1NXYA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (sm2)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Recognition and Resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 100
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nxyA00
1W7FA 4C75A 3ISGA 2Y2OA 4E3NA 5E2EA 1AXBA 1Q2QA 4R23A 3QNCA 1PW1A 2FFFB 1LL5A 3HBRA 2H0YA 2IWBA 4EQIA 1JWZA 2JBFA 5HAIA 1FCMA 3UE1A 5DF7A 5FASA 4OOYA 4U3TA 3ZVTA 3ITAA 2XH9A 4N9KA 4NK3A 4DF6A 3PBQA 4WBGA 3OPRA 3P09A 2H10A 2G2UA 2DNSA 3IHAA 1K6SA 3ZDJA 5F1FA 1JTDA 3VP1A 3GSGA 4IBRA 2GDNA 1K54A 2CC1A 3ZNTA 3V5MA 5DF8A 5A90A 1XKZA 5CRFA 2Y2QA 3ZFZA 4HESA 1K4FA 4GD8A 3HLEA 4KQRA 3G2YA 4GD6A 3G34A 4GDBA 2H5SA 2PU4A 3WS0A 1GCEA 1W8YA 1YQSA 4S2PA 1XGJA 4WZ4A 1BT5A 4XUXA 1YLPA 1MXOA 4KG2A 4JKTA 1XP4A 4LV1A 4YINA 1YT4A 2H0TA 1PZOA 1RP5A 4BENA 1FSWA 1GHMA 3B3XA 4QHCA 5HL1A 3AGEA 2XFTA 2XLNA 1MY8A 3EQUA 2V2FF 4EBNA 2FFYA 1ZKJA 5E2HA 2ZQ9A 3WS1A 5CXWA 5A93A 4Y7PA 2PU2A 5A91A 3IH9A 4DKIA 1MWSA 4RYEA 5GLCA 3SH8A 3LY3A 4B4XA 2Y2JA 3A3FA 3HLWA 3IXDA 4DRTA 4LCMA 1BLHA 1MWRA 4QB8A 3CZDA 5GHZA 1GA9A 3VP2A 4BL2A 4DDSA 4X6TA 2I72A 5FQ9A 2R9WA 1E3UA 4OKPA 1H8YA 5HAQA 1M40A 3GTCA 3E2KA 3P98A 4KZ5A 5FA7A 1K57C 1XPBA 3O87A 2HDUA 3BEBA 2ZQAA 1VQQA 1ES3A 1K4EA 2VGKA 1PWGA 3HLBA 1CEFA 2C5WB 4N1HA 3V50A 1G68A 2RL3A 3G31A 5FAQA 5EPHA 3UPNA 3C4PA 3A3JA 1SDEA 2RCXA 4KZ4A 3UDFA 4O7DA 1HTZA 1BZAA 4KZ9A 2V1ZA 4XUZA 1XGIA 1L2SA 2ZLYA 3O86A 1PIOA 4OQ0A 4WM9A 1IYQA 1YLYA 2ZC6B 1BLCA 4OOLA 4KZBA 5AQ9A 1KVMA 2ZC7A 4BD1A 1ZG6A 2HP5A 5DVAA 2ZQDA 4E6XA 2VGJA 3V39A 5FDHA 1KDSA 4GKUA 1SDNA 1KGFA 4WZ5C 2XF3A 1CEGA 4GN2A 4JXSA 5E2FA 1RCJA 5E2GA 3NC8A 1JWVA 2WAEA 5FQMA 2QMIA 4D2OA 3VOYA 4BD0A 4MBHA 3LEZA 1NZOA 4OP5A 3HLCA 4MNRA 4DE0A 2HP6A 4X68A 1XX2A 3HL9A 3Q7ZA 2ZC3B 5D3OA 4E3OA 3NCKA 1YLWA 1LL9A 5M19A 3Q7VA 1KE0A 4MBKA 3WS4A 4ZJ2A 5JYOA 2J9PA 4ZAMA 3VFHA 1XA7A 3EQVA 3N8RA 5FQKA 5KSHA 3MZEA 2ZD8A 1S0WA 2Y2GA 4IBXA 2J7VA 1K38A 1WE4A 3CMZA 4JPMA 1C3BA 1EI5A 3BLMA 4KZAA 4C3QA 1XXMA 4KG6A 3NI9A 1IEMA 4N9LA 1PYYA 3ZGAB 1IYOA 4WYYA 3IWQA 3VOZA 3BRMA 1YLJA 1K25A 1K57A 1E25A 3FZCA 4OLDA 5CGWA 3RJUA 1DJAA 4P85A 4OONA 3ZG7B 4Y0TA 1E3UD 2EFXA 2EX6A 2WZXA 5IHVA 1KVLA 1ZG4A 4IVIA 1JTGA 1W5DA 2QZ6A 4JXVA 3UE3A 3IH8A 4OH0A 3HUMA 2E8IA 4M3KA 4BQMA 1YLTA 2Y2NA 2WK0A 2ZQCA 4QY6A 4YFMA 4R4SA 3C7VA 4RX2A 2HP9A 1CK3A 5KMWA 4FCFA 5TR7A 3MFDA 4IEDA 2JC7A 1MPLA 3AGDA 3E2LA 2XGNA 1GA0A 4OQIA 1ESIA 3LCEA 3Q1FA 3DTMA 1L0EA 2OLUA 3IXHA 4LCLA 3O3VA 4WZ5A 5AQBA 2EFUA 1U60A 4OQHA 3UY6A 2Y2PA 1PW8A 1ONHA 2ZQ8A 1KDWA 1DJCA 3MKFA 