3HLWA

Ctx-m-9 s70g in complex with cefotaxime
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
publication title Structural insights into substrate recognition and product expulsion in CTX-M enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3hlwA00
3NDEA 1ZG6A 4GD6A 3UY6A 2ZC5B 4N9KA 5M18A 2P9VA 5FQKA 4OQGA 4O7DA 2RCXA 2E8IA 1KDSA 3IT9A 3O87A 4RX2A 5GLBA 1SKFA 3IH9A 4RA7A 4EWFA 4BD1A 4XUXA 5E43A 1YMXA 4KQOA 4BD0A 3NBLA 1DJBA 2EX2A 3WS1A 4NK3A 4OOLA 1ONGA 2R9XA 4LV1A 1L0GA 3Q7ZA 3IWQA 3ZNTA 1LLBA 1JTDA 5FASA 3IF5A 4S2KA 3PBQA 3M6HA 1BUEA 3IXDA 2XD5A 1JTGA 2EX6A 4Y7PA 1W7FA 4GNUA 3ZG7B 1PWDA 4P0MA 3IF6C 2IWDA 4E3LA 2HDSA 1FSYA 2ZJ9A 5AQ9A 4MBFA 4Q8IA 4GDBA 4EV4A 2ZQCA 3ZVWA 3MXRA 1K25A 2Y2HA 5KMWA 1K57C 3ZGAB 2Y4AA 5HAPA 1W5DA 3ITBA 2H0YA 1XKZA 2J7VA 1S0WA 4OP5A 4OQHA 2GDNA 3ZFZA 1C3BA 1NJ4A 1EROA 2FFFB 4OPRA 1LHYA 3RXXA 3QNCA 1KE3A 1VQQA 4E3IA 4OPYA 1YM1A 2XK1A 4S2NA 3VOZA 2OLVA 1KDWA 1ZG4A 2WUQA 5GHXA 1NZOA 4UA9A 3WS2A 4DE2A 4GD8A 4KENB 2Y59A 4DF6A 2WZZA 1XA7A 2WGIA 3IXBA 4UA7A 2HDRA 3PBOA 3N7WA 4PPRA 1M6KA 4ZAMA 3NDGA 1TDLA 2HP9A 4WMCA 4FH4A 5EVIC 2ZM2A 5FI2A 4HBUA 4KZAA 3HLWA 3SH7A 4X53A 3OC2A 2B5RA 3W4OA 1GHIA 3GMWA 3UE0A 3S4XA 3BFDA 3HREA 4OONA 3LY3A 2BLSA 4EBNA 2WZXA 5A92A 3M2KA 4PM6A 4KZ5A 5GLDA 4UA6A 3HLGA 2QMIA 4FD8A 5KSCA 1EWZA 3C4OA 3FKVA 4WBGA 1AXBA 1DY6A 1XP4A 3MZEA 4WMCD 5DVAA 3G32A 4K91A 4PM9A 1XXMA 5CHUA 3G31A 4QJGA 4JF4A 4PM5A 1ZKJA 4KQQA 3BLSA 2EXBA 4WZ5A 4BENA 4X69A 3LO7A 4KG6A 4RYEA 1K54A 2WGVA 4XXRA 1YMSA 5E2FA 4ZDXA 4R23A 2XD1A 2Y2JA 4DDYA 4HBTA 3ZHHA 5HAIA 2WKIA 4E3NA 1ONHA 5TR7A 2G2UA 3G4PA 3NC8A 5AQBA 4OPZA 2EX8A 3I7JA 4WZ4A 2WGWB 4GN2A 1L0FA 2WKHA 1PWCA 2Y2LA 3OCNA 1FSWA 5JYPA 5TFQA 1CK3A 3SS5A 1N9BA 5F1GA 1IELA 3ZVTA 1SDEA 2XF3A 2XR0A 4C75A 2V1ZA 4BLMA 2QPNA 5F82A 3SS3A 3DW0A 5M19A 2HP5A 4MLLA 5CHMA 3HLCA 3DWZA 3FKWA 5GLCA 1PZOA 2EFUA 4X6TA 4B4ZA 4DE1A 2OSUA 4N9LA 3WRZA 4HEFA 2XGNA 4P6BA 3ZCZA 1E25A 2X01A 5FQMA 3OPPA 4PMAA 5HARA 3A3JA 2XFTA 3HVFA 1K56A 4DE3A 2Q9NA 4K0WA 3TG9A 3PBTA 3HLFA 5HX9A 4JXGA 2C5WB 5E2EA 2C6WB 3G2YA 1W8YA 3ZNYA 1K55C 4QU3A 3HLDA 1CEFA 2ZQDA 1GA9A 4IEDA 3IQAA 1ESIA 1ESUA 3GR2A 2P74A 3A3DA 1LI9A 3BECA 3W4QA 1K56D 2Y55A 1RP5A 3FWLA 2XLNA 2H5SA 1Q2PA 4DE0A 3DWKA 1HZOA 4OLGA 1NY0A 1PI5A 2JE5A 4Z9QA 5HFOA 4OP8A 4IBRA 2DCFA 3HUOA 3NI9A 2IWBA 1E4DA 4KQRA 5FQJA 1GA0A 3NY4A 3UE1A 4WYYA 3MXSA 1ES5A 5CTMA 5AQAA 3VP3A 4D2OA 1HD8A 2OV5A 5FSRA 5FATA 4S2IA 3LY4A 5A93A 1PIOA 1CEGA 1ERQA 5BOHA 3GSGA 3ZG5A 1L0DA 5GL9A 1S6RA 4N92A 2WAFA 5FI7A 4ZJ2A 3ZDJA 4A5RA 5F83A 4JBFA 1GHPA 1WYCA 1FOFA 5AQ7A 3C7UA 1TDGA 2PU4A 2ZQ8A 4JLFA 1FCOA 1J9MA 5CTNA 1GHMA 2QZ6A 3IXHA 4S2OA 4EBPA 5GHZA 1YLWA 1YLZA 2ZQAA 3UO9A 1PI4A 1K4FA 3G35A 3HLEA 5FQIA 3UDXA 3E2LA 1NYYA 3N6IA 1IYQA 5GLAA 3V39A 3Q7VA 3UDFA 3QHYA 2JBFA 1NRFA 3JYIA 4OLDA 4BQMA 4OQIA 4RVAA 1XGIA 1YT4A 1TVFA 3UE3A 4FH2A 5FI6A 3W4PA 2EX9A 3OPLA 1MWSA 3Q7VB 3IF6A 1KE4A 3AGFA 4GZBA 1H8YA 4MEZA 5U47A 3B3XA 3MKFA 1K57A 5EOOA 5FAPA 3TOIA 4WEKA 5E2GA 1SHVA 1LL9A 4E6WA 3PAGA 2ZD8A 1KGFA 3NCKA 4E3KA 4K0XA 3GVBA 4DDSA 3IF6B 1NYMA 1ERMA 4QHCA 1NXYA 4ZBEA 3WS5A 4N1HA 2H10A 1KGGA 5EUAA 3VSLA 1MBLA 5CGXA 2Z2LB 1RGYA 3CJMA 3C4PA 1QMEA 3BEBA 5HL1A 2WGWA 2EFXA 5CGWA 4Y0UA 2WK0A 1XPBA 3ITAA 4R3JA 5DTKA 5GHYA 3UDIA 3RXWA 1H8ZA 4E3JA 5L2FA 2RL3A 2JC7A 5E2HA 1I2SA 4MBKA 4QY5A 5EVIA 2XDMA 4L0LA 5EECA 3SS4A 4E3OA 1BZAA 1FCNA 2A49A 4E6XA 1BT5A 3Q82A 1PWGA 1YLYA 1M40A 5DF7A 1Z6FA 2Y2MA 5CRFA 5CHJA 1H5XA 5HW3A 5DTSA 3QNBA 3S22A 4ZTKA 3PBSA 1W79A 1LI0A 5EVIB 3BRMA 2WYXA 1YLTA 3PTEA 5EVID 3BM6A 3HLBA 1K38A 1QMFA 1YQSA 3BYDA 4LCMA 5CXWA 5EE8A 4IVIA 1YLPA 4OOYA 1IYSA 5DTTA 3BLMA 1ES2A 4R4RA 3UNWA 2J8YA 1K6RA 2IWCA 3VFHA 2ZC4B 4QD4A 4OH0A 3VFFA 5CEDA 2X02A 3FV7A 3D4FA 5FQQA 5J8XA 1G6AA 3UN7A 1XA1A 4LV2A 3A3FA 3IHAA 3MKEA 3VP1A 3VP2A 3ZG0A 5CEBA 5F1FA 1MXOA 1I5QA 3BFEA 4U0TA 5DF8A 4WEJA 2ZM8A 4X68A 4F94A 3LCEA 1NZUA 4C6YA 3N8RA 3N8SA 3V3RA 3WS4A 4B88A 3WWXA 2H0TA 4JXSA 4UHUA 2V2FF 4R3BA 1BLHA 2X71A 1KGEA 3G34A 3HUNA 2PU2A 1MWRA 1E3UA 4GB7A 4U3TA 5EVLA 4BL3A 4R1GA 4BL2A 2Y2PA 2HP6A 3W8KA 1KE0A 2DRWA 3IXGA 2JCHA 2HDQA 4ZJ1A 1PW8A 2ZLYA 4KZ4A 2XEPA 4QB8A 4S2PA 1OMEA 4IBXA 4H8RA 1E3UD 1FR6A 2ZMAA 3C7VA 3EQUA 4MBHA 1HTZA 4N1XA 2EXAA 3N8LA 4GOGA 2VGJA 4S2NC 1TEMA 1BTLA 3N4IA 4XUZA 1IYPA 4KG5A 3UPNA 1SDNA 3GRJA 5I94A 1FCMA 1G68A 1ALQA 2P9VB 3IHBA 1K6SA 1K55A 2Y2IA 3A3IA 4YFMA 4DRTA 4X56A 1PYYA 3P09A 4E3MA 3A3EA 1K4EA 4R0QA 2OLUA 3GQZA 1L0EA 2XH9A 4KZ6A 3CMZA 1ES3A 4P87A 1RCJA 2ZQ9A 4OVDA 4CPKA 3UPPA 1IEMA 1VM1A 2XFSA 3AGEA 3P98A 2HDUA 1ZC2A 3BFCA 4YINA 1WE4A 4JF5A 3O86A 2G2WA 5HAQA 4EUZA 1HVBA 1FR1A 3EQVA 3E2KA 4DXCA 4S2MA 3FZCA 2Y2GA 1Q2QA 4DKIA 3PBNA 3MZFA 5FDHA 2Y2NA 3G2ZA 5DF9A 1L2SA 3ISGA 3VOYA 3O88A 4JPMA 3SOIA 2Y2QA 1GCEA 2R9WA 4CJNA 3FYZA 5FA7A 4WZ5C 2BG1A 3MZDA 1PZPA 4WM9A 1XGJA 3CZDA 3IH8A 1IKIA 1K54C 2ZM0A 3HBRA 5G18A 5A91A 4OQ0A 3G30A 3BFGA 4RX3A 4Y0OA 5M1AA 1W8QA 4KG2A 4R4SA 2WAEA 4KZ3A 3HL9A 5FAQA 3WRTA 5EOEA 4UAAA 1SCWA 3PAEA 3MFDA 3VP4A 3OZHA 1JWPA 2Y2KA 2Y91A 3CG5A 1MKIA 2I72A 4MNRA 4FCFA 2V20A 2VGKA 3SH8A 3C5AA 1MPLA 1I2WA 3IWOA 4NETA 5EPHA 1BLPA 3V3SA 1CI8A 3S1YA 3TSGA 1CI9A 4LV0A 4U0XA 2FFYA 1JWZA 3RJUA 1U60A 1LL5A 4X55A 4JXWA 3GTCA 1JWVA 2Y2OA 2J9PA 2ZC7A 4M3KA 5IHVA 4KZBA 1JVJA 4GDNA 3VP0A 3HUMA 2ZC3B 1MWTA 1IYOA 5CERA 1MWUA 2J9OA 5TGFA 4Y0TA 5KZHA 3VMAA 4WELA 3SH9A 1BULA 2HPBA 2UWXA 3LEZA 2A3UA 3OPRA 4ZJ3A 3M6BA 3DTMA 1RGZA 1O7EA 3MBZA 1Y54A 4PM8A 1O07A 2Q9MA 5D3OA 4B4XA 3UPOA 3Q81A 1BLCA 3OPHA 4KZ9A 5KSHA 4GKUA 1DJCA 5CECA 4ID4A 4JXVA 3ZG8B 2WADA 4S2JA 3Q1FA 3WS0A 3PBRA 4JKTA 2WKEA 1YLJA 4JF6A 4P85A 5FAOA 5JYOA 1MY8A 4EQIA 3AGDA 2Z2MB 3BFFA 4HESA 1BLSA 1ES4A 4KZ8A 4LV3A 1KVLA 1WYBA 1IKGA 4DXBA 2CC1A 3V50A 3VSKA 4LCLA 4OPQA 4S2LA 2PBYA 1KVMA 3O3VA 4OKPA 3Q07A 2XQZA 4QY6A 3NIAA 1DJAA 2ZQ7A 4OOMA 3ZG9B 3M2JA 1N4OA 4FSFA 3V5MA 5A90A 1XX2A 3IWIA 4KZ7A 4PM7A 5CGSA 4BJPA 2DNSA 1PW1A 5FQ9A 3OCLA 2ZC6B 1FQGA 4IVKA 4EBLA 4C3QA 1EI5A 1BSGA 4LENA 3GV9A
chains in the Genus database with same CATH superfamily
