1NXYA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (sm2)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Recognition and Resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 100
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nxyA00
5DTKA 3ZG0A 5FDHA 1K38A 4YFMA 1KGFA 5L2FA 1Q2QA 4UAAA 2QZ6A 3HLWA 3DWKA 3UE3A 3ZVWA 1DJCA 1E25A 4EWFA 3GSGA 1PI5A 1YQSA 3B3XA 4N9LA 5HL1A 1PWCA 4GN2A 1E3UD 4WEJA 4QJGA 1GHMA 1K25A 1IYOA 3VP2A 4CJNA 1NY0A 3MKEA 1K56A 1YMSA 5FQKA 2I72A 3GRJA 3E2LA 3NBLA 2WZZA 4E3LA 4MLLA 4RX3A 4N1XA 4N1HA 1ZG6A 1KE0A 2WGVA 1E4DA 5DF7A 1PZPA 3ZFZA 1IEMA 2H5SA 3IWQA 2EX8A 1EROA 3A3IA 4EBLA 3O88A 3ZVTA 4O7DA 4QHCA 2VGJA 5GLCA 1NYYA 1KGGA 1N9BA 2OLVA 3IXGA 2HDUA 5EUAA 3IWIA 2Q9MA 4ZAMA 1MXOA 4GKUA 4WELA 3HLBA 4E3OA 1LL9A 4PM7A 2DNSA 4JXSA 1XKZA 4KQRA 5M1AA 5GLBA 3OCLA 5CEDA 3Q81A 5FQ9A 3C5AA 1IYQA 5CTMA 1DJBA 3A3EA 3SH7A 2QPNA 2V2FF 2WK0A 4LV0A 5I94A 4UA7A 3G30A 1Z6FA 4U3TA 4X6TA 1FSWA 4IVIA 1PWDA 5CEBA 5D3OA 5CHMA 3PBQA 1BTLA 2ZD8A 4HBUA 3HLGA 4Y7PA 5EOOA 5M18A 3SS5A 3PAEA 2H0TA 3Q1FA 2WKHA 2Z2LB 2V20A 1FCOA 3C7VA 2B5RA 2VGKA 1IKIA 5F1GA 1JTDA 3PTEA 3AGDA 4MBHA 5EECA 1XXMA 5FI7A 4U0TA 3VFFA 4WM9A 3G34A 4GB7A 3OC2A 5EVLA 2OV5A 2WAEA 2P9VA 4GD6A 5AQ7A 2EFUA 4KG2A 4S2JA 5G18A 4RX2A 4OQ0A 1EI5A 2WADA 1OMEA 4LCLA 3Q82A 4YINA 3VOZA 5A91A 1KVMA 5KZHA 1IELA 2HDSA 4BJPA 3IHAA 3HL9A 5TR7A 5A92A 5AQAA 5FAOA 4RA7A 3VSLA 1RGZA 1NXYA 3CJMA 1YLJA 1O07A 1J9MA 5FQIA 3V3RA 3ZG5A 2WGWA 5AQ9A 4GD8A 4WZ5A 3HUOA 2EX9A 2FFYA 3BM6A 4FSFA 3G35A 4EV4A 1HVBA 3N8RA 2ZQAA 4OQGA 4DXBA 1HD8A 4EUZA 2WUQA 4S2KA 3UNWA 3HVFA 2J9OA 2Y91A 2Y2LA 2P9VB 3BFEA 4UA9A 2ZM8A 4R1GA 1MWUA 2Y2QA 4XUXA 5KSCA 5CGWA 4H8RA 3PBOA 3IT9A 3QNCA 1K55C 1GHPA 3UPPA 1LL5A 1MWTA 3BECA 3V3SA 1BT5A 4OH0A 2Y4AA 1CI9A 1ZC2A 5E2EA 2IWCA 4GNUA 4FH4A 1W5DA 3BLMA 4HBTA 4OLGA 5GLAA 5HFOA 2E8IA 4Y0TA 5JYOA 1IYSA 4FCFA 4BLMA 2WGWB 1LI9A 3AGFA 3LY3A 2V1ZA 4DF6A 3A3FA 4E6XA 1H5XA 4OOYA 1E3UA 1FQGA 3LO7A 1MWSA 4KZAA 4R23A 5J8XA 2PBYA 3IWOA 2Y2PA 2Y2NA 1KE3A 4S2MA 3WS0A 4BL2A 5CXWA 1SKFA 3C4OA 3DW0A 4LENA 3MZDA 4K0XA 1K57C 1ZKJA 3UN7A 5JYPA 1DY6A 1O7EA 2EFXA 1TDLA 3OCNA 3Q7VB 2IWDA 4JF5A 1YM1A 1M6KA 4WMCD 2XQZA 2ZQCA 4PM8A 1CEGA 5GLDA 3OPPA 3I7JA 4BENA 3PBTA 2XFSA 4RVAA 3D4FA 5HAIA 4BL3A 4WZ5C 3P09A 3BFDA 4UA6A 1IKGA 1ALQA 4QY5A 3NCKA 4LV2A 2JBFA 3SH8A 4OPRA 5IHVA 2A3UA 4B4ZA 2Y2KA 3VFHA 3N6IA 4OQIA 1KE4A 4UHUA 1ES2A 2J7VA 4KZ8A 3HLEA 5E2GA 1GHIA 1XP4A 2XDMA 4HESA 4KG5A 2Y2MA 3UE0A 1LI0A 5HX9A 4KZ7A 5FI2A 1HZOA 1K4EA 4A5RA 1K4FA 3QNBA 4KQOA 3UPOA 4S2NA 4LCMA 5GHYA 2PU4A 3HLFA 3A3JA 2C6WB 3FZCA 5FI6A 1W8YA 1YLPA 3V39A 2R9XA 1S0WA 1YLZA 5U47A 5BOHA 3TOIA 3E2KA 2HDQA 3DWZA 2WYXA 1LHYA 4JXWA 3N8SA 2X01A 2OSUA 1EWZA 4ZDXA 2DCFA 4P87A 3G2ZA 3FV7A 5AQBA 5FQQA 4S2PA 1QMFA 3JYIA 4X69A 1FOFA 1NYMA 4PPRA 4OKPA 2HP9A 4E3KA 4M3KA 1K55A 3EQUA 4R0QA 1PYYA 2Y59A 3S1YA 1WYCA 3C4PA 3MBZA 3ZNYA 4XUZA 3IXHA 3QHYA 4OVDA 3WRTA 3Q7ZA 1NJ4A 2XD5A 3MZFA 3M2KA 1NZOA 1M40A 1W8QA 2GDNA 2IWBA 2ZC5B 5KSHA 4U0XA 5FQMA 4KZ9A 3W4PA 4NETA 3O3VA 3ITAA 1I2WA 1JTGA 3BFFA 2ZQ7A 2Y2IA 5E2FA 1K54C 3IH8A 4ZTKA 4Q8IA 3NIAA 1K57A 3NY4A 3PAGA 1QMEA 1NRFA 1ONHA 4JKTA 4KG6A 3OPRA 2A49A 1L0FA 1MKIA 2OLUA 4ID4A 1FCNA 1BLCA 2XR0A 3FWLA 4S2NC 3ITBA 4WZ4A 1ESIA 5CGXA 4EQIA 1FR1A 3ZG9B 1GCEA 3O86A 1WE4A 1XPBA 3FYZA 1RP5A 2ZC6B 3M2JA 4X55A 1W79A 1XGJA 4OP5A 2Y2GA 1FSYA 4XXRA 1XGIA 2ZLYA 5FAQA 3S4XA 2WZXA 4PM9A 1K6RA 3W8KA 1YT4A 3ISGA 1XX2A 1PWGA 3BRMA 3UO9A 3MZEA 3N7WA 4GOGA 4OOMA 3WS2A 4WMCA 3Q7VA 3PBNA 3C7UA 1HTZA 2X02A 1H8ZA 3PBRA 3VMAA 1PI4A 2XF3A 5A93A 2R9WA 3BLSA 5EVIA 1CK3A 2Y2OA 3WS5A 4IBRA 5E43A 2RL3A 2RCXA 1ERQA 3WRZA 3ZNTA 2Q9NA 4L0LA 4EBNA 1KVLA 2ZJ9A 4BD1A 1TDGA 4R4RA 5DTTA 3HLCA 1S6RA 4R3JA 4C6YA 2ZQ9A 2JCHA 4LV3A 3UDXA 3CMZA 4PMAA 3UE1A 1L0GA 2G2WA 1ZG4A 2QMIA 3O87A 2ZM2A 2Z2MB 3WS4A 3G2YA 3MXSA 5EVIB 3CZDA 4X53A 3G32A 5EPHA 5EVID 3N8LA 3CG5A 1XA1A 5CRFA 3ZG7B 1GA0A 3IHBA 4ZJ3A 4DDYA 1ES3A 2WAFA 4X56A 2Y55A 2ZQ8A 3GV9A 4BQMA 4C75A 3MFDA 1TEMA 4DDSA 4DE2A 4CPKA 3IQAA 4FD8A 5TFQA 1K54A 1XA7A 3IXBA 1BLHA 4ZJ2A 3W4QA 1H8YA 4N92A 3RJUA 3RXXA 5F1FA 2XK1A 4OPZA 4DKIA 1MBLA 3G31A 4WBGA 3NI9A 5FQJA 1YMXA 2XLNA 4OPYA 5CERA 4Y0UA 5EVIC 3UY6A 3FKVA 3PBSA 5F83A 1PW8A 2P74A 5FAPA 1WYBA 3UDIA 3VP1A 4E3JA 4WEKA 1JVJA 3SS3A 3VSKA 3DTMA 1FCMA 3P98A 3UDFA 3IF6A 3ZDJA 1G6AA 2XH9A 3HLDA 3ZGAB 2HPBA 4MNRA 1YLYA 5HW3A 2G2UA 3ZCZA 2Y2JA 1L0EA 2ZMAA 1CI8A 3UPNA 5HAPA 2J9PA 4OLDA 2BG1A 2EX6A 2HP6A 2J8YA 2XEPA 3TG9A 3HUNA 4KQQA 1Y54A 4S2LA 4Z9QA 3ZHHA 4P0MA 4MBFA 1N4OA 4FH2A 3NDGA 5M19A 2XD1A 4K0WA 4PM5A 4R4SA 2EXBA 1MY8A 4KZBA 2CC1A 4JXVA 3LEZA 1IYPA 3M6HA 5CHUA 3GTCA 4JF6A 4OPQA 4HEFA 1L2SA 2WKEA 4OOLA 5CHJA 5DVAA 3EQVA 1PZOA 5FATA 2C5WB 5KMWA 3IF6B 2WGIA 1ONGA 4DE3A 4KENB 3V5MA 4GDBA 5EOEA 2UWXA 4S2OA 5DF8A 1PIOA 1VQQA 1BLPA 1K56D 4E6WA 2ZC3B 5GHZA 2HP5A 1YLTA 4LV1A 3OPLA 2H10A 4QU3A 4GDNA 4P85A 4GZBA 2EXAA 4P6BA 5A90A 1SHVA 2Y2HA 1BZAA 5TGFA 1YLWA 1BLSA 1U60A 2EX2A 1SDNA 3NDEA 4QD4A 4JPMA 4IEDA 4OP8A 3IXDA 3Q07A 4KZ4A 1BSGA 3GQZA 2XFTA 3A3DA 3IF5A 4DE0A 3AGEA 4D2OA 2ZM0A 1C3BA 1MPLA 2WKIA 3WS1A 3IF6C 3ZG8B 4B4XA 3GMWA 4R3BA 1Q2PA 2BLSA 3SH9A 1W7FA 3MXRA 1VM1A 5FA7A 4PM6A 3TSGA 1SCWA 5CECA 1RCJA 1JWVA 3NC8A 1BUEA 3N4IA 1BULA 4X68A 1KGEA 3OZHA 4IBXA 5HAQA 2ZQDA 5E2HA 5CGSA 2XGNA 4BD0A 3GR2A 4KZ6A 1G68A 1ES5A 5GL9A 1KDSA 3BYDA 3W4OA 1LLBA 1I5QA 4KZ5A 1ERMA 1I2SA 1L0DA 3HREA 3FKWA 1PW1A 3M6BA 3IH9A 5FSRA 3VP3A 4C3QA 3SS4A 1ES4A 1RGYA 3VP4A 3LY4A 5CTNA 3VOYA 4MEZA 2HDRA 4DXCA 1FR6A 2FFFB 5DF9A 5DTSA 5F82A 1NZUA 3GVBA 3G4PA 4N9KA 1TVFA 2JC7A 4E3IA 4S2IA 4EBPA 2X71A 4ZJ1A 1CEFA 1ESUA 3MKFA 3LCEA 4JLFA 4JXGA 4E3NA 2ZC4B 5FASA 4K91A 3VP0A 4KZ3A 4DRTA 4B88A 3BFGA 3SOIA 2H0YA 3HUMA 4MBKA 3V50A 4OONA 4QB8A 1DJAA 4RYEA 3BEBA 2DRWA 2JE5A 4F94A 1SDEA 1GA9A 2PU2A 3RXWA 1JWZA 5GHXA 4DE1A 5EE8A 4NK3A 3WWXA 4IVKA 3BFCA 4JF4A 2ZC7A 4JBFA 1AXBA 1JWPA 4WYYA 3S22A 4Y0OA 3OPHA 4QY6A 4ZBEA 1MWRA 1K6SA 3HBRA 1KDWA 4OQHA 5HARA 4E3MA
chains in the Genus database with same CATH superfamily
