3HLWA

Ctx-m-9 s70g in complex with cefotaxime
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
publication title Structural insights into substrate recognition and product expulsion in CTX-M enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3hlwA00
4MEZA 5EVLA 1N9BA 2FFYA 2WYXA 1L0GA 4FD8A 1S0WA 2Z2MB 4L0LA 5FATA 3FZCA 3QNBA 4WZ5A 1PI4A 4P87A 4DE1A 1IELA 1MWUA 1NZOA 3AGEA 3PTEA 3VSLA 2EX9A 5CGWA 3ZNTA 4EQIA 2BG1A 5GLCA 3MXSA 1NYMA 1LI9A 1IYOA 4ZJ1A 1GCEA 3O86A 4IVKA 1I2WA 4BJPA 2ZQ8A 1E3UD 4FCFA 1JTGA 4ID4A 5DF7A 4U0XA 2DNSA 2P9VA 3EQUA 4F94A 1ONHA 4PM8A 3PAEA 3FYZA 3NCKA 4ZDXA 1LL5A 2I72A 3UE3A 5L2FA 5CGXA 4LCLA 5GL9A 4HESA 2Y2HA 4R4SA 3BFCA 4ZJ2A 3UDIA 3ZDJA 4JXSA 2WADA 5G18A 4YFMA 2OLVA 3ZHHA 5F82A 1EWZA 1ES4A 3JYIA 5M19A 1TDLA 3C4OA 1J9MA 2Y4AA 3AGFA 1SHVA 2ZC4B 3QNCA 1ES3A 1I5QA 3BEBA 3CZDA 4ZJ3A 3G34A 4S2PA 1MPLA 3BFFA 3HUMA 3ZG0A 3FWLA 4OQGA 1BULA 3NI9A 1K55A 5DTTA 2XK1A 2ZD8A 3Q82A 2H5SA 1SDEA 1U60A 2ZMAA 4LV2A 3M2KA 1ZKJA 2EFUA 4UAAA 1CEGA 5TR7A 2VGJA 3IF6B 3S22A 5D3OA 3LO7A 5DTKA 4EWFA 1XKZA 3Q1FA 2A49A 1XP4A 2X02A 3N7WA 2R9WA 2Q9MA 2Y2LA 5EVIA 1KGEA 1PW1A 3GR2A 5HL1A 4WYYA 1YMXA 3S4XA 2J9PA 3HREA 4LV3A 3TSGA 4BD1A 5F1FA 2QPNA 3HLFA 5AQ7A 3IHAA 4LV1A 4OQIA 2Y2OA 4O7DA 1M40A 5M1AA 4JF6A 1DY6A 4Z9QA 1GHPA 2Y2PA 3FKVA 2PBYA 2WGWA 2EXAA 4Y0OA 2XD5A 4KENB 3GTCA 4JXWA 1FR6A 3MZEA 2PU4A 1IKGA 1MWRA 1WYBA 5FSRA 1PZOA 5GHXA 1YLWA 3EQVA 1Q2PA 3HUOA 2X71A 1ERMA 4DE0A 4R3BA 2WAFA 4E3JA 1GHMA 4Y7PA 3BFGA 1Q2QA 1L0EA 2Y2JA 3IF6C 3PBNA 2WKIA 1BLPA 4K0XA 1G68A 1SCWA 2RCXA 4FH2A 4X56A 3GQZA 1IKIA 1MBLA 1MWSA 1LHYA 4QY6A 4GOGA 4MBHA 2ZC5B 2Y55A 3FKWA 3ZNYA 2XLNA 1RP5A 3VFHA 3CG5A 3GRJA 4WEJA 1BLSA 2ZC3B 3G32A 1LLBA 1MKIA 4OP5A 2V2FF 3TG9A 4KQRA 3VP0A 4C6YA 4RX3A 1PYYA 2HP6A 4WBGA 3ZCZA 4KZ3A 1BTLA 3NDEA 3IXGA 4GD8A 4GNUA 4UA7A 3V39A 5FASA 2OSUA 1XPBA 5F83A 2VGKA 3IWQA 5E2HA 1S6RA 3LEZA 1NRFA 4JKTA 4WMCA 5CXWA 1GHIA 1YLTA 2EX6A 3GSGA 3I7JA 3WS4A 5GLAA 3W4OA 1ZG6A 3Q7VB 4S2IA 4JF5A 3LCEA 3ZG5A 3C4PA 2IWDA 3HLCA 3QHYA 5HX9A 5CECA 3MZFA 4GZBA 5AQ9A 4KZ4A 2EX2A 5HW3A 5CHJA 3SS4A 3W4PA 2XD1A 3MBZA 4MNRA 5FA7A 1YM1A 4OQHA 3Q7ZA 3UPNA 2XEPA 4KZAA 1FSWA 4HEFA 4OH0A 2EXBA 4KG5A 4E3IA 2OV5A 4M3KA 3A3FA 3A3IA 4OLDA 3OC2A 1Y54A 5CTMA 3IWIA 3WS1A 1PWDA 1WE4A 4OLGA 2V1ZA 3V50A 4PM5A 1W79A 1E25A 4CPKA 3BM6A 1TEMA 3RJUA 5IHVA 2WGVA 1BZAA 1TDGA 2HDSA 3TOIA 3HLDA 1CEFA 3GMWA 4OKPA 4ZAMA 4R0QA 5HFOA 2X01A 3WWXA 5DF8A 1FQGA 3DWZA 5FAOA 1YT4A 2ZQ9A 3N8LA 4QB8A 5HAPA 4X55A 4PPRA 4WELA 2HP9A 2Y2MA 4U3TA 3SS5A 3ZVWA 2HP5A 2GDNA 1DJCA 4X68A 3E2KA 3W8KA 5A92A 5FI7A 1ESUA 4E3MA 4OONA 4DDSA 1K56D 3Q07A 1XGIA 3SH7A 1NJ4A 1GA0A 1JTDA 3O88A 5DVAA 3O87A 4PM9A 5CEBA 1CI8A 4IEDA 4P0MA 3MXRA 4N9LA 4OPQA 4S2MA 2WKEA 2Y2NA 4OQ0A 4JBFA 4OOLA 4GD6A 2B5RA 2V20A 4MLLA 2XGNA 1H5XA 4C3QA 1KGGA 2C5WB 1OMEA 3LY3A 5EUAA 1ERQA 4HBUA 4OPZA 5CGSA 4KZ7A 3UE0A 4E3KA 1K57A 2ZQ7A 3BRMA 2H0YA 3OCNA 1BLHA 1Z6FA 1HVBA 3BFDA 5FAPA 2Y91A 4DE3A 1O07A 1G6AA 2ZM0A 2JE5A 4GN2A 1JWZA 1JWVA 3M2JA 4UHUA 3IH8A 5CHUA 1E3UA 2BLSA 3WS5A 2OLUA 1C3BA 2XH9A 1K6SA 2ZC7A 3DWKA 3IQAA 4GKUA 4RYEA 2IWCA 3SH8A 1BSGA 4ZTKA 4ZBEA 3SS3A 1W8QA 1HD8A 5EOOA 2HDQA 5DTSA 4XXRA 5AQAA 3NC8A 4JPMA 3G35A 4U0TA 4Y0TA 1ZC2A 4KZ8A 3HBRA 3IXDA 3Q81A 1FSYA 3GV9A 5U47A 1FCMA 3N4IA 3UE1A 1IYQA 4WZ5C 3V3SA 1IYPA 4QU3A 5CEDA 2DRWA 4XUZA 3WS0A 3VP1A 2Y2IA 1EI5A 1K56A 1PW8A 1YLYA 5FQ9A 4EBLA 3PBRA 2HDUA 3PBSA 5KMWA 2G2WA 2JC7A 4R1GA 4EUZA 4WEKA 5EOEA 1KE0A 3ISGA 1RGZA 3UN7A 3VP2A 1L0FA 4RA7A 3HL9A 4Q8IA 2Y2KA 3HLWA 3W4QA 1O7EA 2XR0A 5I94A 1XX2A 1K38A 5EVIB 1PZPA 3VP4A 4D2OA 1BUEA 3Q7VA 1FCNA 4B4XA 1JVJA 4P6BA 5FQMA 1N4OA 1CK3A 1I2SA 1ZG4A 2QZ6A 4DF6A 4E6XA 2ZC6B 5E2GA 3B3XA 4LV0A 1ALQA 3UNWA 4BL2A 5JYOA 1YMSA 5TGFA 3N8RA 3ZVTA 4RVAA 5A91A 1L2SA 1FCOA 1YLPA 3A3DA 2WGWB 4JXVA 1H8ZA 4P85A 2Y2GA 4WM9A 3UPPA 5CTNA 5FQKA 1MWTA 2FFFB 2Q9NA 1K6RA 1LL9A 1BLCA 2WKHA 5GLBA 1MY8A 3UDXA 1XGJA 4K0WA 4LCMA 3VOZA 3NY4A 4BQMA 2WZZA 3ZGAB 3IXBA 5KZHA 1KGFA 1ONGA 2JCHA 3NBLA 1KDWA 3P09A 4UA6A 4IBRA 5FQJA 1MXOA 4DKIA 3VMAA 1NXYA 5CRFA 5EVIC 4OPRA 4JXGA 4EBPA 2WUQA 3BLMA 5GHZA 4KQQA 4H8RA 1K25A 1XA1A 5FDHA 1DJBA 3A3EA 2XFTA 3ZG8B 4OP8A 1BT5A 2ZQAA 3IXHA 3MKEA 5FI2A 2G2UA 1IEMA 4CJNA 1RGYA 4KZ9A 2H0TA 4OPYA 1KDSA 1WYCA 3UY6A 4S2OA 4KG2A 4PM7A 2JBFA 4E3LA 3IT9A 3IF6A 5EVID 4KZBA 3PBQA 1H8YA 4NETA 2UWXA 3ZG7B 2ZJ9A 1E4DA 3C7VA 1YLJA 1KVMA 4IBXA 2ZM2A 1FOFA 3IHBA 2RL3A 5EECA 4GDNA 3CMZA 3VOYA 1M6KA 3WS2A 3BLSA 3A3JA 3ITAA 4N9KA 5JYPA 1PI5A 3OPLA 2WZXA 3M6BA 3UO9A 4BD0A 2HDRA 2PU2A 2WAEA 5HARA 5E43A 3LY4A 4GB7A 1K4EA 3G30A 4FSFA 2ZQCA 3IF5A 3MKFA 2A3UA 3G2ZA 4N92A 4RX2A 2J9OA 1SKFA 3C5AA 5E2EA 1DJAA 3DW0A 5E2FA 4R23A 4R4RA 1PWCA 5A93A 1W7FA 4DRTA 1NZUA 3PBTA 3P98A 3ZG9B 3M6HA 3OCLA 3HUNA 1YQSA 3PAGA 4QHCA 4E6WA 2P9VB 1LI0A 3ZFZA 4PMAA 3VP3A 2WGIA 4N1XA 1VM1A 4JF4A 3V3RA 1K54C 3BECA 4IVIA 1GA9A 3IWOA 4KG6A 5FQQA 4PM6A 5TFQA 2XF3A 3PBOA 4JLFA 4BLMA 3GVBA 1TVFA 1W5DA 3SOIA 2ZM8A 4DXCA 5A90A 3HLGA 4X6TA 4R3JA 5KSHA 1AXBA 4X69A 1L0DA 3UPOA 3WRZA 4E3NA 1RCJA 4S2KA 4S2NC 3S1YA 4B4ZA 3OPRA 5EPHA 3G2YA 5BOHA 1HZOA 1FR1A 2XFSA 4S2JA 3V5MA 1ES5A 4EV4A 3C7UA 3WRTA 1KE3A 2H10A 5CERA 2Y59A 4WMCD 5GHYA 3N6IA 5FI6A 4E3OA 3VFFA 4C75A 3E2LA 1IYSA 4KZ6A 2J7VA 1KVLA 5F1GA 4S2LA 4GDBA 5HAQA 2HPBA 3O3VA 3MFDA 3NDGA 3VSKA 4DXBA 2CC1A 4KQOA 3MZDA 4NK3A 3G4PA 3OPPA 1VQQA 4XUXA 5EE8A 1HTZA 5M18A 3BYDA 3G31A 5FAQA 3CJMA 3RXXA 5KSCA 4QJGA 1KE4A 1QMEA 1PWGA 3N8SA 4YINA 2E8IA 2P74A 2Z2LB 1YLZA 3BFEA 3NIAA 1ESIA 3RXWA 1JWPA 5FQIA 4EBNA 2QMIA 1NY0A 1PIOA 4FH4A 5J8XA 4K91A 2R9XA 3SH9A 2ZLYA 4OOMA 1QMFA 4OVDA 1K4FA 1W8YA 2J8YA 1EROA 2C6WB 1XXMA 4LENA 1K55C 1XA7A 3DTMA 1ES2A 2EFXA 5HAIA 2IWBA 4QD4A 5DF9A 3UDFA 4KZ5A 4DDYA 1CI9A 4OOYA 3OZHA 3HLBA 2Y2QA 1NYYA 4N1HA 2XQZA 3FV7A 3ITBA 4Y0UA 1K54A 1SDNA 5AQBA 4X53A 4DE2A 4MBFA 1K57C 4UA9A 3OPHA 4MBKA 2ZQDA 2WK0A 2XDMA 4BENA 2DCFA 2EX8A 5CHMA 4HBTA 4BL3A 4B88A 3D4FA 3HVFA 3IH9A 4A5RA 3AGDA 4WZ4A 4S2NA 4QY5A 5GLDA 3HLEA
chains in the Genus database with same CATH superfamily
