5E43A

Crystal structure of beta-lactamase sros_5706 from streptosporangium roseum
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
GARARKELRTLEASFKGRIGAYAVDTATGKTITYRSGERFPLLSTFKAIAAAAVLHKARTSDPGLLNKVVHWTTAELQEHSPVTGKHVKDGMTVARLCEAAITRSDNTAANMLLKQIGGPAGLTAYFHTLKDPVSRLDRWETELNNWSPKEKRDTTTPASMGRDLRAVTTGDALDARDRERLNAWLTANKTGDARIRAGLPKTWTVGDKTGTNSKYGAGNDIAVVWPGKSAAPIIMSIYTNRGAADAAVDDKVIADTAAILARALGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Beta-lactamase Sros_5706 from Streptosporangium roseum
rcsb
source organism Streptosporangium roseum (strain atcc 12428 / dsm 43021 / jcm 3005 / ni 9100)
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 90
structure length 268
sequence length 268
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e43A00
4KENB 4GZBA 4EV4A 2XLNA 4JXGA 4S2LA 3HUNA 3GRJA 1XX2A 3ITBA 4DE2A 4EUZA 4H8RA 2HDSA 3LY3A 1MPLA 3ZVWA 4X56A 1NRFA 1NY0A 4KZ5A 3S1YA 4QY5A 4MEZA 2OLUA 3TG9A 3ZCZA 3UO9A 4GDNA 5A92A 3CJMA 1K54A 2HDQA 4OLDA 5EVID 3RJUA 3M2KA 5KZHA 3B3XA 3GMWA 4OQIA 5GL9A 3VP0A 5CHJA 3IXGA 5EUAA 3G2ZA 5G18A 1RGZA 1MBLA 5F82A 2VGJA 4UAAA 2EX9A 3HBRA 5F1GA 4P87A 1S6RA 1YMXA 3ZNTA 5HL1A 3N4IA 4Y7PA 4P0MA 5DVAA 3ISGA 4KQOA 5E43A 3BM6A 4XUXA 1K6RA 1XA1A 4N9LA 5AQ7A 2E8IA 3UDXA 5CTMA 1MWSA 5EOEA 1CI8A 3IHBA 3OCLA 2XK1A 3Q81A 3C5AA 4LV0A 3C4PA 1XKZA 1L2SA 3IF6A 1MWUA 3G35A 5CECA 1E25A 4M3KA 4MBHA 4LV2A 1K4EA 2Y2QA 1U60A 4PM5A 4ID4A 5EVLA 1K57A 3PAGA 5DF9A 2V20A 2QMIA 2V1ZA 4R23A 3UE1A 3MFDA 5FI6A 4ZJ2A 5I94A 3M6HA 1KDWA 4N92A 1E4DA 2Q9MA 5EVIB 2RL3A 2XF3A 1PWDA 1YT4A 2R9XA 3BYDA 3FZCA 3BEBA 4DE1A 1IYOA 3PTEA 1N9BA 1RP5A 2ZC3B 3E2LA 4ZJ1A 3VFFA 3WRZA 4FD8A 4KZ3A 5DTSA 2WK0A 1KE0A 2IWBA 3N8RA 5E2HA 1DJBA 2ZC7A 3ZDJA 2JC7A 4WYYA 2H10A 3A3EA 3N8SA 5CXWA 3IXDA 5HAQA 5CTNA 5FQMA 2EXAA 2XD5A 2OSUA 2P74A 4D2OA 3MZFA 4UA9A 4ZDXA 1PW8A 3O88A 4KQQA 3I7JA 3RXXA 1H5XA 1PW1A 2ZQCA 5DTKA 2ZC6B 3VMAA 1W8YA 5GLAA 1ERMA 2Y2JA 3FKVA 5DF7A 2Y2IA 4KZ9A 4WM9A 3DTMA 3ITAA 2C5WB 1HTZA 3G34A 5DF8A 5TR7A 5KSHA 3PBRA 3SOIA 1LL9A 1Y54A 5GLDA 1C3BA 3IF5A 2HP5A 3S4XA 3G4PA 4C75A 5HX9A 2WYXA 2B5RA 1BLCA 3DWKA 3IXHA 1YLZA 2J9PA 4QB8A 1CEFA 2Y2PA 2ZQ8A 3PBOA 2A3UA 4S2IA 4WMCA 1NYYA 4FH4A 5CHUA 1HVBA 3O3VA 4BQMA 2QZ6A 4S2MA 1ZG6A 1PI4A 3IHAA 3P98A 3Q1FA 4R0QA 3NDGA 5CGSA 2IWDA 2J9OA 1WYBA 3IH9A 3IXBA 3M2JA 3QNBA 1NZUA 4WMCD 3QNCA 4IVKA 4X53A 1IKGA 5FDHA 3NIAA 5EPHA 1LL5A 1KVMA 3OCNA 4P6BA 4QY6A 3SS5A 4E3KA 4JXSA 3UPNA 4R4RA 1EWZA 2JBFA 4P85A 4OVDA 1BT5A 3HLWA 4HESA 2I72A 3SS4A 4EQIA 2FFFB 5HAIA 4E3OA 3HL9A 4OOMA 3NBLA 4Z9QA 3NCKA 4B4ZA 2Y2OA 1QMFA 3OPRA 4IVIA 1M40A 4MBFA 3FWLA 4DDSA 1ES3A 3C7UA 4N9KA 1Q2PA 2VGKA 2BG1A 2G2WA 1Z6FA 4JLFA 4S2NA 2DNSA 4OKPA 1W8QA 3WRTA 3A3JA 4JBFA 1CK3A 3LCEA 4UHUA 5FAPA 2PU4A 2P9VA 4RX2A 1IYQA 2IWCA 2WGWB 4QU3A 4E6WA 2HPBA 2ZM8A 3DWZA 3WS5A 5CHMA 3PBQA 3QHYA 5M18A 1FSWA 1ZC2A 4S2NC 3IH8A 5EOOA 3HLDA 2EFXA 4B4XA 4DE0A 5TGFA 1K4FA 2J8YA 1PZPA 2Z2MB 3NC8A 3C4OA 1K54C 5CEBA 2WKHA 4OPZA 5EVIC 3ZG8B 2ZQDA 4KZ4A 3BRMA 5FAQA 5J8XA 3GR2A 5CERA 1VM1A 3EQUA 4R3BA 3ZHHA 1LI0A 4UA6A 4BD0A 1JTDA 4KQRA 1OMEA 1MWTA 1GHMA 4QD4A 3ZG9B 3OPHA 4S2PA 1AXBA 1ESUA 1XGJA 2Q9NA 3A3DA 2FFYA 1IELA 4XUZA 5GHXA 2ZC5B 1K38A 1MY8A 2CC1A 4RYEA 2J7VA 4R3JA 4FSFA 1K56A 2X71A 3BFDA 2PU2A 3Q7VA 1PWCA 4UA7A 5AQBA 5F1FA 4XXRA 1ALQA 5D3OA 4HBUA 5CGWA 3A3FA 5FSRA 1JTGA 2H0TA 3V3SA 4WEJA 4BD1A 1IYSA 2HDUA 1ES2A 5HARA 1W5DA 3G31A 1GHIA 3HLCA 4E3IA 4O7DA 3ZG7B 1K6SA 3SH9A 1XP4A 1JWVA 1KGGA 4OQ0A 4S2JA 5FI7A 2XD1A 4WZ5A 1TDLA 4OOYA 1BSGA 2X02A 4PPRA 4Y0TA 4GKUA 3M6BA 1MXOA 4U0XA 1TEMA 2RCXA 4CJNA 5HW3A 1K56D 3HLGA 3PAEA 4A5RA 4EBLA 4FCFA 1KGEA 2XR0A 2P9VB 3WWXA 2Y55A 1H8YA 3G30A 1YM1A 3P09A 1DJCA 1M6KA 1E3UD 3SH7A 4X69A 3IF6B 5M1AA 3WS0A 4MLLA 5GLCA 4S2OA 3IF6C 5GHZA 4DXCA 3JYIA 3OPPA 3MKFA 3BFEA 3HVFA 5JYOA 1I5QA 4WZ5C 4YINA 4DXBA 1ESIA 3AGDA 3CMZA 4JF6A 3UPPA 3ZVTA 5EE8A 4OONA 1WYCA 2JE5A 4BLMA 4E3NA 2V2FF 4OPYA 1EI5A 1ZKJA 3N7WA 3WS2A 2ZQAA 1KE4A 1NYMA 4IEDA 1H8ZA 1SKFA 3GVBA 1MWRA 4OLGA 1FQGA 1ES4A 1K57C 4PM6A 3RXWA 1JWPA 3NI9A 5TFQA 4EBNA 1TVFA 3C7VA 4X6TA 2H5SA 1YLYA 3PBSA 3FYZA 1L0DA 4GN2A 1DJAA 4GNUA 4LV3A 4DF6A 4Q8IA 4NK3A 5KSCA 3DW0A 4LV1A 4E3MA 4K91A 3HUOA 2EX2A 2G2UA 5M19A 3PBNA 1ONHA 1YLPA 4Y0UA 4ZBEA 1O7EA 1YLWA 5FQQA 2DCFA 1BULA 5EECA 2EX6A 1LLBA 1FCNA 3AGFA 4LENA 2Z2LB 1FSYA 4KZ8A 4MNRA 1GA0A 4U3TA 5FQIA 1BZAA 2Y2KA 2HDRA 2EXBA 4KG5A 4EWFA 3FKWA 2Y2LA 1FOFA 3MZDA 1K55A 4WEKA 4R1GA 5DTTA 3Q7VB 2BLSA 3UE0A 3IT9A 3GSGA 3MZEA 3TSGA 3HREA 1IEMA 3AGEA 4OP8A 4ZAMA 3N6IA 1HZOA 3G2YA 4PM9A 2X01A 3GQZA 4C3QA 1IYPA 1RGYA 4IBRA 2Y4AA 5FI2A 2Y59A 3MKEA 1IKIA 1W7FA 5FQ9A 1L0EA 3GTCA 1FCMA 1FR6A 3S22A 1CI9A 1SCWA 2JCHA 2XDMA 2WUQA 2OLVA 3NY4A 4JPMA 1G6AA 1SDNA 4B88A 1YQSA 4CPKA 1TDGA 4OPQA 5CRFA 2Y2GA 3WS1A 2C6WB 1YLTA 1FCOA 2ZQ7A 4WBGA 5JYPA 1W79A 4KZBA 5HAPA 5E2GA 2XEPA 5AQ9A 3IWIA 4KG2A 3SS3A 4OPRA 3CG5A 4JF5A 2XH9A 1KGFA 3V50A 1EROA 4DRTA 3HLFA 4PMAA 1J9MA 2GDNA 5FATA 3LO7A 5HFOA 3BLMA 2R9WA 4NETA 1HD8A 5F83A 3VP4A 4OQHA 2ZLYA 2XQZA 1BUEA 2A49A 4LCMA 4K0WA 4N1XA 4DKIA 4HEFA 3BFFA 5FASA 3CZDA 1O07A 1ONGA 4PM7A 1KE3A 1L0GA 3D4FA 4QHCA 3HLBA 4OQGA 3VSKA 3ZG5A 4BJPA 4E6XA 5GHYA 3VOZA 3VSLA 4GDBA 3V5MA 3VP1A 2WZXA 3W8KA 3N8LA 2ZMAA 1G68A 3VP2A 3IQAA 5KMWA 3ZFZA 1XXMA 3OZHA 1I2SA 4S2KA 1NXYA 3BECA 4DE3A 5GLBA 4BL3A 2ZM0A 2XGNA 4GB7A 5CGXA 1K55C 4EBPA 3OPLA 4F94A 4JXVA 3Q82A 1BLSA 4R4SA 5E2FA 5E2EA 3W4QA 3W4OA 3SH8A 1GHPA 1PYYA 1KVLA 3ZG0A 1GCEA 4HBTA 1FR1A 1NJ4A 5EVIA 3UE3A 1BLPA 1L0FA 1LI9A 4BL2A 3O87A 3PBTA 3V3RA 1SDEA 1YLJA 4ZTKA 5A91A 4E3LA 1YMSA 3UPOA 5U47A 1KDSA 3BFCA 2WAFA 3A3IA 3MXRA 4DDYA 5A93A 5IHVA 4C6YA 1PWGA 3BFGA 1PI5A 1XGIA 1GA9A 2WKIA 2EX8A 2WZZA 5L2FA 1DY6A 2PBYA 2Y2NA 2EFUA 1SHVA 4LCLA 4X68A 3FV7A 4RA7A 5FQJA 4QJGA 4JKTA 4RVAA 3MBZA 4OOLA 3WS4A 3UN7A 2WGVA 4WELA 5FQKA 4KZ6A 3NDEA 4ZJ3A 3MXSA 1K25A 3HLEA 1XPBA 1E3UA 3BLSA 3HUMA 3LY4A 1WE4A 5CEDA 2Y91A 3OC2A 2HP9A 1N4OA 3EQVA 4WZ4A 5FAOA 4KZAA 4FH2A 4E3JA 1Q2QA 2ZD8A 1XA7A 1PZOA 1LHYA 3GV9A 5AQAA 4KG6A 3G32A 2Y2HA 4GD8A 3VOYA 2ZQ9A 3TOIA 3LEZA 3Q7ZA 3O86A 1ZG4A 2XFTA 4OH0A 4U0TA 2OV5A 5BOHA 1JVJA 2HP6A 2WADA 4PM8A 4BENA 1VQQA 2WGWA 2XFSA 4YFMA 2ZM2A 2ZC4B 3E2KA 2H0YA 3ZNYA 2WAEA 3IWQA 3VFHA 1I2WA 1MKIA 2UWXA 3Q07A 1QMEA 1ERQA 4OP5A 3ZGAB 1ES5A 4IBXA 3VP3A 4KZ7A 3UDIA 4JF4A 2QPNA 3UNWA 1CEGA 5A90A 3UY6A 2DRWA 3W4PA 3IWOA 1RCJA 4GOGA 4MBKA 5FA7A 1PIOA 3UDFA 2Y2MA 1JWZA 1NZOA 4K0XA 2ZJ9A 2WGIA 4X55A 4Y0OA 1BLHA 4JXWA 3V39A 4L0LA 2WKEA 1S0WA 4GD6A 1BTLA 4RX3A 4N1HA
chains in the Genus database with same CATH superfamily