4ARZA 1KGFA 1Q2QA 2QZ6A 3HLWA 3DWKA 1DJCA 4EWFA 3H82B 1PI5A 4Y5FA 2XA7S 4QJGA 4NEED 3KO6A 3VP2A 4GJ4A 3VE4A 3G6OA 1LSXA 1YMSA 4UEYA 5EVEA 2I72A 2QJ7A 3E2LA 2WZZA 3V67A 1ZG6A 5DF7A 2WGVA 1E4DA 1T19A 2R78A 1IEMA 3IWQA 1EROA 3O88A 3NOUC 1TS8A 4QHCA 4FTXA 1NYYA 1N9BA 2OLVA 4EEPA 3IXGA 2HDUA 5EUAA 3IWIA 3HLBA 4E3OA 1LL9A 4JXSA 3ICYA 4G3WA 2ZL1B 3OCLA 2VV7A 1OTEA 5CTMA 3SH7A 2V2FF 4LV0A 3HJIA 4NXBA 3RFBA 2W1RA 2V1AA 4WLAA 5M18A 3HLGA 3PAEA 3Q1FA 2PRFA 2B18A 2B5RA 2VGKA 3HCYA 2W3DA 1JTDA 4NG2A 5F1GA 3OC2A 3IBJA 2OV5A 3JPUA 4GD6A 5AQ7A 4S2JA 5HSQA 3K3DA 1EI5A 3Q82A 5A91A 2Q0OA 2HDSA 2PHYA 4BJPA 3HL9A 5FAOA 1O07A 5FQIA 3T1RA 2WGWA 4HIAA 1HVBA 2ZQAA 1HD8A 4NXGA 4EUZA 2WUQA 2J9OA 2Y91A 4BBVA 5KSCA 3LIDA 3B42A 1BYWA 2Y4AA 1CI9A 4P6ZM 4GNUA 3EGDC 5HFOA 1IYSA 4FCFA 2WGWB 4DF6A 2V1ZA 3MMHA 3T4QA 1F5MA 3IWOA 2Y2PA 4S2MA 1KE3A 2Y2NA 3C30A 3FPVA 2MJ6A 3UN7A 3PXPA 1O7EA 2EFXA 1TDLA 4HJ4A 2CMNA 4XT2B 4YNRA 1CEGA 4Y15A 3PBTA 4IUHA 5HAIA 1N9NA 1TS0A 4KQDA 3BFDA 4UA6A 4HI4A 2A3UA 4B4ZA 3VFHA 3TJZC 4DMZA 1ES2A 2J7VA 4KZ8A 3UE0A 5HX9A 4PKYG 1YKDA 3PHYA 3QNBA 4S2NA 5GHYA 2PU4A 3A3JA 3V39A 2R9XA 4JGOA 5DFYA 2WYXA 4JXWA 4X25A 4ZDXA 3EEHA 5AQBA 5FQQA 3DTEA 3JYIA 3DBAA 3P7NA 1PYYA 2Y79A 3MBZA 1CF0A 2XD5A 3MZFA 1K0KA 1NZOA 5L10A 3T4KA 2ZC5B 5KSHA 1OTAA 2INWA 5HZHA 3JVVA 3O3VA 3ITAA 5G4YA 3BFFA 4ZRRA 1ACFA 2AVXA 1NRFA 3OPRA 4WN5A 4AFIA 1MKIA 4WZ4A 4EQ1A 3MJQA 1FR1A 2PYRA 1ZHHB 1W79A 4OP5A 2Y2GA 1XGIA 5FAQA 1OTIA 3W8KA 3UO9A 2J3WA 3C7UA 2X02A 2XF3A 4LRYC 3BLSA 2RL3A 2RCXA 2J3TC 2IA2A 1D1JA 4L0LA 2PD7A 4EBNA 3HLCA 1S6RA 4C6YA 1TD5A 2JCHA 3UDXA 1L0GA 2VGLS 3O87A 3G2YA 3S7QA 4X53A 5EPHA 5EVID 3CG5A 3EEAA 3ZG7B 1GA0A 2A2LA 4LGWA 3CITA 1ES3A 2WAFA 2M7VA 4FD8A 1XA7A 3IXBA 3UMDA 1PFLA 3IS2A 1MBLA 4WBGA 2ZOIA 5CERA 2A24A 4CLCC 3UDIA 3VP1A 4L9GA 1TS7A 3UDFA 3UB8A 3ZGAB 2HPBA 1YLYA 5IS1A 4FH2A 3IS2B 4R4SA 2EXBA 5MC7A 1IYPA 3M6HA 3GTCA 4OPQA 1SZVA 1L2SA 2WKEA 4DE3A 4S2OA 5DF8A 4HP9A 2ZC3B 4Q0JA 1XJ3A 4I5SA 4LV1A 5A90A 2EXAA 3H7WA 3BY8A 5TGFA 2I9VA 1BLSA 2EX2A 4QD4A 4JPMA 3CUEA 4D2OA 2WKPA 3D72A 1C3BA 2WKIA 1P9WA 1WA9A 1YPRA 3IF6C 3ZG8B 4B4XA 3MXQA 1W7FA 3HJKA 4EU0A 5FA7A 3UE6A 1RCJA 3N4IA 3H7WB 4IJGA 1KGEA 4H6JA 5HAQA 5CGSA 3ZYTA 3GR2A 2PD8A 1LLBA 1ERMA 1VHMA 1IOUA 1L0DA 4PHTA 1PW1A 3VP3A 3VP4A 3LY4A 4MEZA 3KYEA 2PDRA 2FFFB 2QHKA 2JC7A 4H6JB 3MKFA 3LCEA 4GCZA 4JXGA 3KSFA 3VP0A 3SOIA 3HUMA 1FILA 1NLZA 2DRWA 1GA9A 3IX8A 3TW8A 3WWXA 5G4ZA 2KDKA 4IVKA 3F1PA 2ZMFA 4Y0OA 2KLIA 3OPHA 1KDWA 3ZQ5A 5DTKA 2V0UA 4UAAA 3ZVWA 3DAVA 3B3XA 4N9LA 3MKEA 5FQKA 3GRJA 4E3LA 4MLLA 4RX3A 2HF6A 4N1HA 3ZFZA 1PZPA 5AVFA 2H5SA 3A3IA 1KGGA 2VEAA 2VV6A 1OTDA 3UB5P 1MXOA 4WELA 1XKZA 3A0SA 5GLBA 3Q81A 3UB7A 1IYQA 1IFQA 2OWHA 2WK0A 4KUOA 4L9FA 2BASA 1CQAA 3KX0X 5F6AA 2HZ5A 3PBQA 5FL3A 5EOOA 2ZD8A 3SS5A 2HJEA 2WKHA 2V20A 1FCOA 1VEUA 3T4TA 4MBHA 3PTEA 1XXMA 3E4QA 1GSXA 2PYPA 4WM9A 4GB7A 2P9VA 4KG2A 1LT0A 1XFQA 1V9ZA 4RX2A 4OQ0A 4LCLA 1IELA 5AQAA 3VSLA 4I3IA 1NXYA 3ZG5A 3V3RA 4WZ5A 3HUOA 3G35A 4OQGA 4Y13A 3UNWA 2P9VB 4G3VA 3BFEA 4UA9A 3IT9A 1GHPA 5EFWA 4Z1WA 3BECA 2IWCA 1W5DA 4HBTA 5JYOA 5GLAA 2E8IA 1CJFA 4EW7A 1LI9A 3A3FA 1L3LA 4OOYA 1MWSA 2WKRA 4MN6A 1SKFA 3DW0A 4LENA 5EM0A 4K0XA 4ETXA 3T4OA 5A8BA 4P6ZS 1DY6A 1S1YA 4O0PA 5CX7A 3LIFA 2ZQCA 4PM8A 3I7JA 1XJ4A 4HHDA 4BENA 2G7UA 4RVAA 4UQIM 3NJAA 1ALQA 2K7SA 5IHVA 2Y2KA 2ZL1A 4OQIA 2PT7A 2VJWA 1GHIA 1XP4A 2XDMA 5E2GA 5FI2A 4A5RA 3UPOA 3MQQA 4IUKA 3HLFA 2C6WB 4I39A 2B95A 3IBRA 1S0WA 1YLZA 5U47A 3E2KA 3DWZA 1NRJA 3UMEA 2OSUA 2ZBBA 2DCFA 3FV7A 1FOFA 4OKPA 4E3KA 1K55A 3EQUA 1WYCA 3ZNYA 4XUZA 3QHYA 4OVDA 1NJ4A 2H28A 3QP2A 2W3FA 1M40A 1W8QA 2GDNA 4NETA 4JGQA 1I2WA 2ZQ7A 2Y2IA 3DTIA 3IH8A 1K57A 2EWVA 3NY4A 3PAGA 3GDIA 2NUTC 1A0KA 4CQHA 3VV4A 3B47A 1GCEA 3O86A 1WE4A 1RP5A 3M2JA 5L09A 1XGJA 2W27A 4XXRA 2ZLYA 2WZXA 5TBMA 3C8CA 3FPWA 2V9AA 3PBRA 3VMAA 1H8ZA 5I5LA 5F5YA 1PRQA 4XT2A 4IBRA 5E43A 2GJ3A 1ERQA 1YAXA 2ZJ9A 4BD1A 1TDGA 4R4RA 5DTTA 3LFVA 4QWOA 5TBMB 1P0ZA 2G2WA 2QMIA 2ZM2A 3UB6A 1T1AA 3CZDA 3CUEC 1XA1A 4ZJ3A 3VOLA 4DDYA 3TE8A 2ZQ8A 3IQAA 1S4RA 1BLHA 3LICA 5HL6A 3RJUA 3RXXA 5F1FA 2QJ5A 4GS9B 4DJ2A 2XLNA 4Y0UA 5EVIC 1PW8A 5FAPA 4E3JA 3LEQA 1JVJA 3VSKA 3DTMA 1FCMA 3P98A 3LR3A 2O9AA 3VE3A 3ZCZA 5HD5A 2Y2JA 2ZMAA 1CI8A 5HAPA 2BG1A 1Y4OA 4S2LA 5HPFA 4P0MA 4Y3IA 4KZBA 2CC1A 3LEZA 1DP9A 2L1MA 4HEFA 4NXFA 4OOLA 5CHJA 3EQVA 2C5WB 3V5MA 5EOEA 1K56D 1PNEA 1YLTA 2W0NA 3OPLA 2O9CA 4QU3A 4GZBA 4PAUA 4EETB 1SHVA 1BZAA 1J3WA 3NULA 3SW1A 1U60A 1SDNA 4D60A 4OP8A 2XFTA 4DE0A 4X1MA 2JKRM 5HWVA 2ZM0A 3WS1A 4R3BA 2BLSA 2XRNA 4Q0HA 1YSPA 3OBFA 1BUEA 1BULA 4X68A 3OZHA 3QP4A 3IX4A 5GL9A 5IT5A 4I38A 1I2SA 3HREA 1LL8A 2B02A 3IH9A 4C3QA 3C2WA 1ES4A 3SS4A 5CTNA 1D06A 3LI8A 2JKGA 1NZUA 3G4PA 1TVFA 3T1SA 4S2IA 4EBPA 4ZJ1A 3O5YA 1ESUA 1SKOB 4K91A 2LB9A 3BFGA 2H0YA 4MBKA 4WUJA 4QB8A 1TF1A 2NUPC 4F94A 1SDEA 3BFCA 4JF4A 1JWPA 3S22A 4MN5A 4QY6A 1K6SA 3HBRA 2VK3A 1H8MA 5FDHA 3NOTC 1XJ2A 5L2FA 3QP6A 3UE3A 1E25A 5HL1A 1YQSA 4WF0A 1OT9A 1PWCA 1E3UD 1GHMA 1K25A 4CJNA 2JKRI 1K56A 1STZA 3GECA 2GNXA 4I3JA 1KE0A 1TS6A 1S4SA 1GSVA 2JKFA 2EX8A 3ZVTA 3C38A 2W3EA 4HNBA 2Q9MA 4ZAMA 4PM7A 2DNSA 2P7JA 5CEDA 5FQ9A 2OOLA 1DJBA 5LBRA 3G30A 2LB5A 1Z6FA 4U3TA 4X6TA 1FSWA 4IVIA 5CEBA 1BTLA 3LIEA 4Y7PA 2H0TA 4ESPA 2Z2LB 3C7VA 3AGDA 2L4RA 5EVLA 5K5BA 3T1XA 1OMEA 3VOZA 1KVMA 5KZHA 2V8FA 1YSQA 5TR7A 4RA7A 1RGZA 3CJMA 4GD8A 2EX9A 3N8RA 4BBTA 5EV0A 4S2KA 3HVFA 1EW0A 2W1TA 2ZMVA 2ZM8A 3LR5A 5DJTA 5CGWA 4H8RA 3QNCA 1K55C 3UPPA 3V3SA 4Y17A 1H3QA 5E2EA 1ZC2A 3RH8B 5L07A 4OLGA 3AGFA 5HDCA 3T50A 1E3UA 1FQGA 5J8XA 4MN7A 3EOIA 5CXWA 2W1TB 4K08A 1K57C 2JHEA 3Q7VB 2FZ0A 1JNUA 2IWDA 4JF5A 1YM1A 1M6KA 5GLDA 3OPPA 4HJ3A 4FOFA 3D4FA 4BL3A 4DN0A 3S7OA 4QY5A 4LV2A 2JBFA 3SH8A 1OJGA 5F68A 4UHUA 2QYBA 2Y2MA 1LI0A 1HZOA 2VKSA 1K4EA 4UQIS 4KQOA 1W8YA 1YLPA 3LI9A 1ZTUA 5BOHA 3TOIA 1HLUP 1LHYA 3N8SA 1EWZA 4S2PA 1QMFA 2HP9A 3C4PA 3IXHA 2V1BA 3Q7ZA 2YKFA 2PR5A 4M4XA 1LSWA 3MQ0A 2IWBA 4U0XA 1Y28A 4KZ9A 1MC0A 5E2FA 1JTGA 4Q8IA 1DP8A 4ZTKA 4LPZA 2JKTM 1G28A 4KG6A 4YWZA 1DRMA 4ID4A 4S2NC 1BLCA 2XR0A 3FWLA 3ITBA 4LRXC 5HDSA 1ESIA 4EQIA 4YOFA 3FYZA 3D3OA 4RQ9A 4X55A 5AJGA 3S4XA 3PYPA 2M7UA 1W63Q 3KSGA 3ISGA 1PWGA 1S66L 5DKLA 4GOGA 3WS2A 4OOMA 2D01A 3PBNA 1HTZA 1H0MA 1PI4A 2FH5A 2R9WA 3WS5A 3LR4A 4B93A 5KIZA 3KSIA 4LRZE 3W2ZA 3OLOA 3ZNTA 1KVLA 2ZQ9A 5EM1A 3S7PA 4IHQA 3CMZA 3UE1A 1ZG4A 2OAP1 2Z2MB 4R3AA 3MXSA 1XFNA 4CLCB 3IX3A 3IHBA 4X56A 2Y55A 3GV9A 4C75A 1TEMA 4GW9A 4CPKA 4O8GA 1XJ6A 5TFQA 1K54A 4E04A 1H8YA 1UWPX 4N92A 3F1NA 3MS6A 4HQAA 2XK1A 4DKIA 2JKTI 2QWSA 3H9WA 5FQJA 4OPYA 2W3HA 3E4OA 3FKVA 3MF0A 3NHQA 2P74A 1WYBA 3T4SA 3E98A 4WEKA 3SS3A 2KX6A 3IF6A 1NLYA 3HLDA 2XH9A 3ZDJA 4MNRA 5HW3A 3BQAA 2EX6A 2J8YA 4Z9QA 3S7NA 1N4OA 3F1NB 3NDGA 2EA9A 2XD1A 3JVUA 4ARZB 5HD3A 4CLCE 1MY8A 3QP1A 4JXVA 5CHUA 2GX5A 1PZOA 5KMWA 3IF6B 1S67L 2KOIA 1VQQA 1BLPA 4E6WA 5GHZA 2HP5A 2H10A 4GDNA 4P6BA 3KYQA 2V0WA 3NDEA 3L7HA 4R70A 3IXDA 2E8JA 3B33A 4KZ4A 1BSGA 3U2AA 3A3DA 5J3WA 3AGEA 2HV1A 1MPLA 4HP4A 3GMWA 1Q2PA 4JGPA 1LSVA 2O0YA 1VM1A 4PM6A 3TSGA 1SCWA 5IU1A 5J7EA 1JWVA 3NC8A 3BJNA 4IBXA 3MFXA 2ZQDA 1T1BA 1N9OA 4KZ6A 1KOUA 1G68A 3CPTA 4L9EA 1G5UA 3FKWA 3M6BA 5L8MA 1RGYA 3K3CA 3VOYA 2HDRA 3BQ8A 2OWJA 5DF9A 5DTSA 5F82A 3CLOA 4E3IA 1OJ5A 1CEFA 2VZWA 3D9YA 2VA0A 4GS9A 3TRCA 3CPTB 5FASA 4KZ3A 4DRTA 4B88A 1GSWA 3LIAA 4OONA 4LFUA 2YKHA 4DE1A 4NK3A 4JBFA 4JGRA 2XA7M 3QP8A 4ZBEA 3MR0A 5HARA 4E3MA 3ZG0A 1MZUA 1K38A 4YFMA 4B9OA 3MSHA 3CI6A 3GSGA 4GN2A 4WEJA 5DFXA 