3B47A

Periplasmic sensor domain of chemotaxis protein gsu0582
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
121
Chain Sequence
IMDLQTRNTRGLSTLVVRDIGELMMAGDMAVIERYVADVRGKGAVLDLRIYDAAGRPAAPDGEVQAALTSGATAEKRHKRHVLSFIVPLANEVRCQSCHEQGARFNGAMLLTTSLEEGYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures and solution properties of two novel periplasmic sensor domains with c-type heme from chemotaxis proteins of Geobacter sulfurreducens: implications for signal transduction.
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Signaling protein
total genus 35
structure length 121
sequence length 129
ec nomenclature
pdb deposition date 2007-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.290 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b47A00
3B47A 3B42A
chains in the Genus database with same CATH superfamily
2JKTM 2Y4AA 4G3KA 4EXOA 5EV0A 1C3BA 3RJUA 5EM1A 4X25A 2VK3A 4PM5A 2IA2A 2J80A 1GA9A 2GDNA 2V2FF 3TG9A 3G30A 4IVKA 4DKIA 1YQSA 5CEBA 5F5YA 1MKIA 4P87A 1XJ2A 1E3UD 1IKGA 1IEMA 1EROA 3MZDA 1ZTUA 1PW1A 3ZVTA 2VGKA 1CQAA 1WE4A 3ZNTA 5CHJA 4E3MA 1H8YA 4NXEA 4WM9A 3UO9A 3LFVA 1ZG4A 2ZL1A 1YSPA 1BLPA 4OKPA 2PBDP 4OPZA 3C4PA 5F6AA 5MC7A 3N6IA 4R23A 4GHIA 2EWWA 2INWA 3IXDA 5DKLA 3IX4A 2DCFA 3IF6A 3ZNYA 2JE5A 1YAXA 4EBPA 1EW0A 3LUQA 4O0PA 3O88A 4FSFA 3M2KA 1IOUA 3VV4A 4B4ZA 3C2WA 2BLSA 2QYBA 5C5KA 3UY6A 4GS9A 1RP5A 1FR1A 2D01A 1RGYA 4HQAA 4EUVA 1NXYA 4X6TA 1GHPA 4QPRA 5FQKA 3TE8A 1TS8A 1K54C 4FUWA 3A3JA 1PWDA 1P9RA 4ZBEA 5HDSA 4AFIA 1IYOA 4OLDA 4R3JA 4MEZA 4M3KA 2O0YA 3I7JA 2H10A 4EBNA 2HP6A 3A3DA 5DFXA 1CF0A 2AVXA 2H28A 3P7NA 1P97A 4S2PA 5CHMA 4GOGA 2Y8HA 3FWLA 3H9WA 4UA7A 3A0VA 3QP8A 4GD6A 4NETA 3HUNA 3O5YA 3NHQA 4WF0A 3AGDA 4EQ1A 1XA1A 3NOTC 2Y59A 3S7QA 3HLCA 3BFEA 4G3VA 2C6WB 3P98A 4Y2FA 3N4IA 1W8YA 5EVLA 3ZG9B 4QB8A 1DJCA 1GHMA 3UN7A 1YPRA 2J8YA 3R7WA 4Y17A 5G4YA 2M7UA 4KQQA 2X71A 1BLSA 4ZJ3A 1ODVA 3HUOA 3W4OA 3IF5A 4HJ4A 1PNEA 4M4XA 2HPBA 1EWZA 3NI9A 4KZ3A 2A49A 4RYEA 2ZC4B 2PDRA 2ZMVA 1K56A 3C7VA 3TW8A 1RCJA 2JKTI 1MPLA 4Z9QA 4R4SA 3NULA 4K08A 3HLFA 2Y2GA 5DJTA 3ZHHA 3NOUC 4S2LA 2V0WA 4LENA 4UQIM 4Z1WA 3IWQA 4OVDA 2JKGA 1NZUA 3GTCA 1H8MA 2LB9A 4DDYA 4BL3A 3LR4A 3OOVA 1K57A 4P6ZS 3GMWA 1KVLA 4KZ6A 3UMDA 5DF7A 5HAPA 5F69A 5HSQA 3FPWA 2VEAA 2Y2PA 3DTMA 5J7EA 3KSHA 4GLQA 1AXBA 2Y2HA 2OWHA 3MFXA 3KSFA 5DTKA 4QD4A 3BYDA 2JKFA 4YWZA 5FQQA 4H8RA 3BWLA 1BSGA 3LYXA 4XUZA 4F3LA 4B9OA 2PHYA 3E0YA 1I2WA 3IQAA 3UPNA 2OAQ1 5DF8A 3UPPA 4IBRA 4KQOA 2W1RA 1Z6FA 2J9OA 1MKMA 1G68A 1K6SA 4ZTKA 5GHYA 2WGWA 2L4RA 2V1ZA 1ZC2A 1VEUB 5TBMA 3N8RA 1OT9A 3LIEA 2HV1A 5CECA 4GJ4A 2P7JA 4R6LA 3EEAA 2QZ6A 4HY8A 4ZRRA 4N9KA 3UPOA 1NYYA 3W8KA 4ZDXA 3T4SA 3MXQA 1PZPA 4KG6A 5F82A 3TRCA 2DNSA 5JYPA 2ZQ7A 1RGZA 3W4PA 2O9BA 2A24A 1ZKJA 3O87A 3PR6A 3PBOA 4N9LA 1L3LA 3D3OA 1KDWA 5FSRA 4WMCA 1GSVA 3EEHA 1BUEA 1JTGA 2H5SA 2JBFA 1L0FA 5L8MA 1OJ5A 3RFBA 1AWIA 4LRXC 4GD8A 3CWFA 2J3WA 3UE6A 4DE3A 2O9CA 4JLFA 3C5AA 4WUJA 3EWKA 2XR0A 5HDDA 4CQHA 4KQRA 3R4KA 4QWOA 3VP2A 2K2NA 5EPHA 3ISGA 4BWIA 3VP4A 1P0ZA 2VJWA 1PI5A 4DXCA 4HH2A 2HP5A 3GRJA 5FI2A 4R38A 2FFFB 4ID4A 3UB9A 4DMZA 5FASA 1ACFA 1LSWA 3B33A 4II7A 4GW9A 1FCOA 1H8ZA 1SDEA 3U2AA 3C7UA 1STZA 1WYCA 1PWCA 1L0GA 3VP3A 1Y54A 2HJ9C 2WKPA 1K0KA 2R9XA 4KZ7A 2ZM8A 3CJMA 2W3EA 4HEFA 4I5SA 1I5QA 2P9VA 5KSHA 5F1FA 3HLWA 1T1CA 5A92A 4PKYA 3SS5A 3ZGAB 1ES4A 2OWJA 4WL9A 1G5UA 1KGEA 4GNUA 1TEMA 2XD1A 4MBKA 4FH4A 2UWXA 3IX3A 2W0NA 5HWWA 4N1XA 3ZDJA 1KE3A 2XA7M 1YLTA 4OPRA 1FSYA 3LICA 5J4EA 3SOIA 2J3TC 2IWDA 3HLBA 3LY4A 3UB5P 3T4QA 4CPKA 1LL8A 1N9OA 3M6BA 3OPRA 2MJ6A 3QNCA 1L0EA 4JF6A 1WYBA 4E3LA 4OPYA 3UDXA 4HP4A 2WYXA 4NK3A 4UHUA 2QWSA 2PR5A 5HPIA 4GZBA 2Y2NA 4JF4A 5CTMA 3KX0X 4Y5FA 2GX5A 2GZAA 1CEGA 3P09A 1IYQA 1H5XA 3T1RA 3OPLA 4HJ3A 3VP0A 3T4KA 5KIZA 4X68A 1YLZA 4PPRA 3VE3A 1ESIA 2Y2KA 4YINA 4LGWA 2ZQCA 4CLCB 5CHUA 3BFFA 4WMCD 2ZQDA 4PM9A 2PR6A 1PWGA 3ZQ5A 2VGLM 5CERA 4X53A 1ES3A 5F83A 4UAAA 1PZOA 4N1HA 2PU2A 3HLEA 1FIKA 3LI8A 1E4DA 3KSGA 3FYZA 1Q2PA 2J3TD 2J9PA 4LV3A 5AQBA 2P9VB 3F1OB 4R3AA 2Y2OA 4LRZE 5L09A 4EW7A 4S2MA 3MR0A 1S66L 3BLSA 3ZCZA 3CHWP 4BBUA 5AVEA 4WLAA 2EX2A 5HARA 5HWTA 3CPTB 1J3WA 2X01A 1L2SA 3BQAA 4R1GA 5FDHA 3FG8A 2DMWA 4DJ3A 2Y79A 2ZM0A 2GJ3A 3MQOA 3QP5A 3WS0A 2OLUA 3PBTA 3SZTA 5CRFA 3M2JA 3SH7A 2ZC6B 4O7DA 3MFDA 3QP4A 5L2FA 2Q9NA 3V39A 4DDSA 4NXGA 2G2WA 1KOUA 2L1MA 3DAVA 2WADA 4R0QA 5CX7A 3N8LA 3P01A 4S2KA 1WA9A 