5E43A

Crystal structure of beta-lactamase sros_5706 from streptosporangium roseum
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
b'GARARKELRTLEASFKGRIGAYAVDTATGKTITYRSGERFPLLSTFKAIAAAAVLHKARTSDPGLLNKVVHWTTAELQEHSPVTGKHVKDGMTVARLCEAAITRSDNTAANMLLKQIGGPAGLTAYFHTLKDPVSRLDRWETELNNWSPKEKRDTTTPASMGRDLRAVTTGDALDARDRERLNAWLTANKTGDARIRAGLPKTWTVGDKTGTNSKYGAGNDIAVVWPGKSAAPIIMSIYTNRGAADAAVDDKVIADTAAILARALGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Streptosporangium roseum (strain atcc 12428 / dsm 43021 / jcm 3005 / ni 9100)
publication title Crystal Structure of Beta-lactamase Sros_5706 from Streptosporangium roseum
rcsb
total genus 90
structure length 268
sequence length 268
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e43A00
5TR7A 4NETA 3UE1A 2V2FF 1YMSA 3GRJA 4DRTA 1GHMA 1DJCA 1RCJA 3EQUA 4GDNA 5D3OA 1E3UD 1MXOA 3Q7VA 5AQBA 4E3IA 3SS4A 1BZAA 5HW3A 4EV4A 1SKFA 3IXHA 1JTGA 5GLAA 1JWVA 1PI5A 1PW1A 3GSGA 4MBKA 4PM5A 1IYOA 3GR2A 2JCHA 2P9VA 5E2FA 2WGWA 1W8QA 3NDGA 3UNWA 1K56A 3HUMA 4ZJ1A 3HUNA 4P87A 5E2GA 3HVFA 4A5RA 4BENA 1K38A 3UY6A 1JWPA 1FSYA 2ZMAA 3HREA 4S2LA 4WZ5A 4S2NA 2PU4A 5M19A 2OLVA 1XP4A 3MZDA 2QPNA 1YLYA 2OLUA 4R3JA 3AGDA 2ZC7A 1O07A 3CJMA 4FSFA 1JWZA 3A3IA 1ZC2A 4GKUA 4RVAA 4WZ5C 5FQIA 3QNBA 4BD0A 3LEZA 4RX3A 1S6RA 2ZLYA 3W4QA 1EROA 2ZQAA 4HESA 4X69A 4LV0A 3E2KA 4X68A 4S2OA 1TEMA 1GHIA 2ZC3B 2ZC4B 1NY0A 2XR0A 5HARA 3ZDJA 5CEDA 3G30A 2V20A 4S2PA 1ERMA 1Q2QA 3BFDA 3V39A 1KVMA 2HDUA 4OQIA 1XA7A 2WYXA 2Y4AA 3AGFA 2WKHA 4WM9A 5GHXA 4KG6A 4R23A 2P74A 1L0EA 4KG2A 3N6IA 1QMEA 4KZ6A 3A3DA 3TSGA 5BOHA 4OPQA 3UDXA 2WGIA 2ZQ7A 5M18A 4OPZA 2G2WA 3ZHHA 1XGIA 3DTMA 4DKIA 3NI9A 2Y91A 1DJBA 3HBRA 4DE0A 4RYEA 2ZM0A 4GDBA 1MWUA 4PM8A 4Y0TA 4OPYA 4PM9A 1JVJA 1YLZA 4WEJA 1W5DA 2Y2KA 3TG9A 4BD1A 4QU3A 1C3BA 2XQZA 4HBTA 1MWTA 1ES2A 3V5MA 2HDSA 3D4FA 2HPBA 3C7VA 3WS2A 1K54A 4E3KA 1FR1A 1XKZA 3VP3A 3P98A 5KSCA 4R0QA 1GA9A 3FV7A 4B4ZA 4JF6A 4OQHA 3S4XA 3IXDA 2Y2MA 3OCNA 5FDHA 5HAPA 2I72A 3FKVA 4OLDA 1YQSA 1CEGA 1VM1A 4JXWA 1NXYA 3PBTA 4MBHA 1ZG4A 4FD8A 2P9VB 2Q9MA 3BFGA 5GL9A 4KZ4A 5I94A 2OSUA 4DXBA 3NCKA 3VSLA 5CECA 4R1GA 2Y2JA 3BEBA 5CGXA 2BLSA 1EWZA 4MNRA 5HFOA 1LL9A 3IF6C 4PPRA 1SCWA 5HX9A 5JYOA 5A91A 1KVLA 3IF5A 5EUAA 2ZQ9A 3BRMA 3UE0A 4OQ0A 3IH9A 1CK3A 4H8RA 1H5XA 1BLHA 5A93A 1LHYA 1BT5A 3MZFA 4OP8A 4R4RA 2J9PA 4DE3A 4EWFA 2HP9A 3G2YA 4UA6A 1JTDA 3SOIA 1I5QA 4XUZA 4JBFA 1PYYA 1L0FA 1ESUA 4C6YA 3UN7A 2C6WB 2EXAA 3IWOA 4KG5A 3HLGA 3ZVTA 3HLCA 1SDEA 3M2JA 3N4IA 2C5WB 2EFUA 2Y2PA 4BJPA 5EVIC 4E6XA 4Q8IA 1K55A 3P09A 5HAQA 2RL3A 2XDMA 3IF6A 4GZBA 4OOLA 3ZCZA 3LCEA 4P6BA 4ZJ2A 1VQQA 2ZM8A 4F94A 2FFYA 2WAFA 4CPKA 2XFSA 1I2WA 1XA1A 5A92A 1LI9A 1CI8A 4OPRA 1MPLA 4U3TA 1G68A 4E3LA 1RP5A 1XPBA 1K54C 1N9BA 2E8IA 1H8ZA 5EVLA 2Y2HA 3N8RA 2WGWB 2EX2A 4KZ9A 4WMCA 5DF8A 3ZNYA 3IHBA 2FFFB 1YMXA 4E3MA 3OPLA 5CTMA 5DTKA 1Z6FA 2WKIA 2ZD8A 2OV5A 3CG5A 1XX2A 1E3UA 2WZXA 1SHVA 2JE5A 4JPMA 4WELA 3WRZA 4K0XA 2Y2QA 3HLBA 1ESIA 4Y0OA 5FQQA 1NYYA 3LY4A 2XGNA 3UDIA 1BUEA 2PBYA 4OVDA 3OCLA 1HZOA 2WAEA 3OPPA 1YLJA 3IWQA 5KSHA 1BLSA 3ZG0A 4GB7A 3G35A 2R9WA 4S2JA 2UWXA 5F1FA 3O88A 4C75A 1FQGA 4OP5A 5FQJA 1IEMA 1K56D 1Y54A 4S2MA 4KQOA 5FI2A 3MXRA 3LY3A 3I7JA 3S1YA 4N9LA 1ES4A 3BFFA 5CXWA 4BLMA 4QHCA 1H8YA 3UO9A 3VP0A 5F82A 4DDYA 1QMFA 5FQMA 5CEBA 4K0WA 4X55A 4DF6A 5CGSA 1ES3A 4LCMA 5GLDA 3E2LA 5FATA 5TFQA 5GLBA 1GA0A 1FOFA 1FCMA 1K4FA 2EX6A 5GHYA 1YLWA 5HL1A 3O3VA 2HDRA 3PBSA 3A3JA 1OMEA 2ZC5B 1WE4A 3MKEA 5TGFA 4B88A 1ES5A 5E43A 3ZGAB 3O87A 3BFEA 2EX8A 3MBZA 4E3JA 1IYPA 3VMAA 3AGEA 4QY6A 2Y2NA 5U47A 3VSKA 5E2HA 2H10A 3IXGA 3IQAA 4EQIA 3OZHA 2QMIA 2WK0A 5GHZA 3GV9A 3PBQA 2WKEA 4PMAA 1EI5A 4JF5A 3IXBA 2VGJA 4L0LA 3SS5A 1ZKJA 2XEPA 1KE0A 1DJAA 3HLDA 4PM7A 3HLFA 4R3BA 3GMWA 1N4OA 1W79A 4EBPA 3C5AA 1Q2PA 4GD6A 1G6AA 2ZC6B 4UHUA 1KE4A 3VP2A 4GNUA 3V3SA 3LO7A 1LI0A 4KQQA 1KE3A 1W8YA 4D2OA 3GTCA 3QNCA 4EUZA 4WEKA 4UA7A 2WGVA 2EX9A 2ZQ8A 2Z2MB 3ZG7B 1NYMA 3GQZA 5FSRA 1MKIA 5HAIA 2Y59A 4JLFA 4GN2A 5DVAA 1PIOA 3Q1FA 3Q07A 1O7EA 2H5SA 4BL3A 5M1AA 1U60A 1PI4A 4YINA 4Y0UA 4Z9QA 1K4EA 1L0GA 4YFMA 2PU2A 4IVKA 1KDSA 4LENA 4NK3A 4DE2A 3HUOA 2JBFA 3ITAA 4N1HA 1NJ4A 4JXGA 4JF4A 3N8LA 3VFHA 1PWDA 1E4DA 3GVBA 3G32A 3IT9A 3M6HA 4IBXA 3PAGA 2XF3A 3RXXA 4JKTA 1DY6A 2XLNA 1K57C 1PW8A 2J8YA 3Q81A 4LV2A 3NDEA 1MWRA 4OQGA 4KZ7A 3C7UA 3O86A 3WS4A 4FCFA 3WRTA 5IHVA 3VP1A 4B4XA 3VOZA 4BL2A 3SH8A 3G31A 3IHAA 3NC8A 1HTZA 3B3XA 5KMWA 3HLWA 2DRWA 3NBLA 5GLCA 3W8KA 5CTNA 4ZJ3A 3V3RA 4Y7PA 3C4OA 4ZDXA 2A3UA 4M3KA 4X56A 3ZG8B 4N92A 1FR6A 1K6SA 3S22A 1MWSA 4LCLA 4QD4A 3WS0A 1ONGA 1I2SA 2RCXA 4OOMA 4KZ3A 1FSWA 4N9KA 2IWCA 1YM1A 4IBRA 5EOOA 4ZTKA 5J8XA 1W7FA 4KZ8A 2IWDA 1MY8A 3WS5A 1HVBA 2DCFA 4BQMA 1L2SA 2WADA 5FQ9A 2ZQDA 1YLTA 1YLPA 4HBUA 1FCNA 5G18A 1AXBA 5DF9A 1BTLA 1YT4A 4E3OA 3UDFA 3NIAA 5EPHA 4RX2A 1LL5A 4KZBA 2Y55A 4EBLA 3IH8A 1SDNA 4FH2A 2Q9NA 4WYYA 3WS1A 2G2UA 1IKGA 4UAAA 5EE8A 5AQAA 2XD5A 1KDWA 2QZ6A 4DXCA 3Q7ZA 4LV3A 1E25A 1XGJA 1TVFA 3BM6A 1RGZA 3PTEA 3W4PA 5FAOA 1NRFA 2H0TA 3N7WA 4WBGA 1RGYA 5JYPA 3A3EA 2VGKA 3ZVWA 5FAPA 2XH9A 2ZM2A 4ID4A 4X53A 4QY5A 5EVID 3UPOA 5CERA 2X01A 5FQKA 3DWZA 4ZBEA 3BFCA 3ISGA 4OONA 3HLEA 2Y2OA 3FZCA 1M40A 4HEFA 4KZ5A 3MKFA 3N8SA 3V50A 5KZHA 5EOEA 1S0WA 4U0XA 2HDQA 3UPNA 1KGEA 1K25A 4GOGA 2J9OA 4XXRA 2ZJ9A 3PAEA 4IVIA 4R4SA 4XUXA 2V1ZA 1TDGA 1WYBA 3UPPA 3IF6B 2JC7A 3ITBA 3BLMA 4GD8A 4WMCD 1BULA 2WUQA 4P0MA 4P85A 5FASA 3MXSA 3NY4A 3ZFZA 1ALQA 3RJUA 1PWCA 1IYQA 1NZOA 5DF7A 4OKPA 1KGFA 1GCEA 3VP4A 2Y2LA 3ZNTA 3RXWA 2IWBA 3Q82A 5L2FA 5CRFA 5EECA 1XXMA 2ZQCA 1HD8A 3JYIA 4C3QA 2CC1A 3EQVA 5CHJA 2EFXA 2WZZA 4QB8A 5FI7A 3TOIA 2J7VA 5FAQA 5A90A 4O7DA 1PWGA 4N1XA 1WYCA 2A49A 3FWLA 4KENB 4X6TA 1BLPA 1IYSA 3HL9A 5DTSA 1MBLA 4KQRA 4JXVA 2X71A 4WZ4A 4MEZA 2B5RA 4DE1A 5DTTA 3SH7A 2DNSA 4E3NA 4JXSA 2XFTA 4UA9A 1L0DA 3G4PA 3FKWA 3BECA 1K57A 3M2KA 4K91A 1GHPA 5EVIB 4RA7A 2EXBA 1CI9A 2Z2LB 3G2ZA 4OLGA 1K6RA 4PM6A 4S2NC 4MBFA 2H0YA 3A3FA 3OPRA 3DW0A 5E2EA 3FYZA 1PZPA 4U0TA 3W4OA 1LLBA 3WWXA 3BLSA 4ZAMA 4KZAA 1ONHA 1FCOA 4MLLA 3MFDA 3IWIA 4DDSA 3CMZA 4OOYA 1ZG6A 5AQ7A 2XK1A 2Y2IA 1K55C 3PBRA 3M6BA 5F83A 5CGWA 5EVIA 2XD1A 4FH4A 1IKIA 2X02A 1BSGA 5AQ9A 1CEFA 4LV1A 2HP5A 4OH0A 3CZDA 5FI6A 3BYDA 3PBOA 5CHMA 3ZG5A 1J9MA 3G34A 3Q7VB 1NZUA 3UE3A 4E6WA 1ERQA 3OPHA 2Y2GA 1IELA 1BLCA 3OC2A 4S2KA 3ZG9B 4CJNA 2GDNA 5CHUA 5FA7A 3SS3A 4EBNA 4S2IA 3VFFA 1PZOA 2HP6A 2BG1A 3PBNA 5F1GA 3SH9A 1KGGA 3MZEA 4QJGA 3C4PA 4IEDA 3QHYA 1TDLA 3DWKA 3VOYA 1M6KA 2R9XA
chains in the Genus database with same CATH superfamily
