5E43A

Crystal structure of beta-lactamase sros_5706 from streptosporangium roseum
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
GARARKELRTLEASFKGRIGAYAVDTATGKTITYRSGERFPLLSTFKAIAAAAVLHKARTSDPGLLNKVVHWTTAELQEHSPVTGKHVKDGMTVARLCEAAITRSDNTAANMLLKQIGGPAGLTAYFHTLKDPVSRLDRWETELNNWSPKEKRDTTTPASMGRDLRAVTTGDALDARDRERLNAWLTANKTGDARIRAGLPKTWTVGDKTGTNSKYGAGNDIAVVWPGKSAAPIIMSIYTNRGAADAAVDDKVIADTAAILARALGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal Structure of Beta-lactamase Sros_5706 from Streptosporangium roseum
rcsb
source organism Streptosporangium roseum (strain atcc 12428 / dsm 43021 / jcm 3005 / ni 9100)
total genus 90
structure length 268
sequence length 268
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e43A00
4JKTA 4ZDXA 1IYSA 1KGGA 2J9OA 1L0FA 3W4OA 1K54A 2WGIA 5CGWA 3WS4A 2X71A 4H8RA 2R9XA 3VFHA 4HBUA 4EQIA 1IEMA 1L0EA 2ZQCA 4LENA 3PBOA 4R4SA 1LI9A 3FV7A 4JXWA 2B5RA 3VP1A 2JE5A 3MXRA 1ESIA 1YMXA 3IH8A 4XUZA 2H10A 3Q7VB 2Y2MA 2FFFB 1IYQA 4MBKA 5M19A 2XH9A 5KSHA 3SH7A 1JWPA 2WK0A 4EBLA 5EVIC 4WELA 3BFDA 3NC8A 4OONA 3IQAA 3N8RA 3MZDA 4LCLA 1PI4A 1NYMA 2A3UA 4B4ZA 2EXAA 5DF7A 4WYYA 3G2ZA 4QJGA 4KQRA 4P0MA 1VM1A 5F1GA 1FCMA 3MKFA 1LI0A 3CG5A 1I5QA 5EE8A 4WEJA 4QB8A 1ERMA 4K0XA 3PTEA 1YM1A 1HTZA 4WMCA 3SH9A 1LL9A 2ZQ7A 1Q2QA 3JYIA 4GN2A 3TOIA 5CGXA 5HFOA 3UDIA 3OPPA 3DWKA 3WS2A 1ALQA 5FAQA 3IT9A 1KDWA 4LV3A 5GLCA 4UA6A 1L0GA 3LCEA 4LV1A 3FZCA 4O7DA 1XGJA 2Y55A 3IF6A 1BULA 3S4XA 1BTLA 1ERQA 3O86A 1TDLA 1W8YA 2VGJA 1SKFA 4P87A 2EX8A 3ZG0A 4KG2A 4Y0OA 3EQUA 1G6AA 3MKEA 3AGDA 4HESA 2EX9A 4N1HA 3A3JA 4Y0TA 3P09A 5L2FA 2WZZA 2WUQA 4KZ6A 2HP6A 3DWZA 3ZNTA 4OP5A 4E3MA 4FD8A 2ZM0A 1ONHA 5CHMA 3CMZA 5HARA 3MZEA 5HAIA 1LHYA 3ZG9B 1MKIA 3FKVA 2XD1A 3MXSA 3IHBA 2HDSA 4OVDA 5TGFA 1I2SA 4KZ7A 2QMIA 3M2JA 4LV2A 1FR1A 2CC1A 3N8SA 4GOGA 2WAEA 2BG1A 3HUMA 4FH4A 5GLAA 2Y2NA 4ZJ2A 2DCFA 4Y0UA 4EBNA 4A5RA 5EVID 2EFUA 3GQZA 4S2PA 3SH8A 3V5MA 3Q07A 3G32A 4P6BA 4PM7A 1FCNA 3UPOA 2VGKA 5HAQA 3MFDA 2RCXA 4GB7A 3IXGA 4OKPA 2ZQ9A 3HLCA 3PAEA 3VSLA 1O07A 3UPPA 1PW1A 3ZG5A 3CJMA 3GRJA 2ZD8A 1K54C 1SDNA 2PU4A 4JLFA 4JXVA 3SS4A 4N92A 4MBFA 5FI2A 4CJNA 4WZ5A 5IHVA 4JPMA 1K4FA 3BLSA 2ZC4B 3VP2A 2G2UA 4X6TA 2WADA 3G2YA 3WS1A 5GLBA 1HD8A 3BRMA 4DXBA 3G31A 4EV4A 4FCFA 2ZJ9A 4OLDA 5G18A 4YINA 4BENA 1XKZA 4GDBA 3VOZA 3G30A 5GLDA 1RGZA 3IF6B 2XGNA 2OLUA 3OPRA 3LY3A 3OCLA 5DVAA 4MEZA 5I94A 3PBSA 1QMEA 2Y59A 2XD5A 3NCKA 2XLNA 5EVIB 3ITAA 1JTDA 1YT4A 1PWCA 3W8KA 3E2LA 5CRFA 3D4FA 3PBTA 3O88A 4DF6A 3LEZA 1E25A 5JYOA 3Q7ZA 1KE3A 4S2IA 1LL5A 4E6XA 3ZGAB 1NZOA 3ZHHA 2ZQDA 3HLGA 3SOIA 3VMAA 3VSKA 2HPBA 5DTKA 4GDNA 3IWOA 2XEPA 3ZG7B 3IXDA 2HP5A 3C7UA 4RX3A 2P74A 3C4OA 3OPLA 4KZ3A 3HLEA 5A93A 5TFQA 1JWZA 1K56A 2Y2IA 2OV5A 4DE2A 1H8YA 1U60A 1KE4A 4X55A 3B3XA 1L0DA 3A3DA 3HL9A 5HX9A 3Q82A 1PZPA 2Y2OA 2Y4AA 3IF6C 1IYOA 2J7VA 5M18A 4QHCA 3PBNA 3PBRA 2HDQA 3ZVWA 1CK3A 4UA9A 2C6WB 3FKWA 3OCNA 4DDYA 3MBZA 1RP5A 2DNSA 1K38A 1K55A 1VQQA 1MY8A 1YLTA 1Q2PA 3G35A 4P85A 1BLCA 1XP4A 3QHYA 4OOYA 5GL9A 4NK3A 1OMEA 3Q81A 4R3BA 1K6SA 1KVMA 2Q9NA 3N7WA 3BLMA 5DF9A 5EECA 4PM6A 4Q8IA 5FAPA 2HP9A 1K57A 3N6IA 4KG5A 4X69A 3SS5A 3BYDA 4D2OA 2DRWA 4QD4A 1W5DA 4IBRA 2V20A 1CI8A 2XR0A 5FAOA 2X01A 3FWLA 3V3SA 1MPLA 1M40A 1FSWA 1EI5A 1N4OA 1GHMA 1MWTA 4U0TA 4JF5A 1S0WA 3AGEA 5A91A 5EUAA 3PBQA 3VFFA 3ZVTA 2P9VA 4ZJ1A 2J9PA 3IWQA 1YLWA 2H0TA 4DKIA 2OLVA 2PBYA 5U47A 3ZNYA 4CPKA 5AQ9A 1S6RA 2WKIA 3HLBA 2FFYA 4PM5A 4Z9QA 1CEGA 4UAAA 4E3LA 1WE4A 2EX2A 5AQAA 1XXMA 4JXGA 4DE0A 5CGSA 3V50A 2Y91A 4M3KA 1W7FA 5CXWA 2ZLYA 2WKHA 1TVFA 1WYCA 1MWUA 3IXHA 4WMCD 5E2FA 1XA7A 1NZUA 3V3RA 3AGFA 4WZ5C 2X02A 1KE0A 2WGVA 4N9LA 3CZDA 4OQ0A 4OPYA 5DTSA 4S2NA 4R23A 4XXRA 3UNWA 3O87A 3LY4A 2OSUA 5FA7A 4KZAA 2PU2A 3UE3A 4KZ9A 1ONGA 2WGWA 1ESUA 1GHPA 4RVAA 4JBFA 3VP3A 4UA7A 2ZM2A 1IKIA 1PIOA 3UE1A 4KZ4A 1SDEA 2XFTA 5EPHA 4S2MA 1JTGA 1E3UA 1DJAA 1H5XA 2Z2MB 3ZG8B 4OQGA 3W4PA 2EXBA 1NJ4A 4OQIA 4OOMA 2V2FF 1L2SA 4RYEA 2Y2JA 1JVJA 3HLFA 4K91A 5FATA 3ZCZA 2Y2PA 3PAGA 5GHZA 2WYXA 5CHJA 1TEMA 2JCHA 3BFGA 2ZM8A 2XDMA 4E3JA 1CEFA 1XGIA 4Y7PA 3UDFA 4JF6A 4EBPA 5FASA 4E6WA 1FSYA 3N8LA 3RXWA 3RXXA 4GZBA 2EX6A 4QY6A 1ZG4A 2XF3A 4E3IA 3IXBA 1BSGA 1YLYA 4YFMA 1I2WA 3V39A 3UO9A 4C75A 5CTMA 3UN7A 3GR2A 3A3IA 3Q7VA 4B4XA 4DE1A 3A3EA 4KENB 5A92A 3HVFA 2ZMAA 3P98A 4R3JA 1K55C 3HLDA 4KZBA 3ZFZA 5HAPA 1M6KA 1G68A 1SHVA 1ES3A 3A3FA 1PW8A 1DY6A 5CTNA 5E2HA 4ZJ3A 1MWRA 5EOOA 4KQQA 4PM8A 3C4PA 1ZG6A 2H0YA 5CECA 4N1XA 1YLPA 2HDUA 3SS3A 4OLGA 1K57C 2I72A 5E2GA 1GHIA 4KQOA 4C3QA 1LLBA 4OH0A 1PWGA 5FDHA 4FSFA 5FQIA 4ID4A 4X56A 4EUZA 2IWDA 4MLLA 2ZC5B 1O7EA 4QY5A 4BL2A 4N9KA 2JC7A 4OOLA 2R9WA 1IKGA 4R4RA 2C5WB 1GA9A 3I7JA 4K0WA 5E2EA 1IELA 5A90A 2A49A 3N4IA 4GD8A 4C6YA 1PZOA 5E43A 5KSCA 2ZC6B 3C5AA 2ZQAA 4MNRA 4PMAA 4GNUA 4X68A 5CERA 3O3VA 1GCEA 3WRZA 2G2WA 4BLMA 3IWIA 3C7VA 1FOFA 1ZKJA 2H5SA 1TDGA 2ZQ8A 3UPNA 4DXCA 4QU3A 4U3TA 4S2LA 1QMFA 1HVBA 1K56D 4S2NC 2Y2KA 1ES2A 1IYPA 2ZC3B 2Y2QA 2XK1A 1FCOA 2Z2LB 4L0LA 4U0XA 5F82A 3ZDJA 1EROA 4OQHA 1RGYA 3Q1FA 3M2KA 3VP0A 1FR6A 2WKEA 3NY4A 3HBRA 1YQSA 3IH9A 4XUXA 4EWFA 2XFSA 5HW3A 2V1ZA 2QPNA 4BL3A 1KGEA 5GHXA 3GTCA 4X53A 1KGFA 4UHUA 3HUOA 3DTMA 3HUNA 1ES4A 5M1AA 1DJBA 5FSRA 4JF4A 5KMWA 3IHAA 2RL3A 4OP8A 4OPZA 4FH2A 4BJPA 4JXSA 3TG9A 3BEBA 4DE3A 3NIAA 4DRTA 4HEFA 2GDNA 4LCMA 5CHUA 4IVIA 1H8ZA 4KZ8A 4IBXA 4ZBEA 4LV0A 1BT5A 3EQVA 3VP4A 1XX2A 3WRTA 5BOHA 4RA7A 3S1YA 4S2OA 3GMWA 1K4EA 4WZ4A 3BECA 1BLSA 3ISGA 3WS5A 1BLHA 2QZ6A 4MBHA 2E8IA 1Z6FA 4WM9A 5F1FA 5FQQA 5EVLA 1AXBA 5DTTA 3GV9A 3NDEA 1KDSA 5EVIA 5JYPA 2EFXA 1YLZA 5J8XA 2WZXA 3BFCA 2Q9MA 1MBLA 2IWCA 3HLWA 5FQJA 1ZC2A 5FI6A 5CEDA 3OPHA 4E3OA 3M6HA 1BLPA 3LO7A 2XQZA 1YLJA 4KG6A 4PM9A 5D3OA 5FQMA 5EOEA 3W4QA 1NXYA 2J8YA 1W8QA 1K25A 1PI5A 4IVKA 3WS0A 1XPBA 1PWDA 3BFFA 3FYZA 1NRFA 4DDSA 2UWXA 2WAFA 2ZC7A 5AQ7A 3HREA 2IWBA 1PYYA 5TR7A 3TSGA 1E3UD 4KZ5A 4WEKA 3VOYA 1YMSA 3OC2A 2P9VB 3DW0A 5AQBA 4ZTKA 1KVLA 3BFEA 1W79A 3OZHA 4IEDA 3IF5A 1NYYA 4ZAMA 2BLSA 1XA1A 1EWZA 2Y2HA 4R1GA 3UY6A 1HZOA 5FQKA 3UE0A 1SCWA 3WWXA 1JWVA 1ES5A 3GSGA 1GA0A 3QNCA 5FI7A 3NDGA 1K6RA 5FQ9A 1MXOA 2Y2GA 4B88A 2Y2LA 4OPQA 1DJCA 3NBLA 5GHYA 4GD6A 1CI9A 1RCJA 4WBGA 4BQMA 1N9BA 4OPRA 1WYBA 3S22A 5F83A 4R0QA 4S2KA 1E4DA 2JBFA 5DF8A 5KZHA 3UDXA 3M6BA 3NI9A 4GKUA 4S2JA 1FQGA 1MWSA 1BZAA 4BD0A 5CEBA 4BD1A 4E3KA 2WGWB 4HBTA 1J9MA 4PPRA 5HL1A 4NETA 3MZFA 3RJUA 3QNBA 4F94A 4RX2A 4E3NA 3GVBA 1C3BA 1BUEA 1NY0A 3BM6A 3E2KA 1Y54A 3G4PA 2HDRA 3G34A 3ITBA
chains in the Genus database with same CATH superfamily