5I94A 3CUEA 3A3IA 5CGXA 3UE0A 4L9FA 3FKWA 4OQ0A 4HI4A 5GL9A 2P08A 1W8QA 5AQAA 4QY6A 2Q9MA 1OPXA 4YOFA 2V20A 3C38A 5EUAA 2HDQA 3EGXC 4U3TA 1CI9A 4Y15A 5CGWA 2XFTA 1VQQA 5EFWA 4Q8IA 2JN7A 5TGFA 4X69A 4E3JA 3UNWA 4DXBA 1IFQA 1MXOA 5EE8A 2BG1A 4I38A 2EXBA 4MBHA 3DW0A 1S6RA 3JVVA 1T1AA 4E3IA 1YLYA 3IHAA 3OPPA 2HGVA 2Y2LA 1DP8A 3C8CA 4I3IA 4D60A 2XDMA 2YKHA 4S2IA 2PRFA 4N92A 4HESA 4LPZA 5GLDA 4WELA 2XEPA 1XKZA 1ESUA 1NY0A 5CXWA 4BBVA 1TVFA 4K0XA 2QJ7A 3PYPA 4KZAA 1G6OA 4K0WA 1VEUA 1T1BA 3FKVA 4Q0IA 4I3JA 3T12B 4JXGA 3IBRA 3GECA 3S1YA 4WEJA 3ZFZA 5DKKA 4O8GA 2VZWA 3DWZA 4LCLA 2XQZA 1TDGA 3CUEC 3WS2A 3K3DA 4NXBA 4OONA 1FCMA 1F2KA 3A0RA 4RQ9A 1HVBA 3E4OA 4KG2A 2VV7A 1MWRA 1NWZA 2M7VA 3N8SA 1TS0A 4JXVA 1S4SA 3TSGA 3PAGA 3G31A 2WUQA 5JYOA 3LI9A 2XROA 5HD3A 3T1QB 2BTFP 1SDNA 3A3EA 3E2LA 4D2OA 1LLBA 4IUHA 4HJ6A 3RH8B 4RX3A 4ZAMA 3WS1A 2B02A 4ZJ2A 5DJUA 4Y0UA 1BULA 3UDIA 3Q7VB 1KE0A 4NEED 1FCNA 1XXMA 4PHTA 1T18A 4GDNA 2GNXA 4RX2A 1MZUA 2WKEA 1NLYA 3VP1A 3GQZA 3LIFA 3VOZA 3SW1A 4HH3A 3JVUA 3WRZA 2HDUA 2WKIA 3FPVA 1OTBA 4IJGA 1HTZA 4P85A 3MKFA 1BZAA 1O7EA 3PTEA 1T19A 5FAQA 5CTNA 2EXAA 5IU1A 3BY8A 1S1YA 1JVJA 1D1JA 3IH8A 2PU4A 3B47A 4MLLA 1YLWA 3DTIA 1S4RA 2ZMAA 2ZLYA 1GCEA 2FH5A 5EM0A 3ZYTA 1U60A 2HP9A 3ZG5A 4OP5A 1SKOB 3C30A 5A91A 1IKIA 1QMEA 1F9IA 1N4OA 3IBJA 4JXSA 3SS4A 4Q0HA 1K4EA 5FA7A 2W27A 3UB7A 4S2NA 3GSGA 4KZ8A 5FEGA 5FL3A 1XP4A 3EQVA 3VSLA 1VETB 2B95A 1FSWA 4OQHA 4KG5A 5KZHA 4OPQA 1K25A 1JTDA 2PAVP 4ZJ1A 4BLMA 3HCYA 3NECA 4Y0OA 4H6JB 3ZG8B 1KGFA 3OZHA 1ALQA 2C5WB 2A3UA 5FQIA 3HLDA 3L7HA 4X1MA 1P9WA 5EOEA 3PAEA 2KDKA 4OP8A 4HBTA 4BBTA 5IT5A 5AQ7A 2JKRI 2VV8A 5M18A 4BQMA 3T4LA 4DE1A 1QMFA 4UEYA 3LIBA 2KX6A 3UMEA 2I9VA 4EQIA 2QPNA 3NDGA 4OOYA 1MBLA 2ACGA 4QU3A 3CAXA 4KZ5A 2V1BA 3NC8A 1F5MA 4JXWA 5FDSA 4WYYA 4CLCA 4XT2B 5F68A 4LLOB 2PYPA 1IYPA 5DFYA 2RCXA 3D4FA 1ONHA 3QNBA 3F1PB 2XFSA 1GSWA 3HJKA 3OBFA 4YFMA 2PD8A 4ME4A 1V9ZA 3ITAA 3F1OA 4JF5A 4S2NC 2WZZA 4EUZA 1J9MA 1FQGA 1I2SA 1XFNA 1D7EA 3HBRA 5KSCA 2Z6CA 3CPTA 3KYZA 5FATA 3LR3A 2ZM2A 3H7WB 4MN5A 4WN5A 2XSSA 3LY3A 2Z2LB 1DP9A 2B18A 1VHMA 3N7WA 3S7NA 3WS5A 1LSVA 4PAUA 4E6WA 4XUXA 4BL2A 2WZXA 1YKDA 1W5DA 5HDCA 1G6AA 3O3VA 3EQUA 5EVIC 2YKFA 1TS7A 1MY8A 2OV5A 4EETB 4IHQA 4E3NA 2W3FA 2OAP1 5EVIB 3GVBA 4Y7PA 4WZ5A 1K6RA 2XLNA 3MF0A 3MS6A 1W63Q 2M1CA 4MNRA 2CC1A 4MDZA 4EEPA 1SKFA 3Q82A 1A0KA 1S0WA 1PI4A 2JCHA 1X0OA 5KMWA 1YLJA 3F1NB 4CLCC 2KOIA 4R70A 3VSKA 1XA7A 4EEUA 3BFDA 2Y2IA 3MMHA 3L9KA 3BM6A 5FQ9A 4FOFA 3WS4A 2ZC3B 2H0YA 3LR0A 3SH9A 3BJNA 2G7UA 3HVFA 1XGIA 1DY6A 4EWFA 3Q1FA 5DVAA 3T4TA 5DF9A 3HREA 2IWCA 2HJEA 4Y3IA 4B93A 1UWPX 1ZHHB 4HIAA 3CG5A 3TJZC 3V67A 1KDSA 5FEFA 1H0MA 4R4RA 3WRTA 2JC7A 4B4XA 3T50A 2Y2JA 3PXPA 5EVID 1YM1A 3MJQA 2V8FA 2XK1A 3K3CA 5FAOA 5HX9A 1TD5A 4UQIS 2HDRA 2X02A 2WKQA 3HUMA 4EERA 4U0TA 4E3OA 4DJ2A 1PIOA 2G2UA 2XD5A 2UV0E 3E4QA 4QHCA 4XXRA 5I5LA 4Q0JA 5FQJA 4I39A 4KUOA 3T4JA 3DWKA 1O07A 4G3WA 4HBUA 1JWZA 4CLCD 3V3SA 2W1TA 2VX8A 2RL3A 1NRFA 1K55A 1YSQA 1XPBA 4WZ5C 4FD8A 4PM6A 2V1AA 5E2EA 1IELA 5U47A 2Z2MB 4KUKA 1V9YA 5A93A 3T1XA 3H82B 3ZVWA 3U4LP 3VMAA 1MC0A 1CK3A 1PRQA 2I72A 4MCWA 3PBQA 4FTXA 2WKRA 5AQ9A 4NXFA 4A5RA 2W3GA 4QY5A 4HOIA 4ETZA 5GLAA 3G34A 5EECA 2J7VA 3Q7VA 2IWBA 3EOIA 2EX8A 3D72A 3QP6A 1S67L 4DF6A 3FZCA 3B3XA 2PYRA 3BECA 4BJPA 1M6KA 3M6HA 3PHYA 4E3KA 1PFLA 1BLHA 4PMAA 3T1SA 3IXBA 2V0UA 2ZQ9A 5A90A 4S2JA 3LIDA 3S7PA 3IS2B 3G2ZA 1YT4A 4JGRA 3NOPC 1Z09A 4EESA 1KE4A 1HD8A 2VKSA 2K31A 1YLPA 3K2NA 4JPMA 1ONGA 2EA9A 4JGQA 4KZ4A 3A0SA 2W3HA 1JWPA 4MN6A 2HF6A 3BFGA 1G28A 2Q0OA 4OH0A 5DTTA 1K55C 1ZG6A 1TS6A 3MBZA 2ZQAA 2HZ5A 4KENB 3E98A 2W3DA 4GKUA 1SKOA 3W2ZA 1Y4OA 1ERQA 2EFXA 2W1TB 4X55A 2E8JA 3FV7A 1XJ6A 3CMZA 4MBFA 3IWIA 2JKRM 1L0DA 3O86A 3NIAA 3BFCA 1SZVA 3VFHA 2WAEA 4X1LA 3S7OA 1VETA 5A8BA 1ES5A 2OSUA 2V8CA 1M40A 3IT9A 5GLCA 2P74A 4OOLA 3FC7A 4JKTA 3PBSA 3KSIA 4P6BA 5TR7A 3Q81A 5F1GA 1TF1A 2B5RA 2ZL1B 4NG2A 3LIAA 3QHYA 4RVAA 5M1AA 4FH2A 2VA0A 4H6JA 2ZOHA 3IF6C 4C6YA 1DRMA 4PM7A 1LHYA 2EFUA 2EWVA 4GHIB 1BYWA 1H3QA 1S1ZA 5FI7A 3G6OA 3W4QA 2Y91A 3GV9A 4YNRA 3LEQA 5BOHA 3WWXA 3ZG7B 1CJFA 4IUKA 3IF6B 3GR2A 4MN7A 1NLZA 3CI6A 3G4PA 2VLGA 4E04A 2BASA 3B42A 1W7FA 4PM8A 2WK0A 2D02A 4S2OA 3CITA 3VFFA 3HJIA 4GS9B 5HZHA 5FQMA 4ARZA 2XH9A 3RXXA 2P04A 4GN2A 2HDSA 2NUTC 1JNUA 4K91A 3KO6A 3LO7A 2H0TA 2PT7A 1UGUA 2QHKA 1VM1A 2ZOIA 4XT2A 3Q07A 4WBGA 1LI9A 1XX2A 4GDBA 4UA9A 4BENA 3V50A 2XA7S 