5E43A

Crystal structure of beta-lactamase sros_5706 from streptosporangium roseum
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
GARARKELRTLEASFKGRIGAYAVDTATGKTITYRSGERFPLLSTFKAIAAAAVLHKARTSDPGLLNKVVHWTTAELQEHSPVTGKHVKDGMTVARLCEAAITRSDNTAANMLLKQIGGPAGLTAYFHTLKDPVSRLDRWETELNNWSPKEKRDTTTPASMGRDLRAVTTGDALDARDRERLNAWLTANKTGDARIRAGLPKTWTVGDKTGTNSKYGAGNDIAVVWPGKSAAPIIMSIYTNRGAADAAVDDKVIADTAAILARALGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of Beta-lactamase Sros_5706 from Streptosporangium roseum
rcsb
source organism Streptosporangium roseum (strain atcc 12428 / dsm 43021 / jcm 3005 / ni 9100)
molecule tags Hydrolase
total genus 90
structure length 268
sequence length 268
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e43A00
2J9OA 3WRZA 2HP9A 3ITAA 2HDUA 5FA7A 3PAEA 1ERMA 4GNUA 1JWVA 5CXWA 2XLNA 4DE0A 3TG9A 4KZAA 3G35A 5TGFA 3ZGAB 2UWXA 4JF5A 4X69A 1IKGA 1KGGA 3C7UA 1FQGA 3WS4A 1HD8A 1PYYA 3FZCA 4U3TA 1PIOA 5EVID 2ZC6B 3Q1FA 4ZJ3A 4FH4A 3A3FA 1ESUA 1RP5A 1JVJA 2ZLYA 5KSCA 4KZBA 2Q9NA 4QHCA 1CEFA 3Q7ZA 5HAIA 4R0QA 2XH9A 2RL3A 5DF8A 3JYIA 1ES5A 2XGNA 2WK0A 4WZ4A 1MPLA 1SCWA 3PAGA 3VSKA 3O86A 1PW1A 3UPOA 4HEFA 3MZDA 3SH8A 4OOMA 3BLMA 4OKPA 1L0EA 5FATA 3TSGA 4BL3A 3C5AA 2EFXA 4LV3A 3S1YA 4EWFA 1BLCA 5HAPA 4HBUA 5M18A 4KZ3A 5IHVA 2G2WA 2EXBA 5HW3A 3N6IA 5EECA 3BFDA 3N8SA 1H8ZA 3G4PA 5CTMA 2ZM2A 1O7EA 4X68A 4S2KA 4N9LA 4DXBA 1W8YA 1C3BA 3HUOA 4PPRA 5F83A 1KGFA 4DDSA 2X01A 4LV2A 4U0TA 2RCXA 4GD8A 3IH9A 1DJAA 5GHYA 3DW0A 3AGFA 1ONHA 2ZC5B 4RVAA 2QPNA 4WYYA 3RXXA 1L2SA 1LL9A 1G68A 1HTZA 3LCEA 3M2KA 5G18A 4BQMA 4C6YA 3IF6B 4GB7A 3NDEA 3W4QA 2WAFA 4PMAA 3ZCZA 1I5QA 4R23A 4X53A 1YLYA 2JE5A 3OPPA 1L0FA 5EVIB 4QB8A 3WS0A 3HUMA 5GLCA 4EUZA 1CI9A 2Y2NA 1XP4A 3OPRA 1M6KA 1LI9A 3O88A 1EROA 3FV7A 3IHAA 2DRWA 5FI7A 3OCNA 1ZC2A 4A5RA 2Y2LA 1WYBA 2Y4AA 4IVIA 1XPBA 3A3DA 1IYPA 4JF6A 3NC8A 4OPRA 2IWDA 5FQQA 4K91A 5TFQA 5I94A 3IXGA 4H8RA 5FASA 1YT4A 1BTLA 5DTKA 2FFYA 1YM1A 1KE3A 4FH2A 5FAPA 3ZG0A 4U0XA 4LCLA 1H8YA 1MXOA 3IXHA 2BLSA 4ZBEA 4R3JA 2QMIA 1YMXA 2XDMA 3C4PA 3CZDA 4GOGA 3D4FA 2PBYA 3G32A 3M6BA 4ZJ2A 2EX2A 2R9XA 5CEDA 1IELA 2R9WA 2WKEA 2ZM8A 3W8KA 3VP1A 3DWKA 4WEJA 2Y59A 3MZEA 3NY4A 1MWSA 3GVBA 3M2JA 4DE3A 3P09A 1GHMA 3DWZA 4BD0A 4JXWA 4S2JA 3UY6A 4PM8A 1BSGA 3N8LA 1ES3A 5FQIA 3G31A 3HLEA 2XFSA 2WGVA 3HLBA 5CRFA 3FKWA 3ZHHA 3O3VA 4JXSA 5FAOA 4P6BA 3HLCA 1K4FA 3V3SA 1ALQA 2HDSA 2ZQ7A 2DCFA 3LY3A 1PWDA 4PM7A 3GRJA 3UE3A 1FR6A 4GDNA 2HDQA 3WS1A 1IEMA 1CEGA 2QZ6A 4WMCA 1YLTA 2JC7A 4MBFA 3VP3A 4OPQA 3FYZA 4RX2A 3E2LA 2WZZA 4WBGA 3IXBA 5KSHA 4HESA 2OLVA 2EFUA 3AGEA 1BT5A 4P85A 4QD4A 3SOIA 4RYEA 4E3MA 1QMFA 1KDSA 4P87A 2GDNA 1E4DA 1Q2PA 2BG1A 5EVIA 3PBOA 4XXRA 5FAQA 2H0TA 2Y2KA 4GD6A 1K6SA 1XXMA 1TEMA 5CERA 2EX6A 1TDGA 2ZC3B 4OPYA 4UAAA 5EPHA 5EVIC 4D2OA 4E6XA 3OC2A 3MKEA 4RX3A 4WEKA 2XR0A 3BEBA 5E2HA 3EQUA 2P9VB 4S2MA 3IT9A 3I7JA 1G6AA 1RGZA 4OQHA 4ZTKA 2HPBA 3BRMA 4KZ5A 2Q9MA 1WE4A 4N1HA 1GCEA 3NBLA 1K38A 4OOYA 3NDGA 4Y0UA 3VSLA 1E25A 4DE1A 4FCFA 1J9MA 1PZOA 1LL5A 3UPPA 3ZG8B 4N92A 1ES4A 4OLGA 4P0MA 4Z9QA 1CK3A 5KZHA 1KGEA 4GN2A 2ZD8A 4DDYA 4MBKA 5JYOA 3ZVWA 1DJBA 5E43A 4CPKA 4OONA 4E3JA 1JTGA 2OSUA 5M1AA 1BLHA 5EVLA 3QNBA 2JCHA 3GR2A 1S0WA 1BZAA 1EWZA 1ZKJA 4UA7A 4CJNA 4KZ7A 2HP6A 3BFGA 5M19A 4B88A 3NIAA 2ZQCA 3PTEA 5HL1A 4K0XA 3Q81A 4S2NA 3NI9A 4JBFA 3IWQA 4QY5A 1XGIA 1BLSA 1CI8A 1FOFA 1YLZA 3BECA 4S2NC 3W4OA 4EBPA 4KZ6A 2Y2HA 5CGSA 4UHUA 1MWRA 3Q7VB 5FI2A 1PWGA 1XKZA 2C6WB 3IWOA 4OQ0A 3CG5A 3UDXA 1HVBA 1QMEA 2VGKA 2VGJA 3DTMA 4E3IA 2ZC7A 4QJGA 4JXGA 5EOOA 3N8RA 2Y2GA 2XQZA 2ZJ9A 5A92A 3EQVA 5CTNA 4FD8A 3VP0A 1K57A 3MFDA 5AQ9A 4KZ4A 4FSFA 1ESIA 4XUXA 1W7FA 1TDLA 1H5XA 1K57C 1YQSA 3HLGA 1Q2QA 1ZG6A 3GMWA 4KZ8A 2XK1A 1N4OA 4EBLA 3PBTA 1I2WA 3UPNA 3LO7A 5GLBA 1SKFA 5E2GA 4PM5A 2WKHA 2XD1A 4OVDA 5CGXA 1N9BA 3IQAA 3HLFA 4WZ5A 3SH7A 3O87A 4JF4A 1AXBA 1ES2A 4EQIA 2Y91A 4JKTA 5F1FA 1PI4A 5HX9A 4DRTA 4WZ5C 2P9VA 1JWPA 4E6WA 1L0GA 4R4SA 4Q8IA 3NCKA 1JWZA 5HFOA 4IEDA 5AQ7A 1K56D 1YLPA 2CC1A 3N4IA 3VMAA 2G2UA 3IWIA 2ZQDA 4YFMA 1ERQA 2PU4A 3HLWA 3CJMA 3CMZA 1FSYA 3IHBA 4B4XA 2Y2QA 1Z6FA 1MBLA 3C7VA 4GKUA 5F1GA 1MY8A 2ZC4B 3B3XA 3PBQA 3Q82A 2H10A 5CHMA 1K55A 4E3KA 5CGWA 5EUAA 1W5DA 3SH9A 4EBNA 2X71A 4R1GA 1K55C 1HZOA 1YMSA 1SDEA 2HDRA 2Y55A 5CHUA 4GDBA 5A93A 1XX2A 4N9KA 4X55A 3G34A 4OLDA 2PU2A 4PM9A 2X02A 4KQOA 1NYMA 3UNWA 2Z2MB 2Z2LB 2ZMAA 1BLPA 1RCJA 3BFCA 1TVFA 5E2FA 5E2EA 3FWLA 3LEZA 3UE1A 3P98A 4S2PA 3TOIA 3HVFA 2Y2PA 5EE8A 2C5WB 1PW8A 3MXSA 4QY6A 5EOEA 4O7DA 3IH8A 1E3UD 3BYDA 1IYSA 5DTTA 3IF6A 3QHYA 4C3QA 3OPHA 4UA6A 4ZDXA 4E3OA 4MEZA 1FCNA 5DF7A 3IF6C 4X6TA 3WS5A 3Q7VA 4DE2A 4KZ9A 1KE0A 3ZG7B 1IYOA 3HREA 1SDNA 4KG6A 5DVAA 3WWXA 4BENA 4E3LA 1KE4A 4YINA 3UDIA 2OV5A 1NJ4A 4ZAMA 2H0YA 3ISGA 1JTDA 3V5MA 4B4ZA 3ZG9B 2ZQ8A 3MZFA 4KENB 4PM6A 4E3NA 5HAQA 2WGWB 3MBZA 1VM1A 5AQBA 5GLDA 3BLSA 5CHJA 1K54A 1NXYA 3MXRA 4K0WA 5FSRA 4BJPA 5CECA 2OLUA 1K54C 1PI5A 3AGDA 3G30A 3ZDJA 2WUQA 3OZHA 4L0LA 3UN7A 1BUEA 1W79A 4S2LA 4S2IA 4BL2A 4ID4A 3BFFA 3VP2A 3V50A 5U47A 5TR7A 1PWCA 4OP5A 4KQQA 2WYXA 2V20A 2EX8A 5GHZA 2XEPA 3M6HA 1L0DA 1O07A 2XFTA 4R4RA 5A91A 5GHXA 4MLLA 3RXWA 3WRTA 4BD1A 5GLAA 3V3RA 1IKIA 3GTCA 4WELA 1MWTA 4OQGA 4IVKA 3HLDA 5FDHA 2DNSA 2ZQAA 4KQRA 2J9PA 4KG5A 3VP4A 1MWUA 1M40A 3N7WA 3SS3A 2IWCA 4M3KA 4Y7PA 2V1ZA 1VQQA 4JPMA 1KVLA 3ZNTA 3BFEA 1KVMA 1K25A 2H5SA 1DJCA 1I2SA 5D3OA 1DY6A 4LCMA 1GHPA 3ZFZA 5BOHA 2V2FF 1NZOA 3FKVA 1K4EA 4Y0OA 3QNCA 3A3JA 2WKIA 3PBSA 2E8IA 4IBXA 3G2YA 4ZJ1A 5FQ9A 4HBTA 3UDFA 1IYQA 1RGYA 4WM9A 1NY0A 1XA7A 3HL9A 4UA9A 2B5RA 5DF9A 4F94A 2WAEA 2I72A 3WS2A 4KG2A 4RA7A 3BM6A 3VOYA 2JBFA 5AQAA 4QU3A 4LENA 1LHYA 1LLBA 1GHIA 3VFFA 1XA1A 2HP5A 2Y2OA 4N1XA 4NK3A 5FQMA 4MBHA 2Y2IA 3S22A 2P74A 4LV0A 4JXVA 4NETA 3IF5A 5JYPA 3LY4A 3PBRA 2WGIA 2FFFB 3VOZA 2A49A 4Y0TA 3PBNA 1FSWA 2WGWA 1Y54A 1S6RA 2Y2JA 1FCMA 1K56A 1YLJA 1ZG4A 5F82A 1NYYA 4DKIA 2ZM0A 4LV1A 5A90A 4GZBA 4OPZA 4XUZA 2IWBA 2J7VA 1LI0A 3SS4A 3OCLA 5KMWA 3GQZA 5FQJA 1NZUA 3S4XA 4R3BA 4DF6A 4OH0A 1NRFA 4OOLA 5GL9A 3ZVTA 5FQKA 3SS5A 1GA0A 1SHVA 4C75A 2EXAA 3UO9A 2Y2MA 3GSGA 4OP8A 1OMEA 4MNRA 5DTSA 5FI6A 2XD5A 3E2KA 4S2OA 3G2ZA 3RJUA 4OQIA 1EI5A 2ZQ9A 1ONGA 4IBRA 3UE0A 3IXDA 3ITBA 3HUNA 4X56A 1XGJA 3C4OA 4JLFA 3GV9A 3VFHA 3ZNYA 3ZG5A 5HARA 3HBRA 1FR1A 1WYCA 1E3UA 1W8QA 3OPLA 1PZPA 2J8YA 1MKIA 1K6RA 4EV4A 1FCOA 3A3EA 2A3UA 2EX9A 2WADA 1KDWA 1YLWA 5CEBA 5L2FA 1BULA 3Q07A 5J8XA 2WZXA 3V39A 3W4PA 4BLMA 1GA9A 4DXCA 4WMCD 2XF3A 3A3IA 3MKFA 1U60A
chains in the Genus database with same CATH superfamily