3C4OA 1PWCA 5CECA 5HAPA 5HW3A 4N1XA 3M6HA 1NZUA 4KENB 4KZ8A 5GLDA 2EX2A 2WAFA 1JVJA 5CEBA 2ZM0A 3DW0A 2XEPA 1Z6FA 1FOFA 4QD4A 1Y54A 3IWOA 4HBTA 1E4DA 4Y0OA 4FD8A 4X69A 2DRWA 4S2NC 3ZG8B 1HZOA 4N92A 1BLSA 5FQQA 2JCHA 3N7WA 4OPQA 3MXRA 5EVID 3Q81A 3G32A 3PBSA 1DJBA 4OQGA 5F82A 5GLAA 1N4OA 4CJNA 1QMEA 3IHBA 3BYDA 5HX9A 1ES2A 4RA7A 5FQJA 4PPRA 4UAAA 3G2ZA 1KGGA 1NYYA 3OZHA 4JLFA 4WMCA 5BOHA 2WKIA 4GNUA 4ZJ1A 4R3BA 2WKEA 3BLSA 3GV9A 4PM6A 1KGEA 1OMEA 4PM7A 4X53A 3VMAA 4BL3A 3UPOA 3HREA 3TOIA 4PMAA 1PI4A 3IF6B 2XK1A 2HPBA 3PBNA 4OPRA 3IXBA 2DCFA 4KZ6A 3CG5A 4R3JA 5CERA 3ZG0A 3OPLA 3OPPA 1J9MA 3HVFA 1FQGA 4GDNA 3HUNA 3PAEA 4MLLA 2Y91A 3PBOA 2WGWB 4S2JA 5DTKA 2Y2IA 4E3JA 3ZCZA 1L0FA 1K55C 2Y59A 2ZQ7A 3UNWA 4QJGA 2P9VB 2WUQA 2Y2KA 1PZPA 3HLDA 2WKHA 2C6WB 4X55A 4BLMA 3OPHA 1BTLA 5JYPA 2XQZA 3MZDA 4K0WA 2Q9MA 4JBFA 3GQZA 5F1GA 1BULA 4PM9A 5CGSA 3UO9A 2QPNA 1K56A 4ZTKA 2XD1A 1HVBA 5GHYA 1LI9A 1IKIA 1K6RA 1ES5A 3N6IA 2XR0A 3I7JA 4A5RA 3GRJA 4KQOA 3MXSA 2A3UA 3IXGA 3O88A 1YM1A 2WGWA 3HLGA 4Z9QA 1LLBA 5KSCA 1YLZA 2BLSA 4X56A 3C7UA 1I2SA 3V3RA 3NBLA 1MWUA 2J9OA 3W4QA 1GHIA 3BECA 3W4OA 2WGIA 1I5QA 5EECA 5TGFA 2PBYA 3BFEA 4MEZA 3D4FA 4S2NA 1IYPA 4PM5A 1YMSA 4P87A 1CI9A 4JF5A 1HD8A 3UDIA 4EBPA 4EWFA 2HDRA 3BFDA 1I2WA 3V3SA 3OC2A 5M18A 2HDSA 5DF9A 4E6WA 1TDGA 3QHYA 2ZJ9A 4KG5A 2IWDA 1IKGA 4LV2A 1ES4A 5CHJA 1TEMA 4R0QA 4RVAA 4UA9A 4ID4A 2EX8A 1SHVA 5FQIA 4EUZA 3ZG9B 1DY6A 1YMXA 3SS4A 1M6KA 4KQQA 3SS5A 1H5XA 3UN7A 4CPKA 4DXCA 5TFQA 3ZHHA 1EROA 2IWCA 4K91A 4U0TA 3AGFA 1BUEA 1IELA 5AQAA 3SOIA 1WYCA 3VP4A 4WMCD 5EOEA 5FSRA 5CGXA 3RXXA 3WS2A 3A3EA 5I94A 1JWPA 3A3DA 1TVFA 1ONGA 5GHXA 3HUOA 4LV0A 3QNBA 4QU3A 4FH4A 5M1AA 4BJPA 2A49A 3G35A 4OPZA 4UA7A 5HARA 1K55A 2X02A 2P74A 2Y55A 4OP8A 4S2MA 3ZVWA 3NY4A 3IF6C 4L0LA 2OV5A 2Q9NA 1MBLA 2V20A 5CEDA 1MKIA 1ESUA 1EWZA 5L2FA 3N8SA 2Z2LB 5DTSA 4S2IA 3ZNYA 3PBRA 2ZMAA 3UDXA 2HDQA 3G30A 2XFSA 4QY5A 3M2JA 4EBLA 1NRFA 1O7EA 5G18A 2UWXA 4FH2A 2BG1A 2XD5A 4Q8IA 3WRZA 2JE5A 1K56D 4GOGA 3DWKA 5GL9A 3DWZA 1RGYA 4FSFA 5J8XA 4OOMA 3W4PA 4KZ3A 1IYSA 3MZFA 4KZ7A 4UHUA 4H8RA 4OVDA 3FV7A 2Y2MA 3OCLA 2J8YA 1PWDA 3PAGA 3S4XA 3GMWA 4HBUA 5FI6A 3WS5A 4GB7A 3PTEA 3A3IA 3VSKA 1BLPA 3NDEA 4JF6A 1NJ4A 1SKFA 5CHUA 5EVIC 1GHPA 4S2OA 3G4PA 4IVKA 3PBTA 1VM1A 5CHMA 2EX9A 1ALQA 4DE2A 4P0MA 3ITBA 2X01A 3FKVA 3BM6A 2Y2HA 1FCNA 1ERQA 1N9BA 4E3LA 5EVLA 5HFOA 5GLBA 1FR1A 3UE0A 4WELA 4DE3A 4F94A 1H8ZA 4NETA 1BSGA 1Q2PA 4U0XA 3IQAA 1QMFA 3JYIA 2G2WA 4ZJ3A 1LI0A 3S22A 3C5AA 5U47A 3VFFA 2ZC4B 1WYBA 4B88A 5FI2A 4E3IA 3FKWA 