3B47A

Periplasmic sensor domain of chemotaxis protein gsu0582
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
121
Chain Sequence
b'IMDLQTRNTRGLSTLVVRDIGELMMAGDMAVIERYVADVRGKGAVLDLRIYDAAGRPAAPDGEVQAALTSGATAEKRHKRHVLSFIVPLANEVRCQSCHEQGARFNGAMLLTTSLEEGYAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
molecule tags Signaling protein
source organism Geobacter sulfurreducens
publication title Structures and solution properties of two novel periplasmic sensor domains with c-type heme from chemotaxis proteins of Geobacter sulfurreducens: implications for signal transduction.
pubmed doi rcsb
total genus 35
structure length 121
sequence length 129
ec nomenclature
pdb deposition date 2007-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.290 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b47A00
3B47A 3B42A
chains in the Genus database with same CATH superfamily
5FQQA 4KQOA 3CI6A 2J3WA 3DAVA 5HL1A 3V3SA 1OTIA 5EOOA 4KUOA 2XA7S 2Y2NA 3GV9A 5F69A 1XGIA 1KGFA 3A3EA 1GHPA 3Q82A 2OOLA 3BY8A 2HJEA 1Q2QA 2O0YA 3T4OA 4ESPA 4MDZA 1NWZA 5G18A 2EWVA 3UPNA 3IXHA 2WGWA 1H8MA 2XK1A 3BQ8A 2D02A 2W0NA 4BBTA 2HDSA 2VGLS 5EVID 5CEDA 3T4KA 4R4SA 4HIAA 3MMHA 1TD5A 3MZDA 1ES5A 2ZC6B 2ZC5B 4I5SA 3FKVA 2HDQA 1I5QA 2P9VB 4N92A 1QMFA 3GRJA 4E3OA 5HFOA 4DN0A 3OCNA 1XJ3A 2ACGA 4E3JA 3ZVWA 2QJ7A 3DTKA 1MY8A 2W3EA 5G4ZA 4X56A 1JWPA 1UGUA 2W3FA 2OWJA 3LO7A 3OBFA 4KUKA 5HD3A 3CPTA 2DRWA 5MC7A 1DP8A 3MKFA 1K25A 1RGZA 4EUVA 3BLMA 1TS8A 1FCMA 3IX4A 3R7WB 4CQHA 1UWNX 3BWLA 3MXQA 3NOTC 4N1HA 1GA9A 3IX8A 4I38A 1LI9A 1MWUA 3HLEA 4MBFA 2XFTA 2W3DA 3P98A 2A24B 4DF6A 3CITA 4NKPA 4PPRA 2ZMAA 5L8MA 1SCWA 2M7VA 3A0SA 1G6OA 2WADA 2QYBA 2EXBA 1SKOB 3W8KA 3BM6A 5J7EA 3P09A 3IX3A 3NY4A 3LR3A 4WYYA 3S4XA 3LY3A 3MF0A 1PYYA 2V1AA 4HJ6A 2HP9A 4OPYA 4EEPA 3E2KA 1GSXA 5EUAA 4IVIA 2PD8A 3C4OA 5GLCA 3UE0A 3NJAA 4ZTKA 2B02A 3ZYTA 3TW8A 5CXWA 4DXCA 5HPFA 5L09A 1NY0A 3LIBA 1VEUA 5CRFA 4YOFA 3UE6A 1P97A 3UB7A 3FPVA 4K91A 3UPPA 3T12B 4ZBEA 2VV8A 4BJPA 5GHZA 3IF6A 3UDXA 3Q7VB 1DJBA 4KZ6A 1S67L 3G35A 2EFXA 4P85A 3UDFA 4HH3A 4KG5A 3MJQA 4GD8A 2A24A 3M2KA 1TVFA 4RX3A 3HREA 5HWTA 4UA7A 2W3GA 3VP0A 1VQQA 4UEYA 4QHCA 4NEED 1KDSA 3W2ZA 5E2GA 1O7EA 1LLBA 1D7EA 5FDSA 5HPIA 2ZOIA 3SS3A 2XA7M 3BEBA 3G6OA 4H6JB 1K57A 2XQZA 4E3NA 3MQOA 3T1QB 4E6XA 5FASA 2LB5A 3KSGA 4QU3A 1NYMA 3BY9A 5FQIA 4KZBA 2DCFA 5FA7A 1LT0A 1SDNA 4KZ9A 4EQ1A 2OLUA 3H82B 1NLYA 2Y2PA 4JXSA 4HEFA 1GSWA 3ZG0A 1AXBA 2WAFA 2O9CA 1MWSA 2UV0E 1LL5A 2ZQCA 2GZAA 4UQIM 5EM1A 4L0LA 1XXMA 2VGJA 1W8YA 1TS0A 2WAEA 3U2AA 1H3QA 2PU4A 3BFCA 1IYPA 1JVJA 3SS5A 1QMEA 1XFQA 2WGWB 3KYQA 5HL6A 1TDLA 4DE2A 2PYPA 4Q0JA 4X68A 3AGDA 3PBQA 1NZOA 1FIKA 3LUQA 2EX2A 2H28A 4OPRA 4S2NA 4DDSA 3TSGA 4OOMA 2KOIA 1ONHA 4RVAA 3IWQA 4UQIS 3FC7A 4WELA 3VSLA 3A3JA 1HVBA 4ARZA 2GJ3A 1L2SA 1MKIA 5FATA 3GDIA 1O07A 3N7WA 3PTEA 1WE4A 5GLDA 1CF0A 1SKOA 1IYQA 2A2LA 4LFUA 3HL9A 5HAQA 4KQDA 2Q0OA 1M40A 1K55A 2M7UA 4C3QA 1NRFA 3ZG5A 5AVEA 3HBRA 5CHMA 2C6WB 1K57C 2W1TA 3MZFA 5AVFA 3FG8A 5EOEA 4QY5A 2VZWA 3ITBA 3K3DA 4O01A 3VP1A 3EGDC 5GLAA 3T4JA 1V9ZA 1BZAA 2CC1A 1KE0A 2O9BA 1ESUA 4I3IA 3Q1FA 1V9YA 4RYEA 2K2NA 4GDBA 3KYZA 1Q2PA 3ZNTA 4CLCE 2W3HA 1S0WA 4HP4A 1PI5A 5GHXA 5FQMA 4HBTA 5EVIA 3LY4A 2JN7A 3KSHA 3L7HA 4LGWA 4LV1A 1GHIA 2L4RA 1CEFA 4LRYC 3E4PA 3H9WA 5HD5A 3WS1A 3LEQA 4DDYA 3Q7ZA 1OTDA 5FL3A 4BLMA 2IA2A 2WZZA 4GW9A 3C8CA 3ZQ5A 1WA9A 1ZTUA 5HX9A 1CI8A 3N8SA 4EQIA 4BD1A 1VEUB 1JNUA 5EE8A 3OOVA 3UMEA 3PBOA 4ZRRA 2NUTC 3QP5A 1YPRA 1PI4A 5FAQA 2HPBA 1L0GA 2JBFA 1OJ5A 4EU0A 1ONGA 4S2NC 2WKPA 5EVLA 1YLYA 3VOZA 1YLZA 4E3LA 1CK3A 4I39A 3GVBA 3CAXA 1KVLA 3FWLA 4KZAA 3ZCZA 4LCMA 4Y2FA 3EGXC 4E3MA 2FFFB 1KE4A 1VETA 2BASA 3N8LA 3VE4A 4UA9A 3JYIA 1NRJA 4CLCD 1ES2A 4XXRA 4UAAA 4WMCA 4OLDA 5J4EA 1NXYA 2Y2JA 5HSQA 3LI8A 4QD4A 4IVKA 3A3DA 5E2FA 5F83A 4X55A 1BLCA 1LHYA 2J9OA 3S7QA 1K38A 2HDRA 2H0TA 3LR5A 2Z6CA 3GTCA 3U4LP 2ZM0A 2OLVA 2LB9A 5EECA 1STZA 3QHYA 4L9EA 3DTEA 4JF6A 4NXEA 5GL9A 4G3WA 1MC0A 4MN7A 5FQ9A 1SHVA 3IBRA 4YINA 3G2YA 3PXPA 4EUZA 4GB7A 5FI7A 2JKTI 5DKLA 2Q9MA 2ZQDA 3VSKA 1HZOA 1ZKJA 1SKFA 4HOIA 2PU2A 1JWVA 2PYRA 2V8CA 2J9PA 4GD6A 5A92A 4BQMA 3D3OA 1W79A 3RJUA 2AVXA 1Z6FA 4HY8A 4PM9A 3TOIA 3ZG8B 2V9AA 4E3IA 2V0WA 3NOUC 4KQRA 4ZDXA 1XJ6A 3E2LA 3GR2A 2WUQA 1TS6A 3W4OA 3DTMA 1YM1A 4XUZA 3LIFA 4FCFA 4HQAA 4P6ZM 1EI5A 5DF8A 5EVEA 5FI2A 1YLWA 2QPNA 4S2PA 1CEGA 2EX9A 4GJ4A 1BYWA 1K55C 2V1ZA 2Y2LA 