EWWA 3F1OB 1S0WA 2ZC7A 4OOYA 3ITBA 2PYRA 3O86A 4JGOA 4GCZA 4I5SA 3VFHA 2ZBBA 4JF4A 3LYXA 3G31A 3N6IA 3RJUA 4Y17A 3CITA 3LIEA 3PYPA 2JN7A 5FQQA 4WELA 3G30A 4MBKA 2DMWA 1UWPX 2LB5A 2OOLA 2GJ3A 1BZAA 4OQIA 5FI2A 1DP9A 4FUWA 4BBVA 1K6SA 2HDQA 5EOOA 4X1LA 1F5MA 4GOGA 5HPFA 2Z6CA 3VFFA 1FQGA 4IVKA 3HREA 4UA9A 3SS3A 2ZOHA 3NC8A 2W0NA 3G4PA 2LB9A 4Y0TA 3MFXA 1V9ZA 1T19A 1CK3A 5EV0A 5DKKA 4EERA 4KQQA 2QHKA 4LPZA 3Q82A 3IF6B 4LCMA 4QU3A 1TDLA 1KDWA 2Y2HA 5FA7A 2EXAA 5FDHA 4WN5A 4OQ0A 1YAXA 1OT6A 1CF0A 3T12B 1T1BA 1DY6A 4DDSA 2VGKA 4M3KA 1OJGA 4FCFA 2PR6A 1AWIA 3IHAA 3JPUA 3TRCA 4MN5A 1G6AA 4CLCE 5CEBA 2OAP1 3AGFA 4Q8IA 4WZ5C 5A8BA 4PKYG 4KENB 5HX9A 1K6RA 3E4OA 1KGGA 4N1XA 2HDSA 3VP0A 2EX8A 5HDSA 5IS1A 3SH9A 2PDRA 4S2IA 4R38A 2XR0A 4ESPA 1PI4A 4KG6A 4IBRA 4GJ4A 4MBFA 2XROA 2ZD8A 3IF5A 2QMIA 4IJGA 3G2YA 1OTIA 5F83A 2Y2JA 4A5RA 3HLGA 4OKPA 5HZHA 3KX0X 4MEZA 3K3DA 1ZC2A 3IXHA 1LSWA 4CLCA 4O7DA 1K4FA 3IH8A 3L7HA 5CXWA 5DJUA 3P7NA 5CEDA 1S66L 1H8YA 1XFNA 1XGIA
chains in the Genus database with same CATH topology
4EEUA 4YOFA 2QWSA 1G28A 3RTYA 4Q0IA 3A0VA 5F69A 3T4OA 4WEJA 4CLCB 2JKRI 2JKTM 3CUEA 4Q0JA 2FZ0A 4WL9A 3T4SA 2ZMVA 3T4KA 4HQAA 1MKMA 5DF9A 2W27A 5HWVA 2XSSA 3PBTA 4BBUA 4KQOA 4LLOB 5IT5A 4Y3IA 1H8MA 1S4RA 2HJ9C 3LIFA 2J3WA 2XRNA 3LR0A 1T18A 3UB7A 1BYWA 4IHQA 2Y79A 1OTBA 5AVEA 4JGPA 4MN6A 1W63Q 2P7JA 3TW8A 5HD3A 4WUJA 1N9OA 4I39A 4HP9A 4KQDA 3BY9A 1TD5A 2G7UA 3OC2A 3PBSA 4BWIA 3H7WA 2YKHA 4NKPA 4IUKA 2XA7M 3EWKA 3R4KA 4PHTA 2GX5A 4K08A 2V1AA 5J4EA 5MC7A 1GSWA 2FH5A 5DFYA 1LSVA 3IS2A 2J3TC 3UMDA 1IFQA 4ARZA 1S1YA 4I3AA 3PBQA 4DJ2A 3EEAA 1N9LA 4CLCD 2O0YA 2VV7A 5DFXA 2NUTC 4YWZA 2W3HA 3A0RA 3MQ0A 3PBNA 5LBRA 4LRYC 2VGLS 2MJ6A 5F68A 1D7EA 2WKPA 2KX6A 2VA0A 3H7WB 3RH8B 4ZRRA 3IBJA 5HPIA 3LIBA 4BMWA 3NOTC 3NOPC 1P97A 4HP4A 1X0OA 3BW6A 5F5YA 2A24A 5DJTA 3B33A 4HJ3A 3UE6A 4OOMA 4XT2A 1OJ5A 3LIDA 4AFIA 4R3AA 3KSFA 1VB6A 4ARZB 1YKDA 4Y5FA 1Y28A 3OCLA 3TE8A 3BQAA 1TS6A 1GSXA 4WF0A 3OLOA 3HCYA 3C2WA 4KUKA 1ZHHB 2NUPC 4M4XA 1MC0A 5HWTA 4EETB 5I5LA 3LR5A 1LT0A 1F9IA 1XJ3A 3W2ZA 4EXOA 5KSHA 3PBRA 4HOIA 3VE3A 4I3JA 4GS9B 1V9YA 2A24B 2VEAA 3ICYA 3LIAA 5C5KA 3NHQA 2M1CA 4FOFA 2PD8A 4GW9A 2HV1A 3BWLA 3K2NA 3EOIA 1XJ6A 4Z1WA 2EA9A 2M7VA 4HHDA 2BASA 5HDDA 1LSXA 4JGRA 2HF6A 2PYPA 1TS7A 4EESA 2K31A 3FPVA 3F1NA 4NEED 5G4ZA 4JGQA 3E0YA 3JVVA 2JHEA 3CWFA 4L0LA 3EGDC 3VV4A 2W1TB 1H3QA 4P6ZS 3MQQA 1S4SA 3E98A 5IU1A 2EWVA 1G6OA 1OT9A 2W3EA 2GZAA 4EUVA 4R70A 2O9AA 2D02A 2R78A 2V0UA 3H9WA 1KOUA 2OWJA 3NJAA 2GNXA 4O8GA 2M7UA 3KO6A 4LRXC 3E4PA 4L9FA 3LI9A 3KSHA 4UEYA 5J7EA 2VGLM 3F1NB 4HJ4A 2Y8HA 3MF0A 1P9WA 2K7SA 4MDZA 3KSIA 3R7WA 1LL8A 4OOLA 4CLCC 3C30A 5K5BA 5HWWA 4O0PA 5CX7A 3V67A 3T4QA 4II7A 4ETZA 2IA2A 4MCWA 5HD5A 4UQIS 5TJJA 3LUQA 4WLAA 3O5YA 3F1PB 3NOUC 4B93A 2PT7A 1VHMA 3LI8A 4H6JA 1ODVA 2KOIA 3UB6A 4HI4A 4KUOA 2O9BA 3BJNA 3H82A 1IOUA 3G6OA 3FC7A 4GHIA 2ZOIA 3BQ8A 3CLOA 3HJKA 1MZUA 1EW0A 1XJ2A 2VKSA 5J3WA 4EU0A 2QJ5A 2PR5A 4YNRA 1ZTUA 3U2AA 4ETXA 4CQHA 2CMNA 2V0WA 4IUHA 4PAUA 3R7WB 1S67L 4R6LA 2JKRM 1XFQA 3CUEC 5L8MA 3S7QA 4PKYA 4HIAA 3OBFA 3B47A 4BJPA 2W3GA 4GS9A 4I38A 2P08A 4H6JB 4EW7A 2PHYA 2JKTI 2ZMFA 3D3OA 1S1ZA 2QKPA 3H82B 5HDCA 