4JKTA 4DJ2A 1IOUA 2GX5A 3T12B 4UQIS 3G6OA 1OJ5A 3Q7VB 2Y2MA 1XJ3A 4MBKA 2XH9A 5KSHA 3SH7A 3BFDA 3NC8A 1L3LA 1PI4A 1NYMA 2EXAA 4WYYA 3MFXA 4QJGA 4P0MA 3CG5A 2EWVA 4K0XA 3PTEA 3QP8A 1LL9A 2HV1A 3VE4A 3WS2A 3HJIA 1YAXA 3IT9A 4NXBA 4UA6A 4LV1A 1IFQA 4Z1WA 1XGJA 3IF6A 1BULA 3S4XA 3O86A 1W8YA 2VGJA 1ZTUA 4Y0OA 1CQAA 4P6ZM 4N1HA 3UE6A 2HP6A 2ZM0A 1ONHA 5CHMA 2Z6CA 2XD1A 3SZTA 4OVDA 2PT7A 4GOGA 3HUMA 2DCFA 4EBNA 2WKQA 5EVID 3KX0X 4P6BA 4PM7A 1FCNA 3UPOA 4OKPA 3IXGA 1O07A 3UPPA 1PW1A 1SDNA 2PU4A 4N92A 5FI2A 4NXEA 3NHQA 3K2NA 5IHVA 4JPMA 3BLSA 1D06A 2QYBA 2CMNA 3G2YA 3KYZA 3WS1A 1HD8A 2H28A 4FCFA 1XKZA 3IX3A 1RGZA 1Z09A 2Y59A 2K2NA 2XLNA 4BBVA 1JTDA 1YT4A 2FH5A 3PBTA 3O88A 3LEZA 1LL5A 1YSQA 3IWOA 2XEPA 3ZG7B 3C7UA 3QP4A 5EM0A 3C4OA 3OPLA 4KZ3A 1JWZA 3KSHA 2PR5A 3BY9A 3HL9A 3LIFA 2Y4AA 4LRZE 2C6WB 3FKWA 2DNSA 1YLTA 3PR6A 4P85A 3FC7A 2VV8A 2ZMFA 3QHYA 4I3JA 5GL9A 4Y2FA 2Q9NA 5DF9A 2DMWA 2HP9A 2W1TA 5C5KA 4KG5A 5DFXA 4HI4A 5L09A 2XR0A 5FAOA 3FWLA 1MPLA 4U0TA 1S0WA 5EUAA 3PBQA 2P9VA 2J9PA 3H9WA 3UMEA 5FDSA 2H0TA 4DKIA 5U47A 5MC7A 2EX2A 2W3GA 1XXMA 4DE0A 3LICA 2ZLYA 1S4RA 1MWUA 5E2FA 3DBAA 3EGXC 4Y3IA 1KE0A 3T4KA 3CZDA 4OPYA 5IU1A 3UNWA 3LY4A 5FA7A 2XRNA 2PU2A 4HJ6A 1ONGA 2WGWA 1ESUA 4GW9A 2E8JA 1ACFA 5EPHA 2PBDP 4S2MA 2Z2MB 3NJAA 1NJ4A 4OQIA 2GZAA 3CHWP 1WA9A 3HLFA 4K91A 5FATA 3TE8A 3PAGA 4EUVA 5CHJA 3W2ZA 2M7UA 2ZM8A 2XDMA 5AVFA 1CEFA 2PR6A 4E3JA 3T50A 4HJ3A 4E6WA 1FSYA 3RTYA 3RXWA 2XF3A 1YLYA 3HJKA 3A3EA 3DTKA 2W0NA 4KZBA 3ZFZA 2I9VA 4GLQA 1M6KA 5FEFA 4NXFA 2JKTM 3A3FA 1NLYA 4X1LA 5E2HA 5TBMA 4KQQA 4PM8A 2P7JA 1XJ4A 3UMDA 1YLPA 1AWIA 2INWA 4KQOA 4ARZA 2VKSA 2PAVP 3F1OA 4C3QA 5J4EA 4EUZA 2IWDA 4N9KA 4R38A 4Y17A 5E2EA 1IELA 4HP9A 5E43A 4NKPA 2ZC6B 4MNRA 4GNUA 3LEQA 5HWVA 5KIZA 3WRZA 3C7VA 2ZQ8A 1K56D 1ES2A 2Y2QA 1EROA 3Q1FA 3VP0A 3KYQA 2D01A 3IH9A 3L7HA 4XUXA 4EWFA 5GHXA 4X53A 4F3LA 4CLCD 3MXQA 2EWWA 4K08A 2RL3A 4OPZA 4FH2A 4BJPA 4JXSA 3TG9A 4HEFA 2GDNA 4LCMA 3P7NA 1BT5A 5BOHA 1LSWA 1DP9A 1XX2A 4RA7A 2GJ3A 4R6LA 4S2OA 1K4EA 3BECA 1S66L 2E8IA 3NECA 1Z6FA 4ETXA 5FQQA 1AXBA 3NDEA 1YKDA 2EFXA 2WZXA 1MBLA 2IWCA 3LO7A 4KG6A 1V9ZA 2W27A 2D02A 2K31A 5FQMA 2J8YA 1W8QA 2B02A 4HQAA 1H8MA 3BFFA 5AQ7A 3HREA 3TSGA 4KZ5A 3P01A 2P9VB 4IEDA 3IF5A 2NUTC 1P9WA 2PD8A 4MN7A 3UE0A 1SCWA 3WWXA 5HL6A 5FQ9A 1OTDA 3NBLA 1OT9A 3EEHA 4R0QA 5KZHA 1E4DA 4S2JA 3NI9A 1V9YA 1MWSA 4BD0A 4E3KA 2WGWB 4YWZA 4NETA 3NULA 4E3NA 3GVBA 1BUEA 4PKYA 2K7SA 4ZDXA 2J9OA 4L9GA 4EQIA 5AVEA 1LI9A 3VP1A 3LI9A 3IH8A 3GECA 2VV7A 1JWPA 3PXPA 4EBLA 4WELA 4X1MA 3KSGA 3MZDA 4LCLA 2QWSA 4IUHA 5TBMB 3G2ZA 1OTAA 1LI0A 5EE8A 4WEJA 4ARZB 4QB8A 3F1OB 1HTZA 1VB6A 3SH9A 2W3DA 1Q2QA 3PHYA 3TOIA 5CGXA 3OPPA 3DWKA 5FAQA 5GLCA 4O7DA 4AFIA 1X0OA 1ERQA 4UQIM 1SKFA 2EX8A 3EQUA 3MQOA 2JKRM 2EX9A 4Y0TA 3A3JA 3U2AA 4G3KA 2WUQA 4KZ6A 3ZNTA 4I5SA 3CMZA 2A24A 5HARA 3A0SA 3MZEA 5HAIA 1LHYA 3ZG9B 1MKIA 4KUOA 3MXSA 1I2SA 2QMIA 5AJGA 2CC1A 4L9FA 3VV4A 2BG1A 4FH4A 2V8CA 4Y0UA 3E4PA 4A5RA 5F69A 3GQZA 3V5MA 5HDDA 4F3LB 2VGKA 3PYPA 5CX7A 2VGLM 3MFDA 5HAQA 2RCXA 4JGOA 3VSLA 4BWIA 2ZD8A 1K54C 1DRMA 3T1RA 2L1MA 4X6TA 5GLBA 2PHYA 4EV4A 3G30A 5GLDA 2XGNA 2W3HA 3LY3A 3OCLA 5I94A 2XD5A 4B93A 1LSVA 3ITAA 4GS9A 4CLCC 4Q0JA 2LB9A 1E25A 5JYOA 2KDKA 1NZOA 2NUPC 2ZQDA 3B47A 2QJ7A 3S7QA 2V9AA 2VLGA 3VMAA 3VSKA 2HPBA 5DTKA 4GDNA 2HP5A 2G7UA 2Q0OA 5A93A 3H82A 1H8YA 2J3TD 1PZPA 1N9NA 1IYOA 2J7VA 3UB5P 3CUEC 3PBNA 2HDQA 3ZVWA 3OCNA 4DDYA 3MBZA 1RP5A 4EETB 1K38A 1MY8A 1BLCA 1OMEA 1K6SA 1G28A 2JKRI 1PRQA 3N6IA 4X69A 3BQAA 3BYDA 4QD4A 1W5DA 4IBRA 1CI8A 3C8CA 1P97A 3ICYA 5A91A 2HGVA 5TJJA 4Z9QA 3BY8A 3LFVA 5AQAA 4JXGA 4GJ4A 4M3KA 4DN0A 1WYCA 4NXGA 1T1AA 2O9CA 4N9LA 4OQ0A 4FOFA 5A8BA 4XXRA 3LI8A 1GHPA 1IKIA 1PIOA 1DJAA 4OQGA 2W3FA 3W4PA 3LUQA 2EXBA 4LRYC 5HDSA 1L2SA 1LL8A 4RYEA 1JVJA 4HOIA 1TS6A 2WYXA 1MKMA 4HH2A 1XGIA 4EBPA 4QPRA 3OLOA 4E3IA 3IXBA 3UO9A 2A2LA 3GR2A 1J3WA 2Y8HA 3NOUC 4DE1A 4KENB 4H6JA 3HVFA 2ZMAA 3P98A 4R3JA 1K55C 5G4ZA 3HLDA 2HJEA 5HAPA 1G68A 1SHVA 1DY6A 4ZJ3A 3C4PA 5CECA 2A24B 4OLGA 2I72A 3CI6A 1GHIA 1F2KA 1T1BA 4OH0A 2PDRA 3MR0A 1H0MA 2XA7M 2ZC5B 1O7EA 4OOLA 4R4RA 2C5WB 1NRJA 3I7JA 5A90A 3N4IA 4GD8A 3T4LA 4C6YA 1HLUP 4HY8A 5CERA 2P04A 3TJZC 3IWIA 3TRCA 1FOFA 2H5SA 1TDGA 2M7VA 3QP6A 2O99A 2ZC3B 4L0LA 4U0XA 3CPTA 2QKPA 4R70A 1RGYA 4P6ZS 1VETA 2V1BA 4QWOA 4EXOA 3LR5A 2V1ZA 4BL3A 3KSFA 4GS9B 3DTMA 1ES4A 5M1AA 3IHAA 4DE3A 3NIAA 5CHUA 4IVIA 1H8ZA 4KZ8A 4ZBEA 3EQVA 3H82B 3GMWA 4WZ4A 1BLSA 4Y13A 3ISGA 1BLHA 3O5YA 4CLCE 2YKHA 5F1FA 4MCWA 3FPVA 4B9OA 3GV9A 1KDSA 5JYPA 1YLZA 5FI6A 5CEDA 4E3OA 2XQZA 4E04A 4Y15A 4JGQA 5EFWA 4BBTA 2PYPA 3W4QA 1NXYA 3S7OA 1K25A 3WS0A 5G4YA 5EVEA 3UB6A 3FYZA 2IWBA 1YMSA 3LR0A 1STZA 5AQBA 4ZTKA 3UB9A 3BFEA 2PD7A 2BLSA 1XA1A 3T4OA 3UY6A 2OWJA 5HWWA 1ES5A 3QNCA 3KYEA 3TW8A 4B88A 1GSXA 1N9BA 5F83A 3UDXA 4GKUA 4BD1A 3RJUA 4RX2A 5F6AA 1C3BA 2EA9A 1P9RA 1XJ6A 1Y54A 4EERA 3G34A 3ITBA 2J80A 3ZQ5A 3V67A 1IYSA 1KGGA 1L0FA 1SZVA 1K54A 2WGIA 4MN6A 5IS1A 5CGWA 3WS4A 2X71A 4H8RA 4I38A 4HBUA 1P0ZA 1L0EA 3PBOA 4R4SA 4WUJA 3FPWA 5HD3A 3FV7A 3CITA 1YMXA 3L9KA 4XUZA 2H10A 2FFFB 5M19A 4H6JB 3BQ8A 1NWZA 2WK0A 5EVIC 4OONA 4G3VA 3BW6A 4JGPA 4CLCA 2A3UA 5DF7A 4KQRA 3T4TA 1ZHHB 2J3WA 1UWNX 4YNRA 1ERMA 2YKFA 4WMCA 4D60A 3T4SA 3BWLA 2ZOIA 5HFOA 3UDIA 2VV6A 1ALQA 1KDWA 2KX6A 3FZCA 1S67L 1XFQA 1BTLA 3CUEA 4ME4A 3ZG0A 4KG2A 3AGDA 4G3WA 5L2FA 3KSIA 4OP5A 5DKKA 4FUWA 5LBRA 3FKVA 3JVVA 2JKTI 3CPTB 3R7WA 3N8SA 2WAEA 1VETB 5GLAA 2JKGA 4S2PA 3SH8A 3Q07A 1S4SA 4LRXC 3QP1A 3ZG5A 3H7WA 3CJMA 3GRJA 2VEAA 1K4FA 2Z6DA 3VP2A 2G2UA 3CLOA 3BRMA 1F5MA 4DXBA 5G18A 4BENA 4YINA 4GDBA 3VOZA 4XT2B 3OPRA 4MEZA 2PRFA 3PBSA 2BTFP 2W1RA 3NCKA 3E2LA 5CRFA 3D4FA 5HWTA 3ZGAB 3ZHHA 3HLGA 3MMHA 3SOIA 5DKLA 3IXDA 5HPIA 5L07A 4RX3A 3HLEA 5TFQA 2OV5A 3OBFA 4DE2A 3A3DA 5HX9A 1OTEA 3Q82A 2Y2OA 4QHCA 1F9IA 3PBRA 3S7NA 1DP8A 3T1XA 3LR4A 1K55A 1NLZA 1Q2PA 1XP4A 4NK3A 3Q81A 4R3BA 1KVMA 3N7WA 3BLMA 4L9EA 4WF0A 5FAPA 3RH8B 3SS5A 4D2OA 4HNBA 3DAVA 2V20A 1M40A 1N4OA 1GHMA 1MWTA 4JF5A 2O9AA 3AGEA 3VFFA 1W63Q 2ZL1A 3ZVTA 4ZJ1A 3IWQA 1YLWA 2PBYA 3ZNYA 1S6RA 2WKIA 3HLBA 1CEGA 1WE4A 4LPZA 3V50A 5CXWA 2WKHA 4I39A 1TVFA 1XA7A 4WZ5C 2X02A 2WGVA 5DTSA 3JPUA 3LGOA 3UE3A 3IS2B 2OOLA 4RVAA 3VP3A 3ZYTA 4MDZA 2XFTA 4WL9A 3EEAA 1E3UA 4EW7A 1K0KA 4OOMA 2L0WA 2W3EA 2HJ9C 4I3AA 4CLCB 2Y2JA 4Y5FA 2V8FA 3ZCZA 2KLIA 2Y2PA 5DJUA 3RXXA 4GZBA 2B95A 4QY6A 3SW1A 4YFMA 1I2WA 4C75A 5CTMA 3UN7A 2JKFA 3A3IA 5DFYA 5A92A 3VOLA 3QP5A 1ZG6A 2H0YA 2UV0E 1T19A 2HDUA 1K57C 5E2GA 3DTEA 3LIBA 2QJ5A 3T4QA 3R7WB 5FDHA 4FSFA 5FQIA 4X56A 3EOIA 1OTBA 1GA9A 1PZOA 2WKRA 4MN5A 3C5AA 2ZQAA 5FEGA 1Y4OA 3H7WB 1GCEA 2G2WA 4WLAA 3UPNA 4QU3A 4U3TA 4S2LA 1HVBA 4S2NC 2Y2KA 2XK1A 5F82A 1DP6A 4IHQA 1FR6A 3UB7A 4FTXA 5F5YA 3NY4A 3HBRA 2XFSA 1KGEA 4LLOB 1OT6A 3HUOA 3HUNA 2VX8A 1DJBA 4OP8A 3MS6A 2O0YA 3BEBA 4LFUA 3MQQA 4IBXA 4O01A 4LV0A 3VP4A 3S1YA 2VGLS 2HZ5A 3E4OA 4MBHA 4ETZA 5DTTA 3C30A 3T1QB 5EVIA 3D72A 3BFCA 1T18A 4HHDA 3OPHA 1F98A 4MMNA 4R3AA 4BMWA 3C2WA 1XFNA 4JGRA 5D3OA 3MQ0A 5J7EA 2OWHA 2P08A 1XPBA 1PWDA 1TS0A 4IUKA 4DDSA 2ZC7A 2VA0A 4WEKA 2OAQ1 3OC2A 