2ZC5B 5FAPA 3RXWA 5EOOA 4GZBA 4JXGA 1MWTA 4PM8A 4S2LA 5DTTA 2Y2LA 4LENA 3FYZA 1ERMA 4LV3A 5E43A 4WEKA 5AQ7A 5FAOA 2WZZA 1FR6A 4DXBA 3MKEA 2OLVA 4Y0UA 3WWXA 3UPPA 1XA1A 3M2KA 4JXWA 4UA6A 3IF6A 3MBZA 3N8LA 3S1YA 5FATA 1TDLA 3IWIA 4HEFA 5F83A 5A92A 3BFGA 1K54C 2WADA 4R4RA 2EXAA 3ZG5A 1NYMA 5KZHA 3Q07A 4XXRA 3W8KA 1NXYA 3CJMA 5EVIB 1CI8A 3GVBA 5CTMA 4C6YA 4EV4A 3SH7A 1SCWA 3WRTA 4K0XA 2B5RA 4R1GA 1LHYA 3IF5A 3LY4A 2P9VA 1FSYA 2ZM2A 2WGVA 3FWLA 3TG9A 4ZDXA 3Q7VB 1L0GA 1W79A 2Z2MB 4B4ZA 1RGZA 3Q82A 3TSGA 1FCOA 3GR2A 3SH9A 2XDMA 4DDYA 4JF4A 1S6RA 3NDGA 4ZBEA 5EE8A 4WEJA 5EUAA 1L0DA 1ZC2A 4S2KA 2OSUA 2WYXA 3M6BA 3HLFA 4E3MA 5EVIA 4E3KA 3N4IA 4MBFA 2ZM8A 3VSLA 3BFCA 5CTNA 4P6BA 2R9XA 3VP3A 3LO7A 1W8QA 5FI7A 1O07A 1KE3A 3VP0A 1G6AA 1NY0A 2X71A 4OPYA 3IT9A 3OCNA 4OLGA 1KE4A 1PI5A 4RX3A 2Y4AA 3NIAA 4DE1A 3BFFA 2EXBA 3SS3A
chains in the Genus database with same CATH superfamily
1FIKA 2XSSA 3ISGA 1AXBA 1Q2QA 1PW1A 2FFFB 3VV4A 1LL5A 5HWWA 2JBFA 4R38A 4NK3A 2QYBA 2H10A 2DNSA 5F1FA 3GSGA 4IBRA 5A90A 2VV8A 4HESA 3CUEA 4B9OA 3G2YA 4GD6A 4GDBA 2H5SA 5DKKA 1XGJA 4XUXA 4JGQA 2IA2A 4YINA 1P97A 2H0TA 4WN5A 1PZOA 2V1AA 1ACFA 5HL1A 3UB5P 3EQUA 1ZKJA 2CMNA 5E2HA 3IX8A 5CXWA 5A91A 3LR0A 2Y2JA 4O8GA 1BLHA 1ZTUA 4IUKA 1GA9A 1E3UA 3F1PB 4OKPA 1H8YA 4K08A 3E2KA 1XPBA 2ZQAA 1K4EA 2PYPA 3V50A 3UB9A 5FAQA 4KUOA 3R7WA 3S7QA 1BZAA 2V1ZA 2XRNA 2L4RA 3BJNA 4I39A 1YLYA 1CF0A 2ZC6B 4UQIS 4OOLA 4KZBA 1KVMA 5FEGA 2WKQA 4ARZB 2LB9A 5FDHA 4GKUA 1SDNA 2YKFA 5E2GA 3NC8A 2WAEA 4D2OA 1NRJA 4DE0A 2HP6A 3QP6A 5D3OA 1OTEA 3MQQA 2V1BA 3WS4A 3T4SA 2J9PA 3EQVA 2JKTM 2ZOIA 3B33A 4IBXA 2ZOHA 3CMZA 3U2AA 2K31A 3MXQA 4N9LA 1IEMA 4MDZA 3KSIA 1IYOA 2J80A 1K57A 3VOLA 4FTXA 4OONA 4Y0TA 4F3LB 1KVLA 1ZG4A 4IVIA 1JTGA 3UE3A 3IH8A 4OH0A 3KX0X 4M3KA 3LIBA 1YLTA 2V8CA 4IUHA 4RX2A 5KMWA 5TR7A 3MFDA 5IT5A 3E2LA 2XGNA 3H82B 1GA0A 4OQIA 3UMEA 3CHWP 1L0EA 3UE6A 2QHKA 1FILA 3UY6A 1PW8A 1ONHA 1KDWA 1LSVA 4JGPA 4MMNA 3EOIA 3C4OA 1OTAA 5HAPA 5HW3A 3M6HA 4KENB 3JVVA 1Z6FA 1FOFA 2V0WA 4QD4A 2H28A 4S2NC 5HZHA 3N7WA 3G32A 3PBSA 4NXGA 5F82A 1N4OA 1PRQA 1QMEA 3GECA 4RA7A 4PPRA 2XA7M 1NYYA 3EWKA 3OZHA 4WMCA 4GNUA 5HPIA 2O99A 1OTDA 3BLSA 4PM7A 3VMAA 3HREA 3UB7A 3HJIA 3ZG0A 3CG5A 2VJWA 1J9MA 2K2NA 2VA0A 4GDNA 3TJZC 4MLLA 2WGWB 4E3JA 1K55C 2ZQ7A 4I3IA 3HLDA 4BBVA 4GW9A 5JYPA 4JBFA 5F1GA 1BULA 3UO9A 4GLQA 1T1CA 2XD1A 1HVBA 5GHYA 4HJ4A 1IKIA 1K6RA 3N6IA 3I7JA 4A5RA 4KQOA 2M1CA 3MXSA 4HP9A 4HHDA 2WGWA 3E4PA 4Y3IA 3NBLA 3BECA 1I5QA 3EGDC 3HCYA 4PM5A 1HD8A 4LRXC 2BTFP 5M18A 4E6WA 5C5KA 1OT9A 