5EVLA 1S0WA 3FZCA 1PI4A 3KO6A 3VSLA 2EX9A 3MXSA 2M7VA 4ZJ1A 4BJPA 5DF7A 1JTGA 4U0XA 2VV6A 4F94A 3FYZA 4ZDXA 1FIKA 1LL5A 3UE3A 5CGXA 1AWIA 3LR4A 4LCLA 5GL9A 3BFCA 5G18A 3ZHHA 4P6ZS 3T12B 2Y4AA 2ZC4B 3BEBA 3HUMA 3IX4A 3NI9A 2OAQ1 5DTTA 2ZD8A 2H5SA 3QP1A 4G3KA 4UAAA 4LV2A 2JKTI 4HJ6A 2ZOHA 3S22A 5D3OA 3LO7A 4EWFA 1P0ZA 3N7WA 4HOIA 2Q9MA 4WYYA 4EUVA 1VEUA 3T50A 3HREA 4GS9B 3LIFA 3IHAA 4O7DA 5M1AA 1GHPA 3ULFA 2XD5A 4JXWA 1YSPA 1IKGA 3LI8A 5GHXA 1XJ2A 2QHKA 1EW0A 4E3JA 1BLPA 3GECA 2HF6A 2W3DA 4FH2A 3B47A 2JKGA 1XJ4A 1IKIA 1MBLA 1NLZA 4QY6A 3FKWA 4LRYC 3VFHA 2EWWA 3TG9A 3LICA 3VP0A 1PYYA 3ZCZA 4WBGA 3IXGA 2GX5A 2JKFA 4GNUA 1XPBA 3MXQA 3IWQA 3F1PA 1S6RA 3H82A 3S7NA 4WMCA 1GHIA 1XJ3A 3CAXA 3I7JA 3W4OA 2ZBBA 5HX9A 5CECA 3MZFA 5AQ9A 5CHJA 3SS4A 1T19A 3Q7ZA 3UPNA 4ARZA 4HEFA 4OH0A 4Z1WA 1SKOB 2QKPA 4E3IA 2XA7S 4M3KA 4OLDA 3OC2A 3F1NA 3IWIA 4OLGA 3E4QA 4CPKA 1YPRA 2VJWA 3LGOA 5LBRA 2X01A 1WA9A 3MQ0A 4X55A 4WELA 1VETA 2Y2MA 4U3TA 3ZVWA 3E2KA 3LIDA 5FI7A 1ESUA 3Q07A 1XGIA 1NJ4A 3O87A 4PM9A 4IEDA 3MXRA 1XFQA 4OPQA 4RQ9A 4JBFA 4OOLA 2B5RA 4HBUA 3UE0A 3T4OA 1YKDA 2W3HA 2H0YA 1H8MA 4HH2A 3BFDA 3K3DA 5FAPA 4Y3IA 1JWZA 5HPIA 1D7EA 4I38A 5CHUA 2XH9A 4HH3A 4RYEA 3R7WA 3SS3A 5EOOA 2HDQA 4Y13A 2QJ7A 5DKLA 4Y0TA 3JVUA 3GV9A 3N4IA 3UE1A 1IYQA 4WZ5C 3V3SA 2XROA 2VA0A 3VP1A 4ETXA 1YLYA 4EBLA 2HDUA 1STZA 4O8GA 5KMWA 2G2WA 2JC7A 3HL9A 2AVXA 3W4QA 4GLQA 1K0KA 4GHIA 3Q7VA 1VEUB 4KUKA 4YOFA 1N4OA 1I2SA 1SZVA 3CUEA 1H0MA 2E8JA 1ZG4A 2A24B 5E2GA 2ZMVA 3B3XA 4LV0A 1ALQA 4BL2A 1YMSA 5TGFA 3ZVTA 4RVAA 1H8ZA 2VKSA 3ICYA 4EEUA 1OTAA 4MDZA 1GSXA 1K6RA 1BLCA 3D3OA 2WKHA 4BBTA 4K0WA 2W3EA 4JGOA 4BQMA 4L9GA 2LB9A 2JCHA 3P09A 4DKIA 1NXYA 4OPRA 1OT6A 3T4SA 4L9EA 3MKEA 2G2UA 3JVVA 3IS2A 1H8YA 4NETA 2QWSA 3F1PB 3H82B 2ZM2A 3IHBA 3PYPA 2HV1A 3BLSA 5FEGA 2WZXA 3M6BA 3UO9A 2PU2A 2V8CA 4FSFA 2VLGA 3IF5A 4CLCE 2PYPA 5L10A 5E2EA 4ME4A 4X25A 4R4RA 4ARZB 4DRTA 2PRFA 1NZUA 5F6AA 1YQSA 5J4EA 5FL3A 5J3WA 4JLFA 4LRZE 3SOIA 3UB6A 4DXCA 5A90A 1N9OA 1VETB 4R3JA 4UEYA 2O99A 2NUPC 4B4ZA 5EPHA 1D06A 3G2YA 2XFSA 4QWOA 2P7JA 3V5MA 4D60A 3MF0A 4I39A 2HJ9C 4E3OA 3NJAA 1IYSA 4KZ6A 4S2LA 3ZYTA 5HPFA 3NDGA 4KQOA 3MZDA 3LI9A 4XUXA 5EE8A 2E8IA 3A0SA 1YLZA 3BFEA 3NIAA 1NY0A 3ZQ5A 4FH4A 5J8XA 4K91A 1T1AA 3EGXC 3R7WB 2J8YA 5L07A 2IWBA 3VOLA 2XQZA 3ITBA 4Y0UA 3FPVA 1SDNA 4KQDA 4X53A 5AQBA 2ZL1A 1HLUP 2LB5A 3MSHA 5EFWA 2ZQDA 2XDMA 4BL3A 1ACFA 4WUJA 4WZ4A 1F9IA 4GHIB 4QY5A 1X0OA 2FFYA 2WYXA 2XRNA 4WZ5A 4HIAA 3PTEA 1MWUA 5CGWA 2BG1A 5GLCA 1NYMA 1P97A 4ZRRA 1GCEA 4ID4A 2PHYA 3T1XA 1VB6A 3EQUA 2O0YA 1ZTUA 3BJNA 4PKYA 2Y2HA 3UDIA 2WADA 4YFMA 1S1YA 1ES4A 3JYIA 1SHVA 4X1MA 2JKRI 3CITA 1ES3A 1I5QA 3CZDA 4ZJ3A 5EV0A 4S2PA 3ZG0A 3FWLA 2PR6A 4OQGA 1K55A 1J3WA 2XK1A 3A0RA 2ZMAA 1U60A 3M2KA 1CEGA 3IS2B 3DBAA 3UB7A 2A49A 4HI4A 2YKFA 2R9WA 2Y2LA 1NWZA 3T4LA 1YMXA 4IHQA 3TSGA 2QPNA 3HLFA 4WL9A 5AQ7A 3DTIA 4OQIA 3C8CA 1M40A 4JF6A 1DY6A 2Y2PA 2PBYA 2EXAA 4Y0OA 2D02A 1YLWA 1Q2PA 1NLYA 2X71A 3HUOA 1Q2QA 3IF6C 2KOIA 2WKIA 5HDDA 2RCXA 2B95A 3HJIA 4NXBA 4EXOA 3MMHA 4MBHA 2ZC5B 3ZNYA 3CG5A 2P04A 1BLSA 2ZC3B 2V2FF 5L09A 4KZ3A 3NDEA 2I9VA 3O5YA 4GD8A 3RH8B 1ODVA 1CF0A 3LEZA 4O01A 4JKTA 1YLTA 1W63M 3GSGA 3WS4A 5GLAA 4S2IA 4DJ2A 4JF5A 5FEFA 2J3TC 5HWVA 4NXGA 2PDRA 2XD1A 4MNRA 1V9ZA 2XEPA 4KZAA 2K7SA 2EXBA 2J3TD 2OV5A 3LEQA 3BM6A 3RJUA 2HDSA 4OKPA 2L1MA 4R0QA 3WWXA 3DWZA 3U4LP 2ZL1B 2ZQ9A 3N8LA 5HAPA 2IA2A 2GDNA 3W8KA 5A92A 4DDSA 1GA0A 1JTDA 2KDKA 5DVAA 3CUEC 3V67A 5CEBA 2WKEA 4OQ0A 2V20A 4MLLA 2XGNA 3LY3A 1ERQA 4KZ7A 2PYRA 1IOUA 1HVBA 2Y91A 1O07A 2ZM0A 2JE5A 4GN2A 3M2JA 3TJZC 3WS5A 1IFQA 1K6SA 3DWKA 4GKUA 3SH8A 1BSGA 4ZTKA 1GSWA 3BQ8A 4WF0A 4JPMA 1OTEA 1CQAA 1ZC2A 4KZ8A 3HBRA 3IXDA 4F3LA 1FSYA 1FCMA 1UWNX 1IYPA 4QU3A 5CEDA 3WS0A 1K56A 1PW8A 3PBRA 4MN6A 4R1GA 5HD5A 4II7A 3KSGA 4WEKA 1VHMA 5EOEA 3VP2A 1L0FA 4Q8IA 2YKHA 1K38A 4MN7A 4Y2FA 4HJ4A 5FQMA 1CK3A 3NOPC 3T1QB 4EETB 2ZC6B 5L8MA 3N8RA 1L2SA 1YLPA 5CX7A 5AJGA 3UPPA 2Q9NA 2FFFB 1MY8A 3IXBA 3EWKA 5KZHA 1ONGA 4IBRA 5HDCA 3IBRA 5EVIC 4JXGA 1OTIA 1DJBA 3T1RA 1BT5A 4R38A 2H0TA 1KDSA 3UY6A 3LFVA 4S2OA 3IX8A 4E3LA 3IT9A 3IF6A 5EVID 4KZBA 2Y8HA 3PBQA 2UWXA 3ZG7B 2ZJ9A 3EEHA 2V0UA 1KVMA 1FOFA 3CMZA 4HP9A 1M6KA 3A3JA 2D01A 3OPLA 2EWVA 3FC7A 4BD0A 2HDRA 2WAEA 5HARA 2OAP1 2K31A 4GB7A 4CLCC 2J9OA 1SKFA 3C5AA 3MQQA 5E2FA 2Z6CA 3OOVA 2HZ5A 1W7FA 3TW8A 3PBTA 3ZG9B 3M6HA 1L3LA 3HUNA 4Q0HA 3VP3A 4CLCD 4JF4A 3F1OA 4KG6A 5TFQA 4I3IA 1TVFA 5J7EA 3BW6A 1AXBA 4X69A 1XFNA 4E3NA 1RCJA 3S1YA 4JGPA 1FR1A 3D9YA 5IU1A 3C7UA 3WRTA 2W3GA 1TS8A 2VZWA 3VFFA 1KVLA 5HAQA 2HPBA 3O3VA 4QPRA 4DXBA 3VSKA 4G3WA 2CC1A 1XJ6A 4K08A 3OPPA 5M18A 3BYDA 3G31A 3CJMA 2INWA 4QJGA 1PWGA 1S4SA 2WKPA 3RXWA 5FQIA 2J80A 4GJ4A 1QMFA 1K55C 1NRJA 4B9OA 4F3LB 4KZ5A 4WN5A 1CI9A 4OOYA 3OZHA 1NYYA 4HJ3A 2OWHA 4MBFA 4MBKA 1UGUA 2WK0A 3IX3A 5CHMA 3CHWP 4HBTA 4B88A 3FPWA 3HVFA 3IH9A 3AGDA 3P7NA 3A0VA 2CMNA 1L0GA 2KX6A 2Z2MB 4L0LA 3QNBA 3QP6A 4NXFA 1IELA 3AGEA 2M7UA 3MFXA 1A0KA 1LI9A 1IYOA 3L9KA 4IVKA 1I2WA 1E3UD 4FCFA 2P9VA 3KX0X 1ONHA 3PAEA 3RTYA 3NCKA 2I72A 5HZHA 3ZDJA 4ZJ2A 4ETZA 4R4SA 5HL6A 3C2WA 2G7UA 2OLVA 2HGVA 5F82A 1EWZA 3NECA 5M19A 1TDLA 1J9MA 1KOUA 3AGFA 4EU0A 1T1CA 3G34A 2VGLM 3BFFA 1MZUA 3F1NB 3LIBA 1BULA 2PD7A 5A8BA 2EA9A 1ZKJA 2VGJA 3IF6B 5AVEA 5DTKA 1XP4A 5IS1A 3H7WA 2X02A 5EVIA 3GR2A 5HL1A 3NHQA 4LV3A 4JGQA 4BD1A 3E98A 4LV1A 2Y2OA 3LR5A 4Z9QA 1DP8A 3GTCA 3MZEA 2PU4A 3LIAA 2KLIA 1ERMA 4DE0A 4R3BA 5HWTA 4CQHA 2WAFA 1GHMA 4Y7PA 3PBNA 4MN5A 3LIEA 3F1OB 4K0XA 1G68A 3GQZA 2O9CA 4CLCA 1LHYA 2Y55A 3UMDA 1RP5A 2XLNA 4WEJA 3G32A 1LLBA 3QP5A 4KQRA 1OT9A 3KSFA 4C6YA 4RX3A 1BTLA 4BBVA 1Y28A 4UA7A 2OOLA 2OSUA 2GNXA 5E2HA 1DP6A 2MJ6A 1LSXA 5CXWA 2EX6A 3T4TA 2PT7A 3Q7VB 2V1AA 3HLCA 3QHYA 2PD8A 2EX2A 5HW3A 3NULA 3MBZA 5FA7A 1FSWA 4FUWA 4KG5A 4Q0JA 2JKRM 3A3IA 3WS1A 3V50A 3K3CA 2V1ZA 5HDSA 4NG2A 5IHVA 1BZAA 2WKQA 1TDGA 3HLDA 1CEFA 3GMWA 5FAOA 1YT4A 1OTBA 3QP2A 3SS5A 4X68A 1K56D 3SH7A 2V9AA 4N9LA 2Y2NA 4I5SA 4IJGA 4GD6A 4HQAA 1H5XA 2NUTC 4C3QA 1KGGA 2C5WB 1OMEA 2M1CA 3UB9A 5EUAA 1Y4OA 4E3KA 5CGSA 1CJFA 2L0WA 4DE3A 4PKYG 4Q0IA 4DMZA 1JWVA 3VE4A 4UHUA 3IH8A 1E3UA 3E4OA 3MJQA 3IBJA 3T4KA 2VK3A 2WKRA 4ZBEA 4PAUA 2B18A 3DTEA 4XXRA 3NC8A 1T18A 4U0TA 3Q81A 5FDSA 2DRWA 4XUZA 1RGZA 4RA7A 4I3AA 2H28A 2XR0A 5I94A 4AFIA 3H7WB 5EVIB 1PZPA 1JNUA 1BUEA 1JVJA 4MCWA 5I5LA 2QZ6A 4DF6A 2UV0E 3B42A 5JYOA 2Y2GA 3MR0A 1MWTA 1LL9A 3UDXA 5GLBA 5DJUA 4LCMA 3VOZA 2P08A 3CPTA 2VX8A 3ZGAB 1OJ5A 5FQJA 3NBLA 4HNBA 1KDWA 2ZMFA 4BMWA 1H3QA 1MXOA 3VMAA 3T4QA 4CLCB 2J3WA 2A2LA 2WUQA 3BLMA 5GHZA 4KQQA 1XA1A 5FDHA 3A3EA 2XFTA 3T4JA 1V9YA 5FI2A 1IEMA 4CJNA 5HSQA 1OTDA 1RGYA 4KZ9A 1WYCA 4PM7A 2JKTM 4Y17A 3KSIA 1S66L 5EM1A 4G3VA 3C7VA 1YLJA 4IBXA 2FZ0A 5EECA 3K2NA 4E04A 3VV4A 1G28A 4LLOB 3WS2A 3ITAA 4N9KA 4NKPA 5JYPA 4JGRA 5E43A 3LY4A 1GSVA 1K4EA 3G30A 3VE3A 2VGLS 2A3UA 4N92A 4RX2A 4HY8A 5DJTA 5K5BA 3UB5P 1PWCA 3KYZA 3P98A 3OCLA 4QHCA 3PAGA 4PMAA 2WGIA 4N1XA 3V3RA 3BECA 2BTFP 4IVIA 3IWOA 3PHYA 4PM6A 2W1RA 2XF3A 3PBOA 4BLMA 1W5DA 5MC7A 4X6TA 1D1JA 5KSHA 5F68A 3OPRA 5BOHA 1HZOA 4S2JA 3RFBA 1ES5A 1KE3A 2H10A 5CERA 2Y59A 2A24A 1OPXA 3N6IA 3E2LA 5F1GA 4GDBA 3PR6A 4NK3A 4YNRA 1N9LA 1HTZA 3CWFA 1FILA 3RXXA 5KSCA 1QMEA 4YINA 3QP8A 3CLOA 1ESIA 2OWJA 4EBNA 2QMIA 1PIOA 3SH9A 2ZLYA 4OOMA 1LSVA 3BWLA 1K4FA 1W8YA 1EROA 4LENA 1UWPX 3DTMA 4QD4A 5DF9A 3UDFA 4DDYA 3NOTC 1G6OA 1MC0A 1K54A 4R6LA 4BWIA 1K57C 1S1ZA 4XT2A 2EX8A 3D4FA 4A5RA 4S2NA 4EQ1A 3HLEA 4GCZA 4KUOA 3B33A 4MEZA 