4GHIB 3S7OA 1YSQA 2VZWA 1NRJA 2VV6A 1DP8A 3VE4A 1NWZA 2VJWA 3KYZA 4RQ9A 1W63M 5DKLA 2L4RA 2WKRA 3CI6A 4WEKA 2QYBA 4G3WA 2W1TA 4QPRA 1UGUA 4NXGA 2XA7S 4DJ3A 3MJQA 1NLYA 1TF1A 5TBMA 3PBOA 3PXPA 3TJZC 2H28A 1P0ZA 2EWWA 3HJIA 2I9VA 2V9AA 3F1OB 2O99A 2HGVA 3T4LA 3GDIA 1N9NA 2W3DA 4HJ6A 4HH3A 5KIZA 3EEHA 2PYRA 4JGOA 4GCZA 4I5SA 2ZBBA 1DP6A 4HNBA 5EFWA 1STZA 4EEPA 3LYXA 3FPWA 1TS0A 2L0WA 3CITA 1OPXA 3LICA 3LIEA 3PYPA 2JN7A 5TBMB 3T4TA 4WELA 3DBAA 2DMWA 1UWPX 2LB5A 2OOLA 3F1PA 3ZQ5A 2GJ3A 3GECA 3OCNA 3SW1A 3UE3A 4BBTA 2KDKA 3PR6A 3PHYA 1DP9A 2KLIA 4BBVA 4LRZE 4L9GA 2QJ7A 5F6AA 5AVFA 4NXBA 1F5MA 5HPFA 2Z6CA 2YKFA 3LR3A 3LR4A 2O9CA 1GSVA 3RFBA 2W3FA 2ZOHA 1TS8A 2W0NA 2LB9A 1YSPA 3MFXA 4E04A 1V9ZA 1T19A 4NXFA 4EQ1A 5DKKA 4EERA 2QHKA 1T1CA 4LPZA 3K3CA 3KYQA 3LFVA 4G3KA 4GLQA 4WN5A 3E4QA 1YAXA 1OT6A 1OTAA 1NLZA 2D01A 4DMZA 5HL6A 1T1BA 1XJ4A 1WA9A 1OJGA 1JNUA 2P04A 4HH2A 3D72A 2PR6A 4MN7A 3MR0A 3BY8A 3VOLA 3TRCA 4MN5A 4CLCE 4DN0A 4NXEA 4Q0HA 3F1OA 2OAP1 2J80A 3T4JA 3KSGA 5A8BA 3EQUA 4PKYG 1F98A 1UWNX 3E4OA 4G3VA 2K2NA 3ZYTA 3EGXC 5HSQA 5HDSA 1T1AA 3ULFA 3UMEA 5IS1A 2PDRA 3C8CA 2INWA 2OAQ1 4P6ZM 4R38A 4B9OA 2J3TD 3FG8A 5AJGA 2W1RA 4GJ4A 2XROA 2WKQA 1OTEA 5G4YA 4MMNA 3EQVA 1DRMA 4IJGA 3IS2B 4F3LA 1OTDA 1D06A 1OTIA 4O01A 3UB8A 3JVUA 2L1MA 5HZHA 3KX0X 3K3DA 4I3IA 2A2LA 2VX8A 4Y2FA 1P9RA 3S7NA 5FL3A 1LSWA 2HJEA 4HY8A 2OWHA 4CLCA 3MXQA 2VLGA 2V1BA 2Z6DA 4FSFA 3CAXA 4L9EA 3T50A 3IBRA 2VV8A 5DJUA 4ME4A 2PD7A 3P7NA 4UQIM 3B42A 3S7PA 1S66L 2B02A 4XT2B 4F3LB 3UB9A 1XFNA 3A0SA 2B18A 3MMHA 3MQOA 3P01A 3C38A 3OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPV A;  4BMW A;  4CLC D;  5CX7 A;  4CLC E;  4CLC B;  3FPW A;  4NKP A;  4CLC A;  2A2L A;  4CLC C; 
#chains in the Genus database with same CATH topology
 1CQA A;  3Q81 A;  1CEF A;  3MXS A;  5EOE A;  4YOF A;  3UDX A;  1KDS A;  4Q0I A;  2WGI A;  1L3L A;  1ONH A;  1HVB A;  4WEJ A;  3CUE A;  3MZD A;  3T4S A;  3T4K A;  4UAA A;  2W27 A;  5HWV A;  4BBU A;  2X02 A;  5HAR A;  4RYE A;  1S4R A;  3LIF A;  2J3W A;  3LR0 A;  3UE0 A;  3A3I A;  4IHQ A;  4JXV A;  5FDS A;  5G18 A;  2Z2M B;  4JGP A;  3TW8 A;  1W63 Q;  3UO9 A;  4WUJ A;  1FR1 A;  3M6H A;  4UA7 A;  1TD5 A;  3QP5 A;  5GLC A;  4DE2 A;  3H7W A;  2YKH A;  3DWK A;  2UV0 E;  3O3V A;  3T1Q B;  4IUK A;  2JC7 A;  4X1M A;  2V1A A;  2WZX A;  1Y54 A;  3WWX A;  1GSW A;  1GCE A;  3LO7 A;  4D2O A;  4B88 A;  3MKE A;  3TG9 A;  4ARZ A;  4I3A A;  1GA9 A;  5JYO A;  1N9L A;  4S2L A;  1SKO B;  5EM1 A;  2NUT C;  1KGF A;  2W3H A;  3PBN A;  4FTX A;  1IYQ A;  5HAP A;  4ZRR A;  1BUL A;  5AQ9 A;  4BL3 A;  2ZJ9 A;  3LIB A;  4BMW A;  3NOT C;  1JVJ A;  1DJB A;  1P97 A;  3OPH A;  3P09 A;  3UE1 A;  5F5Y A;  1JTD A;  4KG5 A;  2HZ5 A;  4R3A A;  4FH2 A;  1VB6 A;  3IHB A;  4PM5 A;  3OCL A;  3HUO A;  3BQA A;  2RL3 A;  3HCY A;  3OLO A;  3VP1 A;  2I72 A;  1MC0 A;  1JWZ A;  5KSH A;  3CG5 A;  4HOI A;  4GS9 B;  3IT9 A;  1PW8 A;  2VEA A;  1ESU A;  2P74 A;  1K56 D;  4JXW A;  1SZV A;  3K2N A;  3EOI A;  5HDD A;  4Y7P A;  4JGR A;  2C5W B;  2H0Y A;  3ZDJ A;  4JGQ A;  3JVV A;  1YT4 A;  3CWF A;  1H3Q A;  4P6Z S;  2P9V B;  5IU1 A;  1G6O A;  1OT9 A;  3BM6 A;  3BYD A;  3DTK A;  3A3J A;  