2ZL1B 1KVLA 1W79A 3IBJA 4ZAMA 2Y2HA 1EWZA 1SKOB 5FQKA 1H3QA 3GSGA 5FI7A 1VEUB 1UWPX 2Y2GA 1GSWA 3E98A 4OPQA 2JN7A 4GD6A 1CI9A 4WBGA 4BQMA 1D1JA 2FZ0A 4S2KA 4O0PA 5DF8A 2KOIA 3GDIA 5CEBA 4PPRA 1J9MA 3LIDA 3MZFA 3QNBA 4F94A 1OJGA 4DMZA 4EEUA 3RFBA 3BM6A 3E2KA 3G4PA 3T4JA 3W4OA 2R9XA 3VFHA 1XJ2A 5K5BA 1IEMA 2QHKA 2ZQCA 4LENA 4JXWA 4GHIB 2B5RA 3IBRA 2JE5A 3MXRA 1ESIA 1LSXA 1IYQA 1EW0A 2WKPA 3IQAA 5L8MA 3N8RA 1UGUA 4B4ZA 5F1GA 1VM1A 1FCMA 3MKFA 1I5QA 1TS8A 1VHMA 1YM1A 5HD5A 1BYWA 2ZQ7A 1KOUA 3JYIA 4GN2A 4LV3A 3LYXA 3F1NA 3QP2A 1L0GA 3LCEA 2Y55A 4XT2A 1MZUA 3NOTC 4HIAA 2B18A 1TDLA 4P87A 3FG8A 1G6AA 3MKEA 4HESA 5DJTA 3P09A 2WZZA 3DWZA 3JVUA 4E3MA 4FD8A 4WN5A 1TD5A 5HZHA 3IHBA 2HDSA 5TGFA 4II7A 4KZ7A 3M2JA 4LV2A 1FR1A 3C38A 4EEPA 2Y2NA 4ZJ2A 3LIAA 2J3TC 2EFUA 1TS7A 3F1PA 2XROA 3G32A 3T1SA 1T1CA 3S7PA 4GB7A 4IJGA 5EM1A 2ZQ9A 3HLCA 3PAEA 2JHEA 1CF0A 2XA7S 4JLFA 4JXVA 3SS4A 4MBFA 1G5UA 4CJNA 4WZ5A 2ZC4B 2WADA 4X25A 1YPRA 3G31A 2ZJ9A 4OLDA 3IF6B 2OLUA 5DVAA 1QMEA 5EVIB 2VK3A 1PWCA 3CAXA 3W8KA 3EGDC 4DF6A 4EESA 3Q7ZA 1KE3A 4S2IA 4E6XA 4ZRRA 2R78A 5L10A 1G6OA 3E0YA 4PHTA 2P74A 5F68A 1S1YA 2GNXA 1K56A 2Y2IA 1Y28A 1U60A 1KE4A 4X55A 3B3XA 1L0DA 3DTIA 3IS2A 3IF6C 5M18A 1CK3A 4UA9A 3BJNA 3CWFA 2L4RA 1FILA 1VQQA 2ACGA 3G35A 3D9YA 3LR3A 2OAP1 4OOYA 1GSVA 2ZBBA 5EV0A 5EECA 4PM6A 4Q8IA 5I5LA 4EQ1A 1K57A 4NEED 2DRWA 3A0RA 4UEYA 2BASA 4Q0HA 2X01A 3V3SA 1FSWA 1EI5A 1OPXA 1PFLA 2V0WA 2OLVA 4CPKA 5AQ9A 2FFYA 4PM5A 3MJQA 4UAAA 1A0KA 4E3LA 5J3WA 5CGSA 4DJ3A 2O9BA 2Y91A 2ZMVA 1W7FA 3MF0A 3IXHA 4WMCD 1NZUA 3V3RA 3D3OA 3AGFA 2M1CA 4S2NA 4R23A 4PAUA 3O87A 2OSUA 4KZAA 4KZ9A 4JBFA 4UA7A 2ZM2A 3UE1A 4KZ4A 1SDEA 1JTGA 1H5XA 3ZG8B 2V2FF 1LT0A 5GHZA 2W1TB 1TEMA 2JCHA 3BFGA 2IA2A 3MSHA 4Y7PA 3UDFA 4JF6A 5FASA 3N8LA 2EX6A 1ZG4A 1BSGA 3F1NB 3V39A 3Q7VA 4B4XA 1N9OA 3KO6A 1ES3A 1OTIA 1PW8A 5HSQA 4HJ4A 5CTNA 3R4KA 1MWRA 5EOOA 2XSSA 4N1XA 3SS3A 2PYRA 2VZWA 1LLBA 1PWGA 2VJWA 4ID4A 4MLLA 3IX8A 4QY5A 4BL2A 2JC7A 2R9WA 1IKGA 4KUKA 3F1PB 1JNUA 4BBUA 4K0WA 4HH3A 3UB8A 2A49A 3K3CA 5KSCA 4CQHA 4YOFA 4PMAA 2V1AA 4X68A 3O3VA 4BLMA 1ZKJA 5HPFA 4PKYG 4DXCA 3NOPC 1QMFA 4Q0IA 1IYPA 3ZDJA 1FCOA 2Z2LB 4OQHA 3M2KA 4M4XA 2WKEA 3E4QA 1YQSA 5HW3A 2QPNA 3GTCA 3IX4A 1KGFA 4UHUA 5FSRA 4JF4A 1TF1A 5KMWA 1SKOA 4HP4A 4DRTA 1VEUA 2HF6A 2ZOHA 3WRTA 3ULFA 3OOVA 3EWKA 1CJFA 3WS5A 2QZ6A 4EU0A 4WM9A 5EVLA 4KQDA 5J8XA 2MJ6A 2Q9MA 3HLWA 1W63M 4NG2A 5FQJA 1ZC2A 1ODVA 3LIEA 3M6HA 1BLPA 1YLJA 2V0UA 4PM9A 5EOEA 4RQ9A 1PI5A 4IVKA 1FIKA 1D7EA 1NRFA 2UWXA 2WAFA 1PYYA 5TR7A 1E3UD 3VOYA 4GHIA 3DW0A 5IT5A 1S1ZA 3U4LP 3A0VA 3OZHA 1NYYA 4GCZA 5FL3A 4R1GA 1HZOA 3VE3A 1JWVA 3K3DA 1GA0A 3NDGA 1N9LA 1K6RA 1MXOA 2Y2LA 3HCYA 1DJCA 5GHYA 1RCJA 3B42A 4OPRA 1WYBA 3S22A 2LB5A 2JBFA 4LGWA 3M6BA 2AVXA 1FQGA 1BZAA 4ESPA 4I3IA 4HBTA 5HL1A 2Y79A 1YSPA 5HDCA 4O8GA 1NY0A 3B33A 1PNEA 1MC0A 2HDRA
chains in the Genus database with same CATH topology
4JKTA 4ZDXA 1IYSA 1KGGA 2J9OA 1L0FA 3W4OA 1K54A 2WGIA 5CGWA 3WS4A 2X71A 4H8RA 2R9XA 3VFHA 4HBUA 4EQIA 1IEMA 1L0EA 2ZQCA 4LENA 3PBOA 4R4SA 1LI9A 3FV7A 4JXWA 2B5RA 3VP1A 2JE5A 3MXRA 1ESIA 1YMXA 3IH8A 4XUZA 2H10A 3Q7VB 2Y2MA 2FFFB 1IYQA 4MBKA 5M19A 2XH9A 5KSHA 3SH7A 1JWPA 2WK0A 4EBLA 5EVIC 4WELA 3BFDA 3NC8A 4OONA 3IQAA 3N8RA 3MZDA 4LCLA 1PI4A 1NYMA 2A3UA 4B4ZA 2EXAA 5DF7A 4WYYA 3G2ZA 4QJGA 4KQRA 4P0MA 1VM1A 5F1GA 1FCMA 3MKFA 1LI0A 3CG5A 1I5QA 5EE8A 4WEJA 4QB8A 1ERMA 4K0XA 3PTEA 1YM1A 1HTZA 4WMCA 3SH9A 1LL9A 2ZQ7A 1Q2QA 3JYIA 4GN2A 3TOIA 5CGXA 5HFOA 3UDIA 3OPPA 3DWKA 3WS2A 1ALQA 5FAQA 3IT9A 1KDWA 4LV3A 5GLCA 4UA6A 1L0GA 3LCEA 4LV1A 3FZCA 4O7DA 1XGJA 2Y55A 3IF6A 1BULA 3S4XA 1BTLA 1ERQA 3O86A 1TDLA 1W8YA 2VGJA 1SKFA 4P87A 2EX8A 3ZG0A 4KG2A 4Y0OA 3EQUA 1G6AA 3MKEA 3AGDA 4HESA 2EX9A 4N1HA 3A3JA 4Y0TA 3P09A 5L2FA 2WZZA 2WUQA 4KZ6A 2HP6A 3DWZA 3ZNTA 4OP5A 4E3MA 4FD8A 2ZM0A 1ONHA 5CHMA 3CMZA 5HARA 3MZEA 5HAIA 1LHYA 3ZG9B 1MKIA 3FKVA 2XD1A 3MXSA 3IHBA 2HDSA 4OVDA 5TGFA 1I2SA 4KZ7A 2QMIA 3M2JA 4LV2A 1FR1A 2CC1A 3N8SA 4GOGA 2WAEA 2BG1A 3HUMA 4FH4A 5GLAA 2Y2NA 4ZJ2A 2DCFA 4Y0UA 4EBNA 4A5RA 5EVID 2EFUA 3GQZA 4S2PA 3SH8A 3V5MA 3Q07A 3G32A 4P6BA 4PM7A 1FCNA 3UPOA 2VGKA 5HAQA 3MFDA 2RCXA 4GB7A 3IXGA 4OKPA 2ZQ9A 3HLCA 3PAEA 3VSLA 1O07A 3UPPA 1PW1A 3ZG5A 3CJMA 3GRJA 2ZD8A 1K54C 1SDNA 2PU4A 4JLFA 4JXVA 3SS4A 4N92A 4MBFA 5FI2A 4CJNA 4WZ5A 5IHVA 4JPMA 1K4FA 3BLSA 2ZC4B 3VP2A 2G2UA 4X6TA 2WADA 3G2YA 3WS1A 5GLBA 1HD8A 3BRMA 4DXBA 3G31A 4EV4A 4FCFA 2ZJ9A 4OLDA 5G18A 4YINA 4BENA 1XKZA 4GDBA 3VOZA 3G30A 5GLDA 1RGZA 3IF6B 2XGNA 2OLUA 3OPRA 3LY3A 3OCLA 5DVAA 4MEZA 5I94A 3PBSA 1QMEA 2Y59A 2XD5A 3NCKA 2XLNA 5EVIB 3ITAA 1JTDA 1YT4A 1PWCA 3W8KA 3E2LA 5CRFA 3D4FA 3PBTA 3O88A 4DF6A 3LEZA 1E25A 5JYOA 3Q7ZA 1KE3A 4S2IA 1LL5A 4E6XA 3ZGAB 1NZOA 3ZHHA 2ZQDA 3HLGA 3SOIA 3VMAA 3VSKA 2HPBA 5DTKA 4GDNA 3IWOA 2XEPA 3ZG7B 3IXDA 2HP5A 3C7UA 4RX3A 2P74A 3C4OA 3OPLA 4KZ3A 3HLEA 5A93A 5TFQA 1JWZA 1K56A 2Y2IA 2OV5A 4DE2A 1H8YA 1U60A 1KE4A 4X55A 3B3XA 1L0DA 3A3DA 3HL9A 5HX9A 3Q82A 1PZPA 2Y2OA 2Y4AA 3IF6C 1IYOA 2J7VA 5M18A 4QHCA 3PBNA 3PBRA 2HDQA 3ZVWA 1CK3A 4UA9A 2C6WB 3FKWA 3OCNA 4DDYA 3MBZA 1RP5A 2DNSA 1K38A 1K55A 1VQQA 1MY8A 1YLTA 1Q2PA 3G35A 4P85A 1BLCA 1XP4A 3QHYA 4OOYA 5GL9A 4NK3A 1OMEA 3Q81A 4R3BA 1K6SA 1KVMA 2Q9NA 3N7WA 3BLMA 5DF9A 5EECA 4PM6A 4Q8IA 5FAPA 2HP9A 1K57A 3N6IA 4KG5A 4X69A 3SS5A 3BYDA 4D2OA 2DRWA 4QD4A 1W5DA 4IBRA 2V20A 1CI8A 2XR0A 5FAOA 2X01A 3FWLA 3V3SA 1MPLA 1M40A 1FSWA 1EI5A 1N4OA 1GHMA 1MWTA 4U0TA 4JF5A 1S0WA 3AGEA 5A91A 5EUAA 3PBQA 3VFFA 3ZVTA 2P9VA 4ZJ1A 2J9PA 3IWQA 1YLWA 2H0TA 4DKIA 2OLVA 2PBYA 5U47A 3ZNYA 4CPKA 5AQ9A 1S6RA 2WKIA 3HLBA 2FFYA 4PM5A 4Z9QA 1CEGA 4UAAA 4E3LA 1WE4A 2EX2A 5AQAA 1XXMA 4JXGA 4DE0A 5CGSA 3V50A 2Y91A 4M3KA 1W7FA 5CXWA 2ZLYA 2WKHA 1TVFA 1WYCA 1MWUA 3IXHA 4WMCD 5E2FA 1XA7A 1NZUA 3V3RA 3AGFA 4WZ5C 2X02A 1KE0A 2WGVA 4N9LA 3CZDA 4OQ0A 4OPYA 5DTSA 4S2NA 4R23A 4XXRA 3UNWA 3O87A 3LY4A 2OSUA 5FA7A 4KZAA 2PU2A 3UE3A 4KZ9A 1ONGA 2WGWA 1ESUA 1GHPA 4RVAA 4JBFA 3VP3A 4UA7A 2ZM2A 1IKIA 1PIOA 3UE1A 4KZ4A 1SDEA 2XFTA 5EPHA 4S2MA 1JTGA 1E3UA 1DJAA 1H5XA 2Z2MB 3ZG8B 4OQGA 3W4PA 2EXBA 1NJ4A 4OQIA 4OOMA 2V2FF 1L2SA 4RYEA 2Y2JA 1JVJA 3HLFA 4K91A 5FATA 3ZCZA 2Y2PA 3PAGA 5GHZA 2WYXA 5CHJA 1TEMA 2JCHA 3BFGA 2ZM8A 2XDMA 4E3JA 1CEFA 1XGIA 4Y7PA 3UDFA 4JF6A 4EBPA 5FASA 4E6WA 1FSYA 3N8LA 3RXWA 3RXXA 4GZBA 2EX6A 4QY6A 1ZG4A 2XF3A 4E3IA 3IXBA 1BSGA 1YLYA 4YFMA 1I2WA 3V39A 3UO9A 4C75A 5CTMA 3UN7A 3GR2A 3A3IA 3Q7VA 4B4XA 4DE1A 3A3EA 4KENB 5A92A 3HVFA 2ZMAA 3P98A 4R3JA 1K55C 3HLDA 4KZBA 3ZFZA 5HAPA 1M6KA 1G68A 1SHVA 1ES3A 3A3FA 1PW8A 1DY6A 5CTNA 5E2HA 4ZJ3A 1MWRA 5EOOA 4KQQA 4PM8A 3C4PA 1ZG6A 2H0YA 5CECA 4N1XA 1YLPA 2HDUA 3SS3A 4OLGA 1K57C 2I72A 5E2GA 1GHIA 4KQOA 4C3QA 1LLBA 4OH0A 1PWGA 5FDHA 4FSFA 5FQIA 4ID4A 4X56A 4EUZA 2IWDA 4MLLA 2ZC5B 1O7EA 4QY5A 4BL2A 4N9KA 2JC7A 4OOLA 2R9WA 1IKGA 4R4RA 