1N9BA 3KYEA 4FD8A 5FATA 1P9RA 4ESPA 2L4RA 4P87A 3UMEA 4DE1A 1ZHHB 5HD3A 1NZOA 3HCYA 3EGDC 3ZNTA 4EQIA 3O86A 2ZQ8A 2DNSA 4PM8A 2O9BA 5L2FA 2W3FA 3CPTB 4HESA 4PHTA 4JXSA 2W0NA 3R4KA 3C4OA 2Y79A 3C30A 3QNCA 4M4XA 3S7PA 1MPLA 1Z09A 3Q82A 1SDEA 1TS6A 3LR3A 2EFUA 4IUHA 2R78A 5TR7A 3PXPA 3BQAA 2W1TA 1XKZA 3Q1FA 4BBUA 1KGEA 1PW1A 3UB8A 3S4XA 2J9PA 3W2ZA 2VV7A 5F1FA 1MKMA 1LSWA 2ACGA 4B93A 3FKVA 2WGWA 3MQOA 4KENB 1FR6A 1MWRA 1WYBA 5FSRA 1PZOA 3EQVA 4EEPA 3BFGA 2Y2JA 1L0EA 4UQIM 1OJGA 1SCWA 4X56A 2B02A 3OLOA 2VV8A 4HP4A 3E0YA 1MWSA 2V8FA 2GJ3A 3GRJA 3LYXA 1MKIA 4OP5A 2HP6A 5FASA 3V39A 5F83A 2VGKA 1N9NA 1NRFA 5DKKA 4LPZA 1ZG6A 5KIZA 3BY8A 4EW7A 3LCEA 3ZG5A 3C4PA 2IWDA 4GZBA 4KZ4A 1PNEA 3JPUA 3W4PA 5F5YA 1S67L 1YM1A 4OQHA 5HWWA 1TF1A 3A3FA 5CTMA 1Y54A 1F5MA 1PWDA 1WE4A 4PM5A 1W79A 1E25A 1TEMA 2WGVA 1TS7A 3TOIA 5HFOA 4ZAMA 2V1BA 2QYBA 4LFUA 5DF8A 1FQGA 4HHDA 4QB8A 4PPRA 2HP9A 2HP5A 1DJCA 4XT2B 1LT0A 4H6JA 4E3MA 4OONA 3TRCA 3O88A 3CI6A 1CI8A 4P0MA 2FH5A 4P6ZM 4S2MA 4O0PA 3P01A 3LUQA 4OPZA 1K57A 5F69A 2ZQ7A 3BRMA 4R3AA 3OCNA 1BLHA 1Z6FA 3GDIA 1G6AA 3G6OA 2BASA 2K2NA 3DTKA 2BLSA 2OLUA 2DMWA 1C3BA 2ZC7A 3IQAA 2Q0OA 2IWCA 4NEED 1W8QA 4LGWA 1HD8A 5IT5A 2QJ5A 5DTSA 5AQAA 3G35A 3MS6A 1TS0A 1BYWA 3S7QA 5U47A 4R70A 2Z6DA 2GZAA 5G4ZA 2Y2IA 1EI5A 5FQ9A 3PBSA 5TBMA 3LR0A 2W1TB 4IUKA 5DFYA 4EUZA 1KE0A 2JN7A 3ISGA 5G4YA 3UN7A 2Y2KA 3KSHA 3HLWA 1O7EA 4Y15A 1XX2A 3VP4A 4D2OA 1FCNA 4LRXC 4B4XA 4P6BA 4EESA 2W27A 4YWZA 3DAVA 4E6XA 1F98A 5EM0A 3UNWA 4NXEA 5A91A 1FCOA 3A3DA 2WGWB 4JXVA 4P85A 4WM9A 5CTNA 5FQKA 2XSSA 3S7OA 1XGJA 4DJ3A 3NY4A 3U2AA 2WZZA 3SZTA 1KGFA 4UA6A 5CRFA 5C5KA 4EBPA 4H8RA 1K25A 2HJEA 3ZG8B 3NOUC 3EOIA 3HJKA 2ZQAA 3IXHA 4OP8A 1PFLA 4OPYA 2VEAA 4KG2A 2JBFA 3EEAA 3KYQA 2XA7M 1E4DA 2RL3A 4GDNA 2PR5A 5DFXA 3VOYA 3E4PA 3OBFA 1PI5A 4GW9A 2O9AA 4GS9A 3BY9A 2ZQCA 3MKFA 3G2ZA 5TJJA 4X1LA 3SW1A 1W63Q 4MMNA 1F2KA 1DJAA 3DW0A 4R23A 5A93A 4E6WA 1P9WA 2P9VB 1LI0A 3ZFZA 2PBDP 1VM1A 1K54C 1GA9A 2JHEA 2PAVP 5FQQA 5EVEA 3GVBA 2ZM8A 1LL8A 1PRQA 2ZOIA 3HLGA 1L0DA 3UPOA 3WRZA 4S2NC 4S2KA 4H6JB 3T1SA 3D72A 5AVFA 4Y5FA 3QP4A 4DN0A 4EV4A 4WMCD 5GHYA 5FI6A 3H9WA 4C75A 3C38A 4UQIS 1T1BA 2J7VA 3TE8A 3MFDA 3G4PA 1VQQA 2V0WA 4FTXA 5FAQA 1S4RA 1KE4A 3N8SA 2P74A 2Z2LB 1DP9A 1JWPA 4FOFA 2R9XA 4EERA 1SKOA 1G5UA 4OVDA 4WLAA 2C6WB 1YAXA 1XXMA 1XA7A 4I3JA 1ES2A 2EFXA 5HAIA 3FG8A 3HLBA 2Y2QA 4N1HA 3FV7A 1TD5A 1YSQA 4L9FA 4DE2A 4UA9A 5TBMB 3OPHA 3L7HA 1DRMA 3UE6A 4BENA 2DCFA 5GLDA 4GOGA
chains in the Genus database with same CATH topology
4MEZA 5EVLA 1N9BA 2FFYA 2WYXA 1L0GA 4FD8A 1S0WA 2Z2MB 4L0LA 5FATA 3FZCA 3QNBA 4WZ5A 1PI4A 4P87A 4DE1A 1IELA 1MWUA 1NZOA 3AGEA 3PTEA 3VSLA 2EX9A 5CGWA 3ZNTA 4EQIA 2BG1A 5GLCA 3MXSA 1NYMA 1LI9A 1IYOA 4ZJ1A 1GCEA 3O86A 4IVKA 1I2WA 4BJPA 2ZQ8A 1E3UD 4FCFA 1JTGA 4ID4A 5DF7A 4U0XA 2DNSA 2P9VA 3EQUA 4F94A 1ONHA 4PM8A 3PAEA 3FYZA 3NCKA 4ZDXA 1LL5A 2I72A 3UE3A 5L2FA 5CGXA 4LCLA 5GL9A 4HESA 2Y2HA 4R4SA 3BFCA 4ZJ2A 3UDIA 3ZDJA 4JXSA 2WADA 5G18A 4YFMA 2OLVA 3ZHHA 5F82A 1EWZA 1ES4A 3JYIA 5M19A 1TDLA 3C4OA 1J9MA 2Y4AA 3AGFA 1SHVA 2ZC4B 3QNCA 1ES3A 1I5QA 3BEBA 3CZDA 4ZJ3A 3G34A 4S2PA 1MPLA 3BFFA 3HUMA 3ZG0A 3FWLA 4OQGA 1BULA 3NI9A 1K55A 5DTTA 2XK1A 2ZD8A 3Q82A 2H5SA 1SDEA 1U60A 2ZMAA 4LV2A 3M2KA 1ZKJA 2EFUA 4UAAA 1CEGA 5TR7A 2VGJA 3IF6B 3S22A 5D3OA 3LO7A 5DTKA 4EWFA 1XKZA 3Q1FA 2A49A 1XP4A 2X02A 3N7WA 2R9WA 2Q9MA 2Y2LA 5EVIA 1KGEA 1PW1A 3GR2A 5HL1A 4WYYA 1YMXA 3S4XA 2J9PA 3HREA 4LV3A 3TSGA 4BD1A 5F1FA 2QPNA 3HLFA 5AQ7A 3IHAA 4LV1A 4OQIA 2Y2OA 4O7DA 1M40A 5M1AA 4JF6A 1DY6A 4Z9QA 1GHPA 2Y2PA 3FKVA 2PBYA 2WGWA 2EXAA 4Y0OA 2XD5A 4KENB 3GTCA 4JXWA 1FR6A 3MZEA 2PU4A 1IKGA 1MWRA 1WYBA 5FSRA 1PZOA 5GHXA 1YLWA 3EQVA 1Q2PA 3HUOA 2X71A 1ERMA 4DE0A 4R3BA 2WAFA 4E3JA 1GHMA 4Y7PA 3BFGA 1Q2QA 1L0EA 2Y2JA 3IF6C 3PBNA 2WKIA 1BLPA 4K0XA 1G68A 1SCWA 2RCXA 4FH2A 4X56A 3GQZA 1IKIA 1MBLA 1MWSA 1LHYA 4QY6A 4GOGA 4MBHA 2ZC5B 2Y55A 3FKWA 3ZNYA 2XLNA 1RP5A 3VFHA 3CG5A 3GRJA 4WEJA 1BLSA 2ZC3B 3G32A 1LLBA 1MKIA 4OP5A 2V2FF 3TG9A 4KQRA 3VP0A 4C6YA 4RX3A 1PYYA 2HP6A 4WBGA 3ZCZA 4KZ3A 1BTLA 3NDEA 3IXGA 4GD8A 4GNUA 4UA7A 3V39A 5FASA 2OSUA 1XPBA 5F83A 2VGKA 3IWQA 5E2HA 1S6RA 3LEZA 1NRFA 4JKTA 4WMCA 5CXWA 1GHIA 1YLTA 2EX6A 3GSGA 3I7JA 3WS4A 5GLAA 3W4OA 1ZG6A 3Q7VB 4S2IA 4JF5A 3LCEA 3ZG5A 3C4PA 2IWDA 3HLCA 3QHYA 5HX9A 5CECA 3MZFA 4GZBA 5AQ9A 4KZ4A 2EX2A 5HW3A 5CHJA 3SS4A 3W4PA 2XD1A 3MBZA 4MNRA 5FA7A 1YM1A 4OQHA 3Q7ZA 3UPNA 2XEPA 4KZAA 1FSWA 4HEFA 4OH0A 2EXBA 4KG5A 4E3IA 2OV5A 4M3KA 3A3FA 3A3IA 4OLDA 3OC2A 1Y54A 5CTMA 3IWIA 3WS1A 1PWDA 1WE4A 4OLGA 2V1ZA 3V50A 4PM5A 1W79A 1E25A 4CPKA 3BM6A 1TEMA 3RJUA 5IHVA 2WGVA 1BZAA 1TDGA 2HDSA 3TOIA 3HLDA 1CEFA 3GMWA 4OKPA 4ZAMA 4R0QA 5HFOA 2X01A 3WWXA 5DF8A 1FQGA 3DWZA 5FAOA 1YT4A 2ZQ9A 3N8LA 4QB8A 5HAPA 4X55A 4PPRA 4WELA 2HP9A 2Y2MA 4U3TA 3SS5A 3ZVWA 2HP5A 2GDNA 1DJCA 4X68A 3E2KA 3W8KA 5A92A 5FI7A 1ESUA 4E3MA 4OONA 4DDSA 1K56D 3Q07A 1XGIA 3SH7A 1NJ4A 1GA0A 1JTDA 3O88A 5DVAA 3O87A 4PM9A 5CEBA 1CI8A 4IEDA 4P0MA 3MXRA 4N9LA 4OPQA 4S2MA 2WKEA 2Y2NA 4OQ0A 4JBFA 4OOLA 4GD6A 2B5RA 2V20A 4MLLA 2XGNA 1H5XA 4C3QA 1KGGA 2C5WB 1OMEA 3LY3A 5EUAA 1ERQA 4HBUA 4OPZA 5CGSA 4KZ7A 3UE0A 4E3KA 1K57A 2ZQ7A 3BRMA 2H0YA 3OCNA 1BLHA 1Z6FA 1HVBA 3BFDA 5FAPA 2Y91A 4DE3A 1O07A 1G6AA 2ZM0A 2JE5A 4GN2A 1JWZA 1JWVA 3M2JA 4UHUA 3IH8A 5CHUA 1E3UA 2BLSA 3WS5A 2OLUA 1C3BA 2XH9A 1K6SA 2ZC7A 3DWKA 3IQAA 4GKUA 4RYEA 2IWCA 3SH8A 1BSGA 4ZTKA 4ZBEA 3SS3A 1W8QA 1HD8A 5EOOA 2HDQA 5DTSA 4XXRA 5AQAA 3NC8A 4JPMA 3G35A 4U0TA 4Y0TA 1ZC2A 4KZ8A 3HBRA 3IXDA 3Q81A 1FSYA 3GV9A 5U47A 1FCMA 3N4IA 3UE1A 1IYQA 4WZ5C 3V3SA 1IYPA 4QU3A 5CEDA 2DRWA 4XUZA 3WS0A 3VP1A 2Y2IA 1EI5A 1K56A 1PW8A 1YLYA 5FQ9A 4EBLA 3PBRA 2HDUA 3PBSA 5KMWA 2G2WA 2JC7A 4R1GA 4EUZA 4WEKA 5EOEA 1KE0A 3ISGA 1RGZA 3UN7A 3VP2A 1L0FA 4RA7A 3HL9A 4Q8IA 2Y2KA 3HLWA 3W4QA 1O7EA 2XR0A 5I94A 1XX2A 1K38A 5EVIB 1PZPA 3VP4A 4D2OA 1BUEA 3Q7VA 1FCNA 4B4XA 1JVJA 4P6BA 5FQMA 1N4OA 1CK3A 1I2SA 1ZG4A 2QZ6A 4DF6A 4E6XA 2ZC6B 5E2GA 3B3XA 4LV0A 1ALQA 3UNWA 4BL2A 5JYOA 1YMSA 5TGFA 3N8RA 3ZVTA 4RVAA 5A91A 1L2SA 1FCOA 1YLPA 3A3DA 2WGWB 4JXVA 1H8ZA 4P85A 2Y2GA 4WM9A 3UPPA 5CTNA 5FQKA 1MWTA 2FFFB 2Q9NA 1K6RA 1LL9A 1BLCA 2WKHA 5GLBA 1MY8A 3UDXA 1XGJA 4K0WA 4LCMA 3VOZA 3NY4A 4BQMA 2WZZA 3ZGAB 3IXBA 5KZHA 1KGFA 1ONGA 2JCHA 3NBLA 1KDWA 3P09A 4UA6A 4IBRA 5FQJA 1MXOA 4DKIA 3VMAA 1NXYA 5CRFA 5EVIC 4OPRA 4JXGA 4EBPA 2WUQA 3BLMA 5GHZA 4KQQA 4H8RA 1K25A 1XA1A 5FDHA 1DJBA 3A3EA 2XFTA 3ZG8B 4OP8A 1BT5A 2ZQAA 3IXHA 3MKEA 5FI2A 2G2UA 1IEMA 4CJNA 1RGYA 4KZ9A 2H0TA 4OPYA 1KDSA 1WYCA 3UY6A 4S2OA 4KG2A 4PM7A 2JBFA 4E3LA 3IT9A 3IF6A 5EVID 4KZBA 3PBQA 1H8YA 4NETA 2UWXA 3ZG7B 2ZJ9A 1E4DA 3C7VA 1YLJA 1KVMA 4IBXA 2ZM2A 1FOFA 3IHBA 2RL3A 5EECA 4GDNA 3CMZA 3VOYA 1M6KA 3WS2A 3BLSA 3A3JA 3ITAA 4N9KA 