3NDEA 2ZOIA 4GD6A 2Z6DA 3LI8A 2P9VA 1KDSA 4O01A 2QWSA 2ZBBA 4RX2A 1SKFA 2O9AA 3IH9A 5AVEA 4KQOA 3WS1A 2VGLS 4UQIM 4OOLA 1ONGA 1D1JA 4DJ3A 2R9XA 1L0GA 3T4SA 5FASA 3IF5A 4S2KA 1OJ5A 3EEAA 4GNUA 4P0MA 2IWDA 1YKDA 2V0UA 1FSYA 4Q8IA 2Y2HA 4NXFA 5KMWA 1K57C 1PNEA 5HSQA 1XKZA 4IJGA 1C3BA 1NJ4A 2FFFB 4OPRA 1KE3A 4HY8A 4S2NA 2XK1A 2OLVA 2OAQ1 3C8CA 3CUEA 3IX3A 1Z09A 4DF6A 2WZZA 1XA7A 3B47A 5CX7A 3VOLA 3N7WA 4L9FA 5FI2A 2WKRA 3NOPC 2GJ3A 1G6OA 4UA6A 2QMIA 4FD8A 3C4OA 1DY6A 2PR5A 4E04A 4F3LA 3VV4A 4JF4A 4KQQA 4KG6A 1K0KA 4CLCE 3TW8A 4RYEA 1K54A 4XXRA 3JVVA 3LIFA 4DDYA 2V1AA 2WKIA 2VEAA 5AQBA 3F1NA 4OPZA 4WZ4A 3I7JA 2PYPA 2WKHA 5DJUA 2Y2LA 3QP1A 5JYPA 3SS5A 3TRCA 1SDEA 2XR0A 3D72A 2QPNA 5J3WA 4BLMA 3SS3A 3MQOA 2HP5A 3MF0A 3MFXA 1W63M 4X6TA 4B4ZA 3WRZA 4Z1WA 4HEFA 3HVFA 4DE3A 3FPWA 1FILA 4LGWA 5FL3A 4X1LA 2V8FA 3E4PA 4HOIA 3ZNYA 1K55C 4GJ4A 2HV1A 3GR2A 1S1YA 3BECA 2XLNA 4DE0A 2BTFP 1NY0A 1PI5A 2JE5A 2L1MA 1L3LA 4CLCB 4IBRA 1KOUA 2B02A 3NY4A 3UB5P 3MXSA 2OV5A 5FSRA 4S2IA 4B9OA 4BWIA 1F5MA 5GL9A 2HGVA 5CTNA 2Y8HA 1J9MA 4S2OA 4EBPA 5GHZA 1YLZA 3Q7VA 3UDFA 1HLUP 2JBFA 1VETA 3S7QA 4OLDA 3B42A 4QPRA 2EX9A 3OPLA 1MWSA 3LEQA 1KE4A 2VV7A 2V9AA 3SW1A 2W3GA 1LL9A 5FDSA 2ZD8A 3NCKA 1NYMA 1ERMA 4GHIB 5FEGA 4IHQA 2J3WA 1MBLA 3R7WB 1DP9A 1QMEA 2EFXA 4Y0UA 3RXWA 2AVXA 3MR0A 5E2HA 3UB7A 5EVIA 3UB9A 3TE8A 1M40A 5DF7A 1N9LA 1Z6FA 2E8JA 1H5XA 4PKYA 3QNBA 3KSFA 4ZTKA 1TS7A 1W79A 2M7VA 1TD5A 4LCMA 4I3JA 4L9EA 2GX5A 2WKPA 2J8YA 4DJ2A 2IWCA 1OTBA 3VFFA 2X02A 3FV7A 5FQQA 1G6AA 3H9WA 1XA1A 4KUKA 3MKEA 3VP2A 3NHQA 3ZG0A 1VHMA 5CEBA 4WEJA 4F94A 3LCEA 1NZUA 3BY8A 3V3RA 2H0TA 2XROA 1BLHA 2X71A 2H28A 1E3UA 4BL2A 3H7WB 4GCZA 4LFUA 3W8KA 4CLCD 1G28A 2PRFA 1ZTUA 2DRWA 3E4QA 3F1PB 1PW8A 2XEPA 1DP8A 1OMEA 3C7VA 4N1XA 4D60A 2VGJA 2LB5A 5F5YA 4KG5A 1G68A 1ALQA 3IHBA 5L10A 1T1CA 4R0QA 3MQQA 1XFQA 4OVDA 4CPKA 1VM1A 2HDUA 3QP4A 2MJ6A 1TS8A 4JF5A 4EUZA 4Y5FA 4S2MA 3FZCA 3OLOA 1CF0A 4I38A 3O88A 4JPMA 2FZ0A 3FG8A 1PZPA 3EGXC 3A0VA 2VV6A 4WM9A 1SKOB 3HBRA 2ZM0A 3G30A 3NECA 4KG2A 1OTIA 5FAQA 3T4OA 3WRTA 5EOEA 1VEUB 2Y2KA 3CG5A 2V20A 3S7OA 4WF0A 4NETA 2VGLM 3V3SA 5EV0A 2FFYA 4O8GA 5J4EA 1U60A 1JWVA 5IHVA 4B88A 3DBAA 3G6OA 3HUMA 1MWTA 5CERA 5TGFA 4WELA 4Y3IA 3SH9A 5TJJA 3OPRA 4ZJ3A 3UE6A 3B33A 1RGZA 1O7EA 5D3OA 2Q9MA 3Q81A 2V1BA 4KZ9A 4PAUA 2ZOHA 3PBRA 1WA9A 4JF6A 4P85A 2V0WA 5JYOA 2PR6A 1ES4A 4DXBA 3FC7A 4MDZA 3Q07A 4QY6A 4NEED 1DJAA 3CITA 4HI4A 1N4OA 3V5MA 4KZ7A 1S67L 2VV8A 2ZC6B 4C3QA 5HPFA 5HDCA 5HPIA 4OQGA 2INWA 4O7DA 2RCXA 4WLAA 4EWFA 4BD1A 4XUXA 2EX2A 4Y13A 5TBMA 1T18A 4IUKA 2P08A 1OJGA 3TJZC 3ZNTA 3Q7ZA 1TS6A 4HNBA 1VB6A 1JTDA 3F1OB 3PBQA 2NUPC 1PWDA 2PBDP 3IF6C 4E3LA 3KYEA 2HDSA 3ZYTA 4GDBA 2ZQCA 3ZVWA 3MXRA 2H0YA 1LHYA 3QNCA 4E3IA 2ACGA 5L8MA 4UA9A 4DE2A 4KENB 2O9BA 2Y59A 5MC7A 4R3AA 1W63Q 4PPRA 1M6KA 3NDGA 1YPRA 4WMCA 4FH4A 4HBUA 3K2NA 2B5RA 1GHIA 3GMWA 2I9VA 3HREA 4OONA 3BW6A 2JKTI 5KSCA 3MJQA 2J3TD 1AXBA 3MZEA 1XP4A 3G32A 3P01A 3BLSA 2EXBA 4KQDA 2J80A 4B93A 4EQ1A 1OTAA 2W3EA 1YMSA 3KYZA 2XD1A 2W1RA 4CLCC 4LRYC 2G2UA 3CPTA 1BYWA 4GN2A 1PWCA 2GNXA 2V1ZA 3DW0A 4O0PA 5CHMA 3HLCA 2PD8A 3DWZA 3FKWA 2EFUA 2O0YA 4N9LA 2K31A 5LBRA 3LIAA 3HJIA 4PMAA 2HZ5A 2Q9NA 2M7UA 2K2NA 3PBTA 5HX9A 2C6WB 3HLDA 5IS1A 4IEDA 1ESIA 1ESUA 3CHWP 3P7NA 1LI9A 1K56D 1OPXA 3DWKA 4Z9QA 5HFOA 4YNRA 5DFXA 2IWBA 3CI6A 4NKPA 3PR6A 3LR4A 3VP3A 1T19A 5FATA 3LY4A 1CEGA 1ERQA 5BOHA 1N9OA 3RFBA 2WAFA 5FI7A 3LR0A 4I39A 4Y15A 2L4RA 1WYCA 3O5YA 3C7UA 1S1ZA 2PU4A 3U2AA 3IXHA 4HHDA 3E0YA 1YLWA 1MZUA 1PI4A 1XJ6A 3N6IA 3RTYA 3V39A 3MQ0A 3QHYA 4R38A 3JYIA 4BQMA 4RVAA 4BMWA 3C30A 5FI6A 4LPZA 3AGFA 4GZBA 2K7SA 5AJGA 5U47A 3HCYA 1K57A 5EOOA 4G3WA 5FAPA 1XJ2A 4E3KA 4K0XA 3GVBA 3IF6B 4ESPA 4N1HA 4Q0IA 2H10A 1KGGA 1PFLA 2P7JA 1RGYA 3BEBA 2A24B 5HL1A 2WGWA 5CGWA 3ITAA 2RL3A 2JC7A 1SZVA 4QY5A 5EECA 4E3OA 1BZAA 1FCNA 2A49A 1BT5A 1PWGA 1DRMA 1CJFA 5CHJA 2W27A 5F69A 5DTSA 3S22A 3MS6A 4GW9A 3PTEA 3BM6A 4XT2B 1YQSA 2PT7A 2ZL1B 3MXQA 5DTTA 2PHYA 2BASA 1K6RA 4QD4A 5CEDA 3UN7A 2JKGA 3IHAA 4GS9B 4R6LA 1I5QA 3BFEA 3H7WA 5DF8A 3T4LA 1YSPA 3WS4A 4JXSA 1GSWA 3F1PA 3G34A 4GB7A 4U3TA 4BL3A 2Y2PA 2VLGA 3D3OA 2DMWA 4JGQA 3A0SA 1KE0A 2HDQA 4KZ4A 4IBXA 2W1TA 4H8RA 2ZMAA 1FR6A 3EQUA 1HTZA 3IS2B 2EXAA 1TEMA 1BTLA 3N4IA 3GRJA 2P9VB 1P97A 1K6SA 1K55A 1PYYA 3P09A 3A3EA 2B18A 3GQZA 1L0EA 4PHTA 3CMZA 2J3TC 2ZQ9A 3UPPA 1IEMA 2JHEA 3VE4A 1LL8A 1ZC2A 2QJ5A 4MN6A 3O86A 2VX8A 5HAQA 1H3QA 1Y28A 1D7EA 5FDHA 3G2ZA 3VOYA 2Y2QA 3MSHA 1IOUA 4CJNA 2JKRI 4WZ5C 2BG1A 3IH8A 3H82A 5A91A 4RX3A 1W8QA 4KZ3A 3HL9A 3LFVA 3PAEA 3OZHA 5K5BA 4EEUA 4FCFA 3LIEA 1I2WA 5EPHA 1BLPA 1CI8A 3S1YA 3LICA 2CMNA 3T1SA 1V9YA 3GTCA 2ZC7A 1JVJA 1IYOA 2J9OA 5KZHA 3QP8A 3EOIA 3MBZA 1G5UA 4PM8A 3UPOA 1O07A 4B4XA 1BLCA 2KOIA 3OPHA 1DJCA 3BJNA 3Q1FA 3QP6A 4EQIA 3AGDA 3OBFA 4LV3A 1KVLA 1WYBA 2CC1A 2HF6A 4S2LA 1KVMA 3DTIA 3NIAA 2ZQ7A 3F1NB 4OOMA 4NXEA 2VA0A 4FSFA 5A90A 1XX2A 3IWIA 4CQHA 2DNSA 5FQ9A 3OCLA 1BSGA 3GV9A 1ZG6A 4IUHA 4P6ZS 3T1XA 5M18A 2E8IA 5GLBA 5E43A 4BD0A 3KSGA 4HJ4A 5HD3A 2IA2A 4LV1A 4QWOA 1LLBA 1D06A 3EGDC 1BUEA 2V8CA 5DKLA 1LT0A 1W7FA 1P9WA 3ZG7B 3A0RA 3PYPA 3RH8B 2XRNA 3BWLA 1W5DA 5DJTA 3ITBA 2OWHA 3T12B 4OQHA 2W3FA 1EROA 3RXXA 1VQQA 4OPYA 1KDWA 1ZG4A 2WUQA 1UGUA 5GHXA 4GD8A 2WGIA 4UA7A 2ZMVA 3BQAA 1TDLA 2ZM2A 3SH7A 3DAVA 4KZAA 2W0NA 4X53A 5HWTA 3BY9A 3W4OA 1AWIA 5HWVA 2PD7A 2BLSA 3NOTC 2WZXA 4JGRA 2VKSA 5A92A 4PM6A 5GLDA 1EWZA 5DVAA 4K91A 4PM9A 1A0KA 1XXMA 5CHUA 4PM5A 4ZRRA 4BENA 4X69A 3KX0X 4I3AA 2WGVA 5E2FA 3UB8A 4R23A 3VE3A 4ME4A 2Y2JA 3LGOA 4HBTA 3ZHHA 5HAIA 1ONHA 4EETB 3NC8A 3G4PA 1OTDA 2EX8A 4PKYG 1L0FA 3ICYA 1FSWA 1CK3A 1IELA 3ZVTA 4FUWA 2OWJA 5M19A 5GLCA 1PZOA 4DE1A 2OSUA 5EFWA 5A8BA 2XGNA 1E25A 5FQMA 3OPPA 5HARA 2XFTA 3T1QB 2JN7A 4K0WA 1F98A 4QU3A 5C5KA 2ZQDA 1GA9A 3IQAA 3E4OA 2P74A 3W4QA 5G4YA 2D02A 2Y55A 1RP5A 3FWLA 4HIAA 5F6AA 4LRZE 3PXPA 4OP8A 1PRQA 3KYQA 2DCFA 1E4DA 3LYXA 1GA0A 1HD8A 3LIBA 5A93A 3U4LP 3PHYA 3ZG5A 1S6RA 2QYBA 1DP6A 5F83A 2FH5A 1Y4OA 3NULA 1TDGA 2ZQ8A 1T1AA 1GSXA 2ZQAA 3UO9A 1K4FA 3G35A 5FQIA 3E2LA 1NYYA 3KSHA 5KIZA 4OQIA 1XGIA 1YT4A 1OT6A 4FH2A 3DTKA 4NXBA 3IF6A 4X25A 4EERA 5HDDA 1ODVA 1SHVA 2A24A 3PAGA 3ZQ5A 4QHCA 4ZBEA 3WS5A 1F2KA 1F9IA 5EUAA 5CGXA 4RQ9A 3C4PA 1T1BA 3UDIA 1V9ZA 5L2FA 1ACFA 3T50A 2XDMA 4L0LA 5J7EA 4XT2A 5G4ZA 4EU0A 5CRFA 5EVID 3HLBA 4BBTA 1K38A 4IVIA 1YLPA 4OOYA 1IYSA 1ES2A 2KX6A 3D4FA 3JVUA 4H6JB 5F1FA 1MXOA 4CLCA 4DMZA 2ZM8A 1XJ3A 3OOVA 4C6YA 1XJ4A 4UHUA 2V2FF 3HUNA 2PU2A 5EVLA 4R1GA 3IS2A 4NG2A 1MC0A 1S4SA 2NUTC 4EESA 4HH3A 4EW7A 4S2PA 2ZLYA 4QB8A 2JKTM 1E3UD 4MBHA 1MKMA 4GOGA 4S2NC 3T4KA 3CUEC 4XUZA 1IYPA 2R78A 5I94A 1FCMA 2HJEA 2Y2IA 4YFMA 4X56A 5DKKA 2VZWA 2XH9A 4KZ6A 2QHKA 1RCJA 5TBMB 3P98A 3AGEA 1S4RA 3K3DA 3D9YA 2LB9A 2KLIA 4WN5A 4MMNA 1HVBA 3E2KA 4DXCA 1H8MA 2Y2GA 4DKIA 2Y2NA 5DF9A 4GHIA 3ISGA 3SOIA 4JGOA 3FYZA 5FA7A 4ARZB 4MN5A 3R7WA 3CZDA 1IKIA 1K54C 4P6ZM 3TG9A 4Y0OA 4YWZA 4R4SA 5HD5A 1SCWA 3MFDA 1N9NA 4MNRA 1S66L 3KO6A 2VGKA 3IWOA 5HDSA 3T4JA 4KUOA 3S7PA 4U0XA 3RJUA 2Y79A 2Y2OA 2J9PA 4M3KA 3VP0A 4GDNA 2ZC3B 2Z6CA 3LIDA 4Y0TA 3VMAA 4HP4A 1BULA 2HPBA 3KSIA 3IX8A 3M6BA 2B95A 1Y54A 4FTXA 3T4TA 4HH2A 5HWWA 2VJWA 3CLOA 5CECA 4ID4A 3ZG8B 2WADA 3WS0A 3L7HA 1TS0A 5FAOA 1YLJA 1UWNX 1MY8A 4HESA 1BLSA 4DN0A 4KZ8A 1NLYA 1EW0A 1IKGA 3O3VA 4OKPA 3CPTB 3S7NA 3IX4A 2OOLA 4Q0HA 2QJ7A 4EEPA 2PDRA 4HQAA 4BJPA 1P0ZA 1FQGA 4EBLA 4LENA 3UY6A 2ZC5B 4N9KA 5FQKA 4G3KA 3IT9A 3O87A 1X0OA 4RA7A 3FPVA 2XA7S 1YMXA 3NBLA 1DJBA 