4KG5A 3LIAA 4CLCA 4LV2A 4MN7A 4EUZA 4R0QA 4RVAA 4UA9A 4ID4A 5FQIA 1SHVA 3IX3A 3SS4A 4CPKA 1EROA 5AQAA 3SOIA 5FSRA 5CGXA 4E04A 1HLUP 2BASA 3WS2A 3A0VA 3A3DA 1ONGA 2J3TC 4LV0A 3TRCA 2A49A 2LB5A 2X02A 2P74A 2Y55A 4S2MA 3NY4A 2W3HA 2OV5A 5KIZA 2Q9NA 1ESUA 3N8SA 3ZNYA 3U4LP 1DP6A 4EBLA 2VZWA 2XD5A 1K56D 4LRYC 5GL9A 3DWZA 4KZ3A 1IYSA 3FV7A 3PAGA 4EUVA 3A3IA 3VSKA 3L9KA 4JF6A 1D1JA 1P0ZA 1GHPA 3G4PA 3PBTA 3T1RA 4DE2A 2FZ0A 3BM6A 5IS1A 2Y2HA 1ERQA 5EVLA 1FR1A 1S4RA 4WELA 4F94A 4U0XA 2G2WA 5EM1A 3T1SA 3VFFA 2ZC4B 3LR3A 3RFBA 5HD3A 3KYEA 2WKPA 1SZVA 4JXGA 4LENA 5AQ7A 5FAOA 3ICYA 2B18A 2W1TB 4DXBA 2OLVA 3UPPA 3KYZA 4JXWA 3IWIA 4HEFA 2P08A 4II7A 2GJ3A 4R4RA 2D02A 2R78A 3ZG5A 3CUEC 3W8KA 1H8MA 3IS2A 2M7UA 2W1TA 3FPWA 1L0GA 4BWIA 1RGZA 1FCOA 4NKPA 3IX4A 2XDMA 3NDGA 4RQ9A 4LPZA 4HIAA 3FG8A 1L0DA 2Y8HA 2WYXA 2QJ5A 3ZYTA 1L3LA 3VP3A 1H3QA 2VX8A 3VP0A 2X71A 2GNXA 3T1XA 4RX3A 1KE4A 5J4EA 3BFFA 3LIFA 4GCZA 3E0YA 3MSHA 2H0YA 1FCMA 4M4XA 4Y5FA 3ZVTA 3RH8B 4HJ3A 3ITAA 4YWZA 5J3WA 3BQ8A 3PBQA 4WBGA 4DF6A 1Z09A 2G2UA 4JGOA 3IHAA 1K6SA 3E4OA 1K54A 5DF8A 2Y2QA 5L10A 3C8CA 1XFQA 3WS0A 1W8YA 1YQSA 4S2PA 4WZ4A 1BT5A 1MXOA 4KG2A 4JKTA 1XP4A 2W3GA 1YT4A 5G4YA 1RP5A 4DMZA 1GHMA 4QHCA 4GS9B 4WF0A 2JKRM 2FFYA 4Y7PA 3A0RA 3A0SA 1MWSA 4RYEA 5GLCA 3IXDA 4EESA 4LCMA 1MWRA 5GHZA 5HWVA 4DDSA 4GS9A 5J7EA 4EEPA 2R9WA 5HAQA 1K57C 4YOFA 2VGKA 1PWGA 3F1OA 3G31A 3UPNA 2FH5A 1SDEA 4KZ4A 2Q0OA 1HTZA 4YNRA 1XGIA 2ZLYA 4WM9A 1IYQA 2PBDP 5AQ9A 1H0MA 1ZG6A 2ZQDA 3V39A 2PT7A 1KDSA 3F1NB 2EA9A 2XF3A 1CEGA 4GN2A 5E2FA 4MBHA 2W27A 3LEZA 1NZOA 1S4SA 3Q7ZA 4E3OA 3UB8A 4R3AA 3Q7VA 2Z6CA 1F98A 3R4KA 4PKYG 3VFHA 4R70A 2W1RA 2VV7A 5FQKA 1NLYA 3MZEA 2ZD8A 4XT2B 3QP4A 2J7VA 1WE4A 1C3BA 1S1YA 3BLMA 4KZAA 1XXMA 3NI9A 1VETA 3VOZA 4OLDA 3BRMA 1YLJA 1OPXA 1DJAA 4UEYA 3ZG7B 1AWIA 2EFXA 3P01A 3PR6A 5AVEA 2QZ6A 1G5UA 4JXVA 3SS3A 1P9RA 2E8IA 4BQMA 2ZQCA 4QY6A 4R4SA 5EV0A 3C7VA 4IEDA 2KX6A 3NHQA 3Q1FA 3DTMA 2PD8A 2OLUA 3IXHA 4LCLA 4WZ5A 5AQBA 2EFUA 1U60A 2NUPC 1V9YA 3QP5A 1TS7A 4NXFA 1PWCA 1NZUA 5GLDA 1W63Q 2WAFA 4ZRRA 5CEBA 1Y54A 4IJGA 4FD8A 3ZG8B 4I5SA 2O9BA 1BLSA 4N92A 5FQQA 1EW0A 2JCHA 3MXRA 4QPRA 4OQGA 4P6ZM 4R6LA 5HPFA 1OJGA 4EEUA 2L0WA 2V9AA 4CLCC 5BOHA 4DJ3A 4EERA 4ZJ1A 2WKEA 3GV9A 4PM6A 1OMEA 3LUQA 3TOIA 1PI4A 3IF6B 3HJKA 2HPBA 3IXBA 2DCFA 5CERA 4KUKA 3F1PA 3PBOA 4Y15A 1N9NA 4S2JA 2Y2IA 3ZCZA 1L0FA 2Y2KA 1V9ZA 1PZPA 4BLMA 2Q9MA 3GQZA 4PM9A 1K56A 1ES5A 2A3UA 3IXGA 1XJ3A 3HLGA 2O9CA 2VK3A 3V3RA 4ARZA 1CJFA 2WGIA 5EECA 2PBYA 4Q0HA 1YMSA 1CI9A 4JF5A 5FDSA 2M7VA 3E4QA 