5IHVA 4JXVA 2ZBBA 4E6WA 2PR6A 3UO9A 4Z1WA 4EBLA 3LR4A 4LENA 1ZG6A 4GDNA 2IWCA 3BJNA 2Y55A 4GCZA 4NK3A 1W8QA 5CGSA 3CMZA 5EFWA 4CLCA 3VV4A 2QZ6A 2FFYA 4OH0A 3F1OB 2JE5A 3O87A 2ZD8A 4FOFA 1K54C 2DNSA 3K3CA 3A0VA 4R3JA 2E8JA 3E98A 3MQ0A 3WS4A 3OPLA 3BFGA 1K56A 2X71A 2EWWA 4EBPA 3R4KA 4D2OA 5TGFA 3LIDA 1PRQA 3UY6A 2KLIA 2J80A 1K4FA 2GNXA 4WUJA 4PM8A 3H82A 4K0XA 1N9LA 1ZHHB 4F3LA 1K6SA 2ZQ9A 2JKFA 2VGLM 4YFMA 2MJ6A 4LV0A 1LI0A 3IHAA 2HP5A 3HJIA 3GSGA 3BQAA 4BMWA 4JKTA 2R78A 1XP4A 2VV6A 2WK0A 3IHBA 4WZ5C 2ZLYA 5DKKA 2VKSA 1S1YA 2JHEA 1XPBA 1BSGA 1XA1A 3EWKA 3KSFA 3IT9A 2R9XA 4JGOA 2HZ5A 4PM5A 4IHQA 4X25A 4S2OA 1SZVA 4R6LA 2X01A 3OLOA 4WBGA 3T4TA 4S2MA 2OAP1 1NJ4A 1IYSA 5F68A 5K5BA 3BRMA 1H0MA 1F2KA 4IBXA 3UDIA 3NOPC 5KMWA 3QNBA 3IXDA 2X02A 2XEPA 3T50A 4BBVA 4P87A 3NIAA 3B42A 1G28A 1PWGA 4GLQA 5A93A 4G3KA 4OP5A 3IF6C 5G4YA 2B18A 1DY6A 1GCEA 3IS2B 3P01A 1DP6A 3VP3A 1RGYA 1H5XA 3SOIA 2Q9NA 4I3JA 4BL2A 3G32A 3GQZA 2A49A 3LEZA 3GECA 4O0PA 5L07A 3E0YA 3M6HA 3MXRA 2WGVA 4B4ZA 5LBRA 3NCKA 5EPHA 1F5MA 2QKPA 2P04A 5IU1A 5DVAA 3V67A 4KZ5A 4DJ2A 1MZUA 3C2WA 4WMCD 3RXWA 5CEBA 3FYZA 4ME4A 5J3WA 1ACFA 2P7JA 1BLSA 3B3XA 1PWCA 5CX7A 1KOUA 3HCYA 2XF3A 1IEMA 3UE1A 3ITAA 3OC2A 4KG2A 4X69A 4D60A 3MS6A 1W5DA 4AFIA 4ARZB 4EBNA 3FV7A 3MQQA 3DBAA 1S1ZA 3ICYA 1IKGA 5DJTA 3EEAA 5E43A 4Y0OA 4FH2A 2YKFA 4GHIA 1P0ZA 3PBSA 3NDEA 2IWDA 3HUOA 3OZHA 4I3AA 4P6ZS 2WYXA 3CUEC 1BUEA 4GS9A 3DWKA 2QJ5A 3D4FA 1ESIA 2JKGA 2V20A 4R4RA 2Y2IA 4GN2A 4MN5A 3VFHA 4Y13A 2PBDP 3JPUA 4U0TA 3QNCA 1EW0A 4XUXA 2HV1A 2HP6A 1CQAA 2PDRA 1NZUA 3TRCA 3ZHHA 3LIEA 4O7DA 3FKWA 1W63Q 3CHWP 2C5WB 2Y59A 1MBLA 4OLGA 5AQAA 2L0WA 2J3TC 2I9VA 2IWBA 4M4XA 4NETA 4BD0A 1U60A 3O88A 3VP2A 4BBUA 2ZM8A 3ULFA 2PR5A 2ZQ7A 1PZPA 4GOGA 1E3UA 4KZ3A 1YQSA 5TR7A 2Z2MB 2XDMA 1OT6A 1HLUP 4FD8A 2EFUA 5CGWA 3G30A 3WRZA 1FSYA 5EVIC 1N9NA 3NI9A 4PMAA 4DE0A 2GX5A 3W4PA 5A91A 2WKHA 4NXFA 1KGGA 4UA6A 2VEAA 5L2FA 4Y17A 1RP5A 3O3VA 3UE3A 3PBRA 1MWTA 3TJZC 5F1FA 3A3IA 4OPZA 3RTYA 4R3BA 2GDNA 3LIAA 3MFXA 4F94A 3PBTA 5FAOA 3MBZA 1BLHA 3VOLA 4GZBA 3QP6A 4L9GA 1FSWA 4MCWA 4EW7A 1OJGA 4X1LA 3OPRA 3K2NA 4ETZA 5L10A 4HI4A 3V39A 4S2JA 3F1OA 4DMZA 2B5RA 3IF5A 4JF4A 5KZHA 2KDKA 3C38A 5HDSA 1J9MA 3WS0A 1XKZA 4N9KA 4WM9A 3PAGA 3N8RA 1FCNA 1H8ZA 4NG2A 1W63M 4WF0A 1FQGA 4MEZA 1ZC2A 2HGVA 3WS5A 3QP2A 2ZQ8A 3M2JA 1MPLA 3G4PA 3LICA 1ERQA 2VA0A 2J3TD 5I94A 3HLWA 3T4LA 1I2WA 2JKTM 2KX6A 1G5UA 4X1MA 5CTMA 3S7PA 4QWOA 3MFDA 2Y8HA 3C7VA 4K08A 4DJ3A 4KQQA 3F1PB 4Y0UA 4HNBA 2Y2OA 4Y0TA 4IEDA 4KZ8A 1CJFA 4XT2B 1M6KA 4MNRA 3W4QA 3ZDJA 2H5SA 3LI9A 1DJCA 3ISGA 4R0QA 4WEKA 3BFFA 3F1NB 4DRTA 1K6RA 3SH7A 1PIOA 3C5AA 3EQVA 3SH9A 1A0KA 2XD5A 1KE3A 4YNRA 2J8YA 1E4DA 1MXOA 1DP9A 1ERMA 1PZOA 1FCOA 3JVVA 2XROA 4ZJ1A 4HP9A 4WZ4A 3B47A 3TE8A 5FI6A 1D06A 3IXGA 3NECA 4JGQA 2V8FA 1GHMA 3IF6B 4C6YA 4EESA 4HJ4A 5HDDA 1C3BA 3HLCA 4WL9A 1F98A 5CGXA 3KYEA 1JTDA 3LCEA 1PW8A 1E25A 3P7NA 3PYPA 4ZJ3A 2K7SA 1SDEA 3LFVA 5CECA 3LYXA 1D1JA 1OTAA 5FDHA 4DE3A 3ZG9B 1I2SA 2P08A 3OCLA 4GS9B 3R7WA 5DF9A 4EV4A 4S2IA 3NC8A 2G7UA 2P74A 3FZCA 3VE3A 3IS2A 5CHJA 3MKEA 4EERA 2YKHA 2ZMVA 4JXGA 1YLTA 1PW1A 1N9OA 3CPTB 2ZL1A 3UB6A 3G34A 4LCLA 2XSSA 4WLAA 1LL8A 4NXGA 1S4RA 5AQ7A 5CTNA 2XFSA 1WYBA 3WRTA 3QP8A 3HLBA 1UWPX 3S7NA 3ZG7B 2Y91A 1W7FA 1DJAA 1RCJA 4MMNA 4IJGA 3D72A 3Q07A 3HLFA 5FQJA 3LGOA 4R1GA 5M1AA 1BT5A 3UB8A 1DRMA 4H6JA 4EEUA 2Y2GA 1L0FA 2W1TB 1K54A 5U47A 5DFYA 2XRNA 4Q0HA 4B93A 3AGFA 1YSQA 5E2HA 3Q81A 3MZEA 5HW3A 4MLLA 4DXBA 1T18A 4FSFA 3EEHA 2NUPC 2W1RA 2FH5A 2E8IA 4JXWA 1IFQA 4R23A 5C5KA 1JWZA 4PKYG 5TFQA 1L0DA 2L1MA 1YMXA 3UB9A 2A3UA 5EV0A 3F1NA 1H8YA 5EM0A 3N4IA 3IXBA 4II7A 2Z2LB 4PKYA 4DE1A 3GMWA 3JVUA 3T1RA 3CG5A 3UB5P 4OKPA 3WS2A 3S7OA 2WKIA 2DMWA 1NLZA 3CLOA 1HTZA 1EROA 3OPHA 4L9FA 4OQHA 3KO6A 3ZVTA 2H0YA 3MXSA 2Y2HA 3E4OA 2O99A 1OMEA 1VM1A 2WKEA 2OSUA 1PNEA 1MWRA 2JKRI 1EWZA 1FILA 1OTBA 2VX8A 3VOYA 4LRXC 2VK3A 4E3KA 5FAPA 2CMNA 4HBUA 5I5LA 4MBKA 2V0UA 3Q7VA 5HDCA 5DJUA 1F9IA 4IBRA 4LLOB 1PWDA 4HJ3A 1X0OA 4OP8A 4OOLA 4JLFA 2HF6A 4GKUA 3HLGA 3NULA 3BW6A 4B9OA 1KGEA 5HARA 1XJ2A 1IYOA 4C75A 3QP4A 4QB8A 4QPRA 2QHKA 5A8BA 2ZOHA 2G2WA 4RA7A 3DW0A 3VP4A 2WGIA 1XX2A 2V2FF 1YLJA 5KIZA 4FTXA 1VETB 4ZAMA 3IWIA 4OQ0A 1LSXA 1Z09A 4OONA 2J7VA 1IELA 5J8XA 3UMDA 3S1YA 4KZ7A 4B4XA 3O5YA 1TDGA 1Y4OA 5DTSA 4JGPA 3HJKA 2BTFP 4CPKA 5KSHA 3EQUA 3CUEA 2P9VA 1N9BA 3A0RA 4ETXA 4JBFA 3T4SA 3IH9A 1IOUA 3I7JA 2PAVP 3PHYA 2K31A 