3B47A

Periplasmic sensor domain of chemotaxis protein gsu0582
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
121
Chain Sequence
IMDLQTRNTRGLSTLVVRDIGELMMAGDMAVIERYVADVRGKGAVLDLRIYDAAGRPAAPDGEVQAALTSGATAEKRHKRHVLSFIVPLANEVRCQSCHEQGARFNGAMLLTTSLEEGYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures and solution properties of two novel periplasmic sensor domains with c-type heme from chemotaxis proteins of Geobacter sulfurreducens: implications for signal transduction.
pubmed doi rcsb
source organism Geobacter sulfurreducens
total genus 35
structure length 121
sequence length 129
ec nomenclature
pdb deposition date 2007-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.290 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b47A00
3B47A 3B42A
chains in the Genus database with same CATH superfamily
1QMEA 2WKEA 1ALQA 5F82A 2P04A 4BQMA 1LI0A 3P01A 1S4RA 2O0YA 4UHUA 4JGQA 1BTLA 1K55C 3EWKA 2A2LA 4DKIA 4GCZA 2ZL1B 3IF6C 2G2WA 3IXHA 3A3DA 2PD7A 1MY8A 3WRTA 2Y2KA 1F2KA 4IUHA 4NETA 3HUMA 3SH7A 5IS1A 2X71A 1E25A 4FD8A 2Y55A 1LSVA 3M6BA 3LY4A 2O99A 4EUZA 1TEMA 3GV9A 3PAGA 1DP9A 2Y2NA 3VSLA 3TSGA 3R7WB 4U0XA 3SS4A 2P9VB 3NECA 3IHBA 3GRJA 3O88A 2E8IA 1OMEA 3K3CA 4WLAA 4IVIA 3QP1A 1OTDA 2ZLYA 3PAEA 3LYXA 3ITBA 2A24A 4HJ4A 1FSWA 1VEUB 1ESUA 4X1LA 1YAXA 3Q7VB 5EVLA 1Q2PA 3BW6A 5EVIC 5AVFA 2WUQA 4E3NA 4WZ5A 3H7WB 2VGKA 3P98A 5D3OA 4Q0IA 4EBLA 2XK1A 1XA7A 2VKSA 4BL3A 4JKTA 1L0GA 5GLAA 5EVID 3MZDA 3B47A 5FEGA 1I5QA 2DCFA 3IH9A 5DJUA 5CRFA 1HZOA 3D3OA 4F94A 4I38A 3MF0A 3ISGA 5I5LA 4OPQA 4C75A 3GECA 2NUTC 4LFUA 3VP1A 2ZC7A 3HLFA 1VHMA 3FYZA 1ACFA 1DY6A 4ME4A 3G31A 4DE1A 3V39A 2I9VA 1TS7A 4OP8A 2L0WA 3T4KA 1KE0A 3T12B 3NC8A 5IHVA 4NKPA 1Y28A 4DE2A 1N9OA 3E98A 4EQ1A 4KENB 1HTZA 3IX4A 3PBTA 5E2HA 2J80A 2KLIA 3A0SA 1KVLA 3DTMA 1RGZA 5HL6A 5TGFA 4GN2A 5EE8A 4KZAA 1YMSA 3ITAA 2EX6A 1SKFA 1YLPA 1PZPA 5F68A 2PDRA 1YQSA 1MXOA 4KUKA 2ZC3B 3FKVA 4KZBA 4S2NA 2VGLM 4UEYA 4HP4A 4GW9A 3L9KA 4UQIS 1P0ZA 4FCFA 3TOIA 5DVAA 1UWNX 2XDMA 5J7EA 1DP6A 4C6YA 2H5SA 5J8XA 1E3UD 4Y17A 4CJNA 3GMWA 1WE4A 4HI4A 2JCHA 2Z2LB 4GOGA 5FA7A 2KOIA 3BRMA 4WL9A 4B93A 3MQQA 4S2IA 3HL9A 1IELA 2G2UA 1XGJA 3IXGA 3VFFA 1NXYA 2ZC4B 3F1PA 4RX2A 2ZQ7A 3VP0A 3C4OA 3O5YA 3EGDC 2VV8A 1FCMA 1EW0A 3PHYA 3T4JA 1K54A 1ZG4A 4WZ5C 2E8JA 2XRNA 3IF5A 3GSGA 2EX9A 2ZC6B 3P7NA 3FZCA 1OT6A 2Z6DA 4Y15A 4EUVA 2W1TB 4OH0A 3TG9A 5TBMA 2QPNA 3KYZA 2ZL1A 1MZUA 4CQHA 3KO6A 3WS4A 3OLOA 4BL2A 4S2KA 5LBRA 3E4OA 2JKTM 4FSFA 3ZGAB 4FTXA 5F1FA 3KSIA 4DN0A 2WAEA 4JLFA 2V1ZA 1YLJA 3M2KA 4CPKA 3Q1FA 5HWTA 2O9CA 3R7WA 4B88A 4E3LA 3W4PA 4I3AA 3SH8A 4E3JA 3ZHHA 3ZDJA 4OOYA 3HLWA 4OVDA 5M19A 5L2FA 1S4SA 1GSVA 3WS0A 2JKFA 5FATA 2V9AA 3D9YA 1TS0A 3WRZA 4ZTKA 4L0LA 2WKHA 1VEUA 1IFQA 2R78A 1BLCA 4H8RA 2WKPA 1XJ4A 4E3KA 3C5AA 3UO9A 1J9MA 1KGGA 5TJJA 1K4EA 4DDYA 4EBNA 4ETZA 4Q0HA 4CLCA 3H7WA 3MFDA 4KG5A 3K3DA 1LT0A 1ES3A 1IYPA 3RFBA 4MN5A 4IUKA 1SCWA 4R1GA 3LIAA 3C2WA 4S2NC 3A3FA 1XX2A 4GHIB 3OC2A 3T1QB 5AQBA 4H6JA 1S1YA 4LRZE 1KDSA 2WKQA 4P6BA 1P9RA 4PM6A 1YLZA 4XT2A 3UB5P 3BY8A 1KOUA 4LV3A 2BLSA 2OOLA 1GA0A 2QKPA 4KUOA 2XA7M 1LL5A 5EFWA 3A3JA 2VX8A 2O9AA 1MKMA 3KYEA 4LV0A 1OTAA 3N8RA 3LIBA 4LGWA 2K7SA 1D06A 4JF6A 4R3BA 2INWA 3O86A 5GHYA 4NXBA 2W3DA 2ZC5B 3LIEA 5L10A 5EM1A 2HDQA 4DF6A 3QP8A 2JBFA 1K54C 3S7NA 1I2SA 1N9NA 4L9GA 4ID4A 4ZDXA 4OOMA 1NJ4A 4P0MA 2IWBA 4NG2A 1GHPA 5L8MA 1NYYA 2H28A 3KSFA 4IEDA 3DTEA 4KZ6A 3UMDA 2JE5A 3MR0A 3VMAA 3E4QA 4U0TA 3BFGA 3BYDA 4EEPA 4Z1WA 5GLDA 5DF7A 3W2ZA 4WM9A 4NXGA 3ZVWA 3U4LP 2B02A 3W4QA 2DMWA 4S2MA 5HW3A 4HH3A 2XLNA 4GZBA 4OQGA 2B5RA 4GS9B 3S7QA 4ETXA 2WKRA 3EOIA 3JPUA 4JF5A 5DTKA 1PI4A 1ZG6A 3NOUC 4Q0JA 1KGEA 1LLBA 1OJ5A 3PBSA 2LB9A 3A3EA 1N4OA 3PXPA 4L9FA 4ESPA 3Q7ZA 3OPPA 1XFQA 2JHEA 5DTTA 3G35A 4R70A 3CZDA 4BBUA 1JTGA 4UAAA 2V2FF 1OTEA 4ARZB 1IKIA 1K6RA 1DP8A 2BASA 4S2LA 4I39A 4CLCC 3ZFZA 4LLOB 1EI5A 1MC0A 3ICYA 4R3AA 2VGLS 2EXBA 2PR6A 3UB7A 4PM9A 1FOFA 5FASA 4QB8A 3O87A 3WWXA 1FCNA 1YSPA 5HFOA 4CLCD 1BZAA 5BOHA 4P87A 1V9YA 3LR5A 5DTSA 3G6OA 3MMHA 3CPTB 2QMIA 3LUQA 5HPIA 5FAQA 1YLYA 5FAOA 4B4XA 2GZAA 3TE8A 4YWZA 4N92A 5FI7A 1SHVA 2PD8A 3CAXA 3IH8A 4GLQA 2V1BA 4P85A 5G4YA 2PRFA 2ZOIA 3HCYA 4JGRA 2P7JA 2OLUA 5F1GA 4X68A 5CHMA 1FR6A 3LCEA 5FQQA 4GDBA 2Y2LA 3HVFA 3AGDA 3IXBA 5AVEA 3W8KA 4JPMA 1ZTUA 3PTEA 5HDDA 4WBGA 2HGVA 4R0QA 5A90A 2XD1A 1ERQA 4E3OA 4XXRA 4XUXA 2Y2QA 5L07A 2OLVA 2WAFA 5L09A 