4I3IA 5TR7A 4NETA 3C2WA 4EEPA 3UE1A 5HD5A 3EQUA 1MXOA 3MXQA 4E3IA 3P01A 3IXHA 3LIAA 1JWVA 4MBKA 3IBJA 4HJ6A 2VK3A 1IYOA 3GR2A 2JCHA 3R7WA 3HUMA 3HUNA 1XFNA 3EEHA 4BENA 4WZ5A 2EWVA 4QWOA 3UB9A 2QPNA 1YLYA 4I39A 4R3JA 3AGDA 1LT0A 1O07A 4RVAA 1ZC2A 3W4QA 4HESA 4HQAA 4LV0A 4S2OA 1TEMA 3UMEA 3W2ZA 3G30A 3SW1A 2PRFA 4OQIA 2Y4AA 3OLOA 4B9OA 4WL9A 1ACFA 4OPQA 2G7UA 4OPZA 3ZHHA 3DTMA 4MN5A 3NI9A 2Y91A 2ZM0A 4PM8A 2P04A 3BQAA 2O0YA 1W5DA 2PD8A 4QU3A 3V5MA 1S67L 4GS9A 3C7VA 1K54A 1XKZA 2M7VA 3LI8A 4B4ZA 3OCNA 4QHCA 5EM0A 2Q9MA 3BFGA 4KZ4A 1DRMA 4DXBA 5EVEA 2Y2JA 3BEBA 5HFOA 1OJ5A 3IF6C 5JYOA 5A91A 1KVLA 3LI9A 3BRMA 4H8RA 2Q0OA 5DFYA 1BT5A 3MZFA 4OP8A 3LIDA 4F3LA 1JTDA 5AVFA 4XUZA 1PYYA 1ESUA 2VEAA 2L1MA 3HLGA 3ZVTA 1SDEA 1YKDA 3M2JA 2C5WB 4E6XA 4Q8IA 3P09A 2A24B 4JGRA 3NULA 4OOLA 3LCEA 4ZJ2A 2WAFA 5EFWA 2XFSA 4FTXA 4FOFA 1K54C 1N9BA 4BBUA 3FC7A 2E8IA 2WGWB 4KZ9A 5CTMA 5DTKA 4GS9B 2ZD8A 4EUVA 1D7EA 4HJ3A 4WLAA 2WZXA 4K0XA 2B95A 4Y0OA 2XGNA 3UDIA 1NRJA 3F1PB 1HZOA 4GB7A 1YSPA 2R9WA 1SKOA 4ARZB 1LL8A 3BW6A 2PBDP 1N9NA 3UO9A 5FQMA 4X55A 3TW8A 4DF6A 3NJAA 1FOFA 1FCMA 4Y2FA 4BWIA 3PBSA 1OMEA 1WE4A 4B88A 4EERA 3ZGAB 3O87A 3TJZC 2Y2NA 2VV7A 3VSKA 2GJ3A 2H10A 3IQAA 5GHZA 3ICYA 3JVVA 3KYQA 4JF5A 2NUTC 2VGJA 2XEPA 1DJAA 1G6OA 3GMWA 4H6JB 3KYEA 1W79A 2ZC6B 1KE4A 3S7OA 3VP2A 1W8YA 4PHTA 5HPIA 4HI4A 4JGOA 2Y59A 3Q1FA 3Q07A 2QYBA 1K4EA 1L0GA 4YFMA 2PU2A 1KDSA 4DE2A 4N1HA 3N8LA 1PWDA 1OTBA 4JKTA 1P9RA 2J8YA 2VJWA 1FIKA 3Q81A 3PR6A 4LV2A 3NDEA 3WS4A 3C7UA 3HLWA 4G3KA 1T1AA 3W8KA 4ZJ3A 2ZMFA 3MJQA 4N92A 1FR6A 1K6SA 3NOPC 3S22A 1MWSA 4LCLA 4QD4A 2RCXA 4OOMA 3LIBA 4ZTKA 5J8XA 1W7FA 3BQ8A 4KZ8A 3WS5A 2OOLA 4O01A 5IS1A 2ZQDA 5DF9A 1YT4A 3NIAA 1LL5A 1PFLA 1TS8A 2Q9NA 2G2UA 4UAAA 1E25A 1XJ3A 3PTEA 3N7WA 4WBGA 1RGYA 3A3EA 5AJGA 3UPOA 5CERA 4F3LB 5FQKA 4AFIA 4ZBEA 3UMDA 3QP1A 4HEFA 3MKFA 5EOEA 1S0WA 2HDQA 1K25A 2W3DA 2QJ5A 4XXRA 2W1RA 3PHYA 2VV8A 1WYBA 3IF6B 3ITBA 2WUQA 5FASA 3VP4A 3VE4A 3RXWA 4K08A 5EECA 2ZQCA 3CPTB 1HD8A 2CC1A 5CHJA 2EFXA 4XT2B 2D01A 5A90A 1PWGA 3FWLA 5DTSA 4X6TA 1BLPA 1MBLA 2B5RA 4E3NA 4JXSA 3TRCA 3M2KA 2VLGA 4KUOA 4OLGA 4PM6A 1IOUA 3OPRA 5E2EA 4U0TA 1LLBA 2MJ6A 4XT2A 4ZAMA 1ONHA 1FCOA 4Y13A 3MFDA 3IWIA 4OOYA 5F6AA 1S4SA 1G5UA 3B42A 3PBRA 5F83A 2XD1A 2PR5A 4FH4A 1IKIA 3LICA 1J9MA 2ZL1A 4E6WA 1ERQA 1BLCA 3OC2A 4CJNA 3UE6A 3SS3A 2PAVP 1PZOA 3PBNA 4QJGA 4IEDA 1TDLA 3VOYA 3IX3A 1GHMA 1DJCA 4GDNA 5D3OA 5AQBA 2ZL1B 1BZAA 5GLAA 2PYPA 1PI5A 3GSGA 2ZOHA 4PM5A 4WN5A 4ETZA 4I5SA 3MFXA 3UNWA 4ZJ1A 4P87A 4A5RA 3HVFA 4ME4A 1JNUA 1P97A 1K38A 1JWPA 4S2LA 5M19A 2OLVA 3MZDA 5LBRA 2OLUA 5HSQA 2ZC7A 4FSFA 3MS6A 1VHMA 3MQQA 4RX3A 1EROA 1F9IA 3E2KA 4X68A 2HZ5A 2W3HA 2ZC3B 2XR0A 5CEDA 1Q2QA 3BFDA 3V39A 4II7A 2HDUA 4P6ZS 1XA7A 2WKHA 4R23A 1L0EA 2Z6DA 3OBFA 3UDXA 2G2WA 5CX7A 1XJ6A 1MWUA 3LR0A 1T19A 2JN7A 1JVJA 5TJJA 2Y2KA 4YWZA 5AVEA 1MWTA 5DFXA 1FR1A 2OAQ1 5KSCA 3F1OB 1GA9A 2WKQA 3FV7A 4OQHA 3IXDA 4I3AA 2I72A 1TD5A 3FKVA 4OLDA 1YQSA 1M6KA 4DMZA 1VM1A 4JXWA 1BYWA 2OSUA 3DTIA 2KDKA 2WKPA 5DKLA 3RFBA 4PPRA 3QP2A 1UWPX 3IF5A 5EUAA 2M1CA 3UE0A 3MSHA 1CK3A 2QWSA 3DAVA 1BLHA 5A93A 4R4RA 4DE3A 3NOTC 2O9CA 3SOIA 3LR4A 4JBFA 3FG8A 2C6WB 2J3TD 3IWOA 3FPWA 4KG5A 4O0PA 2EFUA 2Y2PA 1DP6A 3D72A 3IF6A 4GZBA 2VZWA 3T12B 1VQQA 2ZM8A 2FFYA 1YAXA 5A92A 1F2KA 1FILA 4U3TA 1N9OA 2CMNA 4WUJA 3QP5A 3OOVA 3TE8A 2EX2A 5DF8A 1STZA 3OPLA 1GSWA 2W3GA 1XX2A 1E3UA 4PKYA 2JE5A 4JPMA 2J3TC 1NYYA 3LY4A 3MQOA 4GHIA 1PRQA 3E98A 3K2NA 4HH3A 1BUEA 2PBYA 3D9YA 2WAEA 1YLJA 3IWQA 5HPFA 5KSHA 1TF1A 3BY9A 3ZG0A 1FQGA 3LGOA 1K56D 1Y54A 4R3AA 4KQOA 4R38A 3S1YA 1ES4A 5CXWA 3VP0A 1H8YA 1QMFA 3NOUC 4LCMA 5GLDA 5TFQA 4MMNA 1YPRA 2HDRA 5HWWA 3A3JA 1ZTUA 2ZC5B 3MKEA 5TGFA 1CJFA 5E43A 1PNEA 3BFEA 1S4RA 2VX8A 2YKHA 5FDSA 3ULFA 4E3JA 2VGLM 4GW9A 3VMAA 3AGEA 4NEED 4EQIA 3OZHA 2WK0A 5F69A 5EM1A 2BTFP 4IUHA 3SS5A 1ZKJA 2OWHA 1N4OA 4EBPA 1SKOB 1G6AA 4GNUA 1KE3A 3QNCA 2WKRA 4EUZA 4WEKA 4P6ZM 2WGVA 2EX9A 2ZQ8A 1NYMA 3GQZA 1H8MA 1MKIA 5HAIA 4GN2A 3L7HA 1U60A 2PT7A 2DMWA 1T1CA 4IVKA 4LENA 3HUOA 2PD7A 2JBFA 1NJ4A 4GCZA 1LSXA 3G32A 3M6HA 3PAGA 1W63Q 1DY6A 2XLNA 3KX0X 3O86A 1TS6A 4B4XA 4Q0IA 3VOZA 3SH8A 3G31A 1H3QA 3NC8A 1HTZA 3B3XA 5KMWA 2D02A 2FZ0A 2DRWA 2GNXA 4DN0A 3V3RA 3S7QA 3EGDC 4M3KA 1ONGA 1I2SA 2QHKA 1AWIA 3T4LA 4N9KA 2V8CA 2ACGA 2IWDA 4BQMA 2DCFA 5FQ9A 2WADA 1YLTA 1YLPA 1AXBA 1BTLA 2W1TB 4E3OA 3UDFA 4RX2A 1V9YA 3MQ0A 2VKSA 1SDNA 3WS1A 4WYYA 2XD5A 2QZ6A 5DKKA 2XA7S 3W4PA 5FAOA 2H0TA 3PXPA 3T1XA 3NECA 3ZVWA 2OWJA 2ZMVA 4ID4A 4X53A 3T4KA 2P08A 5IU1A 2W1TA 2PHYA 4ARZA 4MN6A 1D1JA 2VGLS 3DWZA 3FZCA 1M40A 4KZ5A 3V50A 3D3OA 2ZJ9A 3PAEA 4IVIA 2V1ZA 1TDGA 3UPPA 3QP8A 4WMCD 1BULA 4P0MA 4P85A 3NY4A 1XJ2A 3IX4A 1ALQA 3RJUA 1NZOA 5DF7A 4OKPA 1GCEA 3Q82A 5L2FA 4X1MA 1XXMA 3JYIA 3E4QA 1XJ4A 5FAQA 3U4LP 4N1XA 2A49A 3HL9A 4CLCD 4WZ4A 4ESPA 3SH7A 1KOUA 1K57A 1CI9A 2XSSA 2Z2LB 1K6RA 3LR3A 3WWXA 1PZPA 3BLSA 5IT5A 4MLLA 4DDSA 3M6BA 5CGWA 2X02A 1BSGA 1CEFA 5FI6A 4OH0A 4G3WA 2KLIA 3OPHA 3A0VA 5FA7A 5J4EA 4BBVA 3SH9A 2QKPA 3CPTA 1KGGA 3MZEA 3C4PA 3DWKA 2R9XA 4CLCB 2A2LA 3KYZA 1RCJA 3K3CA 3CAXA 3SS4A 1SKFA 1JTGA 1W63M 3C30A 3VE3A 2P9VA 2WGWA 1VETA 2O9AA 1W8QA 4EXOA 1OPXA 3NDGA 5J7EA 5E2GA 4HJ4A 3UY6A 2ZMAA 3ZYTA 3F1PA 4S2NA 2PU4A 4LLOB 2EWWA 4GKUA 3CJMA 1JWZA 4WZ5C 2O9BA 3QNBA 4BD0A 3LEZA 1S6RA 3UB7A 1N9LA 4X69A 1GHIA 3CWFA 1NY0A 2ZC4B 5HARA 2V20A 4GJ4A 4S2PA 1H0MA 2V9AA 2WYXA 4WM9A 5GHXA 3KO6A 4KG6A 2BASA 4ZRRA 2P74A 4M4XA 3LR5A 4KZ6A 2JKTI 3TSGA 5L8MA 5HDSA 2WGIA 5M18A 2JKFA 3H7WB 4DKIA 1DJBA 1MZUA 5HDCA 3CHWP 4DE0A 5TBMB 2K2NA 3DTKA 4Y0TA 4OPYA 3IS2A 4PM9A 1YLZA 4BD1A 3TG9A 1NWZA 1ES2A 2HDSA 3D4FA 2HPBA 4E3KA 3EEAA 3VP3A 4NXBA 4JF6A 4JGQA 1ZHHB 3S4XA 5FDHA 4EU0A 5HAPA 1SZVA 5GL9A 1NXYA 3PBTA 4MBHA 3S7PA 5I94A 1GSVA 1DP8A 2P9VB 2HGVA 3NCKA 1OJGA 1EWZA 3LIFA 4IHQA 2V1BA 5DJUA 5A8BA 4HH2A 1XFQA 4HNBA 1LHYA 4NKPA 1K0KA 1Y28A 2M7UA 2HP9A 3G2YA 4UA6A 1I5QA 3UN7A 2EXAA 3R4KA 3UB8A 4GLQA 4LRXC 4EETB 1K55A 5HAQA 2RL3A 2R78A 3ZCZA 4P6BA 4L9EA 2LB9A 4F94A 4CPKA 1LI9A 4OPRA 1MPLA 2V0UA 3DTEA 1OTEA 1Y4OA 1H8ZA 5EVLA 3N8RA 3R7WB 1UGUA 3IHBA 4L9FA 1YMXA 4E3MA 3NHQA 1Z6FA 2WKIA 1SHVA 4UEYA 1OTDA 2Y2QA 3HLBA 5FQQA 3IBRA 3LFVA 3OCLA 5MC7A 3OPPA 3T4SA 4CLCA 3G35A 4S2JA 2UWXA 2JKGA 3O88A 4C75A 1YSQA 5F1FA 5FQJA 4S2MA 2JKRI 2LB5A 4KQDA 5FI2A 3LY3A 3BFFA 5F82A 4DDYA 5CEBA 4K0WA 5CGSA 1T18A 3U2AA 2V8FA 4X25A 1OT9A 3O3VA 2KOIA 3VV4A 3RH8B 1VEUA 5DJTA 2EX8A 2INWA 2L4RA 3LYXA 5HL6A 3PYPA 5U47A 3HJIA 2WKEA 4PMAA 5F68A 4Y17A 3JVUA 3IXBA 1KE0A 4PM7A 3HLFA 4Z1WA 4JGPA 3C5AA 4GD6A 2UV0E 1LI0A 3GTCA 4Q0HA 4CLCC 1OTIA 3G6OA 2Z2MB 3T4JA 5DVAA 3C38A 4LPZA 1O7EA 2H5SA 4NXFA 4YINA 3F1NB 1CF0A 3VFHA 3CUEC 1P9WA 4IBXA 1K57C 3FPVA 4EQ1A 1MWRA 4OQGA 1LSVA 3VP1A 3WRTA 5FEGA 3GDIA 5GLCA 4ZDXA 3MR0A 3ZG8B 4X56A 2XROA 2K7SA 3T1QB 4RQ9A 2IWCA 5G4YA 3F1NA 2V1AA 1HVBA 1L2SA 4HOIA 1FCNA 3BJNA 5EPHA 4KZBA 2Y55A 5HD3A 4FH2A 5AQAA 3RTYA 3HCYA 4DXCA 4LV3A 5C5KA 4EESA 5JYPA 5EV0A 2ZM2A 4EEUA 4NXEA 2E8JA 1WA9A 3B47A 2X01A 2GX5A 4B93A 5KZHA 4IUKA 2JHEA 4U0XA 4GOGA 2J9OA 1HLUP 4BBTA 3VOLA 4XUXA 4R4SA 1X0OA 4EW7A 