5JYPA 1PI5A 3OPLA 2WZXA 3M6BA 3UO9A 4BD0A 2HDRA 2PU2A 2WAEA 5HARA 5E43A 3LY4A 4GB7A 1K4EA 3G30A 4FSFA 2ZQCA 3IF5A 3MKFA 2A3UA 3G2ZA 4N92A 4RX2A 2J9OA 1SKFA 3C5AA 5E2EA 1DJAA 3DW0A 5E2FA 4R23A 4R4RA 1PWCA 5A93A 1W7FA 4DRTA 1NZUA 3PBTA 3P98A 3ZG9B 3M6HA 3OCLA 3HUNA 1YQSA 3PAGA 4QHCA 4E6WA 2P9VB 1LI0A 3ZFZA 4PMAA 3VP3A 2WGIA 4N1XA 1VM1A 4JF4A 3V3RA 1K54C 3BECA 4IVIA 1GA9A 3IWOA 4KG6A 5FQQA 4PM6A 5TFQA 2XF3A 3PBOA 4JLFA 4BLMA 3GVBA 1TVFA 1W5DA 3SOIA 2ZM8A 4DXCA 5A90A 3HLGA 4X6TA 4R3JA 5KSHA 1AXBA 4X69A 1L0DA 3UPOA 3WRZA 4E3NA 1RCJA 4S2KA 4S2NC 3S1YA 4B4ZA 3OPRA 5EPHA 3G2YA 5BOHA 1HZOA 1FR1A 2XFSA 4S2JA 3V5MA 1ES5A 4EV4A 3C7UA 3WRTA 1KE3A 2H10A 5CERA 2Y59A 4WMCD 5GHYA 3N6IA 5FI6A 4E3OA 3VFFA 4C75A 3E2LA 1IYSA 4KZ6A 2J7VA 1KVLA 5F1GA 4S2LA 4GDBA 5HAQA 2HPBA 3O3VA 3MFDA 3NDGA 3VSKA 4DXBA 2CC1A 4KQOA 3MZDA 4NK3A 3G4PA 3OPPA 1VQQA 4XUXA 5EE8A 1HTZA 5M18A 3BYDA 3G31A 5FAQA 3CJMA 3RXXA 5KSCA 4QJGA 1KE4A 1QMEA 1PWGA 3N8SA 4YINA 2E8IA 2P74A 2Z2LB 1YLZA 3BFEA 3NIAA 1ESIA 3RXWA 1JWPA 5FQIA 4EBNA 2QMIA 1NY0A 1PIOA 4FH4A 5J8XA 4K91A 2R9XA 3SH9A 2ZLYA 4OOMA 1QMFA 4OVDA 1K4FA 1W8YA 2J8YA 1EROA 2C6WB 1XXMA 4LENA 1K55C 1XA7A 3DTMA 1ES2A 2EFXA 5HAIA 2IWBA 4QD4A 5DF9A 3UDFA 4KZ5A 4DDYA 1CI9A 4OOYA 3OZHA 3HLBA 2Y2QA 1NYYA 4N1HA 2XQZA 3FV7A 3ITBA 4Y0UA 1K54A 1SDNA 5AQBA 4X53A 4DE2A 4MBFA 1K57C 4UA9A 3OPHA 4MBKA 2ZQDA 2WK0A 2XDMA 4BENA 2DCFA 2EX8A 5CHMA 4HBTA 4BL3A 4B88A 3D4FA 3HVFA 3IH9A 4A5RA 3AGDA 4WZ4A 4S2NA 4QY5A 5GLDA 3HLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEZ A;  5EVL A;  1N9B A;  2FFY A;  2WYX A;  1L0G A;  4FD8 A;  1S0W A;  2Z2M B;  4L0L A;  5FAT A;  3FZC A;  3QNB A;  4WZ5 A;  1PI4 A;  4P87 A;  4DE1 A;  1IEL A;  1MWU A;  1NZO A;  3AGE A;  3PTE A;  3VSL A;  2EX9 A;  5CGW A;  3ZNT A;  4EQI A;  2BG1 A;  5GLC A;  3MXS A;  1NYM A;  1LI9 A;  1IYO A;  4ZJ1 A;  1GCE A;  3O86 A;  4IVK A;  1I2W A;  4BJP A;  2ZQ8 A;  1E3U D;  4FCF A;  1JTG A;  4ID4 A;  5DF7 A;  4U0X A;  2DNS A;  2P9V A;  3EQU A;  4F94 A;  1ONH A;  4PM8 A;  3PAE A;  3FYZ A;  3NCK A;  4ZDX A;  1LL5 A;  2I72 A;  3UE3 A;  5L2F A;  5CGX A;  4LCL A;  5GL9 A;  4HES A;  2Y2H A;  4R4S A;  3BFC A;  4ZJ2 A;  3UDI A;  3ZDJ A;  4JXS A;  2WAD A;  5G18 A;  4YFM A;  2OLV A;  3ZHH A;  5F82 A;  1EWZ A;  1ES4 A;  3JYI A;  5M19 A;  1TDL A;  3C4O A;  1J9M A;  2Y4A A;  3AGF A;  1SHV A;  2ZC4 B;  3QNC A;  1ES3 A;  1I5Q A;  3BEB A;  3CZD A;  4ZJ3 A;  3G34 A;  4S2P A;  1MPL A;  3BFF A;  3HUM A;  3ZG0 A;  3FWL A;  4OQG A;  1BUL A;  3NI9 A;  1K55 A;  5DTT A;  2XK1 A;  2ZD8 A;  3Q82 A;  2H5S A;  1SDE A;  1U60 A;  2ZMA A;  4LV2 A;  3M2K A;  1ZKJ A;  2EFU A;  4UAA A;  1CEG A;  5TR7 A;  2VGJ A;  3IF6 B;  3S22 A;  5D3O A;  3LO7 A;  5DTK A;  4EWF A;  1XKZ A;  3Q1F A;  2A49 A;  1XP4 A;  2X02 A;  3N7W A;  2R9W A;  2Q9M A;  2Y2L A;  5EVI A;  1KGE A;  1PW1 A;  3GR2 A;  5HL1 A;  4WYY A;  1YMX A;  3S4X A;  2J9P A;  3HRE A;  4LV3 A;  3TSG A;  4BD1 A;  5F1F A;  2QPN A;  3HLF A;  5AQ7 A;  3IHA A;  4LV1 A;  4OQI A;  2Y2O A;  4O7D A;  1M40 A;  5M1A A;  4JF6 A;  1DY6 A;  4Z9Q A;  1GHP A;  2Y2P A;  3FKV A;  2PBY A;  2WGW A;  2EXA A;  4Y0O A;  2XD5 A;  4KEN B;  3GTC A;  4JXW A;  1FR6 A;  3MZE A;  2PU4 A;  1IKG A;  1MWR A;  1WYB A;  5FSR A;  1PZO A;  5GHX A;  1YLW A;  3EQV A;  1Q2P A;  3HUO A;  2X71 A;  1ERM A;  4DE0 A;  4R3B A;  2WAF A;  4E3J A;  1GHM A;  4Y7P A;  3BFG A;  1Q2Q A;  1L0E A;  2Y2J A;  3IF6 C;  3PBN A;  2WKI A;  1BLP A;  4K0X A;  1G68 A;  1SCW A;  2RCX A;  4FH2 A;  4X56 A;  3GQZ A;  1IKI A;  1MBL A;  1MWS A;  1LHY A;  4QY6 A;  4GOG A;  4MBH A;  2ZC5 B;  2Y55 A;  3FKW A;  3ZNY A;  2XLN A;  1RP5 A;  3VFH A;  3CG5 A;  3GRJ A;  4WEJ A;  1BLS A;  2ZC3 B;  3G32 A;  1LLB A;  1MKI A;  4OP5 A;  2V2F F;  3TG9 A;  4KQR A;  3VP0 A;  4C6Y A;  4RX3 A;  1PYY A;  2HP6 A;  4WBG A;  3ZCZ A;  4KZ3 A;  1BTL A;  3NDE A;  3IXG A;  4GD8 A;  4GNU A;  4UA7 A;  3V39 A;  5FAS A;  2OSU A;  1XPB A;  5F83 A;  2VGK A;  3IWQ A;  5E2H A;  1S6R A;  3LEZ A;  1NRF A;  4JKT A;  4WMC A;  5CXW A;  1GHI A;  1YLT A;  2EX6 A;  3GSG A;  3I7J A;  3WS4 A;  5GLA A;  3W4O A;  1ZG6 A;  3Q7V B;  4S2I A;  4JF5 A;  3LCE A;  3ZG5 A;  3C4P A;  2IWD A;  3HLC A;  3QHY A;  5HX9 A;  5CEC A;  3MZF A;  4GZB A;  5AQ9 A;  4KZ4 A;  2EX2 A;  5HW3 A;  5CHJ A;  3SS4 A;  3W4P A;  2XD1 A;  3MBZ A;  4MNR A;  5FA7 A;  1YM1 A;  4OQH A;  3Q7Z A;  3UPN A;  2XEP A;  4KZA A;  1FSW A;  4HEF A;  4OH0 A;  2EXB A;  4KG5 A;  4E3I A;  2OV5 A;  4M3K A;  3A3F A;  3A3I A;  4OLD A;  3OC2 A;  1Y54 A;  5CTM A;  3IWI A;  3WS1 A;  1PWD A;  1WE4 A;  4OLG A;  2V1Z A;  3V50 A;  4PM5 A;  1W79 A;  1E25 A;  4CPK A;  3BM6 A;  1TEM A;  3RJU A;  5IHV A;  2WGV A;  1BZA A;  1TDG A;  2HDS A;  3TOI A;  3HLD A;  1CEF A;  3GMW A;  4OKP A;  4ZAM A;  4R0Q A;  5HFO A;  2X01 A;  3WWX A;  5DF8 A;  1FQG A;  3DWZ A;  5FAO A;  1YT4 A;  2ZQ9 A;  3N8L A;  4QB8 A;  5HAP A;  4X55 A;  4PPR A;  4WEL A;  2HP9 A;  2Y2M A;  4U3T A;  3SS5 A;  3ZVW A;  2HP5 A;  2GDN A;  1DJC A;  4X68 A;  3E2K A;  3W8K A;  5A92 A;  5FI7 A;  1ESU A;  4E3M A;  4OON A;  4DDS A;  1K56 D;  3Q07 A;  1XGI A;  3SH7 A;  1NJ4 A;  1GA0 A;  1JTD A;  3O88 A;  5DVA A;  3O87 A;  4PM9 A;  5CEB A;  1CI8 A;  4IED A;  4P0M A;  3MXR A;  4N9L A;  4OPQ A;  4S2M A;  2WKE A;  2Y2N A;  4OQ0 A;  4JBF A;  4OOL A;  4GD6 A;  2B5R A;  2V20 A;  4MLL A;  2XGN A;  1H5X A;  4C3Q A;  1KGG A;  2C5W B;  1OME A;  3LY3 A;  5EUA A;  1ERQ A;  4HBU A;  4OPZ A;  5CGS A;  4KZ7 A;  3UE0 A;  4E3K A;  1K57 A;  2ZQ7 A;  3BRM A;  2H0Y A;  3OCN A;  1BLH A;  1Z6F A;  1HVB A;  3BFD A;  5FAP A;  2Y91 A;  4DE3 A;  1O07 A;  1G6A A;  2ZM0 A;  2JE5 A;  4GN2 A;  1JWZ A;  1JWV A;  3M2J A;  4UHU A;  3IH8 A;  5CHU A;  1E3U A;  2BLS A;  3WS5 A;  2OLU A;  1C3B A;  2XH9 A;  1K6S A;  2ZC7 A;  3DWK A;  3IQA A;  4GKU A;  4RYE A;  2IWC A;  3SH8 A;  1BSG A;  4ZTK A;  4ZBE A;  3SS3 A;  1W8Q A;  1HD8 A;  5EOO A;  2HDQ A;  5DTS A;  4XXR A;  5AQA A;  3NC8 A;  4JPM A;  3G35 A;  4U0T A;  4Y0T A;  1ZC2 A;  4KZ8 A;  3HBR A;  3IXD A;  3Q81 A;  1FSY A;  3GV9 A;  5U47 A;  1FCM A;  3N4I A;  3UE1 A;  1IYQ A;  4WZ5 C;  3V3S A;  1IYP A;  4QU3 A;  5CED A;  2DRW A;  4XUZ A;  3WS0 A;  3VP1 A;  2Y2I A;  1EI5 A;  1K56 A;  1PW8 A;  1YLY A;  5FQ9 A;  4EBL A;  3PBR A;  2HDU A;  3PBS A;  5KMW A;  2G2W A;  2JC7 A;  4R1G A;  4EUZ A;  4WEK A;  5EOE A;  1KE0 A;  3ISG A;  1RGZ A;  3UN7 A;  3VP2 A;  1L0F A;  4RA7 A;  3HL9 A;  4Q8I A;  2Y2K A;  3HLW A;  3W4Q A;  1O7E A;  2XR0 A;  5I94 A;  1XX2 A;  1K38 A;  5EVI B;  1PZP A;  3VP4 A;  4D2O A;  1BUE A;  3Q7V A;  1FCN A;  4B4X A;  1JVJ A;  4P6B A;  5FQM A;  1N4O A;  1CK3 A;  1I2S A;  1ZG4 A;  2QZ6 A;  4DF6 A;  4E6X A;  2ZC6 B;  5E2G A;  3B3X A;  4LV0 A;  1ALQ A;  3UNW A;  4BL2 A;  5JYO A;  1YMS A;  