2A24B 2J9OA 2HV1A 2HDUA 5FA7A 1JNUA 4GNUA 5CXWA 2XLNA 4DE0A 3EGDC 3ZGAB 1IKGA 5DFYA 1HD8A 4U3TA 4ZJ3A 4IHQA 4I3AA 1RP5A 1JVJA 5J4EA 1F5MA 2AVXA 4R0QA 3C30A 1TS7A 4EW7A 3JYIA 4WZ4A 3PAGA 4Q0JA 3MZDA 3SH8A 1DRMA 5FATA 3TSGA 2EFXA 4EWFA 2VGLM 4NXGA 4KZ3A 5IHVA 5HW3A 2EXBA 2W1RA 5EECA 1H8ZA 4IUKA 4S2KA 4N9LA 4X68A 2PAVP 5F83A 4DDSA 2X01A 3DW0A 3AGFA 4HJ4A 4I5SA 4WYYA 3B42A 4C6YA 5EM1A 3IF6B 2WAFA 4R23A 1YLYA 2JE5A 3MQQA 5EVIB 3T4KA 1CI9A 1XP4A 2EA9A 1GSXA 1M6KA 1LI9A 1NLYA 3O88A 4CLCB 3IHAA 5FI7A 1OTDA 1ZC2A 4DN0A 3A3DA 4R3AA 5TFQA 5I94A 1T18A 4H8RA 4PAUA 1BTLA 1KE3A 4FH2A 1UWNX 1MXOA 2XDMA 3CZDA 3G32A 3M6BA 2R9WA 3T4JA 5FEGA 3KSFA 2D01A 4HH3A 4DE3A 3E4OA 1IOUA 3UY6A 1BSGA 2KDKA 3N8LA 3HLEA 3HLBA 4BBUA 2UV0E 1ALQA 2HDSA 2HDQA 1GSWA 4HY8A 3UE6A 2QZ6A 1YLTA 3TJZC 4OPQA 3FYZA 4RX2A 1Y4OA 2PD7A 3E2LA 4HESA 4G3KA 4HQAA 2EFUA 3AGEA 1OJ5A 3SOIA 2Q0OA 3IX8A 1E4DA 1Q2PA 5L10A 5EVIA 4GD6A 5TJJA 2EX6A 1TDGA 4CLCD 5EPHA 4WUJA 3MKEA 4WEKA 2XR0A 4S2MA 3IT9A 3BQ8A 4ZTKA 4OQHA 4Q0IA 4KZ5A 2Q9MA 4N1HA 2PR5A 4OOYA 4Y0UA 4DE1A 4FCFA 4H6JB 3UPPA 1ES4A 1VEUB 5EM0A 2PBDP 3KSHA 5E43A 1OTIA 4BWIA 4E3JA 1JTGA 1BLHA 2JCHA 1S0WA 1EWZA 4KZ7A 3PTEA 4S2NA 4JBFA 1XGIA 1BLSA 1YLZA 2W3DA 3CG5A 3UDXA 2VGJA 2VGKA 4QJGA 2ZC7A 2ZOHA 5CTNA 3E0YA 3IS2B 1W7FA 1K57C 3HLGA 4DMZA 3MQ0A 2XK1A 4EBLA 3UPNA 1N9BA 1AXBA 2Y91A 4JKTA 1PI4A 4DRTA 4WZ5C 4E6WA 4R4SA 1K56D 5HDCA 2XA7S 3VMAA 1ERQA 3U2AA 3CMZA 4R38A 4B4XA 3LR0A 4GKUA 4H6JA 5F1GA 3C7VA 1MY8A 1OTBA 2HJ9C 3A0VA 2H10A 5CHMA 3PBQA 4E3KA 3K3CA 3KSIA 4FUWA 1VEUA 4R1GA 1SDEA 5CHUA 5A93A 1XX2A 4N9KA 4I38A 4OLDA 2PU2A 4M4XA 1NYMA 1BLPA 1RCJA 1S66L 3LEZA 3FC7A 5EOEA 1E3UD 4C3QA 3OPHA 4I39A 4HP4A 4DE2A 4BBVA 4KZ9A 3HREA 4KG6A 3ZYTA 3NOUC 5HWTA 1KE4A 4AFIA 3UDIA 4NXEA 1NJ4A 4ZAMA 3ISGA 4B4ZA 2QJ7A 2ZQ8A 4PM6A 3IS2A 1ACFA 5GLDA 5CHJA 1N9OA 1NXYA 3CUEA 5CECA 2VA0A 1K54C 2ACGA 1MZUA 4L0LA 4S2LA 4BL2A 1XJ4A 3VP2A 3BFFA 5U47A 5TR7A 2O9AA 2WYXA 2EX8A 2V20A 4PKYA 2XEPA 3M6HA 4BD1A 2O9BA 2IA2A 4WELA 1MWTA 4IVKA 4MN6A 4KQRA 4ME4A 3VP4A 3SS3A 2IWCA 3F1PB 4QPRA 2V1ZA 3ZNTA 1KVMA 1K25A 2H5SA 5DKKA 3BW6A 5BOHA 2V2FF 3A3JA 3PBSA 2E8IA 4IBXA 4HBTA 4G3WA 1ZHHB 1NY0A 5DF9A 1XA7A 3HL9A 2B5RA 3R4KA 2WAEA 2VZWA 1W63Q 1OT9A 2J3WA 2JKTM 1LLBA 1GHIA 3VFFA 2HP5A 3W2ZA 3K2NA 2I9VA 5FQMA 4MBHA 2Y2IA 3LY4A 2HZ5A 4Y0TA 3PBNA 1CQAA 1FCMA 4BBTA 3LI8A 2ZL1B 4ETZA 3SS4A 3OCLA 1FILA 2XSSA 3S4XA 4DF6A 1NRFA 3PHYA 5HPFA 3H82B 3NJAA 4OQIA 2ZQ9A 4II7A 3UE0A 3IXDA 4Y2FA 1XGJA 3C4OA 4JLFA 4LRZE 2FZ0A 1WYCA 3F1PA 1PZPA 2J8YA 1K6RA 4HH2A 1FCOA 2A3UA 2VX8A 2EWVA 3LIDA 1NRJA 2PT7A 2WZXA 3V39A 3W4PA 1GA9A 4WMCD 3A3IA 3WRZA 2HP9A 4B9OA 2D02A 5HWVA 1JWVA 2VV6A 3MR0A 3G35A 1EW0A 3FZCA 1PIOA 2ZC6B 1OJGA 3EOIA 4JGPA 5KSCA 4LFUA 4NXFA 4JGRA 1F2KA 1YSQA 3Q7ZA 2XH9A 2RL3A 5DF8A 2XGNA 3VSKA 3O86A 1UGUA 2ZL1A 1PRQA 1V9YA 2B18A 5HAPA 4HBUA 3N6IA 3V67A 3N8SA 5CTMA 1O7EA 4DXBA 1W8YA 4PPRA 3H82A 1ONHA 2QPNA 3O5YA 3RXXA 4BQMA 1J3WA 5G18A 4PMAA 1TS6A 4GS9B 4NXBA 1L0FA 4NEED 1ODVA 3MMHA 1WYBA 2Y4AA 2ZMVA 4LPZA 1XPBA 3A0RA 5L09A 2O0YA 1NLZA 5FQQA 3IXGA 3RTYA 1YT4A 3NHQA 1XJ6A 2JKRM 3ZG0A 4LCLA 3IXHA 2BTFP 3OOVA 2EX2A 3W8KA 1BYWA 4YNRA 4WEJA 3NY4A 1MWSA 2V1AA 4BD0A 1DP8A 5AVFA 1STZA 4PM8A 1ES3A 5FQIA 2XFSA 2H28A 5CRFA 3FKWA 3ZHHA 3O3VA 5HDSA 2V1BA 1PWDA 4PM7A 3GRJA 2A2LA 4YWZA 2V9AA 1CEGA 2JC7A 4MBFA 3VP3A 2WKRA 3QP4A 5DJTA 2M7UA 4QD4A 4O01A 4GS9A 2GDNA 2V0WA 2HJEA 1K6SA 4NKPA 1TEMA 2ZC3B 2B02A 3OC2A 4RX3A 5E2HA 1P9WA 5J7EA 1G6AA 1G5UA 1GCEA 3KYQA 1PZOA 4HJ3A 2PYRA 5KZHA 1KGEA 1HLUP 2ZD8A 3SW1A 1DJBA 4OONA 2PDRA 2OSUA 5M1AA 4B93A 1BZAA 2KLIA 3BFGA 4NG2A 1S1ZA 2QJ5A 3FG8A 5HL1A 4GJ4A 3Q81A 3IWQA 4EETB 3R7WB 1FOFA 4UHUA 1MWRA 3Q7VB 4F3LB 1PWGA 1XKZA 2C6WB 4OQ0A 4KUOA 3DTMA 4E3IA 4JXGA 5EOOA 5A92A 2ZJ9A 2M7VA 2A24A 2VKSA 3F1NB 4KZ4A 1NWZA 1TDLA 1YQSA 5C5KA 1SKFA 4PM5A 2XD1A 5CGXA 3IQAA 3D3OA 4EQIA 3BQAA 1L0GA 4Q8IA 5HFOA 4YOFA 3BJNA 3IWIA 4QWOA 4YFMA 2PU4A 3T1XA 3B47A 3HLWA 1FSYA 1IFQA 3IHBA 2Y2QA 3UB7A 1MBLA 1K0KA 2ZC4B 1XFQA 1DP6A 3GDIA 1T1AA 5EUAA 3E4PA 3SH9A 4EBNA 1K55C 1HZOA 4GDBA 4EQ1A 4ETXA 2X02A 4KQOA 5E2FA 1TVFA 3P98A 3TOIA 1UWPX 2QYBA 5EE8A 4O7DA 5DTTA 3IF6A 3R7WA 4E3OA 3WS5A 3Q7VA 4F3LA 3ICYA 3LGOA 3WWXA 2GX5A 4E3LA 4CLCA 5HDDA 1T1BA 3TW8A 3CITA 3F1NA 4KENB 4X1LA 2PRFA 4E3NA 1VM1A 3BLSA 4K0WA 4BJPA 5FSRA 1PFLA 1PI5A 2PR6A 3UN7A 4ID4A 3OLOA 1KOUA 4OP5A 4R4RA 3ZVTA 1O07A 5IU1A 3WRTA 3QP6A 4MLLA 3HJIA 5FEFA 4OQGA 3HLDA 2ZQAA 5L8MA 2W0NA 1M40A 3N7WA 1SZVA 4JPMA 3BFEA 3CHWP 1DJCA 3IX3A 1I2SA 5D3OA 5DKLA 3FPWA 3ZFZA 4LRYC 4Y13A 3IX4A 3G2YA 4ZJ1A 3JVVA 3LR5A 3U4LP 4RA7A 3BM6A 1TS8A 5AQAA 4QU3A 3ZQ5A 1LHYA 4ESPA 4Y5FA 1LSVA 3S22A 5JYPA 3QP8A 3PBRA 2A49A 1FSWA 1Y54A 1K56A 1NYYA 3QP1A 2J7VA 4R70A 3EEHA 3GQZA 5HZHA 1VETB 2JKGA 5GL9A 1GA0A 1SHVA 4MN5A 3P01A 3UO9A 1FIKA 1OMEA 3LR4A 2XD5A 3E2KA 2R78A 4S2OA 1W63M 5HD3A 3HUNA 3T1SA 3ZNYA 3LI9A 3ZG5A 5HARA 3HBRA 1FR1A 1E3UA 1W8QA 3OPLA 4EV4A 4Y3IA 3C2WA 2WADA 1YLWA 3MFXA 4DXCA 3CWFA 4OP8A 2Y2MA 1ERMA 4GHIB 1LSWA 4KZAA 3BY9A 5TGFA 4JF5A 4X69A 2V8CA 1KGGA 3C7UA 3KYZA 4HHDA 1PYYA 1YSPA 3Q1FA 4E04A 5AJGA 4FH4A 1ESUA 4GCZA 2ZLYA 3P7NA 2W1TB 4KZBA 3QP5A 4QHCA 5HPIA 4Y15A 1P97A 1ES5A 1MPLA 2WKQA 2Z6DA 3C38A 4HEFA 4EEPA 3BLMA 5A8BA 3HCYA 4OKPA 3H7WB 3C5AA 1BLCA 3H9WA 5M18A 1VETA 1OT6A 3BFDA 4UEYA 3DAVA 3HUOA 4PHTA 4I3JA 4GD8A 4X1MA 3IH9A 4HI4A 5GHYA 3KO6A 2ZC5B 1LL9A 1G68A 2P08A 4GB7A 3NDEA 3VE4A 3W4QA 3ZCZA 1I5QA 4X53A 1XJ3A 4EUZA 2NUTC 3LIFA 4DJ3A 3TRCA 2DRWA 3OCNA 2Y2LA 1OTAA 4IVIA 2OAQ1 4JF6A 4GHIA 2IWDA 1P9RA 5FASA 2ZBBA 1YM1A 5FAPA 3L9KA 1YMXA 3C4PA 3D4FA 2W1TA 2QKPA 2JKFA 2R9XA 1IELA 5CEDA 1G28A 5KIZA 2WKEA 2ZM8A 3VP1A 3DTIA 3DWKA 2Y59A 3GVBA 3M2JA 1GHMA 3DWZA 3QP2A 3G31A 3H7WA 5FAOA 4JXSA 2VV7A 4P6BA 1K4FA 3LY3A 3UMDA 3NOPC 3UE3A 4PKYG 4GDNA 1IEMA 2W3EA 4L9GA 4WMCA 3MSHA 2WZZA 4JGQA 5KSHA 1BT5A 4P85A 4RYEA 4E3MA 2OWHA 2GNXA 1QMFA 1X0OA 4MMNA 2BG1A 4X25A 3PBOA 4XXRA 5FAQA 2H0TA 2Y2KA 3UB5P 5CERA 2VLGA 4OPYA 5EVIC 4E6XA 1VHMA 4D2OA 2Y8HA 3S7NA 2P9VB 3BRMA 3F1OB 2JKTI 1WE4A 2W3GA 3CPTB 3NDGA 3VSLA 2KOIA 1E25A 1J9MA 3ZG8B 4N92A 4CLCE 1Y28A 4OLGA 4Z9QA 1CK3A 5JYOA 5FL3A 4KUKA 1PNEA 3ZVWA 3LEQA 3T1RA 5EVLA 3QNBA 4UA7A 2HP6A 5M19A 3NIAA 2ZQCA 4L9EA 4K0XA 4ARZB 1VB6A 1CI8A 4S2NC 3BECA 4KZ6A 2Y2HA 5CGSA 5FI2A 3IWOA 1HVBA 1QMEA 3N8RA 3EQVA 1MC0A 4FD8A 3VP0A 4EEUA 1K57A 5AQ9A 1ESIA 1XJ2A 3T4TA 3GMWA 4KZ8A 1DP9A 1S1YA 3LO7A 5GLBA 3LIBA 5E2GA 2XRNA 3EGXC 4WZ5A 3SH7A 1ES2A 2P9VA 3S7PA 3NCKA 5F69A 5AQ7A 3F1OA 2LB9A 3C8CA 1S67L 2G2UA 2ZQDA 3CPTA 3B3XA 3Q82A 5HD5A 2HF6A 2JN7A 1W5DA 4HOIA 2X71A 2B95A 2Y55A 1YMSA 2HDRA 4X55A 3G34A 4WL9A 4EU0A 3UNWA 3UB8A 2ZMAA 3FWLA 3T1QB 4S2PA 3BWLA 3HVFA 2Y2PA 1PW8A 3MXSA 4ARZA 1YPRA 3IH8A 2OWJA 4Q0HA 4UA6A 1FCNA 4LGWA 3ZG7B 2EWWA 4YINA 1H3QA 2H0YA 4WF0A 1JTDA 3TE8A 3V5MA 2W3FA 3MZFA 1TF1A 2P04A 5I5LA 2WGWB 3KYEA 5AQBA 2G7UA 1K54A 3MXRA 4ZRRA 3AGDA 3CUEC 3G30A 2W3HA 1W79A 4P6ZM 3V50A 1PWCA 2JKRI 4Y17A 2VV8A 3RXWA 5A91A 5GHXA 3CLOA 5GLAA 2NUPC 1AWIA 3V3RA 1IKIA 2INWA 3CAXA 3K3DA 5FDHA 4LLOB 3A0SA 3LICA 4IUHA 2J9PA 4M3KA 1VQQA 4JGOA 4G3VA 1DY6A 1OTEA 