4Y7PA 3MR0A 4KG6A 2Y2MA 5F1GA 3MSHA 2XR0A 4OPQA 4F3LB 2VGKA 3H7WB 2HDUA 3BYDA 1BULA 1GA0A 1XGJA 5BOHA 4Y3IA 4HHDA 2EXAA 4Q0IA 2G2UA 4PHTA 4O8GA 2BLSA 4ZJ2A 5AQBA 4LV2A 4A5RA 4Z9QA 5DTTA 2JKRM 3SZTA 3T1XA 4P0MA 3BLSA 5GLBA 1NYYA 4UHUA 1ALQA 4WEJA 3V3RA 5HWWA 4CLCC 3BFEA 3NHQA 4IUHA 2WKRA 1N4OA 3LR0A 5FEGA 4MN6A 3PBNA 3KX0X 2QWSA 4Y5FA 5M19A 1S4SA 1AWIA 1IKIA 2PT7A 3VMAA 1MKMA 1YMSA 4KZ4A 4GHIB 2VLGA 3RFBA 4EETB 3G31A 3V5MA 2VV7A 4RQ9A 2JCHA 4MBHA 2EX8A 4N9LA 5AQ9A 1YKDA 4HH2A 2OAQ1 3B33A 2XLNA 2Y2QA 1ODVA 4H8RA 4YWZA 4B88A 3IBJA 1YAXA 3HLDA 1KVMA 5GHYA 1K0KA 4X6TA 2PBYA 3SH8A 2Y4AA 2WZXA 4NXBA 5F5YA 2PRFA 3SS4A 5KSCA 4GNUA 2WKQA 4PAUA 4CLCB 1XJ4A 5IS1A 3RXXA 2Y79A 5DTKA 3TG9A 2ZL1B 4XT2A 1YSPA 3QP1A 4RX2A 1WYCA 2XGNA 2ZJ9A 1ES4A 1KDWA 2QMIA 1FOFA 3V50A 2RL3A 4LRZE 3SW1A 1OT9A 3CJMA 3N6IA 5JYPA 3C7UA 2BG1A 1P9RA 3HUNA 4M3KA 4OVDA 3T1SA 4U0XA 2ZM2A 1K4EA 2PHYA 4JGRA 4P6BA 4R3AA 4BWIA 5AJGA 5E2EA 3BECA 3NBLA 1ZG4A 1VHMA 1LL9A 3C30A 1FR6A 3G2ZA 4EWFA 1OPXA 2V1BA 2I72A 1Y54A 4JPMA 1XFNA 3AGEA 1CI9A 3H7WA 1JTGA 5HAPA 1YT4A 2W27A 4CJNA 4R70A 5FSRA 5TBMA 3S22A 2UWXA 4QY6A 4BENA 1S66L 5A90A 2OWHA 1TF1A 4OOYA 3T4QA 3UPOA 4WZ5A 3D9YA 5D3OA 3DTIA 3IWOA 1ES3A 4Q8IA 2ZMFA 3UNWA 4EXOA 5CERA 4U3TA 1BLPA 3HUMA 3FPWA 4OQIA 3OPPA 1P9WA 3DWZA 3ZNYA 2M1CA 1L3LA 1FR1A 1Y28A 3VFFA 5DF7A 5TJJA 3IQAA 2D01A 2ZQAA 4QJGA 2ZC4B 5HAIA 4E04A 5HWVA 2OV5A 4OQGA 4K0WA 1T1BA 4KENB 1J3WA 4X53A 5F82A 5DFXA 2ZC3B 4JF5A 1OTEA 1PFLA 4PM6A 3WWXA 1YLPA 2O9AA 3PR6A 4WN5A 3L9KA 1BTLA 3E4QA 3F1PA 1G6AA 1VB6A 2XH9A 2HJ9C 3IH8A 4BL3A 2RCXA 4S2LA 2ZC7A 3CWFA 5EVIB 3EOIA 2R9WA 4HESA 3M6BA 2H10A 4DKIA 4FH4A 3NDGA 2JC7A 3C4PA 2INWA 1K56D 1G68A 3O86A 2Y2KA 2Z6DA 4S2KA 1HD8A 5FQKA 4N1XA 3ZFZA 5IT5A 4R38A 4Y15A 1S6RA 5M18A 1L0EA 2PD7A 3PAEA 3UN7A 4IUKA 1T1CA 4ID4A 3KSIA 5FEFA 1T1AA 5TBMB 5F6AA 1T19A 2XD1A 4FUWA 3ZGAB 1GSVA 1LSVA 5JYOA 4PM7A 1XA7A 2VJWA 4LPZA 3RH8B 4G3VA 1LSWA 2EX6A 1TEMA 2FZ0A 3A3FA 3BFDA 5CHUA 1TS7A 4LV3A 3HVFA 5HZHA 2EA9A 2B95A 3CZDA 1E3UD
chains in the Genus database with same CATH topology
5FL3A 2IA2A 4GW9A 4KQOA 3BW6A 1EW0A 4B9OA 3C8CA 3CI6A 2J3WA 2HV1A 3ZQ5A 1WA9A 1ZTUA 2PDRA 1XJ2A 3TRCA 3LIEA 1OTIA 1W63Q 4KUOA 4QPRA 2QHKA 5A8BA 2XA7S 2ZOHA 5F69A 1JNUA 2L0WA 3OOVA 2J3TC 3UMEA 2I9VA 3PBOA 2OOLA 4ZRRA 2NUTC 3BY8A 4M4XA 2HJEA 5KIZA 2O0YA 3T4OA 4BBUA 1LSXA 3ULFA 2PR5A 4MDZA 1NWZA 2EWVA 1OJ5A 4EU0A 3UMDA 2WKPA 1H8MA 3BQ8A 4I39A 2D02A 3CAXA 2W0NA 4BBTA 4Y2FA 3O5YA 3EGXC 2VGLS 1OT6A 3T4KA 4JGPA 4HIAA 2BASA 3HJKA 3VE4A 3MMHA 1TD5A 5KSHA 3EQUA 1NRJA 3CUEA 3A0RA 1N9NA 4ETXA 4CLCD 4I5SA 3T4SA 2GX5A 1IOUA 4NXFA 3PHYA 2K31A 5J4EA 3MR0A 4DN0A 2VEAA 3OCNA 1XJ3A 5HSQA 3LI8A 3UE3A 3PBRA 3TJZC 2QJ7A 5G4ZA 2W3EA 4F3LB 3RTYA 3H7WB 1UGUA 3LIAA 3MFXA 2W3FA 2OWJA 3S7QA 3OBFA 4KUKA 3PBTA 5HD3A 3LR5A 2Z6CA 3VOLA 4Y3IA 4HHDA 5MC7A 1DP8A 2LB9A 4Q0IA 4PHTA 4L9GA 4O8GA 4MCWA 4EW7A 1OJGA 1STZA 4EUVA 2JKRM 4L9EA 3K2NA 4ETZA 4NXEA 4G3WA 1MC0A 1TS8A 4HI4A 4MN7A 4WEJA 3R7WB 4CQHA 1UWNX 3BWLA 3F1OA 3IBRA 3MXQA 4CLCC 4DMZA 5HWWA 3PXPA 3NHQA 3NOTC 2KDKA 3C38A 5HDSA 2JKTI 5DKLA 4IUHA 2WKRA 4I38A 3LR0A 2W3DA 2A24B 4HOIA 4MN6A 2PYRA 3PBNA 3CITA 4NKPA 3KX0X 5L8MA 1W63M 2QWSA 2M7VA 4Y5FA 4WF0A 1S4SA 3A0SA 3D3OA 1G6OA 2QYBA 2PT7A 2HGVA 1MKMA 4HY8A 4GHIB 5J7EA 2VLGA 3RFBA 2V9AA 3LR3A 4EETB 2V0WA 3NOUC 2VV7A 3LICA 4RQ9A 1XJ6A 2VA0A 1TS6A 2J3TD 1YKDA 3MF0A 2V1AA 4HJ6A 4HH2A 3T4LA 2JKTM 3LIFA 4EEPA 2KX6A 2OAQ1 3B33A 4HQAA 3S7PA 4P6ZM 1ODVA 4YWZA 2Y8HA 3IBJA 4K08A 4DJ3A 1GSXA 1YAXA 3F1PB 4HNBA 2PD8A 3NJAA 4NXBA 5F5YA 4XT2B 2B02A 3ZYTA 3TW8A 5HPFA 3LIBA 4GJ4A 3LI9A 1BYWA 4WEKA 4YOFA 4PAUA 2WKQA 3F1NB 3UE6A 1P97A 4CLCB 1XJ4A 2ZBBA 3UB7A 3EQVA 5IS1A 3FPVA 2PR6A 2Y79A 4YNRA 4Z1WA 1DP9A 3LR4A 2VV8A 4BJPA 3JVVA 2XROA 4HP9A 3BJNA 4XT2A 4GCZA 1YSPA 3B47A 3TE8A 1D06A 1S67L 4JGQA 5EFWA 4HJ4A 5HDDA 4EESA 4CLCA 3VV4A 4HH3A 3MJQA 4LRZE 2A24A 3F1OB 4WL9A 3SW1A 1F98A 5HWTA 4FOFA 1OT9A 2W3GA 3K3CA 3A0VA 3E98A 3P7NA 4UEYA 3PYPA 4NEED 3MQ0A 3W2ZA 1P9RA 2K7SA 1D7EA 5HPIA 3LFVA 2ZOIA 3LYXA 2XA7M 1OTAA 3G6OA 2EWWA 4H6JB 3MQOA 2PHYA 3R4KA 4JGRA 2P08A 3OCLA 2LB5A 4GS9B 3R7WA 3KSGA 4R3AA 4BWIA 5DF9A 5AJGA 3BY9A 3LIDA 2G7UA 2KLIA 2J80A 3VE3A 3IS2A 2GNXA 4WUJA 1VHMA 4EERA 2YKHA 2ZMVA 3C30A 3H82A 1N9LA 1ZHHB 1LT0A 1OPXA 2V1BA 4F3LA 1N9OA 1XFNA 4EQ1A 3UB6A 2VGLM 2MJ6A 3H82B 2XSSA 4WLAA 3H7WA 1NLYA 1GSWA 3HJIA 1LL8A 2W27A 3BQAA 4BMWA 4R70A 5TBMA 2R78A 1S4RA 