4YFMA 3MBZA 4QU3A 2Y2MA 3PBOA 2Y2HA 4MEZA 1TDGA 4YNRA 4Y3IA 2PHYA 3BFCA 5HSQA 5FL3A 1S0WA 1N9LA 3TJZC 4OQHA 1QMFA 3V50A 3CITA 5A8BA 4OP5A 2DRWA 4PM7A 4HBUA 3CHWP 4GHIA 4JGOA 1T1BA 1DJAA 4HESA 3MSHA 5AQ9A 3OPLA 1YM1A 2W0NA 2GJ3A 5DFXA 4JGPA 4BENA 3BY9A 4YOFA 2ZJ9A 2DNSA 5C5KA 2XEPA 3IT9A 2VA0A 3VSKA 4N9LA 1K56A 5EVEA 3IBRA 2HDUA 1CEFA 3ZG9B 4OQIA 1KVMA 4PHTA 1ES4A 3WS2A 3LR0A 3RH8B 1LL8A 4BWIA 3MXSA 2EFXA 3VOZA 2HF6A 2RCXA 4OQ0A 4OPYA 3LFVA 1BYWA 4YINA 3OCLA 3FPVA 4EERA 1VM1A 1I2WA 3G32A 3UB6A 1W63Q 1LI9A 2H0YA 4BD0A 4KQQA 1OTBA 1Y4OA 4DMZA 3FKWA 1TS8A 3H82A 1T18A 5KSHA 4R6LA 1G6OA 4HHDA 2IWDA 2XA7S 3DW0A 1PWGA 4K0WA 4F3LB 1A0KA 5A91A 5TR7A 4WEKA 4E04A 4M3KA 4DXCA 4GDNA 1AWIA 1HVBA 5GL9A 1SZVA 5CTNA 4FH4A 4B9OA 4BMWA 2HJ9C 5HWVA 4MNRA 4AFIA 2FZ0A 4LRYC 5EECA 2FH5A 2QHKA 2X01A 1MWTA 3EQUA 2GNXA 5EV0A 5FQKA 3IXDA 1MBLA 5MC7A 3UPOA 2XROA 3HREA 4K0XA 1VETA 3PBNA 3UE1A 4ARZA 4Y0TA 4ZJ1A 3A3IA 3DWZA 5HD3A 4KG2A 4P6ZM 3ZNTA 5IU1A 2HJEA 1BUEA 1V9ZA 4RA7A 2Y2JA 5JYOA 4IBRA 2Y59A 1H3QA 4DE0A 4PAUA 3UPNA 2K31A 2ZQ9A 3M2JA 1XGIA 3C30A 3WS5A 4UA7A 1PNEA 4HY8A 5HDSA 4MCWA 3MQOA 2J3WA 5CHJA 1G5UA 3D4FA 5HL1A 1P9WA 3UDIA 2WGWA 1G6AA 2Y91A 3OZHA 3HLGA 4EV4A 4N9KA 5E2GA 4IVKA 1GHMA 1WA9A 5EVIB 4BBVA 4FH2A 4O0PA 4R3JA 3S7PA 2V0UA 4EU0A 1PRQA 1FILA 3T1XA 3S4XA 1MWRA 5EOEA 1IYOA 1K56D 3ULFA 5U47A 3C8CA 3CWFA 1TF1A 3LO7A 5DKKA 3S7OA 2YKHA 3G2YA 1Z6FA 2ZD8A 3KSGA 1PWCA 2R9WA 1YPRA 2ZM8A 4S2OA 2J9OA 1BT5A 2W3HA 1HLUP 2X02A 2XFTA 1SDEA 3L7HA 5F5YA 5F83A 3T4OA 4KQOA 3SS3A 3UPPA 2W3FA 5FDSA 4WYYA 2H10A 1SDNA 2VV7A 5DKLA 2XF3A 3N8SA 4Y13A 3S1YA 3IWIA 5DF9A 1IKGA 3BECA 2HP5A 2P9VA 3UDXA 2WYXA 4MN6A 3SW1A 4QD4A 5E43A 3DWKA 1TDLA 2UV0E 3CI6A 3QP2A 1ODVA 4D60A 3B33A 2JN7A 5CEDA 2A3UA 2V1AA 2W1RA 3SS5A 3ZQ5A 3Q7VA 4JXVA 3T4SA 4LV1A 2OSUA 1SKOB 4HJ6A 4KQRA 2VZWA 2EX8A 1NRJA 2ZMVA 5EPHA 2AVXA 1S66L 3E2KA 3QNCA 3W4OA 3HLBA 4WZ4A 2YKFA 4ZAMA 2OWJA 1YLWA 4GNUA 1C3BA 1EWZA 4CLCE 1XP4A 2J8YA 4QY6A 3OCNA 3IQAA 1XJ3A 2FFFB 4WELA 3ZG7B 4N1XA 1XJ6A 2Q9MA 2WZXA 3RXWA 2GX5A 5I94A 1JNUA 1MWUA 1J3WA 5K5BA 5F69A 3T4TA 4R4SA 3GQZA 1K57A 4PKYA 3UNWA 2CMNA 3NCKA 4ZBEA 4EBPA 1NZUA 4F3LA 1FIKA 3OOVA 2CC1A 1ZKJA 4MLLA 3IX3A 1UGUA 2EWWA 3V3SA 4OLDA 3LY3A 3N8LA 1IYSA 1K0KA 4X53A 5AQ7A 3SOIA 2IWCA 3QP5A 1Y54A 4UA6A 1H8MA 4BLMA 2V8CA 4BBTA 5CGSA 3GDIA 3KSHA 3ZG8B 5KSCA 2VV6A 1P97A 3MKEA 3G34A 2JC7A 2W27A 4JF4A 3DAVA 3QNBA 1TS6A 5KZHA 4WN5A 2EFUA 5GHZA 3IWOA 5G4ZA 2ZQDA 5JYPA 4HIAA 4PM5A 1E4DA 4MN7A 1GA9A 5CXWA 1IYQA 3ZCZA 1FQGA 1XKZA 1ES2A 3MFXA 4HQAA 3LGOA 1CI9A 3V67A 3UY6A 5EM0A 3FPWA 3NDEA 4QHCA 4DE3A 1IOUA 4WEJA 5HX9A 5HDCA 1TD5A 1JVJA 4X56A 3HLDA 1YMXA 3WS1A 2PU2A 3NHQA 2LB5A 4WUJA 5AJGA 3F1NB 2XD5A 3LIFA 3N4IA 4X25A 4HOIA 2NUPC 2L1MA 3LIDA 5CECA 2Y2PA 5CTMA 4FOFA 4R4RA 3VE3A 3A0VA 2I72A 1YKDA 1K4FA 1FCOA 2H0TA 3QP4A 3HLCA 4L9EA 3UB8A 4G3WA 4IJGA 3S22A 1S67L 5HARA 1FSYA 1KDWA 3BWLA 2OAQ1 5E2EA 3VP2A 2V20A 1YT4A 1RGYA 2W1TA 3NY4A 4P6ZS 2ZBBA 4WMCA 4DJ3A 3ZG0A 3PBQA 5KMWA 3IX8A 4LPZA 4MBKA 2UWXA 3NIAA 4MDZA 3KYQA 3E0YA 2VK3A 3U2AA 3N7WA 1K57C 1M6KA 1W63M 5G18A 1ERMA 3FWLA 2R9XA 2EA9A 4LCMA 3C7VA 2Q9NA 4K91A 2XFSA 1L0FA 1DJBA 3MQ0A 3CUEA 3VFHA 5FI6A 2C6WB 3P09A 2Y79A 2L4RA 3MZFA 2P74A 4R38A 1L0DA 1NY0A 3T1RA 1F98A 4JXGA 2D02A 3NJAA 4EQIA 2HV1A 1SKOA 3CG5A 3OPHA 3EEAA 2C5WB 2MJ6A 2WGIA 5TBMB 3GTCA 5DFYA 4EESA 2VEAA 3BLMA 3A0RA 4Y0UA 4MBFA 3G4PA 1W7FA 2W3EA 4N1HA 3BQAA 1S6RA 4KG6A 3PBRA 5FI2A 3C4PA 2EWVA 4EETB 1E3UA 3E2LA 1GHIA 2O9BA 5CERA 3IS2B 4G3VA 4E6WA 3AGFA 1W79A 3C7UA 3VE4A 2PBYA 3NBLA 1OTIA 2Y2GA 3HUOA 1W5DA 2V0WA 5CX7A 1D1JA 1K38A 3OPRA 5A92A 4HBTA 4LRXC 1JWVA 1OPXA 5FEFA 1Z09A 3CJMA 2HZ5A 4I3JA 2KDKA 2HDSA 2JKGA 4EEUA 4QWOA 1TVFA 4PKYG 4LV2A 4FUWA 2PT7A 2WKIA 2WADA 5CHUA 5FQIA 4CLCB 3QP6A 5FQJA 1NRFA 4JXWA 4LCLA 2JKRI 3AGEA 2Z2MB 5HAPA 5KIZA 2M7VA 5M1AA 5GLCA 2ZM0A 4H6JB 3GR2A 3NI9A 3UB9A 4D2OA 5TFQA 1CEGA 2Y2IA 4XT2B 1ES5A 1Q2QA 5HWWA 1K25A 4M4XA 4NXEA 4WMCD 4OPZA 5CGXA 3V5MA 1EROA 4GS9A 2ACGA 1BSGA 1BULA 1CK3A 5FQMA 3CLOA 2D01A 1VB6A 4DXBA 2A49A 5FSRA 3F1NA 1BLHA 4S2JA 1DRMA 1ONGA 4II7A 1XPBA 4JBFA 3CUEC 1W8QA 2XH9A 3VP3A 1NWZA 2G7UA 1U60A 2M1CA 2ZQ8A 2XR0A 3MKFA 3FV7A 2RL3A 4OPRA 3R4KA 2EXAA 4HJ3A 5HAIA 3IF6B 4QY5A 3UE3A 1KE4A 5CEBA 5AQAA 3I7JA 1NLYA 4NXFA 5IT5A 4X6TA 5HAQA 4EXOA 1MWSA 2ZM2A 4R23A 1FR1A 2P08A 1PW8A 5FQ9A 3LR4A 4ZRRA 2ZQAA 3CMZA 1XA1A 4C3QA 1GCEA 2Z6CA 4MMNA 3M6HA 2K2NA 3T50A 