4LCMA 1CJFA 1GHPA 3SZTA 4Z1WA 4Y0OA 3E4QA 3QNCA 2WKIA 1F9IA 1D1JA 3MJQA 3L7HA 2I72A 2JBFA 4LENA 2E8JA 1XA1A 4NK3A 2P74A 4JXVA 2FFFB 3VOZA 2WGWA 1S6RA 2Y2JA 3UMEA 5F82A 3DTKA 2L0WA 2ZM0A 3FPVA 3PYPA 5A90A 4IJGA 1LL8A 5EFWA 5FQJA 4K08A 1NZUA 4R3BA 4OH0A 2JHEA 3SS5A 1XFNA 4C75A 4WLAA 3GSGA 5FI6A 1V9ZA 1YAXA 3G2ZA 3RJUA 1EI5A 1ONGA 2FH5A 2V0UA 3ITBA 5MC7A 3GV9A 5F6AA 2OAP1 3MS6A 1TD5A 3A3EA 3LUQA 1D06A 1D7EA 5CEBA 5L2FA 1BULA 3Q07A 4BLMA 3MKFA 1U60A 3ITAA 3PAEA 3TG9A 2UWXA 1FQGA 3WS4A 5EVID 2GZAA 3A3FA 3JPUA 4RQ9A 1S4SA 2Q9NA 1CEFA 5HAIA 3D72A 2KX6A 4R6LA 4EESA 2WK0A 1G6OA 3DBAA 1SCWA 3UPOA 1PW1A 2M1CA 4OOMA 1L0EA 4BL3A 4LV3A 3S1YA 2G2WA 4EXOA 5F5YA 2Y79A 3G4PA 2ZM2A 4BMWA 1C3BA 1KGFA 2O99A 2K2NA 4LV2A 4U0TA 2RCXA 1DJAA 3PXPA 4RVAA 2YKHA 1L2SA 1YKDA 1HTZA 3M2KA 3LCEA 2J3TC 3OPPA 4QB8A 3WS0A 4EUVA 3HUMA 5GLCA 2Y2NA 3OPRA 3VE3A 1EROA 2O9CA 3FV7A 1CF0A 3KSGA 1A0KA 4A5RA 3UB9A 1IYPA 3NC8A 4OPRA 4K91A 1SKOB 4KQDA 4MCWA 3JVUA 5DTKA 2FFYA 5CX7A 4U0XA 1H8YA 2BLSA 4ZBEA 4R3JA 2GJ3A 2QMIA 4GOGA 2PBYA 4ZJ2A 2P7JA 1T19A 5FDSA 3MF0A 2CMNA 1MKMA 3MZEA 5HSQA 1WA9A 2LB5A 3P09A 4JXWA 2K7SA 2VK3A 4S2JA 3OBFA 2WGVA 4XT2B 5G4YA 2PD8A 3HLCA 1Z09A 3V3SA 2BASA 1S4RA 2ZQ7A 3T4LA 2DCFA 1FR6A 4EERA 3WS1A 5IS1A 4WBGA 3IXBA 2OLVA 3EEAA 1KDSA 4P87A 2PHYA 1XXMA 4UAAA 2OOLA 3BEBA 3CI6A 3IBRA 3I7JA 1RGZA 2HPBA 1SKOA 3NBLA 1K38A 2YKFA 1LL5A 2QHKA 4P0MA 3S7QA 4GN2A 4DDYA 4MBKA 4CPKA 5EVEA 4HP9A 3GR2A 1ZKJA 4CJNA 4B88A 3PR6A 2VJWA 3NI9A 4XT2A 4QY5A 3W4OA 4EBPA 5G4ZA 3NULA 3T50A 2Y2GA 2XQZA 2XA7M 4I3IA 3MFDA 5K5BA 4FSFA 1N9NA 4XUXA 4MN7A 4D60A 1H5XA 3D9YA 1Q2QA 1ZG6A 1N4OA 2HGVA 3PBTA 1I2WA 1L3LA 4UQIS 3UB6A 2WKHA 4OVDA 3LYXA 4CQHA 3E98A 4FTXA 4WN5A 3HLFA 3MQOA 3O87A 4JF4A 5F1FA 5HX9A 1JWPA 1JWZA 4IEDA 1YLPA 3LR3A 2CC1A 3N4IA 4HIAA 3CJMA 4LRXC 5HWWA 1Z6FA 1H8MA 4HNBA 1K55A 5IT5A 5CGWA 1OPXA 5F68A 5TBMB 3KX0X 4PM9A 2Z2MB 2Z2LB 3BFCA 5E2EA 3UE1A 5LBRA 2C5WB 4QY6A 2ZOIA 2ZMFA 3BYDA 1IYSA 3QHYA 1TS0A 3ULFA 5DJUA 4ZDXA 1ZTUA 4MEZA 3NECA 5DF7A 3IF6C 4X6TA 3T4QA 1KE0A 1IYOA 1SDNA 5DVAA 4BENA 3T4SA 2OV5A 3GECA 3ZG9B 4FOFA 4CLCC 3G6OA 5HAQA 3MBZA 4O8GA 5J3WA 3BY8A 2OLUA 3ZDJA 2WUQA 3OZHA 2DMWA 1BUEA 4S2IA 3DTEA 5EV0A 1H0MA 3EWKA 4KQQA 5GHZA 2L4RA 1L0DA 2XFTA 1LT0A 3S7OA 3GTCA 1LSXA 2DNSA 4KG5A 1MWUA 1N9LA 3HJKA 3RH8B 4Y7PA 4UQIM 4GLQA 1KVLA 5TBMA 2PYPA 3VV4A 4P6ZS 3VOLA 1NZOA 3FKVA 1K4EA 5HL6A 5DFXA 2J3TD 5FQ9A 3LFVA 4HJ6A 3UDFA 1IYQA 1RGYA 2V8FA 4WM9A 4F94A 4UA9A 2QWSA 3NOTC 3WS2A 4KG2A 3VOYA 2VGLS 3T4OA 1P0ZA 4O0PA 2XROA 2Y2OA 4N1XA 4MDZA 5L07A 4LV0A 3T12B 4NETA 3IF5A 2WGIA 1T1CA 1YLJA 1ZG4A 2WKPA 4DKIA 4LV1A 2Z6CA 3LIEA 4GZBA 2L1MA 4OPZA 4XUZA 2IWBA 2W27A 3B33A 1LI0A 1F98A 5KMWA 4OOLA 5FQKA 2EXAA 3LIAA 5DTSA 4MNRA 2MJ6A 4IBRA 4L9FA 4DJ2A 4X56A 3VFHA 2J80A 1GSVA 3MXQA 3IBJA 3RFBA 2VEAA 4GW9A 5AVEA 1MKIA 2EX9A 1KDWA 5J8XA 2K31A 2XF3A 3EQUA
chains in the Genus database with same CATH topology
2J9OA 3WRZA 2HP9A 3ITAA 2HDUA 5FA7A 3PAEA 1ERMA 4GNUA 1JWVA 5CXWA 2XLNA 4DE0A 3TG9A 4KZAA 3G35A 5TGFA 3ZGAB 2UWXA 4JF5A 4X69A 1IKGA 1KGGA 3C7UA 1FQGA 3WS4A 1HD8A 1PYYA 3FZCA 4U3TA 1PIOA 5EVID 2ZC6B 3Q1FA 4ZJ3A 4FH4A 3A3FA 1ESUA 1RP5A 1JVJA 2ZLYA 5KSCA 4KZBA 2Q9NA 4QHCA 1CEFA 3Q7ZA 5HAIA 4R0QA 2XH9A 2RL3A 5DF8A 3JYIA 1ES5A 2XGNA 2WK0A 4WZ4A 1MPLA 1SCWA 3PAGA 3VSKA 3O86A 1PW1A 3UPOA 4HEFA 3MZDA 3SH8A 4OOMA 3BLMA 4OKPA 1L0EA 5FATA 3TSGA 4BL3A 3C5AA 2EFXA 4LV3A 3S1YA 4EWFA 1BLCA 5HAPA 4HBUA 5M18A 4KZ3A 5IHVA 2G2WA 2EXBA 5HW3A 3N6IA 5EECA 3BFDA 3N8SA 1H8ZA 3G4PA 5CTMA 2ZM2A 1O7EA 4X68A 4S2KA 4N9LA 4DXBA 1W8YA 1C3BA 3HUOA 4PPRA 5F83A 1KGFA 4DDSA 2X01A 4LV2A 4U0TA 2RCXA 4GD8A 3IH9A 1DJAA 5GHYA 3DW0A 3AGFA 1ONHA 2ZC5B 4RVAA 2QPNA 4WYYA 3RXXA 1L2SA 1LL9A 1G68A 1HTZA 3LCEA 3M2KA 5G18A 4BQMA 4C6YA 3IF6B 4GB7A 3NDEA 3W4QA 2WAFA 4PMAA 3ZCZA 1I5QA 4R23A 4X53A 1YLYA 2JE5A 3OPPA 1L0FA 5EVIB 4QB8A 3WS0A 3HUMA 5GLCA 4EUZA 1CI9A 2Y2NA 1XP4A 3OPRA 1M6KA 1LI9A 3O88A 1EROA 3FV7A 3IHAA 2DRWA 5FI7A 3OCNA 1ZC2A 4A5RA 2Y2LA 1WYBA 2Y4AA 4IVIA 1XPBA 3A3DA 1IYPA 4JF6A 3NC8A 4OPRA 2IWDA 5FQQA 4K91A 5TFQA 5I94A 3IXGA 4H8RA 5FASA 1YT4A 1BTLA 5DTKA 2FFYA 1YM1A 1KE3A 4FH2A 5FAPA 3ZG0A 4U0XA 4LCLA 1H8YA 1MXOA 3IXHA 2BLSA 4ZBEA 4R3JA 2QMIA 1YMXA 2XDMA 3C4PA 3CZDA 4GOGA 3D4FA 2PBYA 3G32A 3M6BA 4ZJ2A 2EX2A 2R9XA 5CEDA 1IELA 2R9WA 2WKEA 2ZM8A 3W8KA 3VP1A 3DWKA 4WEJA 2Y59A 3MZEA 3NY4A 1MWSA 3GVBA 3M2JA 4DE3A 3P09A 1GHMA 3DWZA 4BD0A 4JXWA 4S2JA 3UY6A 4PM8A 1BSGA 3N8LA 1ES3A 5FQIA 3G31A 3HLEA 2XFSA 2WGVA 3HLBA 5CRFA 3FKWA 3ZHHA 3O3VA 4JXSA 5FAOA 4P6BA 3HLCA 1K4FA 3V3SA 1ALQA 2HDSA 2ZQ7A 2DCFA 3LY3A 1PWDA 4PM7A 3GRJA 3UE3A 1FR6A 4GDNA 2HDQA 3WS1A 1IEMA 1CEGA 2QZ6A 4WMCA 1YLTA 2JC7A 4MBFA 3VP3A 4OPQA 3FYZA 4RX2A 3E2LA 2WZZA 4WBGA 3IXBA 5KSHA 4HESA 2OLVA 2EFUA 3AGEA 1BT5A 4P85A 4QD4A 3SOIA 4RYEA 4E3MA 1QMFA 1KDSA 4P87A 2GDNA 1E4DA 1Q2PA 2BG1A 5EVIA 3PBOA 4XXRA 5FAQA 2H0TA 2Y2KA 4GD6A 1K6SA 1XXMA 1TEMA 5CERA 2EX6A 1TDGA 2ZC3B 4OPYA 4UAAA 5EPHA 5EVIC 4D2OA 4E6XA 3OC2A 3MKEA 4RX3A 4WEKA 2XR0A 3BEBA 5E2HA 3EQUA 2P9VB 4S2MA 3IT9A 3I7JA 1G6AA 1RGZA 4OQHA 4ZTKA 2HPBA 3BRMA 4KZ5A 2Q9MA 1WE4A 4N1HA 1GCEA 3NBLA 1K38A 4OOYA 3NDGA 4Y0UA 3VSLA 1E25A 4DE1A 4FCFA 1J9MA 1PZOA 1LL5A 3UPPA 3ZG8B 4N92A 1ES4A 4OLGA 4P0MA 4Z9QA 1CK3A 5KZHA 1KGEA 4GN2A 2ZD8A 4DDYA 4MBKA 5JYOA 3ZVWA 1DJBA 5E43A 4CPKA 4OONA 4E3JA 1JTGA 2OSUA 5M1AA 1BLHA 5EVLA 3QNBA 2JCHA 3GR2A 1S0WA 1BZAA 1EWZA 1ZKJA 4UA7A 4CJNA 4KZ7A 2HP6A 3BFGA 5M19A 4B88A 3NIAA 2ZQCA 3PTEA 5HL1A 4K0XA 3Q81A 4S2NA 3NI9A 4JBFA 3IWQA 4QY5A 1XGIA 1BLSA 1CI8A 1FOFA 1YLZA 3BECA 4S2NC 3W4OA 4EBPA 4KZ6A 2Y2HA 5CGSA 4UHUA 1MWRA 3Q7VB 5FI2A 1PWGA 1XKZA 2C6WB 3IWOA 4OQ0A 3CG5A 3UDXA 1HVBA 1QMEA 2VGKA 2VGJA 3DTMA 4E3IA 2ZC7A 4QJGA 4JXGA 5EOOA 3N8RA 2Y2GA 2XQZA 2ZJ9A 5A92A 3EQVA 5CTNA 4FD8A 3VP0A 1K57A 3MFDA 5AQ9A 4KZ4A 4FSFA 1ESIA 4XUXA 1W7FA 1TDLA 1H5XA 1K57C 1YQSA 3HLGA 1Q2QA 1ZG6A 3GMWA 4KZ8A 2XK1A 1N4OA 4EBLA 3PBTA 1I2WA 3UPNA 3LO7A 5GLBA 1SKFA 5E2GA 4PM5A 2WKHA 2XD1A 4OVDA 5CGXA 1N9BA 3IQAA 3HLFA 4WZ5A 3SH7A 3O87A 4JF4A 1AXBA 1ES2A 4EQIA 2Y91A 4JKTA 5F1FA 1PI4A 5HX9A 4DRTA 4WZ5C 2P9VA 1JWPA 4E6WA 1L0GA 4R4SA 4Q8IA 3NCKA 1JWZA 5HFOA 4IEDA 5AQ7A 1K56D 1YLPA 2CC1A 3N4IA 3VMAA 2G2UA 3IWIA 2ZQDA 4YFMA 1ERQA 2PU4A 3HLWA 3CJMA 3CMZA 1FSYA 3IHBA 4B4XA 2Y2QA 1Z6FA 1MBLA 3C7VA 4GKUA 5F1GA 1MY8A 2ZC4B 3B3XA 3PBQA 3Q82A 2H10A 5CHMA 1K55A 4E3KA 5CGWA 5EUAA 1W5DA 3SH9A 4EBNA 2X71A 4R1GA 1K55C 1HZOA 1YMSA 1SDEA 2HDRA 2Y55A 5CHUA 4GDBA 5A93A 1XX2A 4N9KA 4X55A 3G34A 4OLDA 2PU2A 4PM9A 2X02A 4KQOA 1NYMA 3UNWA 2Z2MB 2Z2LB 2ZMAA 1BLPA 1RCJA 3BFCA 1TVFA 5E2FA 5E2EA 3FWLA 3LEZA 3UE1A 3P98A 4S2PA 3TOIA 3HVFA 2Y2PA 5EE8A 2C5WB 1PW8A 3MXSA 4QY6A 5EOEA 4O7DA 3IH8A 1E3UD 3BYDA 1IYSA 5DTTA 3IF6A 3QHYA 4C3QA 3OPHA 4UA6A 4ZDXA 4E3OA 4MEZA 1FCNA 5DF7A 3IF6C 4X6TA 3WS5A 3Q7VA 4DE2A 4KZ9A 1KE0A 3ZG7B 1IYOA 