2JC7A 5G4ZA 3BLMA 2W0NA 3MXSA 3ZFZA 3ZQ5A 1IYQA 3ZNTA 2IWBA 1ODVA 5CRFA 2VA0A 3A0SA 2WZZA 4YNRA 5FI7A 1WYCA 4KENB 3KSGA 2X71A 1NLZA 2KX6A 4DE1A 3DBAA 2A24A 2DNSA 4CQHA 2XFTA 1L0DA 1GHPA 4RA7A 2EXBA 2V0WA 3G2ZA 1MKMA 3V67A 4S2NC 4MBFA 3DW0A 3W4OA 1J3WA 3EGXC 1ZG6A 2XK1A 5EVIA 4Y15A 5AQ9A 4LV1A 2HP5A 3ZG5A 3CZDA 4IJGA 2W3FA 3Q7VB 3UE3A 2Y2GA 1IELA 4S2KA 3ZG9B 2GDNA 3VFFA 3K3DA 2HP6A 2BG1A 5F1GA 3QHYA 4PKYG 2W3EA 2V2FF 1YMSA 3GRJA 3QP6A 4DRTA 2Y8HA 1E3UD 3Q7VA 5HW3A 4EV4A 1PW1A 2HF6A 4LFUA 5E2FA 4E04A 1K56A 1FSYA 3HREA 1XP4A 1NLYA 2AVXA 5FQIA 3A3IA 4NG2A 1L3LA 2ZLYA 2ZQAA 3EWKA 2L0WA 2HJEA 2J80A 3ZDJA 1ERMA 4LGWA 1KVMA 3AGFA 3KSHA 4KG2A 3N6IA 1QMEA 2QJ7A 3A3DA 2HJ9C 2JKRM 5BOHA 2XRNA 2ZQ7A 4PAUA 1DP9A 1XGIA 3CUEA 3S7NA 3HBRA 4RYEA 4GDBA 3T1SA 4WEJA 3MF0A 5L10A 1C3BA 2XQZA 4HBTA 1TS0A 4HY8A 3WS2A 3P98A 4R0QA 2Y2MA 4HP9A 1CEGA 1ZG4A 4FD8A 5K5BA 3VSLA 5CECA 4R1GA 5CGXA 2BLSA 4MNRA 1LL9A 1SCWA 5HX9A 2ZQ9A 4OQ0A 3IH9A 1T1BA 1S1YA 1GSXA 1H5XA 2PDRA 3IS2B 2J9PA 4EWFA 3IX8A 2O99A 2P7JA 3KSFA 1L0FA 4C6YA 3BWLA 3HLCA 3N4IA 4UQIS 4BJPA 5EVIC 4DJ3A 4MCWA 2XDMA 3T4TA 4G3VA 1I2WA 1XA1A 1CI8A 3E0YA 1G68A 2EA9A 4E3LA 1RP5A 1XPBA 3O5YA 2Y2HA 4BMWA 3LIEA 3C8CA 4WMCA 3ZNYA 4GHIB 2FFFB 2OV5A 3CG5A 3LUQA 4WELA 4I3JA 2HV1A 3WRZA 1ESIA 4L9GA 2OAP1 1VB6A 2JKTM 4OVDA 5FEFA 4YOFA 1BLSA 3GECA 3E4OA 2PYRA 3LEQA 4OP5A 1IEMA 3MXRA 3I7JA 4N9LA 4BLMA 1UWNX 3T4QA 4HIAA 3A0RA 4I38A 1ES3A 1A0KA 3E2LA 5FATA 5GLBA 5HDDA 1GA0A 1K4FA 2EX6A 3T50A 5GHYA 1YLWA 5HL1A 3L9KA 1VETB 1ES5A 4DJ2A 3MBZA 2Y79A 3P7NA 1OT6A 1IYPA 4QY6A 5E2HA 3IXGA 2QMIA 3GV9A 3PBQA 1F5MA 2K31A 1EI5A 1EW0A 4L0LA 3HLDA 4R3BA 2GZAA 3CITA 4HP4A 1Q2PA 4R6LA 4UHUA 3V3SA 3LO7A 4KQQA 5FL3A 2H28A 2I9VA 4D2OA 3UB6A 4KUKA 4UA7A 5FSRA 4O8GA 4JLFA 1PIOA 1VEUB 4ETXA 4BL3A 2NUPC 5M1AA 4MN7A 3B33A 1PI4A 5I5LA 4CLCE 4Q0JA 4Y0UA 4Z9QA 3F1OA 4NK3A 4D60A 3T1RA 3ITAA 1S66L 4JXGA 4JF4A 1E4DA 3UB5P 3GVBA 3IT9A 5HZHA 2XF3A 3RXXA 1PW8A 4MDZA 1IFQA 4KZ7A 4FCFA 5IHVA 5L07A 4BL2A 1LSWA 3IHAA 4LRZE 3NBLA 5HWVA 1G28A 5CTNA 4Y7PA 3C4OA 2A3UA 1Z09A 4X1LA 4UQIM 3WS0A 4KZ3A 1FSWA 3SZTA 1YM1A 4IBRA 5EOOA 1MY8A 3E4PA 3EOIA 5G18A 4HBUA 5HWTA 1S1ZA 1V9ZA 4H6JA 4NXGA 3JPUA 3H82A 3HJKA 2ZOIA 4EBLA 3IH8A 1IKGA 5EE8A 1KDWA 2FH5A 3Q7ZA 3BM6A 1XGJA 1TVFA 3CI6A 1RGZA 1NRFA 2VGKA 5FAPA 2XH9A 4QY5A 5EVID 5KIZA 4Y3IA 3QP4A 3T4OA 3BFCA 3ISGA 4OONA 3HLEA 2Y2OA 1MC0A 2W27A 3N8SA 4FUWA 3H7WA 3UPNA 1KGEA 3CLOA 4GD8A 2XA7M 1PWCA 3H9WA 1TS7A 1KGFA 2Y2LA 1D06A 3KSIA 4LRYC 2ZBBA 4C3QA 3EQVA 4QB8A 2VV6A 3TOIA 2J7VA 4O7DA 1IYSA 5L09A 4KQRA 4JXVA 4R70A 3BY8A 4MEZA 5DTTA 5J3WA 1P0ZA 4UA9A 3G4PA 3FKWA 3BECA 4K91A 5EVIB 5F5YA 2PR6A 4Y5FA 2H0YA 2Z6CA 3A3FA 3ZG7B 3FYZA 1F98A 3H82B 4KZAA 3CMZA 5AQ7A 2Y2IA 1K55C 4HHDA 4QPRA 2IA2A 2B02A 3MMHA 2J3WA 1CQAA 3BYDA 3PBOA 5CHMA 3G34A 1NZUA 2B18A 2YKFA 5CHUA 4EBNA 4S2IA 4WF0A 5TBMA 1OTAA
chains in the Genus database with same CATH topology
5TR7A 4NETA 3UE1A 2V2FF 1YMSA 3GRJA 4DRTA 1GHMA 1DJCA 1RCJA 3EQUA 4GDNA 5D3OA 1E3UD 1MXOA 3Q7VA 5AQBA 4E3IA 3SS4A 1BZAA 5HW3A 4EV4A 1SKFA 3IXHA 1JTGA 5GLAA 1JWVA 1PI5A 1PW1A 3GSGA 4MBKA 4PM5A 1IYOA 3GR2A 2JCHA 2P9VA 5E2FA 2WGWA 1W8QA 3NDGA 3UNWA 1K56A 3HUMA 4ZJ1A 3HUNA 4P87A 5E2GA 3HVFA 4A5RA 4BENA 1K38A 3UY6A 1JWPA 1FSYA 2ZMAA 3HREA 4S2LA 4WZ5A 4S2NA 2PU4A 5M19A 2OLVA 1XP4A 3MZDA 2QPNA 1YLYA 2OLUA 4R3JA 3AGDA 2ZC7A 1O07A 3CJMA 4FSFA 1JWZA 3A3IA 1ZC2A 4GKUA 4RVAA 4WZ5C 5FQIA 3QNBA 4BD0A 3LEZA 4RX3A 1S6RA 2ZLYA 3W4QA 1EROA 2ZQAA 4HESA 4X69A 4LV0A 3E2KA 4X68A 4S2OA 1TEMA 1GHIA 2ZC3B 2ZC4B 1NY0A 2XR0A 5HARA 3ZDJA 5CEDA 3G30A 2V20A 4S2PA 1ERMA 1Q2QA 3BFDA 3V39A 1KVMA 2HDUA 4OQIA 1XA7A 2WYXA 2Y4AA 3AGFA 2WKHA 4WM9A 5GHXA 4KG6A 4R23A 2P74A 1L0EA 4KG2A 3N6IA 1QMEA 4KZ6A 3A3DA 3TSGA 5BOHA 4OPQA 3UDXA 2WGIA 2ZQ7A 5M18A 4OPZA 2G2WA 3ZHHA 1XGIA 3DTMA 4DKIA 3NI9A 2Y91A 1DJBA 3HBRA 4DE0A 4RYEA 2ZM0A 4GDBA 1MWUA 4PM8A 4Y0TA 4OPYA 4PM9A 1JVJA 1YLZA 4WEJA 1W5DA 2Y2KA 3TG9A 4BD1A 4QU3A 1C3BA 2XQZA 4HBTA 1MWTA 1ES2A 3V5MA 2HDSA 3D4FA 2HPBA 3C7VA 3WS2A 1K54A 4E3KA 1FR1A 1XKZA 3VP3A 3P98A 5KSCA 4R0QA 1GA9A 3FV7A 4B4ZA 4JF6A 4OQHA 3S4XA 3IXDA 2Y2MA 3OCNA 5FDHA 5HAPA 2I72A 3FKVA 4OLDA 1YQSA 1CEGA 1VM1A 4JXWA 1NXYA 3PBTA 4MBHA 1ZG4A 4FD8A 2P9VB 2Q9MA 3BFGA 5GL9A 4KZ4A 5I94A 2OSUA 4DXBA 3NCKA 3VSLA 5CECA 4R1GA 2Y2JA 3BEBA 5CGXA 2BLSA 1EWZA 4MNRA 5HFOA 1LL9A 3IF6C 4PPRA 1SCWA 5HX9A 5JYOA 5A91A 1KVLA 3IF5A 5EUAA 2ZQ9A 3BRMA 3UE0A 4OQ0A 3IH9A 1CK3A 4H8RA 1H5XA 1BLHA 5A93A 1LHYA 1BT5A 3MZFA 4OP8A 4R4RA 2J9PA 4DE3A 4EWFA 2HP9A 3G2YA 4UA6A 1JTDA 3SOIA 1I5QA 4XUZA 4JBFA 1PYYA 1L0FA 1ESUA 4C6YA 3UN7A 2C6WB 2EXAA 3IWOA 4KG5A 3HLGA 3ZVTA 3HLCA 1SDEA 3M2JA 3N4IA 2C5WB 2EFUA 2Y2PA 4BJPA 5EVIC 4E6XA 4Q8IA 1K55A 3P09A 5HAQA 2RL3A 2XDMA 3IF6A 4GZBA 4OOLA 3ZCZA 3LCEA 4P6BA 4ZJ2A 1VQQA 2ZM8A 4F94A 2FFYA 2WAFA 4CPKA 2XFSA 1I2WA 1XA1A 5A92A 1LI9A 1CI8A 4OPRA 1MPLA 4U3TA 1G68A 4E3LA 1RP5A 1XPBA 1K54C 1N9BA 2E8IA 1H8ZA 5EVLA 2Y2HA 3N8RA 2WGWB 2EX2A 4KZ9A 4WMCA 5DF8A 3ZNYA 3IHBA 2FFFB 1YMXA 4E3MA 3OPLA 5CTMA 5DTKA 1Z6FA 2WKIA 2ZD8A 2OV5A 3CG5A 1XX2A 1E3UA 2WZXA 1SHVA 2JE5A 4JPMA 4WELA 3WRZA 4K0XA 2Y2QA 3HLBA 1ESIA 4Y0OA 5FQQA 1NYYA 3LY4A 2XGNA 3UDIA 1BUEA 2PBYA 4OVDA 3OCLA 1HZOA 2WAEA 3OPPA 1YLJA 3IWQA 5KSHA 1BLSA 3ZG0A 4GB7A 3G35A 2R9WA 4S2JA 2UWXA 5F1FA 3O88A 4C75A 1FQGA 4OP5A 5FQJA 1IEMA 1K56D 1Y54A 4S2MA 4KQOA 5FI2A 3MXRA 3LY3A 3I7JA 3S1YA 4N9LA 1ES4A 3BFFA 5CXWA 4BLMA 4QHCA 1H8YA 3UO9A 3VP0A 5F82A 4DDYA 1QMFA 5FQMA 5CEBA 4K0WA 4X55A 4DF6A 5CGSA 1ES3A 4LCMA 5GLDA 3E2LA 5FATA 5TFQA 5GLBA 1GA0A 1FOFA 1FCMA 1K4FA 2EX6A 5GHYA 1YLWA 5HL1A 3O3VA 2HDRA 3PBSA 3A3JA 1OMEA 2ZC5B 1WE4A 3MKEA 5TGFA 4B88A 1ES5A 5E43A 3ZGAB 3O87A 3BFEA 2EX8A 3MBZA 4E3JA 1IYPA 3VMAA 3AGEA 4QY6A 2Y2NA 5U47A 3VSKA 5E2HA 2H10A 3IXGA 3IQAA 4EQIA 3OZHA 2QMIA 2WK0A 5GHZA 3GV9A 3PBQA 2WKEA 4PMAA 1EI5A 4JF5A 3IXBA 2VGJA 4L0LA 3SS5A 1ZKJA 2XEPA 1KE0A 1DJAA 3HLDA 4PM7A 3HLFA 4R3BA 3GMWA 1N4OA 1W79A 4EBPA 3C5AA 1Q2PA 4GD6A 1G6AA 2ZC6B 4UHUA 1KE4A 3VP2A 4GNUA 3V3SA 3LO7A 1LI0A 4KQQA 1KE3A 1W8YA 4D2OA 3GTCA 3QNCA 4EUZA 4WEKA 4UA7A 2WGVA 2EX9A 2ZQ8A 2Z2MB 3ZG7B 1NYMA 3GQZA 5FSRA 1MKIA 5HAIA 2Y59A 4JLFA 4GN2A 5DVAA 1PIOA 3Q1FA 3Q07A 1O7EA 2H5SA 4BL3A 5M1AA 1U60A 1PI4A 4YINA 4Y0UA 4Z9QA 1K4EA 1L0GA 4YFMA 2PU2A 4IVKA 1KDSA 4LENA 4NK3A 4DE2A 3HUOA 2JBFA 3ITAA 4N1HA 1NJ4A 4JXGA 4JF4A 3N8LA 3VFHA 1PWDA 1E4DA 3GVBA 3G32A 3IT9A 3M6HA 4IBXA 3PAGA 2XF3A 3RXXA 4JKTA 1DY6A 2XLNA 1K57C 1PW8A 2J8YA 3Q81A 4LV2A 3NDEA 1MWRA 4OQGA 4KZ7A 3C7UA 3O86A 3WS4A 4FCFA 3WRTA 5IHVA 3VP1A 4B4XA 3VOZA 4BL2A 3SH8A 3G31A 3IHAA 3NC8A 1HTZA 3B3XA 5KMWA 3HLWA 2DRWA 3NBLA 5GLCA 3W8KA 5CTNA 4ZJ3A 3V3RA 4Y7PA 3C4OA 4ZDXA 2A3UA 4M3KA 4X56A 3ZG8B 4N92A 1FR6A 1K6SA 3S22A 1MWSA 4LCLA 4QD4A 3WS0A 1ONGA 1I2SA 2RCXA 4OOMA 4KZ3A 1FSWA 4N9KA 2IWCA 1YM1A 4IBRA 5EOOA 4ZTKA 5J8XA 1W7FA 