1T19A 3D72A 5GLBA 1CF0A 3UMEA 1DJCA 4DJ2A 3CPTA 4Z9QA 4BD1A 2XGNA 2QJ7A 3GVBA 3PYPA 3G30A 2M7UA 1XXMA 2B18A 2WK0A 4NK3A 1LHYA 3RTYA 4GD8A 2OV5A 4ZJ2A 1PWDA 3F1OB 2Y2OA 4DDSA 4RX3A 1H0MA 4IBXA 4E3MA 1M40A 2J9PA 1LL9A 4QPRA 3Q82A 3HLEA 2ZOHA 3T4LA 1H8ZA 3DBAA 4OOLA 4ZJ3A 3N6IA 2GDNA 2Y8HA 4E6XA 1KE3A 3E4PA 3MXQA 4B4ZA 4KQDA 4GD6A 2BTFP 1T1CA 5DF8A 2PYRA 3BQ8A 2EX2A 5F6AA 3VOYA 1RP5A 3Q81A 2PR5A 4EW7A 2PU4A 3ZG5A 4OKPA 4O01A 3K2NA 4PM8A 4RVAA 4UA9A 1NYMA 1YSQA 4Y5FA 3IS2A 4KZ4A 4GB7A 3Q07A 1F9IA 1PI5A 3FG8A 2ZMAA 4U3TA 5HZHA 1ZC2A 3MS6A 4WF0A 1O7EA 4KZ3A 3BFFA 3ZNYA 3EEHA 1X0OA 3MZEA 3SH9A 2QWSA 3IWQA 3RXXA 4KZ9A 2FFYA 3LICA 2WZZA 2J3TC 3C38A 3VOLA 1STZA 3G2ZA 4PPRA 3BEBA 4KZ8A 1PFLA 2PBDP 1MKIA 1S1ZA 2QJ5A 4BJPA 1YLTA 2VLGA 4XUZA 2V8FA 2QZ6A 2J3TD 4DRTA 4OLGA 3IBJA 5J3WA 1WYBA 4X55A 3NOPC 1NZOA 2Y4AA 1H8YA 4K08A 4O8GA 3QHYA 3HUNA 1T1AA 1OJGA 2KX6A 3T1SA 3LI9A 2W3GA 1BLPA 2HPBA 1G28A 2ZQCA 3LEZA 4G3KA 2VGJA 4LENA 1N9BA 1O07A 2A24B 1CQAA 2B95A 1BLSA 3B42A 1JWPA 4KZ7A 3PR6A 3JVUA 3EGXC 1F5MA 4EWFA 5GHXA 1ZHHB 3HBRA 4X1MA 3BLSA 3BFEA 4HEFA 1H5XA 3EQVA 3TRCA 5A93A 1K55A 3TW8A 2XQZA 3IF6A 5M18A 4Q8IA 1IEMA 2HDRA 3VP4A 3UDFA 1ESIA 4Y7PA 3JVVA 1W8YA 4PMAA 1HD8A 5DJTA 1GSWA 5HD5A 4NEED 3MXRA 3SZTA 1OT9A 1L0EA 1RCJA 4IHQA 2JKTI 3HJIA 1GSXA 4OONA 2XSSA 3H82B 4A5RA 3ZVTA 1K6SA 4UQIM 3HJKA 3T4QA 2J7VA 3LR3A 5EOOA 2HP9A 4RQ9A 5CGWA 5HPFA 4GKUA 3NULA 1PW1A 3ZYTA 4MBHA 4Y2FA 3UE0A 3RJUA 4GJ4A 1PIOA 1UWPX 3LEQA 1L3LA 3LI8A 4HNBA 4RYEA 4E3IA 4QJGA 4HH2A 4Y0OA 3V3RA 3IHAA 1NLZA 4I3IA 3UE6A 4O7DA 5EVIA 1CI8A 2QYBA 3KX0X 5E2FA 1VQQA 3F1OA 2WGVA 3BFDA 1XFNA 1G68A 1LSWA 1PYYA 3BJNA 1WYCA 5EUAA 3JYIA 5FAPA 1JTDA 1D7EA 1VETB 3DTKA 3VV4A 4X69A 2HP6A 2Q0OA 4I5SA 2JKRM 3FC7A 2PYPA 1PZOA 4HP9A 4JXSA 2VJWA 1AXBA 3B3XA 3NOTC 1CJFA 3BM6A 4S2PA 1MPLA 5FDHA 3H9WA 1ONHA 1L2SA 2OWHA 2ZMFA 1JWZA 1LSXA 2OAP1 2BG1A 4KZ5A 3O3VA 3DTIA 2PAVP 1XJ2A 2WGWB 3NDGA 3F1PB 3OBFA 3UN7A 2IA2A 3MJQA 5J4EA 1KGFA
chains in the Genus database with same CATH topology
1N9NA 4L9GA 4NXEA 2W3HA 5F5YA 4GS9A 3T4OA 4KQOA 2P04A 2W3FA 3CLOA 4OOMA 2D01A 1VB6A 2VV7A 5DKLA 3P01A 5L8MA 3F1NA 2H28A 1S4RA 2O0YA 1DRMA 3KSFA 4II7A 4JGQA 5DF9A 3CUEC 3EWKA 3UMDA 2A2LA 3MR0A 3E4QA 4GCZA 1NWZA 2G7UA 2M1CA 4EEPA 4Z1WA 4MN6A 3SW1A 3R4KA 4HJ3A 2PD7A 3W2ZA 3CI6A 4NXGA 3UE3A 1ODVA 4IUHA 3B33A 2JN7A 2B02A 2DMWA 2V1AA 2W1RA 4HH3A 5IS1A 1NLYA 4NXFA 3ZQ5A 5IT5A 4EXOA 3T4SA 4GS9B 3S7QA 1LSVA 2WKRA 3EOIA 4ETXA 2O99A 4HJ6A 2P08A 2VZWA 1NRJA 3NOUC 3LR4A 1DP9A 4ZRRA 4Q0JA 1OJ5A 3PBSA 2ZMVA 2LB9A 3R7WB 1S66L 3PXPA 4L9FA 2YKFA 3K3CA 4WLAA 1XFQA 2JHEA 2OWJA 2Z6CA 4MMNA 1OTDA 2K2NA 4R70A 4CLCE 3T50A 1T19A 3D72A 4BBUA 3OCNA 3LYXA 1XJ3A 2A24A 4HJ4A 4WELA 1OTEA 1XJ6A 4ARZB 3UMEA 1YAXA 4DJ2A 2GX5A 1DP8A 2BASA 3BW6A 4I39A 1JNUA 5AVFA 2QJ7A 4CLCC 3PYPA 4LLOB 5K5BA 2M7UA 2B18A 1MC0A 5F69A 3ICYA 4R3AA 2VGLS 3RTYA 3T4TA 3H7WB 2PR6A 4PKYA 3UB7A 2CMNA 4Q0IA 3F1OB 4F3LA 2VKSA 3OOVA 1YSPA 4CLCD 4QPRA 1UGUA 3B47A 2EWWA 1V9YA 2ZOHA 3LR5A 5DJUA 3T4LA 1H8MA 3G6OA 3MMHA 3DBAA 3D3OA 4OOLA 4BBTA 3GDIA 3LUQA 5HPIA 4I38A 2GZAA 3TE8A 3MF0A 2Y8HA 3KSHA 4YWZA 5I5LA 2VV6A 2PD8A 3E4PA 3CAXA 3MXQA 2V1BA 3GECA 4GLQA 5G4YA 1P97A 2ZOIA 3HCYA 4JGRA 2P7JA 4KQDA 2NUTC 2W27A 1T1CA 1TS6A 2PYRA 3BQ8A 4WN5A 5F6AA 1VHMA 5G4ZA 2PR5A 4ME4A 5AVEA 4HIAA 4EW7A 2I9VA 1TS7A 1ZTUA 4MN7A 2L0WA 4O01A 3T4KA 5HDDA 2HGVA 3K2NA 3MFXA 4NKPA 1Y28A 1N9OA 1YSQA 4HQAA 4Y5FA 3IS2A 3E98A 4EQ1A 3PBTA 3V67A 1F9IA 3FPWA 2J80A 1IOUA 3PBOA 3FG8A 2KLIA 3A0SA 4WEJA 5HDCA 1TD5A 5HZHA 4YNRA 4Y3IA 5HL6A 4WF0A 2PHYA 5HSQA 5FL3A 1N9LA 3NHQA 3TJZC 2LB5A 3EEHA 4WUJA 5AJGA 3CITA 5A8BA 3F1NB 5F68A 1X0OA 3LIFA 2PDRA 2QWSA 4HOIA 2NUPC 2L1MA 4GHIA 4JGOA 1T1BA 3LICA 4KUKA 3LIDA 2J3TC 3C38A 3VOLA 2VGLM 1STZA 4UEYA 4HP4A 4FOFA 4GW9A 3VE3A 2W0NA 2GJ3A 5DFXA 3A0VA 4JGPA 4UQIS 3BY9A 1YKDA 4YOFA 5C5KA 1P0ZA 1S1ZA 4L9EA 2QJ5A 1UWNX 2VA0A 3UB8A 4BJPA 4G3WA 5J7EA 2VLGA 1DP6A 3IBRA 4IJGA 1S67L 2J3TD 3IBJA 5J3WA 3BWLA 4PHTA 2OAQ1 3NOPC 4HI4A 4K08A 4O8GA 2W1TA 1T1AA 2KOIA 4WL9A 4B93A 1OJGA 2KX6A 3LR0A 3MQQA 3RH8B 3LI9A 4P6ZS 1LL8A 2W3GA 2ZBBA 4BWIA 4DJ3A 1G28A 3PBQA 3F1PA 4G3KA 2HF6A 4LPZA 2A24B 3LFVA 1BYWA 3FPVA 3OCLA 3O5YA 3B42A 4EERA 3EGDC 4MDZA 3KYQA 2VV8A 3E0YA 1EW0A 3PHYA 3PR6A 3JVUA 3EGXC 3U2AA 3T4JA 3UB6A 1F5MA 1W63Q 1ZHHB 2XRNA 1W63M 3P7NA 1OTBA 1OT6A 2Z6DA 4DMZA 1TS8A 4EUVA 2W1TB 3H82A 1T18A 3EQVA 5KSHA 4R6LA 1G6OA 