3SZTA 4L9GA 1YSQA 4NK3A 5F68A 2VK3A 3IWQA 4HP9A 3M6HA 1H0MA 3IXDA 2XD5A 1JTGA 2EX6A 4Y7PA 3ULFA 2ZJ9A 5AQ9A 4MBFA 2WKQA 4R70A 4EV4A 1NRJA 1K25A 3ZGAB 2Y4AA 5HAPA 1SKOA 2J7VA 1S0WA 4M4XA 4OP5A 2GDNA 3ZFZA 1YM1A 3VOZA 1VEUA 1NZOA 3WS2A 4K08A 3IXBA 2HDRA 3PBOA 4ZAMA 2ZMFA 2G7UA 2HP9A 5EVIC 3HLWA 3OC2A 3JPUA 1LSWA 5FEFA 2QKPA 3UE0A 3S4XA 3BFDA 4AFIA 3LY3A 4NXGA 4BBVA 4EBNA 3UMDA 3M2KA 4KZ5A 3HLGA 3FKVA 4WBGA 4WMCD 4ETZA 3T1RA 5IU1A 5HZHA 4HJ3A 3G31A 4QJGA 1ZKJA 4WZ5A 3LO7A 4UQIS 2EWVA 4ZDXA 1GSVA 1LSXA 5AVFA 2Q0OA 4F3LB 3UMEA 4E3NA 5TR7A 2KDKA 2WGWB 1OT9A 3OCNA 4BBUA 3C38A 5TFQA 1N9BA 5F1GA 4C75A 2XF3A 5DFYA 5F82A 4MLLA 3GDIA 4P6BA 1YAXA 3ZCZA 2X01A 3A3JA 2YKHA 4WL9A 1K56A 1J3WA 2L0WA 4Y2FA 2EA9A 5L09A 3HLFA 4JXGA 2C5WB 2JKRM 5E2EA 3G2YA 1W8YA 1CEFA 3A3DA 3F1OA 3IBRA 1NWZA 1LSVA 2H5SA 5EM1A 1Q2PA 1HZOA 4OLGA 3QP2A 3HUOA 1IFQA 3NI9A 4KQRA 5FQJA 2HJ9C 3UE1A 4WYYA 1ES5A 5CTMA 5AQAA 4D2OA 4I3IA 1PIOA 2W3HA 3GSGA 1L0DA 4N92A 4ZJ2A 3ZDJA 4A5RA 4JBFA 1GHPA 3LUQA 1FOFA 5AQ7A 2W1TB 4JLFA 1FCOA 1GHMA 2QZ6A 3HLEA 3UDXA 5GLAA 1IYQA 1UWPX 1NRFA 1TVFA 3UE3A 4MCWA 2UV0E 3QP5A 3Q7VB 5IT5A 4G3VA 1VETB 3CAXA 1XFNA 1H8YA 4MEZA 3B3XA 3MKFA 2OAP1 3TOIA 4WEKA 5E2GA 2JKFA 4E6WA 1KGFA 2XSSA 4DDSA 3LI9A 1NXYA 4II7A 3VSLA 2Z2LB 2PYRA 3CJMA 5HL6A 3C2WA 3CWFA 3H82B 2WK0A 1XPBA 4R3JA 5DTKA 5GHYA 1H8ZA 4GLQA 3EEHA 4E3JA 1I2SA 4MBKA 3NOUC 3SS4A 4E6XA 3Q82A 1YLYA 2Y2MA 1NLZA 2P04A 5HW3A 4JGPA 3PBSA 1LI0A 5EVIB 3BRMA 2WYXA 1YLTA 1ZHHB 1QMFA 3BYDA 5CXWA 5EE8A 3HJKA 4H6JA 3BLMA 4R4RA 3UNWA 3UB6A 3VFHA 2ZC4B 4OH0A 5J8XA 4LV2A 3A3FA 4HJ6A 3VP1A 4U0TA 4X68A 3N8RA 3N8SA 3V67A 3WWXA 4R3BA 1OTEA 1KGEA 1MWRA 2HP6A 3R4KA 3IXGA 2JCHA 4ZJ1A 5EM0A 2O99A 3N8LA 3UPNA 3GECA 1SDNA 2EWWA 3A3IA 4DRTA 4E3MA 1STZA 1K4EA 1JNUA 4ETXA 2OLUA 1ES3A 4P87A 3EWKA 2XFSA 1FIKA 3BFCA 4YINA 1WE4A 3T4QA 2G2WA 4WUJA 4ARZA 1FR1A 3EQVA 3BQ8A 2YKFA 3NJAA 1Q2QA 3PBNA 3MZFA 4EUVA 1L2SA 5L07A 4YOFA 1GCEA 2R9WA 2A2LA 3MZDA 1XGJA 3DTEA 3W4PA 5G18A 4OQ0A 3BFGA 5M1AA 2WAEA 4MN7A 4LRXC 4UAAA 3E98A 3VP4A 1JWPA 2Y91A 3K3CA 1MKIA 2I72A 2XA7M 4I5SA 3SH8A 3C5AA 1MPLA 2D01A 5I5LA 4FOFA 3LR3A 4Y17A 3TSGA 1CI9A 2GZAA 4LV0A 1JWZA 5EVEA 1LL5A 4X55A 4JXWA 4KZBA 1MWUA 4EXOA 2UWXA 2ZL1A 3LEZA 3IBJA 2A3UA 3LR5A 2O9CA 3DTMA 2PAVP 5KSHA 4GKUA 4GS9A 4JXVA 4S2JA 3L9KA 3MMHA 4UEYA 4JKTA 1P9RA 2WKEA 2Z2MB 3BFFA 2M1CA 2W3DA 1CQAA 3V50A 3VSKA 4LCLA 4OPQA 2PBYA 2XQZA 4Q0JA 3ZG9B 3M2JA 4PM7A 5CGSA 1PW1A 3W2ZA 4IVKA 4LLOB 4X1MA 1EI5A 1TF1A
chains in the Genus database with same CATH topology
3NDEA 1ZG6A 4GD6A 3UY6A 2ZC5B 4N9KA 5M18A 2P9VA 5FQKA 4OQGA 4O7DA 2RCXA 2E8IA 1KDSA 3IT9A 3O87A 4RX2A 5GLBA 1SKFA 3IH9A 4RA7A 4EWFA 4BD1A 4XUXA 5E43A 1YMXA 4KQOA 4BD0A 3NBLA 1DJBA 2EX2A 3WS1A 4NK3A 4OOLA 1ONGA 2R9XA 4LV1A 1L0GA 3Q7ZA 3IWQA 3ZNTA 1LLBA 1JTDA 5FASA 3IF5A 4S2KA 3PBQA 3M6HA 1BUEA 3IXDA 2XD5A 1JTGA 2EX6A 4Y7PA 1W7FA 4GNUA 3ZG7B 1PWDA 4P0MA 3IF6C 2IWDA 4E3LA 2HDSA 1FSYA 2ZJ9A 5AQ9A 4MBFA 4Q8IA 4GDBA 4EV4A 2ZQCA 3ZVWA 3MXRA 1K25A 2Y2HA 5KMWA 1K57C 3ZGAB 2Y4AA 5HAPA 1W5DA 3ITBA 2H0YA 1XKZA 2J7VA 1S0WA 4OP5A 4OQHA 2GDNA 3ZFZA 1C3BA 1NJ4A 1EROA 2FFFB 4OPRA 1LHYA 3RXXA 3QNCA 1KE3A 1VQQA 4E3IA 4OPYA 1YM1A 2XK1A 4S2NA 3VOZA 2OLVA 1KDWA 1ZG4A 2WUQA 5GHXA 1NZOA 4UA9A 3WS2A 4DE2A 4GD8A 4KENB 2Y59A 4DF6A 2WZZA 1XA7A 2WGIA 3IXBA 4UA7A 2HDRA 3PBOA 3N7WA 4PPRA 1M6KA 4ZAMA 3NDGA 1TDLA 2HP9A 4WMCA 4FH4A 5EVIC 2ZM2A 5FI2A 4HBUA 4KZAA 3HLWA 3SH7A 4X53A 3OC2A 2B5RA 3W4OA 1GHIA 3GMWA 3UE0A 3S4XA 3BFDA 3HREA 4OONA 3LY3A 2BLSA 4EBNA 2WZXA 5A92A 3M2KA 4PM6A 4KZ5A 5GLDA 4UA6A 3HLGA 2QMIA 4FD8A 5KSCA 1EWZA 3C4OA 3FKVA 4WBGA 1AXBA 1DY6A 1XP4A 3MZEA 4WMCD 5DVAA 3G32A 4K91A 4PM9A 1XXMA 5CHUA 3G31A 4QJGA 4JF4A 4PM5A 1ZKJA 4KQQA 3BLSA 2EXBA 4WZ5A 4BENA 4X69A 3LO7A 4KG6A 4RYEA 1K54A 2WGVA 4XXRA 1YMSA 5E2FA 4ZDXA 4R23A 2XD1A 2Y2JA 4DDYA 4HBTA 3ZHHA 5HAIA 2WKIA 4E3NA 1ONHA 5TR7A 2G2UA 3G4PA 3NC8A 5AQBA 4OPZA 2EX8A 3I7JA 4WZ4A 2WGWB 4GN2A 1L0FA 2WKHA 1PWCA 2Y2LA 3OCNA 1FSWA 5JYPA 5TFQA 1CK3A 3SS5A 1N9BA 5F1GA 1IELA 3ZVTA 1SDEA 2XF3A 2XR0A 4C75A 2V1ZA 4BLMA 2QPNA 5F82A 3SS3A 3DW0A 5M19A 2HP5A 4MLLA 5CHMA 3HLCA 3DWZA 3FKWA 5GLCA 1PZOA 2EFUA 4X6TA 4B4ZA 4DE1A 2OSUA 4N9LA 3WRZA 4HEFA 2XGNA 4P6BA 3ZCZA 1E25A 2X01A 5FQMA 3OPPA 4PMAA 5HARA 3A3JA 2XFTA 3HVFA 1K56A 4DE3A 2Q9NA 4K0WA 3TG9A 3PBTA 3HLFA 5HX9A 4JXGA 2C5WB 5E2EA 2C6WB 3G2YA 1W8YA 3ZNYA 1K55C 4QU3A 3HLDA 1CEFA 2ZQDA 1GA9A 4IEDA 3IQAA 1ESIA 1ESUA 3GR2A 2P74A 3A3DA 1LI9A 3BECA 3W4QA 1K56D 2Y55A 1RP5A 3FWLA 2XLNA 2H5SA 1Q2PA 4DE0A 3DWKA 1HZOA 4OLGA 1NY0A 1PI5A 2JE5A 4Z9QA 5HFOA 4OP8A 4IBRA 2DCFA 3HUOA 3NI9A 2IWBA 1E4DA 4KQRA 5FQJA 1GA0A 3NY4A 3UE1A 4WYYA 3MXSA 1ES5A 5CTMA 5AQAA 3VP3A 4D2OA 1HD8A 2OV5A 5FSRA 5FATA 4S2IA 3LY4A 5A93A 1PIOA 1CEGA 1ERQA 5BOHA 3GSGA 3ZG5A 1L0DA 5GL9A 1S6RA 4N92A 2WAFA 5FI7A 4ZJ2A 3ZDJA 4A5RA 5F83A 4JBFA 1GHPA 1WYCA 1FOFA 5AQ7A 3C7UA 1TDGA 2PU4A 2ZQ8A 4JLFA 1FCOA 1J9MA 5CTNA 1GHMA 2QZ6A 3IXHA 4S2OA 4EBPA 5GHZA 1YLWA 1YLZA 2ZQAA 3UO9A 1PI4A 1K4FA 3G35A 3HLEA 5FQIA 3UDXA 3E2LA 1NYYA 3N6IA 1IYQA 5GLAA 3V39A 3Q7VA 3UDFA 3QHYA 2JBFA 1NRFA 3JYIA 4OLDA 4BQMA 4OQIA 4RVAA 1XGIA 1YT4A 1TVFA 3UE3A 4FH2A 5FI6A 3W4PA 2EX9A 3OPLA 1MWSA 3Q7VB 3IF6A 1KE4A 3AGFA 4GZBA 1H8YA 4MEZA 5U47A 3B3XA 3MKFA 1K57A 5EOOA 5FAPA 3TOIA 4WEKA 5E2GA 1SHVA 1LL9A 4E6WA 3PAGA 2ZD8A 1KGFA 3NCKA 4E3KA 4K0XA 3GVBA 4DDSA 3IF6B 1NYMA 1ERMA 4QHCA 1NXYA 4ZBEA 3WS5A 4N1HA 2H10A 1KGGA 5EUAA 3VSLA 1MBLA 5CGXA 2Z2LB 1RGYA 3CJMA 3C4PA 1QMEA 3BEBA 5HL1A 2WGWA 2EFXA 5CGWA 4Y0UA 2WK0A 1XPBA 3ITAA 4R3JA 5DTKA 5GHYA 3UDIA 3RXWA 1H8ZA 4E3JA 5L2FA 2RL3A 2JC7A 5E2HA 1I2SA 4MBKA 4QY5A 5EVIA 2XDMA 4L0LA 5EECA 3SS4A 4E3OA 1BZAA 1FCNA 2A49A 4E6XA 1BT5A 3Q82A 1PWGA 1YLYA 1M40A 5DF7A 1Z6FA 2Y2MA 5CRFA 5CHJA 1H5XA 5HW3A 5DTSA 3QNBA 3S22A 4ZTKA 3PBSA 1W79A 1LI0A 5EVIB 3BRMA 2WYXA 1YLTA 3PTEA 5EVID 3BM6A 3HLBA 1K38A 1QMFA 1YQSA 3BYDA 4LCMA 5CXWA 5EE8A 4IVIA 1YLPA 4OOYA 1IYSA 5DTTA 3BLMA 1ES2A 4R4RA 3UNWA 2J8YA 1K6RA 2IWCA 3VFHA 2ZC4B 4QD4A 4OH0A 3VFFA 5CEDA 2X02A 3FV7A 3D4FA 5FQQA 5J8XA 1G6AA 3UN7A 1XA1A 4LV2A 3A3FA 3IHAA 3MKEA 3VP1A 3VP2A 3ZG0A 5CEBA 5F1FA 1MXOA 1I5QA 3BFEA 4U0TA 5DF8A 4WEJA 2ZM8A 4X68A 4F94A 3LCEA 1NZUA 4C6YA 3N8RA 3N8SA 3V3RA 3WS4A 4B88A 3WWXA 2H0TA 4JXSA 4UHUA 2V2FF 4R3BA 1BLHA 2X71A 1KGEA 3G34A 3HUNA 2PU2A 1MWRA 1E3UA 4GB7A 4U3TA 5EVLA 4BL3A 4R1GA 4BL2A 2Y2PA 2HP6A 3W8KA 1KE0A 2DRWA 3IXGA 2JCHA 2HDQA 4ZJ1A 1PW8A 2ZLYA 4KZ4A 2XEPA 4QB8A 4S2PA 1OMEA 4IBXA 4H8RA 1E3UD 1FR6A 2ZMAA 3C7VA 3EQUA 4MBHA 1HTZA 4N1XA 2EXAA 3N8LA 4GOGA 2VGJA 4S2NC 1TEMA 1BTLA 3N4IA 4XUZA 1IYPA 4KG5A 3UPNA 1SDNA 3GRJA 5I94A 1FCMA 1G68A 1ALQA 2P9VB 3IHBA 1K6SA 1K55A 2Y2IA 3A3IA 4YFMA 4DRTA 4X56A 1PYYA 3P09A 4E3MA 3A3EA 1K4EA 4R0QA 2OLUA 3GQZA 1L0EA 2XH9A 4KZ6A 3CMZA 1ES3A 