4GB7A 5IHVA 5GHXA 1OTEA 3T4OA 3IHBA 5HL1A 4L0LA 3QP1A 3DTEA 4P0MA 2WGIA 1BT5A 1OT6A 3F1PA 4JBFA 1TDLA 5E43A 2O99A 1GSXA 1NJ4A 3G32A 4L9GA 4FCFA 1NZOA 2FZ0A 2EX6A 3BLMA 4WZ4A 1N9NA 4RA7A 2WGVA 4Y0TA 1CI8A 1HZOA 3GDIA 4IBXA 3UDFA 4C3QA 1SCWA 2XF3A 1LL5A 2XGNA 1XFQA 4MMNA 3H7WA 3A3FA 2L0WA 1DP6A 3R7WB 5E2HA 3PBNA 3JPUA 3ZG0A 4U0XA 1E25A 1K4FA 2ZD8A 4BD1A 3V5MA 5D3OA 3LCEA 2NUPC 2Y2MA 1MWUA 4WEKA 2JHEA 3JYIA 1DJBA 5DTSA 3AGEA 3KYEA 2VGLS 5TJJA 1FILA 3S4XA 2R9WA 2WKHA 4OQIA 4O01A 5EVIA 4PKYG 5L07A 3MZEA 1K57C 1F98A 3AGFA 5GHZA 2OLVA 5TFQA 3VE4A 3HL9A 3LGOA 2ZQ8A 3Q7ZA 5HWVA 3BQ8A 4DE2A 4OQGA 4UA6A 5HFOA 2VV6A 5J8XA 3CZDA 3LEZA 5M19A 3BRMA 3F1NA 2KLIA 4JGOA 3SH8A 3E4PA 4ARZB 4LFUA 4E6XA 1BLCA 3MXRA 1N9BA 5HPFA 4LV1A 4ESPA 4BMWA 4EU0A 5GLBA 1Y28A 2V9AA 1HLUP 3SS3A 3IWOA 4OLGA 4KZ9A 1KGGA 2EX9A 1ES2A 2R78A 4DRTA 4EV4A 1ERMA 3VOYA 4JGPA 4DN0A 1FOFA 1LL9A 1PW8A 3NCKA 1E3UA 4F3LB 2PBYA 1K56D 2E8IA 3G35A 3LR5A 3MQQA 5G18A 2ZMFA 3MQ0A 1XGJA 3ULFA 3IH9A 2PD7A 1FR6A 3S22A 4OOMA 1PYYA 1JWVA 2K7SA 4CLCE 4ETXA 1NYMA 2WGWB 1OJGA 3QP2A 3MKEA 4P6ZM 5TBMB 3OCLA 1OTAA 4L9EA 2VGJA 1XJ4A 3NJAA 1OTDA 3HLGA 1LSXA 4Y13A 1DJAA 1BTLA 1CEFA 4LV0A 3UE1A 3IXHA 3NDEA 3MZFA 3ITBA 1GHIA 3BY9A 2A2LA 3BEBA 3RTYA 5EVEA 5HAIA 2ZJ9A 2CMNA 5EOOA 3UB6A 1W79A 3MSHA 1LI0A 4LV2A 1OMEA 5G4ZA 1KVMA 5L10A 2A24B 4B88A 5HL6A 3E2KA 4HP9A 3NY4A 3OLOA 3PBRA 4HNBA 1VB6A 4C75A 3EGDC 5E2FA 1MWTA 3V3RA 1IYSA 2QMIA 5K5BA 3H82A 4LRYC 3UB8A 4KQDA 3ICYA 3OC2A 4F94A 2ZBBA 3UE3A 3NBLA 2O9AA 4KZBA 4CJNA 5E2GA 2WAFA 1XJ3A 3OPHA 1EI5A 2ZC5B 1UWNX 4IVIA 1NRJA 1SHVA 3KYQA 2DRWA 1Q2QA 4GCZA 2QJ5A 1W63M 2Y2QA 5FAPA 3TOIA 4DE0A 5IS1A 4R3BA 5HAQA 3DTKA 3MXSA 3VOLA 4HHDA 2QKPA 3BW6A 5AJGA 2OOLA 2Z6DA 4NKPA 4EBLA 3RXWA 3IXGA 4IEDA 3G2YA 5FI6A 4LCMA 5CGSA 2XRNA 5HW3A 2LB5A 1YMXA 3C4OA 3IS2A 5CEDA 2ZC7A 3OCNA 3D9YA 1N9LA 2Y55A 1OTIA 1YMSA 3IX8A 5AVFA 3DBAA 5LBRA 5J3WA 4I3AA 5HD5A 3CLOA 4QJGA 1K54A 1K38A 1MWSA 1D06A 2FFYA 1LT0A 4X56A 4BD0A 1GA0A
chains in the Genus database with same CATH topology
5KSHA 2JKTM 1TS6A 3ZYTA 1T1CA 4G3KA 4EXOA 4PKYA 3E98A 2W3DA 3C30A 2OWJA 3W2ZA 2IA2A 1F9IA 3IBJA 2J80A 4WL9A 2W1TB 4Q0HA 2W27A 3UB7A 1XJ6A 2JKRM 5F5YA 5FL3A 3EQVA 2W0NA 5HWWA 1XJ2A 3S7OA 5A8BA 2XA7M 1ZTUA 3LICA 5J4EA 2J3TC 4OOLA 3FC7A 3PBSA 3KSIA 4NXEA 3T4QA 3HCYA 1TF1A 3LFVA 3LIAA 1YSPA 4H6JB 2VA0A 1LL8A 1N9OA 4H6JA 2ZOHA 2MJ6A 1DRMA 5F6AA 5MC7A 2EWVA 4GHIB 1BYWA 1H3QA 1S1ZA 4GHIA 3G6OA 2EWWA 4HP4A 4YNRA 2INWA 1P9WA 5DKLA 2QWSA 2PR5A 4IUKA 2KDKA 5HPIA 4MN7A 4BBTA 1NLZA 3CI6A 5IT5A 1YAXA 3KX0X 4Y5FA 2JKRI 2GX5A 2GZAA 2VLGA 1EW0A 2VV8A 4E04A 3LUQA 3T4LA 2BASA 4O0PA 3B42A 4UEYA 3LIBA 2KX6A 3UMEA 4FSFA 1IOUA 2I9VA 3VV4A 2D02A 3C2WA 2QYBA 3CITA 4HJ3A 5C5KA 3HJIA 3T4KA 5KIZA 4GS9B 5HZHA 4GS9A 3VE3A 4ARZA 3CAXA 2P04A 2V1BA 2D01A 2NUTC 4HQAA 1JNUA 4EUVA 1F5MA 3KO6A 4CLCB 4QPRA 4CLCA 3TE8A 4XT2B 2PT7A 1UGUA 2QHKA 2ZOIA 4XT2A 1TS8A 2PR6A 5F68A 3ZQ5A 4LLOB 2PYPA 2VGLM 2XA7S 1P9RA 5HDSA 4AFIA 5DFYA 1OTEA 3T4OA 4L0LA 3LI8A 2O0YA 3F1PB 1OT6A 3KSGA 3F1PA 2O99A 1GSXA 5DFXA 1GSWA 3HJKA 3OBFA 2J3TD 4L9GA 2H28A 2FZ0A 3P7NA 1P97A 2PD8A 3F1OB 4ME4A 4R3AA 1V9ZA 4LRZE 3F1OA 4EW7A 1N9NA 3MR0A 2Y8HA 1S66L 3H9WA 3A0VA 3GDIA 3O5YA 1XFNA 1D7EA 3NHQA 4WLAA 5AVEA 4BBUA 4WF0A 4EQ1A 5HWTA 3NOTC 3S7QA 4G3VA 2Z6CA 1XFQA 3KYZA 3BQAA 4Y2FA 3LR3A 4MMNA 3H7WB 3FG8A 4MN5A 4WN5A 2DMWA 2XSSA 3H7WA 4DJ3A 2Y79A 2GJ3A 3MQOA 2L0WA 1DP6A 3R7WB 3PBNA 3PBTA 1DP9A 3R7WA 2B18A 1VHMA 5G4YA 2M7UA 3S7NA 1LSVA 1ODVA 4PAUA 2NUPC 4HJ4A 4M4XA 1YKDA 5HDCA 4NXGA 3EQUA 1KOUA 4WEKA 2JHEA 2L1MA 2YKFA 1TS7A 5CX7A 3P01A 2PDRA 1WA9A 2ZMVA 2VGLS 3CUEA 5TJJA 4EETB 4IHQA 3TW8A 2JKTI 4L9FA 4HI4A 2W3FA 2OAP1 4K08A 4O01A 5DJTA 4PKYG 2P08A 3MF0A 3NOUC 1W63Q 2V0WA 4UQIM 2M1CA 1F98A 4Z1WA 4MDZA 3VE4A 4EEPA 1OPXA 5HWVA 3BQ8A 4YOFA 3C38A 2VV6A 3EGXC 1X0OA 1H8MA 2LB9A 3F1NB 2KOIA 3LR4A 4CLCC 3F1NA 3OOVA 2KLIA 4JGOA 4P6ZS 4R70A 5EFWA 3E4PA 2JN7A 4ARZB 4EEUA 3UMDA 5HPFA 3MMHA 5F69A 1IFQA 5HSQA 3FPWA 4BMWA 2VEAA 4EU0A 4FOFA 1Y28A 2V9AA 3LR0A 5J7EA 4I38A 3BJNA 3KSHA 2G7UA 4GLQA 3T4TA 3JVVA 2OWHA 5DF9A 1T1AA 2R78A 3MFXA 3KSFA 2HGVA 2HJEA 1DP8A 4Y3IA 4YWZA 4JGPA 3C8CA 4I3IA 3BWLA 4B93A 4DN0A 1UWPX 1ZHHB 4HIAA 3LYXA 4F3LB 3TJZC 4F3LA 3V67A 4B9OA 2YKHA 2PHYA 3LR5A 3MQQA 3E0YA 2ZMFA 3T50A 2OAQ1 4LPZA 3PXPA 3MQ0A 3ULFA 2PD7A 4KQOA 4WELA 2W1RA 3MJQA 4OOMA 1MKMA 2K7SA 3K3CA 4CLCE 4ETXA 4BBVA 1TD5A 1OJGA 2L4RA 2QJ7A 