3UDIA 3BFDA 2HDSA 5DF9A 1TDGA 3QHYA 1IKGA 1TEMA 1UGUA 3ZG9B 4KQQA 1H5XA 5TFQA 2IWCA 4K91A 1BUEA 1TS8A 3OLOA 5EOEA 3A3EA 2JKTI 3QP1A 5GHXA 3BW6A 5M1AA 3LR4A 5HARA 4GHIB 4F3LA 1X0OA 1MBLA 1JNUA 1MKIA 2OAP1 2XFSA 2A2LA 4QY5A 2HJ9C 1NRFA 3W2ZA 1O7EA 1TS6A 2ZMVA 2UWXA 4FH2A 3B42A 2EWVA 3H82A 1RGYA 5J8XA 3W4PA 3MZFA 4KZ7A 4UHUA 4H8RA 4X1MA 4MN5A 3GMWA 3UB6A 3MMHA 3WS5A 4GB7A 3PTEA 1Y4OA 1BLPA 3H7WB 4IVKA 1VM1A 1MKMA 2X01A 3FKVA 2ZL1B 4DE3A 4ZJ3A 1MZUA 1LI0A 5U47A 1DRMA 4B88A 5FI2A 4E3IA 3RXWA 2ZC5B 4G3WA 2V8FA 4WEKA 2WZZA 1FR6A 2HGVA 4ETZA 3S1YA 1TDLA 3VE3A 2ZBBA 1K54C 1VB6A 2EXAA 3EEHA 5KZHA 3Q07A 5EVIB 2B95A 3GVBA 4C6YA 1SCWA 1T1BA 3T1QB 2B5RA 1LHYA 4CQHA 1FSYA 2KLIA 1W79A 3Q82A 2OWHA 1OT6A 3SH9A 4DDYA 5EUAA 2JHEA 5L07A 5EVIA 4E3KA 3BFCA 5CTNA 5LBRA 4IHQA 2R9XA 1PNEA 3MS6A 1VEUB 1W8QA 5FI7A 4DN0A 1O07A 3DAVA 1OTBA 4OPYA 3IT9A 4CLCE 1PI5A 2Y4AA 3SH7A 4DE1A 3GTCA 1LSXA 4C75A 2P7JA 2Y2OA 3CITA 4R23A 2GZAA 3MF0A 4EQIA 1XJ2A 2VGLS 2OWJA 4OOYA 5FASA 4X1LA 1UWPX 2XH9A 3CLOA 3MQ0A 4H6JB 3P09A 2V0UA 1JTDA 2GDNA 2CC1A 3V5MA 2OAQ1 5CRFA 3ZFZA 3HLEA 2YKHA 3G34A 2PU4A 5K5BA 1YLPA 3LGOA 3LICA 3C2WA 3LFVA 4BENA 1FSWA 3B3XA 2XFTA 1MY8A 4EBNA 3S7NA 3WS1A 5A93A 2PU2A 2W0NA 3IH9A 4Z1WA 4DKIA 3LY3A 4B4XA 3A3FA 3HLWA 4HP4A 2VLGA 3NOPC 1ODVA 2HJEA 4DRTA 4BL2A 3E98A 4MCWA 1ZHHB 1TS0A 3O87A 2HDUA 3HLBA 1VQQA 2UV0E 3DBAA 2XROA 1CEFA 2C5WB 4N1HA 4Y13A 1G68A 2RL3A 5DKLA 4L9FA 3UDFA 2XA7S 3LIDA 4KZ9A 4XUZA 5HDCA 1PIOA 4OQ0A 3T50A 4BD1A 3IBJA 5DVAA 4E6XA 1N9OA 3FC7A 4WZ5C 4JXSA 5EVEA 4EW7A 1RCJA 1JWVA 2QMIA 4HI4A 2QKPA 3VOYA 4BD0A 4OP5A 3HLCA 4MNRA 3HL9A 2ZC3B 3TE8A 4PHTA 5M19A 1KE0A 4MBKA 5JYOA 4D60A 4ZAMA 1XA7A 4G3VA 1G6OA 3N8RA 1NWZA 5KSHA 2JN7A 1S0WA 2Y2GA 1K38A 2OOLA 4KG6A 3KSGA 3DTIA 1PYYA 4L9GA 1P9WA 5F69A 3ZGAB 3JVUA 3IWQA 1S66L 1DP9A 3FZCA 2VKSA 2B02A 4EETB 1STZA 2WZXA 5IHVA 5DJTA 2MJ6A 2Y2NA 2WK0A 2VV6A 1CK3A 3LYXA 5HL6A 3LCEA 3VE4A 3O3VA 1S1ZA 1CQAA 2Y2PA 2EWWA 1DJCA 4HY8A 1F9IA 5AVFA 5CECA 1YKDA 5I5LA 1LT0A 4KZ8A 2EX2A 3S7OA 2ZM0A 2P04A 3IWOA 4HBTA 1E4DA 4Y0OA 2DRWA 1HZOA 4OPQA 5EVID 5GLAA 1SKOB 3BYDA 5HX9A 5FQJA 3G2ZA 3KO6A 2DMWA 1KGGA 2ZMFA 4JLFA 1GSXA 4R3BA 2JKRI 4UQIM 3UPOA 4ME4A 4X53A 4I3JA 4OPRA 1A0KA 3OPPA 3PYPA 1FQGA 5IU1A 3HUNA 2QWSA 3PAEA 2Y91A 5DTKA 5TBMB 2Y59A 3UNWA 2P9VB 2WUQA 2WKHA 3RTYA 1BTLA 2XQZA 3MZDA 4O01A 4ZTKA 4AFIA 1LI9A 2INWA 3EEAA 3H9WA 3O88A 1YM1A 2W3FA 5CX7A 5KSCA 1LLBA 2BLSA 3W4QA 1GHIA 3F1NA 3W4OA 1XFNA 5TGFA 2AVXA 3T4QA 3BFEA 3O5YA 3DTKA 4P87A 2HDRA 1I2WA 3OC2A 1S67L 2EX8A 1DY6A 3SS5A 3UN7A 