3HREA 1SDNA 4KG6A 5DVAA 3WWXA 4BENA 4E3LA 1KE4A 4YINA 3UDIA 2OV5A 1NJ4A 4ZAMA 2H0YA 3ISGA 1JTDA 3V5MA 4B4ZA 3ZG9B 2ZQ8A 3MZFA 4KENB 4PM6A 4E3NA 5HAQA 2WGWB 3MBZA 1VM1A 5AQBA 5GLDA 3BLSA 5CHJA 1K54A 1NXYA 3MXRA 4K0WA 5FSRA 4BJPA 5CECA 2OLUA 1K54C 1PI5A 3AGDA 3G30A 3ZDJA 2WUQA 3OZHA 4L0LA 3UN7A 1BUEA 1W79A 4S2LA 4S2IA 4BL2A 4ID4A 3BFFA 3VP2A 3V50A 5U47A 5TR7A 1PWCA 4OP5A 4KQQA 2WYXA 2V20A 2EX8A 5GHZA 2XEPA 3M6HA 1L0DA 1O07A 2XFTA 4R4RA 5A91A 5GHXA 4MLLA 3RXWA 3WRTA 4BD1A 5GLAA 3V3RA 1IKIA 3GTCA 4WELA 1MWTA 4OQGA 4IVKA 3HLDA 5FDHA 2DNSA 2ZQAA 4KQRA 2J9PA 4KG5A 3VP4A 1MWUA 1M40A 3N7WA 3SS3A 2IWCA 4M3KA 4Y7PA 2V1ZA 1VQQA 4JPMA 1KVLA 3ZNTA 3BFEA 1KVMA 1K25A 2H5SA 1DJCA 1I2SA 5D3OA 1DY6A 4LCMA 1GHPA 3ZFZA 5BOHA 2V2FF 1NZOA 3FKVA 1K4EA 4Y0OA 3QNCA 3A3JA 2WKIA 3PBSA 2E8IA 4IBXA 3G2YA 4ZJ1A 5FQ9A 4HBTA 3UDFA 1IYQA 1RGYA 4WM9A 1NY0A 1XA7A 3HL9A 4UA9A 2B5RA 5DF9A 4F94A 2WAEA 2I72A 3WS2A 4KG2A 4RA7A 3BM6A 3VOYA 2JBFA 5AQAA 4QU3A 4LENA 1LHYA 1LLBA 1GHIA 3VFFA 1XA1A 2HP5A 2Y2OA 4N1XA 4NK3A 5FQMA 4MBHA 2Y2IA 3S22A 2P74A 4LV0A 4JXVA 4NETA 3IF5A 5JYPA 3LY4A 3PBRA 2WGIA 2FFFB 3VOZA 2A49A 4Y0TA 3PBNA 1FSWA 2WGWA 1Y54A 1S6RA 2Y2JA 1FCMA 1K56A 1YLJA 1ZG4A 5F82A 1NYYA 4DKIA 2ZM0A 4LV1A 5A90A 4GZBA 4OPZA 4XUZA 2IWBA 2J7VA 1LI0A 3SS4A 3OCLA 5KMWA 3GQZA 5FQJA 1NZUA 3S4XA 4R3BA 4DF6A 4OH0A 1NRFA 4OOLA 5GL9A 3ZVTA 5FQKA 3SS5A 1GA0A 1SHVA 4C75A 2EXAA 3UO9A 2Y2MA 3GSGA 4OP8A 1OMEA 4MNRA 5DTSA 5FI6A 2XD5A 3E2KA 4S2OA 3G2ZA 3RJUA 4OQIA 1EI5A 2ZQ9A 1ONGA 4IBRA 3UE0A 3IXDA 3ITBA 3HUNA 4X56A 1XGJA 3C4OA 4JLFA 3GV9A 3VFHA 3ZNYA 3ZG5A 5HARA 3HBRA 1FR1A 1WYCA 1E3UA 1W8QA 3OPLA 1PZPA 2J8YA 1MKIA 1K6RA 4EV4A 1FCOA 3A3EA 2A3UA 2EX9A 2WADA 1KDWA 1YLWA 5CEBA 5L2FA 1BULA 3Q07A 5J8XA 2WZXA 3V39A 3W4PA 4BLMA 1GA9A 4DXCA 4WMCD 2XF3A 3A3IA 3MKFA 1U60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9O A;  3WRZ A;  2HP9 A;  3ITA A;  2HDU A;  5FA7 A;  3PAE A;  1ERM A;  4GNU A;  1JWV A;  5CXW A;  2XLN A;  4DE0 A;  3TG9 A;  4KZA A;  3G35 A;  5TGF A;  3ZGA B;  2UWX A;  4JF5 A;  4X69 A;  1IKG A;  1KGG A;  3C7U A;  1FQG A;  3WS4 A;  1HD8 A;  1PYY A;  3FZC A;  4U3T A;  1PIO A;  5EVI D;  2ZC6 B;  3Q1F A;  4ZJ3 A;  4FH4 A;  3A3F A;  1ESU A;  1RP5 A;  1JVJ A;  2ZLY A;  5KSC A;  4KZB A;  2Q9N A;  4QHC A;  1CEF A;  3Q7Z A;  5HAI A;  4R0Q A;  2XH9 A;  2RL3 A;  5DF8 A;  3JYI A;  1ES5 A;  2XGN A;  2WK0 A;  4WZ4 A;  1MPL A;  1SCW A;  3PAG A;  3VSK A;  3O86 A;  1PW1 A;  3UPO A;  4HEF A;  3MZD A;  3SH8 A;  4OOM A;  3BLM A;  4OKP A;  1L0E A;  5FAT A;  3TSG A;  4BL3 A;  3C5A A;  2EFX A;  4LV3 A;  3S1Y A;  4EWF A;  1BLC A;  5HAP A;  4HBU A;  5M18 A;  4KZ3 A;  5IHV A;  2G2W A;  2EXB A;  5HW3 A;  3N6I A;  5EEC A;  3BFD A;  3N8S A;  1H8Z A;  3G4P A;  5CTM A;  2ZM2 A;  1O7E A;  4X68 A;  4S2K A;  4N9L A;  4DXB A;  1W8Y A;  1C3B A;  3HUO A;  4PPR A;  5F83 A;  1KGF A;  4DDS A;  2X01 A;  4LV2 A;  4U0T A;  2RCX A;  4GD8 A;  3IH9 A;  1DJA A;  5GHY A;  3DW0 A;  3AGF A;  1ONH A;  2ZC5 B;  4RVA A;  2QPN A;  4WYY A;  3RXX A;  1L2S A;  1LL9 A;  1G68 A;  1HTZ A;  3LCE A;  3M2K A;  5G18 A;  4BQM A;  4C6Y A;  3IF6 B;  4GB7 A;  3NDE A;  3W4Q A;  2WAF A;  4PMA A;  3ZCZ A;  1I5Q A;  4R23 A;  4X53 A;  1YLY A;  2JE5 A;  3OPP A;  1L0F A;  5EVI B;  4QB8 A;  3WS0 A;  3HUM A;  5GLC A;  4EUZ A;  1CI9 A;  2Y2N A;  1XP4 A;  3OPR A;  1M6K A;  1LI9 A;  3O88 A;  1ERO A;  3FV7 A;  3IHA A;  2DRW A;  5FI7 A;  3OCN A;  1ZC2 A;  4A5R A;  2Y2L A;  1WYB A;  2Y4A A;  4IVI A;  1XPB A;  3A3D A;  1IYP A;  4JF6 A;  3NC8 A;  4OPR A;  2IWD A;  5FQQ A;  4K91 A;  5TFQ A;  5I94 A;  3IXG A;  4H8R A;  5FAS A;  1YT4 A;  1BTL A;  5DTK A;  2FFY A;  1YM1 A;  1KE3 A;  4FH2 A;  5FAP A;  3ZG0 A;  4U0X A;  4LCL A;  1H8Y A;  1MXO A;  3IXH A;  2BLS A;  4ZBE A;  4R3J A;  2QMI A;  1YMX A;  2XDM A;  3C4P A;  3CZD A;  4GOG A;  3D4F A;  2PBY A;  3G32 A;  3M6B A;  4ZJ2 A;  2EX2 A;  2R9X A;  5CED A;  1IEL A;  2R9W A;  2WKE A;  2ZM8 A;  3W8K A;  3VP1 A;  3DWK A;  4WEJ A;  2Y59 A;  3MZE A;  3NY4 A;  1MWS A;  3GVB A;  3M2J A;  4DE3 A;  3P09 A;  1GHM A;  3DWZ A;  4BD0 A;  4JXW A;  4S2J A;  3UY6 A;  4PM8 A;  1BSG A;  3N8L A;  1ES3 A;  5FQI A;  3G31 A;  3HLE A;  2XFS A;  2WGV A;  3HLB A;  5CRF A;  3FKW A;  3ZHH A;  3O3V A;  4JXS A;  5FAO A;  4P6B A;  3HLC A;  1K4F A;  3V3S A;  1ALQ A;  2HDS A;  2ZQ7 A;  2DCF A;  3LY3 A;  1PWD A;  4PM7 A;  3GRJ A;  3UE3 A;  1FR6 A;  4GDN A;  2HDQ A;  3WS1 A;  1IEM A;  1CEG A;  2QZ6 A;  4WMC A;  1YLT A;  2JC7 A;  4MBF A;  3VP3 A;  4OPQ A;  3FYZ A;  4RX2 A;  3E2L A;  2WZZ A;  4WBG A;  3IXB A;  5KSH A;  4HES A;  2OLV A;  2EFU A;  3AGE A;  1BT5 A;  4P85 A;  4QD4 A;  3SOI A;  4RYE A;  4E3M A;  1QMF A;  1KDS A;  4P87 A;  2GDN A;  1E4D A;  1Q2P A;  2BG1 A;  5EVI A;  3PBO A;  4XXR A;  5FAQ A;  2H0T A;  2Y2K A;  4GD6 A;  1K6S A;  1XXM A;  1TEM A;  5CER A;  2EX6 A;  1TDG A;  2ZC3 B;  4OPY A;  4UAA A;  5EPH A;  5EVI C;  4D2O A;  4E6X A;  3OC2 A;  3MKE A;  4RX3 A;  4WEK A;  2XR0 A;  3BEB A;  5E2H A;  3EQU A;  2P9V B;  4S2M A;  3IT9 A;  3I7J A;  1G6A A;  1RGZ A;  4OQH A;  4ZTK A;  2HPB A;  3BRM A;  4KZ5 A;  2Q9M A;  1WE4 A;  4N1H A;  1GCE A;  3NBL A;  1K38 A;  4OOY A;  3NDG A;  4Y0U A;  3VSL A;  1E25 A;  4DE1 A;  4FCF A;  1J9M A;  1PZO A;  1LL5 A;  3UPP A;  3ZG8 B;  4N92 A;  1ES4 A;  4OLG A;  4P0M A;  4Z9Q A;  1CK3 A;  5KZH A;  1KGE A;  4GN2 A;  2ZD8 A;  4DDY A;  4MBK A;  5JYO A;  3ZVW A;  1DJB A;  5E43 A;  4CPK A;  4OON A;  4E3J A;  1JTG A;  2OSU A;  5M1A A;  1BLH A;  5EVL A;  3QNB A;  2JCH A;  3GR2 A;  1S0W A;  1BZA A;  1EWZ A;  1ZKJ A;  4UA7 A;  4CJN A;  4KZ7 A;  2HP6 A;  3BFG A;  5M19 A;  4B88 A;  3NIA A;  2ZQC A;  3PTE A;  5HL1 A;  4K0X A;  3Q81 A;  4S2N A;  3NI9 A;  4JBF A;  3IWQ A;  4QY5 A;  1XGI A;  1BLS A;  1CI8 A;  1FOF A;  1YLZ A;  3BEC A;  4S2N C;  3W4O A;  4EBP A;  4KZ6 A;  2Y2H A;  5CGS A;  4UHU A;  1MWR A;  3Q7V B;  5FI2 A;  1PWG A;  1XKZ A;  2C6W B;  3IWO A;  4OQ0 A;  3CG5 A;  3UDX A;  1HVB A;  1QME A;  2VGK A;  2VGJ A;  3DTM A;  4E3I A;  2ZC7 A;  4QJG A;  4JXG A;  5EOO A;  3N8R A;  2Y2G A;  2XQZ A;  2ZJ9 A;  5A92 A;  3EQV A;  5CTN A;  4FD8 A;  3VP0 A;  1K57 A;  3MFD A;  5AQ9 A;  4KZ4 A;  4FSF A;  1ESI A;  4XUX A;  1W7F A;  1TDL A;  1H5X A;  1K57 C;  1YQS A;  3HLG A;  1Q2Q A;  1ZG6 A;  3GMW A;  4KZ8 A;  2XK1 A;  1N4O A;  4EBL A;  3PBT A;  1I2W A;  3UPN A;  3LO7 A;  5GLB A;  1SKF A;  5E2G A;  4PM5 A;  2WKH A;  2XD1 A;  4OVD A;  5CGX A;  1N9B A;  3IQA A;  3HLF A;  4WZ5 A;  3SH7 A;  3O87 A;  4JF4 A;  1AXB A;  1ES2 A;  4EQI A;  2Y91 A;  4JKT A;  5F1F A;  1PI4 A;  5HX9 A;  4DRT A;  4WZ5 C;  2P9V A;  1JWP A;  4E6W A;  1L0G A;  4R4S A;  4Q8I A;  3NCK A;  1JWZ A;  5HFO A;  4IED A;  5AQ7 A;  1K56 D;  1YLP A;  2CC1 A;  3N4I A;  3VMA A;  2G2U A;  3IWI A;  2ZQD A;  4YFM A;  1ERQ A;  2PU4 A;  3HLW A;  3CJM