2EA9A 5TBMA 3TRCA 4HHDA 3KYZA 1MZUA 4CQHA 3KO6A 2XA7S 4F3LB 3OLOA 3MQ0A 3CUEA 3TW8A 5LBRA 2Y79A 2L4RA 4WEKA 4E04A 3E4OA 2JKTM 4R38A 4FSFA 3JVVA 1F98A 5DJTA 2D02A 1GSWA 5HD5A 4NEED 3NJAA 1OT9A 2HV1A 4B9OA 3KSIA 4DN0A 4BMWA 2HJ9C 5HWVA 4IHQA 2JKTI 3EEAA 2FZ0A 3HJIA 4AFIA 4LRYC 1GSXA 2XSSA 3H82B 2MJ6A 2FH5A 5HWTA 5TBMB 2QHKA 2O9CA 5DFYA 3R7WA 4UQIM 3HJKA 4I3AA 3T4QA 4EESA 2VEAA 3LR3A 4RQ9A 3A0RA 5HPFA 3EQUA 2W3EA 3BQAA 1S4SA 3ZYTA 1GSVA 2GNXA 4Y2FA 3PBRA 2EWVA 5MC7A 2V9AA 4GJ4A 1TS0A 4EETB 2XROA 4L0LA 3PBNA 1IFQA 1UWPX 2O9BA 2R78A 4ARZA 3LI8A 2WKPA 4HNBA 3IS2B 4G3VA 1XJ4A 4HH2A 5HD3A 3VE4A 4P6ZM 1NLZA 4I3IA 3UE6A 5IU1A 5TJJA 1OTIA 2HJEA 4ETZA 4Q0HA 4CLCA 1V9ZA 2V0WA 3H7WA 5CX7A 2QYBA 3K3DA 3KX0X 1LT0A 3F1OA 1H3QA 4PAUA 3RFBA 1XFNA 2K31A 1LSWA 4MN5A 4LRXC 4IUKA 3C30A 3BJNA 3LIAA 3C2WA 4HY8A 1OPXA 5HDSA 4MCWA 4GHIB 3MQOA 3OC2A 4I3JA 2KDKA 4H6JA 2J3WA 1S1YA 4LRZE 1D7EA 2WKQA 1P9RA 3VV4A 4XT2A 3BY8A 4EEUA 1P9WA 1KOUA 4I5SA 2JKRM 2OOLA 4PKYG 2QKPA 4KUOA 2XA7M 5EFWA 2PT7A 1WA9A 2VX8A 2O9AA 4BBVA 4CLCB 3FC7A 1MKMA 2PYPA 4HP9A 4O0PA 2VJWA 3S7PA 3NOTC 2V0UA 1OTAA 4EU0A 3LIBA 2JKRI 2K7SA 3H9WA 1D06A 5KIZA 2M7VA 2OWHA 3ULFA 2INWA 3C8CA 4NXBA 3CWFA 1TF1A 2ZMFA 5DKKA 4H6JB 2W3DA 3S7OA 1LSXA 2OAP1 2YKHA 3LIEA 3UB9A 4XT2B 3KSGA 1XJ2A 3OBFA 3F1PB 2IA2A 3MJQA 5J4EA 3S7NA 5HWWA 4M4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B47 A;  3B42 A; 
#chains in the Genus database with same CATH topology
 1QME A;  2WKE A;  1ALQ A;  5F82 A;  2P04 A;  4BQM A;  1LI0 A;  3P01 A;  1S4R A;  2O0Y A;  4UHU A;  4JGQ A;  1BTL A;  1K55 C;  3EWK A;  2A2L A;  4DKI A;  4GCZ A;  2ZL1 B;  3IF6 C;  2G2W A;  3IXH A;  3A3D A;  2PD7 A;  1MY8 A;  3WRT A;  2Y2K A;  1F2K A;  4IUH A;  4NET A;  3HUM A;  3SH7 A;  5IS1 A;  2X71 A;  1E25 A;  4FD8 A;  2Y55 A;  1LSV A;  3M6B A;  3LY4 A;  2O99 A;  4EUZ A;  1TEM A;  3GV9 A;  3PAG A;  1DP9 A;  2Y2N A;  3VSL A;  3TSG A;  3R7W B;  4U0X A;  3SS4 A;  2P9V B;  3NEC A;  3IHB A;  3GRJ A;  3O88 A;  2E8I A;  1OME A;  3K3C A;  4WLA A;  4IVI A;  3QP1 A;  1OTD A;  2ZLY A;  3PAE A;  3LYX A;  3ITB A;  2A24 A;  4HJ4 A;  1FSW A;  1VEU B;  1ESU A;  4X1L A;  1YAX A;  3Q7V B;  5EVL A;  1Q2P A;  3BW6 A;  5EVI C;  5AVF A;  2WUQ A;  4E3N A;  4WZ5 A;  3H7W B;  2VGK A;  3P98 A;  5D3O A;  4Q0I A;  4EBL A;  2XK1 A;  1XA7 A;  2VKS A;  4BL3 A;  4JKT A;  1L0G A;  5GLA A;  5EVI D;  3MZD A;  3B47 A;  5FEG A;  1I5Q A;  2DCF A;  3IH9 A;  5DJU A;  5CRF A;  1HZO A;  3D3O A;  4F94 A;  4I38 A;  3MF0 A;  3ISG A;  5I5L A;  4OPQ A;  4C75 A;  3GEC A;  2NUT C;  4LFU A;  3VP1 A;  2ZC7 A;  3HLF A;  1VHM A;  3FYZ A;  1ACF A;  1DY6 A;  4ME4 A;  3G31 A;  4DE1 A;  3V39 A;  2I9V A;  1TS7 A;  4OP8 A;  2L0W A;  3T4K A;  1KE0 A;  3T12 B;  3NC8 A;  5IHV A;  4NKP A;  1Y28 A;  4DE2 A;  1N9O A;  3E98 A;  4EQ1 A;  4KEN B;  1HTZ A;  3IX4 A;  3PBT A;  5E2H A;  2J80 A;  2KLI A;  3A0S A;  1KVL A;  3DTM A;  1RGZ A;  5HL6 A;  5TGF A;  4GN2 A;  5EE8 A;  4KZA A;  1YMS A;  3ITA A;  2EX6 A;  1SKF A;  1YLP A;  1PZP A;  5F68 A;  2PDR A;  1YQS A;  1MXO A;  4KUK A;  2ZC3 B;  3FKV A;  4KZB A;  4S2N A;  2VGL M;  4UEY A;  4HP4 A;  4GW9 A;  3L9K A;  4UQI S;  1P0Z A;  4FCF A;  3TOI A;  5DVA A;  1UWN X;  2XDM A;  5J7E A;  1DP6 A;  4C6Y A;  2H5S A;  5J8X A;  1E3U D;  4Y17 A;  4CJN A;  3GMW A;  1WE4 A;  4HI4 A;  2JCH A;  2Z2L B;  4GOG A;  5FA7 A;  2KOI A;  3BRM A;  4WL9 A;  4B93 A;  3MQQ A;  4S2I A;  3HL9 A;  1IEL A;  2G2U A;  1XGJ A;  3IXG A;  3VFF A;  1NXY A;  2ZC4 B;  3F1P A;  4RX2 A;  2ZQ7 A;  3VP0 A;  3C4O A;  3O5Y A;  3EGD C;  2VV8 A;  1FCM A;  1EW0 A;  3PHY A;  3T4J A;  1K54 A;  1ZG4 A;  4WZ5 C;  2E8J A;  2XRN A;  3IF5 A;  3GSG A;  2EX9 A;  2ZC6 B;  3P7N A;  3FZC A;  1OT6 A;  2Z6D A;  4Y15 A;  4EUV A;  2W1T B;  4OH0 A;  3TG9 A;  5TBM A;  2QPN A;  3KYZ A;  2ZL1 A;  1MZU A;  4CQH A;  3KO6 A;  3WS4 A;  3OLO A;  4BL2 A;  4S2K A;  5LBR A;  3E4O A;  2JKT M;  4FSF A;  3ZGA B;  4FTX A;  5F1F A;  3KSI A;  4DN0 A;  2WAE A;  4JLF A;  2V1Z A;  1YLJ A;  3M2K A;  4CPK A;  3Q1F A;  5HWT A;  2O9C A;  3R7W A;  4B88 A;  4E3L A;  3W4P A;  4I3A A;  3SH8 A;  4E3J A;  3ZHH A;  3ZDJ A;  4OOY A;  3HLW A;  4OVD A;  5M19 A;  5L2F A;  1S4S A;  1GSV A;  3WS0 A;  2JKF A;  5FAT A;  2V9A A;  3D9Y A;  1TS0 A;  3WRZ A;  4ZTK A;  4L0L A;  2WKH A;  1VEU A;  1IFQ A;  2R78 A;  1BLC A;  4H8R A;  2WKP A;  1XJ4 A;  4E3K A;  3C5A A;  3UO9 A;  1J9M A;  1KGG A;  