4UQIS 3PYPA 1G6OA 4P6ZM 5TBMB 5TBMA 1T1BA 2WKQA 4Q0IA 3OCLA 1OTAA 4L9EA 4EERA 1OT9A 4I3JA 1XJ4A 3NJAA 1OTDA 3IBRA 3LIEA 1LSXA 3GECA 2HV1A 4DJ2A 4GJ4A 2P7JA 3E4QA 4R6LA 4WEJA 3EEAA 5DKKA 5I5LA 4Q0JA 4HY8A 4O8GA 2VZWA 4I39A 4KUOA 4ZRRA 3T4JA 3BY9A 2A2LA 3CUEC 3RTYA 4G3WA 3K3DA 4NXBA 2CMNA 3UB6A 3A0RA 3T4SA 3MXQA 4RQ9A 4CLCD 2W1TA 2VX8A 3TRCA 3E4OA 1YSQA 5G4ZA 2O9BA 2A24B 2VV7A 2A24A 5HL6A 2V1AA 1NWZA 4HP9A 3PBRA 3OLOA 1TS0A 2M7VA 4HNBA 1VB6A 1S4SA 3PR6A 3EGDC 3PBOA 4KUKA 3D3OA 3LI9A 1V9YA 2XROA 1GSVA 3H82B 5K5BA 3EEHA 3H82A 5HD3A 4LRYC 3UB8A 5L8MA 4KQDA 1OJ5A 3ICYA 3OC2A 3RFBA 2ZBBA 1MC0A 4LRXC 3UE3A 2O9AA 4IUHA 3CWFA 4HJ6A 4MCWA 2J3WA 1XJ3A 3PBQA 3RH8B 3UE6A 2O9CA 2WKRA 4NXFA 2W3GA 1UWNX 1NRJA 2B02A 4HOIA 3KYQA 5DJUA 4ETZA 4WUJA 3EWKA 4GCZA 2QJ5A 5HDDA 1W63M 4CQHA 3R4KA 4NEED 4PHTA 1T18A 3EOIA 2GNXA 2K2NA 5IS1A 4BWIA 1MZUA 1P0ZA 3D72A 2VJWA 1S67L 1NLYA 4HH2A 3VOLA 4R38A 2PYRA 4HHDA 2QKPA 3LIFA 4BJPA 3PHYA 3UB9A 3BW6A 5AJGA 4DMZA 3SW1A 4HH3A 3JVUA 2OOLA 2Z6DA 4NKPA 2V0UA 1LSWA 3LIDA 2XRNA 3FPVA 1OTBA 2LB5A 3S7PA 3B33A 3IS2B 4IJGA 4II7A 4GW9A 4JGRA 3IS2A 3NOPC 4EESA 3OCNA 1N9LA 3U2AA 1OTIA 2VKSA 1T19A 2K31A 1STZA 3K2NA 5AVFA 3DBAA 5IU1A 2HJ9C 2WKPA 1S1YA 2EA9A 3BY8A 4JGQA 5LBRA 3A0SA 5J3WA 2W3EA 3B47A 4I3AA 4I5SA 5HD5A 2W3HA 3CLOA 4MN6A 2HF6A 1S4RA 1G28A 1D06A 1LT0A 2FH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B47 A;  3B42 A; 
#chains in the Genus database with same CATH topology
 2JKT M;  2Y4A A;  4G3K A;  4EXO A;  5EV0 A;  1C3B A;  3RJU A;  5EM1 A;  4X25 A;  2VK3 A;  4PM5 A;  2IA2 A;  2J80 A;  1GA9 A;  2GDN A;  2V2F F;  3TG9 A;  3G30 A;  4IVK A;  4DKI A;  1YQS A;  5CEB A;  5F5Y A;  1MKI A;  4P87 A;  1XJ2 A;  1E3U D;  1IKG A;  1IEM A;  1ERO A;  3MZD A;  1ZTU A;  1PW1 A;  3ZVT A;  2VGK A;  1CQA A;  1WE4 A;  3ZNT A;  5CHJ A;  4E3M A;  1H8Y A;  4NXE A;  4WM9 A;  3UO9 A;  3LFV A;  1ZG4 A;  2ZL1 A;  1YSP A;  1BLP A;  4OKP A;  2PBD P;  4OPZ A;  3C4P A;  5F6A A;  5MC7 A;  3N6I A;  4R23 A;  4GHI A;  2EWW A;  2INW A;  3IXD A;  5DKL A;  3IX4 A;  2DCF A;  3IF6 A;  3ZNY A;  2JE5 A;  1YAX A;  4EBP A;  1EW0 A;  3LUQ A;  4O0P A;  3O88 A;  4FSF A;  3M2K A;  1IOU A;  3VV4 A;  4B4Z A;  3C2W A;  2BLS A;  2QYB A;  5C5K A;  3UY6 A;  4GS9 A;  1RP5 A;  1FR1 A;  2D01 A;  1RGY A;  4HQA A;  4EUV A;  1NXY A;  4X6T A;  1GHP A;  4QPR A;  5FQK A;  3TE8 A;  1TS8 A;  1K54 C;  4FUW A;  3A3J A;  1PWD A;  1P9R A;  4ZBE A;  5HDS A;  4AFI A;  1IYO A;  4OLD A;  4R3J A;  4MEZ A;  4M3K A;  2O0Y A;  3I7J A;  2H10 A;  4EBN A;  2HP6 A;  3A3D A;  5DFX A;  1CF0 A;  2AVX A;  2H28 A;  3P7N A;  1P97 A;  4S2P A;  5CHM A;  4GOG A;  2Y8H A;  3FWL A;  3H9W A;  4UA7 A;  3A0V A;  3QP8 A;  4GD6 A;  4NET A;  3HUN A;  3O5Y A;  3NHQ A;  4WF0 A;  3AGD A;  4EQ1 A;  1XA1 A;  3NOT C;  2Y59 A;  3S7Q A;  3HLC A;  3BFE A;  4G3V A;  2C6W B;  3P98 A;  4Y2F A;  3N4I A;  1W8Y A;  5EVL A;  3ZG9 B;  4QB8 A;  1DJC A;  1GHM A;  3UN7 A;  1YPR A;  2J8Y A;  3R7W A;  4Y17 A;  5G4Y A;  2M7U A;  4KQQ A;  2X71 A;  1BLS A;  4ZJ3 A;  1ODV A;  3HUO A;  3W4O A;  3IF5 A;  4HJ4 A;  1PNE A;  4M4X A;  2HPB A;  1EWZ A;  3NI9 A;  4KZ3 A;  2A49 A;  4RYE A;  2ZC4 B;  2PDR A;  2ZMV A;  1K56 A;  3C7V A;  3TW8 A;  1RCJ A;  2JKT I;  1MPL A;  4Z9Q A;  4R4S A;  3NUL A;  4K08 A;  3HLF A;  2Y2G A;  5DJT A;  3ZHH A;  3NOU C;  4S2L A;  2V0W A;  4LEN A;  4UQI M;  4Z1W A;  3IWQ A;  4OVD A;  2JKG A;  1NZU A;  3GTC A;  1H8M A;  2LB9 A;  4DDY A;  4BL3 A;  3LR4 A;  3OOV A;  1K57 A;  4P6Z S;  3GMW A;  1KVL A;  4KZ6 A;  3UMD A;  5DF7 A;  5HAP A;  5F69 A;  5HSQ A;  3FPW A;  2VEA A;  2Y2P A;  3DTM A;  5J7E A;  3KSH A;  4GLQ A;  1AXB A;  2Y2H A;  2OWH A;  3MFX A;  3KSF A;  5DTK A;  4QD4 A;  3BYD A;  2JKF A;  4YWZ A;  5FQQ A;  4H8R A;  3BWL A;  1BSG A;  3LYX A;  4XUZ A;  4F3L A;  4B9O A;  2PHY A;  3E0Y A;  1I2W A;  3IQA A;  3UPN A;  2OAQ 1;  5DF8 A;  3UPP A;  4IBR A;  4KQO A;  2W1R A;  1Z6F A;  2J9O A;  1MKM A;  1G68 A;  1K6S A;  4ZTK A;  5GHY A;  2WGW A;  2L4R A;  2V1Z A;  1ZC2 A;  1VEU B;  5TBM A;  3N8R A;  1OT9 A;  3LIE A;  2HV1 A;  5CEC A;  4GJ4 A;  2P7J A;  4R6L A;  3EEA A;  2QZ6 A;  4HY8 A;  4ZRR A;  4N9K A;  3UPO A;  1NYY A;  3W8K A;  4ZDX A;  3T4S A;  3MXQ A;  1PZP A;  4KG6 A;  5F82 A;  3TRC A;  2DNS A;  5JYP A;  2ZQ7 A;  1RGZ A;  3W4P A;  2O9B A;  2A24 A;  1ZKJ A;  3O87 A;  3PR6 A;  3PBO A;  4N9L A;  1L3L A;  3D3O A;  1KDW A;  5FSR A;  4WMC