1ERQ A;  2R78 A;  4PM9 A;  4EUZ A;  2J9O A;  1PZO A;  3KO6 A;  2FFY A;  4L9F A;  2IWD A;  3LI9 A;  3F1N B;  4OPY A;  5EVE A;  3U4L P;  5FQI A;  4R4R A;  4WM9 A;  2K7S A;  2Y2M A;  1RP5 A;  3R7W A;  3SZT A;  1DJA A;  3CJM A;  2XH9 A;  1TDG A;  2JKG A;  5HWW A;  4O0P A;  1PZP A;  4WZ4 A;  4BEN A;  4UQI S;  3BLS A;  1NRF A;  4C75 A;  4U0T A;  3UB6 A;  1IOU A;  2C6W B;  3FC7 A;  2ZOI A;  1WYC A;  4EBP A;  3BQ8 A;  3SH8 A;  3CLO A;  2QJ5 A;  2PR5 A;  4YNR A;  3DW0 A;  4FH4 A;  2XD5 A;  2ZL1 B;  1H5X A;  5L8M A;  3Q7V B;  1FIL A;  1VQQ A;  1SDN A;  2Y55 A;  4QB8 A;  4JKT A;  4HIA A;  2W3G A;  4H6J B;  4EW7 A;  2PHY A;  4X25 A;  2ZMF A;  1S1Z A;  4RX2 A;  1YLJ A;  4S2N A;  4R4S A;  5CEC A;  4EBN A;  2ZQ7 A;  4N92 A;  3VE4 A;  3FWL A;  2VJW A;  4RQ9 A;  1YMX A;  3DWZ A;  4WEK A;  2QYB A;  3BFF A;  4QPR A;  3RXX A;  2V20 A;  2XA7 S;  4KZ4 A;  3NUL A;  3PXP A;  5L2F A;  3HVF A;  2H28 A;  1P0Z A;  2V9A A;  1K25 A;  3T4L A;  4HJ6 A;  5F82 A;  4JF5 A;  3OPL A;  5KIZ A;  3EEH A;  4E3J A;  1MY8 A;  4C3Q A;  4X6T A;  3BFE A;  5EFW A;  5GHY A;  1L0G A;  3GRJ A;  4NG2 A;  1TS0 A;  1YLY A;  4OP8 A;  4RX3 A;  5TBM B;  4ID4 A;  3AGD A;  1YLZ A;  1PI5 A;  3DBA A;  5EVI A;  3F1P A;  3GEC A;  4YIN A;  4P0M A;  2HP5 A;  2PBD P;  4S2M A;  3SW1 A;  4GD8 A;  4HEF A;  4RVA A;  3A3E A;  2KLI A;  1BLS A;  5F6A A;  4EBL A;  2YKF A;  1CEG A;  3M2K A;  3LR4 A;  1W7F A;  1W5D A;  5A90 A;  5JYP A;  5E2E A;  1A0K A;  4KZ7 A;  1YSP A;  2Y2I A;  1TVF A;  3MFD A;  2CC1 A;  3GQZ A;  3HLC A;  3K3C A;  1E3U A;  4G3K A;  3D4F A;  2ZQA A;  3E4Q A;  1TEM A;  4WMC D;  4OPR A;  1NLZ A;  1WA9 A;  5CHU A;  2P04 A;  3D72 A;  3T1X A;  5FEF A;  4DN0 A;  4Q0H A;  1OME A;  4DF6 A;  3ZVT A;  3EQU A;  2WZZ A;  4GN2 A;  2PU4 A;  1ONG A;  3UME A;  1VET A;  4P6Z M;  3UDF A;  4B9O A;  3FG8 A;  1S6R A;  2W1R A;  1LHY A;  5HW3 A;  2ZLY A;  1DRM A;  3IS2 B;  1OTD A;  2XQZ A;  4QWO A;  4X68 A;  4BD1 A;  1W8Q A;  5KSC A;  2A2L A;  2AVX A;  2Y91 A;  1P9R A;  4GB7 A;  2HJE A;  1MWR A;  2EFU A;  4JBF A;  4S2K A;  2WYX A;  4FSF A;  3ZG9 B;  2B5R A;  4OP5 A;  3W8K A;  3GMW A;  2VV8 A;  1XA1 A;  1ES4 A;  2PD7 A;  4UQI M;  3B42 A;  2B02 A;  4F3L B;  2B18 A;  4LV1 A;  3WS2 A;  4EEU A;  3C7V A;  1K55 A;  4ZJ2 A;  3RTY A;  5F69 A;  2JKR I;  3JYI A;  4KQR A;  1MKM A;  3PBT A;  4R0Q A;  1BLC A;  1PIO A;  4LLO B;  4Y3I A;  2XRN A;  2XK1 A;  3GV9 A;  3OZH A;  4QJG A;  3NI9 A;  1IYP A;  1OTB A;  4R3B A;  4MN6 A;  1KVL A;  5HD3 A;  4I39 A;  4KQD A;  5TGF A;  1FCO A;  3QP8 A;  3O88 A;  3N8R A;  4ZJ1 A;  4F94 A;  2XA7 M;  3R4K A;  4PHT A;  1K4E A;  3M6B A;  2GX5 A;  4K08 A;  5J4E A;  3MZF A;  5MC7 A;  2Q9M A;  1LSV A;  4LV2 A;  3NDE A;  1K57 A;  4Z9Q A;  3UMD A;  1J9M A;  2ZQ8 A;  3PBQ A;  3V3S A;  1YLW A;  5M1A A;  4GD6 A;  4CLC D;  4JF6 A;  2O0Y A;  3IXD A;  4IED A;  4YWZ A;  1XPB A;  3MQ0 A;  5LBR A;  1D7E A;  5FQM A;  3IBJ A;  3ZG0 A;  3B3X A;  5IHV A;  2WGV A;  4NK3 A;  5EPH A;  5DJT A;  3B33 A;  5EEC A;  4X69 A;  2BLS A;  4XT2 A;  1NXY A;  1YKD A;  4Y5F A;  1Y28 A;  2HP9 A;  1TS6 A;  3C2W A;  3VOY A;  3I7J A;  1ZHH B;  4EV4 A;  3WS0 A;  2NUP C;  3ZFZ A;  4QY6 A;  3LR5 A;  1XJ3 