4ARZB 3DAVA 4O8GA 4HOIA 1XX2A 3DTEA 2HDSA 4GS9B 4B9OA 1NRFA 1NY0A 1UWPX 2PYRA 3NOUC 3CJMA 3RJUA 1F2KA 5CHJA 3KSFA 2UV0E 4UAAA 5IU1A 3N4IA 4P0MA 5DVAA 3BM6A 4MDZA 1K6RA 3TE8A 3UDXA 1OTDA 2K31A 1CI8A 3Q81A 3C5AA 1XKZA 1E25A 4M3KA 1K4EA 4ID4A 5DF9A 2QMIA 5FI6A 4ZJ2A 3KX0X 3M6HA 4N92A 1E4DA 2Q9MA 1PWDA 1RP5A 3E2LA 2ZC3B 3O5YA 3LIBA 5DTSA 3N8RA 3L9KA 2XD5A 4HHDA 1PW8A 3TW8A 1H5XA 2ZQCA 2ZC6B 3VMAA 3FKVA 1W63M 3DTMA 2C5WB 3G34A 5DF8A 5KSHA 1NLYA 3PBRA 1H3QA 3QP6A 1Y54A 5GLDA 1MZUA 5EFWA 4LRZE 3T12B 2QYBA 2WYXA 1BLCA 1CEFA 2Y2PA 4S2IA 3O3VA 3LFVA 1PI4A 4DMZA 4LLOB 4GS9A 3NULA 5CGSA 3IH9A 3MQ0A 4X53A 3E4QA 5FDHA 1N9LA 2LB5A 3NIAA 5EPHA 1LL5A 2B02A 4JXSA 1EWZA 3BWLA 2JBFA 2HF6A 3GDIA 5HAIA 3HL9A 3QP1A 5DJTA 2Q0OA 3EEHA 4DDSA 2L0WA 2VV6A 3E98A 2BG1A 2G2WA 4OKPA 1A0KA 2ZL1A 1CK3A 4R38A 2PU4A 2WGWB 3CLOA 1YSPA 3WS5A 5CHMA 3QHYA 5M18A 1ZC2A 4S2NC 1TS0A 5EOOA 5TGFA 2Z2MB 3NC8A 2Z6DA 3LIEA 5CEBA 4OPZA 3IS2B 1D7EA 3GR2A 5CERA 1VM1A 4CLCA 3EQUA 3ZHHA 1Y28A 2JKGA 4QD4A 1AXBA 2Q9NA 2JKRM 2W1TA 1IELA 5GHXA 3QP2A 2CC1A 4DN0A 4R3JA 2Z6CA 3LI8A 5AQBA 5F1FA 5CGWA 1JTGA 4BD1A 1IYSA 1W5DA 3G31A 3HLCA 2VGLM 4O7DA 1K6SA 1JWVA 4Y0TA 3EWKA 4B93A 3ZYTA 4CJNA 1K56D 3LI9A 2CMNA 3G30A 1DJCA 1M6KA 1I5QA 3AGDA 4JF6A 3T1XA 3B33A 4HIAA 3IBRA 3GVBA 1ES4A 4GHIB 1K57C 3S7NA 3MQQA 4EBNA 3C7VA 2B18A 1YLYA 1L0DA 1DJAA 4GNUA 5KSCA 4NK3A 4WL9A 3P7NA 3HUOA 3S7QA 5M19A 2WKRA 4H6JA 2J80A 1YLPA 4MN6A 4Y0UA 5HL6A 3QP8A 5EECA 1LLBA 1FCNA 4LENA 4P6ZM 4MNRA 4U3TA 2Y2KA 2HDRA 4KG5A 5LBRA 1HLUP 3U2AA 3FG8A 3MZDA 1K55A 4O01A 3H7WB 3TSGA 1AWIA 1IEMA 2ZOHA 4ZAMA 3N6IA 2PD7A 2X01A 1LSWA 4IBRA 2YKHA 2W3GA 2J3TD 3UB6A 1L0EA 1NLZA 1FCMA 1FR6A 3S22A 2JCHA 2XDMA 3NY4A 1G6AA 4B88A 1TDGA 3WS1A 2ZOIA 2C6WB 2HZ5A 4F3LB 5HAPA 5AQ9A 3IWIA 4KG2A 1VB6A 1KGFA 3V50A 1EROA 3UB5P 2GDNA 2AVXA 3LO7A 2R9WA 4NETA 1HD8A 2XQZA 1BUEA 1UGUA 4LCMA 5HD5A 1V9YA 4K0WA 4N1XA 3V67A 1ONGA 4BJPA 1KE3A 4IUHA 3D4FA 3HLBA 3ZG5A 5GHYA 3V5MA 3ZFZA 3DTKA 3OZHA 4HJ4A 2W1TB 3MS6A 4BL3A 4KUKA 4Y15A 1KOUA 4GB7A 5CGXA 1K55C 5E2FA 5E2EA 4Y2FA 3SH8A 5HWWA 1GCEA 1LI9A 1F5MA 3EOIA 4ZTKA 1YMSA 3UPOA 1GSVA 4DDYA 1J3WA 1PWGA 5C5KA 2WZZA 1DY6A 2XSSA 3R4KA 4LCLA 4RA7A 5FQJA 4QJGA 4OOLA 1VETB 3UN7A 1YPRA 4WELA 4KZ6A 3BLSA 2EWWA 3EQVA 4WZ4A 5FEFA 5G4YA 1LHYA 2Y2HA 2ZQ9A 2P08A 3F1NA 2JKTM 4I39A 3C2WA 3DBAA 2H0YA 3VFHA 1I2WA 1QMEA 4OP5A 4KZ7A 3UDIA 1WA9A 2OAQ1 1S67L 3UY6A 3W4PA 1RCJA 4GOGA 4EERA 1JWZA 5G4ZA 4Y0OA 1IFQA 3V39A 4L0LA 1SZVA 3LR5A 1OJ5A 4GZBA 5F5YA 3TJZC 2MJ6A 1T1CA 2XLNA 1T19A 4S2LA 4H8RA 3LY3A 1MPLA 4X56A 3S1YA 2V8CA 4MEZA 1K54A 1LSXA 4UEYA 4IHQA 2W1RA 5KZHA 3B3XA 3GMWA 5GL9A 2A24B 3G2ZA 4GLQA 5G18A 2VGJA 5F1GA 2ZMFA 5HL1A 1P0ZA 3ISGA 4UQIM 5AQ7A 2E8IA 5CTMA 2XK1A 4BBUA 3A0VA 5CECA 4MBHA 4AFIA 2KLIA 4MN5A 4Q0HA 2V20A 4R23A 3T4KA 3UE1A 2XA7S 5EVIB 2RL3A 4ETXA 1YT4A 4QWOA 2R9XA 3BEBA 4DE1A 1IYOA 3PTEA 3MJQA 4ZJ1A 3T1QB 2M1CA 1KE0A 5E2HA 2JC7A 3MQOA 3A3EA 5CXWA 3IXDA 4JGQA 2OSUA 5J4EA 3O88A 2HJ9C 2KOIA 3I7JA 1PW1A 5DTKA 1ERMA 3ITAA 5TR7A 3LR4A 5F6AA 3JPUA 3IF5A 3S4XA 3G4PA 4C75A 5HX9A 2B5RA 3DWKA 2J9PA 2ZQ8A 3PBOA 4WMCA 1NYYA 4FH4A 1ZG6A 3BY8A 3Q1FA 3NDGA 4EEPA 4YNRA 1NWZA 1IKGA 1KVMA 4P6BA 4QY6A 3UPNA 4HI4A 3RFBA 3L7HA 3VE4A 4HESA 3D9YA 4E3OA 1F98A 3NBLA 3NCKA 4IVIA 1H8MA 1PNEA 4R6LA 2GNXA 2QJ7A 4N9KA 3WRTA 4UHUA 1Z09A 5FAPA 1IYQA 3G6OA 3DWZA 5F68A 4F3LA 4HJ6A 2J8YA 1PZPA 2PD8A 3C4OA 1K54C 4GJ4A 4II7A 3ZG8B 2ZQDA 4KZ4A 5FAQA 5J8XA 2I9VA 3NJAA 4R3BA 1LI0A 4KQRA 1OMEA 1XJ2A 2WKQA 4Q0IA 2FFYA 4XUZA 4RYEA 2J7VA 4LGWA 4FSFA 1CF0A 2VJWA 5D3OA 3T4SA 4L9FA 3UB9A 5FSRA 3W2ZA 2H0TA 3V3SA 4WEJA 2HDUA 5HARA 1NRJA 1GHIA 4E3IA 2NUTC 1XP4A 5HWVA 1KGGA 4OQ0A 4S2JA 4GKUA 4U0XA 4X25A 3H9WA 3PAEA 4NKPA 4FCFA 1TS8A 2P9VB 3WWXA 1YM1A 4RQ9A 1P9RA 4X69A 4MLLA 3F1PB 3IF6C 1ACFA 4XT2A 3OPPA 3MKFA 4WZ5C 4DXBA 1G6OA 1ESIA 3CMZA 1OPXA 3BQ8A 3N7WA 4Y17A 1NYMA 4IEDA 1H8ZA 1SKFA 1FQGA 1ZTUA 3RXWA 1TVFA 3PBSA 3FYZA 3LYXA 4GN2A 4Q8IA 4LV1A 4K91A 2EX2A 3HCYA 3PBNA 2OWJA 2PR6A 1MKMA 1ONHA 4ZBEA 1O7EA 1YLWA 5FQQA 4ETZA 3VOLA 2DCFA 2PDRA 3LGOA 1GA0A 5FQIA 4CLCD 1BZAA 3S7PA 3B47A 3UMEA 2EXBA 4EWFA 2Y2LA 4WEKA 5I5LA 3UE0A 4NXGA 4PHTA 3GSGA 3EGXC 3HREA 3AGEA 2OAP1 4P6ZS 1RGYA 3BJNA 2W27A 3QP4A 1G5UA 4CPKA 4OPQA 4I3IA 5JYPA 3F1PA 1SKOA 1W79A 4KZBA 5E2GA 4OPRA 3CG5A 3PXPA 4DRTA 4Q0JA 4GW9A 4OQHA 2ZLYA 3PYPA 2A49A 3JVVA 2A24A 3BFFA 5FASA 1O07A 3H82B 4PM7A 4LPZA 4FTXA 2VGLS 1IOUA 2XROA 1G68A 4KUOA 3SW1A 3NHQA 4NXBA 5GLBA 2ZM0A 4JGRA 4EU0A 4EBPA 3OPLA 4KQDA 4R4SA 3W4QA 2ZMVA 1BYWA 3ZG0A 5F69A 4HBTA 3LICA 1L0FA 4BL2A 3O87A 5HDSA 3OLOA 1SDEA 5A91A 1KDSA 2WAFA 3MXRA 2FH5A 3ULFA 3BFGA 2PBYA 2EFUA 1SHVA 3CHWP 3FV7A 3WS4A 2WGVA 1D1JA 1K25A 2QWSA 3IX8A 5CEDA 3MXQA 3T4TA 2HP9A 2GJ3A 5FAOA 3MMHA 1VEUA 1G28A 2ZD8A 1XA7A 1PZOA 2PAVP 4KG6A 3R7WA 3IBJA 3Q7ZA 1ZG4A 4HP4A 4PM8A 2PYPA 4BENA 1VQQA 1OTAA 3A0SA 2ZC4B 2UWXA 1T1AA 5KIZA 3F1OA 1ES5A 4IBXA 2M7VA 3VP3A 1OTEA 2EWVA 1DP8A 3IX3A 5A90A 2DRWA 3CI6A 2Y2MA 2ZJ9A 2WGIA 1YAXA 4G3WA 2WKEA 2VX8A 4RX3A 3KYQA 4KENB 4EV4A 3NECA 3HUNA 4EUZA 4R3AA 4UQIS 4NXEA 1PRQA 4KZ5A 3TG9A 4GDNA 4OLDA 1LT0A 2HDQA 1MC0A 1D06A 4IUKA 3IXGA 5TBMA 1MBLA 5F82A 3HBRA 1OTBA 1T18A 4P87A 4Y7PA 4KQOA 2FZ0A 2G7UA 4XUXA 2O9CA 4N9LA 2D01A 4GHIA 1ODVA 3FPVA 1MWSA 3MFXA 5EOEA 3IHBA 3FC7A 2EA9A 3IF6A 5TBMB 2Y2QA 1TD5A 4PM5A 4O0PA 5EVLA 2VKSA 3K3DA 2B95A 4NG2A 5J3WA 5I94A 2NUPC 2O0YA 2VA0A 2XF3A 3LUQA 3KYEA 4WF0A 3FZCA 3VFFA 5EVEA 3WRZA 4FD8A 4PKYG 4KZ3A 3T50A 2WK0A 3K3CA 2ZC7A 4EETB 1X0OA 4ARZA 5HAQA 5FQMA 2P74A 4D2OA 3HJIA 4GCZA 4KQQA 2VV7A 4EQ1A 5GLAA 2Y2JA 5DF7A 5FL3A 2Y2IA 4WM9A 4CLCC 2ZBBA 3SZTA 2HP5A 4HQAA 4QPRA 2QJ5A 3VE3A 4QB8A 1HVBA 4BQMA 4S2MA 5J7EA 5A8BA 3UE6A 2J9OA 2XRNA 3M2JA 3NOPC 4WMCD 3QNCA 3OCNA 3IS2A 3RH8B 3CAXA 4R4RA 4OVDA 3HLWA 2I72A 2FFFB 4Z9QA 4B4ZA 2Y2OA 3U4LP 4MBFA 1ES3A 3KYZA 4K08A 1Z6FA 1W8QA 4HH2A 4JBFA 3LCEA 4M4XA 2IWCA 2HPBA 3PHYA 3IH8A 4B4XA 4DE0A 2EFXA 5AJGA 2GX5A 4IJGA 2JKFA 4LRYC 3S7OA 4BD0A 1JTDA 1S4SA 1MWTA 3OPHA 1LSVA 3EEAA 1MY8A 1K56A 2X71A 3BFDA 2PU2A 4ZRRA 4ME4A 4H6JB 3A3FA 2R78A 1VETA 4EUVA 1ES2A 4G3VA 3ZG7B 3SH9A 5FI7A 4OOYA 1BSGA 2X02A 4PPRA 2RCXA 3HLGA 4EBLA 3D3OA 1KGEA 3P09A 5M1AA 4DXCA 3JYIA 5JYOA 4YINA 2LB9A 3UPPA 2HJEA 3CWFA 5EE8A 2D02A 1WYCA 2JE5A 4BLMA 4E3NA 4OPYA 1EI5A 1ZKJA 2ZQAA 4WN5A 3LIAA 2H5SA 3C8CA 4LV3A 4DF6A 4CLCB 4I38A 4E3MA 2Y79A 1S4RA 3KSHA 5HZHA 3LIFA 1BULA 5HPFA 2Z2LB 4KZ8A 4WUJA 3FKWA 3VV4A 2WKPA 1FOFA 5DTTA 3Q7VB 2BLSA 4OP8A 4YWZA 4EEUA 2QHKA 4PM9A 2VK3A 4C3QA 5FI2A 2Y59A 1OT6A 1GSWA 3MKEA 1W7FA 5FQ9A 4HH3A 1SCWA 4D60A 2OLVA 4JPMA 5EM1A 2L1MA 5DJUA 1YQSA 5CRFA 2Y2GA 2VLGA 1YLTA 1FCOA 2ZQ7A 4BBVA 3ZQ5A 1V9ZA 3BW6A 3EGDC 4HY8A 5HDDA 2ACGA 1VHMA 3SS3A 3R7WB 3D72A 4PMAA 5FATA 5EV0A 3BLMA 3VP4A 2KDKA 2A2LA 3NOTC 4MCWA 4DKIA 2W3DA 1DRMA 2IA2A 4E6XA 4QHCA 3CPTB 2V0UA 1YSQA 4GDBA 3VP1A 1I2SA 4S2KA 3A0RA 4JXVA 1BLSA 3W4OA 5HD3A 3DTIA 1KVLA 3BQAA 1NJ4A 5EVIA 3UE3A 3HJKA 3PBTA 3E0YA 1YLJA 4E3LA 4BMWA 5U47A 3BFCA 3A3IA 3LIDA 1XJ6A 2INWA 5A93A 3F1NB 1PI5A 2EX8A 2PRFA 4JKTA 4RVAA 4ZJ3A 1UWNX 2V1BA 4I3JA 3GECA 3LY4A 2L4RA 3OC2A 