A;  1GSV A;  3EEH A;  1BUE A;  1JTG A;  2H5S A;  2JBF A;  1L0F A;  5L8M A;  1OJ5 A;  3RFB A;  1AWI A;  4LRX C;  4GD8 A;  3CWF A;  2J3W A;  3UE6 A;  4DE3 A;  2O9C A;  4JLF A;  3C5A A;  4WUJ A;  3EWK A;  2XR0 A;  5HDD A;  4CQH A;  4KQR A;  3R4K A;  4QWO A;  3VP2 A;  2K2N A;  5EPH A;  3ISG A;  4BWI A;  3VP4 A;  1P0Z A;  2VJW A;  1PI5 A;  4DXC A;  4HH2 A;  2HP5 A;  3GRJ A;  5FI2 A;  4R38 A;  2FFF B;  4ID4 A;  3UB9 A;  4DMZ A;  5FAS A;  1ACF A;  1LSW A;  3B33 A;  4II7 A;  4GW9 A;  1FCO A;  1H8Z A;  1SDE A;  3U2A A;  3C7U A;  1STZ A;  1WYC A;  1PWC A;  1L0G A;  3VP3 A;  1Y54 A;  2HJ9 C;  2WKP A;  1K0K A;  2R9X A;  4KZ7 A;  2ZM8 A;  3CJM A;  2W3E A;  4HEF A;  4I5S A;  1I5Q A;  2P9V A;  5KSH A;  5F1F A;  3HLW A;  1T1C A;  5A92 A;  4PKY A;  3SS5 A;  3ZGA B;  1ES4 A;  2OWJ A;  4WL9 A;  1G5U A;  1KGE A;  4GNU A;  1TEM A;  2XD1 A;  4MBK A;  4FH4 A;  2UWX A;  3IX3 A;  2W0N A;  5HWW A;  4N1X A;  3ZDJ A;  1KE3 A;  2XA7 M;  1YLT A;  4OPR A;  1FSY A;  3LIC A;  5J4E A;  3SOI A;  2J3T C;  2IWD A;  3HLB A;  3LY4 A;  3UB5 P;  3T4Q A;  4CPK A;  1LL8 A;  1N9O A;  3M6B A;  3OPR A;  2MJ6 A;  3QNC A;  1L0E A;  4JF6 A;  1WYB A;  4E3L A;  4OPY A;  3UDX A;  4HP4 A;  2WYX A;  4NK3 A;  4UHU A;  2QWS A;  2PR5 A;  5HPI A;  4GZB A;  2Y2N A;  4JF4 A;  5CTM A;  3KX0 X;  4Y5F A;  2GX5 A;  2GZA A;  1CEG A;  3P09 A;  1IYQ A;  1H5X A;  3T1R A;  3OPL A;  4HJ3 A;  3VP0 A;  3T4K A;  5KIZ A;  4X68 A;  1YLZ A;  4PPR A;  3VE3 A;  1ESI A;  2Y2K A;  4YIN A;  4LGW A;  2ZQC A;  4CLC B;  5CHU A;  3BFF A;  4WMC D;  2ZQD A;  4PM9 A;  2PR6 A;  1PWG A;  3ZQ5 A;  2VGL M;  5CER A;  4X53 A;  1ES3 A;  5F83 A;  4UAA A;  1PZO A;  4N1H A;  2PU2 A;  3HLE A;  1FIK A;  3LI8 A;  1E4D A;  3KSG A;  3FYZ A;  1Q2P A;  2J3T D;  2J9P A;  4LV3 A;  5AQB A;  2P9V B;  3F1O B;  4R3A A;  2Y2O A;  4LRZ E;  5L09 A;  4EW7 A;  4S2M A;  3MR0 A;  1S66 L;  3BLS A;  3ZCZ A;  3CHW P;  4BBU A;  5AVE A;  4WLA A;  2EX2 A;  5HAR A;  5HWT A;  3CPT B;  1J3W A;  2X01 A;  1L2S A;  3BQA A;  4R1G A;  5FDH A;  3FG8 A;  2DMW A;  4DJ3 A;  2Y79 A;  2ZM0 A;  2GJ3 A;  3MQO A;  3QP5 A;  3WS0 A;  2OLU A;  3PBT A;  3SZT A;  5CRF A;  3M2J A;  3SH7 A;  2ZC6 B;  4O7D A;  3MFD A;  3QP4 A;  5L2F A;  2Q9N A;  3V39 A;  4DDS A;  4NXG A;  2G2W A;  1KOU A;  2L1M A;  3DAV A;  2WAD A;  4R0Q A;  5CX7 A;  3N8L A;  3P01 A;  4S2K A;  1WA9 A;  5I94 A;  3CUE A;  3A3I A;  5CGX A;  3UE0 A;  4L9F A;  3FKW A;  4OQ0 A;  4HI4 A;  5GL9 A;  2P08 A;  1W8Q A;  5AQA A;  4QY6 A;  2Q9M A;  1OPX A;  4YOF A;  2V20 A;  3C38 A;  5EUA A;  2HDQ A;  3EGX C;  4U3T A;  1CI9 A;  4Y15 A;  5CGW A;  2XFT A;  1VQQ A;  5EFW A;  4Q8I A;  2JN7 A;  5TGF A;  4X69 A;  4E3J A;  3UNW A;  4DXB A;  1IFQ A;  1MXO A;  5EE8 A;  2BG1 A;  4I38 A;  2EXB A;  4MBH A;  3DW0 A;  1S6R A;  3JVV A;  1T1A A;  4E3I A;  1YLY A;  3IHA A;  3OPP A;  2HGV A;  2Y2L A;  1DP8 A;  3C8C A;  4I3I A;  4D60 A;  2XDM A;  2YKH A;  4S2I A;  2PRF A;  4N92 A;  4HES A;  4LPZ A;  5GLD A;  4WEL A;  2XEP A;  1XKZ A;  1ESU A;  1NY0 A;  5CXW A;  4BBV A;  1TVF A;  4K0X A;  2QJ7 A;  3PYP A;  4KZA A;  1G6O A;  4K0W A;  1VEU A;  1T1B A;  3FKV A;  4Q0I A;  4I3J A;  3T12 B;  4JXG A;  3IBR A;  3GEC A;  3S1Y A;  4WEJ A;  3ZFZ A;  5DKK A;  4O8G A;  2VZW A;  3DWZ A;  4LCL A;  2XQZ A;  1TDG A;  3CUE C;  3WS2 A;  3K3D A;  4NXB A;  4OON A;  1FCM A;  1F2K A;  3A0R A;  4RQ9 A;  1HVB A;  3E4O A;  4KG2 A;  2VV7 A;  1MWR A;  1NWZ A;  2M7V A;  3N8S A;  1TS0 A;  4JXV A;  1S4S A;  3TSG A;  3PAG A;  3G31 A;  2WUQ A;  5JYO A;  3LI9 A;  2XRO A;  5HD3 A;  3T1Q B;  2BTF P;  1SDN A;  3A3E A;  3E2L A;  4D2O A;  1LLB A;  4IUH A;  4HJ6 A;  3RH8 B;  4RX3 A;  4ZAM A;  3WS1 A;  2B02 A;  4ZJ2 A;  5DJU A;  4Y0U A;  1BUL A;  3UDI A;  3Q7V B;  1KE0 A;  4NEE D;  1FCN A;  1XXM A;  4PHT A;  1T18 A;  4GDN A;  2GNX A;  4RX2 A;  1MZU A;  2WKE A;  1NLY A;  3VP1 A;  3GQZ A;  3LIF A;  3VOZ A;  3SW1 A;  4HH3 A;  3JVU A;  3WRZ A;  2HDU A;  2WKI A;  3FPV A;  1OTB A;  4IJG A;  1HTZ A;  4P85 A;  3MKF A;  1BZA A;  1O7E A;  3PTE A;  1T19 A;  5FAQ A;  5CTN A;  2EXA A;  5IU1 A;  3BY8 A;  1S1Y A;  1JVJ A;  1D1J A;  3IH8 A;  2PU4 A;  3B47 A;  4MLL A;  1YLW A;  3DTI A;  1S4R A;  2ZMA A;  2ZLY A;  1GCE A;  2FH5 A;  5EM0 A;  3ZYT A;  1U60 A;  2HP9 A;  3ZG5 A;  4OP5 A;  1SKO B;  3C30 A;  5A91 A;  1IKI A;  1QME A;  1F9I A;  1N4O A;  3IBJ A;  4JXS A;  3SS4 A;  4Q0H A;  1K4E A;  5FA7 A;  2W27 A;  3UB7 