3AGFA 1IELA 4XT2A 3OOVA 4HNBA 3NJAA 1WA9A 1JWPA 4QWOA 1TVFA 3HUOA 3T12B 4BJPA 2W3DA 3G35A 3LI9A 4OPZA 4UA7A 4OP8A 3ZVWA 2Y79A 4L0LA 3LIEA 2HF6A 4WLAA 5DTSA 3PBRA 2ZMAA 3UDXA 2HDQA 1MC0A 3V67A 4NEED 2BG1A 5FL3A 4LFUA 4GOGA 4NG2A 1OTIA 3T4LA 4OOMA 2Y2MA 2J8YA 4HBUA 5FI6A 3NDEA 1SKFA 5EVIC 3B47A 4P0MA 3ITBA 3UE0A 3CAXA 3R7WB 3IQAA 3JYIA 3S22A 4ETXA 1WYBA 4HH2A 4LGWA 4B93A 1NLZA 5EOOA 1MWTA 1VHMA 2Y2LA 5E43A 4LV3A 2VEAA 3MKEA 3WWXA 1K0KA 3M2KA 4UA6A 3IF6A 3N8LA 3LR5A 5F83A 5A92A 2A24B 3BY8A 5L8MA 1Y28A 1NXYA 3CJMA 1CI8A 5CTMA 3WRTA 4K0XA 4R1GA 2WGVA 3FWLA 4ZDXA 3FPVA 1W63M 3GR2A 2PHYA 5DFXA 4JF4A 2O9AA 1S6RA 4ZBEA 2A24A 5EE8A 4WEJA 1ZC2A 3M6BA 3HLFA 3N4IA 4MBFA 4P6BA 2I9VA 5EM0A 3LO7A 4I3AA 1NY0A 3C38A 3OCNA 4OLGA 2VGLM 3NIAA 1XJ6A 1W7FA 4E3NA 5E2EA 1XJ4A 2KOIA 3T4JA 2KDKA 3D9YA 3QNCA 5DFYA 3LI8A 3KSFA 4KQDA 2D01A 1YSQA 1YSPA 3HBRA 2IWBA 1JWZA 5HAIA 3UE1A 5DF7A 4U3TA 1F5MA 4N9KA 5AJGA 3OPRA 2J3TD 3ZDJA 3VP1A 3ZNTA 1XKZA 1K4FA 4GD8A 4KQRA 3MR0A 1IOUA 1GCEA 4GHIA 1TD5A 4LV1A 1LL8A 2PYRA 3AGEA 2XLNA 2V2FF 4WL9A 4NXEA 2ZQ9A 5EFWA 3L7HA 3SH8A 3T4KA 4QB8A 3CZDA 3H7WA 3VP2A 4X6TA 2I72A 5FQ9A 1M40A 4GJ4A 3P98A 4KZ5A 5FA7A 3BEBA 2L1MA 1ES3A 4HH3A 4EXOA 2ZL1A 1N9LA 2NUTC 4P6ZS 5EPHA 3C4PA 3A3JA 4BBTA 2RCXA 3UMDA 4O7DA 1L2SA 3O86A 5DJUA 2PRFA 1BLCA 3P7NA 3ZQ5A 2ZC7A 2HP5A 3CWFA 2VGJA 1KGFA 2E8JA 1D06A 5FQMA 3BWLA 5F5YA 3BY9A 3IBRA 4X68A 1XX2A 3NCKA 4CLCB 1YLWA 3MJQA 1LL9A 4EQ1A 2HV1A 4ZJ2A 3K3DA 1G28A 4Y17A 2K7SA 4JPMA 1EI5A 4JGRA 4C3QA 4WYYA 1VEUA 3RJUA 1K25A 1E25A 5CGWA 4P85A 1E3UD 2EX6A 1W5DA 3HUMA 4Q0IA 4YFMA 1GSVA 2HP9A 2G7UA 4G3KA 3MQOA 4FCFA 5F68A 2JC7A 1MPLA 3AGDA 4HQAA 4LRZE 3EGXC 3QP8A 1ESIA 4H6JA 4OQHA 3KSHA 2W3EA 3CPTB 2QJ7A 2ZQ8A 3MKFA 1T19A 4HJ6A 4O0PA 4NXBA 4N1XA 1J3WA 1JVJA 3JPUA 3DW0A 2XEPA 1F2KA 4X25A 4X69A 4I38A 5MC7A 2WKRA 3Q81A 1DJBA 3CPTA 5HDSA 3IHBA 4CJNA 4HOIA 1ES2A 5FEFA 4UAAA 3TW8A 1PFLA 2WKIA 2JKFA 3DTEA 1KGEA 4BL3A 3GDIA 4PMAA 2XK1A 3NOTC 3PBNA 4R3JA 1YAXA 4KZ6A 4EU0A 3OPLA 3SW1A 3HVFA 4ESPA 3MFXA 3IS2B 4QJGA 3BQAA 2C6WB 4X55A 3OPHA 4K0WA 5CGSA 2QPNA 5HD5A 2XR0A 3GRJA 1GSWA 4BBUA 2HZ5A 4Z9QA 1YLZA 4X56A 3C7UA 1I2SA 3NECA 1MWUA 2J9OA 3LEQA 4MEZA 3D4FA 4S2NA 1IYPA 3D3OA 4EBPA 4EWFA 1IFQA 2GX5A 3V3SA 2PD7A 2ZJ9A 5HSQA 2IWDA 5CHJA 1ES4A 3SZTA 3T4OA 1YMXA 1M6KA 4DXCA 3ZHHA 3D72A 4U0TA 4DJ2A 3VP4A 1WYCA 4WMCD 3RXXA 2J3WA 5I94A 5L09A 1UWNX 4BMWA 2PR6A 3QNBA 4QU3A 4FH4A 4WUJA 1K55A 3IF6C 2V20A 5CEDA 1EWZA 5L2FA 3NOUC 5HWTA 2Z2LB 4FOFA 4S2IA 3G30A 3PXPA 3G6OA 3M2JA 5G18A 4Q8IA 3WRZA 2JE5A 3DWKA 