5TJJ A;  1K4E A;  4DDY A;  4EBN A;  4ETZ A;  4Q0H A;  4CLC A;  3H7W A;  3MFD A;  4KG5 A;  3K3D A;  1LT0 A;  1ES3 A;  1IYP A;  3RFB A;  4MN5 A;  4IUK A;  1SCW A;  4R1G A;  3LIA A;  3C2W A;  4S2N C;  3A3F A;  1XX2 A;  4GHI B;  3OC2 A;  3T1Q B;  5AQB A;  4H6J A;  1S1Y A;  4LRZ E;  1KDS A;  2WKQ A;  4P6B A;  1P9R A;  4PM6 A;  1YLZ A;  4XT2 A;  3UB5 P;  3BY8 A;  1KOU A;  4LV3 A;  2BLS A;  2OOL A;  1GA0 A;  2QKP A;  4KUO A;  2XA7 M;  1LL5 A;  5EFW A;  3A3J A;  2VX8 A;  2O9A A;  1MKM A;  3KYE A;  4LV0 A;  1OTA A;  3N8R A;  3LIB A;  4LGW A;  2K7S A;  1D06 A;  4JF6 A;  4R3B A;  2INW A;  3O86 A;  5GHY A;  4NXB A;  2W3D A;  2ZC5 B;  3LIE A;  5L10 A;  5EM1 A;  2HDQ A;  4DF6 A;  3QP8 A;  2JBF A;  1K54 C;  3S7N A;  1I2S A;  1N9N A;  4L9G A;  4ID4 A;  4ZDX A;  4OOM A;  1NJ4 A;  4P0M A;  2IWB A;  4NG2 A;  1GHP A;  5L8M A;  1NYY A;  2H28 A;  3KSF A;  4IED A;  3DTE A;  4KZ6 A;  3UMD A;  2JE5 A;  3MR0 A;  3VMA A;  3E4Q A;  4U0T A;  3BFG A;  3BYD A;  4EEP A;  4Z1W A;  5GLD A;  5DF7 A;  3W2Z A;  4WM9 A;  4NXG A;  3ZVW A;  3U4L P;  2B02 A;  3W4Q A;  2DMW A;  4S2M A;  5HW3 A;  4HH3 A;  2XLN A;  4GZB A;  4OQG A;  2B5R A;  4GS9 B;  3S7Q A;  4ETX A;  2WKR A;  3EOI A;  3JPU A;  4JF5 A;  5DTK A;  1PI4 A;  1ZG6 A;  3NOU C;  4Q0J A;  1KGE A;  1LLB A;  1OJ5 A;  3PBS A;  2LB9 A;  3A3E A;  1N4O A;  3PXP A;  4L9F A;  4ESP A;  3Q7Z A;  3OPP A;  1XFQ A;  2JHE A;  5DTT A;  3G35 A;  4R70 A;  3CZD A;  4BBU A;  1JTG A;  4UAA A;  2V2F F;  1OTE A;  4ARZ B;  1IKI A;  1K6R A;  1DP8 A;  2BAS A;  4S2L A;  4I39 A;  4CLC C;  3ZFZ A;  4LLO B;  1EI5 A;  1MC0 A;  3ICY A;  4R3A A;  2VGL S;  2EXB A;  2PR6 A;  3UB7 A;  4PM9 A;  1FOF A;  5FAS A;  4QB8 A;  3O87 A;  3WWX A;  1FCN A;  1YSP A;  5HFO A;  4CLC D;  1BZA A;  5BOH A;  4P87 A;  1V9Y A;  3LR5 A;  5DTS A;  3G6O A;  3MMH A;  3CPT B;  2QMI A;  3LUQ A;  5HPI A;  5FAQ A;  1YLY A;  5FAO A;  4B4X A;  2GZA A;  3TE8 A;  4YWZ A;  4N92 A;  5FI7 A;  1SHV A;  2PD8 A;  3CAX A;  3IH8 A;  4GLQ A;  2V1B A;  4P85 A;  5G4Y A;  2PRF A;  2ZOI A;  3HCY A;  4JGR A;  2P7J A;  2OLU A;  5F1G A;  4X68 A;  5CHM A;  1FR6 A;  3LCE A;  5FQQ A;  4GDB A;  2Y2L A;  3HVF A;  3AGD A;  3IXB A;  5AVE A;  3W8K A;  4JPM A;  1ZTU A;  3PTE A;  5HDD A;  4WBG A;  2HGV A;  4R0Q A;  5A90 A;  2XD1 A;  1ERQ A;  4E3O A;  4XXR A;  4XUX A;  2Y2Q A;  5L07 A;  2OLV A;  2WAF A;  5L09 A;  4YFM A;  3MBZ A;  4QU3 A;  2Y2M A;  3PBO A;  2Y2H A;  4MEZ A;  1TDG A;  4YNR A;  4Y3I A;  2PHY A;  3BFC A;  5HSQ A;  5FL3 A;  1S0W A;  1N9L A;  3TJZ C;  4OQH A;  1QMF A;  3V50 A;  3CIT A;  5A8B A;  4OP5 A;  2DRW A;  4PM7 A;  4HBU A;  3CHW P;  4GHI A;  4JGO A;  1T1B A;  1DJA A;  4HES A;  3MSH A;  5AQ9 A;  3OPL A;  1YM1 A;  2W0N A;  2GJ3 A;  5DFX A;  4JGP A;  4BEN A;  3BY9 A;  4YOF A;  2ZJ9 A;  2DNS A;  5C5K A;  2XEP A;  3IT9 A;  2VA0 A;  3VSK A;  4N9L A;  1K56 A;  5EVE A;  3IBR A;  2HDU A;  1CEF A;  3ZG9 B;  4OQI A;  1KVM A;  4PHT A;  1ES4 A;  3WS2 A;  3LR0 A;  3RH8 B;  1LL8 A;  4BWI A;  3MXS A;  2EFX A;  3VOZ A;  2HF6 A;  2RCX A;  4OQ0 A;  4OPY A;  3LFV A;  1BYW A;  4YIN A;  3OCL A;  3FPV A;  4EER A;  1VM1 A;  1I2W A;  3G32 A;  3UB6 A;  1W63 Q;  1LI9 A;  2H0Y A;  4BD0 A;  4KQQ A;  1OTB A;  1Y4O A;  4DMZ A;  3FKW A;  1TS8 A;  3H82 A;  1T18 A;  5KSH A;  4R6L A;  1G6O A;  4HHD A;  2IWD A;  2XA7 S;  3DW0 A;  1PWG A;  4K0W A;  4F3L B;  1A0K A;  5A91 A;  5TR7 A;  4WEK A;  4E04 A;  4M3K A;  4DXC A;  4GDN A;  1AWI A;  1HVB A;  5GL9 A;  1SZV A;  5CTN A;  4FH4 A;  4B9O A;  4BMW A;  2HJ9 C;  5HWV A;  4MNR A;  4AFI A;  2FZ0 A;  4LRY C;  5EEC A;  2FH5 A;  2QHK A;  2X01 A;  1MWT A;  3EQU A;  2GNX A;  5EV0 A;  5FQK A;  3IXD A;  1MBL A;  5MC7 A;  3UPO A;  2XRO A;  3HRE A;  4K0X A;  1VET A;  3PBN A;  3UE1 A;  4ARZ A;  4Y0T A;  4ZJ1 A;  3A3I A;  3DWZ A;  5HD3 A;  4KG2 A;  4P6Z M;  3ZNT A;  5IU1 A;  2HJE A;  1BUE A;  1V9Z A;  4RA7 A;  2Y2J A;  5JYO A;  4IBR A;  2Y59 A;  1H3Q A;  4DE0 A;  4PAU A;  3UPN A;  2K31 A;  2ZQ9 A;  3M2J A;  1XGI A;  3C30 A;  3WS5 A;  4UA7 A;  1PNE A;  4HY8 A;  5HDS A;  4MCW A;  3MQO A;  2J3W A;  5CHJ A;  1G5U A;  3D4F A;  5HL1 A;  1P9W A;  3UDI A;  2WGW A;  1G6A A;  2Y91 A;  3OZH A;  3HLG A;  4EV4 A;  4N9K A;  5E2G A;  4IVK A;  1GHM A;  1WA9 A;  5EVI B;  4BBV A;  4FH2 A;  4O0P A;  4R3J A;  3S7P A;  2V0U A;  4EU0 A;  1PRQ A;  1FIL A;  3T1X A;  3S4X A;  1MWR A;  5EOE A;  1IYO A;  1K56 D;  3ULF A;  5U47 A;  3C8C