2C5WB 1GA9A 3I7JA 4K0WA 5E2EA 1IELA 5A90A 2A49A 3N4IA 4GD8A 4C6YA 1PZOA 5E43A 5KSCA 2ZC6B 3C5AA 2ZQAA 4MNRA 4PMAA 4GNUA 4X68A 5CERA 3O3VA 1GCEA 3WRZA 2G2WA 4BLMA 3IWIA 3C7VA 1FOFA 1ZKJA 2H5SA 1TDGA 2ZQ8A 3UPNA 4DXCA 4QU3A 4U3TA 4S2LA 1QMFA 1HVBA 1K56D 4S2NC 2Y2KA 1ES2A 1IYPA 2ZC3B 2Y2QA 2XK1A 1FCOA 2Z2LB 4L0LA 4U0XA 5F82A 3ZDJA 1EROA 4OQHA 1RGYA 3Q1FA 3M2KA 3VP0A 1FR6A 2WKEA 3NY4A 3HBRA 1YQSA 3IH9A 4XUXA 4EWFA 2XFSA 5HW3A 2V1ZA 2QPNA 4BL3A 1KGEA 5GHXA 3GTCA 4X53A 1KGFA 4UHUA 3HUOA 3DTMA 3HUNA 1ES4A 5M1AA 1DJBA 5FSRA 4JF4A 5KMWA 3IHAA 2RL3A 4OP8A 4OPZA 4FH2A 4BJPA 4JXSA 3TG9A 3BEBA 4DE3A 3NIAA 4DRTA 4HEFA 2GDNA 4LCMA 5CHUA 4IVIA 1H8ZA 4KZ8A 4IBXA 4ZBEA 4LV0A 1BT5A 3EQVA 3VP4A 1XX2A 3WRTA 5BOHA 4RA7A 3S1YA 4S2OA 3GMWA 1K4EA 4WZ4A 3BECA 1BLSA 3ISGA 3WS5A 1BLHA 2QZ6A 4MBHA 2E8IA 1Z6FA 4WM9A 5F1FA 5FQQA 5EVLA 1AXBA 5DTTA 3GV9A 3NDEA 1KDSA 5EVIA 5JYPA 2EFXA 1YLZA 5J8XA 2WZXA 3BFCA 2Q9MA 1MBLA 2IWCA 3HLWA 5FQJA 1ZC2A 5FI6A 5CEDA 3OPHA 4E3OA 3M6HA 1BLPA 3LO7A 2XQZA 1YLJA 4KG6A 4PM9A 5D3OA 5FQMA 5EOEA 3W4QA 1NXYA 2J8YA 1W8QA 1K25A 1PI5A 4IVKA 3WS0A 1XPBA 1PWDA 3BFFA 3FYZA 1NRFA 4DDSA 2UWXA 2WAFA 2ZC7A 5AQ7A 3HREA 2IWBA 1PYYA 5TR7A 3TSGA 1E3UD 4KZ5A 4WEKA 3VOYA 1YMSA 3OC2A 2P9VB 3DW0A 5AQBA 4ZTKA 1KVLA 3BFEA 1W79A 3OZHA 4IEDA 3IF5A 1NYYA 4ZAMA 2BLSA 1XA1A 1EWZA 2Y2HA 4R1GA 3UY6A 1HZOA 5FQKA 3UE0A 1SCWA 3WWXA 1JWVA 1ES5A 3GSGA 1GA0A 3QNCA 5FI7A 3NDGA 1K6RA 5FQ9A 1MXOA 2Y2GA 4B88A 2Y2LA 4OPQA 1DJCA 3NBLA 5GHYA 4GD6A 1CI9A 1RCJA 4WBGA 4BQMA 1N9BA 4OPRA 1WYBA 3S22A 5F83A 4R0QA 4S2KA 1E4DA 2JBFA 5DF8A 5KZHA 3UDXA 3M6BA 3NI9A 4GKUA 4S2JA 1FQGA 1MWSA 1BZAA 4BD0A 5CEBA 4BD1A 4E3KA 2WGWB 4HBTA 1J9MA 4PPRA 5HL1A 4NETA 3MZFA 3RJUA 3QNBA 4F94A 4RX2A 4E3NA 3GVBA 1C3BA 1BUEA 1NY0A 3BM6A 3E2KA 1Y54A 3G4PA 2HDRA 3G34A 3ITBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKT A;  4ZDX A;  1IYS A;  1KGG A;  2J9O A;  1L0F A;  3W4O A;  1K54 A;  2WGI A;  5CGW A;  3WS4 A;  2X71 A;  4H8R A;  2R9X A;  3VFH A;  4HBU A;  4EQI A;  1IEM A;  1L0E A;  2ZQC A;  4LEN A;  3PBO A;  4R4S A;  1LI9 A;  3FV7 A;  4JXW A;  2B5R A;  3VP1 A;  2JE5 A;  3MXR A;  1ESI A;  1YMX A;  3IH8 A;  4XUZ A;  2H10 A;  3Q7V B;  2Y2M A;  2FFF B;  1IYQ A;  4MBK A;  5M19 A;  2XH9 A;  5KSH A;  3SH7 A;  1JWP A;  2WK0 A;  4EBL A;  5EVI C;  4WEL A;  3BFD A;  3NC8 A;  4OON A;  3IQA A;  3N8R A;  3MZD A;  4LCL A;  1PI4 A;  1NYM A;  2A3U A;  4B4Z A;  2EXA A;  5DF7 A;  4WYY A;  3G2Z A;  4QJG A;  4KQR A;  4P0M A;  1VM1 A;  5F1G A;  1FCM A;  3MKF A;  1LI0 A;  3CG5 A;  1I5Q A;  5EE8 A;  4WEJ A;  4QB8 A;  1ERM A;  4K0X A;  3PTE A;  1YM1 A;  1HTZ A;  4WMC A;  3SH9 A;  1LL9 A;  2ZQ7 A;  1Q2Q A;  3JYI A;  4GN2 A;  3TOI A;  5CGX A;  5HFO A;  3UDI A;  3OPP A;  3DWK A;  3WS2 A;  1ALQ A;  5FAQ A;  3IT9 A;  1KDW A;  4LV3 A;  5GLC A;  4UA6 A;  1L0G A;  3LCE A;  4LV1 A;  3FZC A;  4O7D A;  1XGJ A;  2Y55 A;  3IF6 A;  1BUL A;  3S4X A;  1BTL A;  1ERQ A;  3O86 A;  1TDL A;  1W8Y A;  2VGJ A;  1SKF A;  4P87 A;  2EX8 A;  3ZG0 A;  4KG2 A;  4Y0O A;  3EQU A;  1G6A A;  3MKE A;  3AGD A;  4HES A;  2EX9 A;  4N1H A;  3A3J A;  4Y0T A;  3P09 A;  5L2F A;  2WZZ A;  2WUQ A;  4KZ6 A;  2HP6 A;  3DWZ A;  3ZNT A;  4OP5 A;  4E3M A;  4FD8 A;  2ZM0 A;  1ONH A;  5CHM A;  3CMZ A;  5HAR A;  3MZE A;  5HAI A;  1LHY A;  3ZG9 B;  1MKI A;  3FKV A;  2XD1 A;  3MXS A;  3IHB A;  2HDS A;  4OVD A;  5TGF A;  1I2S A;  4KZ7 A;  2QMI A;  3M2J A;  4LV2 A;  1FR1 A;  2CC1 A;  3N8S A;  4GOG A;  2WAE A;  2BG1 A;  3HUM A;  4FH4 A;  5GLA A;  2Y2N A;  4ZJ2 A;  2DCF A;  4Y0U A;  4EBN A;  4A5R A;  5EVI D;  2EFU A;  3GQZ A;  4S2P A;  3SH8 A;  3V5M A;  3Q07 A;  3G32 A;  4P6B A;  4PM7 A;  1FCN A;  3UPO A;  2VGK A;  5HAQ A;  3MFD A;  2RCX A;  4GB7 A;  3IXG A;  4OKP A;  2ZQ9 A;  3HLC A;  3PAE A;  3VSL A;  1O07 A;  3UPP A;  1PW1 A;  3ZG5 A;  3CJM A;  3GRJ A;  2ZD8 A;  1K54 C;  1SDN A;  2PU4 A;  4JLF A;  4JXV A;  3SS4 A;  4N92 A;  4MBF A;  5FI2 A;  4CJN A;  4WZ5 A;  5IHV A;  4JPM A;  1K4F A;  3BLS A;  2ZC4 B;  3VP2 A;  2G2U A;  4X6T A;  2WAD A;  3G2Y A;  3WS1 A;  5GLB A;  1HD8 A;  3BRM A;  4DXB A;  3G31 A;  4EV4 A;  4FCF A;  2ZJ9 A;  4OLD A;  5G18 A;  4YIN A;  4BEN A;  1XKZ A;  4GDB A;  3VOZ A;  3G30 A;  5GLD A;  1RGZ A;  3IF6 B;  2XGN A;  2OLU A;  3OPR A;  3LY3 A;  3OCL A;  5DVA A;  4MEZ A;  5I94 A;  3PBS A;  1QME A;  2Y59 A;  2XD5 A;  3NCK A;  2XLN A;  5EVI B;  3ITA A;  1JTD A;  1YT4 A;  1PWC A;  3W8K A;  3E2L A;  5CRF A;  3D4F A;  3PBT A;  3O88 A;  4DF6 A;  3LEZ A;  1E25 A;  5JYO A;  3Q7Z A;  1KE3 A;  4S2I A;  1LL5 A;  4E6X A;  3ZGA B;  1NZO A;  3ZHH A;  2ZQD A;  3HLG A;  3SOI A;  3VMA A;  3VSK A;  2HPB A;  5DTK A;  4GDN A;  3IWO A;  2XEP A;  3ZG7 B;  3IXD A;  2HP5 A;  3C7U A;  4RX3 A;  2P74 A;  3C4O A;  3OPL A;  4KZ3 A;  3HLE A;  5A93 A;  5TFQ A;  1JWZ A;  1K56 A;  2Y2I A;  2OV5 A;  4DE2 A;  1H8Y A;  1U60 A;  1KE4 A;  4X55 A;  3B3X A;  1L0D A;  3A3D A;  3HL9 A;  5HX9 A;  3Q82 A;  1PZP A;  2Y2O A;  2Y4A A;  3IF6 C;  1IYO A;  2J7V A;  5M18 A;  4QHC A;  3PBN A;  3PBR A;  2HDQ A;  3ZVW A;  1CK3 A;  4UA9 A;  2C6W B;  3FKW A;  3OCN A;  4DDY A;  3MBZ A;  1RP5 A;  2DNS A;  1K38 A;  1K55 A;  1VQQ A;  1MY8 A;  1YLT A;  1Q2P A;  3G35 A;  4P85 A;  1BLC A;  1XP4 A;  3QHY A;  4OOY A;  5GL9 A;  4NK3 A;  1OME A;  3Q81 A;  4R3B A;  1K6S A;  1KVM A;  2Q9N A;  3N7W A;  3BLM A;  5DF9 A;  5EEC A;  4PM6 A;  4Q8I A;  5FAP A;  2HP9 A;  1K57 A;  3N6I A;  4KG5 A;  4X69 A;  3SS5 A;  3BYD A;  4D2O A;  2DRW A;  4QD4 A;  1W5D A;  4IBR A;  2V20 A;  1CI8 A;  2XR0 A;  5FAO A;  2X01 A;  3FWL A;  3V3S A;  1MPL A;  1M40 A;  1FSW A;  1EI5 A;  1N4O A;  1GHM A;  1MWT A;  4U0T A;  4JF5 A;  1S0W A;  3AGE A;  5A91 A;  5EUA A;  3PBQ A;  3VFF A;  3ZVT A;  2P9V A;  4ZJ1 A;  2J9P A;  3IWQ A;  1YLW A;  2H0T A;  4DKI A;  2OLV A;  2PBY A;  5U47 A;  3ZNY A;  4CPK A;  5AQ9 A;  1S6R A;  2WKI A;  3HLB A;  2FFY A;  4PM5 A;  4Z9Q A;  1CEG A;  4UAA A;  4E3L A;  1WE4 A;  2EX2 A;  5AQA A;  1XXM A;  4JXG A;  4DE0 A;  5CGS A;  3V50 A;  2Y91 A;  4M3K A;  1W7F A;  5CXW A;  2ZLY A;  2WKH A;  1TVF A;  1WYC A;  1MWU A;  3IXH A;  4WMC D;  5E2F A;  1XA7 A;  1NZU A;  3V3R A;  3AGF A;  4WZ5 C;  2X02 A;  1KE0 A;  2WGV A;  4N9L A;  3CZD A;  4OQ0 A;  4OPY A;  5DTS A;  4S2N A;  4R23 A;  4XXR A;  3UNW A;  3O87 A;  3LY4 A;  2OSU A;  5FA7 A;  4KZA A;  2PU2 A;  3UE3 A;  4KZ9 A;  1ONG A;  2WGW A;  1ESU A;  1GHP A;  4RVA A;  4JBF A;  3VP3 A;  4UA7 A;  2ZM2 A;  1IKI A;  1PIO A;  3UE1 A;  4KZ4 A;  1SDE A;  2XFT A;  5EPH A;  4S2M A;  1JTG A;  1E3U A;  1DJA A;  1H5X A;  2Z2M B;  3ZG8 B;  4OQG A;  3W4P A;  2EXB A;  1NJ4 A;  4OQI A;  4OOM A;  2V2F F;  1L2S A;  4RYE A;  2Y2J A;  1JVJ A;  3HLF A;  4K91 A;  5FAT A;  3ZCZ A;  2Y2P A;  3PAG A;  5GHZ A;  2WYX A;  5CHJ A;  1TEM A;  2JCH A;  3BFG A;  2ZM8 A;  2XDM A;  4E3J A;  