4P87A 1RCJA 2ZQ9A 4OVDA 4CPKA 3UPPA 1IEMA 1VM1A 2XFSA 3AGEA 3P98A 2HDUA 1ZC2A 3BFCA 4YINA 1WE4A 4JF5A 3O86A 2G2WA 5HAQA 4EUZA 1HVBA 1FR1A 3EQVA 3E2KA 4DXCA 4S2MA 3FZCA 2Y2GA 1Q2QA 4DKIA 3PBNA 3MZFA 5FDHA 2Y2NA 3G2ZA 5DF9A 1L2SA 3ISGA 3VOYA 3O88A 4JPMA 3SOIA 2Y2QA 1GCEA 2R9WA 4CJNA 3FYZA 5FA7A 4WZ5C 2BG1A 3MZDA 1PZPA 4WM9A 1XGJA 3CZDA 3IH8A 1IKIA 1K54C 2ZM0A 3HBRA 5G18A 5A91A 4OQ0A 3G30A 3BFGA 4RX3A 4Y0OA 5M1AA 1W8QA 4KG2A 4R4SA 2WAEA 4KZ3A 3HL9A 5FAQA 3WRTA 5EOEA 4UAAA 1SCWA 3PAEA 3MFDA 3VP4A 3OZHA 1JWPA 2Y2KA 2Y91A 3CG5A 1MKIA 2I72A 4MNRA 4FCFA 2V20A 2VGKA 3SH8A 3C5AA 1MPLA 1I2WA 3IWOA 4NETA 5EPHA 1BLPA 3V3SA 1CI8A 3S1YA 3TSGA 1CI9A 4LV0A 4U0XA 2FFYA 1JWZA 3RJUA 1U60A 1LL5A 4X55A 4JXWA 3GTCA 1JWVA 2Y2OA 2J9PA 2ZC7A 4M3KA 5IHVA 4KZBA 1JVJA 4GDNA 3VP0A 3HUMA 2ZC3B 1MWTA 1IYOA 5CERA 1MWUA 2J9OA 5TGFA 4Y0TA 5KZHA 3VMAA 4WELA 3SH9A 1BULA 2HPBA 2UWXA 3LEZA 2A3UA 3OPRA 4ZJ3A 3M6BA 3DTMA 1RGZA 1O7EA 3MBZA 1Y54A 4PM8A 1O07A 2Q9MA 5D3OA 4B4XA 3UPOA 3Q81A 1BLCA 3OPHA 4KZ9A 5KSHA 4GKUA 1DJCA 5CECA 4ID4A 4JXVA 3ZG8B 2WADA 4S2JA 3Q1FA 3WS0A 3PBRA 4JKTA 2WKEA 1YLJA 4JF6A 4P85A 5FAOA 5JYOA 1MY8A 4EQIA 3AGDA 2Z2MB 3BFFA 4HESA 1BLSA 1ES4A 4KZ8A 4LV3A 1KVLA 1WYBA 1IKGA 4DXBA 2CC1A 3V50A 3VSKA 4LCLA 4OPQA 4S2LA 2PBYA 1KVMA 3O3VA 4OKPA 3Q07A 2XQZA 4QY6A 3NIAA 1DJAA 2ZQ7A 4OOMA 3ZG9B 3M2JA 1N4OA 4FSFA 3V5MA 5A90A 1XX2A 3IWIA 4KZ7A 4PM7A 5CGSA 4BJPA 2DNSA 1PW1A 5FQ9A 3OCLA 2ZC6B 1FQGA 4IVKA 4EBLA 4C3QA 1EI5A 1BSGA 4LENA 3GV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDE A;  1ZG6 A;  4GD6 A;  3UY6 A;  2ZC5 B;  4N9K A;  5M18 A;  2P9V A;  5FQK A;  4OQG A;  4O7D A;  2RCX A;  2E8I A;  1KDS A;  3IT9 A;  3O87 A;  4RX2 A;  5GLB A;  1SKF A;  3IH9 A;  4RA7 A;  4EWF A;  4BD1 A;  4XUX A;  5E43 A;  1YMX A;  4KQO A;  4BD0 A;  3NBL A;  1DJB A;  2EX2 A;  3WS1 A;  4NK3 A;  4OOL A;  1ONG A;  2R9X A;  4LV1 A;  1L0G A;  3Q7Z A;  3IWQ A;  3ZNT A;  1LLB A;  1JTD A;  5FAS A;  3IF5 A;  4S2K A;  3PBQ A;  3M6H A;  1BUE A;  3IXD A;  2XD5 A;  1JTG A;  2EX6 A;  4Y7P A;  1W7F A;  4GNU A;  3ZG7 B;  1PWD A;  4P0M A;  3IF6 C;  2IWD A;  4E3L A;  2HDS A;  1FSY A;  2ZJ9 A;  5AQ9 A;  4MBF A;  4Q8I A;  4GDB A;  4EV4 A;  2ZQC A;  3ZVW A;  3MXR A;  1K25 A;  2Y2H A;  5KMW A;  1K57 C;  3ZGA B;  2Y4A A;  5HAP A;  1W5D A;  3ITB A;  2H0Y A;  1XKZ A;  2J7V A;  1S0W A;  4OP5 A;  4OQH A;  2GDN A;  3ZFZ A;  1C3B A;  1NJ4 A;  1ERO A;  2FFF B;  4OPR A;  1LHY A;  3RXX A;  3QNC A;  1KE3 A;  1VQQ A;  4E3I A;  4OPY A;  1YM1 A;  2XK1 A;  4S2N A;  3VOZ A;  2OLV A;  1KDW A;  1ZG4 A;  2WUQ A;  5GHX A;  1NZO A;  4UA9 A;  3WS2 A;  4DE2 A;  4GD8 A;  4KEN B;  2Y59 A;  4DF6 A;  2WZZ A;  1XA7 A;  2WGI A;  3IXB A;  4UA7 A;  2HDR A;  3PBO A;  3N7W A;  4PPR A;  1M6K A;  4ZAM A;  3NDG A;  1TDL A;  2HP9 A;  4WMC A;  4FH4 A;  5EVI C;  2ZM2 A;  5FI2 A;  4HBU A;  4KZA A;  3HLW A;  3SH7 A;  4X53 A;  3OC2 A;  2B5R A;  3W4O A;  1GHI A;  3GMW A;  3UE0 A;  3S4X A;  3BFD A;  3HRE A;  4OON A;  3LY3 A;  2BLS A;  4EBN A;  2WZX A;  5A92 A;  3M2K A;  4PM6 A;  4KZ5 A;  5GLD A;  4UA6 A;  3HLG A;  2QMI A;  4FD8 A;  5KSC A;  1EWZ A;  3C4O A;  3FKV A;  4WBG A;  1AXB A;  1DY6 A;  1XP4 A;  3MZE A;  4WMC D;  5DVA A;  3G32 A;  4K91 A;  4PM9 A;  1XXM A;  5CHU A;  3G31 A;  4QJG A;  4JF4 A;  4PM5 A;  1ZKJ A;  4KQQ A;  3BLS A;  2EXB A;  4WZ5 A;  4BEN A;  4X69 A;  3LO7 A;  4KG6 A;  4RYE A;  1K54 A;  2WGV A;  4XXR A;  1YMS A;  5E2F A;  4ZDX A;  4R23 A;  2XD1 A;  2Y2J A;  4DDY A;  4HBT A;  3ZHH A;  5HAI A;  2WKI A;  4E3N A;  1ONH A;  5TR7 A;  2G2U A;  3G4P A;  3NC8 A;  5AQB A;  4OPZ A;  2EX8 A;  3I7J A;  4WZ4 A;  2WGW B;  4GN2 A;  1L0F A;  2WKH A;  1PWC A;  2Y2L A;  3OCN A;  1FSW A;  5JYP A;  5TFQ A;  1CK3 A;  3SS5 A;  1N9B A;  5F1G A;  1IEL A;  3ZVT A;  1SDE A;  2XF3 A;  2XR0 A;  4C75 A;  2V1Z A;  4BLM A;  2QPN A;  5F82 A;  3SS3 A;  3DW0 A;  5M19 A;  2HP5 A;  4MLL A;  5CHM A;  3HLC A;  3DWZ A;  3FKW A;  5GLC A;  1PZO A;  2EFU A;  4X6T A;  4B4Z A;  4DE1 A;  2OSU A;  4N9L A;  3WRZ A;  4HEF A;  2XGN A;  4P6B A;  3ZCZ A;  1E25 A;  2X01 A;  5FQM A;  3OPP A;  4PMA A;  5HAR A;  3A3J A;  2XFT A;  3HVF A;  1K56 A;  4DE3 A;  2Q9N A;  4K0W A;  3TG9 A;  3PBT A;  3HLF A;  5HX9 A;  4JXG A;  2C5W B;  5E2E A;  2C6W B;  3G2Y A;  1W8Y A;  3ZNY A;  1K55 C;  4QU3 A;  3HLD A;  1CEF A;  2ZQD A;  1GA9 A;  4IED A;  3IQA A;  1ESI A;  1ESU A;  3GR2 A;  2P74 A;  3A3D A;  1LI9 A;  3BEC A;  3W4Q A;  1K56 D;  2Y55 A;  1RP5 A;  3FWL A;  2XLN A;  2H5S A;  1Q2P A;  4DE0 A;  3DWK A;  1HZO A;  4OLG A;  1NY0 A;  1PI5 A;  2JE5 A;  4Z9Q A;  5HFO A;  4OP8 A;  4IBR A;  2DCF A;  3HUO A;  3NI9 A;  2IWB A;  1E4D A;  4KQR A;  5FQJ A;  1GA0 A;  3NY4 A;  3UE1 A;  4WYY A;  3MXS A;  1ES5 A;  5CTM A;  5AQA A;  3VP3 A;  4D2O A;  1HD8 A;  2OV5 A;  5FSR A;  5FAT A;  4S2I A;  3LY4 A;  5A93 A;  1PIO A;  1CEG A;  1ERQ A;  5BOH A;  3GSG A;  3ZG5 A;  1L0D A;  5GL9 A;  1S6R A;  4N92 A;  2WAF A;  5FI7 A;  4ZJ2 A;  3ZDJ A;  4A5R A;  5F83 A;  4JBF A;  1GHP A;  1WYC A;  1FOF A;  5AQ7 A;  3C7U A;  1TDG A;  2PU4 A;  2ZQ8 A;  4JLF A;  1FCO A;  1J9M A;  5CTN A;  1GHM A;  2QZ6 A;  3IXH A;  4S2O A;  4EBP A;  5GHZ A;  1YLW A;  1YLZ A;  2ZQA A;  3UO9 A;  1PI4 A;  1K4F A;  3G35 A;  3HLE A;  5FQI A;  3UDX A;  3E2L A;  1NYY A;  3N6I A;  1IYQ A;  5GLA A;  3V39 A;  3Q7V A;  3UDF A;  3QHY A;  2JBF A;  1NRF A;  3JYI A;  4OLD A;  4BQM A;  4OQI A;  4RVA A;  1XGI A;  1YT4 A;  1TVF A;  3UE3 A;  4FH2 A;  5FI6 A;  3W4P A;  2EX9 A;  3OPL A;  1MWS A;  3Q7V B;  3IF6 A;  1KE4 A;  3AGF A;  4GZB A;  1H8Y A;  4MEZ A;  5U47 A;  3B3X A;  3MKF A;  1K57 A;  5EOO A;  5FAP A;  3TOI A;  4WEK A;  5E2G A;  1SHV A;  1LL9 A;  4E6W A;  3PAG A;  2ZD8 A;  1KGF A;  3NCK A;  4E3K A;  4K0X A;  3GVB A;  4DDS A;  3IF6 B;  1NYM A;  1ERM A;  4QHC A;  1NXY A;  4ZBE A;  3WS5 A;  4N1H A;  2H10 A;  1KGG A;  5EUA A;  3VSL A;  1MBL A;  5CGX A;  2Z2L B;  1RGY A;  3CJM A;  3C4P A;  1QME A;  3BEB A;  5HL1 A;  2WGW A;  2EFX A;  5CGW A;  4Y0U A;  2WK0 A;  1XPB A;  3ITA A;  4R3J A;  5DTK A;  5GHY A;  3UDI A;  3RXW A;  1H8Z A;  4E3J A;  5L2F A;  2RL3 A;  2JC7 A;  5E2H A;  1I2S A;  4MBK A;  4QY5 A;  5EVI A;  2XDM A;  4L0L A;  5EEC A;  3SS4 A;  4E3O A;  1BZA A;  1FCN A;  2A49 A;  4E6X A;  1BT5 A;  3Q82 A;  1PWG A;  1YLY A;  1M40 A;  5DF7 A;  1Z6F A;  2Y2M A;  5CRF A;  5CHJ A;  1H5X A;  5HW3 A;  5DTS A;  3QNB A;  3S22 A;  4ZTK A;  3PBS A;  1W79 A;  1LI0 A;  5EVI B;  3BRM A;  2WYX A;  1YLT A;  3PTE A;  5EVI D;  3BM6 A;  3HLB A;  1K38 A;  1QMF A;  1YQS A;  3BYD A;  4LCM A;  5CXW A;  5EE8 A;  4IVI A;  1YLP A;  4OOY A;  1IYS A;  5DTT A;  3BLM A;  1ES2 A;  4R4R A;  3UNW A;  2J8Y A;  1K6R A;  2IWC A;  3VFH A;  2ZC4 B;  4QD4 A;  4OH0 A;  3VFF A;  5CED A;  2X02 A;  3FV7 A;  