A;  3CMZ A;  1FSY A;  3IHB A;  4B4X A;  2Y2Q A;  1Z6F A;  1MBL A;  3C7V A;  4GKU A;  5F1G A;  1MY8 A;  2ZC4 B;  3B3X A;  3PBQ A;  3Q82 A;  2H10 A;  5CHM A;  1K55 A;  4E3K A;  5CGW A;  5EUA A;  1W5D A;  3SH9 A;  4EBN A;  2X71 A;  4R1G A;  1K55 C;  1HZO A;  1YMS A;  1SDE A;  2HDR A;  2Y55 A;  5CHU A;  4GDB A;  5A93 A;  1XX2 A;  4N9K A;  4X55 A;  3G34 A;  4OLD A;  2PU2 A;  4PM9 A;  2X02 A;  4KQO A;  1NYM A;  3UNW A;  2Z2M B;  2Z2L B;  2ZMA A;  1BLP A;  1RCJ A;  3BFC A;  1TVF A;  5E2F A;  5E2E A;  3FWL A;  3LEZ A;  3UE1 A;  3P98 A;  4S2P A;  3TOI A;  3HVF A;  2Y2P A;  5EE8 A;  2C5W B;  1PW8 A;  3MXS A;  4QY6 A;  5EOE A;  4O7D A;  3IH8 A;  1E3U D;  3BYD A;  1IYS A;  5DTT A;  3IF6 A;  3QHY A;  4C3Q A;  3OPH A;  4UA6 A;  4ZDX A;  4E3O A;  4MEZ A;  1FCN A;  5DF7 A;  3IF6 C;  4X6T A;  3WS5 A;  3Q7V A;  4DE2 A;  4KZ9 A;  1KE0 A;  3ZG7 B;  1IYO A;  3HRE A;  1SDN A;  4KG6 A;  5DVA A;  3WWX A;  4BEN A;  4E3L A;  1KE4 A;  4YIN A;  3UDI A;  2OV5 A;  1NJ4 A;  4ZAM A;  2H0Y A;  3ISG A;  1JTD A;  3V5M A;  4B4Z A;  3ZG9 B;  2ZQ8 A;  3MZF A;  4KEN B;  4PM6 A;  4E3N A;  5HAQ A;  2WGW B;  3MBZ A;  1VM1 A;  5AQB A;  5GLD A;  3BLS A;  5CHJ A;  1K54 A;  1NXY A;  3MXR A;  4K0W A;  5FSR A;  4BJP A;  5CEC A;  2OLU A;  1K54 C;  1PI5 A;  3AGD A;  3G30 A;  3ZDJ A;  2WUQ A;  3OZH A;  4L0L A;  3UN7 A;  1BUE A;  1W79 A;  4S2L A;  4S2I A;  4BL2 A;  4ID4 A;  3BFF A;  3VP2 A;  3V50 A;  5U47 A;  5TR7 A;  1PWC A;  4OP5 A;  4KQQ A;  2WYX A;  2V20 A;  2EX8 A;  5GHZ A;  2XEP A;  3M6H A;  1L0D A;  1O07 A;  2XFT A;  4R4R A;  5A91 A;  5GHX A;  4MLL A;  3RXW A;  3WRT A;  4BD1 A;  5GLA A;  3V3R A;  1IKI A;  3GTC A;  4WEL A;  1MWT A;  4OQG A;  4IVK A;  3HLD A;  5FDH A;  2DNS A;  2ZQA A;  4KQR A;  2J9P A;  4KG5 A;  3VP4 A;  1MWU A;  1M40 A;  3N7W A;  3SS3 A;  2IWC A;  4M3K A;  4Y7P A;  2V1Z A;  1VQQ A;  4JPM A;  1KVL A;  3ZNT A;  3BFE A;  1KVM A;  1K25 A;  2H5S A;  1DJC A;  1I2S A;  5D3O A;  1DY6 A;  4LCM A;  1GHP A;  3ZFZ A;  5BOH A;  2V2F F;  1NZO A;  3FKV A;  1K4E A;  4Y0O A;  3QNC A;  3A3J A;  2WKI A;  3PBS A;  2E8I A;  4IBX A;  3G2Y A;  4ZJ1 A;  5FQ9 A;  4HBT A;  3UDF A;  1IYQ A;  1RGY A;  4WM9 A;  1NY0 A;  1XA7 A;  3HL9 A;  4UA9 A;  2B5R A;  5DF9 A;  4F94 A;  2WAE A;  2I72 A;  3WS2 A;  4KG2 A;  4RA7 A;  3BM6 A;  3VOY A;  2JBF A;  5AQA A;  4QU3 A;  4LEN A;  1LHY A;  1LLB A;  1GHI A;  3VFF A;  1XA1 A;  2HP5 A;  2Y2O A;  4N1X A;  4NK3 A;  5FQM A;  4MBH A;  2Y2I A;  3S22 A;  2P74 A;  4LV0 A;  4JXV A;  4NET A;  3IF5 A;  5JYP A;  3LY4 A;  3PBR A;  2WGI A;  2FFF B;  3VOZ A;  2A49 A;  4Y0T A;  3PBN A;  1FSW A;  2WGW A;  1Y54 A;  1S6R A;  2Y2J A;  1FCM A;  1K56 A;  1YLJ A;  1ZG4 A;  5F82 A;  1NYY A;  4DKI A;  2ZM0 A;  4LV1 A;  5A90 A;  4GZB A;  4OPZ A;  4XUZ A;  2IWB A;  2J7V A;  1LI0 A;  3SS4 A;  3OCL A;  5KMW A;  3GQZ A;  5FQJ A;  1NZU A;  3S4X A;  4R3B A;  4DF6 A;  4OH0 A;  1NRF A;  4OOL A;  5GL9 A;  3ZVT A;  5FQK A;  3SS5 A;  1GA0 A;  1SHV A;  4C75 A;  2EXA A;  3UO9 A;  2Y2M A;  3GSG A;  4OP8 A;  1OME A;  4MNR A;  5DTS A;  5FI6 A;  2XD5 A;  3E2K A;  4S2O A;  3G2Z A;  3RJU A;  4OQI A;  1EI5 A;  2ZQ9 A;  1ONG A;  4IBR A;  3UE0 A;  3IXD A;  3ITB A;  3HUN A;  4X56 A;  1XGJ A;  3C4O A;  4JLF A;  3GV9 A;  3VFH A;  3ZNY A;  3ZG5 A;  5HAR A;  3HBR A;  1FR1 A;  1WYC A;  1E3U A;  1W8Q A;  3OPL A;  1PZP A;  2J8Y A;  1MKI A;  1K6R A;  4EV4 A;  1FCO A;  3A3E A;  2A3U A;  2EX9 A;  2WAD A;  1KDW A;  1YLW A;  5CEB A;  5L2F A;  1BUL A;  3Q07 A;  5J8X A;  2WZX A;  3V39 A;  3W4P A;  4BLM A;  1GA9 A;  4DXC A;  4WMC D;  2XF3 A;  3A3I A;  3MKF A;  1U60 A; 
#chains in the Genus database with same CATH topology
 2A24 B;  2J9O A;  2HV1 A;  2HDU A;  5FA7 A;  1JNU A;  4GNU A;  5CXW A;  2XLN A;  4DE0 A;  3EGD C;  3ZGA B;  1IKG A;  5DFY A;  1HD8 A;  4U3T A;  4ZJ3 A;  4IHQ A;  4I3A A;  1RP5 A;  1JVJ A;  5J4E A;  1F5M A;  2AVX A;  4R0Q A;  3C30 A;  1TS7 A;  4EW7 A;  3JYI A;  4WZ4 A;  3PAG A;  4Q0J A;  3MZD A;  3SH8 A;  1DRM A;  5FAT A;  3TSG A;  2EFX A;  4EWF A;  2VGL M;  4NXG A;  4KZ3 A;  5IHV A;  5HW3 A;  2EXB A;  2W1R A;  5EEC A;  1H8Z A;  4IUK A;  4S2K A;  4N9L A;  4X68 A;  2PAV P;  5F83 A;  4DDS A;  2X01 A;  3DW0 A;  3AGF A;  4HJ4 A;  4I5S A;  4WYY A;  3B42 A;  4C6Y A;  5EM1 A;  3IF6 B;  2WAF A;  4R23 A;  1YLY A;  2JE5 A;  3MQQ A;  5EVI B;  3T4K A;  1CI9 A;  1XP4 A;  2EA9 A;  1GSX A;  1M6K A;  1LI9 A;  1NLY A;  3O88 A;  4CLC B;  3IHA A;  5FI7 A;  1OTD A;  1ZC2 A;  4DN0 A;  3A3D A;  4R3A A;  5TFQ A;  5I94 A;  1T18 A;  4H8R A;  4PAU A;  1BTL A;  1KE3 A;  4FH2 A;  1UWN X;  1MXO A;  2XDM A;  3CZD A;  3G32 A;  3M6B A;  2R9W A;  3T4J A;  5FEG A;  3KSF A;  2D01 A;  4HH3 A;  4DE3 A;  3E4O A;  1IOU A;  3UY6 A;  1BSG A;  2KDK A;  3N8L A;  3HLE A;  3HLB A;  4BBU A;  2UV0 E;  1ALQ A;  2HDS A;  2HDQ A;  1GSW A;  4HY8 A;  3UE6 A;  2QZ6 A;  1YLT A;  3TJZ C;  4OPQ A;  3FYZ A;  4RX2 A;  1Y4O A;  2PD7 A;  3E2L A;  4HES A;  4G3K A;  4HQA A;  2EFU A;  3AGE A;  1OJ5 A;  3SOI A;  2Q0O A;  3IX8 A;  1E4D A;  1Q2P A;  5L10 A;  5EVI A;  4GD6 A;  5TJJ A;  2EX6 A;  1TDG A;  4CLC D;  5EPH A;  4WUJ A;  3MKE A;  4WEK A;  2XR0 A;  4S2M A;  3IT9 A;  3BQ8 A;  4ZTK A;  4OQH A;  4Q0I A;  4KZ5 A;  2Q9M A;  4N1H A;  2PR5 A;  4OOY A;  4Y0U A;  4DE1 A;  4FCF A;  4H6J B;  3UPP A;  1ES4 A;  1VEU B;  5EM0 A;  2PBD P;  3KSH A;  5E43 A;  1OTI A;  4BWI A;  4E3J A;  1JTG A;  1BLH A;  2JCH A;  1S0W A;  1EWZ A;  4KZ7 A;  3PTE A;  4S2N A;  4JBF A;  1XGI A;  1BLS A;  1YLZ A;  2W3D A;  3CG5 A;  3UDX A;  2VGJ A;  2VGK A;  4QJG A;  2ZC7 A;  2ZOH A;  5CTN A;  3E0Y A;  3IS2 B;  1W7F A;  1K57 C;  3HLG A;  4DMZ A;  3MQ0 A;  2XK1 A;  4EBL A;  3UPN A;  1N9B A;  1AXB A;  2Y91 A;  4JKT A;  1PI4 A;  4DRT A;  4WZ5 C;  4E6W A;  4R4S A;  1K56 D;  5HDC A;  2XA7 S;  3VMA A;  1ERQ A;  3U2A A;  3CMZ A;  4R38 A;  4B4X A;  3LR0 A;  4GKU A;  4H6J A;  5F1G A;  3C7V A;  1MY8 A;  1OTB A;  2HJ9 C;  3A0V A;  2H10 A;  5CHM A;  3PBQ A;  4E3K A;  3K3C A;  3KSI A;  4FUW A;  1VEU A;  4R1G A;  1SDE A;  5CHU A;  5A93 A;  1XX2 A;  4N9K A;  4I38 A;  4OLD A;  2PU2 A;  4M4X A;  1NYM A;  1BLP A;  1RCJ A;  1S66 L;  3LEZ A;  3FC7 A;  5EOE A;  1E3U D;  4C3Q A;  3OPH A;  4I39 A;  4HP4 A;  4DE2 A;  4BBV A;  4KZ9 A;  3HRE A;  4KG6 A;  3ZYT A;  3NOU C;  5HWT A;  1KE4 A;  4AFI A;  3UDI A;  4NXE A;  1NJ4 A;  4ZAM A;  3ISG A;  4B4Z A;  2QJ7 A;  2ZQ8 A;  4PM6 A;  3IS2 A;  1ACF A;  5GLD A;  5CHJ A;  1N9O A;  1NXY A;  3CUE A;  5CEC A;  2VA0 A;  1K54 C;  2ACG A;  1MZU A;  4L0L A;  4S2L A;  4BL2 A;  1XJ4 A;  3VP2 A;  3BFF A;  5U47 A;  5TR7 A;  2O9A A;  2WYX A;  2EX8 A;  2V20 A;  4PKY A;  2XEP A;  3M6H A;  4BD1 A;  2O9B A;  2IA2 A;  4WEL A;  1MWT A;  4IVK A;  4MN6 A;  4KQR A;  4ME4 A;  3VP4 A;  3SS3 A;  2IWC A;  3F1P B;  4QPR A;  2V1Z A;  3ZNT A;  1KVM A;  1K25 A;  