4KZ8A 2IWDA 1MY8A 3WS5A 1HVBA 2DCFA 4BQMA 1L2SA 2WADA 5FQ9A 2ZQDA 1YLTA 1YLPA 4HBUA 1FCNA 5G18A 1AXBA 5DF9A 1BTLA 1YT4A 4E3OA 3UDFA 3NIAA 5EPHA 4RX2A 1LL5A 4KZBA 2Y55A 4EBLA 3IH8A 1SDNA 4FH2A 2Q9NA 4WYYA 3WS1A 2G2UA 1IKGA 4UAAA 5EE8A 5AQAA 2XD5A 1KDWA 2QZ6A 4DXCA 3Q7ZA 4LV3A 1E25A 1XGJA 1TVFA 3BM6A 1RGZA 3PTEA 3W4PA 5FAOA 1NRFA 2H0TA 3N7WA 4WBGA 1RGYA 5JYPA 3A3EA 2VGKA 3ZVWA 5FAPA 2XH9A 2ZM2A 4ID4A 4X53A 4QY5A 5EVID 3UPOA 5CERA 2X01A 5FQKA 3DWZA 4ZBEA 3BFCA 3ISGA 4OONA 3HLEA 2Y2OA 3FZCA 1M40A 4HEFA 4KZ5A 3MKFA 3N8SA 3V50A 5KZHA 5EOEA 1S0WA 4U0XA 2HDQA 3UPNA 1KGEA 1K25A 4GOGA 2J9OA 4XXRA 2ZJ9A 3PAEA 4IVIA 4R4SA 4XUXA 2V1ZA 1TDGA 1WYBA 3UPPA 3IF6B 2JC7A 3ITBA 3BLMA 4GD8A 4WMCD 1BULA 2WUQA 4P0MA 4P85A 5FASA 3MXSA 3NY4A 3ZFZA 1ALQA 3RJUA 1PWCA 1IYQA 1NZOA 5DF7A 4OKPA 1KGFA 1GCEA 3VP4A 2Y2LA 3ZNTA 3RXWA 2IWBA 3Q82A 5L2FA 5CRFA 5EECA 1XXMA 2ZQCA 1HD8A 3JYIA 4C3QA 2CC1A 3EQVA 5CHJA 2EFXA 2WZZA 4QB8A 5FI7A 3TOIA 2J7VA 5FAQA 5A90A 4O7DA 1PWGA 4N1XA 1WYCA 2A49A 3FWLA 4KENB 4X6TA 1BLPA 1IYSA 3HL9A 5DTSA 1MBLA 4KQRA 4JXVA 2X71A 4WZ4A 4MEZA 2B5RA 4DE1A 5DTTA 3SH7A 2DNSA 4E3NA 4JXSA 2XFTA 4UA9A 1L0DA 3G4PA 3FKWA 3BECA 1K57A 3M2KA 4K91A 1GHPA 5EVIB 4RA7A 2EXBA 1CI9A 2Z2LB 3G2ZA 4OLGA 1K6RA 4PM6A 4S2NC 4MBFA 2H0YA 3A3FA 3OPRA 3DW0A 5E2EA 3FYZA 1PZPA 4U0TA 3W4OA 1LLBA 3WWXA 3BLSA 4ZAMA 4KZAA 1ONHA 1FCOA 4MLLA 3MFDA 3IWIA 4DDSA 3CMZA 4OOYA 1ZG6A 5AQ7A 2XK1A 2Y2IA 1K55C 3PBRA 3M6BA 5F83A 5CGWA 5EVIA 2XD1A 4FH4A 1IKIA 2X02A 1BSGA 5AQ9A 1CEFA 4LV1A 2HP5A 4OH0A 3CZDA 5FI6A 3BYDA 3PBOA 5CHMA 3ZG5A 1J9MA 3G34A 3Q7VB 1NZUA 3UE3A 4E6WA 1ERQA 3OPHA 2Y2GA 1IELA 1BLCA 3OC2A 4S2KA 3ZG9B 4CJNA 2GDNA 5CHUA 5FA7A 3SS3A 4EBNA 4S2IA 3VFFA 1PZOA 2HP6A 2BG1A 3PBNA 5F1GA 3SH9A 1KGGA 3MZEA 4QJGA 3C4PA 4IEDA 3QHYA 1TDLA 3DWKA 3VOYA 1M6KA 2R9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TR7 A;  4NET A;  3UE1 A;  2V2F F;  1YMS A;  3GRJ A;  4DRT A;  1GHM A;  1DJC A;  1RCJ A;  3EQU A;  4GDN A;  5D3O A;  1E3U D;  1MXO A;  3Q7V A;  5AQB A;  4E3I A;  3SS4 A;  1BZA A;  5HW3 A;  4EV4 A;  1SKF A;  3IXH A;  1JTG A;  5GLA A;  1JWV A;  1PI5 A;  1PW1 A;  3GSG A;  4MBK A;  4PM5 A;  1IYO A;  3GR2 A;  2JCH A;  2P9V A;  5E2F A;  2WGW A;  1W8Q A;  3NDG A;  3UNW A;  1K56 A;  3HUM A;  4ZJ1 A;  3HUN A;  4P87 A;  5E2G A;  3HVF A;  4A5R A;  4BEN A;  1K38 A;  3UY6 A;  1JWP A;  1FSY A;  2ZMA A;  3HRE A;  4S2L A;  4WZ5 A;  4S2N A;  2PU4 A;  5M19 A;  2OLV A;  1XP4 A;  3MZD A;  2QPN A;  1YLY A;  2OLU A;  4R3J A;  3AGD A;  2ZC7 A;  1O07 A;  3CJM A;  4FSF A;  1JWZ A;  3A3I A;  1ZC2 A;  4GKU A;  4RVA A;  4WZ5 C;  5FQI A;  3QNB A;  4BD0 A;  3LEZ A;  4RX3 A;  1S6R A;  2ZLY A;  3W4Q A;  1ERO A;  2ZQA A;  4HES A;  4X69 A;  4LV0 A;  3E2K A;  4X68 A;  4S2O A;  1TEM A;  1GHI A;  2ZC3 B;  2ZC4 B;  1NY0 A;  2XR0 A;  5HAR A;  3ZDJ A;  5CED A;  3G30 A;  2V20 A;  4S2P A;  1ERM A;  1Q2Q A;  3BFD A;  3V39 A;  1KVM A;  2HDU A;  4OQI A;  1XA7 A;  2WYX A;  2Y4A A;  3AGF A;  2WKH A;  4WM9 A;  5GHX A;  4KG6 A;  4R23 A;  2P74 A;  1L0E A;  4KG2 A;  3N6I A;  1QME A;  4KZ6 A;  3A3D A;  3TSG A;  5BOH A;  4OPQ A;  3UDX A;  2WGI A;  2ZQ7 A;  5M18 A;  4OPZ A;  2G2W A;  3ZHH A;  1XGI A;  3DTM A;  4DKI A;  3NI9 A;  2Y91 A;  1DJB A;  3HBR A;  4DE0 A;  4RYE A;  2ZM0 A;  4GDB A;  1MWU A;  4PM8 A;  4Y0T A;  4OPY A;  4PM9 A;  1JVJ A;  1YLZ A;  4WEJ A;  1W5D A;  2Y2K A;  3TG9 A;  4BD1 A;  4QU3 A;  1C3B A;  2XQZ A;  4HBT A;  1MWT A;  1ES2 A;  3V5M A;  2HDS A;  3D4F A;  2HPB A;  3C7V A;  3WS2 A;  1K54 A;  4E3K A;  1FR1 A;  1XKZ A;  3VP3 A;  3P98 A;  5KSC A;  4R0Q A;  1GA9 A;  3FV7 A;  4B4Z A;  4JF6 A;  4OQH A;  3S4X A;  3IXD A;  2Y2M A;  3OCN A;  5FDH A;  5HAP A;  2I72 A;  3FKV A;  4OLD A;  1YQS A;  1CEG A;  1VM1 A;  4JXW A;  1NXY A;  3PBT A;  4MBH A;  1ZG4 A;  4FD8 A;  2P9V B;  2Q9M A;  3BFG A;  5GL9 A;  4KZ4 A;  5I94 A;  2OSU A;  4DXB A;  3NCK A;  3VSL A;  5CEC A;  4R1G A;  2Y2J A;  3BEB A;  5CGX A;  2BLS A;  1EWZ A;  4MNR A;  5HFO A;  1LL9 A;  3IF6 C;  4PPR A;  1SCW A;  5HX9 A;  5JYO A;  5A91 A;  1KVL A;  3IF5 A;  5EUA A;  2ZQ9 A;  3BRM A;  3UE0 A;  4OQ0 A;  3IH9 A;  1CK3 A;  4H8R A;  1H5X A;  1BLH A;  5A93 A;  1LHY A;  1BT5 A;  3MZF A;  4OP8 A;  4R4R A;  2J9P A;  4DE3 A;  4EWF A;  2HP9 A;  3G2Y A;  4UA6 A;  1JTD A;  3SOI A;  1I5Q A;  4XUZ A;  4JBF A;  1PYY A;  1L0F A;  1ESU A;  4C6Y A;  3UN7 A;  2C6W B;  2EXA A;  3IWO A;  4KG5 A;  3HLG A;  3ZVT A;  3HLC A;  1SDE A;  3M2J A;  3N4I A;  2C5W B;  2EFU A;  2Y2P A;  4BJP A;  5EVI C;  4E6X A;  4Q8I A;  1K55 A;  3P09 A;  5HAQ A;  2RL3 A;  2XDM A;  3IF6 A;  4GZB A;  4OOL A;  3ZCZ A;  3LCE A;  4P6B A;  4ZJ2 A;  1VQQ A;  2ZM8 A;  4F94 A;  2FFY A;  2WAF A;  4CPK A;  2XFS A;  1I2W A;  1XA1 A;  5A92 A;  1LI9 A;  1CI8 A;  4OPR A;  1MPL A;  4U3T A;  1G68 A;  4E3L A;  1RP5 A;  1XPB A;  1K54 C;  1N9B A;  2E8I A;  1H8Z A;  5EVL A;  2Y2H A;  3N8R A;  2WGW B;  2EX2 A;  4KZ9 A;  4WMC A;  5DF8 A;  3ZNY A;  3IHB A;  2FFF B;  1YMX A;  4E3M A;  3OPL A;  5CTM A;  5DTK A;  1Z6F A;  2WKI A;  2ZD8 A;  2OV5 A;  3CG5 A;  1XX2 A;  1E3U A;  2WZX A;  1SHV A;  2JE5 A;  4JPM A;  4WEL A;  3WRZ A;  4K0X A;  2Y2Q A;  3HLB A;  1ESI A;  4Y0O A;  5FQQ A;  1NYY A;  3LY4 A;  2XGN A;  3UDI A;  1BUE A;  2PBY A;  4OVD A;  3OCL A;  1HZO A;  2WAE A;  3OPP A;  1YLJ A;  3IWQ A;  5KSH A;  1BLS A;  3ZG0 A;  4GB7 A;  3G35 A;  2R9W A;  4S2J A;  2UWX A;  5F1F A;  3O88 A;  4C75 A;  1FQG A;  4OP5 A;  5FQJ A;  1IEM A;  1K56 D;  1Y54 A;  4S2M A;  4KQO A;  5FI2 A;  3MXR A;  3LY3 A;  3I7J A;  3S1Y A;  4N9L A;  1ES4 A;  3BFF A;  5CXW A;  4BLM A;  4QHC A;  1H8Y A;  3UO9 A;  3VP0 A;  5F82 A;  4DDY A;  1QMF A;  5FQM A;  5CEB A;  4K0W A;  4X55 A;  4DF6 A;  5CGS A;  1ES3 A;  4LCM A;  5GLD A;  3E2L A;  5FAT A;  5TFQ A;  5GLB A;  1GA0 A;  1FOF A;  1FCM A;  1K4F A;  2EX6 A;  5GHY A;  1YLW A;  5HL1 A;  3O3V A;  2HDR A;  3PBS A;  3A3J A;  1OME A;  2ZC5 B;  1WE4 A;  3MKE A;  5TGF A;  4B88 A;  1ES5 A;  5E43 A;  3ZGA B;  3O87 A;  3BFE A;  2EX8 A;  3MBZ A;  4E3J A;  1IYP A;  3VMA A;  3AGE A;  4QY6 A;  2Y2N A;  5U47 A;  3VSK A;  5E2H A;  2H10 A;  3IXG A;  3IQA A;  4EQI A;  3OZH A;  2QMI A;  2WK0 A;  5GHZ A;  3GV9 A;  3PBQ A;  2WKE A;  4PMA A;  1EI5 A;  4JF5 A;  3IXB A;  2VGJ A;  4L0L A;  3SS5 A;  1ZKJ A;  2XEP A;  1KE0 A;  1DJA A;  3HLD A;  4PM7 A;  3HLF A;  4R3B A;  3GMW A;  1N4O A;  1W79 A;  4EBP A;  3C5A A;  1Q2P A;  4GD6 A;  1G6A A;  2ZC6 B;  4UHU A;  1KE4 A;  3VP2 A;  4GNU A;  3V3S A;  3LO7 A;  1LI0 A;  4KQQ A;  1KE3 A;  1W8Y A;  4D2O A;  3GTC A;  3QNC A;  4EUZ A;  4WEK A;  4UA7 A;  2WGV A;  2EX9 A;  2ZQ8 A;  2Z2M B;  3ZG7 B;  1NYM A;  3GQZ A;  5FSR A;  1MKI A;  5HAI A;  2Y59 A;  4JLF A;  4GN2 A;  5DVA A;  1PIO A;  3Q1F A;  3Q07 A;  1O7E A;  2H5S A;  4BL3 A;  5M1A A;  1U60 A;  1PI4 A;  4YIN A;  4Y0U A;  4Z9Q