3D4F A;  5FQQ A;  5J8X A;  1G6A A;  3UN7 A;  1XA1 A;  4LV2 A;  3A3F A;  3IHA A;  3MKE A;  3VP1 A;  3VP2 A;  3ZG0 A;  5CEB A;  5F1F A;  1MXO A;  1I5Q A;  3BFE A;  4U0T A;  5DF8 A;  4WEJ A;  2ZM8 A;  4X68 A;  4F94 A;  3LCE A;  1NZU A;  4C6Y A;  3N8R A;  3N8S A;  3V3R A;  3WS4 A;  4B88 A;  3WWX A;  2H0T A;  4JXS A;  4UHU A;  2V2F F;  4R3B A;  1BLH A;  2X71 A;  1KGE A;  3G34 A;  3HUN A;  2PU2 A;  1MWR A;  1E3U A;  4GB7 A;  4U3T A;  5EVL A;  4BL3 A;  4R1G A;  4BL2 A;  2Y2P A;  2HP6 A;  3W8K A;  1KE0 A;  2DRW A;  3IXG A;  2JCH A;  2HDQ A;  4ZJ1 A;  1PW8 A;  2ZLY A;  4KZ4 A;  2XEP A;  4QB8 A;  4S2P A;  1OME A;  4IBX A;  4H8R A;  1E3U D;  1FR6 A;  2ZMA A;  3C7V A;  3EQU A;  4MBH A;  1HTZ A;  4N1X A;  2EXA A;  3N8L A;  4GOG A;  2VGJ A;  4S2N C;  1TEM A;  1BTL A;  3N4I A;  4XUZ A;  1IYP A;  4KG5 A;  3UPN A;  1SDN A;  3GRJ A;  5I94 A;  1FCM A;  1G68 A;  1ALQ A;  2P9V B;  3IHB A;  1K6S A;  1K55 A;  2Y2I A;  3A3I A;  4YFM A;  4DRT A;  4X56 A;  1PYY A;  3P09 A;  4E3M A;  3A3E A;  1K4E A;  4R0Q A;  2OLU A;  3GQZ A;  1L0E A;  2XH9 A;  4KZ6 A;  3CMZ A;  1ES3 A;  4P87 A;  1RCJ A;  2ZQ9 A;  4OVD A;  4CPK A;  3UPP A;  1IEM A;  1VM1 A;  2XFS A;  3AGE A;  3P98 A;  2HDU A;  1ZC2 A;  3BFC A;  4YIN A;  1WE4 A;  4JF5 A;  3O86 A;  2G2W A;  5HAQ A;  4EUZ A;  1HVB A;  1FR1 A;  3EQV A;  3E2K A;  4DXC A;  4S2M A;  3FZC A;  2Y2G A;  1Q2Q A;  4DKI A;  3PBN A;  3MZF A;  5FDH A;  2Y2N A;  3G2Z A;  5DF9 A;  1L2S A;  3ISG A;  3VOY A;  3O88 A;  4JPM A;  3SOI A;  2Y2Q A;  1GCE A;  2R9W A;  4CJN A;  3FYZ A;  5FA7 A;  4WZ5 C;  2BG1 A;  3MZD A;  1PZP A;  4WM9 A;  1XGJ A;  3CZD A;  3IH8 A;  1IKI A;  1K54 C;  2ZM0 A;  3HBR A;  5G18 A;  5A91 A;  4OQ0 A;  3G30 A;  3BFG A;  4RX3 A;  4Y0O A;  5M1A A;  1W8Q A;  4KG2 A;  4R4S A;  2WAE A;  4KZ3 A;  3HL9 A;  5FAQ A;  3WRT A;  5EOE A;  4UAA A;  1SCW A;  3PAE A;  3MFD A;  3VP4 A;  3OZH A;  1JWP A;  2Y2K A;  2Y91 A;  3CG5 A;  1MKI A;  2I72 A;  4MNR A;  4FCF A;  2V20 A;  2VGK A;  3SH8 A;  3C5A A;  1MPL A;  1I2W A;  3IWO A;  4NET A;  5EPH A;  1BLP A;  3V3S A;  1CI8 A;  3S1Y A;  3TSG A;  1CI9 A;  4LV0 A;  4U0X A;  2FFY A;  1JWZ A;  3RJU A;  1U60 A;  1LL5 A;  4X55 A;  4JXW A;  3GTC A;  1JWV A;  2Y2O A;  2J9P A;  2ZC7 A;  4M3K A;  5IHV A;  4KZB A;  1JVJ A;  4GDN A;  3VP0 A;  3HUM A;  2ZC3 B;  1MWT A;  1IYO A;  5CER A;  1MWU A;  2J9O A;  5TGF A;  4Y0T A;  5KZH A;  3VMA A;  4WEL A;  3SH9 A;  1BUL A;  2HPB A;  2UWX A;  3LEZ A;  2A3U A;  3OPR A;  4ZJ3 A;  3M6B A;  3DTM A;  1RGZ A;  1O7E A;  3MBZ A;  1Y54 A;  4PM8 A;  1O07 A;  2Q9M A;  5D3O A;  4B4X A;  3UPO A;  3Q81 A;  1BLC A;  3OPH A;  4KZ9 A;  5KSH A;  4GKU A;  1DJC A;  5CEC A;  4ID4 A;  4JXV A;  3ZG8 B;  2WAD A;  4S2J A;  3Q1F A;  3WS0 A;  3PBR A;  4JKT A;  2WKE A;  1YLJ A;  4JF6 A;  4P85 A;  5FAO A;  5JYO A;  1MY8 A;  4EQI A;  3AGD A;  2Z2M B;  3BFF A;  4HES A;  1BLS A;  1ES4 A;  4KZ8 A;  4LV3 A;  1KVL A;  1WYB A;  1IKG A;  4DXB A;  2CC1 A;  3V50 A;  3VSK A;  4LCL A;  4OPQ A;  4S2L A;  2PBY A;  1KVM A;  3O3V A;  4OKP A;  3Q07 A;  2XQZ A;  4QY6 A;  3NIA A;  1DJA A;  2ZQ7 A;  4OOM A;  3ZG9 B;  3M2J A;  1N4O A;  4FSF A;  3V5M A;  5A90 A;  1XX2 A;  3IWI A;  4KZ7 A;  4PM7 A;  5CGS A;  4BJP A;  2DNS A;  1PW1 A;  5FQ9 A;  3OCL A;  2ZC6 B;  1FQG A;  4IVK A;  4EBL A;  4C3Q A;  1EI5 A;  1BSG A;  4LEN A;  3GV9 A; 
#chains in the Genus database with same CATH topology
 3NDE A;  2ZOI A;  4GD6 A;  2Z6D A;  3LI8 A;  2P9V A;  1KDS A;  4O01 A;  2QWS A;  2ZBB A;  4RX2 A;  1SKF A;  2O9A A;  3IH9 A;  5AVE A;  4KQO A;  3WS1 A;  2VGL S;  4UQI M;  4OOL A;  1ONG A;  1D1J A;  4DJ3 A;  2R9X A;  1L0G A;  3T4S A;  5FAS A;  3IF5 A;  4S2K A;  1OJ5 A;  3EEA A;  4GNU A;  4P0M A;  2IWD A;  1YKD A;  2V0U A;  1FSY A;  4Q8I A;  2Y2H A;  4NXF A;  5KMW A;  1K57 C;  1PNE A;  5HSQ A;  1XKZ A;  4IJG A;  1C3B A;  1NJ4 A;  2FFF B;  4OPR A;  1KE3 A;  4HY8 A;  4S2N A;  2XK1 A;  2OLV A;  2OAQ 1;  3C8C A;  3CUE A;  3IX3 A;  1Z09 A;  4DF6 A;  2WZZ A;  1XA7 A;  3B47 A;  5CX7 A;  3VOL A;  3N7W A;  4L9F A;  5FI2 A;  2WKR A;  3NOP C;  2GJ3 A;  1G6O A;  4UA6 A;  2QMI A;  4FD8 A;  3C4O A;  1DY6 A;  2PR5 A;  4E04 A;  4F3L A;  3VV4 A;  4JF4 A;  4KQQ A;  4KG6 A;  1K0K A;  4CLC E;  3TW8 A;  4RYE A;  1K54 A;  4XXR A;  3JVV A;  3LIF A;  4DDY A;  2V1A A;  2WKI A;  2VEA A;  5AQB A;  3F1N A;  4OPZ A;  4WZ4 A;  3I7J A;  2PYP A;  2WKH A;  5DJU A;  2Y2L A;  3QP1 A;  5JYP A;  3SS5 A;  3TRC A;  1SDE A;  2XR0 A;  3D72 A;  2QPN A;  5J3W A;  4BLM A;  3SS3 A;  3MQO A;  2HP5 A;  3MF0 A;  3MFX A;  1W63 M;  4X6T A;  4B4Z A;  3WRZ A;  4Z1W A;  4HEF A;  3HVF A;  4DE3 A;  3FPW A;  1FIL A;  4LGW A;  5FL3 A;  4X1L A;  2V8F A;  3E4P A;  4HOI A;  3ZNY A;  1K55 C;  4GJ4 A;  2HV1 A;  3GR2 A;  1S1Y A;  3BEC A;  2XLN A;  4DE0 A;  2BTF P;  1NY0 A;  1PI5 A;  2JE5 A;  2L1M A;  1L3L A;  4CLC B;  4IBR A;  1KOU A;  2B02 A;  3NY4 A;  3UB5 P;  3MXS A;  2OV5 A;  5FSR A;  4S2I A;  4B9O A;  4BWI A;  1F5M A;  5GL9 A;  2HGV A;  5CTN A;  2Y8H A;  1J9M A;  4S2O A;  4EBP A;  5GHZ A;  1YLZ A;  3Q7V A;  3UDF A;  1HLU P;  2JBF A;  1VET A;  3S7Q A;  4OLD A;  3B42 A;  4QPR A;  2EX9 A;  3OPL A;  1MWS A;  3LEQ A;  1KE4 A;  2VV7 A;  2V9A A;  3SW1 A;  2W3G A;  1LL9 A;  5FDS A;  2ZD8 A;  3NCK A;  1NYM A;  1ERM A;  4GHI B;  5FEG A;  4IHQ A;  2J3W A;  1MBL A;  3R7W B;  1DP9 A;  1QME A;  2EFX A;  4Y0U A;  3RXW A;  2AVX A;  3MR0 A;  5E2H A;  3UB7 A;  5EVI A;  3UB9 A;  3TE8 A;  1M40 A;  5DF7 A;  1N9L A;  1Z6F A;  2E8J A;  1H5X A;  4PKY A;  3QNB A;  3KSF A;  4ZTK A;  1TS7 A;  1W79 A;  2M7V A;  1TD5 A;  4LCM A;  4I3J A;  4L9E A;  2GX5 A;  2WKP A;  2J8Y A;  4DJ2 A;  2IWC A;  1OTB A;  3VFF A;  2X02 A;  3FV7 A;  5FQQ A;  1G6A A;  3H9W A;  1XA1 A;  4KUK A;  3MKE A;  3VP2 A;  3NHQ A;  3ZG0 A;  1VHM A;  5CEB A;  4WEJ A;  4F94 A;  3LCE A;  1NZU A;  3BY8 A;  3V3R A;  2H0T A;  2XRO A;  1BLH A;  2X71 A;  2H28 A;  1E3U A;  4BL2 A;  3H7W B;  4GCZ A;  4LFU A;  3W8K A;  4CLC D;  1G28 A;  2PRF A;  1ZTU A;  2DRW A;  3E4Q A;  3F1P B;  1PW8 A;  2XEP A;  1DP8 A;  1OME A;  3C7V A;  4N1X A;  4D60 A;  2VGJ A;  2LB5 A;  5F5Y A;  4KG5 A;  1G68 A;  1ALQ A;  3IHB A;  5L10 A;  1T1C A;  4R0Q A;  3MQQ A;  1XFQ A;  4OVD A;  4CPK A;  1VM1 A;  2HDU A;  3QP4 A;  2MJ6 A;  1TS8 A;  4JF5 A;  4EUZ A;  4Y5F A;  4S2M A;  3FZC A;  3OLO A;  1CF0 A;  4I38 A;  3O88 A;  4JPM A;  2FZ0 A;  3FG8 A;  1PZP A;  3EGX C;  3A0V A;  2VV6 A;  4WM9 A;  1SKO B;  3HBR A;  2ZM0 A;  3G30 A;  3NEC A;  4KG2 A;  1OTI A;  5FAQ A;  3T4O A;  3WRT A;  5EOE A;  1VEU B;  2Y2K A;  3CG5 A;  2V20 A;  3S7O A;  4WF0 A;  4NET A;  2VGL M;  3V3S A;  5EV0 A;  2FFY A;  4O8G A;  5J4E A;  1U60 A;  1JWV A;  5IHV A;  4B88 A;  3DBA A;  3G6O A;  3HUM A;  1MWT A;  5CER A;  5TGF A;  4WEL