A;  3W2Z A;  2BTF P;  4QHC A;  2RCX A;  2FFF B;  3PBR A;  3HLE A;  5D3O A;  4PMA A;  1IYS A;  2X71 A;  5L09 A;  1L2S A;  5EM0 A;  5C5K A;  5FSR A;  4JXG A;  1PNE A;  4Z1W A;  2EA9 A;  4HHD A;  3IWO A;  2HF6 A;  2PYP A;  1TS7 A;  2K31 A;  3FPV A;  2R9W A;  3F1N A;  3UDI A;  4NEE D;  1LL5 A;  3FZC A;  3MQQ A;  3E98 A;  4DRT A;  1F2K A;  4EUV A;  4P87 A;  3N8L A;  3H9W A;  4WZ5 A;  3LEZ A;  4BL2 A;  4Y15 A;  3Q07 A;  2EX6 A;  3KSH A;  5CGX A;  4UEY A;  1YQS A;  1PW1 A;  5BOH A;  1P9W A;  1I2S A;  3BEB A;  1FOF A;  4E3O A;  1HZO A;  4ETZ A;  2IA2 A;  4DE1 A;  5HD5 A;  3NOU C;  4B93 A;  3VSL A;  5A92 A;  4H6J A;  1ERO A;  2O9B A;  4GNU A;  3G6O A;  1FCM A;  4LV0 A;  1JWV A;  5EVL A;  1XJ2 A;  4ETX A;  2CMN A;  3CPT A;  2E8I A;  3FV7 A;  2JKR M;  4OPQ A;  3QNB A;  3S7Q A;  4PKY A;  1YPR A;  3B47 A;  3P98 A;  3HBR A;  3LGO A;  4PM6 A;  3H82 B;  1G5U A;  1KVM A;  4GHI B;  1YSQ A;  2E8J A;  1MKI A;  1K0K A;  1ES3 A;  1NWZ A;  1NZO A;  1W63 M;  3NY4 A;  5U47 A;  2ACG A;  4MLL A;  2Y4A A;  2W1T A;  3VSK A;  5DF8 A;  2WKE A;  1UGU A;  4DJ3 A;  3MJQ A;  1TF1 A;  3ZCZ A;  5TBM A;  3TJZ C;  1WE4 A;  2XF3 A;  2VGJ A;  2I9V A;  4JPM A;  4P6B A;  3AGE A;  3TOI A;  2HGV A;  3S22 A;  4HH3 A;  4MBH A;  2G2U A;  1HLU P;  1CJF A;  5CTN A;  5AQ7 A;  3DTE A;  1VEU A;  2A49 A;  3MKF A;  4HNB A;  1J3W A;  4EEP A;  3VOZ A;  4JLF A;  1M40 A;  2ZC6 B;  3FPW A;  3WRZ A;  1LI0 A;  2L0W A;  1OPX A;  2ZM8 A;  3LIC A;  1G68 A;  3Q7Z A;  1W79 A;  3ZQ5 A;  3RXW A;  3WS1 A;  3OCN A;  3FYZ A;  5TR7 A;  3E2L A;  5AQB A;  2ZM0 A;  5CRF A;  1H8Z A;  3PHY A;  5EE8 A;  1XKZ A;  4ZAM A;  4LRZ E;  4N1H A;  2A3U A;  4NXB A;  4U3T A;  5AVF A;  4KG2 A;  5HAI A;  2W3F A;  3QP4 A;  2IWC A;  2XD1 A;  1I5Q A;  4E04 A;  2DNS A;  1XXM A;  3ZHH A;  2JKF A;  2JE5 A;  2X01 A;  4KZ5 A;  2XDM A;  3NDG A;  2QZ6 A;  4PM7 A;  4EQI A;  5FQ9 A;  2D01 A;  4DMZ A;  5HL6 A;  1XJ4 A;  2Y2L A;  4N9L A;  3KYE A;  3UNW A;  1JNU A;  4HH2 A;  4MNR A;  4XXR A;  1PWD A;  3BY8 A;  1K54 C;  3NBL A;  4NXE A;  1LL9 A;  3F1O A;  3GVB A;  4ZTK A;  2J80 A;  3T4J A;  1EI5 A;  2OSU A;  1UWN X;  2Y2N A;  2K2N A;  3W4P A;  3ZYT A;  2XGN A;  1T1A A;  1KE0 A;  3ULF A;  1MPL A;  2OAQ 1;  2J3T D;  5CHJ A;  5AJG A;  4BD0 A;  3N4I A;  3G32 A;  1OTE A;  4MMN A;  3EQV A;  4F3L A;  4E3L A;  1D06 A;  4O01 A;  5EVI D;  5E2G A;  3UB8 A;  2VK3 A;  2H0T A;  4HBU A;  3DAV A;  4LFU A;  2VX8 A;  4Y2F A;  1JTG A;  2OV5 A;  3LY3 A;  2PU2 A;  1YMS A;  5FL3 A;  2OWH A;  2VLG A;  2V1B A;  1LI9 A;  5FEG A;  2Z6D A;  3T50 A;  1BUE A;  4R23 A;  5FAS A;  3S7P A;  2BG1 A;  3UB9 A;  3A0S A;  4OVD A;  3P01 A;  1BT5 A;  3C38 A;  4QD4 A;  3UB5 P;  3PTE A;  4ZBE A;  5I94 A;  2QWS A;  3ZGA B;  4B4Z A;  4K0X A;  5HAQ A;  3T4O A;  3HLW A;  4OQH A;  4WL9 A;  3IF6 A;  1E3U D;  4E3N A;  3VP2 A;  5DF9 A;  2XSS A;  1PYY A;  4KZ3 A;  4KQO A;  2HP6 A;  5IT5 A;  1W8Y A;  3C7U A;  1H8M A;  2HJ9 C;  1FSW A;  3PAG A;  1T18 A;  2H5S A;  1BYW A;  2WKH A;  1FCN A;  1ES5 A;  3UPN A;  4OLD A;  1ZG6 A;  2P7J A;  1Z6F A;  5A91 A;  3BY9 A;  2WUQ A;  2G7U A;  3OC2 A;  3PBS A;  4KZ9 A;  5GLB A;  4BWI A;  3HLF A;  4WBG A;  4HBT A;  5E2H A;  3SOI