1CEF A;  1XGI A;  4Y7P A;  3UDF A;  4JF6 A;  4EBP A;  5FAS A;  4E6W A;  1FSY A;  3N8L A;  3RXW A;  3RXX A;  4GZB A;  2EX6 A;  4QY6 A;  1ZG4 A;  2XF3 A;  4E3I A;  3IXB A;  1BSG A;  1YLY A;  4YFM A;  1I2W A;  3V39 A;  3UO9 A;  4C75 A;  5CTM A;  3UN7 A;  3GR2 A;  3A3I A;  3Q7V A;  4B4X A;  4DE1 A;  3A3E A;  4KEN B;  5A92 A;  3HVF A;  2ZMA A;  3P98 A;  4R3J A;  1K55 C;  3HLD A;  4KZB A;  3ZFZ A;  5HAP A;  1M6K A;  1G68 A;  1SHV A;  1ES3 A;  3A3F A;  1PW8 A;  1DY6 A;  5CTN A;  5E2H A;  4ZJ3 A;  1MWR A;  5EOO A;  4KQQ A;  4PM8 A;  3C4P A;  1ZG6 A;  2H0Y A;  5CEC A;  4N1X A;  1YLP A;  2HDU A;  3SS3 A;  4OLG A;  1K57 C;  2I72 A;  5E2G A;  1GHI A;  4KQO A;  4C3Q A;  1LLB A;  4OH0 A;  1PWG A;  5FDH A;  4FSF A;  5FQI A;  4ID4 A;  4X56 A;  4EUZ A;  2IWD A;  4MLL A;  2ZC5 B;  1O7E A;  4QY5 A;  4BL2 A;  4N9K A;  2JC7 A;  4OOL A;  2R9W A;  1IKG A;  4R4R A;  2C5W B;  1GA9 A;  3I7J A;  4K0W A;  5E2E A;  1IEL A;  5A90 A;  2A49 A;  3N4I A;  4GD8 A;  4C6Y A;  1PZO A;  5E43 A;  5KSC A;  2ZC6 B;  3C5A A;  2ZQA A;  4MNR A;  4PMA A;  4GNU A;  4X68 A;  5CER A;  3O3V A;  1GCE A;  3WRZ A;  2G2W A;  4BLM A;  3IWI A;  3C7V A;  1FOF A;  1ZKJ A;  2H5S A;  1TDG A;  2ZQ8 A;  3UPN A;  4DXC A;  4QU3 A;  4U3T A;  4S2L A;  1QMF A;  1HVB A;  1K56 D;  4S2N C;  2Y2K A;  1ES2 A;  1IYP A;  2ZC3 B;  2Y2Q A;  2XK1 A;  1FCO A;  2Z2L B;  4L0L A;  4U0X A;  5F82 A;  3ZDJ A;  1ERO A;  4OQH A;  1RGY A;  3Q1F A;  3M2K A;  3VP0 A;  1FR6 A;  2WKE A;  3NY4 A;  3HBR A;  1YQS A;  3IH9 A;  4XUX A;  4EWF A;  2XFS A;  5HW3 A;  2V1Z A;  2QPN A;  4BL3 A;  1KGE A;  5GHX A;  3GTC A;  4X53 A;  1KGF A;  4UHU A;  3HUO A;  3DTM A;  3HUN A;  1ES4 A;  5M1A A;  1DJB A;  5FSR A;  4JF4 A;  5KMW A;  3IHA A;  2RL3 A;  4OP8 A;  4OPZ A;  4FH2 A;  4BJP A;  4JXS A;  3TG9 A;  3BEB A;  4DE3 A;  3NIA A;  4DRT A;  4HEF A;  2GDN A;  4LCM A;  5CHU A;  4IVI A;  1H8Z A;  4KZ8 A;  4IBX A;  4ZBE A;  4LV0 A;  1BT5 A;  3EQV A;  3VP4 A;  1XX2 A;  3WRT A;  5BOH A;  4RA7 A;  3S1Y A;  4S2O A;  3GMW A;  1K4E A;  4WZ4 A;  3BEC A;  1BLS A;  3ISG A;  3WS5 A;  1BLH A;  2QZ6 A;  4MBH A;  2E8I A;  1Z6F A;  4WM9 A;  5F1F A;  5FQQ A;  5EVL A;  1AXB A;  5DTT A;  3GV9 A;  3NDE A;  1KDS A;  5EVI A;  5JYP A;  2EFX A;  1YLZ A;  5J8X A;  2WZX A;  3BFC A;  2Q9M A;  1MBL A;  2IWC A;  3HLW A;  5FQJ A;  1ZC2 A;  5FI6 A;  5CED A;  3OPH A;  4E3O A;  3M6H A;  1BLP A;  3LO7 A;  2XQZ A;  1YLJ A;  4KG6 A;  4PM9 A;  5D3O A;  5FQM A;  5EOE A;  3W4Q A;  1NXY A;  2J8Y A;  1W8Q A;  1K25 A;  1PI5 A;  4IVK A;  3WS0 A;  1XPB A;  1PWD A;  3BFF A;  3FYZ A;  1NRF A;  4DDS A;  2UWX A;  2WAF A;  2ZC7 A;  5AQ7 A;  3HRE A;  2IWB A;  1PYY A;  5TR7 A;  3TSG A;  1E3U D;  4KZ5 A;  4WEK A;  3VOY A;  1YMS A;  3OC2 A;  2P9V B;  3DW0 A;  5AQB A;  4ZTK A;  1KVL A;  3BFE A;  1W79 A;  3OZH A;  4IED A;  3IF5 A;  1NYY A;  4ZAM A;  2BLS A;  1XA1 A;  1EWZ A;  2Y2H A;  4R1G A;  3UY6 A;  1HZO A;  5FQK A;  3UE0 A;  1SCW A;  3WWX A;  1JWV A;  1ES5 A;  3GSG A;  1GA0 A;  3QNC A;  5FI7 A;  3NDG A;  1K6R A;  5FQ9 A;  1MXO A;  2Y2G A;  4B88 A;  2Y2L A;  4OPQ A;  1DJC A;  3NBL A;  5GHY A;  4GD6 A;  1CI9 A;  1RCJ A;  4WBG A;  4BQM A;  1N9B A;  4OPR A;  1WYB A;  3S22 A;  5F83 A;  4R0Q A;  4S2K A;  1E4D A;  2JBF A;  5DF8 A;  5KZH A;  3UDX A;  3M6B A;  3NI9 A;  4GKU A;  4S2J A;  1FQG A;  1MWS A;  1BZA A;  4BD0 A;  5CEB A;  4BD1 A;  4E3K A;  2WGW B;  4HBT A;  1J9M A;  4PPR A;  5HL1 A;  4NET A;  3MZF A;  3RJU A;  3QNB A;  4F94 A;  4RX2 A;  4E3N A;  3GVB A;  1C3B A;  1BUE A;  1NY0 A;  3BM6 A;  3E2K A;  1Y54 A;  3G4P A;  2HDR A;  3G34 A;  3ITB A; 
#chains in the Genus database with same CATH topology
 4JKT A;  4DJ2 A;  1IOU A;  2GX5 A;  3T12 B;  4UQI S;  3G6O A;  1OJ5 A;  3Q7V B;  2Y2M A;  1XJ3 A;  4MBK A;  2XH9 A;  5KSH A;  3SH7 A;  3BFD A;  3NC8 A;  1L3L A;  1PI4 A;  1NYM A;  2EXA A;  4WYY A;  3MFX A;  4QJG A;  4P0M A;  3CG5 A;  2EWV A;  4K0X A;  3PTE A;  3QP8 A;  1LL9 A;  2HV1 A;  3VE4 A;  3WS2 A;  3HJI A;  1YAX A;  3IT9 A;  4NXB A;  4UA6 A;  4LV1 A;  1IFQ A;  4Z1W A;  1XGJ A;  3IF6 A;  1BUL A;  3S4X A;  3O86 A;  1W8Y A;  2VGJ A;  1ZTU A;  4Y0O A;  1CQA A;  4P6Z M;  4N1H A;  3UE6 A;  2HP6 A;  2ZM0 A;  1ONH A;  5CHM A;  2Z6C A;  2XD1 A;  3SZT A;  4OVD A;  2PT7 A;  4GOG A;  3HUM A;  2DCF A;  4EBN A;  2WKQ A;  5EVI D;  3KX0 X;  4P6B A;  4PM7 A;  1FCN A;  3UPO A;  4OKP A;  3IXG A;  1O07 A;  3UPP A;  1PW1 A;  1SDN A;  2PU4 A;  4N92 A;  5FI2 A;  4NXE A;  3NHQ A;  3K2N A;  5IHV A;  4JPM A;  3BLS A;  1D06 A;  2QYB A;  2CMN A;  3G2Y A;  3KYZ A;  3WS1 A;  1HD8 A;  2H28 A;  4FCF A;  1XKZ A;  3IX3 A;  1RGZ A;  1Z09 A;  2Y59 A;  2K2N A;  2XLN A;  4BBV A;  1JTD A;  1YT4 A;  2FH5 A;  3PBT A;  3O88 A;  3LEZ A;  1LL5 A;  1YSQ A;  3IWO A;  2XEP A;  3ZG7 B;  3C7U A;  3QP4 A;  5EM0 A;  3C4O A;  3OPL A;  4KZ3 A;  1JWZ A;  3KSH A;  2PR5 A;  3BY9 A;  3HL9 A;  3LIF A;  2Y4A A;  4LRZ E;  2C6W B;  3FKW A;  2DNS A;  1YLT A;  3PR6 A;  4P85 A;  3FC7 A;  2VV8 A;  2ZMF A;  3QHY A;  4I3J A;  5GL9 A;  4Y2F A;  2Q9N A;  5DF9 A;  2DMW A;  2HP9 A;  2W1T A;  5C5K A;  4KG5 A;  5DFX A;  4HI4 A;  5L09 A;  2XR0 A;  5FAO A;  3FWL A;  1MPL A;  4U0T A;  1S0W A;  5EUA A;  3PBQ A;  2P9V A;  2J9P A;  3H9W A;  3UME A;  5FDS A;  2H0T A;  4DKI A;  5U47 A;  5MC7 A;  2EX2 A;  2W3G A;  1XXM A;  4DE0 A;  3LIC A;  2ZLY A;  1S4R A;  1MWU A;  5E2F A;  3DBA A;  3EGX C;  4Y3I A;  1KE0 A;  3T4K A;  3CZD A;  4OPY A;  5IU1 A;  3UNW A;  3LY4 A;  5FA7 A;  2XRN A;  2PU2 A;  4HJ6 A;  1ONG A;  2WGW A;  1ESU A;  4GW9 A;  2E8J A;  1ACF A;  5EPH A;  2PBD P;  4S2M A;  2Z2M B;  3NJA A;  1NJ4 A;  4OQI A;  2GZA A;  3CHW P;  1WA9 A;  3HLF A;  4K91 A;  5FAT A;  3TE8 A;  3PAG A;  4EUV A;  5CHJ A;  3W2Z A;  2M7U A;  2ZM8 A;  2XDM A;  5AVF A;  1CEF A;  2PR6 A;  4E3J A;  3T50 A;  4HJ3 A;  4E6W A;  1FSY A;  3RTY A;  3RXW A;  2XF3 A;  1YLY A;  3HJK A;  3A3E A;  3DTK A;  2W0N A;  4KZB A;  3ZFZ A;  2I9V A;  4GLQ A;  1M6K A;  5FEF A;  4NXF A;  2JKT M;  3A3F A;  1NLY A;  4X1L A;  5E2H A;  5TBM A;  4KQQ A;  4PM8 A;  2P7J A;  1XJ4 A;  3UMD A;  1YLP A;  1AWI A;  2INW A;  4KQO A;  4ARZ A;  2VKS A;  2PAV P;  3F1O A;  4C3Q A;  5J4E A;  4EUZ A;  2IWD A;  4N9K A;  4R38 A;  4Y17 A;  5E2E A;  1IEL A;  4HP9 A;  5E43 A;  4NKP A;  2ZC6 B;  4MNR A;  4GNU A;  3LEQ A;  5HWV A;  5KIZ A;  3WRZ A;  3C7V A;  2ZQ8 A;  1K56 D;  1ES2 A;  2Y2Q A;  1ERO A;  3Q1F A;  3VP0 A;  3KYQ A;  2D01 A;  3IH9 A;  3L7H A;  4XUX A;  4EWF A;  5GHX A;  4X53 A;  4F3L A;  4CLC D;  3MXQ A;  2EWW A;  4K08 A;  2RL3 A;  4OPZ A;  4FH2 A;  4BJP A;  4JXS A;  3TG9 A;  4HEF A;  2GDN A;  4LCM A;  3P7N A;  1BT5 A;  5BOH A;  1LSW A;  1DP9 A;  1XX2 A;  4RA7 A;  2GJ3 A;  4R6L A;  4S2O A;  1K4E A;  3BEC A;  1S66 L;  2E8I A;  3NEC A;  1Z6F A;  4ETX A;  5FQQ A;  1AXB A;  3NDE A;  1YKD A;  2EFX