1IYOA 1NY0A 3NBLA 4N1XA 4HY8A 5HWWA 2V8CA 3NOPC 4EBLA 2HJ9C 4O7DA 2VGJA 3CWFA 5GLCA 4O01A 3CHWP 2HGVA 2BTFP 4GKUA 3LR0A 4KQRA 3F1OA 5M1AA 1F2KA 1VETA 2PR6A 4HH2A 3C5AA 3A3EA 2QPNA 1G6OA 5I94A 4UA7A 4II7A 3FG8A 1PWDA 5D3OA 4MCWA 5CHMA 4HBUA 3UB9A 4NXEA 1IKIA 4PKYA 3VFFA 4GHIA 5EECA 5FI7A 4U0TA 3F1OB 4KUKA 1VETB 1MKMA 3G34A 1FIKA 2WAEA 2EFUA 3R4KA 4MDZA 5G18A 2WADA 4YINA 4GLQA 2K31A 3IHAA 5A92A 3CAXA 1SKOA 1YLJA 1J9MA 3MQOA 4HOIA 5AQ9A 2FFYA 3BM6A 3A0RA 4FSFA 4GHIB 4DJ3A 4EV4A 4DXBA 4BWIA 2W3GA 2Y2LA 4NKPA 4R1GA 1MWUA 2Y2QA 4XUXA 3PBOA 1LL5A 1MWTA 4R6LA 3P01A 1BT5A 4OH0A 1N9LA 1T1CA 5HPIA 4FH4A 3BLMA 4X1LA 4Y0TA 1AWIA 4BLMA 3LY3A 4BMWA 4E6XA 1H5XA 3LO7A 4KZAA 4R23A 2P04A 2PBYA 1S1ZA 4R38A 3WS0A 4BL2A 3LUQA 3C4OA 4ME4A 1VB6A 3MZDA 1ZKJA 4EEUA 5JYPA 5FEFA 2JN7A 3OCNA 4WMCD 2XQZA 5AVEA 1P97A 2XFSA 3KSHA 4WZ5C 3K2NA 3P09A 1IKGA 1OT6A 2O9BA 3NCKA 4OPRA 2EWWA 4Q0IA 3N6IA 1KE4A 3BW6A 2ZOHA 3HLEA 4KG5A 4HESA 2O99A 4KZ7A 1K4FA 4HH3A 4LCMA 3FZCA 2DMWA 5FI6A 1ODVA 2HDQA 2X01A 4P87A 3G2ZA 1Z09A 4X69A 4PPRA 1NYMA 3PR6A 2J80A 2QKPA 4M3KA 3R7WA 4R0QA 2Y59A 3S1YA 3L9KA 2A24B 3WRTA 4WL9A 3E4PA 3M2KA 5DJUA 3BWLA 5FQMA 3W4PA 1K54C 2PAVP 3NIAA 2K2NA 4BBUA 4Y2FA 4I3AA 1QMEA 1ONHA 4JKTA 3LGOA 3R7WB 1F98A 2A49A 1L0FA 2OLUA 4G3KA 1FCNA 3EWKA 5CGXA 1V9YA 3ZG9B 1XPBA 2ZC6B 3EGXC 2J3TD 1FSYA 1D7EA 4LLOB 4PM9A 1K6RA 2Z6CA 1YT4A 1XX2A 3BRMA 3DTKA 3MZEA 3N7WA 4WMCA 3Q7VA 5A93A 5EVIA 1CK3A 2Y2OA 2VGLM 3BY9A 3WRZA 2Q9NA 2VLGA 4HJ6A 2L0WA 4R3JA 1F9IA 4LV3A 4PMAA 2UV0E 3WS4A 5EVIB 3QP5A 3G32A 4CLCD 3N8LA 2D02A 5CRFA 2VX8A 4QPRA 3T1QB 1W63M 4BQMA 4DE2A 3MFDA 4DDSA 1NWZA 4ZJ2A 3W4QA 1P9RA 3T4LA 4OPZA 3G31A 3NI9A 2OAQ1 1YMXA 3UY6A 2XROA 3PBSA 5F83A 2VV8A 4FUWA 2P08A 1G6AA 2G2UA 3NECA 1L0EA 3F1PB 3UPNA 2J9PA 4OLDA 2HP6A 2XEPA 3TG9A 3HUNA 4KQQA 1Y54A 3ZHHA 4MBFA 5M19A 4K0WA 2ACGA 4PM5A 4F3LA 4JF6A 5DVAA 5FATA 2WGIA 1ONGA 4KENB 2XSSA 4GDBA 2UWXA 1PIOA 4EXOA 3RTYA 5FEGA 4P85A 5C5KA 2Y2HA 1YLWA 3T4JA 3OOVA 4IEDA 5HDDA 3Q07A 2Y8HA 3LIBA 4F3LB 3GQZA 2GZAA 3IF5A 3U4LP 4EERA 3SH9A 3MXRA 1OTBA 5CECA 5TJJA 5E2HA 5J4EA 2XGNA 4ETZA 1UGUA 4BD0A 5F69A 1ES5A 1KDSA 3BYDA 3W4OA 5HWTA 1I5QA 1UWNX 4KZ5A 4CLCA 1VEUB 5FSRA 3KYZA 3ULFA 4EESA 3A0VA 4DXCA 1FR6A 3GVBA 4N9KA 2X71A 1OPXA 1X0OA 4EUVA 1T18A 4JLFA 4E3NA 2WKQA 3FC7A 2ZC4B 3LYXA 4MMNA 3V50A 3SZTA 3H82A 1DJAA 4RYEA 3BEBA 5FDSA 3T12B 2JE5A 1DP6A 2PU2A 3RXWA 1JWZA 5GHXA 2PBDP 5EE8A 5DKKA 3E0YA 2ZC7A 1AXBA 4WYYA 1MWRA 2M1CA 4OQHA 2Z6DA
chains in the Genus database with same CATH topology
5DTKA 3ZG0A 5FDHA 1K38A 4YFMA 1KGFA 5L2FA 1Q2QA 4UAAA 2QZ6A 3HLWA 3DWKA 3UE3A 3ZVWA 1DJCA 1E25A 4EWFA 3GSGA 1PI5A 1YQSA 3B3XA 4N9LA 5HL1A 1PWCA 4GN2A 1E3UD 4WEJA 4QJGA 1GHMA 1K25A 1IYOA 3VP2A 4CJNA 1NY0A 3MKEA 1K56A 1YMSA 5FQKA 2I72A 3GRJA 3E2LA 3NBLA 2WZZA 4E3LA 4MLLA 4RX3A 4N1XA 4N1HA 1ZG6A 1KE0A 2WGVA 1E4DA 5DF7A 1PZPA 3ZFZA 1IEMA 2H5SA 3IWQA 2EX8A 1EROA 3A3IA 4EBLA 3O88A 3ZVTA 4O7DA 4QHCA 2VGJA 5GLCA 1NYYA 1KGGA 1N9BA 2OLVA 3IXGA 2HDUA 5EUAA 3IWIA 2Q9MA 4ZAMA 1MXOA 4GKUA 4WELA 3HLBA 4E3OA 1LL9A 4PM7A 2DNSA 4JXSA 1XKZA 4KQRA 5M1AA 5GLBA 3OCLA 5CEDA 3Q81A 5FQ9A 3C5AA 1IYQA 5CTMA 1DJBA 3A3EA 3SH7A 2QPNA 2V2FF 2WK0A 4LV0A 5I94A 4UA7A 3G30A 1Z6FA 4U3TA 4X6TA 1FSWA 4IVIA 1PWDA 5CEBA 5D3OA 5CHMA 3PBQA 1BTLA 2ZD8A 4HBUA 3HLGA 4Y7PA 5EOOA 5M18A 3SS5A 3PAEA 2H0TA 3Q1FA 2WKHA 2Z2LB 2V20A 1FCOA 3C7VA 2B5RA 2VGKA 1IKIA 5F1GA 1JTDA 3PTEA 3AGDA 4MBHA 5EECA 1XXMA 5FI7A 4U0TA 3VFFA 4WM9A 3G34A 4GB7A 3OC2A 5EVLA 2OV5A 2WAEA 2P9VA 4GD6A 5AQ7A 2EFUA 4KG2A 4S2JA 5G18A 4RX2A 4OQ0A 1EI5A 2WADA 1OMEA 4LCLA 3Q82A 4YINA 3VOZA 5A91A 1KVMA 5KZHA 1IELA 2HDSA 4BJPA 3IHAA 3HL9A 5TR7A 5A92A 5AQAA 5FAOA 4RA7A 3VSLA 1RGZA 1NXYA 3CJMA 1YLJA 1O07A 1J9MA 5FQIA 3V3RA 3ZG5A 2WGWA 5AQ9A 4GD8A 4WZ5A 3HUOA 2EX9A 2FFYA 3BM6A 4FSFA 3G35A 4EV4A 1HVBA 3N8RA 2ZQAA 4OQGA 4DXBA 1HD8A 4EUZA 2WUQA 4S2KA 3UNWA 3HVFA 2J9OA 2Y91A 2Y2LA 2P9VB 3BFEA 4UA9A 2ZM8A 4R1GA 1MWUA 2Y2QA 4XUXA 5KSCA 5CGWA 4H8RA 3PBOA 3IT9A 3QNCA 1K55C 1GHPA 3UPPA 1LL5A 1MWTA 3BECA 3V3SA 1BT5A 4OH0A 2Y4AA 1CI9A 1ZC2A 5E2EA 2IWCA 4GNUA 4FH4A 1W5DA 3BLMA 4HBTA 4OLGA 5GLAA 5HFOA 2E8IA 4Y0TA 5JYOA 1IYSA 4FCFA 4BLMA 2WGWB 1LI9A 3AGFA 3LY3A 2V1ZA 4DF6A 3A3FA 4E6XA 1H5XA 4OOYA 1E3UA 1FQGA 3LO7A 1MWSA 4KZAA 4R23A 5J8XA 2PBYA 3IWOA 2Y2PA 2Y2NA 1KE3A 4S2MA 3WS0A 4BL2A 5CXWA 1SKFA 3C4OA 3DW0A 4LENA 3MZDA 4K0XA 1K57C 1ZKJA 3UN7A 5JYPA 1DY6A 1O7EA 2EFXA 1TDLA 3OCNA 3Q7VB 2IWDA 4JF5A 1YM1A 1M6KA 4WMCD 2XQZA 2ZQCA 4PM8A 1CEGA 5GLDA 3OPPA 3I7JA 4BENA 3PBTA 2XFSA 4RVAA 3D4FA 5HAIA 4BL3A 4WZ5C 3P09A 3BFDA 4UA6A 1IKGA 1ALQA 4QY5A 3NCKA 4LV2A 2JBFA 3SH8A 4OPRA 5IHVA 2A3UA 4B4ZA 2Y2KA 3VFHA 3N6IA 4OQIA 1KE4A 4UHUA 1ES2A 2J7VA 4KZ8A 3HLEA 5E2GA 1GHIA 1XP4A 2XDMA 4HESA 4KG5A 2Y2MA 3UE0A 1LI0A 5HX9A 4KZ7A 5FI2A 1HZOA 1K4EA 4A5RA 1K4FA 3QNBA 4KQOA 3UPOA 4S2NA 4LCMA 5GHYA 2PU4A 3HLFA 3A3JA 2C6WB 3FZCA 5FI6A 1W8YA 1YLPA 3V39A 2R9XA 1S0WA 1YLZA 5U47A 5BOHA 3TOIA 3E2KA 2HDQA 3DWZA 2WYXA 1LHYA 4JXWA 3N8SA 2X01A 2OSUA 1EWZA 4ZDXA 2DCFA 4P87A 3G2ZA 3FV7A 5AQBA 5FQQA 4S2PA 1QMFA 3JYIA 4X69A 1FOFA 1NYMA 4PPRA 4OKPA 2HP9A 4E3KA 4M3KA 1K55A 3EQUA 4R0QA 1PYYA 2Y59A 3S1YA 1WYCA 3C4PA 3MBZA 3ZNYA 4XUZA 3IXHA 3QHYA 4OVDA 3WRTA 3Q7ZA 1NJ4A 2XD5A 3MZFA 3M2KA 1NZOA 1M40A 1W8QA 2GDNA 2IWBA 2ZC5B 5KSHA 4U0XA 5FQMA 4KZ9A 3W4PA 4NETA 3O3VA 3ITAA 1I2WA 1JTGA 3BFFA 2ZQ7A 2Y2IA 5E2FA 1K54C 3IH8A 4ZTKA 4Q8IA 3NIAA 1K57A 3NY4A 3PAGA 1QMEA 1NRFA 1ONHA 4JKTA 4KG6A 3OPRA 2A49A 1L0FA 1MKIA 2OLUA 4ID4A 1FCNA 1BLCA 2XR0A 3FWLA 4S2NC 3ITBA 4WZ4A 1ESIA 5CGXA 4EQIA 1FR1A 3ZG9B 1GCEA 3O86A 1WE4A 1XPBA 3FYZA 1RP5A 2ZC6B 3M2JA 4X55A 1W79A 1XGJA 4OP5A 2Y2GA 1FSYA 4XXRA 1XGIA 2ZLYA 5FAQA 3S4XA 2WZXA 4PM9A 1K6RA 3W8KA 1YT4A 3ISGA 1XX2A 1PWGA 3BRMA 3UO9A 3MZEA 3N7WA 4GOGA 4OOMA 3WS2A 4WMCA 3Q7VA 3PBNA 3C7UA 1HTZA 2X02A 1H8ZA 3PBRA 3VMAA 1PI4A 2XF3A 5A93A 2R9WA 3BLSA 5EVIA 1CK3A 2Y2OA 3WS5A 4IBRA 5E43A 2RL3A 2RCXA 1ERQA 3WRZA 3ZNTA 2Q9NA 4L0LA 4EBNA 1KVLA 2ZJ9A 4BD1A 1TDGA 4R4RA 5DTTA 3HLCA 1S6RA 4R3JA 4C6YA 2ZQ9A 2JCHA 4LV3A 3UDXA 3CMZA 4PMAA 3UE1A 1L0GA 2G2WA 1ZG4A 2QMIA 3O87A 2ZM2A 2Z2MB 3WS4A 3G2YA 3MXSA 5EVIB 3CZDA 4X53A 3G32A 5EPHA 5EVID 3N8LA 3CG5A 1XA1A 5CRFA 3ZG7B 1GA0A 3IHBA 4ZJ3A 4DDYA 1ES3A 2WAFA 4X56A 2Y55A 2ZQ8A 3GV9A 4BQMA 4C75A 3MFDA 1TEMA 4DDSA 4DE2A 4CPKA 3IQAA 4FD8A 5TFQA 1K54A 1XA7A 3IXBA 1BLHA 4ZJ2A 3W4QA 1H8YA 4N92A 3RJUA 3RXXA 5F1FA 2XK1A 4OPZA 4DKIA 1MBLA 3G31A 4WBGA 3NI9A 5FQJA 1YMXA 2XLNA 4OPYA 5CERA 4Y0UA 5EVIC 3UY6A 3FKVA 3PBSA 5F83A 1PW8A 2P74A 5FAPA 1WYBA 3UDIA 3VP1A 4E3JA 4WEKA 1JVJA 3SS3A 3VSKA 3DTMA 1FCMA 3P98A 3UDFA 3IF6A 3ZDJA 1G6AA 2XH9A 3HLDA 3ZGAB 2HPBA 4MNRA 1YLYA 5HW3A 2G2UA 3ZCZA 2Y2JA 1L0EA 2ZMAA 1CI8A 3UPNA 5HAPA 2J9PA 4OLDA 2BG1A 2EX6A 2HP6A 2J8YA 2XEPA 3TG9A 