5TGF A;  3N8R A;  3ZVT A;  4RVA A;  5A91 A;  1L2S A;  1FCO A;  1YLP A;  3A3D A;  2WGW B;  4JXV A;  1H8Z A;  4P85 A;  2Y2G A;  4WM9 A;  3UPP A;  5CTN A;  5FQK A;  1MWT A;  2FFF B;  2Q9N A;  1K6R A;  1LL9 A;  1BLC A;  2WKH A;  5GLB A;  1MY8 A;  3UDX A;  1XGJ A;  4K0W A;  4LCM A;  3VOZ A;  3NY4 A;  4BQM A;  2WZZ A;  3ZGA B;  3IXB A;  5KZH A;  1KGF A;  1ONG A;  2JCH A;  3NBL A;  1KDW A;  3P09 A;  4UA6 A;  4IBR A;  5FQJ A;  1MXO A;  4DKI A;  3VMA A;  1NXY A;  5CRF A;  5EVI C;  4OPR A;  4JXG A;  4EBP A;  2WUQ A;  3BLM A;  5GHZ A;  4KQQ A;  4H8R A;  1K25 A;  1XA1 A;  5FDH A;  1DJB A;  3A3E A;  2XFT A;  3ZG8 B;  4OP8 A;  1BT5 A;  2ZQA A;  3IXH A;  3MKE A;  5FI2 A;  2G2U A;  1IEM A;  4CJN A;  1RGY A;  4KZ9 A;  2H0T A;  4OPY A;  1KDS A;  1WYC A;  3UY6 A;  4S2O A;  4KG2 A;  4PM7 A;  2JBF A;  4E3L A;  3IT9 A;  3IF6 A;  5EVI D;  4KZB A;  3PBQ A;  1H8Y A;  4NET A;  2UWX A;  3ZG7 B;  2ZJ9 A;  1E4D A;  3C7V A;  1YLJ A;  1KVM A;  4IBX A;  2ZM2 A;  1FOF A;  3IHB A;  2RL3 A;  5EEC A;  4GDN A;  3CMZ A;  3VOY A;  1M6K A;  3WS2 A;  3BLS A;  3A3J A;  3ITA A;  4N9K A;  5JYP A;  1PI5 A;  3OPL A;  2WZX A;  3M6B A;  3UO9 A;  4BD0 A;  2HDR A;  2PU2 A;  2WAE A;  5HAR A;  5E43 A;  3LY4 A;  4GB7 A;  1K4E A;  3G30 A;  4FSF A;  2ZQC A;  3IF5 A;  3MKF A;  2A3U A;  3G2Z A;  4N92 A;  4RX2 A;  2J9O A;  1SKF A;  3C5A A;  5E2E A;  1DJA A;  3DW0 A;  5E2F A;  4R23 A;  4R4R A;  1PWC A;  5A93 A;  1W7F A;  4DRT A;  1NZU A;  3PBT A;  3P98 A;  3ZG9 B;  3M6H A;  3OCL A;  3HUN A;  1YQS A;  3PAG A;  4QHC A;  4E6W A;  2P9V B;  1LI0 A;  3ZFZ A;  4PMA A;  3VP3 A;  2WGI A;  4N1X A;  1VM1 A;  4JF4 A;  3V3R A;  1K54 C;  3BEC A;  4IVI A;  1GA9 A;  3IWO A;  4KG6 A;  5FQQ A;  4PM6 A;  5TFQ A;  2XF3 A;  3PBO A;  4JLF A;  4BLM A;  3GVB A;  1TVF A;  1W5D A;  3SOI A;  2ZM8 A;  4DXC A;  5A90 A;  3HLG A;  4X6T A;  4R3J A;  5KSH A;  1AXB A;  4X69 A;  1L0D A;  3UPO A;  3WRZ A;  4E3N A;  1RCJ A;  4S2K A;  4S2N C;  3S1Y A;  4B4Z A;  3OPR A;  5EPH A;  3G2Y A;  5BOH A;  1HZO A;  1FR1 A;  2XFS A;  4S2J A;  3V5M A;  1ES5 A;  4EV4 A;  3C7U A;  3WRT A;  1KE3 A;  2H10 A;  5CER A;  2Y59 A;  4WMC D;  5GHY A;  3N6I A;  5FI6 A;  4E3O A;  3VFF A;  4C75 A;  3E2L A;  1IYS A;  4KZ6 A;  2J7V A;  1KVL A;  5F1G A;  4S2L A;  4GDB A;  5HAQ A;  2HPB A;  3O3V A;  3MFD A;  3NDG A;  3VSK A;  4DXB A;  2CC1 A;  4KQO A;  3MZD A;  4NK3 A;  3G4P A;  3OPP A;  1VQQ A;  4XUX A;  5EE8 A;  1HTZ A;  5M18 A;  3BYD A;  3G31 A;  5FAQ A;  3CJM A;  3RXX A;  5KSC A;  4QJG A;  1KE4 A;  1QME A;  1PWG A;  3N8S A;  4YIN A;  2E8I A;  2P74 A;  2Z2L B;  1YLZ A;  3BFE A;  3NIA A;  1ESI A;  3RXW A;  1JWP A;  5FQI A;  4EBN A;  2QMI A;  1NY0 A;  1PIO A;  4FH4 A;  5J8X A;  4K91 A;  2R9X A;  3SH9 A;  2ZLY A;  4OOM A;  1QMF A;  4OVD A;  1K4F A;  1W8Y A;  2J8Y A;  1ERO A;  2C6W B;  1XXM A;  4LEN A;  1K55 C;  1XA7 A;  3DTM A;  1ES2 A;  2EFX A;  5HAI A;  2IWB A;  4QD4 A;  5DF9 A;  3UDF A;  4KZ5 A;  4DDY A;  1CI9 A;  4OOY A;  3OZH A;  3HLB A;  2Y2Q A;  1NYY A;  4N1H A;  2XQZ A;  3FV7 A;  3ITB A;  4Y0U A;  1K54 A;  1SDN A;  5AQB A;  4X53 A;  4DE2 A;  4MBF A;  1K57 C;  4UA9 A;  3OPH A;  4MBK A;  2ZQD A;  2WK0 A;  2XDM A;  4BEN A;  2DCF A;  2EX8 A;  5CHM A;  4HBT A;  4BL3 A;  4B88 A;  3D4F A;  3HVF A;  3IH9 A;  4A5R A;  3AGD A;  4WZ4 A;  4S2N A;  4QY5 A;  5GLD A;  3HLE A; 
#chains in the Genus database with same CATH topology
 5EVL A;  1S0W A;  3FZC A;  1PI4 A;  3KO6 A;  3VSL A;  2EX9 A;  3MXS A;  2M7V A;  4ZJ1 A;  4BJP A;  5DF7 A;  1JTG A;  4U0X A;  2VV6 A;  4F94 A;  3FYZ A;  4ZDX A;  1FIK A;  1LL5 A;  3UE3 A;  5CGX A;  1AWI A;  3LR4 A;  4LCL A;  5GL9 A;  3BFC A;  5G18 A;  3ZHH A;  4P6Z S;  3T12 B;  2Y4A A;  2ZC4 B;  3BEB A;  3HUM A;  3IX4 A;  3NI9 A;  2OAQ 1;  5DTT A;  2ZD8 A;  2H5S A;  3QP1 A;  4G3K A;  4UAA A;  4LV2 A;  2JKT I;  4HJ6 A;  2ZOH A;  3S22 A;  5D3O A;  3LO7 A;  4EWF A;  1P0Z A;  3N7W A;  4HOI A;  2Q9M A;  4WYY A;  4EUV A;  1VEU A;  3T50 A;  3HRE A;  4GS9 B;  3LIF A;  3IHA A;  4O7D A;  5M1A A;  1GHP A;  3ULF A;  2XD5 A;  4JXW A;  1YSP A;  1IKG A;  3LI8 A;  5GHX A;  1XJ2 A;  2QHK A;  1EW0 A;  4E3J A;  1BLP A;  3GEC A;  2HF6 A;  2W3D A;  4FH2 A;  3B47 A;  2JKG A;  1XJ4 A;  1IKI A;  1MBL A;  1NLZ A;  4QY6 A;  3FKW A;  4LRY C;  3VFH A;  2EWW A;  3TG9 A;  3LIC A;  3VP0 A;  1PYY A;  3ZCZ A;  4WBG A;  3IXG A;  2GX5 A;  2JKF A;  4GNU A;  1XPB A;  3MXQ A;  3IWQ A;  3F1P A;  1S6R A;  3H82 A;  3S7N A;  4WMC A;  1GHI A;  1XJ3 A;  3CAX A;  3I7J A;  3W4O A;  2ZBB A;  5HX9 A;  5CEC A;  3MZF A;  5AQ9 A;  5CHJ A;  3SS4 A;  1T19 A;  3Q7Z A;  3UPN A;  4ARZ A;  4HEF A;  4OH0 A;  4Z1W A;  1SKO B;  2QKP A;  4E3I A;  2XA7 S;  4M3K A;  4OLD A;  3OC2 A;  3F1N A;  3IWI A;  4OLG A;  3E4Q A;  4CPK A;  1YPR A;  2VJW A;  3LGO A;  5LBR A;  2X01 A;  1WA9 A;  3MQ0 A;  4X55 A;  4WEL A;  1VET A;  2Y2M A;  4U3T A;  3ZVW A;  3E2K A;  3LID A;  5FI7 A;  1ESU A;  3Q07 A;  1XGI A;  1NJ4 A;  3O87 A;  4PM9 A;  4IED A;  3MXR A;  1XFQ A;  4OPQ A;  4RQ9 A;  4JBF A;  4OOL A;  2B5R A;  4HBU A;  3UE0 A;  3T4O A;  1YKD A;  2W3H A;  2H0Y A;  1H8M A;  4HH2 A;  3BFD A;  3K3D A;  5FAP A;  4Y3I A;  1JWZ A;  5HPI A;  1D7E A;  4I38 A;  5CHU A;  2XH9 A;  4HH3 A;  4RYE A;  3R7W A;  3SS3 A;  5EOO A;  2HDQ A;  4Y13 A;  2QJ7 A;  5DKL A;  4Y0T A;  3JVU A;  3GV9 A;  3N4I A;  3UE1 A;  1IYQ A;  4WZ5 C;  3V3S A;  2XRO A;  2VA0 A;  3VP1 A;  4ETX A;  1YLY A;  4EBL A;  2HDU A;  1STZ A;  4O8G A;  5KMW A;  2G2W A;  2JC7 A;  3HL9 A;  2AVX A;  3W4Q A;  4GLQ A;  1K0K A;  4GHI A;  3Q7V A;  1VEU B;  4KUK A;  4YOF A;  1N4O A;  1I2S A;  1SZV A;  3CUE A;  1H0M A;  2E8J A;  1ZG4 A;  2A24 B;  5E2G A;  2ZMV A;  3B3X A;  4LV0 A;  1ALQ A;  4BL2 A;  1YMS A;  5TGF A;  3ZVT A;  4RVA A;  1H8Z A;  2VKS A;  3ICY A;  4EEU A;  1OTA A;  4MDZ A;  1GSX A;  1K6R A;  1BLC A;  3D3O A;  2WKH A;  4BBT A;  4K0W A;  2W3E A;  4JGO A;  4BQM A;  4L9G A;  2LB9 A;  2JCH A;  3P09 A;  4DKI A;  1NXY A;  4OPR A;  1OT6 A;  3T4S A;  4L9E A;  3MKE A;  2G2U A;  3JVV A;  3IS2 A;  1H8Y A;  4NET A;  2QWS A;  3F1P B;  3H82 B;  2ZM2 A;  3IHB A;  3PYP A;  2HV1 A;  3BLS A;  5FEG A;  2WZX A;  3M6B A;  3UO9 A;  2PU2 A;  2V8C A;  4FSF A;  2VLG A;  3IF5 A;  4CLC E;  2PYP A;  5L10 A;  5E2E A;  4ME4 A;  4X25 A;  4R4R A;  4ARZ B;  4DRT A;  2PRF A;  1NZU A;  5F6A A;  1YQS A;  5J4E A;  5FL3 A;  5J3W A;  4JLF A;  4LRZ E;  3SOI A;  3UB6 A;  4DXC A;  5A90 A;  1N9O A;  1VET B;  4R3J A;  4UEY A;  2O99 A;  2NUP C;  4B4Z A;  5EPH A;  1D06 A;  3G2Y A;  2XFS A;  4QWO A;  2P7J A;  3V5M A;  4D60 A;  3MF0 A;  4I39 A;  2HJ9 C;  4E3O A;  3NJA A;  1IYS A;  4KZ6 A;  4S2L A;  3ZYT A;  5HPF A;  3NDG A;  4KQO A;  3MZD A;  3LI9 A;  4XUX A;  5EE8 A;  2E8I A;  3A0S A;  1YLZ A;  3BFE A;  3NIA