4NXGA 2O9CA 1S66L 2VV6A 2OWHA 1TF1A 3S7NA 1UWPX 3T4QA 5DKKA 2VKSA 2GZAA 1S1YA 2JHEA 4MMNA 4UQIM 4IJGA 3D72A 3EWKA 3KSFA 2ZMFA 4L0LA 4JGOA 4EXOA 1TS0A 3U2AA 4IHQA 1H3QA 4R6LA 3UB8A 1DRMA 3FPWA 3OLOA 4H6JA 1XFQA 4EEUA 3T4TA 1P9WA 2OAP1 3KYQA 2M1CA 5HL6A 2W1TB 5F68A 5DFYA 5K5BA 2PYPA 2XRNA 1Y28A 4Q0JA 3PBQA 5TJJA 4Q0HA 2D01A 3NOPC 4B93A 3LUQA 4E04A 1YSQA 5HWVA 2H28A 3T50A 4BBVA 4OOMA 2KOIA 1T1BA 1G28A 3B42A 4GLQA 1OTDA 4UQIS 5DFXA 3FC7A 4G3KA 4WELA 1T18A 4ARZA 1OTEA 4FSFA 5G4YA 2O9AA 2GJ3A 3EEHA 3PR6A 2NUPC 4WN5A 2B18A 3GDIA 2W1RA 2FH5A 3IS2B 3P01A 1DP6A 1IFQA 2A2LA 5C5KA 4PKYG 4KQDA 4I3JA 3E4QA 2L1MA 3UB9A 3F1PA 2M7UA 3GECA 4O0PA 1VB6A 3E0YA 2HJ9C 3F1NA 5AVEA 4II7A 5LBRA 3CWFA 1F5MA 4PKYA 2QKPA 2P04A 5IU1A 3V67A 4DJ2A 1MZUA 3EOIA 3JVUA 3C2WA 4ME4A 2W1TA 5J3WA 5AVFA 3FG8A 3S7OA 2P7JA 2VZWA 3K3DA 4O01A 5CX7A 2INWA 2DMWA 1KOUA 3HCYA 1NLZA 3EGDC 3T4JA 3CLOA 1V9ZA 3OC2A 2Z6DA 4L9FA 3KO6A 5IT5A 4AFIA 2O9BA 4R38A 4ARZB 4I3IA 1V9YA 3MQQA 2K2NA 2O99A 3E4OA 3DBAA 1S1ZA 3ICYA 3KYZA 5DJTA 2PD7A 3EEAA 4IUKA 1T1CA 4CLCE 2W3HA 2JKRI 3KSIA 1OTBA 2VX8A 4GHIA 2YKFA 1T1AA 1P0ZA 3PBSA 5TBMB 4HP4A 4LRXC 5F6AA 4I3AA 1T19A 4P6ZS 1GSVA 1LSVA 2CMNA 3CUEC 4GS9A 5I5LA 2JN7A 3KSHA 2QJ5A 2V0UA 2VJWA 4LPZA 3RH8B 4G3VA 5HDCA 1LSWA 5DJUA 2FZ0A 1F9IA 2L4RA 4MN5A 4LLOB 1TS7A 4LRYC 4HJ3A 3E4PA 1X0OA 3H9WA 5HD5A 5HZHA 2EA9A 4OOLA 2HF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B47 A;  3B42 A; 
#chains in the Genus database with same CATH topology
 5FQQ A;  4KQO A;  3CI6 A;  2J3W A;  3DAV A;  5HL1 A;  3V3S A;  1OTI A;  5EOO A;  4KUO A;  2XA7 S;  2Y2N A;  3GV9 A;  5F69 A;  1XGI A;  1KGF A;  3A3E A;  1GHP A;  3Q82 A;  2OOL A;  3BY8 A;  2HJE A;  1Q2Q A;  2O0Y A;  3T4O A;  4ESP A;  4MDZ A;  1NWZ A;  5G18 A;  2EWV A;  3UPN A;  3IXH A;  2WGW A;  1H8M A;  2XK1 A;  3BQ8 A;  2D02 A;  2W0N A;  4BBT A;  2HDS A;  2VGL S;  5EVI D;  5CED A;  3T4K A;  4R4S A;  4HIA A;  3MMH A;  1TD5 A;  3MZD A;  1ES5 A;  2ZC6 B;  2ZC5 B;  4I5S A;  3FKV A;  2HDQ A;  1I5Q A;  2P9V B;  4N92 A;  1QMF A;  3GRJ A;  4E3O A;  5HFO A;  4DN0 A;  3OCN A;  1XJ3 A;  2ACG A;  4E3J A;  3ZVW A;  2QJ7 A;  3DTK A;  1MY8 A;  2W3E A;  5G4Z A;  4X56 A;  1JWP A;  1UGU A;  2W3F A;  2OWJ A;  3LO7 A;  3OBF A;  4KUK A;  5HD3 A;  3CPT A;  2DRW A;  5MC7 A;  1DP8 A;  3MKF A;  1K25 A;  1RGZ A;  4EUV A;  3BLM A;  1TS8 A;  1FCM A;  3IX4 A;  3R7W B;  4CQH A;  1UWN X;  3BWL A;  3MXQ A;  3NOT C;  4N1H A;  1GA9 A;  3IX8 A;  4I38 A;  1LI9 A;  1MWU A;  3HLE A;  4MBF A;  2XFT A;  2W3D A;  3P98 A;  2A24 B;  4DF6 A;  3CIT A;  4NKP A;  4PPR A;  2ZMA A;  5L8M A;  1SCW A;  2M7V A;  3A0S A;  1G6O A;  2WAD A;  2QYB A;  2EXB A;  1SKO B;  3W8K A;  3BM6 A;  5J7E A;  3P09 A;  3IX3 A;  3NY4 A;  3LR3 A;  4WYY A;  3S4X A;  3LY3 A;  3MF0 A;  1PYY A;  2V1A A;  4HJ6 A;  2HP9 A;  4OPY A;  4EEP A;  3E2K A;  1GSX A;  5EUA A;  4IVI A;  2PD8 A;  3C4O A;  5GLC A;  3UE0 A;  3NJA A;  4ZTK A;  2B02 A;  3ZYT A;  3TW8 A;  5CXW A;  4DXC A;  5HPF A;  5L09 A;  1NY0 A;  3LIB A;  1VEU A;  5CRF A;  4YOF A;  3UE6 A;  1P97 A;  3UB7 A;  3FPV A;  4K91 A;  3UPP A;  3T12 B;  4ZBE A;  2VV8 A;  4BJP A;  5GHZ A;  3IF6 A;  3UDX A;  3Q7V B;  1DJB A;  4KZ6 A;  1S67 L;  3G35 A;  2EFX A;  4P85 A;  3UDF A;  4HH3 A;  4KG5 A;  3MJQ A;  4GD8 A;  2A24 A;  3M2K A;  1TVF A;  4RX3 A;  3HRE A;  5HWT A;  4UA7 A;  2W3G A;  3VP0 A;  1VQQ A;  4UEY A;  4QHC A;  4NEE D;  1KDS A;  3W2Z A;  5E2G A;  1O7E A;  1LLB A;  1D7E A;  5FDS A;  5HPI A;  2ZOI A;  3SS3 A;  2XA7 M;  3BEB A;  3G6O A;  4H6J B;  1K57 A;  2XQZ A;  4E3N A;  3MQO A;  3T1Q B;  4E6X A;  5FAS A;  2LB5 A;  3KSG A;  4QU3 A;  1NYM A;  3BY9 A;  5FQI A;  4KZB A;  2DCF A;  5FA7 A;  1LT0 A;  1SDN A;  4KZ9 A;  4EQ1 A;  2OLU A;  3H82 B;  1NLY A;  2Y2P A;  4JXS A;  4HEF A;  1GSW A;  3ZG0 A;  1AXB A;  2WAF A;  2O9C A;  1MWS A;  2UV0 E;  1LL5 A;  2ZQC A;  2GZA A;  4UQI M;  5EM1 A;  4L0L A;  1XXM A;  2VGJ A;  1W8Y A;  1TS0 A;  2WAE A;  3U2A A;  1H3Q A;  2PU4 A;  3BFC A;  1IYP A;  1JVJ A;  3SS5 A;  1QME A;  1XFQ A;  2WGW B;  3KYQ A;  5HL6 A;  1TDL A;  4DE2 A;  2PYP A;  4Q0J A;  4X68 A;  3AGD A;  3PBQ A;  1NZO A;  1FIK A;  3LUQ A;  2EX2 A;  2H28 A;  4OPR A;  4S2N A;  4DDS A;  3TSG A;  4OOM A;  2KOI A;  1ONH A;  4RVA A;  3IWQ A;  4UQI S;  3FC7 A;  4WEL A;  3VSL A;  3A3J A;  1HVB A;  4ARZ A;  2GJ3 A;  1L2S A;  1MKI A;  5FAT A;  3GDI A;  1O07 A;  3N7W A;  3PTE A;  1WE4 A;  