3T1SA 4KZAA 4FH2A 4E3JA 1Q2QA 2VV8A 3GV9A 5FEGA 4GD8A 1FILA 3TOIA 3LEZA 3O86A 2XFTA 4OH0A 2OV5A 2HP6A 2PT7A 2WGWA 2XFSA 4YFMA 2ZM2A 3KSIA 3Q07A 2E8JA 3OOVA 3IX4A 1CJFA 3JVUA 4MBKA 2HV1A 3UDFA 3C38A 3FPWA 4X55A 1BLHA 4JXWA 4N1HA 4EESA 4JXGA 3CUEA 3GRJA 3ITBA 4DE2A 5DKKA 2O99A 4G3KA 3ZVWA 4QY5A 3KO6A 2OLUA 3ZCZA 2W3HA 3UO9A 5EVID 3M2KA 4OQIA 3VP0A 5EUAA 1RGZA 5K5BA 2EX9A 1S6RA 1YMXA 2W3EA 2HGVA 3ZNTA 4X1LA 5E43A 1XA1A 4PKYA 2PBDP 3OCLA 4LV0A 3C4PA 1L2SA 1MWUA 3G35A 4LV2A 1U60A 4PAUA 1K0KA 1K57A 3PAGA 3LEQA 2V1ZA 3MFDA 2JN7A 4DJ3A 1KDWA 3BYDA 1N9BA 3CITA 5L10A 1XFQA 2IWBA 1DJBA 2QKPA 3PR6A 3ZDJA 4WYYA 2H10A 3N8SA 2O9BA 4R70A 5CTNA 2EXAA 3MZFA 4UA9A 4ZDXA 3RXXA 1W8YA 4KZ9A 1TS6A 2BTFP 1HTZA 3SOIA 4Y13A 1LL9A 1C3BA 1XJ4A 3LR3A 3IXHA 1YLZA 5HSQA 2A3UA 5CHUA 2QZ6A 5DFXA 2GZAA 3KSGA 2VEAA 3IHAA 3P98A 4WLAA 4R0QA 4DJ2A 3P01A 2IWDA 1WYBA 3IXBA 3QNBA 1NZUA 4IVKA 4Z1WA 3ICYA 3SS5A 4E3KA 1YKDA 3T4QA 3MR0A 3T4JA 4P85A 2W3FA 1BT5A 3SS4A 4EQIA 2KX6A 2XA7M 4OOMA 1QMFA 4I3AA 3OPRA 1M40A 4Y5FA 3FWLA 4XT2B 1PFLA 3C7UA 4S2NA 1Q2PA 2VGKA 4JLFA 2DNSA 3H82A 3A3JA 4RX2A 2P9VA 1JNUA 4E6WA 4QU3A 3H7WA 2ZM8A 3MSHA 3PBQA 4E04A 1FSWA 3HLDA 5AVFA 1K4FA 2WKHA 5EVIC 3BRMA 4EXOA 5HPIA 4HNBA 4UA6A 2ZL1B 1GHMA 3ZG9B 4S2PA 1ESUA 1XGJA 3UB8A 2OOLA 3A3DA 4NEED 2ZC5B 1K38A 2V8FA 1N9OA 2K7SA 2JHEA 4UA7A 3Q7VA 1PWCA 2PHYA 5HWTA 4XXRA 1ALQA 4HBUA 2H28A 2K2NA 3T4OA 3UMDA 2XD1A 4WZ5A 1TDLA 3UB7A 1T1BA 1OTIA 4YOFA 3M6BA 1MXOA 1TEMA 4HJ3A 5FDSA 3QP5A 1ZHHB 5HW3A 1TF1A 4A5RA 1W63Q 2XR0A 2Y55A 1H8YA 1L3LA 1CQAA 1E3UD 3SH7A 3IF6B 1SKOB 3WS0A 5GLCA 4S2OA 5GHZA 3BFEA 3HVFA 5AVEA 3ZVTA 4OONA 4L9EA 1P97A 2V2FF 5L8MA 3WS2A 1KE4A 4FUWA 1Y4OA 2JKRI 1MWRA 4OLGA 5L09A 4PM6A 3B42A 1JWPA 3K2NA 3NI9A 1GSXA 5TFQA 4X6TA 1H0MA 2YKFA 3DW0A 2G2UA 1OJGA 1P9WA 2EX6A 3AGFA 3T4LA 1VEUB 1FSYA 4BBTA 5IS1A 2V9AA 2J3WA 2OWHA 4MMNA 4R1GA 3IT9A 3MZEA 5MC7A 1HZOA 3G2YA 3GQZA 1IYPA 4Y3IA 4L9GA 1S1YA 2Y4AA 4CLCE 4BWIA 4FOFA 1S66L 1IKIA 4X1MA 3GTCA 1CI9A 2WUQA 1SDNA 3MF0A 4EW7A 4LFUA 3RTYA 2P04A 1LL8A 4WBGA 4ESPA 2JKTI 2XEPA 1XJ3A 4JF5A 2XH9A 5CX7A 3LR0A 3HLFA 1J9MA 5TJJA 5HFOA 5F83A 1OT9A 3T1RA 1S1ZA 2J3TC 1TS7A 4HEFA 3CZDA 4JGPA 3VSKA 1L0GA 5A92A 4OQGA 3VOZA 3VSLA 4HP9A 3E4OA 2WZXA 3W8KA 1F9IA 3N8LA 1EW0A 2ZMAA 3VP2A 3IQAA 5KMWA 1XXMA 3BY9A 1NXYA 3BECA 4DE3A 2XGNA 3F1OB 3E4PA 2O9AA 1FIKA 4F94A 3Q82A 1GHPA 1PYYA 5DKLA 1FR1A 2P7JA 1BLPA 1N9NA 3V3RA 1DP9A 3OBFA 2V0WA 4JGOA 5IHVA 4C6YA 5EM0A 1XGIA 1GA9A 2WKIA 5L2FA 2Y2NA 4X68A 4CQHA 3MBZA 3C30A 5FQKA 3NDEA 3MXSA 4I5SA 3HLEA 1XPBA 1E3UA 3HUMA 1WE4A 2Y91A 5HDCA 1XFNA 1N4OA 5L07A 4NXFA 5AQAA 2M7UA 3G32A 3VOYA 2V1AA 2Y8HA 5DFYA 2W0NA 3CUEC 4U0TA 5BOHA 1JVJA 2WADA 4LRXC 3E2KA 3ZNYA 2WAEA 3IWQA 1MKIA 2BASA 2PR5A 1ERQA 3ZGAB 3CPTA 3TRCA 1STZA 4JF4A 2VZWA 2QPNA 3UNWA 1CEGA 3IWOA 5FA7A 1PIOA 1NZOA 5IT5A 4K0XA 1S0WA 2DMWA 4GD6A 1BTLA 4MN7A 1DP6A
chains in the Genus database with same CATH topology
4KENB 4GZBA 4EV4A 2XLNA 4JXGA 4S2LA 3HUNA 3GRJA 1XX2A 3ITBA 4DE2A 4EUZA 4H8RA 2HDSA 3LY3A 1MPLA 3ZVWA 4X56A 1NRFA 1NY0A 4KZ5A 3S1YA 4QY5A 4MEZA 2OLUA 3TG9A 3ZCZA 3UO9A 4GDNA 5A92A 3CJMA 1K54A 2HDQA 4OLDA 5EVID 3RJUA 3M2KA 5KZHA 3B3XA 3GMWA 4OQIA 5GL9A 3VP0A 5CHJA 3IXGA 5EUAA 3G2ZA 5G18A 1RGZA 1MBLA 5F82A 2VGJA 4UAAA 2EX9A 3HBRA 5F1GA 4P87A 1S6RA 1YMXA 3ZNTA 5HL1A 3N4IA 4Y7PA 4P0MA 5DVAA 3ISGA 4KQOA 5E43A 3BM6A 4XUXA 1K6RA 1XA1A 4N9LA 5AQ7A 2E8IA 3UDXA 5CTMA 1MWSA 5EOEA 1CI8A 3IHBA 3OCLA 2XK1A 3Q81A 3C5AA 4LV0A 3C4PA 1XKZA 1L2SA 3IF6A 1MWUA 3G35A 5CECA 1E25A 4M3KA 4MBHA 4LV2A 1K4EA 2Y2QA 1U60A 4PM5A 4ID4A 5EVLA 1K57A 3PAGA 5DF9A 2V20A 2QMIA 2V1ZA 4R23A 3UE1A 3MFDA 5FI6A 4ZJ2A 5I94A 3M6HA 1KDWA 4N92A 1E4DA 2Q9MA 5EVIB 2RL3A 2XF3A 1PWDA 1YT4A 2R9XA 3BYDA 3FZCA 3BEBA 4DE1A 1IYOA 3PTEA 1N9BA 1RP5A 2ZC3B 3E2LA 4ZJ1A 3VFFA 3WRZA 4FD8A 4KZ3A 5DTSA 2WK0A 1KE0A 2IWBA 3N8RA 5E2HA 1DJBA 2ZC7A 3ZDJA 2JC7A 4WYYA 2H10A 3A3EA 3N8SA 5CXWA 3IXDA 5HAQA 5CTNA 5FQMA 2EXAA 2XD5A 2OSUA 2P74A 4D2OA 3MZFA 4UA9A 4ZDXA 1PW8A 3O88A 4KQQA 3I7JA 3RXXA 1H5XA 1PW1A 2ZQCA 5DTKA 2ZC6B 3VMAA 1W8YA 5GLAA 1ERMA 2Y2JA 3FKVA 5DF7A 2Y2IA 4KZ9A 4WM9A 3DTMA 3ITAA 2C5WB 1HTZA 3G34A 5DF8A 5TR7A 5KSHA 3PBRA 3SOIA 1LL9A 1Y54A 5GLDA 1C3BA 3IF5A 2HP5A 3S4XA 3G4PA 4C75A 5HX9A 2WYXA 2B5RA 1BLCA 3DWKA 3IXHA 1YLZA 2J9PA 4QB8A 1CEFA 2Y2PA 2ZQ8A 3PBOA 2A3UA 4S2IA 4WMCA 1NYYA 4FH4A 5CHUA 1HVBA 3O3VA 4BQMA 2QZ6A 4S2MA 1ZG6A 1PI4A 3IHAA 3P98A 3Q1FA 4R0QA 3NDGA 5CGSA 2IWDA 2J9OA 1WYBA 3IH9A 3IXBA 3M2JA 3QNBA 1NZUA 4WMCD 3QNCA 4IVKA 4X53A 1IKGA 5FDHA 3NIAA 5EPHA 1LL5A 1KVMA 3OCNA 4P6BA 4QY6A 3SS5A 4E3KA 4JXSA 3UPNA 4R4RA 1EWZA 2JBFA 4P85A 4OVDA 1BT5A 3HLWA 4HESA 2I72A 3SS4A 4EQIA 2FFFB 5HAIA 4E3OA 3HL9A 4OOMA 3NBLA 4Z9QA 3NCKA 4B4ZA 2Y2OA 1QMFA 3OPRA 4IVIA 1M40A 4MBFA 3FWLA 4DDSA 1ES3A 3C7UA 4N9KA 1Q2PA 2VGKA 2BG1A 2G2WA 1Z6FA 4JLFA 4S2NA 2DNSA 4OKPA 1W8QA 3WRTA 3A3JA 4JBFA 1CK3A 3LCEA 4UHUA 5FAPA 2PU4A 2P9VA 4RX2A 1IYQA 2IWCA 2WGWB 4QU3A 4E6WA 2HPBA 2ZM8A 3DWZA 3WS5A 5CHMA 3PBQA 3QHYA 5M18A 1FSWA 1ZC2A 4S2NC 3IH8A 5EOOA 3HLDA 2EFXA 4B4XA 4DE0A 5TGFA 1K4FA 2J8YA 1PZPA 2Z2MB 3NC8A 3C4OA 1K54C 5CEBA 2WKHA 4OPZA 5EVIC 3ZG8B 2ZQDA 4KZ4A 3BRMA 5FAQA 5J8XA 3GR2A 5CERA 1VM1A 3EQUA 4R3BA 3ZHHA 1LI0A 4UA6A 4BD0A 1JTDA 4KQRA 1OMEA 1MWTA 1GHMA 4QD4A 3ZG9B 3OPHA 4S2PA 1AXBA 1ESUA 1XGJA 2Q9NA 3A3DA 2FFYA 1IELA 4XUZA 5GHXA 2ZC5B 1K38A 1MY8A 2CC1A 4RYEA 2J7VA 4R3JA 4FSFA 1K56A 2X71A 3BFDA 2PU2A 3Q7VA 1PWCA 4UA7A 5AQBA 5F1FA 4XXRA 1ALQA 5D3OA 4HBUA 5CGWA 3A3FA 5FSRA 1JTGA 2H0TA 3V3SA 4WEJA 4BD1A 1IYSA 2HDUA 1ES2A 5HARA 1W5DA 3G31A 1GHIA 3HLCA 4E3IA 4O7DA 3ZG7B 1K6SA 3SH9A 1XP4A 1JWVA 1KGGA 4OQ0A 4S2JA 5FI7A 2XD1A 4WZ5A 1TDLA 4OOYA 1BSGA 2X02A 4PPRA 4Y0TA 4GKUA 3M6BA 1MXOA 4U0XA 1TEMA 2RCXA 4CJNA 5HW3A 1K56D 3HLGA 3PAEA 4A5RA 4EBLA 4FCFA 1KGEA 2XR0A 2P9VB 3WWXA 2Y55A 1H8YA 3G30A 1YM1A 3P09A 1DJCA 1M6KA 1E3UD 3SH7A 4X69A 3IF6B 5M1AA 3WS0A 4MLLA 5GLCA 4S2OA 3IF6C 5GHZA 4DXCA 3JYIA 3OPPA 3MKFA 3BFEA 3HVFA 5JYOA 1I5QA 4WZ5C 4YINA 4DXBA 1ESIA 3AGDA 3CMZA 4JF6A 3UPPA 3ZVTA 5EE8A 4OONA 1WYCA 2JE5A 4BLMA 4E3NA 2V2FF 4OPYA 1EI5A 1ZKJA 3N7WA 3WS2A 2ZQAA 1KE4A 1NYMA 4IEDA 1H8ZA 1SKFA 3GVBA 1MWRA 4OLGA 1FQGA 1ES4A 1K57C 4PM6A 3RXWA 1JWPA 3NI9A 5TFQA 4EBNA 1TVFA 3C7VA 4X6TA 2H5SA 1YLYA 3PBSA 3FYZA 1L0DA 4GN2A 1DJAA 4GNUA 4LV3A 4DF6A 4Q8IA 4NK3A 5KSCA 3DW0A 4LV1A 4E3MA 4K91A 3HUOA 2EX2A 2G2UA 5M19A 3PBNA 1ONHA 1YLPA 4Y0UA 4ZBEA 1O7EA 1YLWA 5FQQA 2DCFA 1BULA 5EECA 2EX6A 1LLBA 1FCNA 3AGFA 4LENA 2Z2LB 1FSYA 4KZ8A 4MNRA 1GA0A 4U3TA 5FQIA 1BZAA 2Y2KA 2HDRA 2EXBA 4KG5A 4EWFA 3FKWA 2Y2LA 1FOFA 3MZDA 1K55A 4WEKA 4R1GA 5DTTA 3Q7VB 2BLSA 3UE0A 3IT9A 3GSGA 3MZEA 3TSGA 3HREA 1IEMA 3AGEA 4OP8A 4ZAMA 3N6IA 1HZOA 3G2YA 4PM9A 2X01A 3GQZA 4C3QA 1IYPA 1RGYA 4IBRA 2Y4AA 5FI2A 2Y59A 3MKEA 1IKIA 1W7FA 5FQ9A 1L0EA 3GTCA 1FCMA 1FR6A 3S22A 1CI9A 1SCWA 