A;  1K4E A;  1L0G A;  4YFM A;  2PU2 A;  4IVK A;  1KDS A;  4LEN A;  4NK3 A;  4DE2 A;  3HUO A;  2JBF A;  3ITA A;  4N1H A;  1NJ4 A;  4JXG A;  4JF4 A;  3N8L A;  3VFH A;  1PWD A;  1E4D A;  3GVB A;  3G32 A;  3IT9 A;  3M6H A;  4IBX A;  3PAG A;  2XF3 A;  3RXX A;  4JKT A;  1DY6 A;  2XLN A;  1K57 C;  1PW8 A;  2J8Y A;  3Q81 A;  4LV2 A;  3NDE A;  1MWR A;  4OQG A;  4KZ7 A;  3C7U A;  3O86 A;  3WS4 A;  4FCF A;  3WRT A;  5IHV A;  3VP1 A;  4B4X A;  3VOZ A;  4BL2 A;  3SH8 A;  3G31 A;  3IHA A;  3NC8 A;  1HTZ A;  3B3X A;  5KMW A;  3HLW A;  2DRW A;  3NBL A;  5GLC A;  3W8K A;  5CTN A;  4ZJ3 A;  3V3R A;  4Y7P A;  3C4O A;  4ZDX A;  2A3U A;  4M3K A;  4X56 A;  3ZG8 B;  4N92 A;  1FR6 A;  1K6S A;  3S22 A;  1MWS A;  4LCL A;  4QD4 A;  3WS0 A;  1ONG A;  1I2S A;  2RCX A;  4OOM A;  4KZ3 A;  1FSW A;  4N9K A;  2IWC A;  1YM1 A;  4IBR A;  5EOO A;  4ZTK A;  5J8X A;  1W7F A;  4KZ8 A;  2IWD A;  1MY8 A;  3WS5 A;  1HVB A;  2DCF A;  4BQM A;  1L2S A;  2WAD A;  5FQ9 A;  2ZQD A;  1YLT A;  1YLP A;  4HBU A;  1FCN A;  5G18 A;  1AXB A;  5DF9 A;  1BTL A;  1YT4 A;  4E3O A;  3UDF A;  3NIA A;  5EPH A;  4RX2 A;  1LL5 A;  4KZB A;  2Y55 A;  4EBL A;  3IH8 A;  1SDN A;  4FH2 A;  2Q9N A;  4WYY A;  3WS1 A;  2G2U A;  1IKG A;  4UAA A;  5EE8 A;  5AQA A;  2XD5 A;  1KDW A;  2QZ6 A;  4DXC A;  3Q7Z A;  4LV3 A;  1E25 A;  1XGJ A;  1TVF A;  3BM6 A;  1RGZ A;  3PTE A;  3W4P A;  5FAO A;  1NRF A;  2H0T A;  3N7W A;  4WBG A;  1RGY A;  5JYP A;  3A3E A;  2VGK A;  3ZVW A;  5FAP A;  2XH9 A;  2ZM2 A;  4ID4 A;  4X53 A;  4QY5 A;  5EVI D;  3UPO A;  5CER A;  2X01 A;  5FQK A;  3DWZ A;  4ZBE A;  3BFC A;  3ISG A;  4OON A;  3HLE A;  2Y2O A;  3FZC A;  1M40 A;  4HEF A;  4KZ5 A;  3MKF A;  3N8S A;  3V50 A;  5KZH A;  5EOE A;  1S0W A;  4U0X A;  2HDQ A;  3UPN A;  1KGE A;  1K25 A;  4GOG A;  2J9O A;  4XXR A;  2ZJ9 A;  3PAE A;  4IVI A;  4R4S A;  4XUX A;  2V1Z A;  1TDG A;  1WYB A;  3UPP A;  3IF6 B;  2JC7 A;  3ITB A;  3BLM A;  4GD8 A;  4WMC D;  1BUL A;  2WUQ A;  4P0M A;  4P85 A;  5FAS A;  3MXS A;  3NY4 A;  3ZFZ A;  1ALQ A;  3RJU A;  1PWC A;  1IYQ A;  1NZO A;  5DF7 A;  4OKP A;  1KGF A;  1GCE A;  3VP4 A;  2Y2L A;  3ZNT A;  3RXW A;  2IWB A;  3Q82 A;  5L2F A;  5CRF A;  5EEC A;  1XXM A;  2ZQC A;  1HD8 A;  3JYI A;  4C3Q A;  2CC1 A;  3EQV A;  5CHJ A;  2EFX A;  2WZZ A;  4QB8 A;  5FI7 A;  3TOI A;  2J7V A;  5FAQ A;  5A90 A;  4O7D A;  1PWG A;  4N1X A;  1WYC A;  2A49 A;  3FWL A;  4KEN B;  4X6T A;  1BLP A;  1IYS A;  3HL9 A;  5DTS A;  1MBL A;  4KQR A;  4JXV A;  2X71 A;  4WZ4 A;  4MEZ A;  2B5R A;  4DE1 A;  5DTT A;  3SH7 A;  2DNS A;  4E3N A;  4JXS A;  2XFT A;  4UA9 A;  1L0D A;  3G4P A;  3FKW A;  3BEC A;  1K57 A;  3M2K A;  4K91 A;  1GHP A;  5EVI B;  4RA7 A;  2EXB A;  1CI9 A;  2Z2L B;  3G2Z A;  4OLG A;  1K6R A;  4PM6 A;  4S2N C;  4MBF A;  2H0Y A;  3A3F A;  3OPR A;  3DW0 A;  5E2E A;  3FYZ A;  1PZP A;  4U0T A;  3W4O A;  1LLB A;  3WWX A;  3BLS A;  4ZAM A;  4KZA A;  1ONH A;  1FCO A;  4MLL A;  3MFD A;  3IWI A;  4DDS A;  3CMZ A;  4OOY A;  1ZG6 A;  5AQ7 A;  2XK1 A;  2Y2I A;  1K55 C;  3PBR A;  3M6B A;  5F83 A;  5CGW A;  5EVI A;  2XD1 A;  4FH4 A;  1IKI A;  2X02 A;  1BSG A;  5AQ9 A;  1CEF A;  4LV1 A;  2HP5 A;  4OH0 A;  3CZD A;  5FI6 A;  3BYD A;  3PBO A;  5CHM A;  3ZG5 A;  1J9M A;  3G34 A;  3Q7V B;  1NZU A;  3UE3 A;  4E6W A;  1ERQ A;  3OPH A;  2Y2G A;  1IEL A;  1BLC A;  3OC2 A;  4S2K A;  3ZG9 B;  4CJN A;  2GDN A;  5CHU A;  5FA7 A;  3SS3 A;  4EBN A;  4S2I A;  3VFF A;  1PZO A;  2HP6 A;  2BG1 A;  3PBN A;  5F1G A;  3SH9 A;  1KGG A;  3MZE A;  4QJG A;  3C4P A;  4IED A;  3QHY A;  1TDL A;  3DWK A;  3VOY A;  1M6K A;  2R9X A; 
#chains in the Genus database with same CATH topology
 4I3I A;  5TR7 A;  4NET A;  3C2W A;  4EEP A;  3UE1 A;  5HD5 A;  3EQU A;  1MXO A;  3MXQ A;  4E3I A;  3P01 A;  3IXH A;  3LIA A;  1JWV A;  4MBK A;  3IBJ A;  4HJ6 A;  2VK3 A;  1IYO A;  3GR2 A;  2JCH A;  3R7W A;  3HUM A;  3HUN A;  1XFN A;  3EEH A;  4BEN A;  4WZ5 A;  2EWV A;  4QWO A;  3UB9 A;  2QPN A;  1YLY A;  4I39 A;  4R3J A;  3AGD A;  1LT0 A;  1O07 A;  4RVA A;  1ZC2 A;  3W4Q A;  4HES A;  4HQA A;  4LV0 A;  4S2O A;  1TEM A;  3UME A;  3W2Z A;  3G30 A;  3SW1 A;  2PRF A;  4OQI A;  2Y4A A;  3OLO A;  4B9O A;  4WL9 A;  1ACF A;  4OPQ A;  2G7U A;  4OPZ A;  3ZHH A;  3DTM A;  4MN5 A;  3NI9 A;  2Y91 A;  2ZM0 A;  4PM8 A;  2P04 A;  3BQA A;  2O0Y A;  1W5D A;  2PD8 A;  4QU3 A;  3V5M A;  1S67 L;  4GS9 A;  3C7V A;  1K54 A;  1XKZ A;  2M7V A;  3LI8 A;  4B4Z A;  3OCN A;  4QHC A;  5EM0 A;  2Q9M A;  3BFG A;  4KZ4 A;  1DRM A;  4DXB A;  5EVE A;  2Y2J A;  3BEB A;  5HFO A;  1OJ5 A;  3IF6 C;  5JYO A;  5A91 A;  1KVL A;  3LI9 A;  3BRM A;  4H8R A;  2Q0O A;  5DFY A;  1BT5 A;  3MZF A;  4OP8 A;  3LID A;  4F3L A;  1JTD A;  5AVF A;  4XUZ A;  1PYY A;  1ESU A;  2VEA A;  2L1M A;  3HLG A;  3ZVT A;  1SDE A;  1YKD A;  3M2J A;  2C5W B;  4E6X A;  4Q8I A;  3P09 A;  2A24 B;  4JGR A;  3NUL A;  4OOL A;  3LCE A;  4ZJ2 A;  2WAF A;  5EFW A;  2XFS A;  4FTX A;  4FOF A;  1K54 C;  1N9B A;  4BBU A;  3FC7 A;  2E8I A;  2WGW B;  4KZ9 A;  5CTM A;  5DTK A;  4GS9 B;  2ZD8 A;  4EUV A;  1D7E A;  4HJ3 A;  4WLA A;  2WZX A;  4K0X A;  2B95 A;  4Y0O A;  2XGN A;  3UDI A;  1NRJ A;  3F1P B;  1HZO A;  4GB7 A;  1YSP A;  2R9W A;  1SKO A;  4ARZ B;  1LL8 A;  3BW6 A;  2PBD P;  1N9N A;  3UO9 A;  5FQM A;  4X55 A;  3TW8 A;  4DF6 A;  3NJA A;  1FOF A;  1FCM A;  4Y2F A;  4BWI A;  3PBS A;  1OME A;  1WE4 A;  4B88 A;  4EER A;  3ZGA B;  3O87 A;  3TJZ C;  2Y2N A;  2VV7 A;  3VSK A;  2GJ3 A;  2H10 A;  3IQA A;  5GHZ A;  3ICY A;  3JVV A;  3KYQ A;  4JF5 A;  2NUT C;  2VGJ A;  2XEP A;  1DJA A;  1G6O A;  3GMW A;  4H6J B;  3KYE A;  1W79 A;  2ZC6 B;  1KE4 A;  3S7O A;  3VP2 A;  1W8Y A;  4PHT A;  5HPI A;  4HI4 A;  4JGO A;  2Y59 A;  3Q1F A;  3Q07 A;  2QYB A;  1K4E A;  1L0G A;  4YFM A;  2PU2 A;  1KDS A;  4DE2 A;  4N1H A;  3N8L A;  1PWD A;  1OTB A;  4JKT A;  1P9R A;  2J8Y A;  2VJW A;  1FIK A;  3Q81 A;  3PR6 A;  4LV2 A;  3NDE A;  3WS4 A;  3C7U A;  3HLW A;  4G3K A;  1T1A A;  3W8K A;  4ZJ3 A;  2ZMF A;  3MJQ A;  4N92 A;  1FR6 A;  1K6S A;  3NOP C;  3S22 A;  1MWS A;  4LCL A;  4QD4 A;  2RCX A;  4OOM A;  3LIB A;  4ZTK A;  5J8X A;  1W7F A;  3BQ8 A;  4KZ8 A;  3WS5 A;  2OOL A;  4O01 A;  5IS1 A;  2ZQD A;  5DF9 A;  1YT4 A;  3NIA A;  1LL5 A;  1PFL A;  1TS8 A;  2Q9N A;  2G2U A;  4UAA A;  1E25 A;  1XJ3 A;  3PTE A;  3N7W A;  4WBG A;  1RGY A;  3A3E A;  5AJG A;  3UPO A;  5CER A;  4F3L B;  5FQK A;  4AFI A;  4ZBE A;  3UMD A;  3QP1 A;  4HEF A;  3MKF A;  5EOE A;  1S0W A;  2HDQ A;  1K25 A;  2W3D A;  2QJ5 A;  4XXR A;  2W1R A;  3PHY A;  2VV8 A;  1WYB A;  3IF6 B;  3ITB A;  2WUQ A;  5FAS A;  3VP4 A;  3VE4 A;  3RXW A;  4K08 A;  5EEC A;  2ZQC A;  3CPT B;  1HD8 A;  2CC1 A;  5CHJ A;  2EFX A;  4XT2 B;  2D01 A;  5A90 A;  1PWG A;  3FWL A;  5DTS A;  4X6T A;  1BLP A;  1MBL A;  2B5R A;  4E3N A;  