A;  1BLH A;  2WGW B;  1PFL A;  2Y2K A;  4DJ2 A;  3EEA A;  3HLB A;  4E3I A;  4KZ8 A;  4N9K A;  2VV7 A;  4YFM A;  5DFX A;  3ITA A;  3W4Q A;  2KX6 A;  2VA0 A;  3RH8 B;  2J8Y A;  5HPI A;  3C4O A;  4DE0 A;  5M18 A;  4HP4 A;  2UWX A;  4K0W A;  3MXR A;  3UE6 A;  3WS4 A;  1GA0 A;  3MBZ A;  3LID A;  4AFI A;  3ZG7 B;  3KSF A;  3N8S A;  2HPB A;  3L9K A;  3BFG A;  4KUK A;  2ZQ9 A;  4FD8 A;  3FKW A;  4M4X A;  5AQA A;  5I5L A;  2V8C A;  5DTS A;  4ZDX A;  4EXO A;  1H0M A;  4GZB A;  2ZQC A;  2A24 B;  3S1Y A;  3ICY A;  2M1C A;  4DE3 A;  2PD8 A;  3BWL A;  1XJ6 A;  2M7V A;  2DRW A;  1O7E A;  2BAS A;  1K57 C;  4IVI A;  4EES A;  3G34 A;  3VMA A;  5FAO A;  5G4Z A;  3BEC A;  1BLP A;  2EFX A;  1MXO A;  2JHE A;  4L0L A;  3ZNT A;  3ZVW A;  5FAT A;  1S4S A;  1M6K A;  3HUN A;  4OON A;  2EWV A;  4LEN A;  1YLP A;  2W3E A;  2GZA A;  2O9A A;  1ES2 A;  3CMZ A;  1Z09 A;  1L0E A;  4IBX A;  5HL1 A;  5FI6 A;  5CHM A;  1VM1 A;  1L0F A;  3CZD A;  2VGL M;  3IH9 A;  4NET A;  2OLU A;  2Y8H A;  1SKO A;  3ZG5 A;  4MDZ A;  4K91 A;  1LL8 A;  1DJC A;  4CLC C;  3C30 A;  2ZMA A;  1Y4O A;  3V39 A;  3V67 A;  5CER A;  4II7 A;  3S4X A;  4MCW A;  1IYO A;  3LUQ A;  5EVI B;  3O5Y A;  3F1P B;  3LI8 A;  1AXB A;  4HI4 A;  3H82 A;  5GHZ A;  4GHI A;  3ZNY A;  4PM8 A;  2Y2Q A;  1MZU A;  1EW0 A;  5J3W A;  4KZA A;  4EU0 A;  1ZTU A;  3TSG A;  4CQH A;  4PAU A;  2XFT A;  3E2K A;  1ERM A;  1XFQ A;  3CUE C;  4HES A;  3SH7 A;  4BJP A;  3NCK A;  4GS9 A;  4I38 A;  4LCL A;  2JKT I;  2XFS A;  2QKP A;  3UPO A;  3S7O A;  1MWS A;  2VZW A;  3MZE A;  1EWZ A;  3UPP A;  5CGW A;  1KGE A;  2VV6 A;  5F1F A;  3KYZ A;  5DKL A;  2L4R A;  1I2W A;  2EX9 A;  2HDR A;  1U60 A;  3T1S A;  2PRF A;  5DF7 A;  2Y2P A;  1SDE A;  2P9V A;  3DTI A;  3IWQ A;  2Y2O A;  2V2F F;  5FAP A;  3HJI A;  2O99 A;  3GDI A;  1JWP A;  1N9N A;  2W3D A;  1N9B A;  3DTM A;  3GSG A;  5DTT A;  1PWC A;  4OLG A;  3HL9 A;  1E4D A;  1VET B;  4EWF A;  1DP6 A;  1MWU A;  1ALQ A;  1STZ A;  3IX3 A;  4XUX A;  3T1R A;  3ISG A;  3T4T A;  3V50 A;  4GDB A;  4X55 A;  3LY4 A;  3N7W A;  4RA7 A;  3UE3 A;  5A93 A;  4BBT A;  2KDK A;  3IX4 A;  3PR6 A;  4Y13 A;  2Y2G A;  3M2J A;  4S2O A;  4L9G A;  2QJ7 A;  3IXG A;  3OPP A;  2ZL1 A;  1QMF A;  3Q7V A;  3LR3 A;  2O9C A;  1GSV A;  3RFB A;  5CTM A;  2JCH A;  1TS8 A;  2JBF A;  1IKI A;  1HTZ A;  2PBY A;  2WAE A;  1YLT A;  4NXF A;  4EQ1 A;  3IX8 A;  4UA6 A;  1T1C A;  4BLM A;  4LV3 A;  2J9P A;  3KYQ A;  1C3B A;  3HUM A;  3LFV A;  2Y59 A;  4GLQ A;  1OTA A;  1ZKJ A;  3BFD A;  4CPK A;  4MN7 A;  3MR0 A;  4R1G A;  3VOL A;  3IXB A;  5KMW A;  1K38 A;  3KSG A;  3W4O A;  3Q1F A;  1F98 A;  2ZM2 A;  4G3V A;  3EGX C;  4X53 A;  4E3M A;  5HSQ A;  4H8R A;  3WRT A;  3C8C A;  2INW A;  4DXC A;  1IEM A;  3C4P A;  3V3R A;  2WKQ A;  2Q9N A;  5G4Y A;  1IKG A;  1ACF A;  5J8X A;  1BTL A;  3JVU A;  2L1M A;  4BQM A;  5KZH A;  4I3I A;  1CI8 A;  3QNC A;  5FAQ A;  3S7N A;  5DVA A;  4HY8 A;  3MXQ A;  1FSY A;  2WK0 A;  3CAX A;  4L9E A;  3IBR A;  4ME4 A;  1QME A;  1ESI A;  1GHI A;  4XT2 B;  2GDN A;  3G35 A;  3MMH A;  3MQO A;  4R3J A;  3OOV A;  1IEL A;  1HD8 A;  3GTC A;  3BRM A;  1G28 A;  2B95 A;  4X56 A;  1XP4 A;  5TFQ A;  1NJ4 A;  2J7V