3HUNA 4KQQA 1Y54A 4S2LA 4Z9QA 3ZHHA 4P0MA 4MBFA 1N4OA 4FH2A 3NDGA 5M19A 2XD1A 4K0WA 4PM5A 4R4SA 2EXBA 1MY8A 4KZBA 2CC1A 4JXVA 3LEZA 1IYPA 3M6HA 5CHUA 3GTCA 4JF6A 4OPQA 4HEFA 1L2SA 2WKEA 4OOLA 5CHJA 5DVAA 3EQVA 1PZOA 5FATA 2C5WB 5KMWA 3IF6B 2WGIA 1ONGA 4DE3A 4KENB 3V5MA 4GDBA 5EOEA 2UWXA 4S2OA 5DF8A 1PIOA 1VQQA 1BLPA 1K56D 4E6WA 2ZC3B 5GHZA 2HP5A 1YLTA 4LV1A 3OPLA 2H10A 4QU3A 4GDNA 4P85A 4GZBA 2EXAA 4P6BA 5A90A 1SHVA 2Y2HA 1BZAA 5TGFA 1YLWA 1BLSA 1U60A 2EX2A 1SDNA 3NDEA 4QD4A 4JPMA 4IEDA 4OP8A 3IXDA 3Q07A 4KZ4A 1BSGA 3GQZA 2XFTA 3A3DA 3IF5A 4DE0A 3AGEA 4D2OA 2ZM0A 1C3BA 1MPLA 2WKIA 3WS1A 3IF6C 3ZG8B 4B4XA 3GMWA 4R3BA 1Q2PA 2BLSA 3SH9A 1W7FA 3MXRA 1VM1A 5FA7A 4PM6A 3TSGA 1SCWA 5CECA 1RCJA 1JWVA 3NC8A 1BUEA 3N4IA 1BULA 4X68A 1KGEA 3OZHA 4IBXA 5HAQA 2ZQDA 5E2HA 5CGSA 2XGNA 4BD0A 3GR2A 4KZ6A 1G68A 1ES5A 5GL9A 1KDSA 3BYDA 3W4OA 1LLBA 1I5QA 4KZ5A 1ERMA 1I2SA 1L0DA 3HREA 3FKWA 1PW1A 3M6BA 3IH9A 5FSRA 3VP3A 4C3QA 3SS4A 1ES4A 1RGYA 3VP4A 3LY4A 5CTNA 3VOYA 4MEZA 2HDRA 4DXCA 1FR6A 2FFFB 5DF9A 5DTSA 5F82A 1NZUA 3GVBA 3G4PA 4N9KA 1TVFA 2JC7A 4E3IA 4S2IA 4EBPA 2X71A 4ZJ1A 1CEFA 1ESUA 3MKFA 3LCEA 4JLFA 4JXGA 4E3NA 2ZC4B 5FASA 4K91A 3VP0A 4KZ3A 4DRTA 4B88A 3BFGA 3SOIA 2H0YA 3HUMA 4MBKA 3V50A 4OONA 4QB8A 1DJAA 4RYEA 3BEBA 2DRWA 2JE5A 4F94A 1SDEA 1GA9A 2PU2A 3RXWA 1JWZA 5GHXA 4DE1A 5EE8A 4NK3A 3WWXA 4IVKA 3BFCA 4JF4A 2ZC7A 4JBFA 1AXBA 1JWPA 4WYYA 3S22A 4Y0OA 3OPHA 4QY6A 4ZBEA 1MWRA 1K6SA 3HBRA 1KDWA 4OQHA 5HARA 4E3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DTK A;  3ZG0 A;  5FDH A;  1K38 A;  4YFM A;  1KGF A;  5L2F A;  1Q2Q A;  4UAA A;  2QZ6 A;  3HLW A;  3DWK A;  3UE3 A;  3ZVW A;  1DJC A;  1E25 A;  4EWF A;  3GSG A;  1PI5 A;  1YQS A;  3B3X A;  4N9L A;  5HL1 A;  1PWC A;  4GN2 A;  1E3U D;  4WEJ A;  4QJG A;  1GHM A;  1K25 A;  1IYO A;  3VP2 A;  4CJN A;  1NY0 A;  3MKE A;  1K56 A;  1YMS A;  5FQK A;  2I72 A;  3GRJ A;  3E2L A;  3NBL A;  2WZZ A;  4E3L A;  4MLL A;  4RX3 A;  4N1X A;  4N1H A;  1ZG6 A;  1KE0 A;  2WGV A;  1E4D A;  5DF7 A;  1PZP A;  3ZFZ A;  1IEM A;  2H5S A;  3IWQ A;  2EX8 A;  1ERO A;  3A3I A;  4EBL A;  3O88 A;  3ZVT A;  4O7D A;  4QHC A;  2VGJ A;  5GLC A;  1NYY A;  1KGG A;  1N9B A;  2OLV A;  3IXG A;  2HDU A;  5EUA A;  3IWI A;  2Q9M A;  4ZAM A;  1MXO A;  4GKU A;  4WEL A;  3HLB A;  4E3O A;  1LL9 A;  4PM7 A;  2DNS A;  4JXS A;  1XKZ A;  4KQR A;  5M1A A;  5GLB A;  3OCL A;  5CED A;  3Q81 A;  5FQ9 A;  3C5A A;  1IYQ A;  5CTM A;  1DJB A;  3A3E A;  3SH7 A;  2QPN A;  2V2F F;  2WK0 A;  4LV0 A;  5I94 A;  4UA7 A;  3G30 A;  1Z6F A;  4U3T A;  4X6T A;  1FSW A;  4IVI A;  1PWD A;  5CEB A;  5D3O A;  5CHM A;  3PBQ A;  1BTL A;  2ZD8 A;  4HBU A;  3HLG A;  4Y7P A;  5EOO A;  5M18 A;  3SS5 A;  3PAE A;  2H0T A;  3Q1F A;  2WKH A;  2Z2L B;  2V20 A;  1FCO A;  3C7V A;  2B5R A;  2VGK A;  1IKI A;  5F1G A;  1JTD A;  3PTE A;  3AGD A;  4MBH A;  5EEC A;  1XXM A;  5FI7 A;  4U0T A;  3VFF A;  4WM9 A;  3G34 A;  4GB7 A;  3OC2 A;  5EVL A;  2OV5 A;  2WAE A;  2P9V A;  4GD6 A;  5AQ7 A;  2EFU A;  4KG2 A;  4S2J A;  5G18 A;  4RX2 A;  4OQ0 A;  1EI5 A;  2WAD A;  1OME A;  4LCL A;  3Q82 A;  4YIN A;  3VOZ A;  5A91 A;  1KVM A;  5KZH A;  1IEL A;  2HDS A;  4BJP A;  3IHA A;  3HL9 A;  5TR7 A;  5A92 A;  5AQA A;  5FAO A;  4RA7 A;  3VSL A;  1RGZ A;  1NXY A;  3CJM A;  1YLJ A;  1O07 A;  1J9M A;  5FQI A;  3V3R A;  3ZG5 A;  2WGW A;  5AQ9 A;  4GD8 A;  4WZ5 A;  3HUO A;  2EX9 A;  2FFY A;  3BM6 A;  4FSF A;  3G35 A;  4EV4 A;  1HVB A;  3N8R A;  2ZQA A;  4OQG A;  4DXB A;  1HD8 A;  4EUZ A;  2WUQ A;  4S2K A;  3UNW A;  3HVF A;  2J9O A;  2Y91 A;  2Y2L A;  2P9V B;  3BFE A;  4UA9 A;  2ZM8 A;  4R1G A;  1MWU A;  2Y2Q A;  4XUX A;  5KSC A;  5CGW A;  4H8R A;  3PBO A;  3IT9 A;  3QNC A;  1K55 C;  1GHP A;  3UPP A;  1LL5 A;  1MWT A;  3BEC A;  3V3S A;  1BT5 A;  4OH0 A;  2Y4A A;  1CI9 A;  1ZC2 A;  5E2E A;  2IWC A;  4GNU A;  4FH4 A;  1W5D A;  3BLM A;  4HBT A;  4OLG A;  5GLA A;  5HFO A;  2E8I A;  4Y0T A;  5JYO A;  1IYS A;  4FCF A;  4BLM A;  2WGW B;  1LI9 A;  3AGF A;  3LY3 A;  2V1Z A;  4DF6 A;  3A3F A;  4E6X A;  1H5X A;  4OOY A;  1E3U A;  1FQG A;  3LO7 A;  1MWS A;  4KZA A;  4R23 A;  5J8X A;  2PBY A;  3IWO A;  2Y2P A;  2Y2N A;  1KE3 A;  4S2M A;  3WS0 A;  4BL2 A;  5CXW A;  1SKF A;  3C4O A;  3DW0 A;  4LEN A;  3MZD A;  4K0X A;  1K57 C;  1ZKJ A;  3UN7 A;  5JYP A;  1DY6 A;  1O7E A;  2EFX A;  1TDL A;  3OCN A;  3Q7V B;  2IWD A;  4JF5 A;  1YM1 A;  1M6K A;  4WMC D;  2XQZ A;  2ZQC A;  4PM8 A;  1CEG A;  5GLD A;  3OPP A;  3I7J A;  4BEN A;  3PBT A;  2XFS A;  4RVA A;  3D4F A;  5HAI A;  4BL3 A;  4WZ5 C;  3P09 A;  3BFD A;  4UA6 A;  1IKG A;  1ALQ A;  4QY5 A;  3NCK A;  4LV2 A;  2JBF A;  3SH8 A;  4OPR A;  5IHV A;  2A3U A;  4B4Z A;  2Y2K A;  3VFH A;  3N6I A;  4OQI A;  1KE4 A;  4UHU A;  1ES2 A;  2J7V A;  4KZ8 A;  3HLE A;  5E2G A;  1GHI A;  1XP4 A;  2XDM A;  4HES A;  4KG5 A;  2Y2M A;  3UE0 A;  1LI0 A;  5HX9 A;  4KZ7 A;  5FI2 A;  1HZO A;  1K4E A;  4A5R A;  1K4F A;  3QNB A;  4KQO A;  3UPO A;  4S2N A;  4LCM A;  5GHY A;  2PU4 A;  3HLF A;  3A3J A;  2C6W B;  3FZC A;  5FI6 A;  1W8Y A;  1YLP A;  3V39 A;  2R9X A;  1S0W A;  1YLZ A;  5U47 A;  5BOH A;  3TOI A;  3E2K A;  2HDQ A;  3DWZ A;  2WYX A;  1LHY A;  4JXW A;  3N8S A;  2X01 A;  2OSU A;  1EWZ A;  4ZDX A;  2DCF A;  4P87 A;  3G2Z A;  3FV7 A;  5AQB A;  5FQQ A;  4S2P A;  1QMF A;  3JYI A;  4X69 A;  1FOF A;  1NYM A;  4PPR A;  4OKP A;  2HP9 A;  4E3K A;  4M3K A;  1K55 A;  3EQU A;  4R0Q A;  1PYY A;  2Y59 A;  3S1Y A;  1WYC A;  3C4P A;  3MBZ A;  3ZNY A;  4XUZ A;  3IXH A;  3QHY A;  4OVD A;  3WRT A;  3Q7Z A;  1NJ4 A;  2XD5 A;  3MZF A;  3M2K A;  1NZO A;  1M40 A;  1W8Q A;  2GDN A;  2IWB A;  2ZC5 B;  5KSH A;  4U0X A;  5FQM A;  4KZ9 A;  3W4P A;  4NET A;  3O3V A;  3ITA A;  1I2W A;  1JTG A;  3BFF A;  2ZQ7 A;  2Y2I A;  5E2F A;  1K54 C;  3IH8 A;  4ZTK A;  4Q8I A;  3NIA A;  1K57 A;  3NY4 A;  3PAG A;  1QME A;  1NRF A;  1ONH A;  4JKT A;  4KG6 A;  3OPR A;  2A49 A;  1L0F A;  1MKI A;  2OLU A;  4ID4 A;  1FCN A;  1BLC A;  2XR0 A;  3FWL A;  4S2N C;  3ITB A;  4WZ4 A;  1ESI A;  5CGX A;  4EQI A;  1FR1 A;  3ZG9 B;  1GCE A;  3O86 A;  1WE4 A;  1XPB A;  3FYZ A;  1RP5 A;  2ZC6 B;  3M2J A;  4X55 A;  1W79 A;  1XGJ A;  4OP5 A;  2Y2G A;  1FSY A;  4XXR A;  1XGI A;  2ZLY A;  5FAQ A;  3S4X A;  2WZX A;  4PM9 A;  1K6R A;  3W8K A;  1YT4 A;  3ISG A;  1XX2 A;  1PWG A;  3BRM A;  3UO9 A;  3MZE A;  3N7W A;  4GOG A;  4OOM A;  3WS2 A;  4WMC A;  3Q7V A;  3PBN A;  3C7U A;  1HTZ A;  2X02 A;  1H8Z A;  3PBR A;  3VMA A;  1PI4 A;  2XF3 A;  5A93 A;  2R9W A;  3BLS A;  5EVI A;  1CK3 A;  2Y2O A;  3WS5 A;  4IBR A;  5E43 A;  2RL3 A;  2RCX A;  1ERQ A;  3WRZ A;  3ZNT A;  2Q9N A;  4L0L A;  4EBN A;  1KVL A;  2ZJ9 A;  4BD1 A;  1TDG A;  4R4R A;  5DTT A;  3HLC A;  1S6R A;  4R3J A;  