2JCHA 2XDMA 2WUQA 2OLVA 3NY4A 4JPMA 1G6AA 1SDNA 4B88A 1YQSA 4CPKA 1TDGA 4OPQA 5CRFA 2Y2GA 3WS1A 2C6WB 1YLTA 1FCOA 2ZQ7A 4WBGA 5JYPA 1W79A 4KZBA 5HAPA 5E2GA 2XEPA 5AQ9A 3IWIA 4KG2A 3SS3A 4OPRA 3CG5A 4JF5A 2XH9A 1KGFA 3V50A 1EROA 4DRTA 3HLFA 4PMAA 1J9MA 2GDNA 5FATA 3LO7A 5HFOA 3BLMA 2R9WA 4NETA 1HD8A 5F83A 3VP4A 4OQHA 2ZLYA 2XQZA 1BUEA 2A49A 4LCMA 4K0WA 4N1XA 4DKIA 4HEFA 3BFFA 5FASA 3CZDA 1O07A 1ONGA 4PM7A 1KE3A 1L0GA 3D4FA 4QHCA 3HLBA 4OQGA 3VSKA 3ZG5A 4BJPA 4E6XA 5GHYA 3VOZA 3VSLA 4GDBA 3V5MA 3VP1A 2WZXA 3W8KA 3N8LA 2ZMAA 1G68A 3VP2A 3IQAA 5KMWA 3ZFZA 1XXMA 3OZHA 1I2SA 4S2KA 1NXYA 3BECA 4DE3A 5GLBA 4BL3A 2ZM0A 2XGNA 4GB7A 5CGXA 1K55C 4EBPA 3OPLA 4F94A 4JXVA 3Q82A 1BLSA 4R4SA 5E2FA 5E2EA 3W4QA 3W4OA 3SH8A 1GHPA 1PYYA 1KVLA 3ZG0A 1GCEA 4HBTA 1FR1A 1NJ4A 5EVIA 3UE3A 1BLPA 1L0FA 1LI9A 4BL2A 3O87A 3PBTA 3V3RA 1SDEA 1YLJA 4ZTKA 5A91A 4E3LA 1YMSA 3UPOA 5U47A 1KDSA 3BFCA 2WAFA 3A3IA 3MXRA 4DDYA 5A93A 5IHVA 4C6YA 1PWGA 3BFGA 1PI5A 1XGIA 1GA9A 2WKIA 2EX8A 2WZZA 5L2FA 1DY6A 2PBYA 2Y2NA 2EFUA 1SHVA 4LCLA 4X68A 3FV7A 4RA7A 5FQJA 4QJGA 4JKTA 4RVAA 3MBZA 4OOLA 3WS4A 3UN7A 2WGVA 4WELA 5FQKA 4KZ6A 3NDEA 4ZJ3A 3MXSA 1K25A 3HLEA 1XPBA 1E3UA 3BLSA 3HUMA 3LY4A 1WE4A 5CEDA 2Y91A 3OC2A 2HP9A 1N4OA 3EQVA 4WZ4A 5FAOA 4KZAA 4FH2A 4E3JA 1Q2QA 2ZD8A 1XA7A 1PZOA 1LHYA 3GV9A 5AQAA 4KG6A 3G32A 2Y2HA 4GD8A 3VOYA 2ZQ9A 3TOIA 3LEZA 3Q7ZA 3O86A 1ZG4A 2XFTA 4OH0A 4U0TA 2OV5A 5BOHA 1JVJA 2HP6A 2WADA 4PM8A 4BENA 1VQQA 2WGWA 2XFSA 4YFMA 2ZM2A 2ZC4B 3E2KA 2H0YA 3ZNYA 2WAEA 3IWQA 3VFHA 1I2WA 1MKIA 2UWXA 3Q07A 1QMEA 1ERQA 4OP5A 3ZGAB 1ES5A 4IBXA 3VP3A 4KZ7A 3UDIA 4JF4A 2QPNA 3UNWA 1CEGA 5A90A 3UY6A 2DRWA 3W4PA 3IWOA 1RCJA 4GOGA 4MBKA 5FA7A 1PIOA 3UDFA 2Y2MA 1JWZA 1NZOA 4K0XA 2ZJ9A 2WGIA 4X55A 4Y0OA 1BLHA 4JXWA 3V39A 4L0LA 2WKEA 1S0WA 4GD6A 1BTLA 4RX3A 4N1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEN B;  4GZB A;  4EV4 A;  2XLN A;  4JXG A;  4S2L A;  3HUN A;  3GRJ A;  1XX2 A;  3ITB A;  4DE2 A;  4EUZ A;  4H8R A;  2HDS A;  3LY3 A;  1MPL A;  3ZVW A;  4X56 A;  1NRF A;  1NY0 A;  4KZ5 A;  3S1Y A;  4QY5 A;  4MEZ A;  2OLU A;  3TG9 A;  3ZCZ A;  3UO9 A;  4GDN A;  5A92 A;  3CJM A;  1K54 A;  2HDQ A;  4OLD A;  5EVI D;  3RJU A;  3M2K A;  5KZH A;  3B3X A;  3GMW A;  4OQI A;  5GL9 A;  3VP0 A;  5CHJ A;  3IXG A;  5EUA A;  3G2Z A;  5G18 A;  1RGZ A;  1MBL A;  5F82 A;  2VGJ A;  4UAA A;  2EX9 A;  3HBR A;  5F1G A;  4P87 A;  1S6R A;  1YMX A;  3ZNT A;  5HL1 A;  3N4I A;  4Y7P A;  4P0M A;  5DVA A;  3ISG A;  4KQO A;  5E43 A;  3BM6 A;  4XUX A;  1K6R A;  1XA1 A;  4N9L A;  5AQ7 A;  2E8I A;  3UDX A;  5CTM A;  1MWS A;  5EOE A;  1CI8 A;  3IHB A;  3OCL A;  2XK1 A;  3Q81 A;  3C5A A;  4LV0 A;  3C4P A;  1XKZ A;  1L2S A;  3IF6 A;  1MWU A;  3G35 A;  5CEC A;  1E25 A;  4M3K A;  4MBH A;  4LV2 A;  1K4E A;  2Y2Q A;  1U60 A;  4PM5 A;  4ID4 A;  5EVL A;  1K57 A;  3PAG A;  5DF9 A;  2V20 A;  2QMI A;  2V1Z A;  4R23 A;  3UE1 A;  3MFD A;  5FI6 A;  4ZJ2 A;  5I94 A;  3M6H A;  1KDW A;  4N92 A;  1E4D A;  2Q9M A;  5EVI B;  2RL3 A;  2XF3 A;  1PWD A;  1YT4 A;  2R9X A;  3BYD A;  3FZC A;  3BEB A;  4DE1 A;  1IYO A;  3PTE A;  1N9B A;  1RP5 A;  2ZC3 B;  3E2L A;  4ZJ1 A;  3VFF A;  3WRZ A;  4FD8 A;  4KZ3 A;  5DTS A;  2WK0 A;  1KE0 A;  2IWB A;  3N8R A;  5E2H A;  1DJB A;  2ZC7 A;  3ZDJ A;  2JC7 A;  4WYY A;  2H10 A;  3A3E A;  3N8S A;  5CXW A;  3IXD A;  5HAQ A;  5CTN A;  5FQM A;  2EXA A;  2XD5 A;  2OSU A;  2P74 A;  4D2O A;  3MZF A;  4UA9 A;  4ZDX A;  1PW8 A;  3O88 A;  4KQQ A;  3I7J A;  3RXX A;  1H5X A;  1PW1 A;  2ZQC A;  5DTK A;  2ZC6 B;  3VMA A;  1W8Y A;  5GLA A;  1ERM A;  2Y2J A;  3FKV A;  5DF7 A;  2Y2I A;  4KZ9 A;  4WM9 A;  3DTM A;  3ITA A;  2C5W B;  1HTZ A;  3G34 A;  5DF8 A;  5TR7 A;  5KSH A;  3PBR A;  3SOI A;  1LL9 A;  1Y54 A;  5GLD A;  1C3B A;  3IF5 A;  2HP5 A;  3S4X A;  3G4P A;  4C75 A;  5HX9 A;  2WYX A;  2B5R A;  1BLC A;  3DWK A;  3IXH A;  1YLZ A;  2J9P A;  4QB8 A;  1CEF A;  2Y2P A;  2ZQ8 A;  3PBO A;  2A3U A;  4S2I A;  4WMC A;  1NYY A;  4FH4 A;  5CHU A;  1HVB A;  3O3V A;  4BQM A;  2QZ6 A;  4S2M A;  1ZG6 A;  1PI4 A;  3IHA A;  3P98 A;  3Q1F A;  4R0Q A;  3NDG A;  5CGS A;  2IWD A;  2J9O A;  1WYB A;  3IH9 A;  3IXB A;  3M2J A;  3QNB A;  1NZU A;  4WMC D;  3QNC A;  4IVK A;  4X53 A;  1IKG A;  5FDH A;  3NIA A;  5EPH A;  1LL5 A;  1KVM A;  3OCN A;  4P6B A;  4QY6 A;  3SS5 A;  4E3K A;  4JXS A;  3UPN A;  4R4R A;  1EWZ A;  2JBF A;  4P85 A;  4OVD A;  1BT5 A;  3HLW A;  4HES A;  2I72 A;  3SS4 A;  4EQI A;  2FFF B;  5HAI A;  4E3O A;  3HL9 A;  4OOM A;  3NBL A;  4Z9Q A;  3NCK A;  4B4Z A;  2Y2O A;  1QMF A;  3OPR A;  4IVI A;  1M40 A;  4MBF A;  3FWL A;  4DDS A;  1ES3 A;  3C7U A;  4N9K A;  1Q2P A;  2VGK A;  2BG1 A;  2G2W A;  1Z6F A;  4JLF A;  4S2N A;  2DNS A;  4OKP A;  1W8Q A;  3WRT A;  3A3J A;  4JBF A;  1CK3 A;  3LCE A;  4UHU A;  5FAP A;  2PU4 A;  2P9V A;  4RX2 A;  1IYQ A;  2IWC A;  2WGW B;  4QU3 A;  4E6W A;  2HPB A;  2ZM8 A;  3DWZ A;  3WS5 A;  5CHM A;  3PBQ A;  3QHY A;  5M18 A;  1FSW A;  1ZC2 A;  4S2N C;  3IH8 A;  5EOO A;  3HLD A;  2EFX A;  4B4X A;  4DE0 A;  5TGF A;  1K4F A;  2J8Y A;  1PZP A;  2Z2M B;  3NC8 A;  3C4O A;  1K54 C;  5CEB A;  2WKH A;  4OPZ A;  5EVI C;  3ZG8 B;  2ZQD A;  4KZ4 A;  3BRM A;  5FAQ A;  5J8X A;  3GR2 A;  5CER A;  1VM1 A;  3EQU A;  4R3B A;  3ZHH A;  1LI0 A;  4UA6 A;  4BD0 A;  1JTD A;  4KQR A;  1OME A;  1MWT A;  1GHM A;  4QD4 A;  3ZG9 B;  3OPH A;  4S2P A;  1AXB A;  1ESU A;  1XGJ A;  2Q9N A;  3A3D A;  2FFY A;  1IEL A;  4XUZ A;  5GHX A;  2ZC5 B;  1K38 A;  1MY8 A;  2CC1 A;  4RYE A;  2J7V A;  4R3J A;  4FSF A;  1K56 A;  2X71 A;  3BFD A;  2PU2 A;  3Q7V A;  1PWC A;  4UA7 A;  5AQB A;  5F1F A;  4XXR A;  1ALQ A;  5D3O A;  4HBU A;  5CGW A;  3A3F A;  5FSR A;  1JTG A;  2H0T A;  3V3S A;  4WEJ A;  4BD1 A;  1IYS A;  2HDU A;  1ES2 A;  5HAR A;  1W5D A;  3G31 A;  1GHI A;  3HLC A;  4E3I A;  4O7D A;  3ZG7 B;  1K6S A;  3SH9 A;  1XP4 A;  1JWV A;  1KGG A;  4OQ0 A;  4S2J A;  5FI7 A;  2XD1 A;  4WZ5 A;  1TDL A;  4OOY A;  1BSG A;  2X02 A;  4PPR A;  4Y0T A;  4GKU A;  3M6B A;  1MXO A;  4U0X A;  1TEM A;  2RCX A;  4CJN A;  5HW3 A;  1K56 D;  3HLG A;  3PAE A;  4A5R A;  4EBL A;  4FCF A;  1KGE A;  2XR0 A;  2P9V B;  3WWX A;  2Y55 A;  1H8Y A;  3G30 A;  1YM1 A;  3P09 A;  1DJC A;  1M6K A;  1E3U D;  3SH7 A;  4X69 A;  3IF6 B;  5M1A A;  3WS0 A;  4MLL A;  5GLC A;  4S2O A;  3IF6 C;  5GHZ A;  4DXC A;  3JYI A;  3OPP A;  3MKF A;  3BFE A;  3HVF A;  5JYO A;  1I5Q A;  4WZ5 C;  4YIN A;  4DXB A;  1ESI A;  3AGD A;  3CMZ A;  4JF6 A;  3UPP A;  3ZVT A;  5EE8 A;  4OON A;  1WYC A;  2JE5 A;  4BLM A;  4E3N A;  2V2F F;  4OPY A;  1EI5 A;  1ZKJ A;  3N7W A;  3WS2 A;  2ZQA A;  1KE4 A;  1NYM A;  4IED A;  1H8Z A;  1SKF A;  3GVB A;  1MWR A;  4OLG A;  1FQG A;  1ES4 A;  1K57 C;  4PM6 A;  3RXW A;  1JWP A;  3NI9 A;  5TFQ A;  4EBN A;  1TVF A;  3C7V A;  4X6T A;  2H5S