A;  3A0V A;  3O87 A;  3BFC A;  4CLC B;  2JKT M;  4Q0J A;  2FZ0 A;  4B4X A;  5M19 A;  2ZMV A;  4S2N C;  5EUA A;  4HQA A;  1MBL A;  2XEP A;  4UHU A;  5FQK A;  4P85 A;  3NIA A;  3MS6 A;  3UB7 A;  2WGW A;  2G2W A;  2Y79 A;  1K56 A;  4Y0O A;  2Q0O A;  5AVE A;  2Z2L B;  5DTK A;  3UY6 A;  2WAF A;  1NY0 A;  4E6X A;  4DDY A;  1N9O A;  4HP9 A;  1SKF A;  1CI9 A;  1L0D A;  1GHM A;  2ZC3 B;  3G2Z A;  4NKP A;  1MWT A;  1WYB A;  3EWK A;  4Y0U A;  2DCF A;  2EX2 A;  1KE3 A;  2FH5 A;  3FKV A;  5DFY A;  3IS2 A;  2J3T C;  1IFQ A;  1S1Y A;  4E6W A;  1NZU A;  4KZB A;  3MSH A;  1LLB A;  5CGS A;  5EVI C;  1ZG4 A;  3A0R A;  4S2P A;  4LRY C;  2VGL S;  2MJ6 A;  5F68 A;  2WKP A;  3H7W B;  2ZC4 B;  3SS4 A;  3C5A A;  3IF6 C;  1XGJ A;  3NOP C;  1X0O A;  3BW6 A;  2OLV A;  2A24 A;  4HJ3 A;  4OOM A;  3QP2 A;  4GDN A;  1Q2P A;  1OJ5 A;  4ARZ B;  2IWB A;  1BSG A;  2XLN A;  2ZC5 B;  5L07 A;  5GLD A;  2EXB A;  3TE8 A;  4WF0 A;  1GSX A;  3UN7 A;  3A3D A;  4GKU A;  3CPT B;  5HWT A;  4EET B;  3A3F A;  1LT0 A;  1F9I A;  3ZG8 B;  1XX2 A;  1NYM A;  3VE3 A;  4I3J A;  1V9Y A;  3D9Y A;  3LIA A;  5GHX A;  4OQG A;  4DXB A;  4C6Y A;  3NHQ A;  1D1J A;  4FOF A;  1KE4 A;  4GW9 A;  2HDU A;  2HV1 A;  3IQA A;  1LSX A;  1E25 A;  2R9X A;  3E0Y A;  1FIK A;  3EGD C;  3VV4 A;  2W1T B;  4OPZ A;  1K54 A;  3PAE A;  4R70 A;  1NYY A;  2D02 A;  3LCE A;  3V5M A;  2V0U A;  4XUZ A;  5HFO A;  2H10 A;  1KOU A;  2OWJ A;  2ZQD A;  3NJA A;  2GNX A;  5E43 A;  4DKI A;  4O8G A;  3QP6 A;  2M7U A;  1XA7 A;  1FR6 A;  1N4O A;  4LRX C;  3E4P A;  4KZ6 A;  4QY5 A;  5J7E A;  1GHP A;  1VEU B;  2WKI A;  4HJ4 A;  2WAD A;  3MF0 A;  4LGW A;  3KSI A;  5FQJ A;  5L10 A;  4S2J A;  4OOL A;  1RGZ A;  5K5B A;  5CX7 A;  1RGY A;  3T4Q A;  3CHW P;  1SCW A;  1Q2Q A;  5TJJ A;  4WLA A;  2PT7 A;  3NEC A;  1VHM A;  1ODV A;  2KOI A;  4KUO A;  3BJN A;  1O07 A;  3LEQ A;  3OPR A;  3HJK A;  2VKS A;  3U2A A;  4CJN A;  1K55 C;  2V0W A;  4IUH A;  3WS5 A;  4JXS A;  3R7W B;  3VP4 A;  1S67 L;  4R6L A;  3IWI A;  3QHY A;  4E3K A;  4U0X A;  4WYY A;  3OBF A;  5FI7 A;  5GL9 A;  2P08 A;  5GLA A;  3VP3 A;  3SS5 A;  3D3O A;  5HDC A;  1YM1 A;  5E2F A;  1NRJ A;  3QP1 A;  1DP8 A;  1SHV A;  4D60 A;  2V1Z A;  2QPN A;  1RCJ A;  2PAV P;  4PPR A;  2WKR A;  3BLM A;  1PRQ A;  3CI6 A;  3HLD A;  4G3W A;  5F1G A;  4WMC A;  1PWG A;  4OH0 A;  4ZJ3 A;  4NXG A;  1NLY A;  3GR2 A;  3PBO A;  2V8F A;  2EWW A;  3F1O B;  1S0W A;  2ZC7 A;  4OOY A;  3ITB A;  2PYR A;  3O86 A;  4JGO A;  4GCZ A;  4I5S A;  3VFH A;  2ZBB A;  4JF4 A;  3LYX A;  3G31 A;  3N6I A;  3RJU A;  4Y17 A;  3CIT A;  3LIE A;  3PYP A;  2JN7 A;  5FQQ A;  4WEL A;  3G30 A;  4MBK A;  2DMW A;  1UWP X;  2LB5 A;  2OOL A;  2GJ3 A;  1BZA A;  4OQI A;  5FI2 A;  1DP9 A;  4FUW A;  4BBV A;  1K6S A;  2HDQ A;  5EOO A;  4X1L A;  1F5M A;  4GOG A;  5HPF A;  2Z6C A;  3VFF A;  1FQG A;  4IVK A;  3HRE A;  4UA9 A;  3SS3 A;  2ZOH A;  3NC8 A;  2W0N A;  3G4P A;  2LB9 A;  4Y0T A;  3MFX A;  1V9Z A;  1T19 A;  1CK3 A;  5EV0 A;  5DKK A;  4EER A;  4KQQ A;  2QHK A;  4LPZ A;  3Q82 A;  3IF6 B;  4LCM A;  4QU3 A;  1TDL A;  1KDW A;  2Y2H A;  5FA7 A;  2EXA A;  5FDH A;  4WN5 A;  4OQ0 A;  1YAX A;  1OT6 A;  1CF0 A;  3T12 B;  1T1B