4JXS A;  3TRC A;  3M2K A;  2VLG A;  4KUO A;  4OLG A;  4PM6 A;  1IOU A;  3OPR A;  5E2E A;  4U0T A;  1LLB A;  2MJ6 A;  4XT2 A;  4ZAM A;  1ONH A;  1FCO A;  4Y13 A;  3MFD A;  3IWI A;  4OOY A;  5F6A A;  1S4S A;  1G5U A;  3B42 A;  3PBR A;  5F83 A;  2XD1 A;  2PR5 A;  4FH4 A;  1IKI A;  3LIC A;  1J9M A;  2ZL1 A;  4E6W A;  1ERQ A;  1BLC A;  3OC2 A;  4CJN A;  3UE6 A;  3SS3 A;  2PAV P;  1PZO A;  3PBN A;  4QJG A;  4IED A;  1TDL A;  3VOY A;  3IX3 A;  1GHM A;  1DJC A;  4GDN A;  5D3O A;  5AQB A;  2ZL1 B;  1BZA A;  5GLA A;  2PYP A;  1PI5 A;  3GSG A;  2ZOH A;  4PM5 A;  4WN5 A;  4ETZ A;  4I5S A;  3MFX A;  3UNW A;  4ZJ1 A;  4P87 A;  4A5R A;  3HVF A;  4ME4 A;  1JNU A;  1P97 A;  1K38 A;  1JWP A;  4S2L A;  5M19 A;  2OLV A;  3MZD A;  5LBR A;  2OLU A;  5HSQ A;  2ZC7 A;  4FSF A;  3MS6 A;  1VHM A;  3MQQ A;  4RX3 A;  1ERO A;  1F9I A;  3E2K A;  4X68 A;  2HZ5 A;  2W3H A;  2ZC3 B;  2XR0 A;  5CED A;  1Q2Q A;  3BFD A;  3V39 A;  4II7 A;  2HDU A;  4P6Z S;  1XA7 A;  2WKH A;  4R23 A;  1L0E A;  2Z6D A;  3OBF A;  3UDX A;  2G2W A;  5CX7 A;  1XJ6 A;  1MWU A;  3LR0 A;  1T19 A;  2JN7 A;  1JVJ A;  5TJJ A;  2Y2K A;  4YWZ A;  5AVE A;  1MWT A;  5DFX A;  1FR1 A;  2OAQ 1;  5KSC A;  3F1O B;  1GA9 A;  2WKQ A;  3FV7 A;  4OQH A;  3IXD A;  4I3A A;  2I72 A;  1TD5 A;  3FKV A;  4OLD A;  1YQS A;  1M6K A;  4DMZ A;  1VM1 A;  4JXW A;  1BYW A;  2OSU A;  3DTI A;  2KDK A;  2WKP A;  5DKL A;  3RFB A;  4PPR A;  3QP2 A;  1UWP X;  3IF5 A;  5EUA A;  2M1C A;  3UE0 A;  3MSH A;  1CK3 A;  2QWS A;  3DAV A;  1BLH A;  5A93 A;  4R4R A;  4DE3 A;  3NOT C;  2O9C A;  3SOI A;  3LR4 A;  4JBF A;  3FG8 A;  2C6W B;  2J3T D;  3IWO A;  3FPW A;  4KG5 A;  4O0P A;  2EFU A;  2Y2P A;  1DP6 A;  3D72 A;  3IF6 A;  4GZB A;  2VZW A;  3T12 B;  1VQQ A;  2ZM8 A;  2FFY A;  1YAX A;  5A92 A;  1F2K A;  1FIL A;  4U3T A;  1N9O A;  2CMN A;  4WUJ A;  3QP5 A;  3OOV A;  3TE8 A;  2EX2 A;  5DF8 A;  1STZ A;  3OPL A;  1GSW A;  2W3G A;  1XX2 A;  1E3U A;  4PKY A;  2JE5 A;  4JPM A;  2J3T C;  1NYY A;  3LY4 A;  3MQO A;  4GHI A;  1PRQ A;  3E98 A;  3K2N A;  4HH3 A;  1BUE A;  2PBY A;  3D9Y A;  2WAE A;  1YLJ A;  3IWQ A;  5HPF A;  5KSH A;  1TF1 A;  3BY9 A;  3ZG0 A;  1FQG A;  3LGO A;  1K56 D;  1Y54 A;  4R3A A;  4KQO A;  4R38 A;  3S1Y A;  1ES4 A;  5CXW A;  3VP0 A;  1H8Y A;  1QMF A;  3NOU C;  4LCM A;  5GLD A;  5TFQ A;  4MMN A;  1YPR A;  2HDR A;  5HWW A;  3A3J A;  1ZTU A;  2ZC5 B;  3MKE A;  5TGF A;  1CJF A;  5E43 A;  1PNE A;  3BFE A;  1S4R A;  2VX8 A;  2YKH A;  5FDS A;  3ULF A;  4E3J A;  2VGL M;  4GW9 A;  3VMA A;  3AGE A;  4NEE D;  4EQI A;  3OZH A;  2WK0 A;  5F69 A;  5EM1 A;  2BTF P;  4IUH A;  3SS5 A;  1ZKJ A;  2OWH A;  1N4O A;  4EBP A;  1SKO B;  1G6A A;  4GNU A;  1KE3 A;  3QNC A;  2WKR A;  4EUZ A;  4WEK A;  4P6Z M;  2WGV A;  2EX9 A;  2ZQ8 A;  1NYM A;  3GQZ A;  1H8M A;  1MKI A;  5HAI A;  4GN2 A;  3L7H A;  1U60 A;  2PT7 A;  2DMW A;  1T1C A;  4IVK A;  4LEN A;  3HUO A;  2PD7 A;  2JBF A;  1NJ4 A;  4GCZ A;  1LSX A;  3G32 A;  3M6H A;  3PAG A;  1W63 Q;  1DY6 A;  2XLN A;  3KX0 X;  3O86 A;  1TS6 A;  4B4X A;  4Q0I A;  3VOZ A;  3SH8 A;  3G31 A;  1H3Q A;  3NC8 A;  1HTZ A;  3B3X A;  5KMW A;  2D02 A;  2FZ0 A;  2DRW A;  2GNX A;  4DN0 A;  3V3R A;  3S7Q A;  3EGD C;  4M3K A;  1ONG A;  1I2S A;  2QHK A;  1AWI A;  3T4L A;  4N9K A;  2V8C A;  2ACG A;  2IWD A;  4BQM A;  2DCF A;  5FQ9 A;  2WAD A;  1YLT A;  1YLP A;  1AXB A;  1BTL A;  2W1T B;  4E3O A;  3UDF A;  4RX2 A;  1V9Y A;  3MQ0 A;  2VKS A;  1SDN A;  3WS1 A;  4WYY A;  2XD5 A;  2QZ6 A;  5DKK A;  2XA7 S;  3W4P A;  5FAO A;  2H0T A;  3PXP A;  3T1X A;  3NEC A;  3ZVW A;  2OWJ A;  2ZMV A;  4ID4 A;  4X53 A;  3T4K A;  2P08 A;  5IU1 A;  2W1T A;  2PHY A;  4ARZ A;  4MN6 A;  1D1J A;  2VGL S;  3DWZ A;  3FZC A;  1M40 A;  4KZ5 A;  3V50 A;  3D3O A;  2ZJ9 A;  3PAE A;  4IVI A;  2V1Z A;  1TDG A;  3UPP A;  3QP8 A;  4WMC D;  1BUL A;  4P0M A;  4P85 A;  3NY4 A;  1XJ2 A;  3IX4 A;  1ALQ A;  3RJU A;  1NZO A;  5DF7 A;  4OKP A;  1GCE A;  3Q82 A;  5L2F A;  4X1M A;  1XXM A;  3JYI A;  3E4Q A;  1XJ4 A;  5FAQ A;  3U4L P;  4N1X A;  2A49 A;  3HL9 A;  4CLC D;  4WZ4 A;  4ESP A;  3SH7 A;  1KOU A;  1K57 A;  1CI9 A;  2XSS A;  2Z2L B;  1K6R A;  3LR3 A;  3WWX A;  1PZP A;  3BLS A;  5IT5 A;  4MLL A;  4DDS A;  3M6B A;  5CGW A;  2X02 A;  1BSG A;  1CEF A;  5FI6 A;  4OH0 A;  4G3W A;  2KLI A;  3OPH A;  3A0V A;  5FA7 A;  5J4E A;  4BBV A;  3SH9 A;  2QKP A;  3CPT A;  1KGG A;  3MZE A;  3C4P A;  3DWK A;  2R9X A;  4CLC B;  2A2L A;  3KYZ A;  1RCJ A;  3K3C A;  3CAX A;  3SS4 A;  1SKF A;  1JTG A;  1W63 M;  3C30 A;  3VE3 A;  2P9V A;  2WGW A;  1VET A;  2O9A A;  1W8Q A;  4EXO A;  1OPX A;  3NDG A;  5J7E A;  5E2G A;  4HJ4 A;  3UY6 A;  2ZMA A;  3ZYT A;  3F1P A;  4S2N A;  2PU4 A;  4LLO B;  2EWW A;  4GKU A;  3CJM A;  1JWZ A;  4WZ5 C;  2O9B A;  3QNB A;  4BD0 A;  3LEZ A;  1S6R A;  3UB7 A;  1N9L A;  4X69 A;  1GHI A;  3CWF A;  1NY0 A;  2ZC4 B;  5HAR A;  2V20 A;  4GJ4 A;  4S2P A;  1H0M A;  2V9A A;  2WYX A;  4WM9 A;  5GHX A;  3KO6 A;  4KG6 A;  2BAS A;  4ZRR A;  2P74 A;  4M4X A;  3LR5 A;  4KZ6 A;  2JKT I;  3TSG A;  5L8M A;  5HDS A;  2WGI A;  5M18 A;  2JKF A;  3H7W B;  4DKI A;  1DJB A;  1MZU A;  5HDC A;  3CHW P;  4DE0 A;  5TBM B;  2K2N A;  3DTK A;  4Y0T A;  4OPY A;  3IS2 A;  4PM9 A;  1YLZ A;  4BD1 A;  3TG9 A;  1NWZ A;  1ES2 A;  2HDS A;  3D4F A;  2HPB A;  4E3K A;  3EEA A;  3VP3 A;  4NXB A;  4JF6 A;  4JGQ A;  1ZHH B;  3S4X A;  5FDH A;  4EU0 A;  5HAP A;  1SZV A;  5GL9 A;  1NXY A;  3PBT A;  4MBH A;  3S7P A;  5I94 A;  1GSV A;  1DP8 A;  2P9V B;  2HGV A;  3NCK A;  1OJG A;  1EWZ A;  3LIF A;  4IHQ A;  2V1B A;  5DJU A;  5A8B A;  4HH2 A;  1XFQ A;  4HNB A;  1LHY A;  4NKP A;  1K0K A;  1Y28 A;  2M7U A;  2HP9 A;  3G2Y A;  4UA6 A;  1I5Q A;  3UN7 A;  2EXA A;  3R4K A;  3UB8 A;  4GLQ A;  4LRX C;  4EET B;  1K55 A;  5HAQ A;  2RL3 A;  2R78 A;  3ZCZ A;  4P6B A;  4L9E A;  2LB9 A;  4F94 A;  4CPK A;  1LI9 A;  4OPR A;  1MPL A;  2V0U A;  3DTE A;  1OTE A;  1Y4O A;  1H8Z A;  5EVL A;  3N8R A;  3R7W B;  1UGU A;  3IHB A;  4L9F A;  1YMX A;  4E3M A;  3NHQ A;  1Z6F A;  2WKI A;  1SHV A;  4UEY A;  1OTD A;  2Y2Q A;  3HLB A;  5FQQ A;  3IBR A;  3LFV A;  3OCL A;  5MC7 A;  3OPP A;  3T4S A;  4CLC A;  3G35 A;  4S2J A;  2UWX A;  2JKG A;  3O88 A;  4C75 A;  1YSQ A;  5F1F A;  5FQJ A;  4S2M A;  2JKR I;  2LB5 A;  4KQD A;  5FI2 A;  3LY3 A;  3BFF A;  5F82 A;  4DDY A;  5CEB A;  4K0W A;  5CGS A;  1T18 A;  3U2A A;  2V8F A;  4X25 A;  1OT9 A;  3O3V A;  2KOI A;  3VV4 A;  3RH8 B;  1VEU A;  5DJT A;  2EX8 A;  2INW A;  2L4R A;  3LYX A;  5HL6 A;  3PYP A;  5U47 A;  3HJI A;  2WKE A;  4PMA A;  5F68 A;  4Y17 A;  3JVU A;  3IXB A;  1KE0 A;  4PM7 A;  3HLF A;  4Z1W A;  4JGP A;  3C5A A;  4GD6 A;  2UV0 E;  1LI0 A;  3GTC A;  4Q0H A;  4CLC C;  1OTI A;  3G6O A;  2Z2M B;  3T4J A;  5DVA A;  3C38 A;  4LPZ A;  1O7E A;  2H5S A;  4NXF A;  4YIN A;  