4C6Y A;  2ZQ9 A;  2JCH A;  4LV3 A;  3UDX A;  3CMZ A;  4PMA A;  3UE1 A;  1L0G A;  2G2W A;  1ZG4 A;  2QMI A;  3O87 A;  2ZM2 A;  2Z2M B;  3WS4 A;  3G2Y A;  3MXS A;  5EVI B;  3CZD A;  4X53 A;  3G32 A;  5EPH A;  5EVI D;  3N8L A;  3CG5 A;  1XA1 A;  5CRF A;  3ZG7 B;  1GA0 A;  3IHB A;  4ZJ3 A;  4DDY A;  1ES3 A;  2WAF A;  4X56 A;  2Y55 A;  2ZQ8 A;  3GV9 A;  4BQM A;  4C75 A;  3MFD A;  1TEM A;  4DDS A;  4DE2 A;  4CPK A;  3IQA A;  4FD8 A;  5TFQ A;  1K54 A;  1XA7 A;  3IXB A;  1BLH A;  4ZJ2 A;  3W4Q A;  1H8Y A;  4N92 A;  3RJU A;  3RXX A;  5F1F A;  2XK1 A;  4OPZ A;  4DKI A;  1MBL A;  3G31 A;  4WBG A;  3NI9 A;  5FQJ A;  1YMX A;  2XLN A;  4OPY A;  5CER A;  4Y0U A;  5EVI C;  3UY6 A;  3FKV A;  3PBS A;  5F83 A;  1PW8 A;  2P74 A;  5FAP A;  1WYB A;  3UDI A;  3VP1 A;  4E3J A;  4WEK A;  1JVJ A;  3SS3 A;  3VSK A;  3DTM A;  1FCM A;  3P98 A;  3UDF A;  3IF6 A;  3ZDJ A;  1G6A A;  2XH9 A;  3HLD A;  3ZGA B;  2HPB A;  4MNR A;  1YLY A;  5HW3 A;  2G2U A;  3ZCZ A;  2Y2J A;  1L0E A;  2ZMA A;  1CI8 A;  3UPN A;  5HAP A;  2J9P A;  4OLD A;  2BG1 A;  2EX6 A;  2HP6 A;  2J8Y A;  2XEP A;  3TG9 A;  3HUN A;  4KQQ A;  1Y54 A;  4S2L A;  4Z9Q A;  3ZHH A;  4P0M A;  4MBF A;  1N4O A;  4FH2 A;  3NDG A;  5M19 A;  2XD1 A;  4K0W A;  4PM5 A;  4R4S A;  2EXB A;  1MY8 A;  4KZB A;  2CC1 A;  4JXV A;  3LEZ A;  1IYP A;  3M6H A;  5CHU A;  3GTC A;  4JF6 A;  4OPQ A;  4HEF A;  1L2S A;  2WKE A;  4OOL A;  5CHJ A;  5DVA A;  3EQV A;  1PZO A;  5FAT A;  2C5W B;  5KMW A;  3IF6 B;  2WGI A;  1ONG A;  4DE3 A;  4KEN B;  3V5M A;  4GDB A;  5EOE A;  2UWX A;  4S2O A;  5DF8 A;  1PIO A;  1VQQ A;  1BLP A;  1K56 D;  4E6W A;  2ZC3 B;  5GHZ A;  2HP5 A;  1YLT A;  4LV1 A;  3OPL A;  2H10 A;  4QU3 A;  4GDN A;  4P85 A;  4GZB A;  2EXA A;  4P6B A;  5A90 A;  1SHV A;  2Y2H A;  1BZA A;  5TGF A;  1YLW A;  1BLS A;  1U60 A;  2EX2 A;  1SDN A;  3NDE A;  4QD4 A;  4JPM A;  4IED A;  4OP8 A;  3IXD A;  3Q07 A;  4KZ4 A;  1BSG A;  3GQZ A;  2XFT A;  3A3D A;  3IF5 A;  4DE0 A;  3AGE A;  4D2O A;  2ZM0 A;  1C3B A;  1MPL A;  2WKI A;  3WS1 A;  3IF6 C;  3ZG8 B;  4B4X A;  3GMW A;  4R3B A;  1Q2P A;  2BLS A;  3SH9 A;  1W7F A;  3MXR A;  1VM1 A;  5FA7 A;  4PM6 A;  3TSG A;  1SCW A;  5CEC A;  1RCJ A;  1JWV A;  3NC8 A;  1BUE A;  3N4I A;  1BUL A;  4X68 A;  1KGE A;  3OZH A;  4IBX A;  5HAQ A;  2ZQD A;  5E2H A;  5CGS A;  2XGN A;  4BD0 A;  3GR2 A;  4KZ6 A;  1G68 A;  1ES5 A;  5GL9 A;  1KDS A;  3BYD A;  3W4O A;  1LLB A;  1I5Q A;  4KZ5 A;  1ERM A;  1I2S A;  1L0D A;  3HRE A;  3FKW A;  1PW1 A;  3M6B A;  3IH9 A;  5FSR A;  3VP3 A;  4C3Q A;  3SS4 A;  1ES4 A;  1RGY A;  3VP4 A;  3LY4 A;  5CTN A;  3VOY A;  4MEZ A;  2HDR A;  4DXC A;  1FR6 A;  2FFF B;  5DF9 A;  5DTS A;  5F82 A;  1NZU A;  3GVB A;  3G4P A;  4N9K A;  1TVF A;  2JC7 A;  4E3I A;  4S2I A;  4EBP A;  2X71 A;  4ZJ1 A;  1CEF A;  1ESU A;  3MKF A;  3LCE A;  4JLF A;  4JXG A;  4E3N A;  2ZC4 B;  5FAS A;  4K91 A;  3VP0 A;  4KZ3 A;  4DRT A;  4B88 A;  3BFG A;  3SOI A;  2H0Y A;  3HUM A;  4MBK A;  3V50 A;  4OON A;  4QB8 A;  1DJA A;  4RYE A;  3BEB A;  2DRW A;  2JE5 A;  4F94 A;  1SDE A;  1GA9 A;  2PU2 A;  3RXW A;  1JWZ A;  5GHX A;  4DE1 A;  5EE8 A;  4NK3 A;  3WWX A;  4IVK A;  3BFC A;  4JF4 A;  2ZC7 A;  4JBF A;  1AXB A;  1JWP A;  4WYY A;  3S22 A;  4Y0O A;  3OPH A;  4QY6 A;  4ZBE A;  1MWR A;  1K6S A;  3HBR A;  1KDW A;  4OQH A;  5HAR A;  4E3M A; 
#chains in the Genus database with same CATH topology
 4ARZ A;  1KGF A;  1Q2Q A;  2QZ6 A;  3HLW A;  3DWK A;  1DJC A;  4EWF A;  3H82 B;  1PI5 A;  4Y5F A;  2XA7 S;  4QJG A;  4NEE D;  3KO6 A;  3VP2 A;  4GJ4 A;  3VE4 A;  3G6O A;  1LSX A;  1YMS A;  4UEY A;  5EVE A;  2I72 A;  2QJ7 A;  3E2L A;  2WZZ A;  3V67 A;  1ZG6 A;  5DF7 A;  2WGV A;  1E4D A;  1T19 A;  2R78 A;  1IEM A;  3IWQ A;  1ERO A;  3O88 A;  3NOU C;  1TS8 A;  4QHC A;  4FTX A;  1NYY A;  1N9B A;  2OLV A;  4EEP A;  3IXG A;  2HDU A;  5EUA A;  3IWI A;  3HLB A;  4E3O A;  1LL9 A;  4JXS A;  3ICY A;  4G3W A;  2ZL1 B;  3OCL A;  2VV7 A;  1OTE A;  5CTM A;  3SH7 A;  2V2F F;  4LV0 A;  3HJI A;  4NXB A;  3RFB A;  2W1R A;  2V1A A;  4WLA A;  5M18 A;  3HLG A;  3PAE A;  3Q1F A;  2PRF A;  2B18 A;  2B5R A;  2VGK A;  3HCY A;  2W3D A;  1JTD A;  4NG2 A;  5F1G A;  3OC2 A;  3IBJ A;  2OV5 A;  3JPU A;  4GD6 A;  5AQ7 A;  4S2J A;  5HSQ A;  3K3D A;  1EI5 A;  3Q82 A;  5A91 A;  2Q0O A;  2HDS A;  2PHY A;  4BJP A;  3HL9 A;  5FAO A;  1O07 A;  5FQI A;  3T1R A;  2WGW A;  4HIA A;  1HVB A;  2ZQA A;  1HD8 A;  4NXG A;  4EUZ A;  2WUQ A;  2J9O A;  2Y91 A;  4BBV A;  5KSC A;  3LID A;  3B42 A;  1BYW A;  2Y4A A;  1CI9 A;  4P6Z M;  4GNU A;  3EGD C;  5HFO A;  1IYS A;  4FCF A;  2WGW B;  4DF6 A;  2V1Z A;  3MMH A;  3T4Q A;  1F5M A;  3IWO A;  2Y2P A;  4S2M A;  1KE3 A;  2Y2N A;  3C30 A;  3FPV A;  2MJ6 A;  3UN7 A;  3PXP A;  1O7E A;  2EFX A;  1TDL A;  4HJ4 A;  2CMN A;  4XT2 B;  4YNR A;  1CEG A;  4Y15 A;  3PBT A;  4IUH A;  5HAI A;  1N9N A;  1TS0 A;  4KQD A;  3BFD A;  4UA6 A;  4HI4 A;  2A3U A;  4B4Z A;  3VFH A;  3TJZ C;  4DMZ A;  1ES2 A;  2J7V A;  4KZ8 A;  3UE0 A;  5HX9 A;  4PKY G;  1YKD A;  3PHY A;  3QNB A;  4S2N A;  5GHY A;  2PU4 A;  3A3J A;  3V39 A;  2R9X A;  4JGO A;  5DFY A;  2WYX A;  4JXW A;  4X25 A;  4ZDX A;  3EEH A;  5AQB A;  5FQQ A;  3DTE A;  3JYI A;  3DBA A;  3P7N A;  1PYY A;  2Y79 A;  3MBZ A;  1CF0 A;  2XD5 A;  3MZF A;  1K0K A;  1NZO A;  5L10 A;  3T4K A;  2ZC5 B;  5KSH A;  1OTA A;  2INW A;  5HZH A;  3JVV A;  3O3V A;  3ITA A;  5G4Y A;  3BFF A;  4ZRR A;  1ACF A;  2AVX A;  1NRF A;  3OPR A;  4WN5 A;  4AFI A;  1MKI A;  4WZ4 A;  4EQ1 A;  3MJQ A;  1FR1 A;  2PYR A;  1ZHH B;  1W79 A;  4OP5 A;  2Y2G A;  1XGI A;  5FAQ A;  1OTI A;  3W8K A;  3UO9 A;  2J3W A;  3C7U A;  2X02 A;  2XF3 A;  4LRY C;  3BLS A;  2RL3 A;  2RCX A;  2J3T C;  2IA2 A;  1D1J A;  4L0L A;  2PD7 A;  4EBN A;  3HLC A;  1S6R A;  4C6Y A;  1TD5 A;  2JCH A;  3UDX A;  1L0G A;  2VGL S;  3O87 A;  3G2Y A;  3S7Q A;  4X53 A;  5EPH A;  5EVI D;  3CG5 A;  3EEA A;  3ZG7 B;  1GA0 A;  2A2L A;  4LGW A;  3CIT A;  1ES3 A;  2WAF A;  2M7V A;  4FD8 A;  1XA7 A;  3IXB A;  3UMD A;  1PFL A;  3IS2 A;  1MBL A;  4WBG A;  2ZOI A;  5CER A;  2A24 A;  4CLC C;  3UDI A;  3VP1 A;  4L9G A;  1TS7 A;  3UDF A;  3UB8 A;  3ZGA B;  2HPB A;  1YLY A;  5IS1 A;  4FH2 A;  3IS2 B;  4R4S A;  2EXB A;  5MC7 A;  1IYP A;  3M6H A;  3GTC A;  4OPQ A;  1SZV A;  1L2S A;  2WKE A;  4DE3 A;  4S2O A;  5DF8 A;  4HP9 A;  2ZC3 B;  4Q0J A;  1XJ3 A;  4I5S A;  4LV1 A;  5A90 A;  2EXA A;  3H7W A;  3BY8 A;  5TGF A;  2I9V A;  1BLS A;  2EX2 A;  4QD4 A;  4JPM A;  3CUE A;  4D2O A;  2WKP A;  3D72 A;  1C3B A;  2WKI A;  1P9W A;  1WA9 A;  1YPR A;  3IF6 C;  3ZG8 B;  4B4X A;  3MXQ A;  1W7F A;  3HJK A;  4EU0 A;  5FA7 A;  3UE6 A;  1RCJ A;  3N4I A;  3H7W B;  4IJG A;  1KGE A;  4H6J A;  5HAQ A;  5CGS A;  3ZYT A;  3GR2 A;  