4FSFA 2ACGA 4OVDA 1KOUA 3QP2A 3OCLA 1PWDA 2PDRA 3S4XA 4Q0JA 1NJ4A 5HDDA 5CHUA 4S2OA 5CHMA 2EX9A 1ALQA 3K2NA 3NULA 1FCNA 1N9BA 4E3LA 3F1OB 5HFOA 5GLBA 4MN6A 1TF1A 1H8ZA 1SKOA 4NETA 1BSGA 1Q2PA 1LSWA 1QMFA 4CLCD 3C5AA 3S7PA 4PKYA 5G4ZA 4PAUA 3FKWA 5FAPA 4GZBA 1T18A 4PM8A 4S2LA 5DTTA 3ULFA 3FYZA 1ERMA 3T4TA 4Y0UA 5TJJA 1XA1A 3MBZA 5FATA 4Y2FA 5F6AA 2Z6DA 3BFGA 2WADA 3CI6A 3KYQA 3OBFA 4LLOB 1NYMA 4XXRA 1BYWA 4EV4A 2PR5A 5A8BA 5TBMA 3IF5A 3LY4A 2P9VA 2ZM2A 3TG9A 3PHYA 3K3CA 3Q7VB 2Z2MB 4B4ZA 1T1AA 3TSGA 4FUWA 1DP8A 2PAVP 1D7EA 3C30A 4S2KA 2OSUA 1YPRA 4L9EA 4E3MA 2ZM8A 3VSLA 1OJ5A 1VETB 1KE3A 1G6AA 2JKGA 2EXBA 2O0YA
chains in the Genus database with same CATH topology
1W7FA 4C75A 3ISGA 2Y2OA 4E3NA 5E2EA 1AXBA 1Q2QA 4R23A 3QNCA 1PW1A 2FFFB 1LL5A 3HBRA 2H0YA 2IWBA 4EQIA 1JWZA 2JBFA 5HAIA 1FCMA 3UE1A 5DF7A 5FASA 4OOYA 4U3TA 3ZVTA 3ITAA 2XH9A 4N9KA 4NK3A 4DF6A 3PBQA 4WBGA 3OPRA 3P09A 2H10A 2G2UA 2DNSA 3IHAA 1K6SA 3ZDJA 5F1FA 1JTDA 3VP1A 3GSGA 4IBRA 2GDNA 1K54A 2CC1A 3ZNTA 3V5MA 5DF8A 5A90A 1XKZA 5CRFA 2Y2QA 3ZFZA 4HESA 1K4FA 4GD8A 3HLEA 4KQRA 3G2YA 4GD6A 3G34A 4GDBA 2H5SA 2PU4A 3WS0A 1GCEA 1W8YA 1YQSA 4S2PA 1XGJA 4WZ4A 1BT5A 4XUXA 1YLPA 1MXOA 4KG2A 4JKTA 1XP4A 4LV1A 4YINA 1YT4A 2H0TA 1PZOA 1RP5A 4BENA 1FSWA 1GHMA 3B3XA 4QHCA 5HL1A 3AGEA 2XFTA 2XLNA 1MY8A 3EQUA 2V2FF 4EBNA 2FFYA 1ZKJA 5E2HA 2ZQ9A 3WS1A 5CXWA 5A93A 4Y7PA 2PU2A 5A91A 3IH9A 4DKIA 1MWSA 4RYEA 5GLCA 3SH8A 3LY3A 4B4XA 2Y2JA 3A3FA 3HLWA 3IXDA 4DRTA 4LCMA 1BLHA 1MWRA 4QB8A 3CZDA 5GHZA 1GA9A 3VP2A 4BL2A 4DDSA 4X6TA 2I72A 5FQ9A 2R9WA 1E3UA 4OKPA 1H8YA 5HAQA 1M40A 3GTCA 3E2KA 3P98A 4KZ5A 5FA7A 1K57C 1XPBA 3O87A 2HDUA 3BEBA 2ZQAA 1VQQA 1ES3A 1K4EA 2VGKA 1PWGA 3HLBA 1CEFA 2C5WB 4N1HA 3V50A 1G68A 2RL3A 3G31A 5FAQA 5EPHA 3UPNA 3C4PA 3A3JA 1SDEA 2RCXA 4KZ4A 3UDFA 4O7DA 1HTZA 1BZAA 4KZ9A 2V1ZA 4XUZA 1XGIA 1L2SA 2ZLYA 3O86A 1PIOA 4OQ0A 4WM9A 1IYQA 1YLYA 2ZC6B 1BLCA 4OOLA 4KZBA 5AQ9A 1KVMA 2ZC7A 4BD1A 1ZG6A 2HP5A 5DVAA 2ZQDA 4E6XA 2VGJA 3V39A 5FDHA 1KDSA 4GKUA 1SDNA 1KGFA 4WZ5C 2XF3A 1CEGA 4GN2A 4JXSA 5E2FA 1RCJA 5E2GA 3NC8A 1JWVA 2WAEA 5FQMA 2QMIA 4D2OA 3VOYA 4BD0A 4MBHA 3LEZA 1NZOA 4OP5A 3HLCA 4MNRA 4DE0A 2HP6A 4X68A 1XX2A 3HL9A 3Q7ZA 2ZC3B 5D3OA 4E3OA 3NCKA 1YLWA 1LL9A 5M19A 3Q7VA 1KE0A 4MBKA 3WS4A 4ZJ2A 5JYOA 2J9PA 4ZAMA 3VFHA 1XA7A 3EQVA 3N8RA 5FQKA 5KSHA 3MZEA 2ZD8A 1S0WA 2Y2GA 4IBXA 2J7VA 1K38A 1WE4A 3CMZA 4JPMA 1C3BA 1EI5A 3BLMA 4KZAA 4C3QA 1XXMA 4KG6A 3NI9A 1IEMA 4N9LA 1PYYA 3ZGAB 1IYOA 4WYYA 3IWQA 3VOZA 3BRMA 1YLJA 1K25A 1K57A 1E25A 3FZCA 4OLDA 5CGWA 