A;  3CWF A;  1TF1 A;  3LO7 A;  5DKK A;  3S7O A;  2YKH A;  3G2Y A;  1Z6F A;  2ZD8 A;  3KSG A;  1PWC A;  2R9W A;  1YPR A;  2ZM8 A;  4S2O A;  2J9O A;  1BT5 A;  2W3H A;  1HLU P;  2X02 A;  2XFT A;  1SDE A;  3L7H A;  5F5Y A;  5F83 A;  3T4O A;  4KQO A;  3SS3 A;  3UPP A;  2W3F A;  5FDS A;  4WYY A;  2H10 A;  1SDN A;  2VV7 A;  5DKL A;  2XF3 A;  3N8S A;  4Y13 A;  3S1Y A;  3IWI A;  5DF9 A;  1IKG A;  3BEC A;  2HP5 A;  2P9V A;  3UDX A;  2WYX A;  4MN6 A;  3SW1 A;  4QD4 A;  5E43 A;  3DWK A;  1TDL A;  2UV0 E;  3CI6 A;  3QP2 A;  1ODV A;  4D60 A;  3B33 A;  2JN7 A;  5CED A;  2A3U A;  2V1A A;  2W1R A;  3SS5 A;  3ZQ5 A;  3Q7V A;  4JXV A;  3T4S A;  4LV1 A;  2OSU A;  1SKO B;  4HJ6 A;  4KQR A;  2VZW A;  2EX8 A;  1NRJ A;  2ZMV A;  5EPH A;  2AVX A;  1S66 L;  3E2K A;  3QNC A;  3W4O A;  3HLB A;  4WZ4 A;  2YKF A;  4ZAM A;  2OWJ A;  1YLW A;  4GNU A;  1C3B A;  1EWZ A;  4CLC E;  1XP4 A;  2J8Y A;  4QY6 A;  3OCN A;  3IQA A;  1XJ3 A;  2FFF B;  4WEL A;  3ZG7 B;  4N1X A;  1XJ6 A;  2Q9M A;  2WZX A;  3RXW A;  2GX5 A;  5I94 A;  1JNU A;  1MWU A;  1J3W A;  5K5B A;  5F69 A;  3T4T A;  4R4S A;  3GQZ A;  1K57 A;  4PKY A;  3UNW A;  2CMN A;  3NCK A;  4ZBE A;  4EBP A;  1NZU A;  4F3L A;  1FIK A;  3OOV A;  2CC1 A;  1ZKJ A;  4MLL A;  3IX3 A;  1UGU A;  2EWW A;  3V3S A;  4OLD A;  3LY3 A;  3N8L A;  1IYS A;  1K0K A;  4X53 A;  5AQ7 A;  3SOI A;  2IWC A;  3QP5 A;  1Y54 A;  4UA6 A;  1H8M A;  4BLM A;  2V8C A;  4BBT A;  5CGS A;  3GDI A;  3KSH A;  3ZG8 B;  5KSC A;  2VV6 A;  1P97 A;  3MKE A;  3G34 A;  2JC7 A;  2W27 A;  4JF4 A;  3DAV A;  3QNB A;  1TS6 A;  5KZH A;  4WN5 A;  2EFU A;  5GHZ A;  3IWO A;  5G4Z A;  2ZQD A;  5JYP A;  4HIA A;  4PM5 A;  1E4D A;  4MN7 A;  1GA9 A;  5CXW A;  1IYQ A;  3ZCZ A;  1FQG A;  1XKZ A;  1ES2 A;  3MFX A;  4HQA A;  3LGO A;  1CI9 A;  3V67 A;  3UY6 A;  5EM0 A;  3FPW A;  3NDE A;  4QHC A;  4DE3 A;  1IOU A;  4WEJ A;  5HX9 A;  5HDC A;  1TD5 A;  1JVJ A;  4X56 A;  3HLD A;  1YMX A;  3WS1 A;  2PU2 A;  3NHQ A;  2LB5 A;  4WUJ A;  5AJG A;  3F1N B;  2XD5 A;  3LIF A;  3N4I A;  4X25 A;  4HOI A;  2NUP C;  2L1M A;  3LID A;  5CEC A;  2Y2P A;  5CTM A;  4FOF A;  4R4R A;  3VE3 A;  3A0V A;  2I72 A;  1YKD A;  1K4F A;  1FCO A;  2H0T A;  3QP4 A;  3HLC A;  4L9E A;  3UB8 A;  4G3W A;  4IJG A;  3S22 A;  1S67 L;  5HAR A;  1FSY A;  1KDW A;  3BWL A;  2OAQ 1;  5E2E A;  3VP2 A;  2V20 A;  1YT4 A;  1RGY A;  2W1T A;  3NY4 A;  4P6Z S;  2ZBB A;  4WMC A;  4DJ3 A;  3ZG0 A;  3PBQ A;  5KMW A;  3IX8 A;  4LPZ A;  4MBK A;  2UWX A;  3NIA A;  4MDZ A;  3KYQ A;  3E0Y A;  2VK3 A;  3U2A A;  3N7W A;  1K57 C;  1M6K A;  1W63 M;  5G18 A;  1ERM A;  3FWL A;  2R9X A;  2EA9 A;  4LCM A;  3C7V A;  2Q9N A;  4K91 A;  2XFS A;  1L0F A;  1DJB A;  3MQ0 A;  3CUE A;  3VFH A;  5FI6 A;  2C6W B;  3P09 A;  2Y79 A;  2L4R A;  3MZF A;  2P74 A;  4R38 A;  1L0D A;  1NY0 A;  3T1R A;  1F98 A;  4JXG A;  2D02 A;  3NJA A;  4EQI A;  2HV1 A;  1SKO A;  3CG5 A;  3OPH A;  3EEA A;  2C5W B;  2MJ6 A;  2WGI A;  5TBM B;  3GTC A;  5DFY A;  4EES A;  2VEA A;  3BLM A;  3A0R A;  4Y0U A;  4MBF A;  3G4P A;  1W7F A;  2W3E A;  4N1H A;  3BQA A;  1S6R A;  4KG6 A;  3PBR A;  5FI2 A;  3C4P A;  2EWV A;  4EET B;  1E3U A;  3E2L A;  1GHI A;  2O9B A;  5CER A;  3IS2 B;  4G3V A;  4E6W A;  3AGF A;  1W79 A;  3C7U A;  3VE4 A;  2PBY A;  3NBL A;  1OTI A;  2Y2G A;  3HUO A;  1W5D A;  2V0W A;  5CX7 A;  1D1J A;  1K38 A;  3OPR A;  5A92 A;  4HBT A;  4LRX C;  1JWV A;  1OPX A;  5FEF A;  1Z09 A;  3CJM A;  2HZ5 A;  4I3J A;  2KDK A;  2HDS A;  2JKG A;  4EEU A;  4QWO A;  1TVF A;  4PKY G;  4LV2 A;  4FUW A;  2PT7 A;  2WKI A;  2WAD A;  5CHU A;  5FQI A;  4CLC B;  3QP6 A;  5FQJ A;  1NRF A;  4JXW A;  4LCL A;  2JKR I;  3AGE A;  2Z2M B;  5HAP A;  5KIZ A;  2M7V A;  5M1A A;  5GLC A;  2ZM0 A;  4H6J B;  3GR2 A;  3NI9 A;  3UB9 A;  4D2O A;  5TFQ A;  1CEG A;  2Y2I A;  4XT2 B;  1ES5 A;  1Q2Q A;  5HWW A;  1K25 A;  4M4X A;  4NXE A;  4WMC D;  4OPZ A;  5CGX A;  3V5M A;  1ERO A;  4GS9 A;  2ACG A;  1BSG A;  1BUL A;  1CK3 A;  5FQM A;  3CLO A;  2D01 A;  1VB6 A;  4DXB A;  2A49 A;  5FSR A;  3F1N A;  1BLH A;  4S2J A;  1DRM A;  1ONG A;  4II7 A;  1XPB A;  4JBF A;  3CUE C;  1W8Q A;  2XH9 A;  3VP3 A;  1NWZ A;  2G7U A;  1U60 A;  2M1C A;  2ZQ8 A;  2XR0 A;  3MKF A;  3FV7 A;  2RL3 A;  4OPR A;  3R4K A;  2EXA A;  4HJ3 A;  5HAI A;  3IF6 B;  4QY5 A;  3UE3 A;  1KE4 A;  5CEB A;  5AQA A;  3I7J A;  1NLY A;  4NXF A;  5IT5 A;  4X6T A;  5HAQ A;  4EXO A;  1MWS