2PD8 A;  1LLB A;  1ERM A;  1VHM A;  1IOU A;  1L0D A;  4PHT A;  1PW1 A;  3VP3 A;  3VP4 A;  3LY4 A;  4MEZ A;  3KYE A;  2PDR A;  2FFF B;  2QHK A;  2JC7 A;  4H6J B;  3MKF A;  3LCE A;  4GCZ A;  4JXG A;  3KSF A;  3VP0 A;  3SOI A;  3HUM A;  1FIL A;  1NLZ A;  2DRW A;  1GA9 A;  3IX8 A;  3TW8 A;  3WWX A;  5G4Z A;  2KDK A;  4IVK A;  3F1P A;  2ZMF A;  4Y0O A;  2KLI A;  3OPH A;  1KDW A;  3ZQ5 A;  5DTK A;  2V0U A;  4UAA A;  3ZVW A;  3DAV A;  3B3X A;  4N9L A;  3MKE A;  5FQK A;  3GRJ A;  4E3L A;  4MLL A;  4RX3 A;  2HF6 A;  4N1H A;  3ZFZ A;  1PZP A;  5AVF A;  2H5S A;  3A3I A;  1KGG A;  2VEA A;  2VV6 A;  1OTD A;  3UB5 P;  1MXO A;  4WEL A;  1XKZ A;  3A0S A;  5GLB A;  3Q81 A;  3UB7 A;  1IYQ A;  1IFQ A;  2OWH A;  2WK0 A;  4KUO A;  4L9F A;  2BAS A;  1CQA A;  3KX0 X;  5F6A A;  2HZ5 A;  3PBQ A;  5FL3 A;  5EOO A;  2ZD8 A;  3SS5 A;  2HJE A;  2WKH A;  2V20 A;  1FCO A;  1VEU A;  3T4T A;  4MBH A;  3PTE A;  1XXM A;  3E4Q A;  1GSX A;  2PYP A;  4WM9 A;  4GB7 A;  2P9V A;  4KG2 A;  1LT0 A;  1XFQ A;  1V9Z A;  4RX2 A;  4OQ0 A;  4LCL A;  1IEL A;  5AQA A;  3VSL A;  4I3I A;  1NXY A;  3ZG5 A;  3V3R A;  4WZ5 A;  3HUO A;  3G35 A;  4OQG A;  4Y13 A;  3UNW A;  2P9V B;  4G3V A;  3BFE A;  4UA9 A;  3IT9 A;  1GHP A;  5EFW A;  4Z1W A;  3BEC A;  2IWC A;  1W5D A;  4HBT A;  5JYO A;  5GLA A;  2E8I A;  1CJF A;  4EW7 A;  1LI9 A;  3A3F A;  1L3L A;  4OOY A;  1MWS A;  2WKR A;  4MN6 A;  1SKF A;  3DW0 A;  4LEN A;  5EM0 A;  4K0X A;  4ETX A;  3T4O A;  5A8B A;  4P6Z S;  1DY6 A;  1S1Y A;  4O0P A;  5CX7 A;  3LIF A;  2ZQC A;  4PM8 A;  3I7J A;  1XJ4 A;  4HHD A;  4BEN A;  2G7U A;  4RVA A;  4UQI M;  3NJA A;  1ALQ A;  2K7S A;  5IHV A;  2Y2K A;  2ZL1 A;  4OQI A;  2PT7 A;  2VJW A;  1GHI A;  1XP4 A;  2XDM A;  5E2G A;  5FI2 A;  4A5R A;  3UPO A;  3MQQ A;  4IUK A;  3HLF A;  2C6W B;  4I39 A;  2B95 A;  3IBR A;  1S0W A;  1YLZ A;  5U47 A;  3E2K A;  3DWZ A;  1NRJ A;  3UME A;  2OSU A;  2ZBB A;  2DCF A;  3FV7 A;  1FOF A;  4OKP A;  4E3K A;  1K55 A;  3EQU A;  1WYC A;  3ZNY A;  4XUZ A;  3QHY A;  4OVD A;  1NJ4 A;  2H28 A;  3QP2 A;  2W3F A;  1M40 A;  1W8Q A;  2GDN A;  4NET A;  4JGQ A;  1I2W A;  2ZQ7 A;  2Y2I A;  3DTI A;  3IH8 A;  1K57 A;  2EWV A;  3NY4 A;  3PAG A;  3GDI A;  2NUT C;  1A0K A;  4CQH A;  3VV4 A;  3B47 A;  1GCE A;  3O86 A;  1WE4 A;  1RP5 A;  3M2J A;  5L09 A;  1XGJ A;  2W27 A;  4XXR A;  2ZLY A;  2WZX A;  5TBM A;  3C8C A;  3FPW A;  2V9A A;  3PBR A;  3VMA A;  1H8Z A;  5I5L A;  5F5Y A;  1PRQ A;  4XT2 A;  4IBR A;  5E43 A;  2GJ3 A;  1ERQ A;  1YAX A;  2ZJ9 A;  4BD1 A;  1TDG A;  4R4R A;  5DTT A;  3LFV A;  4QWO A;  5TBM B;  1P0Z A;  2G2W A;  2QMI A;  2ZM2 A;  3UB6 A;  1T1A A;  3CZD A;  3CUE C;  1XA1 A;  4ZJ3 A;  3VOL A;  4DDY A;  3TE8 A;  2ZQ8 A;  3IQA A;  1S4R A;  1BLH A;  3LIC A;  5HL6 A;  3RJU A;  3RXX A;  5F1F A;  2QJ5 A;  4GS9 B;  4DJ2 A;  2XLN A;  4Y0U A;  5EVI C;  1PW8 A;  5FAP A;  4E3J A;  3LEQ A;  1JVJ A;  3VSK A;  3DTM A;  1FCM A;  3P98 A;  3LR3 A;  2O9A A;  3VE3 A;  3ZCZ A;  5HD5 A;  2Y2J A;  2ZMA A;  1CI8 A;  5HAP A;  2BG1 A;  1Y4O A;  4S2L A;  5HPF A;  4P0M A;  4Y3I A;  4KZB A;  2CC1 A;  3LEZ A;  1DP9 A;  2L1M A;  4HEF A;  4NXF A;  4OOL A;  5CHJ A;  3EQV A;  2C5W B;  3V5M A;  5EOE A;  1K56 D;  1PNE A;  1YLT A;  2W0N A;  3OPL A;  2O9C A;  4QU3 A;  4GZB A;  4PAU A;  4EET B;  1SHV A;  1BZA A;  1J3W A;  3NUL A;  3SW1 A;  1U60 A;  1SDN A;  4D60 A;  4OP8 A;  2XFT A;  4DE0 A;  4X1M A;  2JKR M;  5HWV A;  2ZM0 A;  3WS1 A;  4R3B A;  2BLS A;  2XRN A;  4Q0H A;  1YSP A;  3OBF A;  1BUE A;  1BUL A;  4X68 A;  3OZH A;  3QP4 A;  3IX4 A;  5GL9 A;  5IT5 A;  4I38 A;  1I2S A;  3HRE A;  1LL8 A;  2B02 A;  3IH9 A;  4C3Q A;  3C2W A;  1ES4 A;  3SS4 A;  5CTN A;  1D06 A;  3LI8 A;  2JKG A;  1NZU A;  3G4P A;  1TVF A;  3T1S A;  4S2I A;  4EBP A;  4ZJ1 A;  3O5Y A;  1ESU A;  1SKO B;  4K91 A;  2LB9 A;  3BFG A;  2H0Y A;  4MBK A;  4WUJ A;  4QB8 A;  1TF1 A;  2NUP C;  4F94 A;  1SDE A;  3BFC A;  4JF4 A;  1JWP A;  3S22 A;  4MN5 A;  4QY6 A;  1K6S A;  3HBR A;  2VK3 A;  1H8M A;  5FDH A;  3NOT C;  1XJ2 A;  5L2F A;  3QP6 A;  3UE3 A;  1E25 A;  5HL1 A;  1YQS A;  4WF0 A;  1OT9 A;  1PWC A;  1E3U D;  1GHM A;  1K25 A;  4CJN A;  2JKR I;  1K56 A;  1STZ A;  3GEC A;  2GNX A;  4I3J A;  1KE0 A;  1TS6 A;  1S4S A;  1GSV A;  2JKF A;  2EX8 A;  3ZVT A;  3C38 A;  2W3E A;  4HNB A;  2Q9M A;  4ZAM A;  4PM7 A;  2DNS A;  2P7J A;  5CED A;  5FQ9 A;  2OOL A;  1DJB A;  5LBR A;  3G30 A;  2LB5 A;  1Z6F A;  4U3T A;  4X6T A;  1FSW A;  4IVI A;  5CEB A;  1BTL A;  3LIE A;  4Y7P A;  2H0T A;  4ESP A;  2Z2L B;  3C7V A;  3AGD A;  2L4R A;  5EVL A;  5K5B A;  3T1X A;  1OME A;  3VOZ A;  1KVM A;  5KZH A;  2V8F A;  1YSQ A;  5TR7 A;  4RA7 A;  1RGZ A;  3CJM A;  4GD8 A;  2EX9 A;  3N8R A;  4BBT A;  5EV0 A;  4S2K A;  3HVF A;  1EW0 A;  2W1T A;  2ZMV A;  2ZM8 A;  3LR5 A;  5DJT A;  5CGW A;  4H8R A;  3QNC A;  1K55 C;  3UPP A;  3V3S A;  4Y17 A;  1H3Q A;  5E2E A;  1ZC2 A;  3RH8 B;  5L07 A;  4OLG A;  3AGF A;  5HDC A;  3T50 A;  1E3U A;  1FQG A;  5J8X A;  4MN7 A;  3EOI A;  5CXW A;  2W1T B;  4K08 A;  1K57 C;  2JHE A;  3Q7V B;  2FZ0 A;  1JNU A;  2IWD A;  4JF5 A;  1YM1 A;  1M6K A;  5GLD A;  3OPP A;  4HJ3 A;  4FOF A;  3D4F A;  4BL3 A;  4DN0 A;  3S7O A;  4QY5 A;  4LV2 A;  2JBF A;  3SH8 A;  1OJG A;  5F68 A;  4UHU A;  2QYB A;  2Y2M A;  1LI0 A;  1HZO A;  2VKS A;  1K4E A;  4UQI S;  4KQO A;  1W8Y A;  1YLP A;  3LI9 A;  1ZTU A;  5BOH A;  3TOI A;  1HLU P;  1LHY A;  3N8S A;  1EWZ A;  4S2P A;  1QMF A;  2HP9 A;  3C4P A;  3IXH A;  2V1B A;  3Q7Z A;  2YKF A;  2PR5 A;  4M4X A;  1LSW A;  3MQ0 A;  2IWB A;  4U0X A;  1Y28 A;  4KZ9 A;  1MC0 A;  5E2F A;  1JTG A;  4Q8I A;  1DP8 A;  4ZTK A;  4LPZ A;  2JKT M;  1G28 A;  4KG6 A;  4YWZ A;  1DRM A;  4ID4 A;  4S2N C;  1BLC A;  2XR0 A;  3FWL A;  3ITB A;  4LRX C;  5HDS A;  1ESI A;  4EQI A;  4YOF A;  3FYZ A;  3D3O A;  4RQ9 A;  4X55 A;  5AJG A;  3S4X A;  3PYP A;  2M7U A;  1W63 Q;  3KSG A;  3ISG A;  1PWG A;  1S66 L;  5DKL A;  4GOG A;  3WS2 A;  4OOM A;  2D01 A;  3PBN A;  1HTZ A;  1H0M A;  1PI4 A;  2FH5 A;  2R9W A;  3WS5 A;  3LR4 A;  4B93 A;  5KIZ A;  3KSI A;  4LRZ E;  3W2Z A;  3OLO A;  3ZNT A;  1KVL A;  2ZQ9 A;  5EM1 A;  3S7P A;  4IHQ A;  3CMZ A;  3UE1 A;  1ZG4 A;  2OAP 1;  2Z2M B;  4R3A A;  3MXS A;  1XFN A;  4CLC B;  3IX3 A;  3IHB A;  4X56 A;  2Y55 A;  3GV9 A;  4C75 A;  1TEM A;  4GW9 A;  4CPK A;  4O8G A;  1XJ6 A;  5TFQ A;  1K54 A;  4E04 A;  1H8Y A;  1UWP X;  4N92 A;  3F1N A;  3MS6 A;  4HQA A;  2XK1 A;  4DKI A;  2JKT I;  2QWS A;  3H9W A;  5FQJ A;  4OPY A;  2W3H A;  3E4O A;  3FKV A;  3MF0 A;  3NHQ A;  2P74 A;  1WYB A;  3T4S A;  3E98 A;  4WEK A;  3SS3 A;  2KX6 A;  3IF6 A;  1NLY A;  3HLD A;  2XH9 A;  3ZDJ A;  4MNR A;  5HW3 A;  3BQA A;  2EX6 A;  2J8Y A;  4Z9Q A;  3S7N A;  1N4O A;  3F1N B;  3NDG A;  