3F1N B;  1CF0 A;  3VFH A;  3CUE C;  1P9W A;  4IBX A;  1K57 C;  3FPV A;  4EQ1 A;  1MWR A;  4OQG A;  1LSV A;  3VP1 A;  3WRT A;  5FEG A;  3GDI A;  5GLC A;  4ZDX A;  3MR0 A;  3ZG8 B;  4X56 A;  2XRO A;  2K7S A;  3T1Q B;  4RQ9 A;  2IWC A;  5G4Y A;  3F1N A;  2V1A A;  1HVB A;  1L2S A;  4HOI A;  1FCN A;  3BJN A;  5EPH A;  4KZB A;  2Y55 A;  5HD3 A;  4FH2 A;  5AQA A;  3RTY A;  3HCY A;  4DXC A;  4LV3 A;  5C5K A;  4EES A;  5JYP A;  5EV0 A;  2ZM2 A;  4EEU A;  4NXE A;  2E8J A;  1WA9 A;  3B47 A;  2X01 A;  2GX5 A;  4B93 A;  5KZH A;  4IUK A;  2JHE A;  4U0X A;  4GOG A;  2J9O A;  1HLU P;  4BBT A;  3VOL A;  4XUX A;  4R4S A;  1X0O A;  4EW7 A;  2JC7 A;  5G4Z A;  3BLM A;  2W0N A;  3MXS A;  3ZFZ A;  3ZQ5 A;  1IYQ A;  3ZNT A;  2IWB A;  1ODV A;  5CRF A;  2VA0 A;  3A0S A;  2WZZ A;  4YNR A;  5FI7 A;  1WYC A;  4KEN B;  3KSG A;  2X71 A;  1NLZ A;  2KX6 A;  4DE1 A;  3DBA A;  2A24 A;  2DNS A;  4CQH A;  2XFT A;  1L0D A;  1GHP A;  4RA7 A;  2EXB A;  2V0W A;  3G2Z A;  1MKM A;  3V67 A;  4S2N C;  4MBF A;  3DW0 A;  3W4O A;  1J3W A;  3EGX C;  1ZG6 A;  2XK1 A;  5EVI A;  4Y15 A;  5AQ9 A;  4LV1 A;  2HP5 A;  3ZG5 A;  3CZD A;  4IJG A;  2W3F A;  3Q7V B;  3UE3 A;  2Y2G A;  1IEL A;  4S2K A;  3ZG9 B;  2GDN A;  3VFF A;  3K3D A;  2HP6 A;  2BG1 A;  5F1G A;  3QHY A;  4PKY G;  2W3E A;  2V2F F;  1YMS A;  3GRJ A;  3QP6 A;  4DRT A;  2Y8H A;  1E3U D;  3Q7V A;  5HW3 A;  4EV4 A;  1PW1 A;  2HF6 A;  4LFU A;  5E2F A;  4E04 A;  1K56 A;  1FSY A;  3HRE A;  1XP4 A;  1NLY A;  2AVX A;  5FQI A;  3A3I A;  4NG2 A;  1L3L A;  2ZLY A;  2ZQA A;  3EWK A;  2L0W A;  2HJE A;  2J80 A;  3ZDJ A;  1ERM A;  4LGW A;  1KVM A;  3AGF A;  3KSH A;  4KG2 A;  3N6I A;  1QME A;  2QJ7 A;  3A3D A;  2HJ9 C;  2JKR M;  5BOH A;  2XRN A;  2ZQ7 A;  4PAU A;  1DP9 A;  1XGI A;  3CUE A;  3S7N A;  3HBR A;  4RYE A;  4GDB A;  3T1S A;  4WEJ A;  3MF0 A;  5L10 A;  1C3B A;  2XQZ A;  4HBT A;  1TS0 A;  4HY8 A;  3WS2 A;  3P98 A;  4R0Q A;  2Y2M A;  4HP9 A;  1CEG A;  1ZG4 A;  4FD8 A;  5K5B A;  3VSL A;  5CEC A;  4R1G A;  5CGX A;  2BLS A;  4MNR A;  1LL9 A;  1SCW A;  5HX9 A;  2ZQ9 A;  4OQ0 A;  3IH9 A;  1T1B A;  1S1Y A;  1GSX A;  1H5X A;  2PDR A;  3IS2 B;  2J9P A;  4EWF A;  3IX8 A;  2O99 A;  2P7J A;  3KSF A;  1L0F A;  4C6Y A;  3BWL A;  3HLC A;  3N4I A;  4UQI S;  4BJP A;  5EVI C;  4DJ3 A;  4MCW A;  2XDM A;  3T4T A;  4G3V A;  1I2W A;  1XA1 A;  1CI8 A;  3E0Y A;  1G68 A;  2EA9 A;  4E3L A;  1RP5 A;  1XPB A;  3O5Y A;  2Y2H A;  4BMW A;  3LIE A;  3C8C A;  4WMC A;  3ZNY A;  4GHI B;  2FFF B;  2OV5 A;  3CG5 A;  3LUQ A;  4WEL A;  4I3J A;  2HV1 A;  3WRZ A;  1ESI A;  4L9G A;  2OAP 1;  1VB6 A;  2JKT M;  4OVD A;  5FEF A;  4YOF A;  1BLS A;  3GEC A;  3E4O A;  2PYR A;  3LEQ A;  4OP5 A;  1IEM A;  3MXR A;  3I7J A;  4N9L A;  4BLM A;  1UWN X;  3T4Q A;  4HIA A;  3A0R A;  4I38 A;  1ES3 A;  1A0K A;  3E2L A;  5FAT A;  5GLB A;  5HDD A;  1GA0 A;  1K4F A;  2EX6 A;  3T50 A;  5GHY A;  1YLW A;  5HL1 A;  3L9K A;  1VET B;  1ES5 A;  4DJ2 A;  3MBZ A;  2Y79 A;  3P7N A;  1OT6 A;  1IYP A;  4QY6 A;  5E2H A;  3IXG A;  2QMI A;  3GV9 A;  3PBQ A;  1F5M A;  2K31 A;  1EI5 A;  1EW0 A;  4L0L A;  3HLD A;  4R3B A;  2GZA A;  3CIT A;  4HP4 A;  1Q2P A;  4R6L A;  4UHU A;  3V3S A;  3LO7 A;  4KQQ A;  5FL3 A;  2H28 A;  2I9V A;  4D2O A;  3UB6 A;  4KUK A;  4UA7 A;  5FSR A;  4O8G A;  4JLF A;  1PIO A;  1VEU B;  4ETX A;  4BL3 A;  2NUP C;  5M1A A;  4MN7 A;  3B33 A;  1PI4 A;  5I5L A;  4CLC E;  4Q0J A;  4Y0U A;  4Z9Q A;  3F1O A;  4NK3 A;  4D60 A;  3T1R A;  3ITA A;  1S66 L;  4JXG A;  4JF4 A;  1E4D A;  3UB5 P;  3GVB A;  3IT9 A;  5HZH A;  2XF3 A;  3RXX A;  1PW8 A;  4MDZ A;  1IFQ A;  4KZ7 A;  4FCF A;  5IHV A;  5L07 A;  4BL2 A;  1LSW A;  3IHA A;  4LRZ E;  3NBL A;  5HWV A;  1G28 A;  5CTN A;  4Y7P A;  3C4O A;  2A3U A;  1Z09 A;  4X1L A;  4UQI M;  3WS0 A;  4KZ3 A;  1FSW A;  3SZT A;  1YM1 A;  4IBR A;  5EOO A;  1MY8 A;  3E4P A;  3EOI A;  5G18 A;  4HBU A;  5HWT A;  1S1Z A;  1V9Z A;  4H6J A;  4NXG A;  3JPU A;  3H82 A;  3HJK A;  2ZOI A;  4EBL A;  3IH8 A;  1IKG A;  5EE8 A;  1KDW A;  2FH5 A;  3Q7Z A;  3BM6 A;  1XGJ A;  1TVF A;  3CI6 A;  1RGZ A;  1NRF A;  2VGK A;  5FAP A;  2XH9 A;  4QY5 A;  5EVI D;  5KIZ A;  4Y3I A;  3QP4 A;  3T4O A;  3BFC A;  3ISG A;  4OON A;  3HLE A;  2Y2O A;  1MC0 A;  2W27 A;  3N8S A;  4FUW A;  3H7W A;  3UPN A;  1KGE A;  3CLO A;  4GD8 A;  2XA7 M;  1PWC A;  3H9W A;  1TS7 A;  1KGF A;  2Y2L A;  1D06 A;  3KSI A;  4LRY C;  2ZBB A;  4C3Q A;  3EQV A;  4QB8 A;  2VV6 A;  3TOI A;  2J7V A;  4O7D A;  1IYS A;  5L09 A;  4KQR A;  4JXV A;  4R70 A;  3BY8 A;  4MEZ A;  5DTT A;  5J3W A;  1P0Z A;  4UA9 A;  3G4P A;  3FKW A;  3BEC A;  4K91 A;  5EVI B;  5F5Y A;  2PR6 A;  4Y5F A;  2H0Y A;  2Z6C A;  3A3F A;  3ZG7 B;  3FYZ A;  1F98 A;  3H82 B;  4KZA A;  3CMZ A;  5AQ7 A;  2Y2I A;  1K55 C;  4HHD A;  4QPR A;  2IA2 A;  2B02 A;  3MMH A;  2J3W A;  1CQA A;  3BYD A;  3PBO A;  5CHM A;  3G34 A;  1NZU A;  2B18 A;  2YKF A;  5CHU A;  4EBN A;  4S2I A;  4WF0 A;  5TBM A;  1OTA A; 
#chains in the Genus database with same CATH homology
 5TR7 A;  4NET A;  3UE1 A;  2V2F F;  1YMS A;  3GRJ A;  4DRT A;  1GHM A;  1DJC A;  1RCJ A;  3EQU A;  4GDN A;  5D3O A;  1E3U D;  1MXO A;  3Q7V A;  5AQB A;  4E3I A;  3SS4 A;  1BZA A;  5HW3 A;  4EV4 A;  1SKF A;  3IXH A;  1JTG A;  5GLA A;  1JWV A;  1PI5 A;  1PW1 A;  3GSG A;  4MBK A;  4PM5 A;  1IYO A;  3GR2 A;  2JCH A;  2P9V A;  5E2F A;  2WGW A;  1W8Q A;  3NDG A;  3UNW A;  1K56 A;  3HUM A;  4ZJ1 A;  3HUN A;  4P87 A;  5E2G A;  3HVF A;  4A5R A;  4BEN A;  1K38 A;  3UY6 A;  1JWP A;  1FSY A;  2ZMA A;  3HRE A;  4S2L A;  4WZ5 A;  4S2N A;  2PU4 A;  5M19 A;  2OLV A;  1XP4 A;  3MZD A;  2QPN A;  1YLY A;  2OLU A;  4R3J A;  3AGD A;  2ZC7 A;  1O07 A;  3CJM A;  4FSF A;  1JWZ A;  3A3I A;  1ZC2 A;  4GKU A;  4RVA A;  4WZ5 C;  5FQI A;  3QNB A;  4BD0 A;  3LEZ A;  4RX3 A;  1S6R A;  2ZLY A;  3W4Q A;  1ERO A;  2ZQA A;  4HES A;  4X69 A;  4LV0 A;  3E2K A;  4X68 A;  4S2O A;  1TEM A;  1GHI A;  2ZC3 B;  2ZC4 B;  1NY0 A;  2XR0 A;  5HAR A;  3ZDJ A;  5CED A;  3G30 A;  2V20 A;  4S2P A;  1ERM A;  1Q2Q A;  3BFD A;  3V39 A;  1KVM A;  2HDU A;  4OQI A;  1XA7 A;  2WYX A;  2Y4A A;  3AGF A;  2WKH A;  4WM9 A;  5GHX A;  4KG6 A;  4R23 A;  2P74 A;  1L0E A;  4KG2 A;  3N6I A;  1QME A;  4KZ6 A;  3A3D A;  3TSG A;  5BOH A;  4OPQ A;  3UDX A;  2WGI A;  2ZQ7 A;  5M18 A;  4OPZ A;  2G2W A;  3ZHH A;  1XGI A;  3DTM A;  4DKI A;  3NI9 A;  2Y91 A;  1DJB A;  3HBR A;  4DE0 A;  4RYE A;  2ZM0 A;  4GDB A;  1MWU A;  4PM8 A;  4Y0T A;  4OPY A;  4PM9 A;  1JVJ A;  1YLZ A;  4WEJ A;  1W5D A;  2Y2K A;  3TG9 A;  4BD1 A;  4QU3 A;  1C3B A;  2XQZ A;  4HBT A;  1MWT A;  1ES2 A;  3V5M A;  2HDS A;  3D4F A;  2HPB A;  3C7V A;  3WS2 A;  1K54 A;  4E3K A;  1FR1 A;  1XKZ A;  3VP3 A;  3P98 A;  5KSC A;  4R0Q A;  1GA9 A;  3FV7 A;  4B4Z A;  4JF6 A;  4OQH A;  3S4X A;  3IXD A;  2Y2M