A;  2ZM2 A;  4R23 A;  1FR1 A;  2P08 A;  1PW8 A;  5FQ9 A;  3LR4 A;  4ZRR A;  2ZQA A;  3CMZ A;  1XA1 A;  4C3Q A;  1GCE A;  2Z6C A;  4MMN A;  3M6H A;  2K2N A;  3T50 A;  1T19 A;  3D72 A;  5GLB A;  1CF0 A;  3UME A;  1DJC A;  4DJ2 A;  3CPT A;  4Z9Q A;  4BD1 A;  2XGN A;  2QJ7 A;  3GVB A;  3PYP A;  3G30 A;  2M7U A;  1XXM A;  2B18 A;  2WK0 A;  4NK3 A;  1LHY A;  3RTY A;  4GD8 A;  2OV5 A;  4ZJ2 A;  1PWD A;  3F1O B;  2Y2O A;  4DDS A;  4RX3 A;  1H0M A;  4IBX A;  4E3M A;  1M40 A;  2J9P A;  1LL9 A;  4QPR A;  3Q82 A;  3HLE A;  2ZOH A;  3T4L A;  1H8Z A;  3DBA A;  4OOL A;  4ZJ3 A;  3N6I A;  2GDN A;  2Y8H A;  4E6X A;  1KE3 A;  3E4P A;  3MXQ A;  4B4Z A;  4KQD A;  4GD6 A;  2BTF P;  1T1C A;  5DF8 A;  2PYR A;  3BQ8 A;  2EX2 A;  5F6A A;  3VOY A;  1RP5 A;  3Q81 A;  2PR5 A;  4EW7 A;  2PU4 A;  3ZG5 A;  4OKP A;  4O01 A;  3K2N A;  4PM8 A;  4RVA A;  4UA9 A;  1NYM A;  1YSQ A;  4Y5F A;  3IS2 A;  4KZ4 A;  4GB7 A;  3Q07 A;  1F9I A;  1PI5 A;  3FG8 A;  2ZMA A;  4U3T A;  5HZH A;  1ZC2 A;  3MS6 A;  4WF0 A;  1O7E A;  4KZ3 A;  3BFF A;  3ZNY A;  3EEH A;  1X0O A;  3MZE A;  3SH9 A;  2QWS A;  3IWQ A;  3RXX A;  4KZ9 A;  2FFY A;  3LIC A;  2WZZ A;  2J3T C;  3C38 A;  3VOL A;  1STZ A;  3G2Z A;  4PPR A;  3BEB A;  4KZ8 A;  1PFL A;  2PBD P;  1MKI A;  1S1Z A;  2QJ5 A;  4BJP A;  1YLT A;  2VLG A;  4XUZ A;  2V8F A;  2QZ6 A;  2J3T D;  4DRT A;  4OLG A;  3IBJ A;  5J3W A;  1WYB A;  4X55 A;  3NOP C;  1NZO A;  2Y4A A;  1H8Y A;  4K08 A;  4O8G A;  3QHY A;  3HUN A;  1T1A A;  1OJG A;  2KX6 A;  3T1S A;  3LI9 A;  2W3G A;  1BLP A;  2HPB A;  1G28 A;  2ZQC A;  3LEZ A;  4G3K A;  2VGJ A;  4LEN A;  1N9B A;  1O07 A;  2A24 B;  1CQA A;  2B95 A;  1BLS A;  3B42 A;  1JWP A;  4KZ7 A;  3PR6 A;  3JVU A;  3EGX C;  1F5M A;  4EWF A;  5GHX A;  1ZHH B;  3HBR A;  4X1M A;  3BLS A;  3BFE A;  4HEF A;  1H5X A;  3EQV A;  3TRC A;  5A93 A;  1K55 A;  3TW8 A;  2XQZ A;  3IF6 A;  5M18 A;  4Q8I A;  1IEM A;  2HDR A;  3VP4 A;  3UDF A;  1ESI A;  4Y7P A;  3JVV A;  1W8Y A;  4PMA A;  1HD8 A;  5DJT A;  1GSW A;  5HD5 A;  4NEE D;  3MXR A;  3SZT A;  1OT9 A;  1L0E A;  1RCJ A;  4IHQ A;  2JKT I;  3HJI A;  1GSX A;  4OON A;  2XSS A;  3H82 B;  4A5R A;  3ZVT A;  1K6S A;  4UQI M;  3HJK A;  3T4Q A;  2J7V A;  3LR3 A;  5EOO A;  2HP9 A;  4RQ9 A;  5CGW A;  5HPF A;  4GKU A;  3NUL A;  1PW1 A;  3ZYT A;  4MBH A;  4Y2F A;  3UE0 A;  3RJU A;  4GJ4 A;  1PIO A;  1UWP X;  3LEQ A;  1L3L A;  3LI8 A;  4HNB A;  4RYE A;  4E3I A;  4QJG A;  4HH2 A;  4Y0O A;  3V3R A;  3IHA A;  1NLZ A;  4I3I A;  3UE6 A;  4O7D A;  5EVI A;  1CI8 A;  2QYB A;  3KX0 X;  5E2F A;  1VQQ A;  3F1O A;  2WGV A;  3BFD A;  1XFN A;  1G68 A;  1LSW A;  1PYY A;  3BJN A;  1WYC A;  5EUA A;  3JYI A;  5FAP A;  1JTD A;  1D7E A;  1VET B;  3DTK A;  3VV4 A;  4X69 A;  2HP6 A;  2Q0O A;  4I5S A;  2JKR M;  3FC7 A;  2PYP A;  1PZO A;  4HP9 A;  4JXS A;  2VJW A;  1AXB A;  3B3X A;  3NOT C;  1CJF A;  3BM6 A;  4S2P A;  1MPL A;  5FDH A;  3H9W A;  1ONH A;  1L2S A;  2OWH A;  2ZMF A;  1JWZ A;  1LSX A;  2OAP 1;  2BG1 A;  4KZ5 A;  3O3V A;  3DTI A;  2PAV P;  1XJ2 A;  2WGW B;  3NDG A;  3F1P B;  3OBF A;  3UN7 A;  2IA2 A;  3MJQ A;  5J4E A;  1KGF A; 
#chains in the Genus database with same CATH homology
 1N9N A;  4L9G A;  4NXE A;  2W3H A;  5F5Y A;  4GS9 A;  3T4O A;  4KQO A;  2P04 A;  2W3F A;  3CLO A;  4OOM A;  2D01 A;  1VB6 A;  2VV7 A;  5DKL A;  3P01 A;  5L8M A;  3F1N A;  2H28 A;  1S4R A;  2O0Y A;  1DRM A;  3KSF A;  4II7 A;  4JGQ A;  5DF9 A;  3CUE C;  3EWK A;  3UMD A;  2A2L A;  3MR0 A;  3E4Q A;  4GCZ A;  1NWZ A;  2G7U A;  2M1C A;  4EEP A;  4Z1W A;  4MN6 A;  3SW1 A;  3R4K A;  4HJ3 A;  2PD7 A;  3W2Z A;  3CI6 A;  4NXG A;  3UE3 A;  1ODV A;  4IUH A;  3B33 A;  2JN7 A;  2B02 A;  2DMW A;  2V1A A;  2W1R A;  4HH3 A;  5IS1 A;  1NLY A;  4NXF A;  3ZQ5 A;  5IT5 A;  4EXO A;  3T4S A;  4GS9 B;  3S7Q A;  1LSV A;  2WKR A;  3EOI A;  4ETX A;  2O99 A;  4HJ6 A;  2P08 A;  2VZW A;  1NRJ A;  3NOU C;  3LR4 A;  1DP9 A;  4ZRR A;  4Q0J A;  1OJ5 A;  3PBS A;  2ZMV A;  2LB9 A;  3R7W B;  1S66 L;  3PXP A;  4L9F A;  2YKF A;  3K3C A;  4WLA A;  1XFQ A;  2JHE A;  2OWJ A;  2Z6C A;  4MMN A;  1OTD A;  2K2N A;  4R70 A;  4CLC E;  3T50 A;  1T19 A;  3D72 A;  4BBU A;  3OCN A;  3LYX A;  1XJ3 A;  2A24 A;  4HJ4 A;  4WEL A;  1OTE A;  1XJ6 A;  4ARZ B;  3UME A;  1YAX A;  4DJ2 A;  2GX5 A;  1DP8 A;  2BAS A;  3BW6 A;  4I39 A;  1JNU A;  5AVF A;  2QJ7 A;  4CLC C;  3PYP A;  4LLO B;  5K5B A;  2M7U A;  2B18 