2H5S A;  5DKK A;  3BW6 A;  5BOH A;  2V2F F;  3A3J A;  3PBS A;  2E8I A;  4IBX A;  4HBT A;  4G3W A;  1ZHH B;  1NY0 A;  5DF9 A;  1XA7 A;  3HL9 A;  2B5R A;  3R4K A;  2WAE A;  2VZW A;  1W63 Q;  1OT9 A;  2J3W A;  2JKT M;  1LLB A;  1GHI A;  3VFF A;  2HP5 A;  3W2Z A;  3K2N A;  2I9V A;  5FQM A;  4MBH A;  2Y2I A;  3LY4 A;  2HZ5 A;  4Y0T A;  3PBN A;  1CQA A;  1FCM A;  4BBT A;  3LI8 A;  2ZL1 B;  4ETZ A;  3SS4 A;  3OCL A;  1FIL A;  2XSS A;  3S4X A;  4DF6 A;  1NRF A;  3PHY A;  5HPF A;  3H82 B;  3NJA A;  4OQI A;  2ZQ9 A;  4II7 A;  3UE0 A;  3IXD A;  4Y2F A;  1XGJ A;  3C4O A;  4JLF A;  4LRZ E;  2FZ0 A;  1WYC A;  3F1P A;  1PZP A;  2J8Y A;  1K6R A;  4HH2 A;  1FCO A;  2A3U A;  2VX8 A;  2EWV A;  3LID A;  1NRJ A;  2PT7 A;  2WZX A;  3V39 A;  3W4P A;  1GA9 A;  4WMC D;  3A3I A;  3WRZ A;  2HP9 A;  4B9O A;  2D02 A;  5HWV A;  1JWV A;  2VV6 A;  3MR0 A;  3G35 A;  1EW0 A;  3FZC A;  1PIO A;  2ZC6 B;  1OJG A;  3EOI A;  4JGP A;  5KSC A;  4LFU A;  4NXF A;  4JGR A;  1F2K A;  1YSQ A;  3Q7Z A;  2XH9 A;  2RL3 A;  5DF8 A;  2XGN A;  3VSK A;  3O86 A;  1UGU A;  2ZL1 A;  1PRQ A;  1V9Y A;  2B18 A;  5HAP A;  4HBU A;  3N6I A;  3V67 A;  3N8S A;  5CTM A;  1O7E A;  4DXB A;  1W8Y A;  4PPR A;  3H82 A;  1ONH A;  2QPN A;  3O5Y A;  3RXX A;  4BQM A;  1J3W A;  5G18 A;  4PMA A;  1TS6 A;  4GS9 B;  4NXB A;  1L0F A;  4NEE D;  1ODV A;  3MMH A;  1WYB A;  2Y4A A;  2ZMV A;  4LPZ A;  1XPB A;  3A0R A;  5L09 A;  2O0Y A;  1NLZ A;  5FQQ A;  3IXG A;  3RTY A;  1YT4 A;  3NHQ A;  1XJ6 A;  2JKR M;  3ZG0 A;  4LCL A;  3IXH A;  2BTF P;  3OOV A;  2EX2 A;  3W8K A;  1BYW A;  4YNR A;  4WEJ A;  3NY4 A;  1MWS A;  2V1A A;  4BD0 A;  1DP8 A;  5AVF A;  1STZ A;  4PM8 A;  1ES3 A;  5FQI A;  2XFS A;  2H28 A;  5CRF A;  3FKW A;  3ZHH A;  3O3V A;  5HDS A;  2V1B A;  1PWD A;  4PM7 A;  3GRJ A;  2A2L A;  4YWZ A;  2V9A A;  1CEG A;  2JC7 A;  4MBF A;  3VP3 A;  2WKR A;  3QP4 A;  5DJT A;  2M7U A;  4QD4 A;  4O01 A;  4GS9 A;  2GDN A;  2V0W A;  2HJE A;  1K6S A;  4NKP A;  1TEM A;  2ZC3 B;  2B02 A;  3OC2 A;  4RX3 A;  5E2H A;  1P9W A;  5J7E A;  1G6A A;  1G5U A;  1GCE A;  3KYQ A;  1PZO A;  4HJ3 A;  2PYR A;  5KZH A;  1KGE A;  1HLU P;  2ZD8 A;  3SW1 A;  1DJB A;  4OON A;  2PDR A;  2OSU A;  5M1A A;  4B93 A;  1BZA A;  2KLI A;  3BFG A;  4NG2 A;  1S1Z A;  2QJ5 A;  3FG8 A;  5HL1 A;  4GJ4 A;  3Q81 A;  3IWQ A;  4EET B;  3R7W B;  1FOF A;  4UHU A;  1MWR A;  3Q7V B;  4F3L B;  1PWG A;  1XKZ A;  2C6W B;  4OQ0 A;  4KUO A;  3DTM A;  4E3I A;  4JXG A;  5EOO A;  5A92 A;  2ZJ9 A;  2M7V A;  2A24 A;  2VKS A;  3F1N B;  4KZ4 A;  1NWZ A;  1TDL A;  1YQS A;  5C5K A;  1SKF A;  4PM5 A;  2XD1 A;  5CGX A;  3IQA A;  3D3O A;  4EQI A;  3BQA A;  1L0G A;  4Q8I A;  5HFO A;  4YOF A;  3BJN A;  3IWI A;  4QWO A;  4YFM A;  2PU4 A;  3T1X A;  3B47 A;  3HLW A;  1FSY A;  1IFQ A;  3IHB A;  2Y2Q A;  3UB7 A;  1MBL A;  1K0K A;  2ZC4 B;  1XFQ A;  1DP6 A;  3GDI A;  1T1A A;  5EUA A;  3E4P A;  3SH9 A;  4EBN A;  1K55 C;  1HZO A;  4GDB A;  4EQ1 A;  4ETX A;  2X02 A;  4KQO A;  5E2F A;  1TVF A;  3P98 A;  3TOI A;  1UWP X;  2QYB A;  5EE8 A;  4O7D A;  5DTT A;  3IF6 A;  3R7W A;  4E3O A;  3WS5 A;  3Q7V A;  4F3L A;  3ICY A;  3LGO A;  3WWX A;  2GX5 A;  4E3L A;  4CLC A;  5HDD A;  1T1B A;  3TW8 A;  3CIT A;  3F1N A;  4KEN B;  4X1L A;  2PRF A;  4E3N A;  1VM1 A;  3BLS A;  4K0W A;  4BJP A;  5FSR A;  1PFL A;  1PI5 A;  2PR6 A;  3UN7 A;  4ID4 A;  3OLO A;  1KOU A;  4OP5 A;  4R4R A;  3ZVT A;  1O07 A;  5IU1 A;  3WRT A;  3QP6 A;  4MLL A;  3HJI A;  5FEF A;  4OQG A;  3HLD A;  2ZQA A;  5L8M A;  2W0N A;  1M40 A;  3N7W A;  1SZV A;  4JPM A;  3BFE A;  3CHW P;  1DJC A;  3IX3 A;  1I2S A;  5D3O A;  5DKL A;  3FPW A;  3ZFZ A;  4LRY C;  4Y13 A;  3IX4 A;  3G2Y A;  4ZJ1 A;  3JVV A;  3LR5 A;  3U4L P;  4RA7 A;  3BM6 A;  1TS8 A;  5AQA A;  4QU3 A;  3ZQ5 A;  1LHY A;  4ESP A;  4Y5F A;  1LSV A;  3S22 A;  5JYP A;  3QP8 A;  3PBR A;  2A49 A;  1FSW A;  1Y54 A;  1K56 A;  1NYY A;  3QP1 A;  2J7V A;  4R70 A;  3EEH A;  3GQZ A;  5HZH A;  1VET B;  2JKG A;  5GL9 A;  1GA0 A;  1SHV A;  4MN5 A;  3P01 A;  3UO9 A;  1FIK A;  1OME A;  3LR4 A;  2XD5 A;  3E2K A;  2R78 A;  4S2O A;  1W63 M;  5HD3 A;  3HUN A;  3T1S A;  3ZNY A;  3LI9 A;  3ZG5 A;  5HAR A;  3HBR A;  1FR1 A;  1E3U A;  1W8Q A;  3OPL A;  4EV4 A;  4Y3I A;  3C2W A;  2WAD A;  1YLW A;  3MFX A;  4DXC A;  3CWF A;  4OP8 A;  2Y2M A;  1ERM A;  4GHI B;  1LSW A;  4KZA A;  3BY9 A;  5TGF A;  4JF5 A;  4X69 A;  2V8C A;  1KGG A;  3C7U A;  3KYZ A;  4HHD A;  1PYY A;  1YSP A;  3Q1F A;  4E04 A;  5AJG A;  4FH4 A;  1ESU A;  4GCZ A;  2ZLY A;  3P7N A;  2W1T B;  4KZB A;  3QP5 A;  4QHC A;  5HPI A;  4Y15 A;  1P97 A;  1ES5 A;  1MPL A;  2WKQ A;  2Z6D A;  3C38 A;  4HEF A;  4EEP A;  3BLM A;  5A8B A;  3HCY A;  4OKP A;  3H7W B;  3C5A A;  1BLC A;  3H9W A;  5M18 A;  1VET A;  1OT6 A;  3BFD A;  4UEY A;  3DAV A;  3HUO A;  4PHT A;  4I3J A;  4GD8 A;  4X1M A;  3IH9 A;  4HI4 A;  5GHY A;  3KO6 A;  2ZC5 B;  1LL9 A;  1G68 A;  2P08 A;  4GB7 A;  3NDE A;  3VE4 A;  3W4Q A;  3ZCZ A;  1I5Q A;  4X53 A;  1XJ3 A;  4EUZ A;  2NUT C;  3LIF A;  4DJ3 A;  3TRC A;  2DRW A;  3OCN A;  2Y2L A;  1OTA A;  4IVI A;  2OAQ 1;  4JF6 A;  4GHI A;  2IWD A;  1P9R A;  5FAS A;  2ZBB A;  1YM1 A;  5FAP A;  3L9K A;  1YMX A;  3C4P A;  3D4F A;  2W1T A;  2QKP A;  2JKF A;  2R9X A;  1IEL A;  5CED A;  1G28 A;  5KIZ A;  2WKE A;  2ZM8 A;  3VP1 A;  3DTI A;  3DWK A;  2Y59 A;  3GVB A;  3M2J A;  1GHM A;  3DWZ A;  3QP2 A;  3G31 A;  3H7W A;  5FAO A;  4JXS A;  2VV7 A;  4P6B A;  1K4F A;  3LY3 A;  3UMD A;  3NOP C;  3UE3 A;  4PKY G;  4GDN A;  1IEM A;  2W3E A;  4L9G A;  4WMC A;  3MSH A;  2WZZ A;  4JGQ A;  5KSH A;  1BT5 A;  4P85 A;  4RYE A;  4E3M A;  2OWH A;  2GNX A;  1QMF A;  1X0O A;  4MMN A;  2BG1 A;  4X25 A;  3PBO A;  4XXR A;  5FAQ A;  2H0T A;  2Y2K A;  3UB5 P;  5CER A;  2VLG A;  4OPY A;  5EVI C;  4E6X A;  1VHM A;  4D2O A;  2Y8H A;  3S7N A;  2P9V B;  3BRM A;  3F1O B;  2JKT I;  1WE4 A;  2W3G A;  3CPT B;  3NDG A;  3VSL A;  2KOI A;  1E25 A;  1J9M A;  3ZG8 B;  4N92 A;  4CLC E;  1Y28 A;  4OLG A;  4Z9Q A;  1CK3 A;  5JYO A;  5FL3 A;  4KUK A;  1PNE A;  3ZVW A;  3LEQ A;  3T1R A;  5EVL A;  3QNB A;  4UA7 A;  2HP6 A;  5M19 A;  3NIA A;  2ZQC A;  4L9E A;  4K0X A;  4ARZ B;  1VB6 A;  1CI8 A;  4S2N C;  3BEC A;  4KZ6 A;  2Y2H A;  5CGS A;  5FI2 A;  3IWO A;  1HVB A;  1QME A;  3N8R A;  3EQV A;  1MC0 A;  4FD8 A;  3VP0 A;  4EEU A;  1K57 A;  5AQ9 A;  1ESI A;  1XJ2 A;  3T4T A;  3GMW A;  4KZ8 A;  1DP9 A;  1S1Y A;  3LO7 A;  5GLB A;  3LIB A;  5E2G A;  2XRN A;  3EGX C;  4WZ5 A;  3SH7 A;  1ES2 A;  2P9V A;  3S7P A;  3NCK A;  5F69 A;  5AQ7 A;  3F1O A;  2LB9 A;  3C8C A;  1S67 L;  2G2U A;  2ZQD A;  3CPT A;  3B3X A;  3Q82 A;  5HD5 A;  2HF6 A;  2JN7 A;  1W5D A;  4HOI A;  2X71 A;  2B95 A;  2Y55 A;  1YMS A;  2HDR A;  4X55 A;  3G34 A;  4WL9 A;  4EU0 A;  3UNW A;  3UB8 A;  2ZMA A;  3FWL A;  3T1Q B;  