A;  3OCN A;  5FDH A;  5HAP A;  2I72 A;  3FKV A;  4OLD A;  1YQS A;  1CEG A;  1VM1 A;  4JXW A;  1NXY A;  3PBT A;  4MBH A;  1ZG4 A;  4FD8 A;  2P9V B;  2Q9M A;  3BFG A;  5GL9 A;  4KZ4 A;  5I94 A;  2OSU A;  4DXB A;  3NCK A;  3VSL A;  5CEC A;  4R1G A;  2Y2J A;  3BEB A;  5CGX A;  2BLS A;  1EWZ A;  4MNR A;  5HFO A;  1LL9 A;  3IF6 C;  4PPR A;  1SCW A;  5HX9 A;  5JYO A;  5A91 A;  1KVL A;  3IF5 A;  5EUA A;  2ZQ9 A;  3BRM A;  3UE0 A;  4OQ0 A;  3IH9 A;  1CK3 A;  4H8R A;  1H5X A;  1BLH A;  5A93 A;  1LHY A;  1BT5 A;  3MZF A;  4OP8 A;  4R4R A;  2J9P A;  4DE3 A;  4EWF A;  2HP9 A;  3G2Y A;  4UA6 A;  1JTD A;  3SOI A;  1I5Q A;  4XUZ A;  4JBF A;  1PYY A;  1L0F A;  1ESU A;  4C6Y A;  3UN7 A;  2C6W B;  2EXA A;  3IWO A;  4KG5 A;  3HLG A;  3ZVT A;  3HLC A;  1SDE A;  3M2J A;  3N4I A;  2C5W B;  2EFU A;  2Y2P A;  4BJP A;  5EVI C;  4E6X A;  4Q8I A;  1K55 A;  3P09 A;  5HAQ A;  2RL3 A;  2XDM A;  3IF6 A;  4GZB A;  4OOL A;  3ZCZ A;  3LCE A;  4P6B A;  4ZJ2 A;  1VQQ A;  2ZM8 A;  4F94 A;  2FFY A;  2WAF A;  4CPK A;  2XFS A;  1I2W A;  1XA1 A;  5A92 A;  1LI9 A;  1CI8 A;  4OPR A;  1MPL A;  4U3T A;  1G68 A;  4E3L A;  1RP5 A;  1XPB A;  1K54 C;  1N9B A;  2E8I A;  1H8Z A;  5EVL A;  2Y2H A;  3N8R A;  2WGW B;  2EX2 A;  4KZ9 A;  4WMC A;  5DF8 A;  3ZNY A;  3IHB A;  2FFF B;  1YMX A;  4E3M A;  3OPL A;  5CTM A;  5DTK A;  1Z6F A;  2WKI A;  2ZD8 A;  2OV5 A;  3CG5 A;  1XX2 A;  1E3U A;  2WZX A;  1SHV A;  2JE5 A;  4JPM A;  4WEL A;  3WRZ A;  4K0X A;  2Y2Q A;  3HLB A;  1ESI A;  4Y0O A;  5FQQ A;  1NYY A;  3LY4 A;  2XGN A;  3UDI A;  1BUE A;  2PBY A;  4OVD A;  3OCL A;  1HZO A;  2WAE A;  3OPP A;  1YLJ A;  3IWQ A;  5KSH A;  1BLS A;  3ZG0 A;  4GB7 A;  3G35 A;  2R9W A;  4S2J A;  2UWX A;  5F1F A;  3O88 A;  4C75 A;  1FQG A;  4OP5 A;  5FQJ A;  1IEM A;  1K56 D;  1Y54 A;  4S2M A;  4KQO A;  5FI2 A;  3MXR A;  3LY3 A;  3I7J A;  3S1Y A;  4N9L A;  1ES4 A;  3BFF A;  5CXW A;  4BLM A;  4QHC A;  1H8Y A;  3UO9 A;  3VP0 A;  5F82 A;  4DDY A;  1QMF A;  5FQM A;  5CEB A;  4K0W A;  4X55 A;  4DF6 A;  5CGS A;  1ES3 A;  4LCM A;  5GLD A;  3E2L A;  5FAT A;  5TFQ A;  5GLB A;  1GA0 A;  1FOF A;  1FCM A;  1K4F A;  2EX6 A;  5GHY A;  1YLW A;  5HL1 A;  3O3V A;  2HDR A;  3PBS A;  3A3J A;  1OME A;  2ZC5 B;  1WE4 A;  3MKE A;  5TGF A;  4B88 A;  1ES5 A;  5E43 A;  3ZGA B;  3O87 A;  3BFE A;  2EX8 A;  3MBZ A;  4E3J A;  1IYP A;  3VMA A;  3AGE A;  4QY6 A;  2Y2N A;  5U47 A;  3VSK A;  5E2H A;  2H10 A;  3IXG A;  3IQA A;  4EQI A;  3OZH A;  2QMI A;  2WK0 A;  5GHZ A;  3GV9 A;  3PBQ A;  2WKE A;  4PMA A;  1EI5 A;  4JF5 A;  3IXB A;  2VGJ A;  4L0L A;  3SS5 A;  1ZKJ A;  2XEP A;  1KE0 A;  1DJA A;  3HLD A;  4PM7 A;  3HLF A;  4R3B A;  3GMW A;  1N4O A;  1W79 A;  4EBP A;  3C5A A;  1Q2P A;  4GD6 A;  1G6A A;  2ZC6 B;  4UHU A;  1KE4 A;  3VP2 A;  4GNU A;  3V3S A;  3LO7 A;  1LI0 A;  4KQQ A;  1KE3 A;  1W8Y A;  4D2O A;  3GTC A;  3QNC A;  4EUZ A;  4WEK A;  4UA7 A;  2WGV A;  2EX9 A;  2ZQ8 A;  2Z2M B;  3ZG7 B;  1NYM A;  3GQZ A;  5FSR A;  1MKI A;  5HAI A;  2Y59 A;  4JLF A;  4GN2 A;  5DVA A;  1PIO A;  3Q1F A;  3Q07 A;  1O7E A;  2H5S A;  4BL3 A;  5M1A A;  1U60 A;  1PI4 A;  4YIN A;  4Y0U A;  4Z9Q A;  1K4E A;  1L0G A;  4YFM A;  2PU2 A;  4IVK A;  1KDS A;  4LEN A;  4NK3 A;  4DE2 A;  3HUO A;  2JBF A;  3ITA A;  4N1H A;  1NJ4 A;  4JXG A;  4JF4 A;  3N8L A;  3VFH A;  1PWD A;  1E4D A;  3GVB A;  3G32 A;  3IT9 A;  3M6H A;  4IBX A;  3PAG A;  2XF3 A;  3RXX A;  4JKT A;  1DY6 A;  2XLN A;  1K57 C;  1PW8 A;  2J8Y A;  3Q81 A;  4LV2 A;  3NDE A;  1MWR A;  4OQG A;  4KZ7 A;  3C7U A;  3O86 A;  3WS4 A;  4FCF A;  3WRT A;  5IHV A;  3VP1 A;  4B4X A;  3VOZ A;  4BL2 A;  3SH8 A;  3G31 A;  3IHA A;  3NC8 A;  1HTZ A;  3B3X A;  5KMW A;  3HLW A;  2DRW A;  3NBL A;  5GLC A;  3W8K A;  5CTN A;  4ZJ3 A;  3V3R A;  4Y7P A;  3C4O A;  4ZDX A;  2A3U A;  4M3K A;  4X56 A;  3ZG8 B;  4N92 A;  1FR6 A;  1K6S A;  3S22 A;  1MWS A;  4LCL A;  4QD4 A;  3WS0 A;  1ONG A;  1I2S A;  2RCX A;  4OOM A;  4KZ3 A;  1FSW A;  4N9K A;  2IWC A;  1YM1 A;  4IBR A;  5EOO A;  4ZTK A;  5J8X A;  1W7F A;  4KZ8 A;  2IWD A;  1MY8 A;  3WS5 A;  1HVB A;  2DCF A;  4BQM A;  1L2S A;  2WAD A;  5FQ9 A;  2ZQD A;  1YLT A;  1YLP A;  4HBU A;  1FCN A;  5G18 A;  1AXB A;  5DF9 A;  1BTL A;  1YT4 A;  4E3O A;  3UDF A;  3NIA A;  5EPH A;  4RX2 A;  1LL5 A;  4KZB A;  2Y55 A;  4EBL A;  3IH8 A;  1SDN A;  4FH2 A;  2Q9N A;  4WYY A;  3WS1 A;  2G2U A;  1IKG A;  4UAA A;  5EE8 A;  5AQA A;  2XD5 A;  1KDW A;  2QZ6 A;  4DXC A;  3Q7Z A;  4LV3 A;  1E25 A;  1XGJ A;  1TVF A;  3BM6 A;  1RGZ A;  3PTE A;  3W4P A;  5FAO A;  1NRF A;  2H0T A;  3N7W A;  4WBG A;  1RGY A;  5JYP A;  3A3E A;  2VGK A;  3ZVW A;  5FAP A;  2XH9 A;  2ZM2 A;  4ID4 A;  4X53 A;  4QY5 A;  5EVI D;  3UPO A;  5CER A;  2X01 A;  5FQK A;  3DWZ A;  4ZBE A;  3BFC A;  3ISG A;  4OON A;  3HLE A;  2Y2O A;  3FZC A;  1M40 A;  4HEF A;  4KZ5 A;  3MKF A;  3N8S A;  3V50 A;  5KZH A;  5EOE A;  1S0W A;  4U0X A;  2HDQ A;  3UPN A;  1KGE A;  1K25 A;  4GOG A;  2J9O A;  4XXR A;  2ZJ9 A;  3PAE A;  4IVI A;  4R4S A;  4XUX A;  2V1Z A;  1TDG A;  1WYB A;  3UPP A;  3IF6 B;  2JC7 A;  3ITB A;  3BLM A;  4GD8 A;  4WMC D;  1BUL A;  2WUQ A;  4P0M A;  4P85 A;  5FAS A;  3MXS A;  3NY4 A;  3ZFZ A;  1ALQ A;  3RJU A;  1PWC A;  1IYQ A;  1NZO A;  5DF7 A;  4OKP A;  1KGF A;  1GCE A;  3VP4 A;  2Y2L A;  3ZNT A;  3RXW A;  2IWB A;  3Q82 A;  5L2F A;  5CRF A;  5EEC A;  1XXM A;  2ZQC A;  1HD8 A;  3JYI A;  4C3Q A;  2CC1 A;  3EQV A;  5CHJ A;  2EFX A;  2WZZ A;  4QB8 A;  5FI7 A;  3TOI A;  2J7V A;  5FAQ A;  5A90 A;  4O7D A;  1PWG A;  4N1X A;  1WYC A;  2A49 A;  3FWL A;  4KEN B;  4X6T A;  1BLP A;  1IYS A;  3HL9 A;  5DTS A;  1MBL A;  4KQR A;  4JXV A;  2X71 A;  4WZ4 A;  4MEZ A;  2B5R A;  4DE1 A;  5DTT A;  3SH7 A;  2DNS A;  4E3N A;  4JXS A;  2XFT A;  4UA9 A;  1L0D A;  3G4P A;  3FKW A;  3BEC A;  1K57 A;  3M2K A;  4K91 A;  1GHP A;  5EVI B;  4RA7 A;  2EXB A;  1CI9 A;  2Z2L B;  3G2Z A;  4OLG A;  1K6R A;  4PM6 A;  4S2N C;  4MBF A;  2H0Y A;  3A3F A;  3OPR A;  3DW0 A;  5E2E A;  3FYZ A;  1PZP A;  4U0T A;  3W4O A;  1LLB A;  3WWX A;  3BLS A;  4ZAM A;  4KZA A;  1ONH A;  1FCO A;  4MLL A;  3MFD A;  3IWI A;  4DDS A;  3CMZ A;  4OOY A;  1ZG6 A;  5AQ7 A;  2XK1 A;  2Y2I A;  1K55 C;  3PBR A;  3M6B A;  5F83 A;  5CGW A;  5EVI A;  2XD1 A;  4FH4 A;  1IKI A;  2X02 A;  1BSG A;  5AQ9 A;  1CEF A;  4LV1 A;  2HP5 A;  4OH0 A;  3CZD A;  5FI6 A;  3BYD A;  3PBO A;  5CHM A;  3ZG5 A;  1J9M A;  3G34 A;  3Q7V B;  1NZU A;  3UE3 A;  4E6W A;  1ERQ A;  3OPH A;  2Y2G A;  1IEL A;  1BLC A;  3OC2 A;  4S2K A;  3ZG9 B;  4CJN A;  2GDN A;  5CHU A;  5FA7 A;  3SS3 A;  4EBN A;  4S2I A;  3VFF A;  1PZO A;  2HP6 A;  2BG1 A;  3PBN A;  5F1G A;  3SH9 A;  1KGG A;  3MZE A;  4QJG A;  3C4P A;  4IED A;  3QHY A;  1TDL A;  3DWK A;  3VOY A;  1M6K A;  2R9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...