A;  1YLY A;  3PBS A;  3FYZ A;  1L0D A;  4GN2 A;  1DJA A;  4GNU A;  4LV3 A;  4DF6 A;  4Q8I A;  4NK3 A;  5KSC A;  3DW0 A;  4LV1 A;  4E3M A;  4K91 A;  3HUO A;  2EX2 A;  2G2U A;  5M19 A;  3PBN A;  1ONH A;  1YLP A;  4Y0U A;  4ZBE A;  1O7E A;  1YLW A;  5FQQ A;  2DCF A;  1BUL A;  5EEC A;  2EX6 A;  1LLB A;  1FCN A;  3AGF A;  4LEN A;  2Z2L B;  1FSY A;  4KZ8 A;  4MNR A;  1GA0 A;  4U3T A;  5FQI A;  1BZA A;  2Y2K A;  2HDR A;  2EXB A;  4KG5 A;  4EWF A;  3FKW A;  2Y2L A;  1FOF A;  3MZD A;  1K55 A;  4WEK A;  4R1G A;  5DTT A;  3Q7V B;  2BLS A;  3UE0 A;  3IT9 A;  3GSG A;  3MZE A;  3TSG A;  3HRE A;  1IEM A;  3AGE A;  4OP8 A;  4ZAM A;  3N6I A;  1HZO A;  3G2Y A;  4PM9 A;  2X01 A;  3GQZ A;  4C3Q A;  1IYP A;  1RGY A;  4IBR A;  2Y4A A;  5FI2 A;  2Y59 A;  3MKE A;  1IKI A;  1W7F A;  5FQ9 A;  1L0E A;  3GTC A;  1FCM A;  1FR6 A;  3S22 A;  1CI9 A;  1SCW A;  2JCH A;  2XDM A;  2WUQ A;  2OLV A;  3NY4 A;  4JPM A;  1G6A A;  1SDN A;  4B88 A;  1YQS A;  4CPK A;  1TDG A;  4OPQ A;  5CRF A;  2Y2G A;  3WS1 A;  2C6W B;  1YLT A;  1FCO A;  2ZQ7 A;  4WBG A;  5JYP A;  1W79 A;  4KZB A;  5HAP A;  5E2G A;  2XEP A;  5AQ9 A;  3IWI A;  4KG2 A;  3SS3 A;  4OPR A;  3CG5 A;  4JF5 A;  2XH9 A;  1KGF A;  3V50 A;  1ERO A;  4DRT A;  3HLF A;  4PMA A;  1J9M A;  2GDN A;  5FAT A;  3LO7 A;  5HFO A;  3BLM A;  2R9W A;  4NET A;  1HD8 A;  5F83 A;  3VP4 A;  4OQH A;  2ZLY A;  2XQZ A;  1BUE A;  2A49 A;  4LCM A;  4K0W A;  4N1X A;  4DKI A;  4HEF A;  3BFF A;  5FAS A;  3CZD A;  1O07 A;  1ONG A;  4PM7 A;  1KE3 A;  1L0G A;  3D4F A;  4QHC A;  3HLB A;  4OQG A;  3VSK A;  3ZG5 A;  4BJP A;  4E6X A;  5GHY A;  3VOZ A;  3VSL A;  4GDB A;  3V5M A;  3VP1 A;  2WZX A;  3W8K A;  3N8L A;  2ZMA A;  1G68 A;  3VP2 A;  3IQA A;  5KMW A;  3ZFZ A;  1XXM A;  3OZH A;  1I2S A;  4S2K A;  1NXY A;  3BEC A;  4DE3 A;  5GLB A;  4BL3 A;  2ZM0 A;  2XGN A;  4GB7 A;  5CGX A;  1K55 C;  4EBP A;  3OPL A;  4F94 A;  4JXV A;  3Q82 A;  1BLS A;  4R4S A;  5E2F A;  5E2E A;  3W4Q A;  3W4O A;  3SH8 A;  1GHP A;  1PYY A;  1KVL A;  3ZG0 A;  1GCE A;  4HBT A;  1FR1 A;  1NJ4 A;  5EVI A;  3UE3 A;  1BLP A;  1L0F A;  1LI9 A;  4BL2 A;  3O87 A;  3PBT A;  3V3R A;  1SDE A;  1YLJ A;  4ZTK A;  5A91 A;  4E3L A;  1YMS A;  3UPO A;  5U47 A;  1KDS A;  3BFC A;  2WAF A;  3A3I A;  3MXR A;  4DDY A;  5A93 A;  5IHV A;  4C6Y A;  1PWG A;  3BFG A;  1PI5 A;  1XGI A;  1GA9 A;  2WKI A;  2EX8 A;  2WZZ A;  5L2F A;  1DY6 A;  2PBY A;  2Y2N A;  2EFU A;  1SHV A;  4LCL A;  4X68 A;  3FV7 A;  4RA7 A;  5FQJ A;  4QJG A;  4JKT A;  4RVA A;  3MBZ A;  4OOL A;  3WS4 A;  3UN7 A;  2WGV A;  4WEL A;  5FQK A;  4KZ6 A;  3NDE A;  4ZJ3 A;  3MXS A;  1K25 A;  3HLE A;  1XPB A;  1E3U A;  3BLS A;  3HUM A;  3LY4 A;  1WE4 A;  5CED A;  2Y91 A;  3OC2 A;  2HP9 A;  1N4O A;  3EQV A;  4WZ4 A;  5FAO A;  4KZA A;  4FH2 A;  4E3J A;  1Q2Q A;  2ZD8 A;  1XA7 A;  1PZO A;  1LHY A;  3GV9 A;  5AQA A;  4KG6 A;  3G32 A;  2Y2H A;  4GD8 A;  3VOY A;  2ZQ9 A;  3TOI A;  3LEZ A;  3Q7Z A;  3O86 A;  1ZG4 A;  2XFT A;  4OH0 A;  4U0T A;  2OV5 A;  5BOH A;  1JVJ A;  2HP6 A;  2WAD A;  4PM8 A;  4BEN A;  1VQQ A;  2WGW A;  2XFS A;  4YFM A;  2ZM2 A;  2ZC4 B;  3E2K A;  2H0Y A;  3ZNY A;  2WAE A;  3IWQ A;  3VFH A;  1I2W A;  1MKI A;  2UWX A;  3Q07 A;  1QME A;  1ERQ A;  4OP5 A;  3ZGA B;  1ES5 A;  4IBX A;  3VP3 A;  4KZ7 A;  3UDI A;  4JF4 A;  2QPN A;  3UNW A;  1CEG A;  5A90 A;  3UY6 A;  2DRW A;  3W4P A;  3IWO A;  1RCJ A;  4GOG A;  4MBK A;  5FA7 A;  1PIO A;  3UDF A;  2Y2M A;  1JWZ A;  1NZO A;  4K0X A;  2ZJ9 A;  2WGI A;  4X55 A;  4Y0O A;  1BLH A;  4JXW A;  3V39 A;  4L0L A;  2WKE A;  1S0W A;  4GD6 A;  1BTL A;  4RX3 A;  4N1H A; 
#chains in the Genus database with same CATH topology
 4ARZ B;  3DAV A;  4O8G A;  4HOI A;  1XX2 A;  3DTE A;  2HDS A;  4GS9 B;  4B9O A;  1NRF A;  1NY0 A;  1UWP X;  2PYR A;  3NOU C;  3CJM A;  3RJU A;  1F2K A;  5CHJ A;  3KSF A;  2UV0 E;  4UAA A;  5IU1 A;  3N4I A;  4P0M A;  5DVA A;  3BM6 A;  4MDZ A;  1K6R A;  3TE8 A;  3UDX A;  1OTD A;  2K31 A;  1CI8 A;  3Q81 A;  3C5A A;  1XKZ A;  1E25 A;  4M3K A;  1K4E A;  4ID4 A;  5DF9 A;  2QMI A;  5FI6 A;  4ZJ2 A;  3KX0 X;  3M6H A;  4N92 A;  1E4D A;  2Q9M A;  1PWD A;  1RP5 A;  3E2L A;  2ZC3 B;  3O5Y A;  3LIB A;  5DTS A;  3N8R A;  3L9K A;  2XD5 A;  4HHD A;  1PW8 A;  3TW8 A;  1H5X A;  2ZQC A;  2ZC6 B;  3VMA A;  3FKV A;  1W63 M;  3DTM A;  2C5W B;  3G34 A;  5DF8 A;  5KSH A;  1NLY A;  3PBR A;  1H3Q A;  3QP6 A;  1Y54 A;  5GLD A;  1MZU A;  5EFW A;  4LRZ E;  3T12 B;  2QYB A;  2WYX A;  1BLC A;  1CEF A;  2Y2P A;  4S2I A;  3O3V A;  3LFV A;  1PI4 A;  4DMZ A;  4LLO B;  4GS9 A;  3NUL A;  5CGS A;  3IH9 A;  3MQ0 A;  4X53 A;  3E4Q A;  5FDH A;  1N9L A;  2LB5 A;  3NIA A;  5EPH A;  1LL5 A;  2B02 A;  4JXS A;  1EWZ A;  3BWL A;  2JBF A;  2HF6 A;  3GDI A;  5HAI A;  3HL9 A;  3QP1 A;  5DJT A;  2Q0O A;  3EEH A;  4DDS A;  2L0W A;  2VV6 A;  3E98 A;  2BG1 A;  2G2W A;  4OKP A;  1A0K A;  2ZL1 A;  1CK3 A;  4R38 A;  2PU4 A;  2WGW B;  3CLO A;  1YSP A;  3WS5 A;  5CHM A;  3QHY A;  5M18 A;  1ZC2 A;  4S2N C;  1TS0 A;  5EOO A;  5TGF A;  2Z2M B;  3NC8 A;  2Z6D A;  3LIE A;  5CEB A;  4OPZ A;  3IS2 B;  1D7E A;  3GR2 A;  5CER A;  1VM1 A;  4CLC A;  3EQU A;  3ZHH A;  1Y28 A;  2JKG A;  4QD4 A;  1AXB A;  2Q9N A;  2JKR M;  2W1T A;  1IEL A;  5GHX A;  3QP2 A;  2CC1 A;  4DN0 A;  4R3J A;  2Z6C A;  3LI8 A;  5AQB A;  5F1F A;  5CGW A;  1JTG A;  4BD1 A;  1IYS A;  1W5D A;  3G31 A;  3HLC A;  2VGL M;  4O7D A;  1K6S A;  1JWV A;  4Y0T A;  3EWK A;  4B93 A;  3ZYT A;  4CJN A;  1K56 D;  3LI9 A;  2CMN A;  3G30 A;  1DJC A;  1M6K A;  1I5Q A;  3AGD A;  4JF6 A;  3T1X A;  3B33 A;  4HIA A;  3IBR A;  3GVB A;  1ES4 A;  4GHI B;  1K57 C;  3S7N A;  3MQQ A;  4EBN A;  3C7V A;  2B18 A;  1YLY A;  1L0D A;  1DJA A;  4GNU A;  5KSC A;  4NK3 A;  4WL9 A;  3P7N A;  3HUO A;  3S7Q A;  5M19 A;  2WKR A;  4H6J A;  2J80 A;  1YLP A;  4MN6 A;  4Y0U A;  5HL6 A;  3QP8 A;  5EEC A;  1LLB A;  1FCN A;  4LEN A;  4P6Z M;  4MNR A;  4U3T A;  2Y2K A;  2HDR A;  4KG5 A;  5LBR A;  1HLU P;  3U2A A;  3FG8 A;  3MZD A;  1K55 A;  4O01 A;  3H7W B;  3TSG A;  1AWI A;  1IEM A;  2ZOH A;  4ZAM A;  3N6I A;  2PD7 A;  2X01 A;  1LSW A;  4IBR A;  2YKH A;  2W3G A;  2J3T D;  3UB6 A;  1L0E A;  1NLZ A;  1FCM A;  1FR6 A;  3S22 A;  2JCH A;  2XDM A;  3NY4 A;  1G6A A;  4B88 A;  1TDG A;  3WS1 A;  2ZOI A;  2C6W B;  2HZ5 A;  4F3L B;  5HAP A;  5AQ9 A;  3IWI A;  4KG2 A;  1VB6 A;  1KGF A;  3V50 A;  1ERO A;  3UB5 P;  2GDN A;  2AVX A;  3LO7 A;  2R9W A;  4NET A;  1HD8 A;  2XQZ A;  1BUE A;  1UGU A;  4LCM A;  5HD5 A;  1V9Y A;  4K0W A;  4N1X A;  3V67 A;  1ONG A;  4BJP A;  1KE3 A;  4IUH A;  3D4F A;  3HLB A;  3ZG5 A;  5GHY A;  3V5M A;  3ZFZ A;  3DTK A;  3OZH A;  4HJ4 A;  2W1T B;  3MS6 A;  4BL3 A;  4KUK A;  4Y15 A;  1KOU A;  4GB7 A;  5CGX A;  1K55 C;  5E2F A;  5E2E A;  4Y2F A;  3SH8 A;  5HWW A;  1GCE A;  1LI9 A;  1F5M