A;  1NY0 A;  3ZQ5 A;  4FH4 A;  5J8X A;  4K91 A;  1T1A A;  3EGX C;  3R7W B;  2J8Y A;  5L07 A;  2IWB A;  3VOL A;  2XQZ A;  3ITB A;  4Y0U A;  3FPV A;  1SDN A;  4KQD A;  4X53 A;  5AQB A;  2ZL1 A;  1HLU P;  2LB5 A;  3MSH A;  5EFW A;  2ZQD A;  2XDM A;  4BL3 A;  1ACF A;  4WUJ A;  4WZ4 A;  1F9I A;  4GHI B;  4QY5 A;  1X0O A;  2FFY A;  2WYX A;  2XRN A;  4WZ5 A;  4HIA A;  3PTE A;  1MWU A;  5CGW A;  2BG1 A;  5GLC A;  1NYM A;  1P97 A;  4ZRR A;  1GCE A;  4ID4 A;  2PHY A;  3T1X A;  1VB6 A;  3EQU A;  2O0Y A;  1ZTU A;  3BJN A;  4PKY A;  2Y2H A;  3UDI A;  2WAD A;  4YFM A;  1S1Y A;  1ES4 A;  3JYI A;  1SHV A;  4X1M A;  2JKR I;  3CIT A;  1ES3 A;  1I5Q A;  3CZD A;  4ZJ3 A;  5EV0 A;  4S2P A;  3ZG0 A;  3FWL A;  2PR6 A;  4OQG A;  1K55 A;  1J3W A;  2XK1 A;  3A0R A;  2ZMA A;  1U60 A;  3M2K A;  1CEG A;  3IS2 B;  3DBA A;  3UB7 A;  2A49 A;  4HI4 A;  2YKF A;  2R9W A;  2Y2L A;  1NWZ A;  3T4L A;  1YMX A;  4IHQ A;  3TSG A;  2QPN A;  3HLF A;  4WL9 A;  5AQ7 A;  3DTI A;  4OQI A;  3C8C A;  1M40 A;  4JF6 A;  1DY6 A;  2Y2P A;  2PBY A;  2EXA A;  4Y0O A;  2D02 A;  1YLW A;  1Q2P A;  1NLY A;  2X71 A;  3HUO A;  1Q2Q A;  3IF6 C;  2KOI A;  2WKI A;  5HDD A;  2RCX A;  2B95 A;  3HJI A;  4NXB A;  4EXO A;  3MMH A;  4MBH A;  2ZC5 B;  3ZNY A;  3CG5 A;  2P04 A;  1BLS A;  2ZC3 B;  2V2F F;  5L09 A;  4KZ3 A;  3NDE A;  2I9V A;  3O5Y A;  4GD8 A;  3RH8 B;  1ODV A;  1CF0 A;  3LEZ A;  4O01 A;  4JKT A;  1YLT A;  1W63 M;  3GSG A;  3WS4 A;  5GLA A;  4S2I A;  4DJ2 A;  4JF5 A;  5FEF A;  2J3T C;  5HWV A;  4NXG A;  2PDR A;  2XD1 A;  4MNR A;  1V9Z A;  2XEP A;  4KZA A;  2K7S A;  2EXB A;  2J3T D;  2OV5 A;  3LEQ A;  3BM6 A;  3RJU A;  2HDS A;  4OKP A;  2L1M A;  4R0Q A;  3WWX A;  3DWZ A;  3U4L P;  2ZL1 B;  2ZQ9 A;  3N8L A;  5HAP A;  2IA2 A;  2GDN A;  3W8K A;  5A92 A;  4DDS A;  1GA0 A;  1JTD A;  2KDK A;  5DVA A;  3CUE C;  3V67 A;  5CEB A;  2WKE A;  4OQ0 A;  2V20 A;  4MLL A;  2XGN A;  3LY3 A;  1ERQ A;  4KZ7 A;  2PYR A;  1IOU A;  1HVB A;  2Y91 A;  1O07 A;  2ZM0 A;  2JE5 A;  4GN2 A;  3M2J A;  3TJZ C;  3WS5 A;  1IFQ A;  1K6S A;  3DWK A;  4GKU A;  3SH8 A;  1BSG A;  4ZTK A;  1GSW A;  3BQ8 A;  4WF0 A;  4JPM A;  1OTE A;  1CQA A;  1ZC2 A;  4KZ8 A;  3HBR A;  3IXD A;  4F3L A;  1FSY A;  1FCM A;  1UWN X;  1IYP A;  4QU3 A;  5CED A;  3WS0 A;  1K56 A;  1PW8 A;  3PBR A;  4MN6 A;  4R1G A;  5HD5 A;  4II7 A;  3KSG A;  4WEK A;  1VHM A;  5EOE A;  3VP2 A;  1L0F A;  4Q8I A;  2YKH A;  1K38 A;  4MN7 A;  4Y2F A;  4HJ4 A;  5FQM A;  1CK3 A;  3NOP C;  3T1Q B;  4EET B;  2ZC6 B;  5L8M A;  3N8R A;  1L2S A;  1YLP A;  5CX7 A;  5AJG A;  3UPP A;  2Q9N A;  2FFF B;  1MY8 A;  3IXB A;  3EWK A;  5KZH A;  1ONG A;  4IBR A;  5HDC A;  3IBR A;  5EVI C;  4JXG A;  1OTI A;  1DJB A;  3T1R A;  1BT5 A;  4R38 A;  2H0T A;  1KDS A;  3UY6 A;  3LFV A;  4S2O A;  3IX8 A;  4E3L A;  3IT9 A;  3IF6 A;  5EVI D;  4KZB A;  2Y8H A;  3PBQ A;  2UWX A;  3ZG7 B;  2ZJ9 A;  3EEH A;  2V0U A;  1KVM A;  1FOF A;  3CMZ A;  4HP9 A;  1M6K A;  3A3J A;  2D01 A;  3OPL A;  2EWV A;  3FC7 A;  4BD0 A;  2HDR A;  2WAE A;  5HAR A;  2OAP 1;  2K31 A;  4GB7 A;  4CLC C;  2J9O A;  1SKF A;  3C5A A;  3MQQ A;  5E2F A;  2Z6C A;  3OOV A;  2HZ5 A;  1W7F A;  3TW8 A;  3PBT A;  3ZG9 B;  3M6H A;  1L3L A;  3HUN A;  4Q0H A;  3VP3 A;  4CLC D;  4JF4 A;  3F1O A;  4KG6 A;  5TFQ A;  4I3I A;  1TVF A;  5J7E A;  3BW6 A;  1AXB A;  4X69 A;  1XFN A;  4E3N A;  1RCJ A;  3S1Y A;  4JGP A;  1FR1 A;  3D9Y A;  5IU1 A;  3C7U A;  3WRT A;  2W3G A;  1TS8 A;  2VZW A;  3VFF A;  1KVL A;  5HAQ A;  2HPB A;  3O3V A;  4QPR A;  4DXB A;  3VSK A;  4G3W A;  2CC1 A;  1XJ6 A;  4K08 A;  3OPP A;  5M18 A;  3BYD A;  3G31 A;  3CJM A;  2INW A;  4QJG A;  1PWG A;  1S4S A;  2WKP A;  3RXW A;  5FQI A;  2J80 A;  4GJ4 A;  1QMF A;  1K55 C;  1NRJ A;  4B9O A;  4F3L B;  4KZ5 A;  4WN5 A;  1CI9 A;  4OOY A;  3OZH A;  1NYY A;  4HJ3 A;  2OWH A;  4MBF A;  4MBK A;  1UGU A;  2WK0 A;  3IX3 A;  5CHM A;  3CHW P;  4HBT A;  4B88 A;  3FPW A;  3HVF A;  3IH9 A;  3AGD A;  3P7N A;  3A0V A;  2CMN A;  1L0G A;  2KX6 A;  2Z2M B;  4L0L A;  3QNB A;  3QP6 A;  4NXF A;  1IEL A;  3AGE A;  2M7U A;  3MFX A;  1A0K A;  1LI9 A;  1IYO A;  3L9K A;  4IVK A;  1I2W A;  1E3U D;  4FCF A;  2P9V A;  3KX0 X;  1ONH A;  3PAE A;  3RTY A;  3NCK A;  2I72 A;  5HZH A;  3ZDJ A;  4ZJ2 A;  4ETZ A;  4R4S A;  5HL6 A;  3C2W A;  2G7U A;  2OLV A;  2HGV A;  5F82 A;  1EWZ A;  3NEC A;  5M19 A;  1TDL A;  1J9M A;  1KOU A;  3AGF A;  4EU0 A;  1T1C A;  3G34 A;  2VGL M;  3BFF A;  1MZU A;  3F1N B;  3LIB A;  1BUL A;  2PD7 A;  5A8B A;  2EA9 A;  1ZKJ A;  2VGJ A;  3IF6 B;  5AVE A;  5DTK A;  1XP4 A;  5IS1 A;  3H7W A;  2X02 A;  5EVI A;  3GR2 A;  5HL1 A;  3NHQ A;  4LV3 A;  4JGQ A;  4BD1 A;  3E98 A;  4LV1 A;  2Y2O A;  3LR5 A;  4Z9Q A;  1DP8 A;  3GTC A;  3MZE A;  2PU4 A;  3LIA A;  2KLI A;  1ERM A;  4DE0 A;  4R3B A;  5HWT A;  4CQH A;  2WAF A;  1GHM A;  4Y7P A;  3PBN A;  4MN5 A;  3LIE A;  3F1O B;  4K0X A;  1G68 A;  3GQZ A;  2O9C A;  4CLC A;  1LHY A;  2Y55 A;  3UMD A;  1RP5 A;  2XLN A;  4WEJ A;  3G32 A;  1LLB A;  3QP5 A;  4KQR A;  1OT9 A;  3KSF A;  4C6Y A;  4RX3 A;  1BTL A;  4BBV A;  1Y28 A;  4UA7 A;  2OOL A;  2OSU A;  2GNX A;  5E2H A;  1DP6 A;  2MJ6 A;  1LSX A;  5CXW A;  2EX6 A;  3T4T A;  2PT7 A;  3Q7V B;  2V1A A;  3HLC A;  3QHY A;  2PD8 A;  2EX2 A;  5HW3 A;  3NUL A;  3MBZ A;  5FA7 A;  1FSW A;  4FUW A;  4KG5 A;  4Q0J A;  2JKR M;  3A3I A;  3WS1 A;  3V50 A;  3K3C A;  2V1Z A;  5HDS A;  4NG2 A;  5IHV A;  1BZA A;  2WKQ A;  1TDG A;  3HLD A;  1CEF A;  3GMW A;  5FAO A;  1YT4 A;  1OTB A;  3QP2 A;  3SS5 A;  4X68 A;  1K56 D;  3SH7 A;  2V9A A;  4N9L A;  2Y2N A;  4I5S A;  4IJG A;  4GD6 A;  4HQA A;  1H5X A;  2NUT C;  4C3Q A;  1KGG A;  2C5W B;  1OME A;  2M1C A;  3UB9 A;  5EUA A;  1Y4O A;  4E3K A;  5CGS A;  1CJF A;  2L0W A;  4DE3 A;  4PKY G;  4Q0I A;  4DMZ A;  1JWV A;  3VE4 A;  4UHU A;  3IH8 A;  1E3U A;  3E4O A;  3MJQ A;  3IBJ A;  3T4K A;  2VK3 A;  2WKR A;  4ZBE A;  4PAU A;  2B18 A;  3DTE A;  4XXR A;  3NC8 A;  1T18 A;  4U0T A;  3Q81 A;  5FDS A;  2DRW A;  4XUZ A;  1RGZ A;  4RA7 A;  4I3A A;  2H28 A;  2XR0 A;  5I94 A;  4AFI A;  3H7W B;  5EVI B;  1PZP A;  1JNU A;  1BUE A;  1JVJ A;  4MCW A;  5I5L A;  2QZ6 A;  4DF6 A;  2UV0 E;  3B42 A;  5JYO A;  2Y2G A;  3MR0 A;  1MWT A;  1LL9 A;  3UDX A;  5GLB A;  5DJU A;  4LCM A;  3VOZ A;  2P08 A;  3CPT A;  2VX8 A;  3ZGA B;  1OJ5 A;  5FQJ A;  3NBL A;  4HNB A;  1KDW A;  2ZMF A;  4BMW A;  1H3Q A;  1MXO A;  3VMA A;  3T4Q A;  4CLC B;  2J3W A;  2A2L A;  2WUQ A;  3BLM A;  5GHZ A;  4KQQ A;  1XA1 A;  5FDH A;  3A3E A;  2XFT A;  3T4J A;  1V9Y A;  5FI2 A;  1IEM A;  4CJN A;  5HSQ A;  1OTD A;  1RGY A;  4KZ9 A;  1WYC A;  4PM7 A;  2JKT M;  4Y17 A;  3KSI A;  1S66 L;  5EM1 A;  4G3V A;  3C7V A;  1YLJ A;  4IBX A;  2FZ0 A;  5EEC A;  3K2N A;  4E04 