2EA9 A;  2XD1 A;  3JVU A;  4ARZ B;  5HD3 A;  4CLC E;  1MY8 A;  3QP1 A;  4JXV A;  5CHU A;  2GX5 A;  1PZO A;  5KMW A;  3IF6 B;  1S67 L;  2KOI A;  1VQQ A;  1BLP A;  4E6W A;  5GHZ A;  2HP5 A;  2H10 A;  4GDN A;  4P6B A;  3KYQ A;  2V0W A;  3NDE A;  3L7H A;  4R70 A;  3IXD A;  2E8J A;  3B33 A;  4KZ4 A;  1BSG A;  3U2A A;  3A3D A;  5J3W A;  3AGE A;  2HV1 A;  1MPL A;  4HP4 A;  3GMW A;  1Q2P A;  4JGP A;  1LSV A;  2O0Y A;  1VM1 A;  4PM6 A;  3TSG A;  1SCW A;  5IU1 A;  5J7E A;  1JWV A;  3NC8 A;  3BJN A;  4IBX A;  3MFX A;  2ZQD A;  1T1B A;  1N9O A;  4KZ6 A;  1KOU A;  1G68 A;  3CPT A;  4L9E A;  1G5U A;  3FKW A;  3M6B A;  5L8M A;  1RGY A;  3K3C A;  3VOY A;  2HDR A;  3BQ8 A;  2OWJ A;  5DF9 A;  5DTS A;  5F82 A;  3CLO A;  4E3I A;  1OJ5 A;  1CEF A;  2VZW A;  3D9Y A;  2VA0 A;  4GS9 A;  3TRC A;  3CPT B;  5FAS A;  4KZ3 A;  4DRT A;  4B88 A;  1GSW A;  3LIA A;  4OON A;  4LFU A;  2YKH A;  4DE1 A;  4NK3 A;  4JBF A;  4JGR A;  2XA7 M;  3QP8 A;  4ZBE A;  3MR0 A;  5HAR A;  4E3M A;  3ZG0 A;  1MZU A;  1K38 A;  4YFM A;  4B9O A;  3MSH A;  3CI6 A;  3GSG A;  4GN2 A;  4WEJ A;  5DFX A;  1IYO A;  1NY0 A;  3NBL A;  4N1X A;  4HY8 A;  5HWW A;  2V8C A;  3NOP C;  4EBL A;  2HJ9 C;  4O7D A;  2VGJ A;  3CWF A;  5GLC A;  4O01 A;  3CHW P;  2HGV A;  2BTF P;  4GKU A;  3LR0 A;  4KQR A;  3F1O A;  5M1A A;  1F2K A;  1VET A;  2PR6 A;  4HH2 A;  3C5A A;  3A3E A;  2QPN A;  1G6O A;  5I94 A;  4UA7 A;  4II7 A;  3FG8 A;  1PWD A;  5D3O A;  4MCW A;  5CHM A;  4HBU A;  3UB9 A;  4NXE A;  1IKI A;  4PKY A;  3VFF A;  4GHI A;  5EEC A;  5FI7 A;  4U0T A;  3F1O B;  4KUK A;  1VET B;  1MKM A;  3G34 A;  1FIK A;  2WAE A;  2EFU A;  3R4K A;  4MDZ A;  5G18 A;  2WAD A;  4YIN A;  4GLQ A;  2K31 A;  3IHA A;  5A92 A;  3CAX A;  1SKO A;  1YLJ A;  1J9M A;  3MQO A;  4HOI A;  5AQ9 A;  2FFY A;  3BM6 A;  3A0R A;  4FSF A;  4GHI B;  4DJ3 A;  4EV4 A;  4DXB A;  4BWI A;  2W3G A;  2Y2L A;  4NKP A;  4R1G A;  1MWU A;  2Y2Q A;  4XUX A;  3PBO A;  1LL5 A;  1MWT A;  4R6L A;  3P01 A;  1BT5 A;  4OH0 A;  1N9L A;  1T1C A;  5HPI A;  4FH4 A;  3BLM A;  4X1L A;  4Y0T A;  1AWI A;  4BLM A;  3LY3 A;  4BMW A;  4E6X A;  1H5X A;  3LO7 A;  4KZA A;  4R23 A;  2P04 A;  2PBY A;  1S1Z A;  4R38 A;  3WS0 A;  4BL2 A;  3LUQ A;  3C4O A;  4ME4 A;  1VB6 A;  3MZD A;  1ZKJ A;  4EEU A;  5JYP A;  5FEF A;  2JN7 A;  3OCN A;  4WMC D;  2XQZ A;  5AVE A;  1P97 A;  2XFS A;  3KSH A;  4WZ5 C;  3K2N A;  3P09 A;  1IKG A;  1OT6 A;  2O9B A;  3NCK A;  4OPR A;  2EWW A;  4Q0I A;  3N6I A;  1KE4 A;  3BW6 A;  2ZOH A;  3HLE A;  4KG5 A;  4HES A;  2O99 A;  4KZ7 A;  1K4F A;  4HH3 A;  4LCM A;  3FZC A;  2DMW A;  5FI6 A;  1ODV A;  2HDQ A;  2X01 A;  4P87 A;  3G2Z A;  1Z09 A;  4X69 A;  4PPR A;  1NYM A;  3PR6 A;  2J80 A;  2QKP A;  4M3K A;  3R7W A;  4R0Q A;  2Y59 A;  3S1Y A;  3L9K A;  2A24 B;  3WRT A;  4WL9 A;  3E4P A;  3M2K A;  5DJU A;  3BWL A;  5FQM A;  3W4P A;  1K54 C;  2PAV P;  3NIA A;  2K2N A;  4BBU A;  4Y2F A;  4I3A A;  1QME A;  1ONH A;  4JKT A;  3LGO A;  3R7W B;  1F98 A;  2A49 A;  1L0F A;  2OLU A;  4G3K A;  1FCN A;  3EWK A;  5CGX A;  1V9Y A;  3ZG9 B;  1XPB A;  2ZC6 B;  3EGX C;  2J3T D;  1FSY A;  1D7E A;  4LLO B;  4PM9 A;  1K6R A;  2Z6C A;  1YT4 A;  1XX2 A;  3BRM A;  3DTK A;  3MZE A;  3N7W A;  4WMC A;  3Q7V A;  5A93 A;  5EVI A;  1CK3 A;  2Y2O A;  2VGL M;  3BY9 A;  3WRZ A;  2Q9N A;  2VLG A;  4HJ6 A;  2L0W A;  4R3J A;  1F9I A;  4LV3 A;  4PMA A;  2UV0 E;  3WS4 A;  5EVI B;  3QP5 A;  3G32 A;  4CLC D;  3N8L A;  2D02 A;  5CRF A;  2VX8 A;  4QPR A;  3T1Q B;  1W63 M;  4BQM A;  4DE2 A;  3MFD A;  4DDS A;  1NWZ A;  4ZJ2 A;  3W4Q A;  1P9R A;  3T4L A;  4OPZ A;  3G31 A;  3NI9 A;  2OAQ 1;  1YMX A;  3UY6 A;  2XRO A;  3PBS A;  5F83 A;  2VV8 A;  4FUW A;  2P08 A;  1G6A A;  2G2U A;  3NEC A;  1L0E A;  3F1P B;  3UPN A;  2J9P A;  4OLD A;  2HP6 A;  2XEP A;  3TG9 A;  3HUN A;  4KQQ A;  1Y54 A;  3ZHH A;  4MBF A;  5M19 A;  4K0W A;  2ACG A;  4PM5 A;  4F3L A;  4JF6 A;  5DVA A;  5FAT A;  2WGI A;  1ONG A;  4KEN B;  2XSS A;  4GDB A;  2UWX A;  1PIO A;  4EXO A;  3RTY A;  5FEG A;  4P85 A;  5C5K A;  2Y2H A;  1YLW A;  3T4J A;  3OOV A;  4IED A;  5HDD A;  3Q07 A;  2Y8H A;  3LIB A;  4F3L B;  3GQZ A;  2GZA A;  3IF5 A;  3U4L P;  4EER A;  3SH9 A;  3MXR A;  1OTB A;  5CEC A;  5TJJ A;  5E2H A;  5J4E A;  2XGN A;  4ETZ A;  1UGU A;  4BD0 A;  5F69 A;  1ES5 A;  1KDS A;  3BYD A;  3W4O A;  5HWT A;  1I5Q A;  1UWN X;  4KZ5 A;  4CLC A;  1VEU B;  5FSR A;  3KYZ A;  3ULF A;  4EES A;  3A0V A;  4DXC A;  1FR6 A;  3GVB A;  4N9K A;  2X71 A;  1OPX A;  1X0O A;  4EUV A;  1T18 A;  4JLF A;  4E3N A;  2WKQ A;  3FC7 A;  2ZC4 B;  3LYX A;  4MMN A;  3V50 A;  3SZT A;  3H82 A;  1DJA A;  4RYE A;  3BEB A;  5FDS A;  3T12 B;  2JE5 A;  1DP6 A;  2PU2 A;  3RXW A;  1JWZ A;  5GHX A;  2PBD P;  5EE8 A;  5DKK A;  3E0Y A;  2ZC7 A;  1AXB A;  4WYY A;  1MWR A;  2M1C A;  4OQH A;  2Z6D A; 
#chains in the Genus database with same CATH homology
 5DTK A;  3ZG0 A;  5FDH A;  1K38 A;  4YFM A;  1KGF A;  5L2F A;  1Q2Q A;  4UAA A;  2QZ6 A;  3HLW A;  3DWK A;  3UE3 A;  3ZVW A;  1DJC A;  1E25 A;  4EWF A;  3GSG A;  1PI5 A;  1YQS A;  3B3X A;  4N9L A;  5HL1 A;  1PWC A;  4GN2 A;  1E3U D;  4WEJ A;  4QJG A;  1GHM A;  1K25 A;  1IYO A;  3VP2 A;  4CJN A;  1NY0 A;  3MKE A;  1K56 A;  1YMS A;  5FQK A;  2I72 A;  3GRJ A;  3E2L A;  3NBL A;  2WZZ A;  4E3L A;  4MLL A;  4RX3 A;  4N1X A;  4N1H A;  1ZG6 A;  1KE0 A;  2WGV A;  1E4D A;  5DF7 A;  1PZP A;  3ZFZ A;  1IEM A;  2H5S A;  3IWQ A;  2EX8 A;  1ERO A;  3A3I A;  4EBL A;  3O88 A;  3ZVT A;  4O7D A;  4QHC A;  2VGJ A;  5GLC A;  1NYY A;  1KGG A;  1N9B A;  2OLV A;  3IXG A;  2HDU A;  5EUA A;  3IWI A;  2Q9M A;  4ZAM A;  1MXO A;  4GKU A;  4WEL A;  3HLB A;  4E3O A;  1LL9 A;  4PM7 A;  2DNS A;  4JXS A;  1XKZ A;  4KQR A;  5M1A A;  5GLB A;  3OCL A;  5CED A;  3Q81 A;  5FQ9 A;  3C5A A;  1IYQ A;  5CTM A;  1DJB A;  3A3E A;  3SH7 A;  2QPN A;  2V2F F;  2WK0 A;  4LV0 A;  5I94 A;  4UA7 A;  3G30 A;  1Z6F A;  4U3T A;  4X6T A;  1FSW A;  4IVI A;  1PWD A;  5CEB A;  5D3O A;  5CHM A;  3PBQ A;  1BTL A;  2ZD8 A;  4HBU A;  3HLG A;  4Y7P A;  5EOO A;  5M18 A;  3SS5 A;  3PAE A;  2H0T A;  3Q1F A;  2WKH A;  2Z2L B;  2V20 A;  1FCO A;  3C7V A;  2B5R A;  2VGK A;  1IKI A;  5F1G A;  1JTD A;  3PTE A;  3AGD A;  4MBH A;  5EEC A;  1XXM A;  5FI7 A;  4U0T A;  3VFF A;  4WM9 A;  3G34 A;  4GB7 A;  3OC2 A;  5EVL A;  2OV5 A;  2WAE A;  2P9V A;  4GD6 A;  5AQ7 A;  2EFU A;  4KG2 A;  4S2J A;  5G18 A;  4RX2 A;  4OQ0 A;  1EI5 A;  2WAD A;  1OME A;  4LCL A;  3Q82 A;  4YIN A;  3VOZ A;  5A91 A;  1KVM A;  5KZH A;  1IEL A;  2HDS A;  4BJP A;  3IHA A;  3HL9 A;  5TR7 A;  5A92 A;  5AQA A;  5FAO A;  4RA7 A;  3VSL A;  1RGZ A;  1NXY A;  3CJM A;  1YLJ A;  1O07 A;  1J9M A;  5FQI A;  3V3R A;  3ZG5 A;  2WGW A;  5AQ9 A;  4GD8 A;  4WZ5 A;  3HUO