4S2P A;  3BWL A;  3HVF A;  2Y2P A;  1PW8 A;  3MXS A;  4ARZ A;  1YPR A;  3IH8 A;  2OWJ A;  4Q0H A;  4UA6 A;  1FCN A;  4LGW A;  3ZG7 B;  2EWW A;  4YIN A;  1H3Q A;  2H0Y A;  4WF0 A;  1JTD A;  3TE8 A;  3V5M A;  2W3F A;  3MZF A;  1TF1 A;  2P04 A;  5I5L A;  2WGW B;  3KYE A;  5AQB A;  2G7U A;  1K54 A;  3MXR A;  4ZRR A;  3AGD A;  3CUE C;  3G30 A;  2W3H A;  1W79 A;  4P6Z M;  3V50 A;  1PWC A;  2JKR I;  4Y17 A;  2VV8 A;  3RXW A;  5A91 A;  5GHX A;  3CLO A;  5GLA A;  2NUP C;  1AWI A;  3V3R A;  1IKI A;  2INW A;  3CAX A;  3K3D A;  5FDH A;  4LLO B;  3A0S A;  3LIC A;  4IUH A;  2J9P A;  4M3K A;  1VQQ A;  4JGO A;  4G3V A;  1DY6 A;  1OTE A;  4LCM A;  1CJF A;  1GHP A;  3SZT A;  4Z1W A;  4Y0O A;  3E4Q A;  3QNC A;  2WKI A;  1F9I A;  1D1J A;  3MJQ A;  3L7H A;  2I72 A;  2JBF A;  4LEN A;  2E8J A;  1XA1 A;  4NK3 A;  2P74 A;  4JXV A;  2FFF B;  3VOZ A;  2WGW A;  1S6R A;  2Y2J A;  3UME A;  5F82 A;  3DTK A;  2L0W A;  2ZM0 A;  3FPV A;  3PYP A;  5A90 A;  4IJG A;  1LL8 A;  5EFW A;  5FQJ A;  4K08 A;  1NZU A;  4R3B A;  4OH0 A;  2JHE A;  3SS5 A;  1XFN A;  4C75 A;  4WLA A;  3GSG A;  5FI6 A;  1V9Z A;  1YAX A;  3G2Z A;  3RJU A;  1EI5 A;  1ONG A;  2FH5 A;  2V0U A;  3ITB A;  5MC7 A;  3GV9 A;  5F6A A;  2OAP 1;  3MS6 A;  1TD5 A;  3A3E A;  3LUQ A;  1D06 A;  1D7E A;  5CEB A;  5L2F A;  1BUL A;  3Q07 A;  4BLM A;  3MKF A;  1U60 A;  3ITA A;  3PAE A;  3TG9 A;  2UWX A;  1FQG A;  3WS4 A;  5EVI D;  2GZA A;  3A3F A;  3JPU A;  4RQ9 A;  1S4S A;  2Q9N A;  1CEF A;  5HAI A;  3D72 A;  2KX6 A;  4R6L A;  4EES A;  2WK0 A;  1G6O A;  3DBA A;  1SCW A;  3UPO A;  1PW1 A;  2M1C A;  4OOM A;  1L0E A;  4BL3 A;  4LV3 A;  3S1Y A;  2G2W A;  4EXO A;  5F5Y A;  2Y79 A;  3G4P A;  2ZM2 A;  4BMW A;  1C3B A;  1KGF A;  2O99 A;  2K2N A;  4LV2 A;  4U0T A;  2RCX A;  1DJA A;  3PXP A;  4RVA A;  2YKH A;  1L2S A;  1YKD A;  1HTZ A;  3M2K A;  3LCE A;  2J3T C;  3OPP A;  4QB8 A;  3WS0 A;  4EUV A;  3HUM A;  5GLC A;  2Y2N A;  3OPR A;  3VE3 A;  1ERO A;  2O9C A;  3FV7 A;  1CF0 A;  3KSG A;  1A0K A;  4A5R A;  3UB9 A;  1IYP A;  3NC8 A;  4OPR A;  4K91 A;  1SKO B;  4KQD A;  4MCW A;  3JVU A;  5DTK A;  2FFY A;  5CX7 A;  4U0X A;  1H8Y A;  2BLS A;  4ZBE A;  4R3J A;  2GJ3 A;  2QMI A;  4GOG A;  2PBY A;  4ZJ2 A;  2P7J A;  1T19 A;  5FDS A;  3MF0 A;  2CMN A;  1MKM A;  3MZE A;  5HSQ A;  1WA9 A;  2LB5 A;  3P09 A;  4JXW A;  2K7S A;  2VK3 A;  4S2J A;  3OBF A;  2WGV A;  4XT2 B;  5G4Y A;  2PD8 A;  3HLC A;  1Z09 A;  3V3S A;  2BAS A;  1S4R A;  2ZQ7 A;  3T4L A;  2DCF A;  1FR6 A;  4EER A;  3WS1 A;  5IS1 A;  4WBG A;  3IXB A;  2OLV A;  3EEA A;  1KDS A;  4P87 A;  2PHY A;  1XXM A;  4UAA A;  2OOL A;  3BEB A;  3CI6 A;  3IBR A;  3I7J A;  1RGZ A;  2HPB A;  1SKO A;  3NBL A;  1K38 A;  2YKF A;  1LL5 A;  2QHK A;  4P0M A;  3S7Q A;  4GN2 A;  4DDY A;  4MBK A;  4CPK A;  5EVE A;  4HP9 A;  3GR2 A;  1ZKJ A;  4CJN A;  4B88 A;  3PR6 A;  2VJW A;  3NI9 A;  4XT2 A;  4QY5 A;  3W4O A;  4EBP A;  5G4Z A;  3NUL A;  3T50 A;  2Y2G A;  2XQZ A;  2XA7 M;  4I3I A;  3MFD A;  5K5B A;  4FSF A;  1N9N A;  4XUX A;  4MN7 A;  4D60 A;  1H5X A;  3D9Y A;  1Q2Q A;  1ZG6 A;  1N4O A;  2HGV A;  3PBT A;  1I2W A;  1L3L A;  4UQI S;  3UB6 A;  2WKH A;  4OVD A;  3LYX A;  4CQH A;  3E98 A;  4FTX A;  4WN5 A;  3HLF A;  3MQO A;  3O87 A;  4JF4 A;  5F1F A;  5HX9 A;  1JWP A;  1JWZ A;  4IED A;  1YLP A;  3LR3 A;  2CC1 A;  3N4I A;  4HIA A;  3CJM A;  4LRX C;  5HWW A;  1Z6F A;  1H8M A;  4HNB A;  1K55 A;  5IT5 A;  5CGW A;  1OPX A;  5F68 A;  5TBM B;  3KX0 X;  4PM9 A;  2Z2M B;  2Z2L B;  3BFC A;  5E2E A;  3UE1 A;  5LBR A;  2C5W B;  4QY6 A;  2ZOI A;  2ZMF A;  3BYD A;  1IYS A;  3QHY A;  1TS0 A;  3ULF A;  5DJU A;  4ZDX A;  1ZTU A;  4MEZ A;  3NEC A;  5DF7 A;  3IF6 C;  4X6T A;  3T4Q A;  1KE0 A;  1IYO A;  1SDN A;  5DVA A;  4BEN A;  3T4S A;  2OV5 A;  3GEC A;  3ZG9 B;  4FOF A;  4CLC C;  3G6O A;  5HAQ A;  3MBZ A;  4O8G A;  5J3W A;  3BY8 A;  2OLU A;  3ZDJ A;  2WUQ A;  3OZH A;  2DMW A;  1BUE A;  4S2I A;  3DTE A;  5EV0 A;  1H0M A;  3EWK A;  4KQQ A;  5GHZ A;  2L4R A;  1L0D A;  2XFT A;  1LT0 A;  3S7O A;  3GTC A;  1LSX A;  2DNS A;  4KG5 A;  1MWU A;  1N9L A;  3HJK A;  3RH8 B;  4Y7P A;  4UQI M;  4GLQ A;  1KVL A;  5TBM A;  2PYP A;  3VV4 A;  4P6Z S;  3VOL A;  1NZO A;  3FKV A;  1K4E A;  5HL6 A;  5DFX A;  2J3T D;  5FQ9 A;  3LFV A;  4HJ6 A;  3UDF A;  1IYQ A;  1RGY A;  2V8F A;  4WM9 A;  4F94 A;  4UA9 A;  2QWS A;  3NOT C;  3WS2 A;  4KG2 A;  3VOY A;  2VGL S;  3T4O A;  1P0Z A;  4O0P A;  2XRO A;  2Y2O A;  4N1X A;  4MDZ A;  5L07 A;  4LV0 A;  3T12 B;  4NET A;  3IF5 A;  2WGI A;  1T1C A;  1YLJ A;  1ZG4 A;  2WKP A;  4DKI A;  4LV1 A;  2Z6C A;  3LIE A;  4GZB A;  2L1M A;  4OPZ A;  4XUZ A;  2IWB A;  2W27 A;  3B33 A;  1LI0 A;  1F98 A;  5KMW A;  4OOL A;  5FQK A;  2EXA A;  3LIA A;  5DTS A;  4MNR A;  2MJ6 A;  4IBR A;  4L9F A;  4DJ2 A;  4X56 A;  3VFH A;  2J80 A;  1GSV A;  3MXQ A;  3IBJ A;  3RFB A;  2VEA A;  4GW9 A;  5AVE A;  1MKI A;  2EX9 A;  1KDW A;  5J8X A;  2K31 A;  2XF3 A;  3EQU A; 
#chains in the Genus database with same CATH homology
 2J9O A;  3WRZ A;  2HP9 A;  3ITA A;  2HDU A;  5FA7 A;  3PAE A;  1ERM A;  4GNU A;  1JWV A;  5CXW A;  2XLN A;  4DE0 A;  3TG9 A;  4KZA A;  3G35 A;  5TGF A;  3ZGA B;  2UWX A;  4JF5 A;  4X69 A;  1IKG A;  1KGG A;  3C7U A;  1FQG A;  3WS4 A;  1HD8 A;  1PYY A;  3FZC A;  4U3T A;  1PIO A;  5EVI D;  2ZC6 B;  3Q1F A;  4ZJ3 A;  4FH4 A;  3A3F A;  1ESU A;  1RP5 A;  1JVJ A;  2ZLY A;  5KSC A;  4KZB A;  2Q9N A;  4QHC A;  1CEF A;  3Q7Z A;  5HAI A;  4R0Q A;  2XH9 A;  2RL3 A;  5DF8 A;  3JYI A;  1ES5 A;  2XGN A;  2WK0 A;  4WZ4 A;  1MPL A;  1SCW A;  3PAG A;  3VSK A;  3O86 A;  1PW1 A;  3UPO A;  4HEF A;  3MZD A;  3SH8 A;  4OOM A;  3BLM A;  4OKP A;  1L0E A;  5FAT A;  3TSG A;  4BL3 A;  3C5A A;  2EFX A;  4LV3 A;  3S1Y A;  4EWF A;  1BLC A;  5HAP A;  4HBU A;  5M18 A;  4KZ3 A;  5IHV A;  2G2W A;  2EXB A;  5HW3 A;  3N6I A;  5EEC A;  3BFD A;  3N8S A;  1H8Z A;  3G4P A;  5CTM A;  2ZM2 A;  1O7E A;  4X68 A;  4S2K A;  4N9L A;  4DXB A;  1W8Y A;  1C3B A;  3HUO A;  4PPR A;  5F83 A;  1KGF A;  4DDS A;  2X01 A;  4LV2 A;  4U0T A;  2RCX A;  4GD8 A;  3IH9 A;  1DJA A;  5GHY A;  3DW0 A;  3AGF A;  1ONH A;  2ZC5 B;  4RVA A;  2QPN A;  4WYY A;  3RXX A;  1L2S A;  1LL9 A;  1G68 A;  1HTZ A;  3LCE A;  3M2K A;  5G18 A;  4BQM A;  4C6Y A;  3IF6 B;  4GB7 A;  3NDE A;  3W4Q A;  2WAF A;  4PMA A;  3ZCZ A;  1I5Q A;  4R23 A;  4X53 A;  1YLY A;  2JE5 A;  3OPP A;  1L0F A;  5EVI B;  4QB8 A;  3WS0 A;  3HUM A;  5GLC A;  4EUZ A;  1CI9 A;  2Y2N A;  1XP4 A;  3OPR A;  1M6K A;  1LI9 A;  3O88 A;  1ERO A;  3FV7 A;  3IHA A;  2DRW A;  5FI7 A;  3OCN A;  1ZC2 A;  4A5R A;  2Y2L A;  1WYB A;  2Y4A A;  4IVI A;  1XPB A;  3A3D A;  1IYP A;  4JF6 A;  3NC8 A;  4OPR A;  2IWD A;  5FQQ A;  4K91 A;  5TFQ A;  5I94 A;  3IXG A;  4H8R A;  5FAS A;  1YT4 A;  1BTL A;  5DTK A;  2FFY A;  1YM1 A;  