A;  1MC0 A;  5F69 A;  3ICY A;  4R3A A;  2VGL S;  3RTY A;  3T4T A;  3H7W B;  2PR6 A;  4PKY A;  3UB7 A;  2CMN A;  4Q0I A;  3F1O B;  4F3L A;  2VKS A;  3OOV A;  1YSP A;  4CLC D;  4QPR A;  1UGU A;  3B47 A;  2EWW A;  1V9Y A;  2ZOH A;  3LR5 A;  5DJU A;  3T4L A;  1H8M A;  3G6O A;  3MMH A;  3DBA A;  3D3O A;  4OOL A;  4BBT A;  3GDI A;  3LUQ A;  5HPI A;  4I38 A;  2GZA A;  3TE8 A;  3MF0 A;  2Y8H A;  3KSH A;  4YWZ A;  5I5L A;  2VV6 A;  2PD8 A;  3E4P A;  3CAX A;  3MXQ A;  2V1B A;  3GEC A;  4GLQ A;  5G4Y A;  1P97 A;  2ZOI A;  3HCY A;  4JGR A;  2P7J A;  4KQD A;  2NUT C;  2W27 A;  1T1C A;  1TS6 A;  2PYR A;  3BQ8 A;  4WN5 A;  5F6A A;  1VHM A;  5G4Z A;  2PR5 A;  4ME4 A;  5AVE A;  4HIA A;  4EW7 A;  2I9V A;  1TS7 A;  1ZTU A;  4MN7 A;  2L0W A;  4O01 A;  3T4K A;  5HDD A;  2HGV A;  3K2N A;  3MFX A;  4NKP A;  1Y28 A;  1N9O A;  1YSQ A;  4HQA A;  4Y5F A;  3IS2 A;  3E98 A;  4EQ1 A;  3PBT A;  3V67 A;  1F9I A;  3FPW A;  2J80 A;  1IOU A;  3PBO A;  3FG8 A;  2KLI A;  3A0S A;  4WEJ A;  5HDC A;  1TD5 A;  5HZH A;  4YNR A;  4Y3I A;  5HL6 A;  4WF0 A;  2PHY A;  5HSQ A;  5FL3 A;  1N9L A;  3NHQ A;  3TJZ C;  2LB5 A;  3EEH A;  4WUJ A;  5AJG A;  3CIT A;  5A8B A;  3F1N B;  5F68 A;  1X0O A;  3LIF A;  2PDR A;  2QWS A;  4HOI A;  2NUP C;  2L1M A;  4GHI A;  4JGO A;  1T1B A;  3LIC A;  4KUK A;  3LID A;  2J3T C;  3C38 A;  3VOL A;  2VGL M;  1STZ A;  4UEY A;  4HP4 A;  4FOF A;  4GW9 A;  3VE3 A;  2W0N A;  2GJ3 A;  5DFX A;  3A0V A;  4JGP A;  4UQI S;  3BY9 A;  1YKD A;  4YOF A;  5C5K A;  1P0Z A;  1S1Z A;  4L9E A;  2QJ5 A;  1UWN X;  2VA0 A;  3UB8 A;  4BJP A;  4G3W A;  5J7E A;  2VLG A;  1DP6 A;  3IBR A;  4IJG A;  1S67 L;  2J3T D;  3IBJ A;  5J3W A;  3BWL A;  4PHT A;  2OAQ 1;  3NOP C;  4HI4 A;  4K08 A;  4O8G A;  2W1T A;  1T1A A;  2KOI A;  4WL9 A;  4B93 A;  1OJG A;  2KX6 A;  3LR0 A;  3MQQ A;  3RH8 B;  3LI9 A;  4P6Z S;  1LL8 A;  2W3G A;  2ZBB A;  4BWI A;  4DJ3 A;  1G28 A;  3PBQ A;  3F1P A;  4G3K A;  2HF6 A;  4LPZ A;  2A24 B;  3LFV A;  1BYW A;  3FPV A;  3OCL A;  3O5Y A;  3B42 A;  4EER A;  3EGD C;  4MDZ A;  3KYQ A;  2VV8 A;  3E0Y A;  1EW0 A;  3PHY A;  3PR6 A;  3JVU A;  3EGX C;  3U2A A;  3T4J A;  3UB6 A;  1F5M A;  1W63 Q;  1ZHH B;  2XRN A;  1W63 M;  3P7N A;  1OTB A;  1OT6 A;  2Z6D A;  4DMZ A;  1TS8 A;  4EUV A;  2W1T B;  3H82 A;  1T18 A;  3EQV A;  5KSH A;  4R6L A;  1G6O A;  2EA9 A;  5TBM A;  3TRC A;  4HHD A;  3KYZ A;  1MZU A;  4CQH A;  3KO6 A;  2XA7 S;  4F3L B;  3OLO A;  3MQ0 A;  3CUE A;  3TW8 A;  5LBR A;  2Y79 A;  2L4R A;  4WEK A;  4E04 A;  3E4O A;  2JKT M;  4R38 A;  4FSF A;  3JVV A;  1F98 A;  5DJT A;  2D02 A;  1GSW A;  5HD5 A;  4NEE D;  3NJA A;  1OT9 A;  2HV1 A;  4B9O A;  3KSI A;  4DN0 A;  4BMW A;  2HJ9 C;  5HWV A;  4IHQ A;  2JKT I;  3EEA A;  2FZ0 A;  3HJI A;  4AFI A;  4LRY C;  1GSX A;  2XSS A;  3H82 B;  2MJ6 A;  2FH5 A;  5HWT A;  5TBM B;  2QHK A;  2O9C A;  5DFY A;  3R7W A;  4UQI M;  3HJK A;  4I3A A;  3T4Q A;  4EES A;  2VEA A;  3LR3 A;  4RQ9 A;  3A0R A;  5HPF A;  3EQU A;  2W3E A;  3BQA A;  1S4S A;  3ZYT A;  1GSV A;  2GNX A;  4Y2F A;  3PBR A;  2EWV A;  5MC7 A;  2V9A A;  4GJ4 A;  1TS0 A;  4EET B;  2XRO A;  4L0L A;  3PBN A;  1IFQ A;  1UWP X;  2O9B A;  2R78 A;  4ARZ A;  3LI8 A;  2WKP A;  4HNB A;  3IS2 B;  4G3V A;  1XJ4 A;  4HH2 A;  5HD3 A;  3VE4 A;  4P6Z M;  1NLZ A;  4I3I A;  3UE6 A;  5IU1 A;  5TJJ A;  1OTI A;  2HJE A;  4ETZ A;  4Q0H A;  4CLC A;  1V9Z A;  2V0W A;  3H7W A;  5CX7 A;  2QYB A;  3K3D A;  3KX0 X;  1LT0 A;  3F1O A;  1H3Q A;  4PAU A;  3RFB A;  1XFN A;  2K31 A;  1LSW A;  4MN5 A;  4LRX C;  4IUK A;  3C30 A;  3BJN A;  3LIA A;  3C2W A;  4HY8 A;  1OPX A;  5HDS A;  4MCW A;  4GHI B;  3MQO A;  3OC2 A;  4I3J A;  2KDK A;  4H6J A;  2J3W A;  1S1Y A;  4LRZ E;  1D7E A;  2WKQ A;  1P9R A;  3VV4 A;  4XT2 A;  3BY8 A;  4EEU A;  1P9W A;  1KOU A;  4I5S A;  2JKR M;  2OOL A;  4PKY G;  2QKP A;  4KUO A;  2XA7 M;  5EFW A;  2PT7 A;  1WA9 A;  2VX8 A;  2O9A A;  4BBV A;  4CLC B;  3FC7 A;  1MKM A;  2PYP A;  4HP9 A;  4O0P A;  2VJW A;  3S7P A;  3NOT C;  2V0U A;  1OTA A;  4EU0 A;  3LIB A;  2JKR I;  2K7S A;  3H9W A;  1D06 A;  5KIZ A;  2M7V A;  2OWH A;  3ULF A;  2INW A;  3C8C A;  4NXB A;  3CWF A;  1TF1 A;  2ZMF A;  5DKK A;  4H6J B;  2W3D A;  3S7O A;  1LSX A;  2OAP 1;  2YKH A;  3LIE A;  3UB9 A;  4XT2 B;  3KSG A;  1XJ2 A;  3OBF A;  3F1P B;  2IA2 A;  3MJQ A;  5J4E A;  3S7N A;  5HWW A;  4M4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...