A;  3EOI A;  4ZTK A;  1YMS A;  3UPO A;  1GSV A;  4DDY A;  1J3W A;  1PWG A;  5C5K A;  2WZZ A;  1DY6 A;  2XSS A;  3R4K A;  4LCL A;  4RA7 A;  5FQJ A;  4QJG A;  4OOL A;  1VET B;  3UN7 A;  1YPR A;  4WEL A;  4KZ6 A;  3BLS A;  2EWW A;  3EQV A;  4WZ4 A;  5FEF A;  5G4Y A;  1LHY A;  2Y2H A;  2ZQ9 A;  2P08 A;  3F1N A;  2JKT M;  4I39 A;  3C2W A;  3DBA A;  2H0Y A;  3VFH A;  1I2W A;  1QME A;  4OP5 A;  4KZ7 A;  3UDI A;  1WA9 A;  2OAQ 1;  1S67 L;  3UY6 A;  3W4P A;  1RCJ A;  4GOG A;  4EER A;  1JWZ A;  5G4Z A;  4Y0O A;  1IFQ A;  3V39 A;  4L0L A;  1SZV A;  3LR5 A;  1OJ5 A;  4GZB A;  5F5Y A;  3TJZ C;  2MJ6 A;  1T1C A;  2XLN A;  1T19 A;  4S2L A;  4H8R A;  3LY3 A;  1MPL A;  4X56 A;  3S1Y A;  2V8C A;  4MEZ A;  1K54 A;  1LSX A;  4UEY A;  4IHQ A;  2W1R A;  5KZH A;  3B3X A;  3GMW A;  5GL9 A;  2A24 B;  3G2Z A;  4GLQ A;  5G18 A;  2VGJ A;  5F1G A;  2ZMF A;  5HL1 A;  1P0Z A;  3ISG A;  4UQI M;  5AQ7 A;  2E8I A;  5CTM A;  2XK1 A;  4BBU A;  3A0V A;  5CEC A;  4MBH A;  4AFI A;  2KLI A;  4MN5 A;  4Q0H A;  2V20 A;  4R23 A;  3T4K A;  3UE1 A;  2XA7 S;  5EVI B;  2RL3 A;  4ETX A;  1YT4 A;  4QWO A;  2R9X A;  3BEB A;  4DE1 A;  1IYO A;  3PTE A;  3MJQ A;  4ZJ1 A;  3T1Q B;  2M1C A;  1KE0 A;  5E2H A;  2JC7 A;  3MQO A;  3A3E A;  5CXW A;  3IXD A;  4JGQ A;  2OSU A;  5J4E A;  3O88 A;  2HJ9 C;  2KOI A;  3I7J A;  1PW1 A;  5DTK A;  1ERM A;  3ITA A;  5TR7 A;  3LR4 A;  5F6A A;  3JPU A;  3IF5 A;  3S4X A;  3G4P A;  4C75 A;  5HX9 A;  2B5R A;  3DWK A;  2J9P A;  2ZQ8 A;  3PBO A;  4WMC A;  1NYY A;  4FH4 A;  1ZG6 A;  3BY8 A;  3Q1F A;  3NDG A;  4EEP A;  4YNR A;  1NWZ A;  1IKG A;  1KVM A;  4P6B A;  4QY6 A;  3UPN A;  4HI4 A;  3RFB A;  3L7H A;  3VE4 A;  4HES A;  3D9Y A;  4E3O A;  1F98 A;  3NBL A;  3NCK A;  4IVI A;  1H8M A;  1PNE A;  4R6L A;  2GNX A;  2QJ7 A;  4N9K A;  3WRT A;  4UHU A;  1Z09 A;  5FAP A;  1IYQ A;  3G6O A;  3DWZ A;  5F68 A;  4F3L A;  4HJ6 A;  2J8Y A;  1PZP A;  2PD8 A;  3C4O A;  1K54 C;  4GJ4 A;  4II7 A;  3ZG8 B;  2ZQD A;  4KZ4 A;  5FAQ A;  5J8X A;  2I9V A;  3NJA A;  4R3B A;  1LI0 A;  4KQR A;  1OME A;  1XJ2 A;  2WKQ A;  4Q0I A;  2FFY A;  4XUZ A;  4RYE A;  2J7V A;  4LGW A;  4FSF A;  1CF0 A;  2VJW A;  5D3O A;  3T4S A;  4L9F A;  3UB9 A;  5FSR A;  3W2Z A;  2H0T A;  3V3S A;  4WEJ A;  2HDU A;  5HAR A;  1NRJ A;  1GHI A;  4E3I A;  2NUT C;  1XP4 A;  5HWV A;  1KGG A;  4OQ0 A;  4S2J A;  4GKU A;  4U0X A;  4X25 A;  3H9W A;  3PAE A;  4NKP A;  4FCF A;  1TS8 A;  2P9V B;  3WWX A;  1YM1 A;  4RQ9 A;  1P9R A;  4X69 A;  4MLL A;  3F1P B;  3IF6 C;  1ACF A;  4XT2 A;  3OPP A;  3MKF A;  4WZ5 C;  4DXB A;  1G6O A;  1ESI A;  3CMZ A;  1OPX A;  3BQ8 A;  3N7W A;  4Y17 A;  1NYM A;  4IED A;  1H8Z A;  1SKF A;  1FQG A;  1ZTU A;  3RXW A;  1TVF A;  3PBS A;  3FYZ A;  3LYX A;  4GN2 A;  4Q8I A;  4LV1 A;  4K91 A;  2EX2 A;  3HCY A;  3PBN A;  2OWJ A;  2PR6 A;  1MKM A;  1ONH A;  4ZBE A;  1O7E A;  1YLW A;  5FQQ A;  4ETZ A;  3VOL A;  2DCF A;  2PDR A;  3LGO A;  1GA0 A;  5FQI A;  4CLC D;  1BZA A;  3S7P A;  3B47 A;  3UME A;  2EXB A;  4EWF A;  2Y2L A;  4WEK A;  5I5L A;  3UE0 A;  4NXG A;  4PHT A;  3GSG A;  3EGX C;  3HRE A;  3AGE A;  2OAP 1;  4P6Z S;  1RGY A;  3BJN A;  2W27 A;  3QP4 A;  1G5U A;  4CPK A;  4OPQ A;  4I3I A;  5JYP A;  3F1P A;  1SKO A;  1W79 A;  4KZB A;  5E2G A;  4OPR A;  3CG5 A;  3PXP A;  4DRT A;  4Q0J A;  4GW9 A;  4OQH A;  2ZLY A;  3PYP A;  2A49 A;  3JVV A;  2A24 A;  3BFF A;  5FAS A;  1O07 A;  3H82 B;  4PM7 A;  4LPZ A;  4FTX A;  2VGL S;  1IOU A;  2XRO A;  1G68 A;  4KUO A;  3SW1 A;  3NHQ A;  4NXB A;  5GLB A;  2ZM0 A;  4JGR A;  4EU0 A;  4EBP A;  3OPL A;  4KQD A;  4R4S A;  3W4Q A;  2ZMV A;  1BYW A;  3ZG0 A;  5F69 A;  4HBT A;  3LIC A;  1L0F A;  4BL2 A;  3O87 A;  5HDS A;  3OLO A;  1SDE A;  5A91 A;  1KDS A;  2WAF A;  3MXR A;  2FH5 A;  3ULF A;  3BFG A;  2PBY A;  2EFU A;  1SHV A;  3CHW P;  3FV7 A;  3WS4 A;  2WGV A;  1D1J A;  1K25 A;  2QWS A;  3IX8 A;  5CED A;  3MXQ A;  3T4T A;  2HP9 A;  2GJ3 A;  5FAO A;  3MMH A;  1VEU A;  1G28 A;  2ZD8 A;  1XA7 A;  1PZO A;  2PAV P;  4KG6 A;  3R7W A;  3IBJ A;  3Q7Z A;  1ZG4 A;  4HP4 A;  4PM8 A;  2PYP A;  4BEN A;  1VQQ A;  1OTA A;  3A0S A;  2ZC4 B;  2UWX A;  1T1A A;  5KIZ A;  3F1O A;  1ES5 A;  4IBX A;  2M7V A;  3VP3 A;  1OTE A;  2EWV A;  1DP8 A;  3IX3 A;  5A90 A;  2DRW A;  3CI6 A;  2Y2M A;  2ZJ9 A;  2WGI A;  1YAX A;  4G3W A;  2WKE A;  2VX8 A;  4RX3 A;  3KYQ A;  4KEN B;  4EV4 A;  3NEC A;  3HUN A;  4EUZ A;  4R3A A;  4UQI S;  4NXE A;  1PRQ A;  4KZ5 A;  3TG9 A;  4GDN A;  4OLD A;  1LT0 A;  2HDQ A;  1MC0 A;  1D06 A;  4IUK A;  3IXG A;  5TBM A;  1MBL A;  5F82 A;  3HBR A;  1OTB A;  1T18 A;  4P87 A;  4Y7P A;  4KQO A;  2FZ0 A;  2G7U A;  4XUX A;  2O9C A;  4N9L A;  2D01 A;  4GHI A;  1ODV A;  3FPV A;  1MWS A;  3MFX A;  5EOE A;  3IHB A;  3FC7 A;  2EA9 A;  3IF6 A;  5TBM B;  2Y2Q A;  1TD5 A;  4PM5 A;  4O0P A;  5EVL A;  2VKS A;  3K3D A;  2B95 A;  4NG2 A;  5J3W A;  5I94 A;  2NUP C;  2O0Y A;  2VA0 A;  2XF3 A;  3LUQ A;  3KYE A;  4WF0 A;  3FZC A;  3VFF A;  5EVE A;  3WRZ A;  4FD8 A;  4PKY G;  4KZ3 A;  3T50 A;  2WK0 A;  3K3C A;  2ZC7 A;  4EET B;  1X0O A;  4ARZ A;  5HAQ A;  5FQM A;  2P74 A;  4D2O A;  3HJI A;  4GCZ A;  4KQQ A;  2VV7 A;  4EQ1 A;  5GLA A;  2Y2J A;  5DF7 A;  5FL3 A;  2Y2I A;  4WM9 A;  4CLC C;  2ZBB A;  3SZT A;  2HP5 A;  4HQA A;  4QPR A;  2QJ5 A;  3VE3 A;  4QB8 A;  1HVB A;  4BQM A;  4S2M A;  5J7E A;  5A8B A;  3UE6 A;  2J9O A;  2XRN A;  3M2J A;  3NOP C;  4WMC D;  3QNC A;  3OCN A;  3IS2 A;  3RH8 B;  3CAX A;  4R4R A;  4OVD A;  3HLW A;  2I72 A;  2FFF B;  4Z9Q A;  4B4Z A;  2Y2O A;  3U4L P;  4MBF A;  1ES3 A;  3KYZ A;  4K08 A;  1Z6F A;  1W8Q A;  4HH2 A;  4JBF A;  3LCE A;  4M4X A;  2IWC A;  2HPB A;  3PHY A;  3IH8 A;  4B4X A;  4DE0 A;  2EFX A;  5AJG A;  2GX5 A;  4IJG A;  2JKF A;  4LRY C;  3S7O A;  4BD0 A;  1JTD A;  1S4S A;  1MWT A;  3OPH A;  1LSV A;  3EEA A;  1MY8 A;  1K56 A;  2X71 A;  3BFD A;  2PU2 A;  4ZRR A;  4ME4 A;  4H6J B;  3A3F A;  2R78 A;  1VET A;  4EUV A;  1ES2 A;  4G3V A;  3ZG7 B;  3SH9 A;  5FI7 A;  4OOY A;  1BSG A;  2X02 A;  4PPR A;  2RCX A;  3HLG A;  4EBL A;  3D3O A;  1KGE A;  3P09 A;  5M1A A;  4DXC A;  3JYI A;  5JYO A;  4YIN A;  2LB9 A;  3UPP A;  2HJE A;  3CWF A;  5EE8 A;  2D02 A;  1WYC A;  2JE5 A;  4BLM A;  4E3N A;  4OPY A;  1EI5 A;  1ZKJ A;  2ZQA A;  4WN5 A;  3LIA A;  2H5S A;  3C8C A;  4LV3 A;  4DF6 A;  4CLC B;  4I38 A;  4E3M A;  2Y79 A;  1S4R A;  3KSH A;  5HZH A;  3LIF A;  1BUL A;  5HPF A;  2Z2L B;  4KZ8 A;  4WUJ A;  3FKW A;  3VV4 A;  2WKP A;  1FOF A;  5DTT A;  3Q7V B;  2BLS A;  4OP8 A;  4YWZ A;  4EEU A;  2QHK A;  4PM9 A;  2VK3 A;  4C3Q A;  5FI2 A;  2Y59 A;  1OT6 A;  1GSW A;  3MKE A;  1W7F A;  5FQ9 A;  4HH3 A;  1SCW A;  4D60 A;  2OLV A;  4JPM A;  5EM1 A;  2L1M A;  5DJU A;  1YQS A;  5CRF A;  2Y2G A;  2VLG A;  1YLT A;  1FCO A;  2ZQ7 A;  4BBV A;  3ZQ5 A;  1V9Z A;  3BW6 