5GLD A;  1CF0 A;  1SKO A;  1IYQ A;  2A2L A;  4LFU A;  3HL9 A;  5HAQ A;  4KQD A;  2Q0O A;  1M40 A;  1K55 A;  2M7U A;  4C3Q A;  1NRF A;  3ZG5 A;  5AVE A;  3HBR A;  5CHM A;  2C6W B;  1K57 C;  2W1T A;  3MZF A;  5AVF A;  3FG8 A;  5EOE A;  4QY5 A;  2VZW A;  3ITB A;  3K3D A;  4O01 A;  3VP1 A;  3EGD C;  5GLA A;  3T4J A;  1V9Z A;  1BZA A;  2CC1 A;  1KE0 A;  2O9B A;  1ESU A;  4I3I A;  3Q1F A;  1V9Y A;  4RYE A;  2K2N A;  4GDB A;  3KYZ A;  1Q2P A;  3ZNT A;  4CLC E;  2W3H A;  1S0W A;  4HP4 A;  1PI5 A;  5GHX A;  5FQM A;  4HBT A;  5EVI A;  3LY4 A;  2JN7 A;  3KSH A;  3L7H A;  4LGW A;  4LV1 A;  1GHI A;  2L4R A;  1CEF A;  4LRY C;  3E4P A;  3H9W A;  5HD5 A;  3WS1 A;  3LEQ A;  4DDY A;  3Q7Z A;  1OTD A;  5FL3 A;  4BLM A;  2IA2 A;  2WZZ A;  4GW9 A;  3C8C A;  3ZQ5 A;  1WA9 A;  1ZTU A;  5HX9 A;  1CI8 A;  3N8S A;  4EQI A;  4BD1 A;  1VEU B;  1JNU A;  5EE8 A;  3OOV A;  3UME A;  3PBO A;  4ZRR A;  2NUT C;  3QP5 A;  1YPR A;  1PI4 A;  5FAQ A;  2HPB A;  1L0G A;  2JBF A;  1OJ5 A;  4EU0 A;  1ONG A;  4S2N C;  2WKP A;  5EVL A;  1YLY A;  3VOZ A;  1YLZ A;  4E3L A;  1CK3 A;  4I39 A;  3GVB A;  3CAX A;  1KVL A;  3FWL A;  4KZA A;  3ZCZ A;  4LCM A;  4Y2F A;  3EGX C;  4E3M A;  2FFF B;  1KE4 A;  1VET A;  2BAS A;  3N8L A;  3VE4 A;  4UA9 A;  3JYI A;  1NRJ A;  4CLC D;  1ES2 A;  4XXR A;  4UAA A;  4WMC A;  4OLD A;  5J4E A;  1NXY A;  2Y2J A;  5HSQ A;  3LI8 A;  4QD4 A;  4IVK A;  3A3D A;  5E2F A;  5F83 A;  4X55 A;  1BLC A;  1LHY A;  2J9O A;  3S7Q A;  1K38 A;  2HDR A;  2H0T A;  3LR5 A;  2Z6C A;  3GTC A;  3U4L P;  2ZM0 A;  2OLV A;  2LB9 A;  5EEC A;  1STZ A;  3QHY A;  4L9E A;  3DTE A;  4JF6 A;  4NXE A;  5GL9 A;  4G3W A;  1MC0 A;  4MN7 A;  5FQ9 A;  1SHV A;  3IBR A;  4YIN A;  3G2Y A;  3PXP A;  4EUZ A;  4GB7 A;  5FI7 A;  2JKT I;  5DKL A;  2Q9M A;  2ZQD A;  3VSK A;  1HZO A;  1ZKJ A;  1SKF A;  4HOI A;  2PU2 A;  1JWV A;  2PYR A;  2V8C A;  2J9P A;  4GD6 A;  5A92 A;  4BQM A;  3D3O A;  1W79 A;  3RJU A;  2AVX A;  1Z6F A;  4HY8 A;  4PM9 A;  3TOI A;  3ZG8 B;  2V9A A;  4E3I A;  2V0W A;  3NOU C;  4KQR A;  4ZDX A;  1XJ6 A;  3E2L A;  3GR2 A;  2WUQ A;  1TS6 A;  3W4O A;  3DTM A;  1YM1 A;  4XUZ A;  3LIF A;  4FCF A;  4HQA A;  4P6Z M;  1EI5 A;  5DF8 A;  5EVE A;  5FI2 A;  1YLW A;  2QPN A;  4S2P A;  1CEG A;  2EX9 A;  4GJ4 A;  1BYW A;  1K55 C;  2V1Z A;  2Y2L A;  5IHV A;  4JXV A;  2ZBB A;  4E6W A;  2PR6 A;  3UO9 A;  4Z1W A;  4EBL A;  3LR4 A;  4LEN A;  1ZG6 A;  4GDN A;  2IWC A;  3BJN A;  2Y55 A;  4GCZ A;  4NK3 A;  1W8Q A;  5CGS A;  3CMZ A;  5EFW A;  4CLC A;  3VV4 A;  2QZ6 A;  2FFY A;  4OH0 A;  3F1O B;  2JE5 A;  3O87 A;  2ZD8 A;  4FOF A;  1K54 C;  2DNS A;  3K3C A;  3A0V A;  4R3J A;  2E8J A;  3E98 A;  3MQ0 A;  3WS4 A;  3OPL A;  3BFG A;  1K56 A;  2X71 A;  2EWW A;  4EBP A;  3R4K A;  4D2O A;  5TGF A;  3LID A;  1PRQ A;  3UY6 A;  2KLI A;  2J80 A;  1K4F A;  2GNX A;  4WUJ A;  4PM8 A;  3H82 A;  4K0X A;  1N9L A;  1ZHH B;  4F3L A;  1K6S A;  2ZQ9 A;  2JKF A;  2VGL M;  4YFM A;  2MJ6 A;  4LV0 A;  1LI0 A;  3IHA A;  2HP5 A;  3HJI A;  3GSG A;  3BQA A;  4BMW A;  4JKT A;  2R78 A;  1XP4 A;  2VV6 A;  2WK0 A;  3IHB A;  4WZ5 C;  2ZLY A;  5DKK A;  2VKS A;  1S1Y A;  2JHE A;  1XPB A;  1BSG A;  1XA1 A;  3EWK A;  3KSF A;  3IT9 A;  2R9X A;  4JGO A;  2HZ5 A;  4PM5 A;  4IHQ A;  4X25 A;  4S2O A;  1SZV A;  4R6L A;  2X01 A;  3OLO A;  4WBG A;  3T4T A;  4S2M A;  2OAP 1;  1NJ4 A;  1IYS A;  5F68 A;  5K5B A;  3BRM A;  1H0M A;  1F2K A;  4IBX A;  3UDI A;  3NOP C;  5KMW A;  3QNB A;  3IXD A;  2X02 A;  2XEP A;  3T50 A;  4BBV A;  4P87 A;  3NIA A;  3B42 A;  1G28 A;  1PWG A;  4GLQ A;  5A93 A;  4G3K A;  4OP5 A;  3IF6 C;  5G4Y A;  2B18 A;  1DY6 A;  1GCE A;  3IS2 B;  3P01 A;  1DP6 A;  3VP3 A;  1RGY A;  1H5X A;  3SOI A;  2Q9N A;  4I3J A;  4BL2 A;  3G32 A;  3GQZ A;  2A49 A;  3LEZ A;  3GEC A;  4O0P A;  5L07 A;  3E0Y A;  3M6H A;  3MXR A;  2WGV A;  4B4Z A;  5LBR A;  3NCK A;  5EPH A;  1F5M A;  2QKP A;  2P04 A;  5IU1 A;  5DVA A;  3V67 A;  4KZ5 A;  4DJ2 A;  1MZU A;  3C2W A;  4WMC D;  3RXW A;  5CEB A;  3FYZ A;  4ME4 A;  5J3W A;  1ACF A;  2P7J A;  1BLS A;  3B3X A;  1PWC A;  5CX7 A;  1KOU A;  3HCY A;  2XF3 A;  1IEM A;  3UE1 A;  3ITA A;  3OC2 A;  4KG2 A;  4X69 A;  4D60 A;  3MS6 A;  1W5D A;  4AFI A;  4ARZ B;  4EBN A;  3FV7 A;  3MQQ A;  3DBA A;  1S1Z A;  3ICY A;  1IKG A;  5DJT A;  3EEA A;  5E43 A;  4Y0O A;  4FH2 A;  2YKF A;  4GHI A;  1P0Z A;  3PBS A;  3NDE A;  2IWD A;  3HUO A;  3OZH A;  4I3A A;  