1KE3 A;  4FH2 A;  5FAP A;  3ZG0 A;  4U0X A;  4LCL A;  1H8Y A;  1MXO A;  3IXH A;  2BLS A;  4ZBE A;  4R3J A;  2QMI A;  1YMX A;  2XDM A;  3C4P A;  3CZD A;  4GOG A;  3D4F A;  2PBY A;  3G32 A;  3M6B A;  4ZJ2 A;  2EX2 A;  2R9X A;  5CED A;  1IEL A;  2R9W A;  2WKE A;  2ZM8 A;  3W8K A;  3VP1 A;  3DWK A;  4WEJ A;  2Y59 A;  3MZE A;  3NY4 A;  1MWS A;  3GVB A;  3M2J A;  4DE3 A;  3P09 A;  1GHM A;  3DWZ A;  4BD0 A;  4JXW A;  4S2J A;  3UY6 A;  4PM8 A;  1BSG A;  3N8L A;  1ES3 A;  5FQI A;  3G31 A;  3HLE A;  2XFS A;  2WGV A;  3HLB A;  5CRF A;  3FKW A;  3ZHH A;  3O3V A;  4JXS A;  5FAO A;  4P6B A;  3HLC A;  1K4F A;  3V3S A;  1ALQ A;  2HDS A;  2ZQ7 A;  2DCF A;  3LY3 A;  1PWD A;  4PM7 A;  3GRJ A;  3UE3 A;  1FR6 A;  4GDN A;  2HDQ A;  3WS1 A;  1IEM A;  1CEG A;  2QZ6 A;  4WMC A;  1YLT A;  2JC7 A;  4MBF A;  3VP3 A;  4OPQ A;  3FYZ A;  4RX2 A;  3E2L A;  2WZZ A;  4WBG A;  3IXB A;  5KSH A;  4HES A;  2OLV A;  2EFU A;  3AGE A;  1BT5 A;  4P85 A;  4QD4 A;  3SOI A;  4RYE A;  4E3M A;  1QMF A;  1KDS A;  4P87 A;  2GDN A;  1E4D A;  1Q2P A;  2BG1 A;  5EVI A;  3PBO A;  4XXR A;  5FAQ A;  2H0T A;  2Y2K A;  4GD6 A;  1K6S A;  1XXM A;  1TEM A;  5CER A;  2EX6 A;  1TDG A;  2ZC3 B;  4OPY A;  4UAA A;  5EPH A;  5EVI C;  4D2O A;  4E6X A;  3OC2 A;  3MKE A;  4RX3 A;  4WEK A;  2XR0 A;  3BEB A;  5E2H A;  3EQU A;  2P9V B;  4S2M A;  3IT9 A;  3I7J A;  1G6A A;  1RGZ A;  4OQH A;  4ZTK A;  2HPB A;  3BRM A;  4KZ5 A;  2Q9M A;  1WE4 A;  4N1H A;  1GCE A;  3NBL A;  1K38 A;  4OOY A;  3NDG A;  4Y0U A;  3VSL A;  1E25 A;  4DE1 A;  4FCF A;  1J9M A;  1PZO A;  1LL5 A;  3UPP A;  3ZG8 B;  4N92 A;  1ES4 A;  4OLG A;  4P0M A;  4Z9Q A;  1CK3 A;  5KZH A;  1KGE A;  4GN2 A;  2ZD8 A;  4DDY A;  4MBK A;  5JYO A;  3ZVW A;  1DJB A;  5E43 A;  4CPK A;  4OON A;  4E3J A;  1JTG A;  2OSU A;  5M1A A;  1BLH A;  5EVL A;  3QNB A;  2JCH A;  3GR2 A;  1S0W A;  1BZA A;  1EWZ A;  1ZKJ A;  4UA7 A;  4CJN A;  4KZ7 A;  2HP6 A;  3BFG A;  5M19 A;  4B88 A;  3NIA A;  2ZQC A;  3PTE A;  5HL1 A;  4K0X A;  3Q81 A;  4S2N A;  3NI9 A;  4JBF A;  3IWQ A;  4QY5 A;  1XGI A;  1BLS A;  1CI8 A;  1FOF A;  1YLZ A;  3BEC A;  4S2N C;  3W4O A;  4EBP A;  4KZ6 A;  2Y2H A;  5CGS A;  4UHU A;  1MWR A;  3Q7V B;  5FI2 A;  1PWG A;  1XKZ A;  2C6W B;  3IWO A;  4OQ0 A;  3CG5 A;  3UDX A;  1HVB A;  1QME A;  2VGK A;  2VGJ A;  3DTM A;  4E3I A;  2ZC7 A;  4QJG A;  4JXG A;  5EOO A;  3N8R A;  2Y2G A;  2XQZ A;  2ZJ9 A;  5A92 A;  3EQV A;  5CTN A;  4FD8 A;  3VP0 A;  1K57 A;  3MFD A;  5AQ9 A;  4KZ4 A;  4FSF A;  1ESI A;  4XUX A;  1W7F A;  1TDL A;  1H5X A;  1K57 C;  1YQS A;  3HLG A;  1Q2Q A;  1ZG6 A;  3GMW A;  4KZ8 A;  2XK1 A;  1N4O A;  4EBL A;  3PBT A;  1I2W A;  3UPN A;  3LO7 A;  5GLB A;  1SKF A;  5E2G A;  4PM5 A;  2WKH A;  2XD1 A;  4OVD A;  5CGX A;  1N9B A;  3IQA A;  3HLF A;  4WZ5 A;  3SH7 A;  3O87 A;  4JF4 A;  1AXB A;  1ES2 A;  4EQI A;  2Y91 A;  4JKT A;  5F1F A;  1PI4 A;  5HX9 A;  4DRT A;  4WZ5 C;  2P9V A;  1JWP A;  4E6W A;  1L0G A;  4R4S A;  4Q8I A;  3NCK A;  1JWZ A;  5HFO A;  4IED A;  5AQ7 A;  1K56 D;  1YLP A;  2CC1 A;  3N4I A;  3VMA A;  2G2U A;  3IWI A;  2ZQD A;  4YFM A;  1ERQ A;  2PU4 A;  3HLW A;  3CJM A;  3CMZ A;  1FSY A;  3IHB A;  4B4X A;  2Y2Q A;  1Z6F A;  1MBL A;  3C7V A;  4GKU A;  5F1G A;  1MY8 A;  2ZC4 B;  3B3X A;  3PBQ A;  3Q82 A;  2H10 A;  5CHM A;  1K55 A;  4E3K A;  5CGW A;  5EUA A;  1W5D A;  3SH9 A;  4EBN A;  2X71 A;  4R1G A;  1K55 C;  1HZO A;  1YMS A;  1SDE A;  2HDR A;  2Y55 A;  5CHU A;  4GDB A;  5A93 A;  1XX2 A;  4N9K A;  4X55 A;  3G34 A;  4OLD A;  2PU2 A;  4PM9 A;  2X02 A;  4KQO A;  1NYM A;  3UNW A;  2Z2M B;  2Z2L B;  2ZMA A;  1BLP A;  1RCJ A;  3BFC A;  1TVF A;  5E2F A;  5E2E A;  3FWL A;  3LEZ A;  3UE1 A;  3P98 A;  4S2P A;  3TOI A;  3HVF A;  2Y2P A;  5EE8 A;  2C5W B;  1PW8 A;  3MXS A;  4QY6 A;  5EOE A;  4O7D A;  3IH8 A;  1E3U D;  3BYD A;  1IYS A;  5DTT A;  3IF6 A;  3QHY A;  4C3Q A;  3OPH A;  4UA6 A;  4ZDX A;  4E3O A;  4MEZ A;  1FCN A;  5DF7 A;  3IF6 C;  4X6T A;  3WS5 A;  3Q7V A;  4DE2 A;  4KZ9 A;  1KE0 A;  3ZG7 B;  1IYO A;  3HRE A;  1SDN A;  4KG6 A;  5DVA A;  3WWX A;  4BEN A;  4E3L A;  1KE4 A;  4YIN A;  3UDI A;  2OV5 A;  1NJ4 A;  4ZAM A;  2H0Y A;  3ISG A;  1JTD A;  3V5M A;  4B4Z A;  3ZG9 B;  2ZQ8 A;  3MZF A;  4KEN B;  4PM6 A;  4E3N A;  5HAQ A;  2WGW B;  3MBZ A;  1VM1 A;  5AQB A;  5GLD A;  3BLS A;  5CHJ A;  1K54 A;  1NXY A;  3MXR A;  4K0W A;  5FSR A;  4BJP A;  5CEC A;  2OLU A;  1K54 C;  1PI5 A;  3AGD A;  3G30 A;  3ZDJ A;  2WUQ A;  3OZH A;  4L0L A;  3UN7 A;  1BUE A;  1W79 A;  4S2L A;  4S2I A;  4BL2 A;  4ID4 A;  3BFF A;  3VP2 A;  3V50 A;  5U47 A;  5TR7 A;  1PWC A;  4OP5 A;  4KQQ A;  2WYX A;  2V20 A;  2EX8 A;  5GHZ A;  2XEP A;  3M6H A;  1L0D A;  1O07 A;  2XFT A;  4R4R A;  5A91 A;  5GHX A;  4MLL A;  3RXW A;  3WRT A;  4BD1 A;  5GLA A;  3V3R A;  1IKI A;  3GTC A;  4WEL A;  1MWT A;  4OQG A;  4IVK A;  3HLD A;  5FDH A;  2DNS A;  2ZQA A;  4KQR A;  2J9P A;  4KG5 A;  3VP4 A;  1MWU A;  1M40 A;  3N7W A;  3SS3 A;  2IWC A;  4M3K A;  4Y7P A;  2V1Z A;  1VQQ A;  4JPM A;  1KVL A;  3ZNT A;  3BFE A;  1KVM A;  1K25 A;  2H5S A;  1DJC A;  1I2S A;  5D3O A;  1DY6 A;  4LCM A;  1GHP A;  3ZFZ A;  5BOH A;  2V2F F;  1NZO A;  3FKV A;  1K4E A;  4Y0O A;  3QNC A;  3A3J A;  2WKI A;  3PBS A;  2E8I A;  4IBX A;  3G2Y A;  4ZJ1 A;  5FQ9 A;  4HBT A;  3UDF A;  1IYQ A;  1RGY A;  4WM9 A;  1NY0 A;  1XA7 A;  3HL9 A;  4UA9 A;  2B5R A;  5DF9 A;  4F94 A;  2WAE A;  2I72 A;  3WS2 A;  4KG2 A;  4RA7 A;  3BM6 A;  3VOY A;  2JBF A;  5AQA A;  4QU3 A;  4LEN A;  1LHY A;  1LLB A;  1GHI A;  3VFF A;  1XA1 A;  2HP5 A;  2Y2O A;  4N1X A;  4NK3 A;  5FQM A;  4MBH A;  2Y2I A;  3S22 A;  2P74 A;  4LV0 A;  4JXV A;  4NET A;  3IF5 A;  5JYP A;  3LY4 A;  3PBR A;  2WGI A;  2FFF B;  3VOZ A;  2A49 A;  4Y0T A;  3PBN A;  1FSW A;  2WGW A;  1Y54 A;  1S6R A;  2Y2J A;  1FCM A;  1K56 A;  1YLJ A;  1ZG4 A;  5F82 A;  1NYY A;  4DKI A;  2ZM0 A;  4LV1 A;  5A90 A;  4GZB A;  4OPZ A;  4XUZ A;  2IWB A;  2J7V A;  1LI0 A;  3SS4 A;  3OCL A;  5KMW A;  3GQZ A;  5FQJ A;  1NZU A;  3S4X A;  4R3B A;  4DF6 A;  4OH0 A;  1NRF A;  4OOL A;  5GL9 A;  3ZVT A;  5FQK A;  3SS5 A;  1GA0 A;  1SHV A;  4C75 A;  2EXA A;  3UO9 A;  2Y2M A;  3GSG A;  4OP8 A;  1OME A;  4MNR A;  5DTS A;  5FI6 A;  2XD5 A;  3E2K A;  4S2O A;  3G2Z A;  3RJU A;  4OQI A;  1EI5 A;  2ZQ9 A;  1ONG A;  4IBR A;  3UE0 A;  3IXD A;  3ITB A;  3HUN A;  4X56 A;  1XGJ A;  3C4O A;  4JLF A;  3GV9 A;  3VFH A;  3ZNY A;  3ZG5 A;  5HAR A;  3HBR A;  1FR1 A;  1WYC A;  1E3U A;  1W8Q A;  3OPL A;  1PZP A;  2J8Y A;  1MKI A;  1K6R A;  4EV4 A;  1FCO A;  3A3E A;  2A3U A;  2EX9 A;  2WAD A;  1KDW A;  1YLW A;  5CEB A;  5L2F A;  1BUL A;  3Q07 A;  5J8X A;  2WZX A;  3V39 A;  3W4P A;  4BLM A;  1GA9 A;  4DXC A;  4WMC D;  2XF3 A;  3A3I A;  3MKF A;  1U60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...