A;  1DY6 A;  4DDS A;  2VGK A;  4M3K A;  1OJG A;  4FCF A;  2PR6 A;  1AWI A;  3IHA A;  3JPU A;  3TRC A;  4MN5 A;  1G6A A;  4CLC E;  5CEB A;  2OAP 1;  3AGF A;  4Q8I A;  4WZ5 C;  5A8B A;  4PKY G;  4KEN B;  5HX9 A;  1K6R A;  3E4O A;  1KGG A;  4N1X A;  2HDS A;  3VP0 A;  2EX8 A;  5HDS A;  5IS1 A;  3SH9 A;  2PDR A;  4S2I A;  4R38 A;  2XR0 A;  4ESP A;  1PI4 A;  4KG6 A;  4IBR A;  4GJ4 A;  4MBF A;  2XRO A;  2ZD8 A;  3IF5 A;  2QMI A;  4IJG A;  3G2Y A;  1OTI A;  5F83 A;  2Y2J A;  4A5R A;  3HLG A;  4OKP A;  5HZH A;  3KX0 X;  4MEZ A;  3K3D A;  1ZC2 A;  3IXH A;  1LSW A;  4CLC A;  4O7D A;  1K4F A;  3IH8 A;  3L7H A;  5CXW A;  5DJU A;  3P7N A;  5CED A;  1S66 L;  1H8Y A;  1XFN A;  1XGI A; 
#chains in the Genus database with same CATH homology
 4EEU A;  4YOF A;  2QWS A;  1G28 A;  3RTY A;  4Q0I A;  3A0V A;  5F69 A;  3T4O A;  4WEJ A;  4CLC B;  2JKR I;  2JKT M;  3CUE A;  4Q0J A;  2FZ0 A;  4WL9 A;  3T4S A;  2ZMV A;  3T4K A;  4HQA A;  1MKM A;  5DF9 A;  2W27 A;  5HWV A;  2XSS A;  3PBT A;  4BBU A;  4KQO A;  4LLO B;  5IT5 A;  4Y3I A;  1H8M A;  1S4R A;  2HJ9 C;  3LIF A;  2J3W A;  2XRN A;  3LR0 A;  1T18 A;  3UB7 A;  1BYW A;  4IHQ A;  2Y79 A;  1OTB A;  5AVE A;  4JGP A;  4MN6 A;  1W63 Q;  2P7J A;  3TW8 A;  5HD3 A;  4WUJ A;  1N9O A;  4I39 A;  4HP9 A;  4KQD A;  3BY9 A;  1TD5 A;  2G7U A;  3OC2 A;  3PBS A;  4BWI A;  3H7W A;  2YKH A;  4NKP A;  4IUK A;  2XA7 M;  3EWK A;  3R4K A;  4PHT A;  2GX5 A;  4K08 A;  2V1A A;  5J4E A;  5MC7 A;  1GSW A;  2FH5 A;  5DFY A;  1LSV A;  3IS2 A;  2J3T C;  3UMD A;  1IFQ A;  4ARZ A;  1S1Y A;  4I3A A;  3PBQ A;  4DJ2 A;  3EEA A;  1N9L A;  4CLC D;  2O0Y A;  2VV7 A;  5DFX A;  2NUT C;  4YWZ A;  2W3H A;  3A0R A;  3MQ0 A;  3PBN A;  5LBR A;  4LRY C;  2VGL S;  2MJ6 A;  5F68 A;  1D7E A;  2WKP A;  2KX6 A;  2VA0 A;  3H7W B;  3RH8 B;  4ZRR A;  3IBJ A;  5HPI A;  3LIB A;  4BMW A;  3NOT C;  3NOP C;  1P97 A;  4HP4 A;  1X0O A;  3BW6 A;  5F5Y A;  2A24 A;  5DJT A;  3B33 A;  4HJ3 A;  3UE6 A;  4OOM A;  4XT2 A;  1OJ5 A;  3LID A;  4AFI A;  4R3A A;  3KSF A;  1VB6 A;  4ARZ B;  1YKD A;  4Y5F A;  1Y28 A;  3OCL A;  3TE8 A;  3BQA A;  1TS6 A;  1GSX A;  4WF0 A;  3OLO A;  3HCY A;  3C2W A;  4KUK A;  1ZHH B;  2NUP C;  4M4X A;  1MC0 A;  5HWT A;  4EET B;  5I5L A;  3LR5 A;  1LT0 A;  1F9I A;  1XJ3 A;  3W2Z A;  4EXO A;  5KSH A;  3PBR A;  4HOI A;  3VE3 A;  4I3J A;  4GS9 B;  1V9Y A;  2A24 B;  2VEA A;  3ICY A;  3LIA A;  5C5K A;  3NHQ A;  2M1C A;  4FOF A;  2PD8 A;  4GW9 A;  2HV1 A;  3BWL A;  3K2N A;  3EOI A;  1XJ6 A;  4Z1W A;  2EA9 A;  2M7V A;  4HHD A;  2BAS A;  5HDD A;  1LSX A;  4JGR A;  2HF6 A;  2PYP A;  1TS7 A;  4EES A;  2K31 A;  3FPV A;  3F1N A;  4NEE D;  5G4Z A;  4JGQ A;  3E0Y A;  3JVV A;  2JHE A;  3CWF A;  4L0L A;  3EGD C;  3VV4 A;  2W1T B;  1H3Q A;  4P6Z S;  3MQQ A;  1S4S A;  3E98 A;  5IU1 A;  2EWV A;  1G6O A;  1OT9 A;  2W3E A;  2GZA A;  4EUV A;  4R70 A;  2O9A A;  2D02 A;  2R78 A;  2V0U A;  3H9W A;  1KOU A;  2OWJ A;  3NJA A;  2GNX A;  4O8G A;  2M7U A;  3KO6 A;  4LRX C;  3E4P A;  4L9F A;  3LI9 A;  3KSH A;  4UEY A;  5J7E A;  2VGL M;  3F1N B;  4HJ4 A;  2Y8H A;  3MF0 A;  1P9W A;  2K7S A;  4MDZ A;  3KSI A;  3R7W A;  1LL8 A;  4OOL A;  4CLC C;  3C30 A;  5K5B