A;  3VV4 A;  1G28 A;  4LLO B;  3WS2 A;  3ITA A;  4N9K A;  4NKP A;  5JYP A;  4JGR A;  5E43 A;  3LY4 A;  1GSV A;  1K4E A;  3G30 A;  3VE3 A;  2VGL S;  2A3U A;  4N92 A;  4RX2 A;  4HY8 A;  5DJT A;  5K5B A;  3UB5 P;  1PWC A;  3KYZ A;  3P98 A;  3OCL A;  4QHC A;  3PAG A;  4PMA A;  2WGI A;  4N1X A;  3V3R A;  3BEC A;  2BTF P;  4IVI A;  3IWO A;  3PHY A;  4PM6 A;  2W1R A;  2XF3 A;  3PBO A;  4BLM A;  1W5D A;  5MC7 A;  4X6T A;  1D1J A;  5KSH A;  5F68 A;  3OPR A;  5BOH A;  1HZO A;  4S2J A;  3RFB A;  1ES5 A;  1KE3 A;  2H10 A;  5CER A;  2Y59 A;  2A24 A;  1OPX A;  3N6I A;  3E2L A;  5F1G A;  4GDB A;  3PR6 A;  4NK3 A;  4YNR A;  1N9L A;  1HTZ A;  3CWF A;  1FIL A;  3RXX A;  5KSC A;  1QME A;  4YIN A;  3QP8 A;  3CLO A;  1ESI A;  2OWJ A;  4EBN A;  2QMI A;  1PIO A;  3SH9 A;  2ZLY A;  4OOM A;  1LSV A;  3BWL A;  1K4F A;  1W8Y A;  1ERO A;  4LEN A;  1UWP X;  3DTM A;  4QD4 A;  5DF9 A;  3UDF A;  4DDY A;  3NOT C;  1G6O A;  1MC0 A;  1K54 A;  4R6L A;  4BWI A;  1K57 C;  1S1Z A;  4XT2 A;  2EX8 A;  3D4F A;  4A5R A;  4S2N A;  4EQ1 A;  3HLE A;  4GCZ A;  4KUO A;  3B33 A;  4MEZ A;  1N9B A;  3KYE A;  4FD8 A;  5FAT A;  1P9R A;  4ESP A;  2L4R A;  4P87 A;  3UME A;  4DE1 A;  1ZHH B;  5HD3 A;  1NZO A;  3HCY A;  3EGD C;  3ZNT A;  4EQI A;  3O86 A;  2ZQ8 A;  2DNS A;  4PM8 A;  2O9B A;  5L2F A;  2W3F A;  3CPT B;  4HES A;  4PHT A;  4JXS A;  2W0N A;  3R4K A;  3C4O A;  2Y79 A;  3C30 A;  3QNC A;  4M4X A;  3S7P A;  1MPL A;  1Z09 A;  3Q82 A;  1SDE A;  1TS6 A;  3LR3 A;  2EFU A;  4IUH A;  2R78 A;  5TR7 A;  3PXP A;  3BQA A;  2W1T A;  1XKZ A;  3Q1F A;  4BBU A;  1KGE A;  1PW1 A;  3UB8 A;  3S4X A;  2J9P A;  3W2Z A;  2VV7 A;  5F1F A;  1MKM A;  1LSW A;  2ACG A;  4B93 A;  3FKV A;  2WGW A;  3MQO A;  4KEN B;  1FR6 A;  1MWR A;  1WYB A;  5FSR A;  1PZO A;  3EQV A;  4EEP A;  3BFG A;  2Y2J A;  1L0E A;  4UQI M;  1OJG A;  1SCW A;  4X56 A;  2B02 A;  3OLO A;  2VV8 A;  4HP4 A;  3E0Y A;  1MWS A;  2V8F A;  2GJ3 A;  3GRJ A;  3LYX A;  1MKI A;  4OP5 A;  2HP6 A;  5FAS A;  3V39 A;  5F83 A;  2VGK A;  1N9N A;  1NRF A;  5DKK A;  4LPZ A;  1ZG6 A;  5KIZ A;  3BY8 A;  4EW7 A;  3LCE A;  3ZG5 A;  3C4P A;  2IWD A;  4GZB A;  4KZ4 A;  1PNE A;  3JPU A;  3W4P A;  5F5Y A;  1S67 L;  1YM1 A;  4OQH A;  5HWW A;  1TF1 A;  3A3F A;  5CTM A;  1Y54 A;  1F5M A;  1PWD A;  1WE4 A;  4PM5 A;  1W79 A;  1E25 A;  1TEM A;  2WGV A;  1TS7 A;  3TOI A;  5HFO A;  4ZAM A;  2V1B A;  2QYB A;  4LFU A;  5DF8 A;  1FQG A;  4HHD A;  4QB8 A;  4PPR A;  2HP9 A;  2HP5 A;  1DJC A;  4XT2 B;  1LT0 A;  4H6J A;  4E3M A;  4OON A;  3TRC A;  3O88 A;  3CI6 A;  1CI8 A;  4P0M A;  2FH5 A;  4P6Z M;  4S2M A;  4O0P A;  3P01 A;  3LUQ A;  4OPZ A;  1K57 A;  5F69 A;  2ZQ7 A;  3BRM A;  4R3A A;  3OCN A;  1BLH A;  1Z6F A;  3GDI A;  1G6A A;  3G6O A;  2BAS A;  2K2N A;  3DTK A;  2BLS A;  2OLU A;  2DMW A;  1C3B A;  2ZC7 A;  3IQA A;  2Q0O A;  2IWC A;  4NEE D;  1W8Q A;  4LGW A;  1HD8 A;  5IT5 A;  2QJ5 A;  5DTS A;  5AQA A;  3G35 A;  3MS6 A;  1TS0 A;  1BYW A;  3S7Q A;  5U47 A;  4R70 A;  2Z6D A;  2GZA A;  5G4Z A;  2Y2I A;  1EI5 A;  5FQ9 A;  3PBS A;  5TBM A;  3LR0 A;  2W1T B;  4IUK A;  5DFY A;  4EUZ A;  1KE0 A;  2JN7 A;  3ISG A;  5G4Y A;  3UN7 A;  2Y2K A;  3KSH A;  3HLW A;  1O7E A;  4Y15 A;  1XX2 A;  3VP4 A;  4D2O A;  1FCN A;  4LRX C;  4B4X A;  4P6B A;  4EES A;  2W27 A;  4YWZ A;  3DAV A;  4E6X A;  1F98 A;  5EM0 A;  3UNW A;  4NXE A;  5A91 A;  1FCO A;  3A3D A;  2WGW B;  4JXV A;  4P85 A;  4WM9 A;  5CTN A;  5FQK A;  2XSS A;  3S7O A;  1XGJ A;  4DJ3 A;  3NY4 A;  3U2A A;  2WZZ A;  3SZT A;  1KGF A;  4UA6 A;  5CRF A;  5C5K A;  4EBP A;  4H8R A;  1K25 A;  2HJE A;  3ZG8 B;  3NOU C;  3EOI A;  3HJK A;  2ZQA A;  3IXH A;  4OP8 A;  1PFL A;  4OPY A;  2VEA A;  4KG2 A;  2JBF A;  3EEA A;  3KYQ A;  2XA7 M;  1E4D A;  2RL3 A;  4GDN A;  2PR5 A;  5DFX A;  3VOY A;  3E4P A;  3OBF A;  1PI5 A;  4GW9 A;  2O9A A;  4GS9 A;  3BY9 A;  2ZQC A;  3MKF A;  3G2Z A;  5TJJ A;  4X1L A;  3SW1 A;  1W63 Q;  4MMN A;  1F2K A;  1DJA A;  3DW0 A;  4R23 A;  5A93 A;  4E6W A;  1P9W A;  2P9V B;  1LI0 A;  3ZFZ A;  2PBD P;  1VM1 A;  1K54 C;  1GA9 A;  2JHE A;  2PAV P;  5FQQ A;  5EVE A;  3GVB A;  2ZM8 A;  1LL8 A;  1PRQ A;  2ZOI A;  3HLG A;  1L0D A;  3UPO A;  3WRZ A;  4S2N C;  4S2K A;  4H6J B;  3T1S A;  3D72 A;  5AVF A;  4Y5F A;  3QP4 A;  4DN0 A;  4EV4 A;  4WMC D;  5GHY A;  5FI6 A;  3H9W A;  4C75 A;  3C38 A;  4UQI S;  1T1B A;  2J7V A;  3TE8 A;  3MFD A;  3G4P A;  1VQQ A;  2V0W A;  4FTX A;  5FAQ A;  1S4R A;  1KE4 A;  3N8S A;  2P74 A;  2Z2L B;  1DP9 A;  1JWP A;  4FOF A;  2R9X A;  4EER A;  1SKO A;  1G5U A;  4OVD A;  4WLA A;  2C6W B;  1YAX A;  1XXM A;  1XA7 A;  4I3J A;  1ES2 A;  2EFX A;  5HAI A;  3FG8 A;  3HLB A;  2Y2Q A;  4N1H A;  3FV7 A;  1TD5 A;  1YSQ A;  4L9F A;  4DE2 A;  4UA9 A;  5TBM B;  3OPH A;  3L7H A;  1DRM A;  3UE6 A;  4BEN A;  2DCF A;  5GLD A;  4GOG A; 
#chains in the Genus database with same CATH homology
 4MEZ A;  5EVL A;  1N9B A;  2FFY A;  2WYX A;  1L0G A;  4FD8 A;  1S0W A;  2Z2M B;  4L0L A;  5FAT A;  3FZC A;  3QNB A;  4WZ5 A;  1PI4 A;  4P87 A;  4DE1 A;  1IEL A;  1MWU A;  1NZO A;  3AGE A;  3PTE A;  3VSL A;  2EX9 A;  5CGW A;  3ZNT A;  4EQI A;  2BG1 A;  5GLC A;  3MXS A;  1NYM A;  1LI9 A;  1IYO A;  4ZJ1 A;  1GCE A;  3O86 A;  4IVK A;  1I2W A;  4BJP A;  2ZQ8 A;  1E3U D;  4FCF A;  1JTG A;  4ID4 A;  5DF7 A;  4U0X A;  2DNS A;  2P9V A;  3EQU A;  4F94 A;  1ONH A;  4PM8 A;  3PAE A;  3FYZ A;  3NCK A;  4ZDX A;  1LL5 A;  2I72 A;  3UE3 A;  5L2F A;  5CGX A;  4LCL A;  5GL9 A;  4HES A;  2Y2H A;  4R4S A;  3BFC A;  4ZJ2 A;  3UDI A;  3ZDJ A;  4JXS A;  2WAD A;  5G18 A;  4YFM A;  2OLV A;  3ZHH A;  5F82 A;  1EWZ A;  1ES4 A;  3JYI A;  5M19 A;  1TDL A;  3C4O A;  1J9M A;  2Y4A A;  3AGF A;  1SHV A;  2ZC4 B;  3QNC A;  1ES3 A;  1I5Q A;  3BEB A;  3CZD A;  4ZJ3 A;  3G34 A;  4S2P A;  1MPL A;  3BFF A;  3HUM A;  3ZG0 A;  3FWL A;  4OQG A;  1BUL A;  3NI9 A;  1K55 A;  5DTT A;  2XK1 A;  2ZD8 A;  3Q82 A;  2H5S A;  1SDE A;  1U60 A;  2ZMA A;  4LV2 A;  3M2K A;  1ZKJ A;  2EFU A;  4UAA A;  1CEG A;  5TR7 A;  2VGJ A;  3IF6 B;  3S22 A;  5D3O A;  3LO7 A;  5DTK A;  4EWF A;  1XKZ A;  3Q1F A;  2A49 A;  1XP4 A;  2X02 A;  3N7W A;  2R9W A;  2Q9M A;  2Y2L A;  5EVI A;  1KGE A;  1PW1 A;  3GR2 A;  5HL1 A;  4WYY A;  1YMX A;  3S4X A;  2J9P A;  3HRE A;  4LV3 A;  3TSG A;  4BD1 A;  5F1F A;  2QPN A;  3HLF A;  5AQ7 A;  3IHA A;  4LV1 A;  4OQI A;  2Y2O A;  4O7D A;  1M40 A;  5M1A A;  4JF6 A;  1DY6 A;  4Z9Q A;  1GHP A;  2Y2P A;  3FKV A;  2PBY A;  2WGW A;  2EXA A;  4Y0O A;  2XD5 A;  4KEN B;  3GTC A;  4JXW A;  1FR6 A;  3MZE A;  2PU4 A;  1IKG A;  1MWR A;  1WYB A;  5FSR A;  1PZO A;  5GHX A;  1YLW A;  3EQV A;  1Q2P A;  3HUO A;  2X71 A;  1ERM A;  4DE0 A;  4R3B A;  2WAF A;  4E3J A;  1GHM A;  4Y7P A;  3BFG A;  1Q2Q A;  1L0E