A;  4Y3I A;  3SH9 A;  5TJJ A;  3OPR A;  4ZJ3 A;  3UE6 A;  3B33 A;  1RGZ A;  1O7E A;  5D3O A;  2Q9M A;  3Q81 A;  2V1B A;  4KZ9 A;  4PAU A;  2ZOH A;  3PBR A;  1WA9 A;  4JF6 A;  4P85 A;  2V0W A;  5JYO A;  2PR6 A;  1ES4 A;  4DXB A;  3FC7 A;  4MDZ A;  3Q07 A;  4QY6 A;  4NEE D;  1DJA A;  3CIT A;  4HI4 A;  1N4O A;  3V5M A;  4KZ7 A;  1S67 L;  2VV8 A;  2ZC6 B;  4C3Q A;  5HPF A;  5HDC A;  5HPI A;  4OQG A;  2INW A;  4O7D A;  2RCX A;  4WLA A;  4EWF A;  4BD1 A;  4XUX A;  2EX2 A;  4Y13 A;  5TBM A;  1T18 A;  4IUK A;  2P08 A;  1OJG A;  3TJZ C;  3ZNT A;  3Q7Z A;  1TS6 A;  4HNB A;  1VB6 A;  1JTD A;  3F1O B;  3PBQ A;  2NUP C;  1PWD A;  2PBD P;  3IF6 C;  4E3L A;  3KYE A;  2HDS A;  3ZYT A;  4GDB A;  2ZQC A;  3ZVW A;  3MXR A;  2H0Y A;  1LHY A;  3QNC A;  4E3I A;  2ACG A;  5L8M A;  4UA9 A;  4DE2 A;  4KEN B;  2O9B A;  2Y59 A;  5MC7 A;  4R3A A;  1W63 Q;  4PPR A;  1M6K A;  3NDG A;  1YPR A;  4WMC A;  4FH4 A;  4HBU A;  3K2N A;  2B5R A;  1GHI A;  3GMW A;  2I9V A;  3HRE A;  4OON A;  3BW6 A;  2JKT I;  5KSC A;  3MJQ A;  2J3T D;  1AXB A;  3MZE A;  1XP4 A;  3G32 A;  3P01 A;  3BLS A;  2EXB A;  4KQD A;  2J80 A;  4B93 A;  4EQ1 A;  1OTA A;  2W3E A;  1YMS A;  3KYZ A;  2XD1 A;  2W1R A;  4CLC C;  4LRY C;  2G2U A;  3CPT A;  1BYW A;  4GN2 A;  1PWC A;  2GNX A;  2V1Z A;  3DW0 A;  4O0P A;  5CHM A;  3HLC A;  2PD8 A;  3DWZ A;  3FKW A;  2EFU A;  2O0Y A;  4N9L A;  2K31 A;  5LBR A;  3LIA A;  3HJI A;  4PMA A;  2HZ5 A;  2Q9N A;  2M7U A;  2K2N A;  3PBT A;  5HX9 A;  2C6W B;  3HLD A;  5IS1 A;  4IED A;  1ESI A;  1ESU A;  3CHW P;  3P7N A;  1LI9 A;  1K56 D;  1OPX A;  3DWK A;  4Z9Q A;  5HFO A;  4YNR A;  5DFX A;  2IWB A;  3CI6 A;  4NKP A;  3PR6 A;  3LR4 A;  3VP3 A;  1T19 A;  5FAT A;  3LY4 A;  1CEG A;  1ERQ A;  5BOH A;  1N9O A;  3RFB A;  2WAF A;  5FI7 A;  3LR0 A;  4I39 A;  4Y15 A;  2L4R A;  1WYC A;  3O5Y A;  3C7U A;  1S1Z A;  2PU4 A;  3U2A A;  3IXH A;  4HHD A;  3E0Y A;  1YLW A;  1MZU A;  1PI4 A;  1XJ6 A;  3N6I A;  3RTY A;  3V39 A;  3MQ0 A;  3QHY A;  4R38 A;  3JYI A;  4BQM A;  4RVA A;  4BMW A;  3C30 A;  5FI6 A;  4LPZ A;  3AGF A;  4GZB A;  2K7S A;  5AJG A;  5U47 A;  3HCY A;  1K57 A;  5EOO A;  4G3W A;  5FAP A;  1XJ2 A;  4E3K A;  4K0X A;  3GVB A;  3IF6 B;  4ESP A;  4N1H A;  4Q0I A;  2H10 A;  1KGG A;  1PFL A;  2P7J A;  1RGY A;  3BEB A;  2A24 B;  5HL1 A;  2WGW A;  5CGW A;  3ITA A;  2RL3 A;  2JC7 A;  1SZV A;  4QY5 A;  5EEC A;  4E3O A;  1BZA A;  1FCN A;  2A49 A;  1BT5 A;  1PWG A;  1DRM A;  1CJF A;  5CHJ A;  2W27 A;  5F69 A;  5DTS A;  3S22 A;  3MS6 A;  4GW9 A;  3PTE A;  3BM6 A;  4XT2 B;  1YQS A;  2PT7 A;  2ZL1 B;  3MXQ A;  5DTT A;  2PHY A;  2BAS A;  1K6R A;  4QD4 A;  5CED A;  3UN7 A;  2JKG A;  3IHA A;  4GS9 B;  4R6L A;  1I5Q A;  3BFE A;  3H7W A;  5DF8 A;  3T4L A;  1YSP A;  3WS4 A;  4JXS A;  1GSW A;  3F1P A;  3G34 A;  4GB7 A;  4U3T A;  4BL3 A;  2Y2P A;  2VLG A;  3D3O A;  2DMW A;  4JGQ A;  3A0S A;  1KE0 A;  2HDQ A;  4KZ4 A;  4IBX A;  2W1T A;  4H8R A;  2ZMA A;  1FR6 A;  3EQU A;  1HTZ A;  3IS2 B;  2EXA A;  1TEM A;  1BTL A;  3N4I A;  3GRJ A;  2P9V B;  1P97 A;  1K6S A;  1K55 A;  1PYY A;  3P09 A;  3A3E A;  2B18 A;  3GQZ A;  1L0E A;  4PHT A;  3CMZ A;  2J3T C;  2ZQ9 A;  3UPP A;  1IEM A;  2JHE A;  3VE4 A;  1LL8 A;  1ZC2 A;  2QJ5 A;  4MN6 A;  3O86 A;  2VX8 A;  5HAQ A;  1H3Q A;  1Y28 A;  1D7E A;  5FDH A;  3G2Z A;  3VOY A;  2Y2Q A;  3MSH A;  1IOU A;  4CJN A;  2JKR I;  4WZ5 C;  2BG1 A;  3IH8 A;  3H82 A;  5A91 A;  4RX3 A;  1W8Q A;  4KZ3 A;  3HL9 A;  3LFV A;  3PAE A;  3OZH A;  5K5B A;  4EEU A;  4FCF A;  3LIE A;  1I2W A;  5EPH A;  1BLP A;  1CI8 A;  3S1Y A;  3LIC A;  2CMN A;  3T1S A;  1V9Y A;  3GTC A;  2ZC7 A;  1JVJ A;  1IYO A;  2J9O A;  5KZH A;  3QP8 A;  3EOI A;  3MBZ A;  1G5U A;  4PM8 A;  3UPO A;  1O07 A;  4B4X A;  1BLC A;  2KOI A;  3OPH A;  1DJC A;  3BJN A;  3Q1F A;  3QP6 A;  4EQI A;  3AGD A;  3OBF A;  4LV3 A;  1KVL A;  1WYB A;  2CC1 A;  2HF6 A;  4S2L A;  1KVM A;  3DTI A;  3NIA A;  2ZQ7 A;  3F1N B;  4OOM A;  4NXE A;  2VA0 A;  4FSF A;  5A90 A;  1XX2 A;  3IWI A;  4CQH A;  2DNS A;  5FQ9 A;  3OCL A;  1BSG A;  3GV9 A;  1ZG6 A;  4IUH A;  4P6Z S;  3T1X A;  5M18 A;  2E8I A;  5GLB A;  5E43 A;  4BD0 A;  3KSG A;  4HJ4 A;  5HD3 A;  2IA2 A;  4LV1 A;  4QWO A;  1LLB A;  1D06 A;  3EGD C;  1BUE A;  2V8C A;  5DKL A;  1LT0 A;  1W7F A;  1P9W A;  3ZG7 B;  3A0R A;  3PYP A;  3RH8 B;  2XRN A;  3BWL A;  1W5D A;  5DJT A;  3ITB A;  2OWH A;  3T12 B;  4OQH A;  2W3F A;  1ERO A;  3RXX A;  1VQQ A;  4OPY A;  1KDW A;  1ZG4 A;  2WUQ A;  1UGU A;  5GHX A;  4GD8 A;  2WGI A;  4UA7 A;  2ZMV A;  3BQA A;  1TDL A;  2ZM2 A;  3SH7 A;  3DAV A;  4KZA A;  2W0N A;  4X53 A;  5HWT A;  3BY9 A;  3W4O A;  1AWI A;  5HWV A;  2PD7 A;  2BLS A;  3NOT C;  2WZX A;  4JGR A;  2VKS A;  5A92 A;  4PM6 A;  5GLD A;  1EWZ A;  5DVA A;  4K91 A;  4PM9 A;  1A0K A;  1XXM A;  5CHU A;  4PM5 A;  4ZRR A;  4BEN A;  4X69 A;  3KX0 X;  4I3A A;  2WGV A;  5E2F A;  3UB8 A;  4R23 A;  3VE3 A;  4ME4 A;  2Y2J A;  3LGO A;  4HBT A;  3ZHH A;  5HAI A;  1ONH A;  4EET B;  3NC8 A;  3G4P A;  1OTD A;  2EX8 A;  4PKY G;  1L0F A;  3ICY A;  1FSW A;  1CK3 A;  1IEL A;  3ZVT A;  4FUW A;  2OWJ A;  5M19 A;  5GLC A;  1PZO A;  4DE1 A;  2OSU A;  5EFW A;  5A8B A;  2XGN A;  1E25 A;  5FQM A;  3OPP A;  5HAR A;  2XFT A;  3T1Q B;  2JN7 A;  4K0W A;  1F98 A;  4QU3 A;  5C5K A;  2ZQD A;  1GA9 A;  3IQA A;  3E4O A;  2P74 A;  3W4Q A;  5G4Y A;  2D02 A;  2Y55 A;  1RP5 A;  3FWL A;  4HIA A;  5F6A A;  4LRZ E;  3PXP A;  4OP8 A;  1PRQ A;  3KYQ A;  2DCF A;  1E4D A;  3LYX A;  1GA0 A;  1HD8 A;  3LIB A;  5A93 A;  3U4L P;  3PHY A;  3ZG5 A;  1S6R A;  2QYB A;  1DP6 A;  5F83 A;  2FH5 A;  1Y4O A;  3NUL A;  1TDG A;  2ZQ8 A;  1T1A A;  1GSX A;  2ZQA A;  3UO9 A;  1K4F A;  3G35 A;  5FQI A;  3E2L A;  1NYY A;  3KSH A;  5KIZ A;  4OQI A;  1XGI A;  1YT4 A;  1OT6 A;  4FH2 A;  3DTK A;  4NXB A;  3IF6 A;  4X25 A;  4EER A;  5HDD A;  1ODV A;  1SHV A;  2A24 A;  3PAG A;  3ZQ5 A;  4QHC A;  4ZBE A;  3WS5 A;  1F2K A;  1F9I A;  5EUA A;  5CGX A;  4RQ9 A;  3C4P A;  1T1B A;  3UDI A;  1V9Z A;  5L2F A;  1ACF A;  3T50 A;  2XDM A;  4L0L A;  5J7E A;  4XT2 A;  5G4Z A;  4EU0 A;  5CRF A;  5EVI D;  3HLB A;  4BBT A;  1K38 A;  4IVI A;  1YLP A;  4OOY A;  1IYS A;  1ES2 A;  2KX6 A;  3D4F A;  3JVU A;  4H6J B;  5F1F A;  1MXO A;  4CLC A;  4DMZ A;  2ZM8 A;  1XJ3 A;  3OOV A;  4C6Y A;  1XJ4 A;  4UHU A;  2V2F F;  3HUN A;  2PU2 A;  5EVL A;  4R1G A;  3IS2 A;  4NG2 A;  1MC0 A;  1S4S A;  2NUT C;  4EES A;  4HH3 A;  4EW7 A;  4S2P A;  2ZLY A;  4QB8 A;  2JKT M;  1E3U D;  4MBH A;  1MKM A;  4GOG A;  4S2N C;  3T4K A;  3CUE C;  4XUZ A;  1IYP A;  2R78 A;  5I94 A;  1FCM A;  2HJE A;  2Y2I A;  4YFM A;  4X56 A;  5DKK A;  2VZW A;  2XH9 A;  4KZ6 A;  2QHK A;  1RCJ A;  5TBM B;  3P98 A;  3AGE A;  1S4R A;  3K3D A;  3D9Y