4P6Z S;  2WYX A;  3CUE C;  1BUE A;  4GS9 A;  3DWK A;  2QJ5 A;  3D4F A;  1ESI A;  2JKG A;  2V20 A;  4R4R A;  2Y2I A;  4GN2 A;  4MN5 A;  3VFH A;  4Y13 A;  2PBD P;  3JPU A;  4U0T A;  3QNC A;  1EW0 A;  4XUX A;  2HV1 A;  2HP6 A;  1CQA A;  2PDR A;  1NZU A;  3TRC A;  3ZHH A;  3LIE A;  4O7D A;  3FKW A;  1W63 Q;  3CHW P;  2C5W B;  2Y59 A;  1MBL A;  4OLG A;  5AQA A;  2L0W A;  2J3T C;  2I9V A;  2IWB A;  4M4X A;  4NET A;  4BD0 A;  1U60 A;  3O88 A;  3VP2 A;  4BBU A;  2ZM8 A;  3ULF A;  2PR5 A;  2ZQ7 A;  1PZP A;  4GOG A;  1E3U A;  4KZ3 A;  1YQS A;  5TR7 A;  2Z2M B;  2XDM A;  1OT6 A;  1HLU P;  4FD8 A;  2EFU A;  5CGW A;  3G30 A;  3WRZ A;  1FSY A;  5EVI C;  1N9N A;  3NI9 A;  4PMA A;  4DE0 A;  2GX5 A;  3W4P A;  5A91 A;  2WKH A;  4NXF A;  1KGG A;  4UA6 A;  2VEA A;  5L2F A;  4Y17 A;  1RP5 A;  3O3V A;  3UE3 A;  3PBR A;  1MWT A;  3TJZ C;  5F1F A;  3A3I A;  4OPZ A;  3RTY A;  4R3B A;  2GDN A;  3LIA A;  3MFX A;  4F94 A;  3PBT A;  5FAO A;  3MBZ A;  1BLH A;  3VOL A;  4GZB A;  3QP6 A;  4L9G A;  1FSW A;  4MCW A;  4EW7 A;  1OJG A;  4X1L A;  3OPR A;  3K2N A;  4ETZ A;  5L10 A;  4HI4 A;  3V39 A;  4S2J A;  3F1O A;  4DMZ A;  2B5R A;  3IF5 A;  4JF4 A;  5KZH A;  2KDK A;  3C38 A;  5HDS A;  1J9M A;  3WS0 A;  1XKZ A;  4N9K A;  4WM9 A;  3PAG A;  3N8R A;  1FCN A;  1H8Z A;  4NG2 A;  1W63 M;  4WF0 A;  1FQG A;  4MEZ A;  1ZC2 A;  2HGV A;  3WS5 A;  3QP2 A;  2ZQ8 A;  3M2J A;  1MPL A;  3G4P A;  3LIC A;  1ERQ A;  2VA0 A;  2J3T D;  5I94 A;  3HLW A;  3T4L A;  1I2W A;  2JKT M;  2KX6 A;  1G5U A;  4X1M A;  5CTM A;  3S7P A;  4QWO A;  3MFD A;  2Y8H A;  3C7V A;  4K08 A;  4DJ3 A;  4KQQ A;  3F1P B;  4Y0U A;  4HNB A;  2Y2O A;  4Y0T A;  4IED A;  4KZ8 A;  1CJF A;  4XT2 B;  1M6K A;  4MNR A;  3W4Q A;  3ZDJ A;  2H5S A;  3LI9 A;  1DJC A;  3ISG A;  4R0Q A;  4WEK A;  3BFF A;  3F1N B;  4DRT A;  1K6R A;  3SH7 A;  1PIO A;  3C5A A;  3EQV A;  3SH9 A;  1A0K A;  2XD5 A;  1KE3 A;  4YNR A;  2J8Y A;  1E4D A;  1MXO A;  1DP9 A;  1ERM A;  1PZO A;  1FCO A;  3JVV A;  2XRO A;  4ZJ1 A;  4HP9 A;  4WZ4 A;  3B47 A;  3TE8 A;  5FI6 A;  1D06 A;  3IXG A;  3NEC A;  4JGQ A;  2V8F A;  1GHM A;  3IF6 B;  4C6Y A;  4EES A;  4HJ4 A;  5HDD A;  1C3B A;  3HLC A;  4WL9 A;  1F98 A;  5CGX A;  3KYE A;  1JTD A;  3LCE A;  1PW8 A;  1E25 A;  3P7N A;  3PYP A;  4ZJ3 A;  2K7S A;  1SDE A;  3LFV A;  5CEC A;  3LYX A;  1D1J A;  1OTA A;  5FDH A;  4DE3 A;  3ZG9 B;  1I2S A;  2P08 A;  3OCL A;  4GS9 B;  3R7W A;  5DF9 A;  4EV4 A;  4S2I A;  3NC8 A;  2G7U A;  2P74 A;  3FZC A;  3VE3 A;  3IS2 A;  5CHJ A;  3MKE A;  4EER A;  2YKH A;  2ZMV A;  4JXG A;  1YLT A;  1PW1 A;  1N9O A;  3CPT B;  2ZL1 A;  3UB6 A;  3G34 A;  4LCL A;  2XSS A;  4WLA A;  1LL8 A;  4NXG A;  1S4R A;  5AQ7 A;  5CTN A;  2XFS A;  1WYB A;  3WRT A;  3QP8 A;  3HLB A;  1UWP X;  3S7N A;  3ZG7 B;  2Y91 A;  1W7F A;  1DJA A;  1RCJ A;  4MMN A;  4IJG A;  3D72 A;  3Q07 A;  3HLF A;  5FQJ A;  3LGO A;  4R1G A;  5M1A A;  1BT5 A;  3UB8 A;  1DRM A;  4H6J A;  4EEU A;  2Y2G A;  1L0F A;  2W1T B;  1K54 A;  5U47 A;  5DFY A;  2XRN A;  4Q0H A;  4B93 A;  3AGF A;  1YSQ A;  5E2H A;  3Q81 A;  3MZE A;  5HW3 A;  4MLL A;  4DXB A;  1T18 A;  4FSF A;  3EEH A;  2NUP C;  2W1R A;  2FH5 A;  2E8I A;  4JXW A;  1IFQ A;  4R23 A;  5C5K A;  1JWZ A;  4PKY G;  5TFQ A;  1L0D A;  2L1M A;  1YMX A;  3UB9 A;  2A3U A;  5EV0 A;  3F1N A;  1H8Y A;  5EM0 A;  3N4I A;  3IXB A;  4II7 A;  2Z2L B;  4PKY A;  4DE1 A;  3GMW A;  3JVU A;  3T1R A;  3CG5 A;  3UB5 P;  4OKP A;  3WS2 A;  3S7O A;  2WKI A;  2DMW A;  1NLZ A;  3CLO A;  1HTZ A;  1ERO A;  3OPH A;  4L9F A;  4OQH A;  3KO6 A;  3ZVT A;  2H0Y A;  3MXS A;  2Y2H A;  3E4O A;  2O99 A;  1OME A;  1VM1 A;  2WKE A;  2OSU A;  1PNE A;  1MWR A;  2JKR I;  1EWZ A;  1FIL A;  1OTB A;  2VX8 A;  3VOY A;  4LRX C;  2VK3 A;  4E3K A;  5FAP A;  2CMN A;  4HBU A;  5I5L A;  4MBK A;  2V0U A;  3Q7V A;  5HDC A;  5DJU A;  1F9I A;  4IBR A;  4LLO B;  1PWD A;  4HJ3 A;  1X0O A;  4OP8 A;  4OOL A;  4JLF A;  2HF6 A;  4GKU A;  3HLG A;  3NUL A;  3BW6 A;  4B9O A;  1KGE A;  5HAR A;  1XJ2 A;  1IYO A;  4C75 A;  3QP4 A;  4QB8 A;  4QPR A;  2QHK A;  5A8B A;  2ZOH A;  2G2W A;  4RA7 A;  3DW0 A;  3VP4 A;  2WGI A;  1XX2 A;  2V2F F;  1YLJ A;  5KIZ A;  4FTX A;  1VET B;  4ZAM A;  3IWI A;  4OQ0 A;  1LSX A;  1Z09 A;  4OON A;  2J7V A;  1IEL A;  5J8X A;  3UMD A;  3S1Y A;  4KZ7 A;  4B4X A;  3O5Y A;  1TDG A;  1Y4O A;  5DTS A;  4JGP A;  3HJK A;  2BTF P;  4CPK A;  5KSH A;  3EQU A;  3CUE