A;  2Y2J A;  3IF6 C;  3PBN A;  2WKI A;  1BLP A;  4K0X A;  1G68 A;  1SCW A;  2RCX A;  4FH2 A;  4X56 A;  3GQZ A;  1IKI A;  1MBL A;  1MWS A;  1LHY A;  4QY6 A;  4GOG A;  4MBH A;  2ZC5 B;  2Y55 A;  3FKW A;  3ZNY A;  2XLN A;  1RP5 A;  3VFH A;  3CG5 A;  3GRJ A;  4WEJ A;  1BLS A;  2ZC3 B;  3G32 A;  1LLB A;  1MKI A;  4OP5 A;  2V2F F;  3TG9 A;  4KQR A;  3VP0 A;  4C6Y A;  4RX3 A;  1PYY A;  2HP6 A;  4WBG A;  3ZCZ A;  4KZ3 A;  1BTL A;  3NDE A;  3IXG A;  4GD8 A;  4GNU A;  4UA7 A;  3V39 A;  5FAS A;  2OSU A;  1XPB A;  5F83 A;  2VGK A;  3IWQ A;  5E2H A;  1S6R A;  3LEZ A;  1NRF A;  4JKT A;  4WMC A;  5CXW A;  1GHI A;  1YLT A;  2EX6 A;  3GSG A;  3I7J A;  3WS4 A;  5GLA A;  3W4O A;  1ZG6 A;  3Q7V B;  4S2I A;  4JF5 A;  3LCE A;  3ZG5 A;  3C4P A;  2IWD A;  3HLC A;  3QHY A;  5HX9 A;  5CEC A;  3MZF A;  4GZB A;  5AQ9 A;  4KZ4 A;  2EX2 A;  5HW3 A;  5CHJ A;  3SS4 A;  3W4P A;  2XD1 A;  3MBZ A;  4MNR A;  5FA7 A;  1YM1 A;  4OQH A;  3Q7Z A;  3UPN A;  2XEP A;  4KZA A;  1FSW A;  4HEF A;  4OH0 A;  2EXB A;  4KG5 A;  4E3I A;  2OV5 A;  4M3K A;  3A3F A;  3A3I A;  4OLD A;  3OC2 A;  1Y54 A;  5CTM A;  3IWI A;  3WS1 A;  1PWD A;  1WE4 A;  4OLG A;  2V1Z A;  3V50 A;  4PM5 A;  1W79 A;  1E25 A;  4CPK A;  3BM6 A;  1TEM A;  3RJU A;  5IHV A;  2WGV A;  1BZA A;  1TDG A;  2HDS A;  3TOI A;  3HLD A;  1CEF A;  3GMW A;  4OKP A;  4ZAM A;  4R0Q A;  5HFO A;  2X01 A;  3WWX A;  5DF8 A;  1FQG A;  3DWZ A;  5FAO A;  1YT4 A;  2ZQ9 A;  3N8L A;  4QB8 A;  5HAP A;  4X55 A;  4PPR A;  4WEL A;  2HP9 A;  2Y2M A;  4U3T A;  3SS5 A;  3ZVW A;  2HP5 A;  2GDN A;  1DJC A;  4X68 A;  3E2K A;  3W8K A;  5A92 A;  5FI7 A;  1ESU A;  4E3M A;  4OON A;  4DDS A;  1K56 D;  3Q07 A;  1XGI A;  3SH7 A;  1NJ4 A;  1GA0 A;  1JTD A;  3O88 A;  5DVA A;  3O87 A;  4PM9 A;  5CEB A;  1CI8 A;  4IED A;  4P0M A;  3MXR A;  4N9L A;  4OPQ A;  4S2M A;  2WKE A;  2Y2N A;  4OQ0 A;  4JBF A;  4OOL A;  4GD6 A;  2B5R A;  2V20 A;  4MLL A;  2XGN A;  1H5X A;  4C3Q A;  1KGG A;  2C5W B;  1OME A;  3LY3 A;  5EUA A;  1ERQ A;  4HBU A;  4OPZ A;  5CGS A;  4KZ7 A;  3UE0 A;  4E3K A;  1K57 A;  2ZQ7 A;  3BRM A;  2H0Y A;  3OCN A;  1BLH A;  1Z6F A;  1HVB A;  3BFD A;  5FAP A;  2Y91 A;  4DE3 A;  1O07 A;  1G6A A;  2ZM0 A;  2JE5 A;  4GN2 A;  1JWZ A;  1JWV A;  3M2J A;  4UHU A;  3IH8 A;  5CHU A;  1E3U A;  2BLS A;  3WS5 A;  2OLU A;  1C3B A;  2XH9 A;  1K6S A;  2ZC7 A;  3DWK A;  3IQA A;  4GKU A;  4RYE A;  2IWC A;  3SH8 A;  1BSG A;  4ZTK A;  4ZBE A;  3SS3 A;  1W8Q A;  1HD8 A;  5EOO A;  2HDQ A;  5DTS A;  4XXR A;  5AQA A;  3NC8 A;  4JPM A;  3G35 A;  4U0T A;  4Y0T A;  1ZC2 A;  4KZ8 A;  3HBR A;  3IXD A;  3Q81 A;  1FSY A;  3GV9 A;  5U47 A;  1FCM A;  3N4I A;  3UE1 A;  1IYQ A;  4WZ5 C;  3V3S A;  1IYP A;  4QU3 A;  5CED A;  2DRW A;  4XUZ A;  3WS0 A;  3VP1 A;  2Y2I A;  1EI5 A;  1K56 A;  1PW8 A;  1YLY A;  5FQ9 A;  4EBL A;  3PBR A;  2HDU A;  3PBS A;  5KMW A;  2G2W A;  2JC7 A;  4R1G A;  4EUZ A;  4WEK A;  5EOE A;  1KE0 A;  3ISG A;  1RGZ A;  3UN7 A;  3VP2 A;  1L0F A;  4RA7 A;  3HL9 A;  4Q8I A;  2Y2K A;  3HLW A;  3W4Q A;  1O7E A;  2XR0 A;  5I94 A;  1XX2 A;  1K38 A;  5EVI B;  1PZP A;  3VP4 A;  4D2O A;  1BUE A;  3Q7V A;  1FCN A;  4B4X A;  1JVJ A;  4P6B A;  5FQM A;  1N4O A;  1CK3 A;  1I2S A;  1ZG4 A;  2QZ6 A;  4DF6 A;  4E6X A;  2ZC6 B;  5E2G A;  3B3X A;  4LV0 A;  1ALQ A;  3UNW A;  4BL2 A;  5JYO A;  1YMS A;  5TGF A;  3N8R A;  3ZVT A;  4RVA A;  5A91 A;  1L2S A;  1FCO A;  1YLP A;  3A3D A;  2WGW B;  4JXV A;  1H8Z A;  4P85 A;  2Y2G A;  4WM9 A;  3UPP A;  5CTN A;  5FQK A;  1MWT A;  2FFF B;  2Q9N A;  1K6R A;  1LL9 A;  1BLC A;  2WKH A;  5GLB A;  1MY8 A;  3UDX A;  1XGJ A;  4K0W A;  4LCM A;  3VOZ A;  3NY4 A;  4BQM A;  2WZZ A;  3ZGA B;  3IXB A;  5KZH A;  1KGF A;  1ONG A;  2JCH A;  3NBL A;  1KDW A;  3P09 A;  4UA6 A;  4IBR A;  5FQJ A;  1MXO A;  4DKI A;  3VMA A;  1NXY A;  5CRF A;  5EVI C;  4OPR A;  4JXG A;  4EBP A;  2WUQ A;  3BLM A;  5GHZ A;  4KQQ A;  4H8R A;  1K25 A;  1XA1 A;  5FDH A;  1DJB A;  3A3E A;  2XFT A;  3ZG8 B;  4OP8 A;  1BT5 A;  2ZQA A;  3IXH A;  3MKE A;  5FI2 A;  2G2U A;  1IEM A;  4CJN A;  1RGY A;  4KZ9 A;  2H0T A;  4OPY A;  1KDS A;  1WYC A;  3UY6 A;  4S2O A;  4KG2 A;  4PM7 A;  2JBF A;  4E3L A;  3IT9 A;  3IF6 A;  5EVI D;  4KZB A;  3PBQ A;  1H8Y A;  4NET A;  2UWX A;  3ZG7 B;  2ZJ9 A;  1E4D A;  3C7V A;  1YLJ A;  1KVM A;  4IBX A;  2ZM2 A;  1FOF A;  3IHB A;  2RL3 A;  5EEC A;  4GDN A;  3CMZ A;  3VOY A;  1M6K A;  3WS2 A;  3BLS A;  3A3J A;  3ITA A;  4N9K A;  5JYP A;  1PI5 A;  3OPL A;  2WZX A;  3M6B A;  3UO9 A;  4BD0 A;  2HDR A;  2PU2 A;  2WAE A;  5HAR A;  5E43 A;  3LY4 A;  4GB7 A;  1K4E A;  3G30 A;  4FSF A;  2ZQC A;  3IF5 A;  3MKF A;  2A3U A;  3G2Z A;  4N92 A;  4RX2 A;  2J9O A;  1SKF A;  3C5A A;  5E2E A;  1DJA A;  3DW0 A;  5E2F A;  4R23 A;  4R4R A;  1PWC A;  5A93 A;  1W7F A;  4DRT A;  1NZU A;  3PBT A;  3P98 A;  3ZG9 B;  3M6H A;  3OCL A;  3HUN A;  1YQS A;  3PAG A;  4QHC A;  4E6W A;  2P9V B;  1LI0 A;  3ZFZ A;  4PMA A;  3VP3 A;  2WGI A;  4N1X A;  1VM1 A;  4JF4 A;  3V3R A;  1K54 C;  3BEC A;  4IVI A;  1GA9 A;  3IWO A;  4KG6 A;  5FQQ A;  4PM6 A;  5TFQ A;  2XF3 A;  3PBO A;  4JLF A;  4BLM A;  3GVB A;  1TVF A;  1W5D A;  3SOI A;  2ZM8 A;  4DXC A;  5A90 A;  3HLG A;  4X6T A;  4R3J A;  5KSH A;  1AXB A;  4X69 A;  1L0D A;  3UPO A;  3WRZ A;  4E3N A;  1RCJ A;  4S2K A;  4S2N C;  3S1Y A;  4B4Z A;  3OPR A;  5EPH A;  3G2Y A;  5BOH A;  1HZO A;  1FR1 A;  2XFS A;  4S2J A;  3V5M A;  1ES5 A;  4EV4 A;  3C7U A;  3WRT A;  1KE3 A;  2H10 A;  5CER A;  2Y59 A;  4WMC D;  5GHY A;  3N6I A;  5FI6 A;  4E3O A;  3VFF A;  4C75 A;  3E2L A;  1IYS A;  4KZ6 A;  2J7V A;  1KVL A;  5F1G A;  4S2L A;  4GDB A;  5HAQ A;  2HPB A;  3O3V A;  3MFD A;  3NDG A;  3VSK A;  4DXB A;  2CC1 A;  4KQO A;  3MZD A;  4NK3 A;  3G4P A;  3OPP A;  1VQQ A;  4XUX A;  5EE8 A;  1HTZ A;  5M18 A;  3BYD A;  3G31 A;  5FAQ A;  3CJM A;  3RXX A;  5KSC A;  4QJG A;  1KE4 A;  1QME A;  1PWG A;  3N8S A;  4YIN A;  2E8I A;  2P74 A;  2Z2L B;  1YLZ A;  3BFE A;  3NIA A;  1ESI A;  3RXW A;  1JWP A;  5FQI A;  4EBN A;  2QMI A;  1NY0 A;  1PIO A;  4FH4 A;  5J8X A;  4K91 A;  2R9X A;  3SH9 A;  2ZLY A;  4OOM A;  1QMF A;  4OVD A;  1K4F A;  1W8Y A;  2J8Y A;  1ERO A;  2C6W B;  1XXM A;  4LEN A;  1K55 C;  1XA7 A;  3DTM A;  1ES2 A;  2EFX A;  5HAI A;  2IWB A;  4QD4 A;  5DF9 A;  3UDF A;  4KZ5 A;  4DDY A;  1CI9 A;  4OOY A;  3OZH A;  3HLB A;  2Y2Q A;  1NYY A;  4N1H A;  2XQZ A;  3FV7 A;  3ITB A;  4Y0U A;  1K54 A;  1SDN A;  5AQB A;  4X53 A;  4DE2 A;  4MBF A;  1K57 C;  4UA9 A;  3OPH A;  4MBK A;  2ZQD A;  2WK0 A;  2XDM A;  4BEN A;  2DCF A;  2EX8 A;  5CHM A;  4HBT A;  4BL3 A;  4B88 A;  3D4F A;  3HVF A;  3IH9 A;  4A5R A;  3AGD A;  4WZ4 A;  4S2N A;  4QY5 A;  5GLD A;  3HLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...