A;  2LB9 A;  2KLI A;  4WN5 A;  4MMN A;  1HVB A;  3E2K A;  4DXC A;  1H8M A;  2Y2G A;  4DKI A;  2Y2N A;  5DF9 A;  4GHI A;  3ISG A;  3SOI A;  4JGO A;  3FYZ A;  5FA7 A;  4ARZ B;  4MN5 A;  3R7W A;  3CZD A;  1IKI A;  1K54 C;  4P6Z M;  3TG9 A;  4Y0O A;  4YWZ A;  4R4S A;  5HD5 A;  1SCW A;  3MFD A;  1N9N A;  4MNR A;  1S66 L;  3KO6 A;  2VGK A;  3IWO A;  5HDS A;  3T4J A;  4KUO A;  3S7P A;  4U0X A;  3RJU A;  2Y79 A;  2Y2O A;  2J9P A;  4M3K A;  3VP0 A;  4GDN A;  2ZC3 B;  2Z6C A;  3LID A;  4Y0T A;  3VMA A;  4HP4 A;  1BUL A;  2HPB A;  3KSI A;  3IX8 A;  3M6B A;  2B95 A;  1Y54 A;  4FTX A;  3T4T A;  4HH2 A;  5HWW A;  2VJW A;  3CLO A;  5CEC A;  4ID4 A;  3ZG8 B;  2WAD A;  3WS0 A;  3L7H A;  1TS0 A;  5FAO A;  1YLJ A;  1UWN X;  1MY8 A;  4HES A;  1BLS A;  4DN0 A;  4KZ8 A;  1NLY A;  1EW0 A;  1IKG A;  3O3V A;  4OKP A;  3CPT B;  3S7N A;  3IX4 A;  2OOL A;  4Q0H A;  2QJ7 A;  4EEP A;  2PDR A;  4HQA A;  4BJP A;  1P0Z A;  1FQG A;  4EBL A;  4LEN A;  3UY6 A;  2ZC5 B;  4N9K A;  5FQK A;  4G3K A;  3IT9 A;  3O87 A;  1X0O A;  4RA7 A;  3FPV A;  2XA7 S;  1YMX A;  3NBL A;  1DJB A;  3SZT A;  4L9G A;  1YSQ A;  4NK3 A;  5F68 A;  2VK3 A;  3IWQ A;  4HP9 A;  3M6H A;  1H0M A;  3IXD A;  2XD5 A;  1JTG A;  2EX6 A;  4Y7P A;  3ULF A;  2ZJ9 A;  5AQ9 A;  4MBF A;  2WKQ A;  4R70 A;  4EV4 A;  1NRJ A;  1K25 A;  3ZGA B;  2Y4A A;  5HAP A;  1SKO A;  2J7V A;  1S0W A;  4M4X A;  4OP5 A;  2GDN A;  3ZFZ A;  1YM1 A;  3VOZ A;  1VEU A;  1NZO A;  3WS2 A;  4K08 A;  3IXB A;  2HDR A;  3PBO A;  4ZAM A;  2ZMF A;  2G7U A;  2HP9 A;  5EVI C;  3HLW A;  3OC2 A;  3JPU A;  1LSW A;  5FEF A;  2QKP A;  3UE0 A;  3S4X A;  3BFD A;  4AFI A;  3LY3 A;  4NXG A;  4BBV A;  4EBN A;  3UMD A;  3M2K A;  4KZ5 A;  3HLG A;  3FKV A;  4WBG A;  4WMC D;  4ETZ A;  3T1R A;  5IU1 A;  5HZH A;  4HJ3 A;  3G31 A;  4QJG A;  1ZKJ A;  4WZ5 A;  3LO7 A;  4UQI S;  2EWV A;  4ZDX A;  1GSV A;  1LSX A;  5AVF A;  2Q0O A;  4F3L B;  3UME A;  4E3N A;  5TR7 A;  2KDK A;  2WGW B;  1OT9 A;  3OCN A;  4BBU A;  3C38 A;  5TFQ A;  1N9B A;  5F1G A;  4C75 A;  2XF3 A;  5DFY A;  5F82 A;  4MLL A;  3GDI A;  4P6B A;  1YAX A;  3ZCZ A;  2X01 A;  3A3J A;  2YKH A;  4WL9 A;  1K56 A;  1J3W A;  2L0W A;  4Y2F A;  2EA9 A;  5L09 A;  3HLF A;  4JXG A;  2C5W B;  2JKR M;  5E2E A;  3G2Y A;  1W8Y A;  1CEF A;  3A3D A;  3F1O A;  3IBR A;  1NWZ A;  1LSV A;  2H5S A;  5EM1 A;  1Q2P A;  1HZO A;  4OLG A;  3QP2 A;  3HUO A;  1IFQ A;  3NI9 A;  4KQR A;  5FQJ A;  2HJ9 C;  3UE1 A;  4WYY A;  1ES5 A;  5CTM A;  5AQA A;  4D2O A;  4I3I A;  1PIO A;  2W3H A;  3GSG A;  1L0D A;  4N92 A;  4ZJ2 A;  3ZDJ A;  4A5R A;  4JBF A;  1GHP A;  3LUQ A;  1FOF A;  5AQ7 A;  2W1T B;  4JLF A;  1FCO A;  1GHM A;  2QZ6 A;  3HLE A;  3UDX A;  5GLA A;  1IYQ A;  1UWP X;  1NRF A;  1TVF A;  3UE3 A;  4MCW A;  2UV0 E;  3QP5 A;  3Q7V B;  5IT5 A;  4G3V A;  1VET B;  3CAX A;  1XFN A;  1H8Y A;  4MEZ A;  3B3X A;  3MKF A;  2OAP 1;  3TOI A;  4WEK A;  5E2G A;  2JKF A;  4E6W A;  1KGF A;  2XSS A;  4DDS A;  3LI9 A;  1NXY A;  4II7 A;  3VSL A;  2Z2L B;  2PYR A;  3CJM A;  5HL6 A;  3C2W A;  3CWF A;  3H82 B;  2WK0 A;  1XPB A;  4R3J A;  5DTK A;  5GHY A;  1H8Z A;  4GLQ A;  3EEH A;  4E3J A;  1I2S A;  4MBK A;  3NOU C;  3SS4 A;  4E6X A;  3Q82 A;  1YLY A;  2Y2M A;  1NLZ A;  2P04 A;  5HW3 A;  4JGP A;  3PBS A;  1LI0 A;  5EVI B;  3BRM A;  2WYX A;  1YLT A;  1ZHH B;  1QMF A;  3BYD A;  5CXW A;  5EE8 A;  3HJK A;  4H6J A;  3BLM A;  4R4R A;  3UNW A;  3UB6 A;  3VFH A;  2ZC4 B;  4OH0 A;  5J8X A;  4LV2 A;  3A3F A;  4HJ6 A;  3VP1 A;  4U0T A;  4X68 A;  3N8R A;  3N8S A;  3V67 A;  3WWX A;  4R3B A;  1OTE A;  1KGE A;  1MWR A;  2HP6 A;  3R4K A;  3IXG A;  2JCH A;  4ZJ1 A;  5EM0 A;  2O99 A;  3N8L A;  3UPN A;  3GEC A;  1SDN A;  2EWW A;  3A3I A;  4DRT A;  4E3M A;  1STZ A;  1K4E A;  1JNU A;  4ETX A;  2OLU A;  1ES3 A;  4P87 A;  3EWK A;  2XFS A;  1FIK A;  3BFC A;  4YIN A;  1WE4 A;  3T4Q A;  2G2W A;  4WUJ A;  4ARZ A;  1FR1 A;  3EQV A;  3BQ8 A;  2YKF A;  3NJA A;  1Q2Q A;  3PBN A;  3MZF A;  4EUV A;  1L2S A;  5L07 A;  4YOF A;  1GCE A;  2R9W A;  2A2L A;  3MZD A;  1XGJ A;  3DTE A;  3W4P A;  5G18 A;  4OQ0 A;  3BFG A;  5M1A A;  2WAE A;  4MN7 A;  4LRX C;  4UAA A;  3E98 A;  3VP4 A;  1JWP A;  2Y91 A;  3K3C A;  1MKI A;  2I72 A;  2XA7 M;  4I5S A;  3SH8 A;  3C5A A;  1MPL A;  2D01 A;  5I5L A;  4FOF A;  3LR3 A;  4Y17 A;  3TSG A;  1CI9 A;  2GZA A;  4LV0 A;  1JWZ A;  5EVE A;  1LL5 A;  4X55 A;  4JXW A;  4KZB A;  1MWU A;  4EXO A;  2UWX A;  2ZL1 A;  3LEZ A;  3IBJ A;  2A3U A;  3LR5 A;  2O9C A;  3DTM A;  2PAV P;  5KSH A;  4GKU A;  4GS9 A;  4JXV A;  4S2J A;  3L9K A;  3MMH A;  4UEY A;  4JKT A;  1P9R A;  2WKE A;  2Z2M B;  3BFF A;  2M1C A;  2W3D A;  1CQA A;  3V50 A;  3VSK A;  4LCL A;  4OPQ A;  2PBY A;  2XQZ A;  4Q0J A;  3ZG9 B;  3M2J A;  4PM7 A;  5CGS A;  1PW1 A;  3W2Z A;  4IVK A;  4LLO B;  4X1M A;  1EI5 A;  1TF1 A; 
#chains in the Genus database with same CATH homology
 3NDE A;  1ZG6 A;  4GD6 A;  3UY6 A;  2ZC5 B;  4N9K A;  5M18 A;  2P9V A;  5FQK A;  4OQG A;  4O7D A;  2RCX A;  2E8I A;  1KDS A;  3IT9 A;  3O87 A;  4RX2 A;  5GLB A;  1SKF A;  3IH9 A;  4RA7 A;  4EWF A;  4BD1 A;  4XUX A;  5E43 A;  1YMX A;  4KQO A;  4BD0 A;  3NBL A;  1DJB A;  2EX2 A;  3WS1 A;  4NK3 A;  4OOL A;  1ONG A;  2R9X A;  4LV1 A;  1L0G A;  3Q7Z A;  3IWQ A;  3ZNT A;  1LLB A;  1JTD A;  5FAS A;  3IF5 A;  4S2K A;  3PBQ A;  3M6H A;  1BUE A;  3IXD A;  2XD5 A;  1JTG A;  2EX6 A;  4Y7P A;  1W7F A;  4GNU A;  3ZG7 B;  1PWD A;  4P0M A;  3IF6 C;  2IWD A;  4E3L A;  2HDS A;  1FSY A;  2ZJ9 A;  5AQ9 A;  4MBF A;  4Q8I A;  4GDB A;  4EV4 A;  2ZQC A;  3ZVW A;  3MXR A;  1K25 A;  2Y2H A;  5KMW A;  1K57 C;  3ZGA B;  2Y4A A;  5HAP A;  1W5D A;  3ITB A;  2H0Y A;  1XKZ A;  2J7V A;  1S0W A;  4OP5 A;  4OQH A;  2GDN A;  3ZFZ A;  1C3B A;  1NJ4 A;  1ERO A;  2FFF B;  4OPR A;  1LHY A;  3RXX A;  3QNC A;  1KE3 A;  1VQQ A;  4E3I A;  4OPY A;  1YM1 A;  2XK1 A;  4S2N A;  3VOZ A;  2OLV A;  1KDW A;  1ZG4 A;  2WUQ A;  5GHX A;  1NZO A;  4UA9 A;  3WS2 A;  4DE2 A;  4GD8 A;  4KEN B;  2Y59 A;  4DF6 A;  2WZZ A;  1XA7 A;  2WGI A;  3IXB A;  4UA7 A;  2HDR A;  3PBO A;  3N7W A;  4PPR A;  1M6K A;  4ZAM A;  3NDG A;  1TDL A;  2HP9 A;  4WMC A;  4FH4 A;  5EVI C;  2ZM2 A;  5FI2 A;  4HBU A;  4KZA A;  3HLW A;  3SH7 A;  4X53 A;  3OC2 A;  2B5R A;  3W4O A;  1GHI A;  3GMW A;  3UE0 A;  3S4X A;  3BFD A;  3HRE A;  4OON A;  3LY3 A;  2BLS A;  4EBN A;  2WZX A;  5A92 A;  3M2K A;  4PM6 A;  4KZ5 A;  5GLD A;  4UA6 A;  3HLG A;  2QMI A;  4FD8 A;  5KSC A;  1EWZ A;  3C4O A;  3FKV A;  4WBG A;  1AXB A;  1DY6 A;  1XP4 A;  3MZE A;  4WMC D;  5DVA A;  3G32 A;  4K91 A;  4PM9 A;  1XXM A;  5CHU A;  3G31 A;  4QJG A;  4JF4 A;  4PM5 A;  1ZKJ A;  4KQQ A;  3BLS A;  2EXB A;  4WZ5 A;  4BEN A;  4X69 A;  3LO7 A;  4KG6 A;  4RYE A;  1K54 A;  2WGV