A;  5HWW A;  4O0P A;  5CX7 A;  3V67 A;  3T4Q A;  4II7 A;  4ETZ A;  2IA2 A;  4MCW A;  5HD5 A;  4UQI S;  5TJJ A;  3LUQ A;  4WLA A;  3O5Y A;  3F1P B;  3NOU C;  4B93 A;  2PT7 A;  1VHM A;  3LI8 A;  4H6J A;  1ODV A;  2KOI A;  3UB6 A;  4HI4 A;  4KUO A;  2O9B A;  3BJN A;  3H82 A;  1IOU A;  3G6O A;  3FC7 A;  4GHI A;  2ZOI A;  3BQ8 A;  3CLO A;  3HJK A;  1MZU A;  1EW0 A;  1XJ2 A;  2VKS A;  5J3W A;  4EU0 A;  2QJ5 A;  2PR5 A;  4YNR A;  1ZTU A;  3U2A A;  4ETX A;  4CQH A;  2CMN A;  2V0W A;  4IUH A;  4PAU A;  3R7W B;  1S67 L;  4R6L A;  2JKR M;  1XFQ A;  3CUE C;  5L8M A;  3S7Q A;  4PKY A;  4HIA A;  3OBF A;  3B47 A;  4BJP A;  2W3G A;  4GS9 A;  4I38 A;  2P08 A;  4H6J B;  4EW7 A;  2PHY A;  2JKT I;  2ZMF A;  3D3O A;  1S1Z A;  2QKP A;  3H82 B;  5HDC A;  4GHI B;  3S7O A;  1YSQ A;  2VZW A;  1NRJ A;  2VV6 A;  1DP8 A;  3VE4 A;  1NWZ A;  2VJW A;  3KYZ A;  4RQ9 A;  1W63 M;  5DKL A;  2L4R A;  2WKR A;  3CI6 A;  4WEK A;  2QYB A;  4G3W A;  2W1T A;  4QPR A;  1UGU A;  4NXG A;  2XA7 S;  4DJ3 A;  3MJQ A;  1NLY A;  1TF1 A;  5TBM A;  3PBO A;  3PXP A;  3TJZ C;  2H28 A;  1P0Z A;  2EWW A;  3HJI A;  2I9V A;  2V9A A;  3F1O B;  2O99 A;  2HGV A;  3T4L A;  3GDI A;  1N9N A;  2W3D A;  4HJ6 A;  4HH3 A;  5KIZ A;  3EEH A;  2PYR A;  4JGO A;  4GCZ A;  4I5S A;  2ZBB A;  1DP6 A;  4HNB A;  5EFW A;  1STZ A;  4EEP A;  3LYX A;  3FPW A;  1TS0 A;  2L0W A;  3CIT A;  1OPX A;  3LIC A;  3LIE A;  3PYP A;  2JN7 A;  5TBM B;  3T4T A;  4WEL A;  3DBA A;  2DMW A;  1UWP X;  2LB5 A;  2OOL A;  3F1P A;  3ZQ5 A;  2GJ3 A;  3GEC A;  3OCN A;  3SW1 A;  3UE3 A;  4BBT A;  2KDK A;  3PR6 A;  3PHY A;  1DP9 A;  2KLI A;  4BBV A;  4LRZ E;  4L9G A;  2QJ7 A;  5F6A A;  5AVF A;  4NXB A;  1F5M A;  5HPF A;  2Z6C A;  2YKF A;  3LR3 A;  3LR4 A;  2O9C A;  1GSV A;  3RFB A;  2W3F A;  2ZOH A;  1TS8 A;  2W0N A;  2LB9 A;  1YSP A;  3MFX A;  4E04 A;  1V9Z A;  1T19 A;  4NXF A;  4EQ1 A;  5DKK A;  4EER A;  2QHK A;  1T1C A;  4LPZ A;  3K3C A;  3KYQ A;  3LFV A;  4G3K A;  4GLQ A;  4WN5 A;  3E4Q A;  1YAX A;  1OT6 A;  1OTA A;  1NLZ A;  2D01 A;  4DMZ A;  5HL6 A;  1T1B A;  1XJ4 A;  1WA9 A;  1OJG A;  1JNU A;  2P04 A;  4HH2 A;  3D72 A;  2PR6 A;  4MN7 A;  3MR0 A;  3BY8 A;  3VOL A;  3TRC A;  4MN5 A;  4CLC E;  4DN0 A;  4NXE A;  4Q0H A;  3F1O A;  2OAP 1;  2J80 A;  3T4J A;  3KSG A;  5A8B A;  3EQU A;  4PKY G;  1F98 A;  1UWN X;  3E4O A;  4G3V A;  2K2N A;  3ZYT A;  3EGX C;  5HSQ A;  5HDS A;  1T1A A;  3ULF A;  3UME A;  5IS1 A;  2PDR A;  3C8C A;  2INW A;  2OAQ 1;  4P6Z M;  4R38 A;  4B9O A;  2J3T D;  3FG8 A;  5AJG A;  2W1R A;  4GJ4 A;  2XRO A;  2WKQ A;  1OTE A;  5G4Y A;  4MMN A;  3EQV A;  1DRM A;  4IJG A;  3IS2 B;  4F3L A;  1OTD A;  1D06 A;  1OTI A;  4O01 A;  3UB8 A;  3JVU A;  2L1M A;  5HZH A;  3KX0 X;  3K3D A;  4I3I A;  2A2L A;  2VX8 A;  4Y2F A;  1P9R A;  3S7N A;  5FL3 A;  1LSW A;  2HJE A;  4HY8 A;  2OWH A;  4CLC A;  3MXQ A;  2VLG A;  2V1B A;  2Z6D A;  4FSF A;  3CAX A;  4L9E A;  3T50 A;  3IBR A;  2VV8 A;  5DJU A;  4ME4 A;  2PD7 A;  3P7N A;  4UQI M;  3B42 A;  3S7P A;  1S66 L;  2B02 A;  4XT2 B;  4F3L B;  3UB9 A;  1XFN A;  3A0S A;  2B18 A;  3MMH A;  3MQO A;  3P01 A;  3C38 A;  3OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...