A;  2WZX A;  1MBL A;  2IWC A;  3LO7 A;  4KG6 A;  1V9Z A;  2W27 A;  2D02 A;  2K31 A;  5FQM A;  2J8Y A;  1W8Q A;  2B02 A;  4HQA A;  1H8M A;  3BFF A;  5AQ7 A;  3HRE A;  3TSG A;  4KZ5 A;  3P01 A;  2P9V B;  4IED A;  3IF5 A;  2NUT C;  1P9W A;  2PD8 A;  4MN7 A;  3UE0 A;  1SCW A;  3WWX A;  5HL6 A;  5FQ9 A;  1OTD A;  3NBL A;  1OT9 A;  3EEH A;  4R0Q A;  5KZH A;  1E4D A;  4S2J A;  3NI9 A;  1V9Y A;  1MWS A;  4BD0 A;  4E3K A;  2WGW B;  4YWZ A;  4NET A;  3NUL A;  4E3N A;  3GVB A;  1BUE A;  4PKY A;  2K7S A;  4ZDX A;  2J9O A;  4L9G A;  4EQI A;  5AVE A;  1LI9 A;  3VP1 A;  3LI9 A;  3IH8 A;  3GEC A;  2VV7 A;  1JWP A;  3PXP A;  4EBL A;  4WEL A;  4X1M A;  3KSG A;  3MZD A;  4LCL A;  2QWS A;  4IUH A;  5TBM B;  3G2Z A;  1OTA A;  1LI0 A;  5EE8 A;  4WEJ A;  4ARZ B;  4QB8 A;  3F1O B;  1HTZ A;  1VB6 A;  3SH9 A;  2W3D A;  1Q2Q A;  3PHY A;  3TOI A;  5CGX A;  3OPP A;  3DWK A;  5FAQ A;  5GLC A;  4O7D A;  4AFI A;  1X0O A;  1ERQ A;  4UQI M;  1SKF A;  2EX8 A;  3EQU A;  3MQO A;  2JKR M;  2EX9 A;  4Y0T A;  3A3J A;  3U2A A;  4G3K A;  2WUQ A;  4KZ6 A;  3ZNT A;  4I5S A;  3CMZ A;  2A24 A;  5HAR A;  3A0S A;  3MZE A;  5HAI A;  1LHY A;  3ZG9 B;  1MKI A;  4KUO A;  3MXS A;  1I2S A;  2QMI A;  5AJG A;  2CC1 A;  4L9F A;  3VV4 A;  2BG1 A;  4FH4 A;  2V8C A;  4Y0U A;  3E4P A;  4A5R A;  5F69 A;  3GQZ A;  3V5M A;  5HDD A;  4F3L B;  2VGK A;  3PYP A;  5CX7 A;  2VGL M;  3MFD A;  5HAQ A;  2RCX A;  4JGO A;  3VSL A;  4BWI A;  2ZD8 A;  1K54 C;  1DRM A;  3T1R A;  2L1M A;  4X6T A;  5GLB A;  2PHY A;  4EV4 A;  3G30 A;  5GLD A;  2XGN A;  2W3H A;  3LY3 A;  3OCL A;  5I94 A;  2XD5 A;  4B93 A;  1LSV A;  3ITA A;  4GS9 A;  4CLC C;  4Q0J A;  2LB9 A;  1E25 A;  5JYO A;  2KDK A;  1NZO A;  2NUP C;  2ZQD A;  3B47 A;  2QJ7 A;  3S7Q A;  2V9A A;  2VLG A;  3VMA A;  3VSK A;  2HPB A;  5DTK A;  4GDN A;  2HP5 A;  2G7U A;  2Q0O A;  5A93 A;  3H82 A;  1H8Y A;  2J3T D;  1PZP A;  1N9N A;  1IYO A;  2J7V A;  3UB5 P;  3CUE C;  3PBN A;  2HDQ A;  3ZVW A;  3OCN A;  4DDY A;  3MBZ A;  1RP5 A;  4EET B;  1K38 A;  1MY8 A;  1BLC A;  1OME A;  1K6S A;  1G28 A;  2JKR I;  1PRQ A;  3N6I A;  4X69 A;  3BQA A;  3BYD A;  4QD4 A;  1W5D A;  4IBR A;  1CI8 A;  3C8C A;  1P97 A;  3ICY A;  5A91 A;  2HGV A;  5TJJ A;  4Z9Q A;  3BY8 A;  3LFV A;  5AQA A;  4JXG A;  4GJ4 A;  4M3K A;  4DN0 A;  1WYC A;  4NXG A;  1T1A A;  2O9C A;  4N9L A;  4OQ0 A;  4FOF A;  5A8B A;  4XXR A;  3LI8 A;  1GHP A;  1IKI A;  1PIO A;  1DJA A;  4OQG A;  2W3F A;  3W4P A;  3LUQ A;  2EXB A;  4LRY C;  5HDS A;  1L2S A;  1LL8 A;  4RYE A;  1JVJ A;  4HOI A;  1TS6 A;  2WYX A;  1MKM A;  4HH2 A;  1XGI A;  4EBP A;  4QPR A;  3OLO A;  4E3I A;  3IXB A;  3UO9 A;  2A2L A;  3GR2 A;  1J3W A;  2Y8H A;  3NOU C;  4DE1 A;  4KEN B;  4H6J A;  3HVF A;  2ZMA A;  3P98 A;  4R3J A;  1K55 C;  5G4Z A;  3HLD A;  2HJE A;  5HAP A;  1G68 A;  1SHV A;  1DY6 A;  4ZJ3 A;  3C4P A;  5CEC A;  2A24 B;  4OLG A;  2I72 A;  3CI6 A;  1GHI A;  1F2K A;  1T1B A;  4OH0 A;  2PDR A;  3MR0 A;  1H0M A;  2XA7 M;  2ZC5 B;  1O7E A;  4OOL A;  4R4R A;  2C5W B;  1NRJ A;  3I7J A;  5A90 A;  3N4I A;  4GD8 A;  3T4L A;  4C6Y A;  1HLU P;  4HY8 A;  5CER A;  2P04 A;  3TJZ C;  3IWI A;  3TRC A;  1FOF A;  2H5S A;  1TDG A;  2M7V A;  3QP6 A;  2O99 A;  2ZC3 B;  4L0L A;  4U0X A;  3CPT A;  2QKP A;  4R70 A;  1RGY A;  4P6Z S;  1VET A;  2V1B A;  4QWO A;  4EXO A;  3LR5 A;  2V1Z A;  4BL3 A;  3KSF A;  4GS9 B;  3DTM A;  1ES4 A;  5M1A A;  3IHA A;  4DE3 A;  3NIA A;  5CHU A;  4IVI A;  1H8Z A;  4KZ8 A;  4ZBE A;  3EQV A;  3H82 B;  3GMW A;  4WZ4 A;  1BLS A;  4Y13 A;  3ISG A;  1BLH A;  3O5Y A;  4CLC E;  2YKH A;  5F1F A;  4MCW A;  3FPV A;  4B9O A;  3GV9 A;  1KDS A;  5JYP A;  1YLZ A;  5FI6 A;  5CED A;  4E3O A;  2XQZ A;  4E04 A;  4Y15 A;  4JGQ A;  5EFW A;  4BBT A;  2PYP A;  3W4Q A;  1NXY A;  3S7O A;  1K25 A;  3WS0 A;  5G4Y A;  5EVE A;  3UB6 A;  3FYZ A;  2IWB A;  1YMS A;  3LR0 A;  1STZ A;  5AQB A;  4ZTK A;  3UB9 A;  3BFE A;  2PD7 A;  2BLS A;  1XA1 A;  3T4O A;  3UY6 A;  2OWJ A;  5HWW A;  1ES5 A;  3QNC A;  3KYE A;  3TW8 A;  4B88 A;  1GSX A;  1N9B A;  5F83 A;  3UDX A;  4GKU A;  4BD1 A;  3RJU A;  4RX2 A;  5F6A A;  1C3B A;  2EA9 A;  1P9R A;  1XJ6 A;  1Y54 A;  4EER A;  3G34 A;  3ITB A;  2J80 A;  3ZQ5 A;  3V67 A;  1IYS A;  1KGG A;  1L0F A;  1SZV A;  1K54 A;  2WGI A;  4MN6 A;  5IS1 A;  5CGW A;  3WS4 A;  2X71 A;  4H8R A;  4I38 A;  4HBU A;  1P0Z A;  1L0E A;  3PBO A;  4R4S A;  4WUJ A;  3FPW A;  5HD3 A;  3FV7 A;  3CIT A;  1YMX A;  3L9K A;  4XUZ A;  2H10 A;  2FFF B;  5M19 A;  4H6J B;  3BQ8 A;  1NWZ A;  2WK0 A;  5EVI C;  4OON A;  4G3V A;  3BW6 A;  4JGP A;  4CLC A;  2A3U A;  5DF7 A;  4KQR A;  3T4T A;  1ZHH B;  2J3W A;  1UWN X;  4YNR A;  1ERM A;  2YKF A;  4WMC A;  4D60 A;  3T4S A;  3BWL A;  2ZOI A;  5HFO A;  3UDI A;  2VV6 A;  1ALQ A;  1KDW A;  2KX6 A;  3FZC A;  1S67 L;  1XFQ A;  1BTL A;  3CUE A;  4ME4 A;  3ZG0 A;  4KG2 A;  3AGD A;  4G3W A;  5L2F A;  3KSI A;  4OP5 A;  5DKK A;  4FUW A;  5LBR A;  3FKV A;  3JVV A;  2JKT I;  3CPT B;  3R7W A;  3N8S A;  2WAE A;  1VET B;  5GLA A;  2JKG A;  4S2P A;  3SH8 A;  3Q07 A;  1S4S A;  4LRX C;  3QP1 A;  3ZG5 A;  3H7W A;  3CJM A;  3GRJ A;  2VEA A;  1K4F A;  2Z6D A;  3VP2 A;  2G2U A;  3CLO A;  3BRM A;  1F5M A;  4DXB A;  5G18 A;  4BEN A;  4YIN A;  4GDB A;  3VOZ A;  4XT2 B;  3OPR A;  4MEZ A;  2PRF A;  3PBS A;  2BTF P;  2W1R A;  3NCK A;  3E2L A;  5CRF A;  3D4F A;  5HWT A;  3ZGA B;  3ZHH A;  3HLG A;  3MMH A;  3SOI A;  5DKL A;  3IXD A;  5HPI A;  5L07 A;  4RX3 A;  3HLE A;  5TFQ A;  2OV5 A;  3OBF A;  4DE2 A;  3A3D A;  5HX9 A;  1OTE A;  3Q82 A;  2Y2O A;  4QHC A;  1F9I A;  3PBR A;  3S7N A;  1DP8 A;  3T1X A;  3LR4 A;  1K55 A;  1NLZ A;  1Q2P A;  1XP4 A;  4NK3 A;  3Q81 A;  4R3B A;  1KVM A;  3N7W A;  3BLM A;  4L9E A;  4WF0 A;  5FAP A;  3RH8 B;  3SS5 A;  4D2O A;  4HNB A;  3DAV A;  2V20 A;  1M40 A;  1N4O A;  1GHM A;  1MWT A;  4JF5 A;  2O9A A;  3AGE A;  3VFF A;  1W63 Q;  2ZL1 A;  3ZVT A;  4ZJ1 A;  3IWQ A;  1YLW A;  2PBY A;  3ZNY A;  1S6R A;  2WKI A;  3HLB A;  1CEG A;  1WE4 A;  4LPZ A;  3V50 A;  5CXW A;  2WKH A;  4I39 A;  1TVF A;  1XA7 A;  4WZ5 C;  2X02 A;  2WGV A;  5DTS A;  3JPU A;  3LGO A;  3UE3 A;  3IS2 B;  2OOL A;  4RVA A;  3VP3 A;  3ZYT A;  4MDZ A;  2XFT A;  4WL9 A;  3EEA A;  1E3U A;  4EW7 A;  1K0K A;  4OOM A;  2L0W A;  2W3E A;  2HJ9 C;  4I3A A;  4CLC B;  2Y2J A;  4Y5F A;  2V8F A;  3ZCZ A;  2KLI A;  2Y2P A;  5DJU A;  3RXX A;  4GZB A;  2B95 A;  4QY6 A;  3SW1 A;  4YFM A;  1I2W A;  4C75 A;  5CTM A;  3UN7 A;  2JKF A;  3A3I A;  5DFY A;  5A92 A;  3VOL A;  3QP5 A;  1ZG6 A;  2H0Y A;  2UV0 E;  1T19 A;  2HDU A;  1K57 C;  5E2G A;  3DTE A;  3LIB A;  2QJ5 A;  3T4Q A;  3R7W B;  5FDH A;  4FSF A;  5FQI A;  4X56 A;  3EOI A;  1OTB A;  1GA9 A;  1PZO A;  2WKR A;  4MN5 A;  3C5A A;  2ZQA A;  5FEG A;  1Y4O A;  3H7W B;  1GCE A;  2G2W A;  4WLA A;  3UPN A;  4QU3 