A;  4S2N A;  3GSG A;  4KZ8 A;  5FEG A;  5FL3 A;  1XP4 A;  3EQV A;  3VSL A;  1VET B;  2B95 A;  1FSW A;  4OQH A;  4KG5 A;  5KZH A;  4OPQ A;  1K25 A;  1JTD A;  2PAV P;  4ZJ1 A;  4BLM A;  3HCY A;  3NEC A;  4Y0O A;  4H6J B;  3ZG8 B;  1KGF A;  3OZH A;  1ALQ A;  2C5W B;  2A3U A;  5FQI A;  3HLD A;  3L7H A;  4X1M A;  1P9W A;  5EOE A;  3PAE A;  2KDK A;  4OP8 A;  4HBT A;  4BBT A;  5IT5 A;  5AQ7 A;  2JKR I;  2VV8 A;  5M18 A;  4BQM A;  3T4L A;  4DE1 A;  1QMF A;  4UEY A;  3LIB A;  2KX6 A;  3UME A;  2I9V A;  4EQI A;  2QPN A;  3NDG A;  4OOY A;  1MBL A;  2ACG A;  4QU3 A;  3CAX A;  4KZ5 A;  2V1B A;  3NC8 A;  1F5M A;  4JXW A;  5FDS A;  4WYY A;  4CLC A;  4XT2 B;  5F68 A;  4LLO B;  2PYP A;  1IYP A;  5DFY A;  2RCX A;  3D4F A;  1ONH A;  3QNB A;  3F1P B;  2XFS A;  1GSW A;  3HJK A;  3OBF A;  4YFM A;  2PD8 A;  4ME4 A;  1V9Z A;  3ITA A;  3F1O A;  4JF5 A;  4S2N C;  2WZZ A;  4EUZ A;  1J9M A;  1FQG A;  1I2S A;  1XFN A;  1D7E A;  3HBR A;  5KSC A;  2Z6C A;  3CPT A;  3KYZ A;  5FAT A;  3LR3 A;  2ZM2 A;  3H7W B;  4MN5 A;  4WN5 A;  2XSS A;  3LY3 A;  2Z2L B;  1DP9 A;  2B18 A;  1VHM A;  3N7W A;  3S7N A;  3WS5 A;  1LSV A;  4PAU A;  4E6W A;  4XUX A;  4BL2 A;  2WZX A;  1YKD A;  1W5D A;  5HDC A;  1G6A A;  3O3V A;  3EQU A;  5EVI C;  2YKF A;  1TS7 A;  1MY8 A;  2OV5 A;  4EET B;  4IHQ A;  4E3N A;  2W3F A;  2OAP 1;  5EVI B;  3GVB A;  4Y7P A;  4WZ5 A;  1K6R A;  2XLN A;  3MF0 A;  3MS6 A;  1W63 Q;  2M1C A;  4MNR A;  2CC1 A;  4MDZ A;  4EEP A;  1SKF A;  3Q82 A;  1A0K A;  1S0W A;  1PI4 A;  2JCH A;  1X0O A;  5KMW A;  1YLJ A;  3F1N B;  4CLC C;  2KOI A;  4R70 A;  3VSK A;  1XA7 A;  4EEU A;  3BFD A;  2Y2I A;  3MMH A;  3L9K A;  3BM6 A;  5FQ9 A;  4FOF A;  3WS4 A;  2ZC3 B;  2H0Y A;  3LR0 A;  3SH9 A;  3BJN A;  2G7U A;  3HVF A;  1XGI A;  1DY6 A;  4EWF A;  3Q1F A;  5DVA A;  3T4T A;  5DF9 A;  3HRE A;  2IWC A;  2HJE A;  4Y3I A;  4B93 A;  1UWP X;  1ZHH B;  4HIA A;  3CG5 A;  3TJZ C;  3V67 A;  1KDS A;  5FEF A;  1H0M A;  4R4R A;  3WRT A;  2JC7 A;  4B4X A;  3T50 A;  2Y2J A;  3PXP A;  5EVI D;  1YM1 A;  3MJQ A;  2V8F A;  2XK1 A;  3K3C A;  5FAO A;  5HX9 A;  1TD5 A;  4UQI S;  2HDR A;  2X02 A;  2WKQ A;  3HUM A;  4EER A;  4U0T A;  4E3O A;  4DJ2 A;  1PIO A;  2G2U A;  2XD5 A;  2UV0 E;  3E4Q A;  4QHC A;  4XXR A;  5I5L A;  4Q0J A;  5FQJ A;  4I39 A;  4KUO A;  3T4J A;  3DWK A;  1O07 A;  4G3W A;  4HBU A;  1JWZ A;  4CLC D;  3V3S A;  2W1T A;  2VX8 A;  2RL3 A;  1NRF A;  1K55 A;  1YSQ A;  1XPB A;  4WZ5 C;  4FD8 A;  4PM6 A;  2V1A A;  5E2E A;  1IEL A;  5U47 A;  2Z2M B;  4KUK A;  1V9Y A;  5A93 A;  3T1X A;  3H82 B;  3ZVW A;  3U4L P;  3VMA A;  1MC0 A;  1CK3 A;  1PRQ A;  2I72 A;  4MCW A;  3PBQ A;  4FTX A;  2WKR A;  5AQ9 A;  4NXF A;  4A5R A;  2W3G A;  4QY5 A;  4HOI A;  4ETZ A;  5GLA A;  3G34 A;  5EEC A;  2J7V A;  3Q7V A;  2IWB A;  3EOI A;  2EX8 A;  3D72 A;  3QP6 A;  1S67 L;  4DF6 A;  3FZC A;  3B3X A;  2PYR A;  3BEC A;  4BJP A;  1M6K A;  3M6H A;  3PHY A;  4E3K A;  1PFL A;  1BLH A;  4PMA A;  3T1S A;  3IXB A;  2V0U A;  2ZQ9 A;  5A90 A;  4S2J A;  3LID A;  3S7P A;  3IS2 B;  3G2Z A;  1YT4 A;  4JGR A;  3NOP C;  1Z09 A;  4EES A;  1KE4 A;  1HD8 A;  2VKS A;  2K31 A;  1YLP A;  3K2N A;  4JPM A;  1ONG A;  2EA9 A;  4JGQ A;  4KZ4 A;  3A0S A;  2W3H A;  1JWP A;  4MN6 A;  2HF6 A;  3BFG A;  1G28 A;  2Q0O A;  4OH0 A;  5DTT A;  1K55 C;  1ZG6 A;  1TS6 A;  3MBZ A;  2ZQA A;  2HZ5 A;  4KEN B;  3E98 A;  2W3D A;  4GKU A;  1SKO A;  3W2Z A;  1Y4O A;  1ERQ A;  2EFX A;  2W1T B;  4X55 A;  2E8J A;  3FV7 A;  1XJ6 A;  3CMZ A;  4MBF A;  3IWI A;  2JKR M;  1L0D A;  3O86 A;  3NIA A;  3BFC A;  1SZV A;  3VFH A;  2WAE A;  4X1L A;  3S7O A;  1VET A;  5A8B A;  1ES5 A;  2OSU A;  2V8C A;  1M40 A;  3IT9 A;  5GLC A;  2P74 A;  4OOL A;  3FC7 A;  4JKT A;  3PBS A;  3KSI A;  4P6B A;  5TR7 A;  3Q81 A;  5F1G A;  1TF1 A;  2B5R A;  2ZL1 B;  4NG2 A;  3LIA A;  3QHY A;  4RVA A;  5M1A A;  4FH2 A;  2VA0 A;  4H6J A;  2ZOH A;  3IF6 C;  4C6Y A;  1DRM A;  4PM7 A;  1LHY A;  2EFU A;  2EWV A;  4GHI B;  1BYW A;  1H3Q A;  1S1Z A;  5FI7 A;  3G6O A;  3W4Q A;  2Y91 A;  3GV9 A;  4YNR A;  3LEQ A;  5BOH A;  3WWX A;  3ZG7 B;  1CJF A;  4IUK A;  3IF6 B;  3GR2 A;  4MN7 A;  1NLZ A;  3CI6 A;  3G4P A;  2VLG A;  4E04 A;  2BAS A;  3B42 A;  1W7F A;  4PM8 A;  2WK0 A;  2D02 A;  4S2O A;  3CIT A;  3VFF A;  3HJI A;  4GS9 B;  5HZH A;  5FQM A;  4ARZ A;  2XH9 A;  3RXX A;  2P04 A;  4GN2 A;  2HDS A;  2NUT C;  1JNU A;  4K91 A;  3KO6 A;  