A;  3EGD C;  4HY8 A;  5HDD A;  2ACG A;  1VHM A;  3SS3 A;  3R7W B;  3D72 A;  4PMA A;  5FAT A;  5EV0 A;  3BLM A;  3VP4 A;  2KDK A;  2A2L A;  3NOT C;  4MCW A;  4DKI A;  2W3D A;  1DRM A;  2IA2 A;  4E6X A;  4QHC A;  3CPT B;  2V0U A;  1YSQ A;  4GDB A;  3VP1 A;  1I2S A;  4S2K A;  3A0R A;  4JXV A;  1BLS A;  3W4O A;  5HD3 A;  3DTI A;  1KVL A;  3BQA A;  1NJ4 A;  5EVI A;  3UE3 A;  3HJK A;  3PBT A;  3E0Y A;  1YLJ A;  4E3L A;  4BMW A;  5U47 A;  3BFC A;  3A3I A;  3LID A;  1XJ6 A;  2INW A;  5A93 A;  3F1N B;  1PI5 A;  2EX8 A;  2PRF A;  4JKT A;  4RVA A;  4ZJ3 A;  1UWN X;  2V1B A;  4I3J A;  3GEC A;  3LY4 A;  2L4R A;  3OC2 A;  3T1S A;  4KZA A;  4FH2 A;  4E3J A;  1Q2Q A;  2VV8 A;  3GV9 A;  5FEG A;  4GD8 A;  1FIL A;  3TOI A;  3LEZ A;  3O86 A;  2XFT A;  4OH0 A;  2OV5 A;  2HP6 A;  2PT7 A;  2WGW A;  2XFS A;  4YFM A;  2ZM2 A;  3KSI A;  3Q07 A;  2E8J A;  3OOV A;  3IX4 A;  1CJF A;  3JVU A;  4MBK A;  2HV1 A;  3UDF A;  3C38 A;  3FPW A;  4X55 A;  1BLH A;  4JXW A;  4N1H A;  4EES A;  4JXG A;  3CUE A;  3GRJ A;  3ITB A;  4DE2 A;  5DKK A;  2O99 A;  4G3K A;  3ZVW A;  4QY5 A;  3KO6 A;  2OLU A;  3ZCZ A;  2W3H A;  3UO9 A;  5EVI D;  3M2K A;  4OQI A;  3VP0 A;  5EUA A;  1RGZ A;  5K5B A;  2EX9 A;  1S6R A;  1YMX A;  2W3E A;  2HGV A;  3ZNT A;  4X1L A;  5E43 A;  1XA1 A;  4PKY A;  2PBD P;  3OCL A;  4LV0 A;  3C4P A;  1L2S A;  1MWU A;  3G35 A;  4LV2 A;  1U60 A;  4PAU A;  1K0K A;  1K57 A;  3PAG A;  3LEQ A;  2V1Z A;  3MFD A;  2JN7 A;  4DJ3 A;  1KDW A;  3BYD A;  1N9B A;  3CIT A;  5L10 A;  1XFQ A;  2IWB A;  1DJB A;  2QKP A;  3PR6 A;  3ZDJ A;  4WYY A;  2H10 A;  3N8S A;  2O9B A;  4R70 A;  5CTN A;  2EXA A;  3MZF A;  4UA9 A;  4ZDX A;  3RXX A;  1W8Y A;  4KZ9 A;  1TS6 A;  2BTF P;  1HTZ A;  3SOI A;  4Y13 A;  1LL9 A;  1C3B A;  1XJ4 A;  3LR3 A;  3IXH A;  1YLZ A;  5HSQ A;  2A3U A;  5CHU A;  2QZ6 A;  5DFX A;  2GZA A;  3KSG A;  2VEA A;  3IHA A;  3P98 A;  4WLA A;  4R0Q A;  4DJ2 A;  3P01 A;  2IWD A;  1WYB A;  3IXB A;  3QNB A;  1NZU A;  4IVK A;  4Z1W A;  3ICY A;  3SS5 A;  4E3K A;  1YKD A;  3T4Q A;  3MR0 A;  3T4J A;  4P85 A;  2W3F A;  1BT5 A;  3SS4 A;  4EQI A;  2KX6 A;  2XA7 M;  4OOM A;  1QMF A;  4I3A A;  3OPR A;  1M40 A;  4Y5F A;  3FWL A;  4XT2 B;  1PFL A;  3C7U A;  4S2N A;  1Q2P A;  2VGK A;  4JLF A;  2DNS A;  3H82 A;  3A3J A;  4RX2 A;  2P9V A;  1JNU A;  4E6W A;  4QU3 A;  3H7W A;  2ZM8 A;  3MSH A;  3PBQ A;  4E04 A;  1FSW A;  3HLD A;  5AVF A;  1K4F A;  2WKH A;  5EVI C;  3BRM A;  4EXO A;  5HPI A;  4HNB A;  4UA6 A;  2ZL1 B;  1GHM A;  3ZG9 B;  4S2P A;  1ESU A;  1XGJ A;  3UB8 A;  2OOL A;  3A3D A;  4NEE D;  2ZC5 B;  1K38 A;  2V8F A;  1N9O A;  2K7S A;  2JHE A;  4UA7 A;  3Q7V A;  1PWC A;  2PHY A;  5HWT A;  4XXR A;  1ALQ A;  4HBU A;  2H28 A;  2K2N A;  3T4O A;  3UMD A;  2XD1 A;  4WZ5 A;  1TDL A;  3UB7 A;  1T1B A;  1OTI A;  4YOF A;  3M6B A;  1MXO A;  1TEM A;  4HJ3 A;  5FDS A;  3QP5 A;  1ZHH B;  5HW3 A;  1TF1 A;  4A5R A;  1W63 Q;  2XR0 A;  2Y55 A;  1H8Y A;  1L3L A;  1CQA A;  1E3U D;  3SH7 A;  3IF6 B;  1SKO B;  3WS0 A;  5GLC A;  4S2O A;  5GHZ A;  3BFE A;  3HVF A;  5AVE A;  3ZVT A;  4OON A;  4L9E A;  1P97 A;  2V2F F;  5L8M A;  3WS2 A;  1KE4 A;  4FUW A;  1Y4O A;  2JKR I;  1MWR A;  4OLG A;  5L09 A;  4PM6 A;  3B42 A;  1JWP A;  3K2N A;  3NI9 A;  1GSX A;  5TFQ A;  4X6T A;  1H0M A;  2YKF A;  3DW0 A;  2G2U A;  1OJG A;  1P9W A;  2EX6 A;  3AGF A;  3T4L A;  1VEU B;  1FSY A;  4BBT A;  5IS1 A;  2V9A A;  2J3W A;  2OWH A;  4MMN A;  4R1G A;  3IT9 A;  3MZE A;  5MC7 A;  1HZO A;  3G2Y A;  3GQZ A;  1IYP A;  4Y3I A;  4L9G A;  1S1Y A;  2Y4A A;  4CLC E;  4BWI A;  4FOF A;  1S66 L;  1IKI A;  4X1M A;  3GTC A;  1CI9 A;  2WUQ A;  1SDN A;  3MF0 A;  4EW7 A;  4LFU A;  3RTY A;  2P04 A;  1LL8 A;  4WBG A;  4ESP A;  2JKT I;  2XEP A;  1XJ3 A;  4JF5 A;  2XH9 A;  5CX7 A;  3LR0 A;  3HLF A;  1J9M A;  5TJJ A;  5HFO A;  5F83 A;  1OT9 A;  3T1R A;  1S1Z A;  2J3T C;  1TS7 A;  4HEF A;  3CZD A;  4JGP A;  3VSK A;  1L0G A;  5A92 A;  4OQG A;  3VOZ A;  3VSL A;  4HP9 A;  3E4O A;  2WZX A;  3W8K A;  1F9I A;  3N8L A;  1EW0 A;  2ZMA A;  3VP2 A;  3IQA A;  5KMW A;  1XXM A;  3BY9 A;  1NXY A;  3BEC A;  4DE3 A;  2XGN A;  3F1O B;  3E4P A;  2O9A A;  1FIK A;  4F94 A;  3Q82 A;  1GHP A;  1PYY A;  5DKL A;  1FR1 A;  2P7J A;  1BLP A;  1N9N A;  3V3R A;  1DP9 A;  3OBF A;  2V0W A;  4JGO A;  5IHV A;  4C6Y A;  5EM0 A;  1XGI A;  1GA9 A;  2WKI A;  5L2F A;  2Y2N A;  4X68 A;  4CQH A;  3MBZ A;  3C30 A;  5FQK A;  3NDE A;  3MXS A;  4I5S A;  3HLE A;  1XPB A;  1E3U A;  3HUM A;  1WE4 A;  2Y91 A;  5HDC A;  1XFN A;  1N4O A;  5L07 A;  4NXF A;  5AQA A;  2M7U A;  3G32 A;  3VOY A;  2V1A A;  2Y8H A;  5DFY A;  2W0N A;  3CUE C;  4U0T A;  5BOH A;  1JVJ A;  2WAD A;  4LRX C;  3E2K A;  3ZNY A;  2WAE A;  3IWQ A;  1MKI A;  2BAS A;  2PR5 A;  1ERQ A;  3ZGA B;  3CPT A;  3TRC A;  1STZ A;  4JF4 A;  2VZW A;  2QPN A;  3UNW A;  1CEG A;  3IWO A;  5FA7 A;  1PIO A;  1NZO A;  5IT5 A;  4K0X A;  1S0W A;  2DMW A;  4GD6 A;  1BTL A;  4MN7 A;  1DP6 A; 
#chains in the Genus database with same CATH homology
 4KEN B;  4GZB A;  4EV4 A;  2XLN A;  4JXG A;  4S2L A;  3HUN A;  3GRJ A;  1XX2 A;  3ITB A;  4DE2 A;  4EUZ A;  4H8R A;  2HDS A;  3LY3 A;  1MPL A;  3ZVW A;  4X56 A;  1NRF A;  1NY0 A;  4KZ5 A;  3S1Y A;  4QY5 A;  4MEZ A;  2OLU A;  3TG9 A;  3ZCZ A;  3UO9 A;  4GDN A;  5A92 A;  3CJM A;  1K54 A;  2HDQ A;  4OLD A;  5EVI D;  3RJU A;  3M2K A;  5KZH A;  3B3X A;  3GMW A;  4OQI A;  5GL9 A;  3VP0 A;  5CHJ A;  3IXG A;  5EUA A;  3G2Z A;  5G18 A;  1RGZ A;  1MBL A;  5F82 A;  2VGJ A;  4UAA A;  2EX9 A;  3HBR A;  5F1G A;  4P87 A;  1S6R A;  1YMX A;  3ZNT A;  5HL1 A;  3N4I A;  4Y7P A;  4P0M A;  5DVA A;  3ISG A;  4KQO A;  5E43 A;  3BM6 A;  4XUX A;  1K6R A;  1XA1 A;  4N9L A;  5AQ7 A;  2E8I A;  3UDX A;  5CTM A;  1MWS A;  5EOE A;  1CI8 A;  3IHB A;  3OCL A;  2XK1 A;  3Q81 A;  3C5A A;  4LV0 A;  3C4P A;  1XKZ A;  1L2S A;  3IF6 A;  1MWU A;  3G35 A;  5CEC A;  1E25 A;  4M3K A;  4MBH A;  4LV2 A;  1K4E A;  2Y2Q A;  1U60 A;  4PM5 A;  4ID4 A;  5EVL A;  1K57 A;  3PAG A;  5DF9 A;  2V20 A;  2QMI A;  2V1Z A;  4R23 A;  3UE1 A;  3MFD A;  5FI6 A;  4ZJ2 A;  5I94 A;  3M6H A;  1KDW A;  4N92 A;  1E4D A;  2Q9M A;  5EVI B;  2RL3 A;  2XF3 A;  1PWD A;  1YT4 A;  2R9X A;  3BYD A;  3FZC A;  3BEB A;  4DE1 A;  1IYO A;  3PTE A;  1N9B A;  1RP5 A;  2ZC3 B;  3E2L A;  4ZJ1 A;  3VFF A;  3WRZ A;  4FD8 A;  4KZ3 A;  5DTS A;  2WK0 A;  1KE0 A;  2IWB A;  3N8R A;  5E2H A;  1DJB A;  2ZC7 A;  3ZDJ A;  2JC7 A;  4WYY A;  2H10 A;  3A3E A;  3N8S A;  5CXW A;  3IXD A;  5HAQ A;  5CTN A;  5FQM A;  2EXA A;  2XD5 A;  2OSU A;  2P74 A;  4D2O A;  3MZF A;  4UA9 A;  4ZDX A;  1PW8 A;  3O88 A;  4KQQ A;  3I7J A;  3RXX A;  1H5X A;  1PW1 A;  2ZQC A;  5DTK A;  2ZC6 B;  3VMA A;  1W8Y A;  5GLA A;  1ERM A;  2Y2J A;  3FKV A;  5DF7 A;  2Y2I A;  4KZ9 A;  4WM9 A;  3DTM A;  3ITA A;  2C5W