A;  2P9V A;  1N9B A;  3A0R A;  4ETX A;  4JBF A;  3T4S A;  3IH9 A;  1IOU A;  3I7J A;  2PAV P;  3PHY A;  2K31 A;  4Y7P A;  3MR0 A;  4KG6 A;  2Y2M A;  5F1G A;  3MSH A;  2XR0 A;  4OPQ A;  4F3L B;  2VGK A;  3H7W B;  2HDU A;  3BYD A;  1BUL A;  1GA0 A;  1XGJ A;  5BOH A;  4Y3I A;  4HHD A;  2EXA A;  4Q0I A;  2G2U A;  4PHT A;  4O8G A;  2BLS A;  4ZJ2 A;  5AQB A;  4LV2 A;  4A5R A;  4Z9Q A;  5DTT A;  2JKR M;  3SZT A;  3T1X A;  4P0M A;  3BLS A;  5GLB A;  1NYY A;  4UHU A;  1ALQ A;  4WEJ A;  3V3R A;  5HWW A;  4CLC C;  3BFE A;  3NHQ A;  4IUH A;  2WKR A;  1N4O A;  3LR0 A;  5FEG A;  4MN6 A;  3PBN A;  3KX0 X;  2QWS A;  4Y5F A;  5M19 A;  1S4S A;  1AWI A;  1IKI A;  2PT7 A;  3VMA A;  1MKM A;  1YMS A;  4KZ4 A;  4GHI B;  2VLG A;  3RFB A;  4EET B;  3G31 A;  3V5M A;  2VV7 A;  4RQ9 A;  2JCH A;  4MBH A;  2EX8 A;  4N9L A;  5AQ9 A;  1YKD A;  4HH2 A;  2OAQ 1;  3B33 A;  2XLN A;  2Y2Q A;  1ODV A;  4H8R A;  4YWZ A;  4B88 A;  3IBJ A;  1YAX A;  3HLD A;  1KVM A;  5GHY A;  1K0K A;  4X6T A;  2PBY A;  3SH8 A;  2Y4A A;  2WZX A;  4NXB A;  5F5Y A;  2PRF A;  3SS4 A;  5KSC A;  4GNU A;  2WKQ A;  4PAU A;  4CLC B;  1XJ4 A;  5IS1 A;  3RXX A;  2Y79 A;  5DTK A;  3TG9 A;  2ZL1 B;  4XT2 A;  1YSP A;  3QP1 A;  4RX2 A;  1WYC A;  2XGN A;  2ZJ9 A;  1ES4 A;  1KDW A;  2QMI A;  1FOF A;  3V50 A;  2RL3 A;  4LRZ E;  3SW1 A;  1OT9 A;  3CJM A;  3N6I A;  5JYP A;  3C7U A;  2BG1 A;  1P9R A;  3HUN A;  4M3K A;  4OVD A;  3T1S A;  4U0X A;  2ZM2 A;  1K4E A;  2PHY A;  4JGR A;  4P6B A;  4R3A A;  4BWI A;  5AJG A;  5E2E A;  3BEC A;  3NBL A;  1ZG4 A;  1VHM A;  1LL9 A;  3C30 A;  1FR6 A;  3G2Z A;  4EWF A;  1OPX A;  2V1B A;  2I72 A;  1Y54 A;  4JPM A;  1XFN A;  3AGE A;  1CI9 A;  3H7W A;  1JTG A;  5HAP A;  1YT4 A;  2W27 A;  4CJN A;  4R70 A;  5FSR A;  5TBM A;  3S22 A;  2UWX A;  4QY6 A;  4BEN A;  1S66 L;  5A90 A;  2OWH A;  1TF1 A;  4OOY A;  3T4Q A;  3UPO A;  4WZ5 A;  3D9Y A;  5D3O A;  3DTI A;  3IWO A;  1ES3 A;  4Q8I A;  2ZMF A;  3UNW A;  4EXO A;  5CER A;  4U3T A;  1BLP A;  3HUM A;  3FPW A;  4OQI A;  3OPP A;  1P9W A;  3DWZ A;  3ZNY A;  2M1C A;  1L3L A;  1FR1 A;  1Y28 A;  3VFF A;  5DF7 A;  5TJJ A;  3IQA A;  2D01 A;  2ZQA A;  4QJG A;  2ZC4 B;  5HAI A;  4E04 A;  5HWV A;  2OV5 A;  4OQG A;  4K0W A;  1T1B A;  4KEN B;  1J3W A;  4X53 A;  5F82 A;  5DFX A;  2ZC3 B;  4JF5 A;  1OTE A;  1PFL A;  4PM6 A;  3WWX A;  1YLP A;  2O9A A;  3PR6 A;  4WN5 A;  3L9K A;  1BTL A;  3E4Q A;  3F1P A;  1G6A A;  1VB6 A;  2XH9 A;  2HJ9 C;  3IH8 A;  4BL3 A;  2RCX A;  4S2L A;  2ZC7 A;  3CWF A;  5EVI B;  3EOI A;  2R9W A;  4HES A;  3M6B A;  2H10 A;  4DKI A;  4FH4 A;  3NDG A;  2JC7 A;  3C4P A;  2INW A;  1K56 D;  1G68 A;  3O86 A;  2Y2K A;  2Z6D A;  4S2K A;  1HD8 A;  5FQK A;  4N1X A;  3ZFZ A;  5IT5 A;  4R38 A;  4Y15 A;  1S6R A;  5M18 A;  1L0E A;  2PD7 A;  3PAE A;  3UN7 A;  4IUK A;  1T1C A;  4ID4 A;  3KSI A;  5FEF A;  1T1A A;  5TBM B;  5F6A A;  1T19 A;  2XD1 A;  4FUW A;  3ZGA B;  1GSV A;  1LSV A;  5JYO A;  4PM7 A;  1XA7 A;  2VJW A;  4LPZ A;  3RH8 B;  4G3V A;  1LSW A;  2EX6 A;  1TEM A;  2FZ0 A;  3A3F A;  3BFD A;  5CHU A;  1TS7 A;  4LV3 A;  3HVF A;  5HZH A;  2EA9 A;  2B95 A;  3CZD A;  1E3U D; 
#chains in the Genus database with same CATH homology
 5FL3 A;  2IA2 A;  4GW9 A;  4KQO A;  3BW6 A;  1EW0 A;  4B9O A;  3C8C A;  3CI6 A;  2J3W A;  2HV1 A;  3ZQ5 A;  1WA9 A;  1ZTU A;  2PDR A;  1XJ2 A;  3TRC A;  3LIE A;  1OTI A;  1W63 Q;  4KUO A;  4QPR A;  2QHK A;  5A8B A;  2XA7 S;  2ZOH A;  5F69 A;  1JNU A;  2L0W A;  3OOV A;  2J3T C;  3UME A;  2I9V A;  3PBO A;  2OOL A;  4ZRR A;  2NUT C;  3BY8 A;  4M4X A;  2HJE A;  5KIZ A;  2O0Y A;  3T4O A;  4BBU A;  1LSX A;  3ULF A;  2PR5 A;  4MDZ A;  1NWZ A;  2EWV A;  1OJ5 A;  4EU0 A;  3UMD A;  2WKP A;  1H8M A;  3BQ8 A;  4I39 A;  2D02 A;  3CAX A;  2W0N A;  4BBT A;  4Y2F A;  3O5Y A;  3EGX C;  2VGL S;  1OT6 A;  3T4K A;  4JGP A;  4HIA A;  2BAS A;  3HJK A;  3VE4 A;  3MMH A;  1TD5 A;  5KSH A;  3EQU A;  1NRJ A;  3CUE A;  3A0R A;  1N9N A;  4ETX A;  4CLC D;  4I5S A;  3T4S A;  2GX5 A;  1IOU A;  4NXF A;  3PHY A;  2K31 A;  5J4E A;  3MR0 A;  4DN0 A;  2VEA A;  3OCN A;  1XJ3 A;  5HSQ A;  3LI8 A;  3UE3 A;  3PBR A;  3TJZ C;  2QJ7 A;  5G4Z A;  2W3E A;  4F3L B;  3RTY A;  3H7W B;  1UGU A;  3LIA A;  3MFX A;  2W3F A;  2OWJ A;  3S7Q A;  3OBF A;  4KUK A;  3PBT A;  5HD3 A;  3LR5 A;  2Z6C A;  3VOL A;  4Y3I A;  4HHD A;  5MC7 A;  1DP8 A;  2LB9 A;  4Q0I A;  4PHT A;  4L9G A;  4O8G A;  4MCW