A;  4U3T A;  4S2L A;  1HVB A;  4S2N C;  2Y2K A;  2XK1 A;  5F82 A;  1DP6 A;  4IHQ A;  1FR6 A;  3UB7 A;  4FTX A;  5F5Y A;  3NY4 A;  3HBR A;  2XFS A;  1KGE A;  4LLO B;  1OT6 A;  3HUO A;  3HUN A;  2VX8 A;  1DJB A;  4OP8 A;  3MS6 A;  2O0Y A;  3BEB A;  4LFU A;  3MQQ A;  4IBX A;  4O01 A;  4LV0 A;  3VP4 A;  3S1Y A;  2VGL S;  2HZ5 A;  3E4O A;  4MBH A;  4ETZ A;  5DTT A;  3C30 A;  3T1Q B;  5EVI A;  3D72 A;  3BFC A;  1T18 A;  4HHD A;  3OPH A;  1F98 A;  4MMN A;  4R3A A;  4BMW A;  3C2W A;  1XFN A;  4JGR A;  5D3O A;  3MQ0 A;  5J7E A;  2OWH A;  2P08 A;  1XPB A;  1PWD A;  1TS0 A;  4IUK A;  4DDS A;  2ZC7 A;  2VA0 A;  4WEK A;  2OAQ 1;  3OC2 A;  2ZL1 B;  1KVL A;  1W79 A;  3IBJ A;  4ZAM A;  2Y2H A;  1EWZ A;  1SKO B;  5FQK A;  1H3Q A;  3GSG A;  5FI7 A;  1VEU B;  1UWP X;  2Y2G A;  1GSW A;  3E98 A;  4OPQ A;  2JN7 A;  4GD6 A;  1CI9 A;  4WBG A;  4BQM A;  1D1J A;  2FZ0 A;  4S2K A;  4O0P A;  5DF8 A;  2KOI A;  3GDI A;  5CEB A;  4PPR A;  1J9M A;  3LID A;  3MZF A;  3QNB A;  4F94 A;  1OJG A;  4DMZ A;  4EEU A;  3RFB A;  3BM6 A;  3E2K A;  3G4P A;  3T4J A;  3W4O A;  2R9X A;  3VFH A;  1XJ2 A;  5K5B A;  1IEM A;  2QHK A;  2ZQC A;  4LEN A;  4JXW A;  4GHI B;  2B5R A;  3IBR A;  2JE5 A;  3MXR A;  1ESI A;  1LSX A;  1IYQ A;  1EW0 A;  2WKP A;  3IQA A;  5L8M A;  3N8R A;  1UGU A;  4B4Z A;  5F1G A;  1VM1 A;  1FCM A;  3MKF A;  1I5Q A;  1TS8 A;  1VHM A;  1YM1 A;  5HD5 A;  1BYW A;  2ZQ7 A;  1KOU A;  3JYI A;  4GN2 A;  4LV3 A;  3LYX A;  3F1N A;  3QP2 A;  1L0G A;  3LCE A;  2Y55 A;  4XT2 A;  1MZU A;  3NOT C;  4HIA A;  2B18 A;  1TDL A;  4P87 A;  3FG8 A;  1G6A A;  3MKE A;  4HES A;  5DJT A;  3P09 A;  2WZZ A;  3DWZ A;  3JVU A;  4E3M A;  4FD8 A;  4WN5 A;  1TD5 A;  5HZH A;  3IHB A;  2HDS A;  5TGF A;  4II7 A;  4KZ7 A;  3M2J A;  4LV2 A;  1FR1 A;  3C38 A;  4EEP A;  2Y2N A;  4ZJ2 A;  3LIA A;  2J3T C;  2EFU A;  1TS7 A;  3F1P A;  2XRO A;  3G32 A;  3T1S A;  1T1C A;  3S7P A;  4GB7 A;  4IJG A;  5EM1 A;  2ZQ9 A;  3HLC A;  3PAE A;  2JHE A;  1CF0 A;  2XA7 S;  4JLF A;  4JXV A;  3SS4 A;  4MBF A;  1G5U A;  4CJN A;  4WZ5 A;  2ZC4 B;  2WAD A;  4X25 A;  1YPR A;  3G31 A;  2ZJ9 A;  4OLD A;  3IF6 B;  2OLU A;  5DVA A;  1QME A;  5EVI B;  2VK3 A;  1PWC A;  3CAX A;  3W8K A;  3EGD C;  4DF6 A;  4EES A;  3Q7Z A;  1KE3 A;  4S2I A;  4E6X A;  4ZRR A;  2R78 A;  5L10 A;  1G6O A;  3E0Y A;  4PHT A;  2P74 A;  5F68 A;  1S1Y A;  2GNX A;  1K56 A;  2Y2I A;  1Y28 A;  1U60 A;  1KE4 A;  4X55 A;  3B3X A;  1L0D A;  3DTI A;  3IS2 A;  3IF6 C;  5M18 A;  1CK3 A;  4UA9 A;  3BJN A;  3CWF A;  2L4R A;  1FIL A;  1VQQ A;  2ACG A;  3G35 A;  3D9Y A;  3LR3 A;  2OAP 1;  4OOY A;  1GSV A;  2ZBB A;  5EV0 A;  5EEC A;  4PM6 A;  4Q8I A;  5I5L A;  4EQ1 A;  1K57 A;  4NEE D;  2DRW A;  3A0R A;  4UEY A;  2BAS A;  4Q0H A;  2X01 A;  3V3S A;  1FSW A;  1EI5 A;  1OPX A;  1PFL A;  2V0W A;  2OLV A;  4CPK A;  5AQ9 A;  2FFY A;  4PM5 A;  3MJQ A;  4UAA A;  1A0K A;  4E3L A;  5J3W A;  5CGS A;  4DJ3 A;  2O9B A;  2Y91 A;  2ZMV A;  1W7F A;  3MF0 A;  3IXH A;  4WMC D;  1NZU A;  3V3R A;  3D3O A;  3AGF A;  2M1C A;  4S2N A;  4R23 A;  4PAU A;  3O87 A;  2OSU A;  4KZA A;  4KZ9 A;  4JBF A;  4UA7 A;  2ZM2 A;  3UE1 A;  4KZ4 A;  1SDE A;  1JTG A;  1H5X A;  3ZG8 B;  2V2F F;  1LT0 A;  5GHZ A;  2W1T B;  1TEM A;  2JCH A;  3BFG A;  2IA2 A;  3MSH A;  4Y7P A;  3UDF A;  4JF6 A;  5FAS A;  3N8L A;  2EX6 A;  1ZG4 A;  1BSG A;  3F1N B;  3V39 A;  3Q7V A;  4B4X A;  1N9O A;  3KO6 A;  1ES3 A;  1OTI A;  1PW8 A;  5HSQ A;  4HJ4 A;  5CTN A;  3R4K A;  1MWR A;  5EOO A;  2XSS A;  4N1X A;  3SS3 A;  2PYR A;  2VZW A;  1LLB A;  1PWG A;  2VJW A;  4ID4 A;  4MLL A;  3IX8 A;  4QY5 A;  4BL2 A;  2JC7 A;  2R9W A;  1IKG A;  4KUK A;  3F1P B;  1JNU A;  4BBU A;  4K0W A;  4HH3 A;  3UB8 A;  2A49 A;  3K3C A;  5KSC A;  4CQH A;  4YOF A;  4PMA A;  2V1A A;  4X68 A;  3O3V A;  4BLM A;  1ZKJ A;  5HPF A;  4PKY G;  4DXC A;  3NOP C;  1QMF A;  4Q0I A;  1IYP A;  3ZDJ A;  1FCO A;  2Z2L B;  4OQH A;  3M2K A;  4M4X A;  2WKE A;  3E4Q A;  1YQS A;  5HW3 A;  2QPN A;  3GTC A;  3IX4 A;  1KGF A;  4UHU A;  5FSR A;  4JF4 A;  1TF1 A;  5KMW A;  1SKO A;  4HP4 A;  4DRT A;  1VEU A;  2HF6 A;  2ZOH A;  3WRT A;  3ULF A;  3OOV A;  3EWK A;  1CJF A;  3WS5 A;  2QZ6 A;  4EU0 A;  4WM9 A;  5EVL A;  4KQD A;  5J8X A;  2MJ6 A;  2Q9M A;  3HLW A;  1W63 M;  4NG2 A;  5FQJ A;  1ZC2 A;  1ODV A;  3LIE A;  3M6H A;  1BLP A;  1YLJ A;  2V0U A;  4PM9 A;  5EOE A;  4RQ9 A;  1PI5 A;  4IVK A;  1FIK A;  1D7E A;  1NRF A;  2UWX A;  2WAF A;  1PYY A;  5TR7 A;  1E3U D;  3VOY A;  4GHI A;  3DW0 A;  5IT5 A;  1S1Z A;  3U4L P;  3A0V A;  3OZH A;  1NYY A;  4GCZ A;  5FL3 A;  4R1G A;  1HZO A;  3VE3 A;  1JWV A;  3K3D A;  1GA0 A;  3NDG A;  1N9L A;  1K6R A;  1MXO A;  2Y2L A;  3HCY A;  1DJC A;  5GHY A;  1RCJ A;  3B42 A;  4OPR A;  1WYB A;  3S22 A;  2LB5 A;  2JBF A;  4LGW A;  3M6B A;  2AVX A;  1FQG A;  1BZA A;  4ESP A;  4I3I A;  4HBT A;  5HL1 A;  2Y79 A;  1YSP A;  5HDC A;  4O8G A;  1NY0 A;  3B33 A;  1PNE A;  1MC0 A;  2HDR A; 
#chains in the Genus database with same CATH homology
 4JKT A;  4ZDX A;  1IYS A;  1KGG A;  2J9O A;  1L0F A;  3W4O A;  1K54 A;  2WGI A;  5CGW A;  3WS4 A;  2X71 A;  4H8R A;  2R9X A;  3VFH A;  4HBU A;  4EQI A;  1IEM A;  1L0E A;  2ZQC A;  4LEN A;  3PBO A;  4R4S A;  1LI9 A;  3FV7 A;  4JXW A;  2B5R A;  3VP1 A;  2JE5 A;  3MXR A;  1ESI A;  1YMX A;  3IH8 A;  4XUZ A;  2H10 A;  3Q7V B;  2Y2M A;  2FFF B;  1IYQ A;  4MBK A;  5M19 A;  2XH9 A;  5KSH A;  3SH7 A;  1JWP A;  2WK0 A;  4EBL A;  5EVI C;  4WEL A;  3BFD A;  3NC8 A;  4OON A;  3IQA A;  3N8R A;  3MZD A;  4LCL A;  1PI4 A;  1NYM A;  2A3U A;  4B4Z A;  2EXA A;  5DF7 A;  4WYY A;  3G2Z A;  4QJG A;  4KQR A;  4P0M A;  1VM1 A;  5F1G A;  1FCM A;  3MKF A;  1LI0 A;  3CG5 A;  1I5Q A;  5EE8 A;  4WEJ A;  4QB8 A;  1ERM A;  4K0X A;  3PTE A;  1YM1 A;  1HTZ A;  4WMC A;  3SH9 A;  1LL9 A;  2ZQ7 A;  1Q2Q A;  3JYI A;  4GN2 A;  3TOI A;  5CGX A;  5HFO A;  3UDI A;  3OPP A;  3DWK A;  3WS2 A;  1ALQ A;  5FAQ A;  3IT9 A;  1KDW A;  4LV3 A;  5GLC A;  4UA6 A;  1L0G A;  3LCE A;  4LV1 A;  3FZC A;  4O7D A;  1XGJ A;  2Y55 A;  3IF6 A;  1BUL A;  3S4X A;  1BTL A;  1ERQ A;  3O86 A;  1TDL A;  1W8Y A;  2VGJ A;  1SKF A;  4P87 A;  2EX8 A;  3ZG0 A;  4KG2 A;  4Y0O A;  3EQU A;  1G6A A;  3MKE A;  3AGD A;  4HES A;  2EX9 A;  4N1H A;  3A3J A;  4Y0T A;  3P09 A;  5L2F A;  2WZZ A;  2WUQ A;  4KZ6 A;  2HP6 A;  3DWZ A;  3ZNT A;  4OP5 A;  4E3M A;  4FD8 A;  2ZM0 A;  1ONH A;  5CHM A;  3CMZ A;  5HAR A;  3MZE A;  5HAI A;  1LHY A;  3ZG9 B;  1MKI A;  3FKV A;  2XD1 A;  3MXS A;  3IHB A;  2HDS A;  4OVD A;  5TGF A;  1I2S A;  4KZ7 A;  2QMI A;  3M2J A;  4LV2 A;  1FR1 A;  2CC1 A;  3N8S A;  4GOG A;  2WAE A;  2BG1 A;  3HUM A;  4FH4 A;  5GLA A;  2Y2N A;  4ZJ2 A;  2DCF A;  4Y0U A;  4EBN A;  4A5R A;  5EVI D;  2EFU A;  3GQZ A;  4S2P A;  3SH8 A;  3V5M A;  3Q07 A;  3G32 A;  4P6B A;  