3LO7 A;  2H0T A;  2PT7 A;  1UGU A;  2QHK A;  1VM1 A;  2ZOI A;  4XT2 A;  3Q07 A;  4WBG A;  1LI9 A;  1XX2 A;  4GDB A;  4UA9 A;  4BEN A;  3V50 A;  2XA7 S;  4GB7 A;  5IHV A;  5GHX A;  1OTE A;  3T4O A;  3IHB A;  5HL1 A;  4L0L A;  3QP1 A;  3DTE A;  4P0M A;  2WGI A;  1BT5 A;  1OT6 A;  3F1P A;  4JBF A;  1TDL A;  5E43 A;  2O99 A;  1GSX A;  1NJ4 A;  3G32 A;  4L9G A;  4FCF A;  1NZO A;  2FZ0 A;  2EX6 A;  3BLM A;  4WZ4 A;  1N9N A;  4RA7 A;  2WGV A;  4Y0T A;  1CI8 A;  1HZO A;  3GDI A;  4IBX A;  3UDF A;  4C3Q A;  1SCW A;  2XF3 A;  1LL5 A;  2XGN A;  1XFQ A;  4MMN A;  3H7W A;  3A3F A;  2L0W A;  1DP6 A;  3R7W B;  5E2H A;  3PBN A;  3JPU A;  3ZG0 A;  4U0X A;  1E25 A;  1K4F A;  2ZD8 A;  4BD1 A;  3V5M A;  5D3O A;  3LCE A;  2NUP C;  2Y2M A;  1MWU A;  4WEK A;  2JHE A;  3JYI A;  1DJB A;  5DTS A;  3AGE A;  3KYE A;  2VGL S;  5TJJ A;  1FIL A;  3S4X A;  2R9W A;  2WKH A;  4OQI A;  4O01 A;  5EVI A;  4PKY G;  5L07 A;  3MZE A;  1K57 C;  1F98 A;  3AGF A;  5GHZ A;  2OLV A;  5TFQ A;  3VE4 A;  3HL9 A;  3LGO A;  2ZQ8 A;  3Q7Z A;  5HWV A;  3BQ8 A;  4DE2 A;  4OQG A;  4UA6 A;  5HFO A;  2VV6 A;  5J8X A;  3CZD A;  3LEZ A;  5M19 A;  3BRM A;  3F1N A;  2KLI A;  4JGO A;  3SH8 A;  3E4P A;  4ARZ B;  4LFU A;  4E6X A;  1BLC A;  3MXR A;  1N9B A;  5HPF A;  4LV1 A;  4ESP A;  4BMW A;  4EU0 A;  5GLB A;  1Y28 A;  2V9A A;  1HLU P;  3SS3 A;  3IWO A;  4OLG A;  4KZ9 A;  1KGG A;  2EX9 A;  1ES2 A;  2R78 A;  4DRT A;  4EV4 A;  1ERM A;  3VOY A;  4JGP A;  4DN0 A;  1FOF A;  1LL9 A;  1PW8 A;  3NCK A;  1E3U A;  4F3L B;  2PBY A;  1K56 D;  2E8I A;  3G35 A;  3LR5 A;  3MQQ A;  5G18 A;  2ZMF A;  3MQ0 A;  1XGJ A;  3ULF A;  3IH9 A;  2PD7 A;  1FR6 A;  3S22 A;  4OOM A;  1PYY A;  1JWV A;  2K7S A;  4CLC E;  4ETX A;  1NYM A;  2WGW B;  1OJG A;  3QP2 A;  3MKE A;  4P6Z M;  5TBM B;  3OCL A;  1OTA A;  4L9E A;  2VGJ A;  1XJ4 A;  3NJA A;  1OTD A;  3HLG A;  1LSX A;  4Y13 A;  1DJA A;  1BTL A;  1CEF A;  4LV0 A;  3UE1 A;  3IXH A;  3NDE A;  3MZF A;  3ITB A;  1GHI A;  3BY9 A;  2A2L A;  3BEB A;  3RTY A;  5EVE A;  5HAI A;  2ZJ9 A;  2CMN A;  5EOO A;  3UB6 A;  1W79 A;  3MSH A;  1LI0 A;  4LV2 A;  1OME A;  5G4Z A;  1KVM A;  5L10 A;  2A24 B;  4B88 A;  5HL6 A;  3E2K A;  4HP9 A;  3NY4 A;  3OLO A;  3PBR A;  4HNB A;  1VB6 A;  4C75 A;  3EGD C;  5E2F A;  1MWT A;  3V3R A;  1IYS A;  2QMI A;  5K5B A;  3H82 A;  4LRY C;  3UB8 A;  4KQD A;  3ICY A;  3OC2 A;  4F94 A;  2ZBB A;  3UE3 A;  3NBL A;  2O9A A;  4KZB A;  4CJN A;  5E2G A;  2WAF A;  1XJ3 A;  3OPH A;  1EI5 A;  2ZC5 B;  1UWN X;  4IVI A;  1NRJ A;  1SHV A;  3KYQ A;  2DRW A;  1Q2Q A;  4GCZ A;  2QJ5 A;  1W63 M;  2Y2Q A;  5FAP A;  3TOI A;  4DE0 A;  5IS1 A;  4R3B A;  5HAQ A;  3DTK A;  3MXS A;  3VOL A;  4HHD A;  2QKP A;  3BW6 A;  5AJG A;  2OOL A;  2Z6D A;  4NKP A;  4EBL A;  3RXW A;  3IXG A;  4IED A;  3G2Y A;  5FI6 A;  4LCM A;  5CGS A;  2XRN A;  5HW3 A;  2LB5 A;  1YMX A;  3C4O A;  3IS2 A;  5CED A;  2ZC7 A;  3OCN A;  3D9Y A;  1N9L A;  2Y55 A;  1OTI A;  1YMS A;  3IX8 A;  5AVF A;  3DBA A;  5LBR A;  5J3W A;  4I3A A;  5HD5 A;  3CLO A;  4QJG A;  1K54 A;  1K38 A;  1MWS A;  1D06 A;  2FFY A;  1LT0 A;  4X56 A;  4BD0 A;  1GA0 A; 
#chains in the Genus database with same CATH homology
 5KSH A;  2JKT M;  1TS6 A;  3ZYT A;  1T1C A;  4G3K A;  4EXO A;  4PKY A;  3E98 A;  2W3D A;  3C30 A;  2OWJ A;  3W2Z A;  2IA2 A;  1F9I A;  3IBJ A;  2J80 A;  4WL9 A;  2W1T B;  4Q0H A;  2W27 A;  3UB7 A;  1XJ6 A;  2JKR M;  5F5Y A;  5FL3 A;  3EQV A;  2W0N A;  5HWW A;  1XJ2 A;  3S7O A;  5A8B A;  2XA7 M;  1ZTU A;  3LIC A;  5J4E A;  2J3T C;  4OOL A;  3FC7 A;  3PBS A;  3KSI A;  4NXE A;  3T4Q A;  3HCY A;  1TF1 A;  3LFV A;  3LIA A;  1YSP A;  4H6J B;  2VA0 A;  1LL8 A;  1N9O A;  4H6J A;  2ZOH A;  2MJ6 A;  1DRM A;  5F6A A;  5MC7 A;  2EWV A;  4GHI B;  1BYW A;  1H3Q A;  1S1Z A;  4GHI A;  3G6O A;  2EWW A;  4HP4 A;  4YNR A;  2INW A;  1P9W A;  5DKL A;  2QWS A;  2PR5 A;  4IUK A;  2KDK A;  5HPI A;  4MN7 A;  4BBT A;  1NLZ A;  3CI6 A;  5IT5 A;  1YAX A;  3KX0 X;  4Y5F A;  2JKR I;  2GX5 A;  2GZA A;  2VLG A;  1EW0 A;  2VV8 A;  4E04 A;  3LUQ A;  3T4L A;  2BAS A;  4O0P A;  3B42 A;  4UEY A;  3LIB A;  2KX6 A;  3UME A;  4FSF A;  1IOU A;  2I9V A;  3VV4 A;  2D02 A;  3C2W A;  2QYB A;  3CIT A;  4HJ3 A;  5C5K A;  3HJI A;  3T4K A;  5KIZ A;  4GS9 B;  5HZH A;  4GS9 A;  3VE3 A;  4ARZ A;  3CAX A;  2P04 A;  2V1B A;  2D01 A;  2NUT C;  4HQA A;  1JNU A;  4EUV A;  1F5M A;  3KO6 A;  4CLC B;  