A;  4EW7 A;  1OJG A;  1STZ A;  4EUV A;  2JKR M;  4L9E A;  3K2N A;  4ETZ A;  4NXE A;  4G3W A;  1MC0 A;  1TS8 A;  4HI4 A;  4MN7 A;  4WEJ A;  3R7W B;  4CQH A;  1UWN X;  3BWL A;  3F1O A;  3IBR A;  3MXQ A;  4CLC C;  4DMZ A;  5HWW A;  3PXP A;  3NHQ A;  3NOT C;  2KDK A;  3C38 A;  5HDS A;  2JKT I;  5DKL A;  4IUH A;  2WKR A;  4I38 A;  3LR0 A;  2W3D A;  2A24 B;  4HOI A;  4MN6 A;  2PYR A;  3PBN A;  3CIT A;  4NKP A;  3KX0 X;  5L8M A;  1W63 M;  2QWS A;  2M7V A;  4Y5F A;  4WF0 A;  1S4S A;  3A0S A;  3D3O A;  1G6O A;  2QYB A;  2PT7 A;  2HGV A;  1MKM A;  4HY8 A;  4GHI B;  5J7E A;  2VLG A;  3RFB A;  2V9A A;  3LR3 A;  4EET B;  2V0W A;  3NOU C;  2VV7 A;  3LIC A;  4RQ9 A;  1XJ6 A;  2VA0 A;  1TS6 A;  2J3T D;  1YKD A;  3MF0 A;  2V1A A;  4HJ6 A;  4HH2 A;  3T4L A;  2JKT M;  3LIF A;  4EEP A;  2KX6 A;  2OAQ 1;  3B33 A;  4HQA A;  3S7P A;  4P6Z M;  1ODV A;  4YWZ A;  2Y8H A;  3IBJ A;  4K08 A;  4DJ3 A;  1GSX A;  1YAX A;  3F1P B;  4HNB A;  2PD8 A;  3NJA A;  4NXB A;  5F5Y A;  4XT2 B;  2B02 A;  3ZYT A;  3TW8 A;  5HPF A;  3LIB A;  4GJ4 A;  3LI9 A;  1BYW A;  4WEK A;  4YOF A;  4PAU A;  2WKQ A;  3F1N B;  3UE6 A;  1P97 A;  4CLC B;  1XJ4 A;  2ZBB A;  3UB7 A;  3EQV A;  5IS1 A;  3FPV A;  2PR6 A;  2Y79 A;  4YNR A;  4Z1W A;  1DP9 A;  3LR4 A;  2VV8 A;  4BJP A;  3JVV A;  2XRO A;  4HP9 A;  3BJN A;  4XT2 A;  4GCZ A;  1YSP A;  3B47 A;  3TE8 A;  1D06 A;  1S67 L;  4JGQ A;  5EFW A;  4HJ4 A;  5HDD A;  4EES A;  4CLC A;  3VV4 A;  4HH3 A;  3MJQ A;  4LRZ E;  2A24 A;  3F1O B;  4WL9 A;  3SW1 A;  1F98 A;  5HWT A;  4FOF A;  1OT9 A;  2W3G A;  3K3C A;  3A0V A;  3E98 A;  3P7N A;  4UEY A;  3PYP A;  4NEE D;  3MQ0 A;  3W2Z A;  1P9R A;  2K7S A;  1D7E A;  5HPI A;  3LFV A;  2ZOI A;  3LYX A;  2XA7 M;  1OTA A;  3G6O A;  2EWW A;  4H6J B;  3MQO A;  2PHY A;  3R4K A;  4JGR A;  2P08 A;  3OCL A;  2LB5 A;  4GS9 B;  3R7W A;  3KSG A;  4R3A A;  4BWI A;  5DF9 A;  5AJG A;  3BY9 A;  3LID A;  2G7U A;  2KLI A;  2J80 A;  3VE3 A;  3IS2 A;  2GNX A;  4WUJ A;  1VHM A;  4EER A;  2YKH A;  2ZMV A;  3C30 A;  3H82 A;  1N9L A;  1ZHH B;  1LT0 A;  1OPX A;  2V1B A;  4F3L A;  1N9O A;  1XFN A;  4EQ1 A;  3UB6 A;  2VGL M;  2MJ6 A;  3H82 B;  2XSS A;  4WLA A;  3H7W A;  1NLY A;  1GSW A;  3HJI A;  1LL8 A;  2W27 A;  3BQA A;  4BMW A;  4R70 A;  5TBM A;  2R78 A;  1S4R A;  4NXG A;  2O9C A;  1S66 L;  2VV6 A;  2OWH A;  1TF1 A;  3S7N A;  1UWP X;  3T4Q A;  5DKK A;  2VKS A;  2GZA A;  1S1Y A;  2JHE A;  4MMN A;  4UQI M;  4IJG A;  3D72 A;  3EWK A;  3KSF A;  2ZMF A;  4L0L A;  4JGO A;  4EXO A;  1TS0 A;  3U2A A;  4IHQ A;  1H3Q A;  4R6L A;  3UB8 A;  1DRM A;  3FPW A;  3OLO A;  4H6J A;  1XFQ A;  4EEU A;  3T4T A;  1P9W A;  2OAP 1;  3KYQ A;  2M1C A;  5HL6 A;  2W1T B;  5F68 A;  5DFY A;  5K5B A;  2PYP A;  2XRN A;  1Y28 A;  4Q0J A;  3PBQ A;  5TJJ A;  4Q0H A;  2D01 A;  3NOP C;  4B93 A;  3LUQ A;  4E04 A;  1YSQ A;  5HWV A;  2H28 A;  3T50 A;  4BBV A;  4OOM A;  2KOI A;  1T1B A;  1G28 A;  3B42 A;  4GLQ A;  1OTD A;  4UQI S;  5DFX A;  3FC7 A;  4G3K A;  4WEL A;  1T18 A;  4ARZ A;  1OTE A;  4FSF A;  5G4Y A;  2O9A A;  2GJ3 A;  3EEH A;  3PR6 A;  2NUP C;  4WN5 A;  2B18 A;  3GDI A;  2W1R A;  2FH5 A;  3IS2 B;  3P01 A;  1DP6 A;  1IFQ A;  2A2L A;  5C5K A;  4PKY G;  4KQD A;  4I3J A;  3E4Q A;  2L1M A;  3UB9 A;  3F1P A;  2M7U A;  3GEC A;  4O0P A;  1VB6 A;  3E0Y A;  2HJ9 C;  3F1N A;  5AVE A;  4II7 A;  5LBR A;  3CWF A;  1F5M A;  4PKY A;  2QKP A;  2P04 A;  5IU1 A;  3V67 A;  4DJ2 A;  1MZU A;  3EOI A;  3JVU A;  3C2W A;  4ME4 A;  2W1T A;  5J3W A;  5AVF A;  3FG8 A;  3S7O A;  2P7J A;  2VZW A;  3K3D A;  4O01 A;  5CX7 A;  2INW A;  2DMW A;  1KOU A;  3HCY A;  1NLZ A;  3EGD C;  3T4J A;  3CLO A;  1V9Z A;  3OC2 A;  2Z6D A;  4L9F A;  3KO6 A;  5IT5 A;  4AFI A;  2O9B A;  4R38 A;  4ARZ B;  4I3I A;  1V9Y A;  3MQQ A;  2K2N A;  2O99 A;  3E4O A;  3DBA A;  1S1Z A;  3ICY A;  3KYZ A;  5DJT A;  2PD7 A;  3EEA A;  4IUK A;  1T1C A;  4CLC E;  2W3H A;  2JKR I;  3KSI A;  1OTB A;  2VX8 A;  4GHI A;  2YKF A;  1T1A A;  1P0Z A;  3PBS A;  5TBM B;  4HP4 A;  4LRX C;  5F6A A;  4I3A A;  1T19 A;  4P6Z S;  1GSV A;  1LSV A;  2CMN A;  3CUE C;  4GS9 A;  5I5L A;  2JN7 A;  3KSH A;  2QJ5 A;  2V0U A;  2VJW A;  4LPZ A;  3RH8 B;  4G3V A;  5HDC A;  1LSW A;  5DJU A;  2FZ0 A;  1F9I A;  2L4R A;  4MN5 A;  4LLO B;  1TS7 A;  4LRY C;  4HJ3 A;  3E4P A;  1X0O A;  3H9W A;  5HD5 A;  5HZH A;  2EA9 A;  4OOL A;  2HF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...