4PM7 A;  1FCN A;  3UPO A;  2VGK A;  5HAQ A;  3MFD A;  2RCX A;  4GB7 A;  3IXG A;  4OKP A;  2ZQ9 A;  3HLC A;  3PAE A;  3VSL A;  1O07 A;  3UPP A;  1PW1 A;  3ZG5 A;  3CJM A;  3GRJ A;  2ZD8 A;  1K54 C;  1SDN A;  2PU4 A;  4JLF A;  4JXV A;  3SS4 A;  4N92 A;  4MBF A;  5FI2 A;  4CJN A;  4WZ5 A;  5IHV A;  4JPM A;  1K4F A;  3BLS A;  2ZC4 B;  3VP2 A;  2G2U A;  4X6T A;  2WAD A;  3G2Y A;  3WS1 A;  5GLB A;  1HD8 A;  3BRM A;  4DXB A;  3G31 A;  4EV4 A;  4FCF A;  2ZJ9 A;  4OLD A;  5G18 A;  4YIN A;  4BEN A;  1XKZ A;  4GDB A;  3VOZ A;  3G30 A;  5GLD A;  1RGZ A;  3IF6 B;  2XGN A;  2OLU A;  3OPR A;  3LY3 A;  3OCL A;  5DVA A;  4MEZ A;  5I94 A;  3PBS A;  1QME A;  2Y59 A;  2XD5 A;  3NCK A;  2XLN A;  5EVI B;  3ITA A;  1JTD A;  1YT4 A;  1PWC A;  3W8K A;  3E2L A;  5CRF A;  3D4F A;  3PBT A;  3O88 A;  4DF6 A;  3LEZ A;  1E25 A;  5JYO A;  3Q7Z A;  1KE3 A;  4S2I A;  1LL5 A;  4E6X A;  3ZGA B;  1NZO A;  3ZHH A;  2ZQD A;  3HLG A;  3SOI A;  3VMA A;  3VSK A;  2HPB A;  5DTK A;  4GDN A;  3IWO A;  2XEP A;  3ZG7 B;  3IXD A;  2HP5 A;  3C7U A;  4RX3 A;  2P74 A;  3C4O A;  3OPL A;  4KZ3 A;  3HLE A;  5A93 A;  5TFQ A;  1JWZ A;  1K56 A;  2Y2I A;  2OV5 A;  4DE2 A;  1H8Y A;  1U60 A;  1KE4 A;  4X55 A;  3B3X A;  1L0D A;  3A3D A;  3HL9 A;  5HX9 A;  3Q82 A;  1PZP A;  2Y2O A;  2Y4A A;  3IF6 C;  1IYO A;  2J7V A;  5M18 A;  4QHC A;  3PBN A;  3PBR A;  2HDQ A;  3ZVW A;  1CK3 A;  4UA9 A;  2C6W B;  3FKW A;  3OCN A;  4DDY A;  3MBZ A;  1RP5 A;  2DNS A;  1K38 A;  1K55 A;  1VQQ A;  1MY8 A;  1YLT A;  1Q2P A;  3G35 A;  4P85 A;  1BLC A;  1XP4 A;  3QHY A;  4OOY A;  5GL9 A;  4NK3 A;  1OME A;  3Q81 A;  4R3B A;  1K6S A;  1KVM A;  2Q9N A;  3N7W A;  3BLM A;  5DF9 A;  5EEC A;  4PM6 A;  4Q8I A;  5FAP A;  2HP9 A;  1K57 A;  3N6I A;  4KG5 A;  4X69 A;  3SS5 A;  3BYD A;  4D2O A;  2DRW A;  4QD4 A;  1W5D A;  4IBR A;  2V20 A;  1CI8 A;  2XR0 A;  5FAO A;  2X01 A;  3FWL A;  3V3S A;  1MPL A;  1M40 A;  1FSW A;  1EI5 A;  1N4O A;  1GHM A;  1MWT A;  4U0T A;  4JF5 A;  1S0W A;  3AGE A;  5A91 A;  5EUA A;  3PBQ A;  3VFF A;  3ZVT A;  2P9V A;  4ZJ1 A;  2J9P A;  3IWQ A;  1YLW A;  2H0T A;  4DKI A;  2OLV A;  2PBY A;  5U47 A;  3ZNY A;  4CPK A;  5AQ9 A;  1S6R A;  2WKI A;  3HLB A;  2FFY A;  4PM5 A;  4Z9Q A;  1CEG A;  4UAA A;  4E3L A;  1WE4 A;  2EX2 A;  5AQA A;  1XXM A;  4JXG A;  4DE0 A;  5CGS A;  3V50 A;  2Y91 A;  4M3K A;  1W7F A;  5CXW A;  2ZLY A;  2WKH A;  1TVF A;  1WYC A;  1MWU A;  3IXH A;  4WMC D;  5E2F A;  1XA7 A;  1NZU A;  3V3R A;  3AGF A;  4WZ5 C;  2X02 A;  1KE0 A;  2WGV A;  4N9L A;  3CZD A;  4OQ0 A;  4OPY A;  5DTS A;  4S2N A;  4R23 A;  4XXR A;  3UNW A;  3O87 A;  3LY4 A;  2OSU A;  5FA7 A;  4KZA A;  2PU2 A;  3UE3 A;  4KZ9 A;  1ONG A;  2WGW A;  1ESU A;  1GHP A;  4RVA A;  4JBF A;  3VP3 A;  4UA7 A;  2ZM2 A;  1IKI A;  1PIO A;  3UE1 A;  4KZ4 A;  1SDE A;  2XFT A;  5EPH A;  4S2M A;  1JTG A;  1E3U A;  1DJA A;  1H5X A;  2Z2M B;  3ZG8 B;  4OQG A;  3W4P A;  2EXB A;  1NJ4 A;  4OQI A;  4OOM A;  2V2F F;  1L2S A;  4RYE A;  2Y2J A;  1JVJ A;  3HLF A;  4K91 A;  5FAT A;  3ZCZ A;  2Y2P A;  3PAG A;  5GHZ A;  2WYX A;  5CHJ A;  1TEM A;  2JCH A;  3BFG A;  2ZM8 A;  2XDM A;  4E3J A;  1CEF A;  1XGI A;  4Y7P A;  3UDF A;  4JF6 A;  4EBP A;  5FAS A;  4E6W A;  1FSY A;  3N8L A;  3RXW A;  3RXX A;  4GZB A;  2EX6 A;  4QY6 A;  1ZG4 A;  2XF3 A;  4E3I A;  3IXB A;  1BSG A;  1YLY A;  4YFM A;  1I2W A;  3V39 A;  3UO9 A;  4C75 A;  5CTM A;  3UN7 A;  3GR2 A;  3A3I A;  3Q7V A;  4B4X A;  4DE1 A;  3A3E A;  4KEN B;  5A92 A;  3HVF A;  2ZMA A;  3P98 A;  4R3J A;  1K55 C;  3HLD A;  4KZB A;  3ZFZ A;  5HAP A;  1M6K A;  1G68 A;  1SHV A;  1ES3 A;  3A3F A;  1PW8 A;  1DY6 A;  5CTN A;  5E2H A;  4ZJ3 A;  1MWR A;  5EOO A;  4KQQ A;  4PM8 A;  3C4P A;  1ZG6 A;  2H0Y A;  5CEC A;  4N1X A;  1YLP A;  2HDU A;  3SS3 A;  4OLG A;  1K57 C;  2I72 A;  5E2G A;  1GHI A;  4KQO A;  4C3Q A;  1LLB A;  4OH0 A;  1PWG A;  5FDH A;  4FSF A;  5FQI A;  4ID4 A;  4X56 A;  4EUZ A;  2IWD A;  4MLL A;  2ZC5 B;  1O7E A;  4QY5 A;  4BL2 A;  4N9K A;  2JC7 A;  4OOL A;  2R9W A;  1IKG A;  4R4R A;  2C5W B;  1GA9 A;  3I7J A;  4K0W A;  5E2E A;  1IEL A;  5A90 A;  2A49 A;  3N4I A;  4GD8 A;  4C6Y A;  1PZO A;  5E43 A;  5KSC A;  2ZC6 B;  3C5A A;  2ZQA A;  4MNR A;  4PMA A;  4GNU A;  4X68 A;  5CER A;  3O3V A;  1GCE A;  3WRZ A;  2G2W A;  4BLM A;  3IWI A;  3C7V A;  1FOF A;  1ZKJ A;  2H5S A;  1TDG A;  2ZQ8 A;  3UPN A;  4DXC A;  4QU3 A;  4U3T A;  4S2L A;  1QMF A;  1HVB A;  1K56 D;  4S2N C;  2Y2K A;  1ES2 A;  1IYP A;  2ZC3 B;  2Y2Q A;  2XK1 A;  1FCO A;  2Z2L B;  4L0L A;  4U0X A;  5F82 A;  3ZDJ A;  1ERO A;  4OQH A;  1RGY A;  3Q1F A;  3M2K A;  3VP0 A;  1FR6 A;  2WKE A;  3NY4 A;  3HBR A;  1YQS A;  3IH9 A;  4XUX A;  4EWF A;  2XFS A;  5HW3 A;  2V1Z A;  2QPN A;  4BL3 A;  1KGE A;  5GHX A;  3GTC A;  4X53 A;  1KGF A;  4UHU A;  3HUO A;  3DTM A;  3HUN A;  1ES4 A;  5M1A A;  1DJB A;  5FSR A;  4JF4 A;  5KMW A;  3IHA A;  2RL3 A;  4OP8 A;  4OPZ A;  4FH2 A;  4BJP A;  4JXS A;  3TG9 A;  3BEB A;  4DE3 A;  3NIA A;  4DRT A;  4HEF A;  2GDN A;  4LCM A;  5CHU A;  4IVI A;  1H8Z A;  4KZ8 A;  4IBX A;  4ZBE A;  4LV0 A;  1BT5 A;  3EQV A;  3VP4 A;  1XX2 A;  3WRT A;  5BOH A;  4RA7 A;  3S1Y A;  4S2O A;  3GMW A;  1K4E A;  4WZ4 A;  3BEC A;  1BLS A;  3ISG A;  3WS5 A;  1BLH A;  2QZ6 A;  4MBH A;  2E8I A;  1Z6F A;  4WM9 A;  5F1F A;  5FQQ A;  5EVL A;  1AXB A;  5DTT A;  3GV9 A;  3NDE A;  1KDS A;  5EVI A;  5JYP A;  2EFX A;  1YLZ A;  5J8X A;  2WZX A;  3BFC A;  2Q9M A;  1MBL A;  2IWC A;  3HLW A;  5FQJ A;  1ZC2 A;  5FI6 A;  5CED A;  3OPH A;  4E3O A;  3M6H A;  1BLP A;  3LO7 A;  2XQZ A;  1YLJ A;  4KG6 A;  4PM9 A;  5D3O A;  5FQM A;  5EOE A;  3W4Q A;  1NXY A;  2J8Y A;  1W8Q A;  1K25 A;  1PI5 A;  4IVK A;  3WS0 A;  1XPB A;  1PWD A;  3BFF A;  3FYZ A;  1NRF A;  4DDS A;  2UWX A;  2WAF A;  2ZC7 A;  5AQ7 A;  3HRE A;  2IWB A;  1PYY A;  5TR7 A;  3TSG A;  1E3U D;  4KZ5 A;  4WEK A;  3VOY A;  1YMS A;  3OC2 A;  2P9V B;  3DW0 A;  5AQB A;  4ZTK A;  1KVL A;  3BFE A;  1W79 A;  3OZH A;  4IED A;  3IF5 A;  1NYY A;  4ZAM A;  2BLS A;  1XA1 A;  1EWZ A;  2Y2H A;  4R1G A;  3UY6 A;  1HZO A;  5FQK A;  3UE0 A;  1SCW A;  3WWX A;  1JWV A;  1ES5 A;  3GSG A;  1GA0 A;  3QNC A;  5FI7 A;  3NDG A;  1K6R A;  5FQ9 A;  1MXO A;  2Y2G A;  4B88 A;  2Y2L A;  4OPQ A;  1DJC A;  3NBL A;  5GHY A;  4GD6 A;  1CI9 A;  1RCJ A;  4WBG A;  4BQM A;  1N9B A;  4OPR A;  1WYB A;  3S22 A;  5F83 A;  4R0Q A;  4S2K A;  1E4D A;  2JBF A;  5DF8 A;  5KZH A;  3UDX A;  3M6B A;  3NI9 A;  4GKU A;  4S2J A;  1FQG A;  1MWS A;  1BZA A;  4BD0 A;  5CEB A;  4BD1 A;  4E3K A;  2WGW B;  4HBT A;  1J9M A;  4PPR A;  5HL1 A;  4NET A;  3MZF A;  3RJU A;  3QNB A;  4F94 A;  4RX2 A;  4E3N A;  3GVB A;  1C3B A;  1BUE A;  1NY0 A;  3BM6 A;  3E2K A;  1Y54 A;  3G4P A;  2HDR A;  3G34 A;  3ITB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...