B;  1HTZ A;  3G34 A;  5DF8 A;  5TR7 A;  5KSH A;  3PBR A;  3SOI A;  1LL9 A;  1Y54 A;  5GLD A;  1C3B A;  3IF5 A;  2HP5 A;  3S4X A;  3G4P A;  4C75 A;  5HX9 A;  2WYX A;  2B5R A;  1BLC A;  3DWK A;  3IXH A;  1YLZ A;  2J9P A;  4QB8 A;  1CEF A;  2Y2P A;  2ZQ8 A;  3PBO A;  2A3U A;  4S2I A;  4WMC A;  1NYY A;  4FH4 A;  5CHU A;  1HVB A;  3O3V A;  4BQM A;  2QZ6 A;  4S2M A;  1ZG6 A;  1PI4 A;  3IHA A;  3P98 A;  3Q1F A;  4R0Q A;  3NDG A;  5CGS A;  2IWD A;  2J9O A;  1WYB A;  3IH9 A;  3IXB A;  3M2J A;  3QNB A;  1NZU A;  4WMC D;  3QNC A;  4IVK A;  4X53 A;  1IKG A;  5FDH A;  3NIA A;  5EPH A;  1LL5 A;  1KVM A;  3OCN A;  4P6B A;  4QY6 A;  3SS5 A;  4E3K A;  4JXS A;  3UPN A;  4R4R A;  1EWZ A;  2JBF A;  4P85 A;  4OVD A;  1BT5 A;  3HLW A;  4HES A;  2I72 A;  3SS4 A;  4EQI A;  2FFF B;  5HAI A;  4E3O A;  3HL9 A;  4OOM A;  3NBL A;  4Z9Q A;  3NCK A;  4B4Z A;  2Y2O A;  1QMF A;  3OPR A;  4IVI A;  1M40 A;  4MBF A;  3FWL A;  4DDS A;  1ES3 A;  3C7U A;  4N9K A;  1Q2P A;  2VGK A;  2BG1 A;  2G2W A;  1Z6F A;  4JLF A;  4S2N A;  2DNS A;  4OKP A;  1W8Q A;  3WRT A;  3A3J A;  4JBF A;  1CK3 A;  3LCE A;  4UHU A;  5FAP A;  2PU4 A;  2P9V A;  4RX2 A;  1IYQ A;  2IWC A;  2WGW B;  4QU3 A;  4E6W A;  2HPB A;  2ZM8 A;  3DWZ A;  3WS5 A;  5CHM A;  3PBQ A;  3QHY A;  5M18 A;  1FSW A;  1ZC2 A;  4S2N C;  3IH8 A;  5EOO A;  3HLD A;  2EFX A;  4B4X A;  4DE0 A;  5TGF A;  1K4F A;  2J8Y A;  1PZP A;  2Z2M B;  3NC8 A;  3C4O A;  1K54 C;  5CEB A;  2WKH A;  4OPZ A;  5EVI C;  3ZG8 B;  2ZQD A;  4KZ4 A;  3BRM A;  5FAQ A;  5J8X A;  3GR2 A;  5CER A;  1VM1 A;  3EQU A;  4R3B A;  3ZHH A;  1LI0 A;  4UA6 A;  4BD0 A;  1JTD A;  4KQR A;  1OME A;  1MWT A;  1GHM A;  4QD4 A;  3ZG9 B;  3OPH A;  4S2P A;  1AXB A;  1ESU A;  1XGJ A;  2Q9N A;  3A3D A;  2FFY A;  1IEL A;  4XUZ A;  5GHX A;  2ZC5 B;  1K38 A;  1MY8 A;  2CC1 A;  4RYE A;  2J7V A;  4R3J A;  4FSF A;  1K56 A;  2X71 A;  3BFD A;  2PU2 A;  3Q7V A;  1PWC A;  4UA7 A;  5AQB A;  5F1F A;  4XXR A;  1ALQ A;  5D3O A;  4HBU A;  5CGW A;  3A3F A;  5FSR A;  1JTG A;  2H0T A;  3V3S A;  4WEJ A;  4BD1 A;  1IYS A;  2HDU A;  1ES2 A;  5HAR A;  1W5D A;  3G31 A;  1GHI A;  3HLC A;  4E3I A;  4O7D A;  3ZG7 B;  1K6S A;  3SH9 A;  1XP4 A;  1JWV A;  1KGG A;  4OQ0 A;  4S2J A;  5FI7 A;  2XD1 A;  4WZ5 A;  1TDL A;  4OOY A;  1BSG A;  2X02 A;  4PPR A;  4Y0T A;  4GKU A;  3M6B A;  1MXO A;  4U0X A;  1TEM A;  2RCX A;  4CJN A;  5HW3 A;  1K56 D;  3HLG A;  3PAE A;  4A5R A;  4EBL A;  4FCF A;  1KGE A;  2XR0 A;  2P9V B;  3WWX A;  2Y55 A;  1H8Y A;  3G30 A;  1YM1 A;  3P09 A;  1DJC A;  1M6K A;  1E3U D;  3SH7 A;  4X69 A;  3IF6 B;  5M1A A;  3WS0 A;  4MLL A;  5GLC A;  4S2O A;  3IF6 C;  5GHZ A;  4DXC A;  3JYI A;  3OPP A;  3MKF A;  3BFE A;  3HVF A;  5JYO A;  1I5Q A;  4WZ5 C;  4YIN A;  4DXB A;  1ESI A;  3AGD A;  3CMZ A;  4JF6 A;  3UPP A;  3ZVT A;  5EE8 A;  4OON A;  1WYC A;  2JE5 A;  4BLM A;  4E3N A;  2V2F F;  4OPY A;  1EI5 A;  1ZKJ A;  3N7W A;  3WS2 A;  2ZQA A;  1KE4 A;  1NYM A;  4IED A;  1H8Z A;  1SKF A;  3GVB A;  1MWR A;  4OLG A;  1FQG A;  1ES4 A;  1K57 C;  4PM6 A;  3RXW A;  1JWP A;  3NI9 A;  5TFQ A;  4EBN A;  1TVF A;  3C7V A;  4X6T A;  2H5S A;  1YLY A;  3PBS A;  3FYZ A;  1L0D A;  4GN2 A;  1DJA A;  4GNU A;  4LV3 A;  4DF6 A;  4Q8I A;  4NK3 A;  5KSC A;  3DW0 A;  4LV1 A;  4E3M A;  4K91 A;  3HUO A;  2EX2 A;  2G2U A;  5M19 A;  3PBN A;  1ONH A;  1YLP A;  4Y0U A;  4ZBE A;  1O7E A;  1YLW A;  5FQQ A;  2DCF A;  1BUL A;  5EEC A;  2EX6 A;  1LLB A;  1FCN A;  3AGF A;  4LEN A;  2Z2L B;  1FSY A;  4KZ8 A;  4MNR A;  1GA0 A;  4U3T A;  5FQI A;  1BZA A;  2Y2K A;  2HDR A;  2EXB A;  4KG5 A;  4EWF A;  3FKW A;  2Y2L A;  1FOF A;  3MZD A;  1K55 A;  4WEK A;  4R1G A;  5DTT A;  3Q7V B;  2BLS A;  3UE0 A;  3IT9 A;  3GSG A;  3MZE A;  3TSG A;  3HRE A;  1IEM A;  3AGE A;  4OP8 A;  4ZAM A;  3N6I A;  1HZO A;  3G2Y A;  4PM9 A;  2X01 A;  3GQZ A;  4C3Q A;  1IYP A;  1RGY A;  4IBR A;  2Y4A A;  5FI2 A;  2Y59 A;  3MKE A;  1IKI A;  1W7F A;  5FQ9 A;  1L0E A;  3GTC A;  1FCM A;  1FR6 A;  3S22 A;  1CI9 A;  1SCW A;  2JCH A;  2XDM A;  2WUQ A;  2OLV A;  3NY4 A;  4JPM A;  1G6A A;  1SDN A;  4B88 A;  1YQS A;  4CPK A;  1TDG A;  4OPQ A;  5CRF A;  2Y2G A;  3WS1 A;  2C6W B;  1YLT A;  1FCO A;  2ZQ7 A;  4WBG A;  5JYP A;  1W79 A;  4KZB A;  5HAP A;  5E2G A;  2XEP A;  5AQ9 A;  3IWI A;  4KG2 A;  3SS3 A;  4OPR A;  3CG5 A;  4JF5 A;  2XH9 A;  1KGF A;  3V50 A;  1ERO A;  4DRT A;  3HLF A;  4PMA A;  1J9M A;  2GDN A;  5FAT A;  3LO7 A;  5HFO A;  3BLM A;  2R9W A;  4NET A;  1HD8 A;  5F83 A;  3VP4 A;  4OQH A;  2ZLY A;  2XQZ A;  1BUE A;  2A49 A;  4LCM A;  4K0W A;  4N1X A;  4DKI A;  4HEF A;  3BFF A;  5FAS A;  3CZD A;  1O07 A;  1ONG A;  4PM7 A;  1KE3 A;  1L0G A;  3D4F A;  4QHC A;  3HLB A;  4OQG A;  3VSK A;  3ZG5 A;  4BJP A;  4E6X A;  5GHY A;  3VOZ A;  3VSL A;  4GDB A;  3V5M A;  3VP1 A;  2WZX A;  3W8K A;  3N8L A;  2ZMA A;  1G68 A;  3VP2 A;  3IQA A;  5KMW A;  3ZFZ A;  1XXM A;  3OZH A;  1I2S A;  4S2K A;  1NXY A;  3BEC A;  4DE3 A;  5GLB A;  4BL3 A;  2ZM0 A;  2XGN A;  4GB7 A;  5CGX A;  1K55 C;  4EBP A;  3OPL A;  4F94 A;  4JXV A;  3Q82 A;  1BLS A;  4R4S A;  5E2F A;  5E2E A;  3W4Q A;  3W4O A;  3SH8 A;  1GHP A;  1PYY A;  1KVL A;  3ZG0 A;  1GCE A;  4HBT A;  1FR1 A;  1NJ4 A;  5EVI A;  3UE3 A;  1BLP A;  1L0F A;  1LI9 A;  4BL2 A;  3O87 A;  3PBT A;  3V3R A;  1SDE A;  1YLJ A;  4ZTK A;  5A91 A;  4E3L A;  1YMS A;  3UPO A;  5U47 A;  1KDS A;  3BFC A;  2WAF A;  3A3I A;  3MXR A;  4DDY A;  5A93 A;  5IHV A;  4C6Y A;  1PWG A;  3BFG A;  1PI5 A;  1XGI A;  1GA9 A;  2WKI A;  2EX8 A;  2WZZ A;  5L2F A;  1DY6 A;  2PBY A;  2Y2N A;  2EFU A;  1SHV A;  4LCL A;  4X68 A;  3FV7 A;  4RA7 A;  5FQJ A;  4QJG A;  4JKT A;  4RVA A;  3MBZ A;  4OOL A;  3WS4 A;  3UN7 A;  2WGV A;  4WEL A;  5FQK A;  4KZ6 A;  3NDE A;  4ZJ3 A;  3MXS A;  1K25 A;  3HLE A;  1XPB A;  1E3U A;  3BLS A;  3HUM A;  3LY4 A;  1WE4 A;  5CED A;  2Y91 A;  3OC2 A;  2HP9 A;  1N4O A;  3EQV A;  4WZ4 A;  5FAO A;  4KZA A;  4FH2 A;  4E3J A;  1Q2Q A;  2ZD8 A;  1XA7 A;  1PZO A;  1LHY A;  3GV9 A;  5AQA A;  4KG6 A;  3G32 A;  2Y2H A;  4GD8 A;  3VOY A;  2ZQ9 A;  3TOI A;  3LEZ A;  3Q7Z A;  3O86 A;  1ZG4 A;  2XFT A;  4OH0 A;  4U0T A;  2OV5 A;  5BOH A;  1JVJ A;  2HP6 A;  2WAD A;  4PM8 A;  4BEN A;  1VQQ A;  2WGW A;  2XFS A;  4YFM A;  2ZM2 A;  2ZC4 B;  3E2K A;  2H0Y A;  3ZNY A;  2WAE A;  3IWQ A;  3VFH A;  1I2W A;  1MKI A;  2UWX A;  3Q07 A;  1QME A;  1ERQ A;  4OP5 A;  3ZGA B;  1ES5 A;  4IBX A;  3VP3 A;  4KZ7 A;  3UDI A;  4JF4 A;  2QPN A;  3UNW A;  1CEG A;  5A90 A;  3UY6 A;  2DRW A;  3W4P A;  3IWO A;  1RCJ A;  4GOG A;  4MBK A;  5FA7 A;  1PIO A;  3UDF A;  2Y2M A;  1JWZ A;  1NZO A;  4K0X A;  2ZJ9 A;  2WGI A;  4X55 A;  4Y0O A;  1BLH A;  4JXW A;  3V39 A;  4L0L A;  2WKE A;  1S0W A;  4GD6 A;  1BTL A;  4RX3 A;  4N1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...