A;  4XXR A;  1YMS A;  5E2F A;  4ZDX A;  4R23 A;  2XD1 A;  2Y2J A;  4DDY A;  4HBT A;  3ZHH A;  5HAI A;  2WKI A;  4E3N A;  1ONH A;  5TR7 A;  2G2U A;  3G4P A;  3NC8 A;  5AQB A;  4OPZ A;  2EX8 A;  3I7J A;  4WZ4 A;  2WGW B;  4GN2 A;  1L0F A;  2WKH A;  1PWC A;  2Y2L A;  3OCN A;  1FSW A;  5JYP A;  5TFQ A;  1CK3 A;  3SS5 A;  1N9B A;  5F1G A;  1IEL A;  3ZVT A;  1SDE A;  2XF3 A;  2XR0 A;  4C75 A;  2V1Z A;  4BLM A;  2QPN A;  5F82 A;  3SS3 A;  3DW0 A;  5M19 A;  2HP5 A;  4MLL A;  5CHM A;  3HLC A;  3DWZ A;  3FKW A;  5GLC A;  1PZO A;  2EFU A;  4X6T A;  4B4Z A;  4DE1 A;  2OSU A;  4N9L A;  3WRZ A;  4HEF A;  2XGN A;  4P6B A;  3ZCZ A;  1E25 A;  2X01 A;  5FQM A;  3OPP A;  4PMA A;  5HAR A;  3A3J A;  2XFT A;  3HVF A;  1K56 A;  4DE3 A;  2Q9N A;  4K0W A;  3TG9 A;  3PBT A;  3HLF A;  5HX9 A;  4JXG A;  2C5W B;  5E2E A;  2C6W B;  3G2Y A;  1W8Y A;  3ZNY A;  1K55 C;  4QU3 A;  3HLD A;  1CEF A;  2ZQD A;  1GA9 A;  4IED A;  3IQA A;  1ESI A;  1ESU A;  3GR2 A;  2P74 A;  3A3D A;  1LI9 A;  3BEC A;  3W4Q A;  1K56 D;  2Y55 A;  1RP5 A;  3FWL A;  2XLN A;  2H5S A;  1Q2P A;  4DE0 A;  3DWK A;  1HZO A;  4OLG A;  1NY0 A;  1PI5 A;  2JE5 A;  4Z9Q A;  5HFO A;  4OP8 A;  4IBR A;  2DCF A;  3HUO A;  3NI9 A;  2IWB A;  1E4D A;  4KQR A;  5FQJ A;  1GA0 A;  3NY4 A;  3UE1 A;  4WYY A;  3MXS A;  1ES5 A;  5CTM A;  5AQA A;  3VP3 A;  4D2O A;  1HD8 A;  2OV5 A;  5FSR A;  5FAT A;  4S2I A;  3LY4 A;  5A93 A;  1PIO A;  1CEG A;  1ERQ A;  5BOH A;  3GSG A;  3ZG5 A;  1L0D A;  5GL9 A;  1S6R A;  4N92 A;  2WAF A;  5FI7 A;  4ZJ2 A;  3ZDJ A;  4A5R A;  5F83 A;  4JBF A;  1GHP A;  1WYC A;  1FOF A;  5AQ7 A;  3C7U A;  1TDG A;  2PU4 A;  2ZQ8 A;  4JLF A;  1FCO A;  1J9M A;  5CTN A;  1GHM A;  2QZ6 A;  3IXH A;  4S2O A;  4EBP A;  5GHZ A;  1YLW A;  1YLZ A;  2ZQA A;  3UO9 A;  1PI4 A;  1K4F A;  3G35 A;  3HLE A;  5FQI A;  3UDX A;  3E2L A;  1NYY A;  3N6I A;  1IYQ A;  5GLA A;  3V39 A;  3Q7V A;  3UDF A;  3QHY A;  2JBF A;  1NRF A;  3JYI A;  4OLD A;  4BQM A;  4OQI A;  4RVA A;  1XGI A;  1YT4 A;  1TVF A;  3UE3 A;  4FH2 A;  5FI6 A;  3W4P A;  2EX9 A;  3OPL A;  1MWS A;  3Q7V B;  3IF6 A;  1KE4 A;  3AGF A;  4GZB A;  1H8Y A;  4MEZ A;  5U47 A;  3B3X A;  3MKF A;  1K57 A;  5EOO A;  5FAP A;  3TOI A;  4WEK A;  5E2G A;  1SHV A;  1LL9 A;  4E6W A;  3PAG A;  2ZD8 A;  1KGF A;  3NCK A;  4E3K A;  4K0X A;  3GVB A;  4DDS A;  3IF6 B;  1NYM A;  1ERM A;  4QHC A;  1NXY A;  4ZBE A;  3WS5 A;  4N1H A;  2H10 A;  1KGG A;  5EUA A;  3VSL A;  1MBL A;  5CGX A;  2Z2L B;  1RGY A;  3CJM A;  3C4P A;  1QME A;  3BEB A;  5HL1 A;  2WGW A;  2EFX A;  5CGW A;  4Y0U A;  2WK0 A;  1XPB A;  3ITA A;  4R3J A;  5DTK A;  5GHY A;  3UDI A;  3RXW A;  1H8Z A;  4E3J A;  5L2F A;  2RL3 A;  2JC7 A;  5E2H A;  1I2S A;  4MBK A;  4QY5 A;  5EVI A;  2XDM A;  4L0L A;  5EEC A;  3SS4 A;  4E3O A;  1BZA A;  1FCN A;  2A49 A;  4E6X A;  1BT5 A;  3Q82 A;  1PWG A;  1YLY A;  1M40 A;  5DF7 A;  1Z6F A;  2Y2M A;  5CRF A;  5CHJ A;  1H5X A;  5HW3 A;  5DTS A;  3QNB A;  3S22 A;  4ZTK A;  3PBS A;  1W79 A;  1LI0 A;  5EVI B;  3BRM A;  2WYX A;  1YLT A;  3PTE A;  5EVI D;  3BM6 A;  3HLB A;  1K38 A;  1QMF A;  1YQS A;  3BYD A;  4LCM A;  5CXW A;  5EE8 A;  4IVI A;  1YLP A;  4OOY A;  1IYS A;  5DTT A;  3BLM A;  1ES2 A;  4R4R A;  3UNW A;  2J8Y A;  1K6R A;  2IWC A;  3VFH A;  2ZC4 B;  4QD4 A;  4OH0 A;  3VFF A;  5CED A;  2X02 A;  3FV7 A;  3D4F A;  5FQQ A;  5J8X A;  1G6A A;  3UN7 A;  1XA1 A;  4LV2 A;  3A3F A;  3IHA A;  3MKE A;  3VP1 A;  3VP2 A;  3ZG0 A;  5CEB A;  5F1F A;  1MXO A;  1I5Q A;  3BFE A;  4U0T A;  5DF8 A;  4WEJ A;  2ZM8 A;  4X68 A;  4F94 A;  3LCE A;  1NZU A;  4C6Y A;  3N8R A;  3N8S A;  3V3R A;  3WS4 A;  4B88 A;  3WWX A;  2H0T A;  4JXS A;  4UHU A;  2V2F F;  4R3B A;  1BLH A;  2X71 A;  1KGE A;  3G34 A;  3HUN A;  2PU2 A;  1MWR A;  1E3U A;  4GB7 A;  4U3T A;  5EVL A;  4BL3 A;  4R1G A;  4BL2 A;  2Y2P A;  2HP6 A;  3W8K A;  1KE0 A;  2DRW A;  3IXG A;  2JCH A;  2HDQ A;  4ZJ1 A;  1PW8 A;  2ZLY A;  4KZ4 A;  2XEP A;  4QB8 A;  4S2P A;  1OME A;  4IBX A;  4H8R A;  1E3U D;  1FR6 A;  2ZMA A;  3C7V A;  3EQU A;  4MBH A;  1HTZ A;  4N1X A;  2EXA A;  3N8L A;  4GOG A;  2VGJ A;  4S2N C;  1TEM A;  1BTL A;  3N4I A;  4XUZ A;  1IYP A;  4KG5 A;  3UPN A;  1SDN A;  3GRJ A;  5I94 A;  1FCM A;  1G68 A;  1ALQ A;  2P9V B;  3IHB A;  1K6S A;  1K55 A;  2Y2I A;  3A3I A;  4YFM A;  4DRT A;  4X56 A;  1PYY A;  3P09 A;  4E3M A;  3A3E A;  1K4E A;  4R0Q A;  2OLU A;  3GQZ A;  1L0E A;  2XH9 A;  4KZ6 A;  3CMZ A;  1ES3 A;  4P87 A;  1RCJ A;  2ZQ9 A;  4OVD A;  4CPK A;  3UPP A;  1IEM A;  1VM1 A;  2XFS A;  3AGE A;  3P98 A;  2HDU A;  1ZC2 A;  3BFC A;  4YIN A;  1WE4 A;  4JF5 A;  3O86 A;  2G2W A;  5HAQ A;  4EUZ A;  1HVB A;  1FR1 A;  3EQV A;  3E2K A;  4DXC A;  4S2M A;  3FZC A;  2Y2G A;  1Q2Q A;  4DKI A;  3PBN A;  3MZF A;  5FDH A;  2Y2N A;  3G2Z A;  5DF9 A;  1L2S A;  3ISG A;  3VOY A;  3O88 A;  4JPM A;  3SOI A;  2Y2Q A;  1GCE A;  2R9W A;  4CJN A;  3FYZ A;  5FA7 A;  4WZ5 C;  2BG1 A;  3MZD A;  1PZP A;  4WM9 A;  1XGJ A;  3CZD A;  3IH8 A;  1IKI A;  1K54 C;  2ZM0 A;  3HBR A;  5G18 A;  5A91 A;  4OQ0 A;  3G30 A;  3BFG A;  4RX3 A;  4Y0O A;  5M1A A;  1W8Q A;  4KG2 A;  4R4S A;  2WAE A;  4KZ3 A;  3HL9 A;  5FAQ A;  3WRT A;  5EOE A;  4UAA A;  1SCW A;  3PAE A;  3MFD A;  3VP4 A;  3OZH A;  1JWP A;  2Y2K A;  2Y91 A;  3CG5 A;  1MKI A;  2I72 A;  4MNR A;  4FCF A;  2V20 A;  2VGK A;  3SH8 A;  3C5A A;  1MPL A;  1I2W A;  3IWO A;  4NET A;  5EPH A;  1BLP A;  3V3S A;  1CI8 A;  3S1Y A;  3TSG A;  1CI9 A;  4LV0 A;  4U0X A;  2FFY A;  1JWZ A;  3RJU A;  1U60 A;  1LL5 A;  4X55 A;  4JXW A;  3GTC A;  1JWV A;  2Y2O A;  2J9P A;  2ZC7 A;  4M3K A;  5IHV A;  4KZB A;  1JVJ A;  4GDN A;  3VP0 A;  3HUM A;  2ZC3 B;  1MWT A;  1IYO A;  5CER A;  1MWU A;  2J9O A;  5TGF A;  4Y0T A;  5KZH A;  3VMA A;  4WEL A;  3SH9 A;  1BUL A;  2HPB A;  2UWX A;  3LEZ A;  2A3U A;  3OPR A;  4ZJ3 A;  3M6B A;  3DTM A;  1RGZ A;  1O7E A;  3MBZ A;  1Y54 A;  4PM8 A;  1O07 A;  2Q9M A;  5D3O A;  4B4X A;  3UPO A;  3Q81 A;  1BLC A;  3OPH A;  4KZ9 A;  5KSH A;  4GKU A;  1DJC A;  5CEC A;  4ID4 A;  4JXV A;  3ZG8 B;  2WAD A;  4S2J A;  3Q1F A;  3WS0 A;  3PBR A;  4JKT A;  2WKE A;  1YLJ A;  4JF6 A;  4P85 A;  5FAO A;  5JYO A;  1MY8 A;  4EQI A;  3AGD A;  2Z2M B;  3BFF A;  4HES A;  1BLS A;  1ES4 A;  4KZ8 A;  4LV3 A;  1KVL A;  1WYB A;  1IKG A;  4DXB A;  2CC1 A;  3V50 A;  3VSK A;  4LCL A;  4OPQ A;  4S2L A;  2PBY A;  1KVM A;  3O3V A;  4OKP A;  3Q07 A;  2XQZ A;  4QY6 A;  3NIA A;  1DJA A;  2ZQ7 A;  4OOM A;  3ZG9 B;  3M2J A;  1N4O A;  4FSF A;  3V5M A;  5A90 A;  1XX2 A;  3IWI A;  4KZ7 A;  4PM7 A;  5CGS A;  4BJP A;  2DNS A;  1PW1 A;  5FQ9 A;  3OCL A;  2ZC6 B;  1FQG A;  4IVK A;  4EBL A;  4C3Q A;  1EI5 A;  1BSG A;  4LEN A;  3GV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...