A;  2EX9 A;  2FFY A;  3BM6 A;  4FSF A;  3G35 A;  4EV4 A;  1HVB A;  3N8R A;  2ZQA A;  4OQG A;  4DXB A;  1HD8 A;  4EUZ A;  2WUQ A;  4S2K A;  3UNW A;  3HVF A;  2J9O A;  2Y91 A;  2Y2L A;  2P9V B;  3BFE A;  4UA9 A;  2ZM8 A;  4R1G A;  1MWU A;  2Y2Q A;  4XUX A;  5KSC A;  5CGW A;  4H8R A;  3PBO A;  3IT9 A;  3QNC A;  1K55 C;  1GHP A;  3UPP A;  1LL5 A;  1MWT A;  3BEC A;  3V3S A;  1BT5 A;  4OH0 A;  2Y4A A;  1CI9 A;  1ZC2 A;  5E2E A;  2IWC A;  4GNU A;  4FH4 A;  1W5D A;  3BLM A;  4HBT A;  4OLG A;  5GLA A;  5HFO A;  2E8I A;  4Y0T A;  5JYO A;  1IYS A;  4FCF A;  4BLM A;  2WGW B;  1LI9 A;  3AGF A;  3LY3 A;  2V1Z A;  4DF6 A;  3A3F A;  4E6X A;  1H5X A;  4OOY A;  1E3U A;  1FQG A;  3LO7 A;  1MWS A;  4KZA A;  4R23 A;  5J8X A;  2PBY A;  3IWO A;  2Y2P A;  2Y2N A;  1KE3 A;  4S2M A;  3WS0 A;  4BL2 A;  5CXW A;  1SKF A;  3C4O A;  3DW0 A;  4LEN A;  3MZD A;  4K0X A;  1K57 C;  1ZKJ A;  3UN7 A;  5JYP A;  1DY6 A;  1O7E A;  2EFX A;  1TDL A;  3OCN A;  3Q7V B;  2IWD A;  4JF5 A;  1YM1 A;  1M6K A;  4WMC D;  2XQZ A;  2ZQC A;  4PM8 A;  1CEG A;  5GLD A;  3OPP A;  3I7J A;  4BEN A;  3PBT A;  2XFS A;  4RVA A;  3D4F A;  5HAI A;  4BL3 A;  4WZ5 C;  3P09 A;  3BFD A;  4UA6 A;  1IKG A;  1ALQ A;  4QY5 A;  3NCK A;  4LV2 A;  2JBF A;  3SH8 A;  4OPR A;  5IHV A;  2A3U A;  4B4Z A;  2Y2K A;  3VFH A;  3N6I A;  4OQI A;  1KE4 A;  4UHU A;  1ES2 A;  2J7V A;  4KZ8 A;  3HLE A;  5E2G A;  1GHI A;  1XP4 A;  2XDM A;  4HES A;  4KG5 A;  2Y2M A;  3UE0 A;  1LI0 A;  5HX9 A;  4KZ7 A;  5FI2 A;  1HZO A;  1K4E A;  4A5R A;  1K4F A;  3QNB A;  4KQO A;  3UPO A;  4S2N A;  4LCM A;  5GHY A;  2PU4 A;  3HLF A;  3A3J A;  2C6W B;  3FZC A;  5FI6 A;  1W8Y A;  1YLP A;  3V39 A;  2R9X A;  1S0W A;  1YLZ A;  5U47 A;  5BOH A;  3TOI A;  3E2K A;  2HDQ A;  3DWZ A;  2WYX A;  1LHY A;  4JXW A;  3N8S A;  2X01 A;  2OSU A;  1EWZ A;  4ZDX A;  2DCF A;  4P87 A;  3G2Z A;  3FV7 A;  5AQB A;  5FQQ A;  4S2P A;  1QMF A;  3JYI A;  4X69 A;  1FOF A;  1NYM A;  4PPR A;  4OKP A;  2HP9 A;  4E3K A;  4M3K A;  1K55 A;  3EQU A;  4R0Q A;  1PYY A;  2Y59 A;  3S1Y A;  1WYC A;  3C4P A;  3MBZ A;  3ZNY A;  4XUZ A;  3IXH A;  3QHY A;  4OVD A;  3WRT A;  3Q7Z A;  1NJ4 A;  2XD5 A;  3MZF A;  3M2K A;  1NZO A;  1M40 A;  1W8Q A;  2GDN A;  2IWB A;  2ZC5 B;  5KSH A;  4U0X A;  5FQM A;  4KZ9 A;  3W4P A;  4NET A;  3O3V A;  3ITA A;  1I2W A;  1JTG A;  3BFF A;  2ZQ7 A;  2Y2I A;  5E2F A;  1K54 C;  3IH8 A;  4ZTK A;  4Q8I A;  3NIA A;  1K57 A;  3NY4 A;  3PAG A;  1QME A;  1NRF A;  1ONH A;  4JKT A;  4KG6 A;  3OPR A;  2A49 A;  1L0F A;  1MKI A;  2OLU A;  4ID4 A;  1FCN A;  1BLC A;  2XR0 A;  3FWL A;  4S2N C;  3ITB A;  4WZ4 A;  1ESI A;  5CGX A;  4EQI A;  1FR1 A;  3ZG9 B;  1GCE A;  3O86 A;  1WE4 A;  1XPB A;  3FYZ A;  1RP5 A;  2ZC6 B;  3M2J A;  4X55 A;  1W79 A;  1XGJ A;  4OP5 A;  2Y2G A;  1FSY A;  4XXR A;  1XGI A;  2ZLY A;  5FAQ A;  3S4X A;  2WZX A;  4PM9 A;  1K6R A;  3W8K A;  1YT4 A;  3ISG A;  1XX2 A;  1PWG A;  3BRM A;  3UO9 A;  3MZE A;  3N7W A;  4GOG A;  4OOM A;  3WS2 A;  4WMC A;  3Q7V A;  3PBN A;  3C7U A;  1HTZ A;  2X02 A;  1H8Z A;  3PBR A;  3VMA A;  1PI4 A;  2XF3 A;  5A93 A;  2R9W A;  3BLS A;  5EVI A;  1CK3 A;  2Y2O A;  3WS5 A;  4IBR A;  5E43 A;  2RL3 A;  2RCX A;  1ERQ A;  3WRZ A;  3ZNT A;  2Q9N A;  4L0L A;  4EBN A;  1KVL A;  2ZJ9 A;  4BD1 A;  1TDG A;  4R4R A;  5DTT A;  3HLC A;  1S6R A;  4R3J A;  4C6Y A;  2ZQ9 A;  2JCH A;  4LV3 A;  3UDX A;  3CMZ A;  4PMA A;  3UE1 A;  1L0G A;  2G2W A;  1ZG4 A;  2QMI A;  3O87 A;  2ZM2 A;  2Z2M B;  3WS4 A;  3G2Y A;  3MXS A;  5EVI B;  3CZD A;  4X53 A;  3G32 A;  5EPH A;  5EVI D;  3N8L A;  3CG5 A;  1XA1 A;  5CRF A;  3ZG7 B;  1GA0 A;  3IHB A;  4ZJ3 A;  4DDY A;  1ES3 A;  2WAF A;  4X56 A;  2Y55 A;  2ZQ8 A;  3GV9 A;  4BQM A;  4C75 A;  3MFD A;  1TEM A;  4DDS A;  4DE2 A;  4CPK A;  3IQA A;  4FD8 A;  5TFQ A;  1K54 A;  1XA7 A;  3IXB A;  1BLH A;  4ZJ2 A;  3W4Q A;  1H8Y A;  4N92 A;  3RJU A;  3RXX A;  5F1F A;  2XK1 A;  4OPZ A;  4DKI A;  1MBL A;  3G31 A;  4WBG A;  3NI9 A;  5FQJ A;  1YMX A;  2XLN A;  4OPY A;  5CER A;  4Y0U A;  5EVI C;  3UY6 A;  3FKV A;  3PBS A;  5F83 A;  1PW8 A;  2P74 A;  5FAP A;  1WYB A;  3UDI A;  3VP1 A;  4E3J A;  4WEK A;  1JVJ A;  3SS3 A;  3VSK A;  3DTM A;  1FCM A;  3P98 A;  3UDF A;  3IF6 A;  3ZDJ A;  1G6A A;  2XH9 A;  3HLD A;  3ZGA B;  2HPB A;  4MNR A;  1YLY A;  5HW3 A;  2G2U A;  3ZCZ A;  2Y2J A;  1L0E A;  2ZMA A;  1CI8 A;  3UPN A;  5HAP A;  2J9P A;  4OLD A;  2BG1 A;  2EX6 A;  2HP6 A;  2J8Y A;  2XEP A;  3TG9 A;  3HUN A;  4KQQ A;  1Y54 A;  4S2L A;  4Z9Q A;  3ZHH A;  4P0M A;  4MBF A;  1N4O A;  4FH2 A;  3NDG A;  5M19 A;  2XD1 A;  4K0W A;  4PM5 A;  4R4S A;  2EXB A;  1MY8 A;  4KZB A;  2CC1 A;  4JXV A;  3LEZ A;  1IYP A;  3M6H A;  5CHU A;  3GTC A;  4JF6 A;  4OPQ A;  4HEF A;  1L2S A;  2WKE A;  4OOL A;  5CHJ A;  5DVA A;  3EQV A;  1PZO A;  5FAT A;  2C5W B;  5KMW A;  3IF6 B;  2WGI A;  1ONG A;  4DE3 A;  4KEN B;  3V5M A;  4GDB A;  5EOE A;  2UWX A;  4S2O A;  5DF8 A;  1PIO A;  1VQQ A;  1BLP A;  1K56 D;  4E6W A;  2ZC3 B;  5GHZ A;  2HP5 A;  1YLT A;  4LV1 A;  3OPL A;  2H10 A;  4QU3 A;  4GDN A;  4P85 A;  4GZB A;  2EXA A;  4P6B A;  5A90 A;  1SHV A;  2Y2H A;  1BZA A;  5TGF A;  1YLW A;  1BLS A;  1U60 A;  2EX2 A;  1SDN A;  3NDE A;  4QD4 A;  4JPM A;  4IED A;  4OP8 A;  3IXD A;  3Q07 A;  4KZ4 A;  1BSG A;  3GQZ A;  2XFT A;  3A3D A;  3IF5 A;  4DE0 A;  3AGE A;  4D2O A;  2ZM0 A;  1C3B A;  1MPL A;  2WKI A;  3WS1 A;  3IF6 C;  3ZG8 B;  4B4X A;  3GMW A;  4R3B A;  1Q2P A;  2BLS A;  3SH9 A;  1W7F A;  3MXR A;  1VM1 A;  5FA7 A;  4PM6 A;  3TSG A;  1SCW A;  5CEC A;  1RCJ A;  1JWV A;  3NC8 A;  1BUE A;  3N4I A;  1BUL A;  4X68 A;  1KGE A;  3OZH A;  4IBX A;  5HAQ A;  2ZQD A;  5E2H A;  5CGS A;  2XGN A;  4BD0 A;  3GR2 A;  4KZ6 A;  1G68 A;  1ES5 A;  5GL9 A;  1KDS A;  3BYD A;  3W4O A;  1LLB A;  1I5Q A;  4KZ5 A;  1ERM A;  1I2S A;  1L0D A;  3HRE A;  3FKW A;  1PW1 A;  3M6B A;  3IH9 A;  5FSR A;  3VP3 A;  4C3Q A;  3SS4 A;  1ES4 A;  1RGY A;  3VP4 A;  3LY4 A;  5CTN A;  3VOY A;  4MEZ A;  2HDR A;  4DXC A;  1FR6 A;  2FFF B;  5DF9 A;  5DTS A;  5F82 A;  1NZU A;  3GVB A;  3G4P A;  4N9K A;  1TVF A;  2JC7 A;  4E3I A;  4S2I A;  4EBP A;  2X71 A;  4ZJ1 A;  1CEF A;  1ESU A;  3MKF A;  3LCE A;  4JLF A;  4JXG A;  4E3N A;  2ZC4 B;  5FAS A;  4K91 A;  3VP0 A;  4KZ3 A;  4DRT A;  4B88 A;  3BFG A;  3SOI A;  2H0Y A;  3HUM A;  4MBK A;  3V50 A;  4OON A;  4QB8 A;  1DJA A;  4RYE A;  3BEB A;  2DRW A;  2JE5 A;  4F94 A;  1SDE A;  1GA9 A;  2PU2 A;  3RXW A;  1JWZ A;  5GHX A;  4DE1 A;  5EE8 A;  4NK3 A;  3WWX A;  4IVK A;  3BFC A;  4JF4 A;  2ZC7 A;  4JBF A;  1AXB A;  1JWP A;  4WYY A;  3S22 A;  4Y0O A;  3OPH A;  4QY6 A;  4ZBE A;  1MWR A;  1K6S A;  3HBR A;  1KDW A;  4OQH A;  5HAR A;  4E3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...