4QPR A;  4CLC A;  3TE8 A;  4XT2 B;  2PT7 A;  1UGU A;  2QHK A;  2ZOI A;  4XT2 A;  1TS8 A;  2PR6 A;  5F68 A;  3ZQ5 A;  4LLO B;  2PYP A;  2VGL M;  2XA7 S;  1P9R A;  5HDS A;  4AFI A;  5DFY A;  1OTE A;  3T4O A;  4L0L A;  3LI8 A;  2O0Y A;  3F1P B;  1OT6 A;  3KSG A;  3F1P A;  2O99 A;  1GSX A;  5DFX A;  1GSW A;  3HJK A;  3OBF A;  2J3T D;  4L9G A;  2H28 A;  2FZ0 A;  3P7N A;  1P97 A;  2PD8 A;  3F1O B;  4ME4 A;  4R3A A;  1V9Z A;  4LRZ E;  3F1O A;  4EW7 A;  1N9N A;  3MR0 A;  2Y8H A;  1S66 L;  3H9W A;  3A0V A;  3GDI A;  3O5Y A;  1XFN A;  1D7E A;  3NHQ A;  4WLA A;  5AVE A;  4BBU A;  4WF0 A;  4EQ1 A;  5HWT A;  3NOT C;  3S7Q A;  4G3V A;  2Z6C A;  1XFQ A;  3KYZ A;  3BQA A;  4Y2F A;  3LR3 A;  4MMN A;  3H7W B;  3FG8 A;  4MN5 A;  4WN5 A;  2DMW A;  2XSS A;  3H7W A;  4DJ3 A;  2Y79 A;  2GJ3 A;  3MQO A;  2L0W A;  1DP6 A;  3R7W B;  3PBN A;  3PBT A;  1DP9 A;  3R7W A;  2B18 A;  1VHM A;  5G4Y A;  2M7U A;  3S7N A;  1LSV A;  1ODV A;  4PAU A;  2NUP C;  4HJ4 A;  4M4X A;  1YKD A;  5HDC A;  4NXG A;  3EQU A;  1KOU A;  4WEK A;  2JHE A;  2L1M A;  2YKF A;  1TS7 A;  5CX7 A;  3P01 A;  2PDR A;  1WA9 A;  2ZMV A;  2VGL S;  3CUE A;  5TJJ A;  4EET B;  4IHQ A;  3TW8 A;  2JKT I;  4L9F A;  4HI4 A;  2W3F A;  2OAP 1;  4K08 A;  4O01 A;  5DJT A;  4PKY G;  2P08 A;  3MF0 A;  3NOU C;  1W63 Q;  2V0W A;  4UQI M;  2M1C A;  1F98 A;  4Z1W A;  4MDZ A;  3VE4 A;  4EEP A;  1OPX A;  5HWV A;  3BQ8 A;  4YOF A;  3C38 A;  2VV6 A;  3EGX C;  1X0O A;  1H8M A;  2LB9 A;  3F1N B;  2KOI A;  3LR4 A;  4CLC C;  3F1N A;  3OOV A;  2KLI A;  4JGO A;  4P6Z S;  4R70 A;  5EFW A;  3E4P A;  2JN7 A;  4ARZ B;  4EEU A;  3UMD A;  5HPF A;  3MMH A;  5F69 A;  1IFQ A;  5HSQ A;  3FPW A;  4BMW A;  2VEA A;  4EU0 A;  4FOF A;  1Y28 A;  2V9A A;  3LR0 A;  5J7E A;  4I38 A;  3BJN A;  3KSH A;  2G7U A;  4GLQ A;  3T4T A;  3JVV A;  2OWH A;  5DF9 A;  1T1A A;  2R78 A;  3MFX A;  3KSF A;  2HGV A;  2HJE A;  1DP8 A;  4Y3I A;  4YWZ A;  4JGP A;  3C8C A;  4I3I A;  3BWL A;  4B93 A;  4DN0 A;  1UWP X;  1ZHH B;  4HIA A;  3LYX A;  4F3L B;  3TJZ C;  4F3L A;  3V67 A;  4B9O A;  2YKH A;  2PHY A;  3LR5 A;  3MQQ A;  3E0Y A;  2ZMF A;  3T50 A;  2OAQ 1;  4LPZ A;  3PXP A;  3MQ0 A;  3ULF A;  2PD7 A;  4KQO A;  4WEL A;  2W1R A;  3MJQ A;  4OOM A;  1MKM A;  2K7S A;  3K3C A;  4CLC E;  4ETX A;  4BBV A;  1TD5 A;  1OJG A;  2L4R A;  2QJ7 A;  4UQI S;  3PYP A;  1G6O A;  4P6Z M;  5TBM B;  5TBM A;  1T1B A;  2WKQ A;  4Q0I A;  3OCL A;  1OTA A;  4L9E A;  4EER A;  1OT9 A;  4I3J A;  1XJ4 A;  3NJA A;  1OTD A;  3IBR A;  3LIE A;  1LSX A;  3GEC A;  2HV1 A;  4DJ2 A;  4GJ4 A;  2P7J A;  3E4Q A;  4R6L A;  4WEJ A;  3EEA A;  5DKK A;  5I5L A;  4Q0J A;  4HY8 A;  4O8G A;  2VZW A;  4I39 A;  4KUO A;  4ZRR A;  3T4J A;  3BY9 A;  2A2L A;  3CUE C;  3RTY A;  4G3W A;  3K3D A;  4NXB A;  2CMN A;  3UB6 A;  3A0R A;  3T4S A;  3MXQ A;  4RQ9 A;  4CLC D;  2W1T A;  2VX8 A;  3TRC A;  3E4O A;  1YSQ A;  5G4Z A;  2O9B A;  2A24 B;  2VV7 A;  2A24 A;  5HL6 A;  2V1A A;  1NWZ A;  4HP9 A;  3PBR A;  3OLO A;  1TS0 A;  2M7V A;  4HNB A;  1VB6 A;  1S4S A;  3PR6 A;  3EGD C;  3PBO A;  4KUK A;  3D3O A;  3LI9 A;  1V9Y A;  2XRO A;  1GSV A;  3H82 B;  5K5B A;  3EEH A;  3H82 A;  5HD3 A;  4LRY C;  3UB8 A;  5L8M A;  4KQD A;  1OJ5 A;  3ICY A;  3OC2 A;  3RFB A;  2ZBB A;  1MC0 A;  4LRX C;  3UE3 A;  2O9A A;  4IUH A;  3CWF A;  4HJ6 A;  4MCW A;  2J3W A;  1XJ3 A;  3PBQ A;  3RH8 B;  3UE6 A;  2O9C A;  2WKR A;  4NXF A;  2W3G A;  1UWN X;  1NRJ A;  2B02 A;  4HOI A;  3KYQ A;  5DJU A;  4ETZ A;  4WUJ A;  3EWK A;  4GCZ A;  2QJ5 A;  5HDD A;  1W63 M;  4CQH A;  3R4K A;  4NEE D;  4PHT A;  1T18 A;  3EOI A;  2GNX A;  2K2N A;  5IS1 A;  4BWI A;  1MZU A;  1P0Z A;  3D72 A;  2VJW A;  1S67 L;  1NLY A;  4HH2 A;  3VOL A;  4R38 A;  2PYR A;  4HHD A;  2QKP A;  3LIF A;  4BJP A;  3PHY A;  3UB9 A;  3BW6 A;  5AJG A;  4DMZ A;  3SW1 A;  4HH3 A;  3JVU A;  2OOL A;  2Z6D A;  4NKP A;  2V0U A;  1LSW A;  3LID A;  2XRN A;  3FPV A;  1OTB A;  2LB5 A;  3S7P A;  3B33 A;  3IS2 B;  4IJG A;  4II7 A;  4GW9 A;  4JGR A;  3IS2 A;  3NOP C;  4EES A;  3OCN A;  1N9L A;  3U2A A;  1OTI A;  2VKS A;  1T19 A;  2K31 A;  1STZ A;  3K2N A;  5AVF A;  3DBA A;  5IU1 A;  2HJ9 C;  2WKP A;  1S1Y A;  2EA9 A;  3BY8 A;  4JGQ A;  5LBR A;  3A0S A;  5J3W A;  2W3E A;  3B47 A;  4I3A A;  4I5S A;  5HD5 A;  2W3H A;  3CLO A;  4MN6 A;  2HF6 A;  1S4R A;  1G28 A;  1D06 A;  1LT0 A;  2FH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...