3RJUA 1DJAA 4P85A 4OONA 3ZG7B 4Y0TA 1E3UD 2EFXA 2EX6A 2WZXA 5IHVA 1KVLA 1ZG4A 4IVIA 1JTGA 1W5DA 2QZ6A 4JXVA 3UE3A 3IH8A 4OH0A 3HUMA 2E8IA 4M3KA 4BQMA 1YLTA 2Y2NA 2WK0A 2ZQCA 4QY6A 4YFMA 4R4SA 3C7VA 4RX2A 2HP9A 1CK3A 5KMWA 4FCFA 5TR7A 3MFDA 4IEDA 2JC7A 1MPLA 3AGDA 3E2LA 2XGNA 1GA0A 4OQIA 1ESIA 3LCEA 3Q1FA 3DTMA 1L0EA 2OLUA 3IXHA 4LCLA 3O3VA 4WZ5A 5AQBA 2EFUA 1U60A 4OQHA 3UY6A 2Y2PA 1PW8A 1ONHA 2ZQ8A 1KDWA 1DJCA 3MKFA 3C4OA 1PWCA 5CECA 5HAPA 5HW3A 4N1XA 3M6HA 1NZUA 4KENB 4KZ8A 5GLDA 2EX2A 2WAFA 1JVJA 5CEBA 2ZM0A 3DW0A 2XEPA 1Z6FA 1FOFA 4QD4A 1Y54A 3IWOA 4HBTA 1E4DA 4Y0OA 4FD8A 4X69A 2DRWA 4S2NC 3ZG8B 1HZOA 4N92A 1BLSA 5FQQA 2JCHA 3N7WA 4OPQA 3MXRA 5EVID 3Q81A 3G32A 3PBSA 1DJBA 4OQGA 5F82A 5GLAA 1N4OA 4CJNA 1QMEA 3IHBA 3BYDA 5HX9A 1ES2A 4RA7A 5FQJA 4PPRA 4UAAA 3G2ZA 1KGGA 1NYYA 3OZHA 4JLFA 4WMCA 5BOHA 2WKIA 4GNUA 4ZJ1A 4R3BA 2WKEA 3BLSA 3GV9A 4PM6A 1KGEA 1OMEA 4PM7A 4X53A 3VMAA 4BL3A 3UPOA 3HREA 3TOIA 4PMAA 1PI4A 3IF6B 2XK1A 2HPBA 3PBNA 4OPRA 3IXBA 2DCFA 4KZ6A 3CG5A 4R3JA 5CERA 3ZG0A 3OPLA 3OPPA 1J9MA 3HVFA 1FQGA 4GDNA 3HUNA 3PAEA 4MLLA 2Y91A 3PBOA 2WGWB 4S2JA 5DTKA 2Y2IA 4E3JA 3ZCZA 1L0FA 1K55C 2Y59A 2ZQ7A 3UNWA 4QJGA 2P9VB 2WUQA 2Y2KA 1PZPA 3HLDA 2WKHA 2C6WB 4X55A 4BLMA 3OPHA 1BTLA 5JYPA 2XQZA 3MZDA 4K0WA 2Q9MA 4JBFA 3GQZA 5F1GA 1BULA 4PM9A 5CGSA 3UO9A 2QPNA 1K56A 4ZTKA 2XD1A 1HVBA 5GHYA 1LI9A 1IKIA 1K6RA 1ES5A 3N6IA 2XR0A 3I7JA 4A5RA 3GRJA 4KQOA 3MXSA 2A3UA 3IXGA 3O88A 1YM1A 2WGWA 3HLGA 4Z9QA 1LLBA 5KSCA 1YLZA 2BLSA 4X56A 3C7UA 1I2SA 3V3RA 3NBLA 1MWUA 2J9OA 3W4QA 1GHIA 3BECA 3W4OA 2WGIA 1I5QA 5EECA 5TGFA 2PBYA 3BFEA 4MEZA 3D4FA 4S2NA 1IYPA 4PM5A 1YMSA 4P87A 1CI9A 4JF5A 1HD8A 3UDIA 4EBPA 4EWFA 2HDRA 3BFDA 1I2WA 3V3SA 3OC2A 5M18A 2HDSA 5DF9A 4E6WA 1TDGA 3QHYA 2ZJ9A 4KG5A 2IWDA 1IKGA 4LV2A 1ES4A 5CHJA 1TEMA 4R0QA 4RVAA 4UA9A 4ID4A 2EX8A 1SHVA 5FQIA 4EUZA 3ZG9B 1DY6A 1YMXA 3SS4A 1M6KA 4KQQA 3SS5A 1H5XA 3UN7A 4CPKA 4DXCA 5TFQA 3ZHHA 1EROA 2IWCA 4K91A 4U0TA 3AGFA 1BUEA 1IELA 5AQAA 3SOIA 1WYCA 3VP4A 4WMCD 5EOEA 5FSRA 5CGXA 3RXXA 3WS2A 3A3EA 5I94A 1JWPA 3A3DA 1TVFA 1ONGA 5GHXA 3HUOA 4LV0A 3QNBA 4QU3A 4FH4A 5M1AA 4BJPA 2A49A 3G35A 4OPZA 4UA7A 5HARA 1K55A 2X02A 2P74A 2Y55A 4OP8A 4S2MA 3ZVWA 3NY4A 3IF6C 4L0LA 2OV5A 2Q9NA 1MBLA 2V20A 5CEDA 1MKIA 1ESUA 1EWZA 5L2FA 3N8SA 2Z2LB 5DTSA 4S2IA 3ZNYA 3PBRA 2ZMAA 3UDXA 2HDQA 3G30A 2XFSA 4QY5A 3M2JA 4EBLA 1NRFA 1O7EA 5G18A 2UWXA 4FH2A 2BG1A 2XD5A 4Q8IA 3WRZA 2JE5A 1K56D 4GOGA 3DWKA 5GL9A 3DWZA 1RGYA 4FSFA 5J8XA 4OOMA 3W4PA 4KZ3A 1IYSA 3MZFA 4KZ7A 4UHUA 4H8RA 4OVDA 3FV7A 2Y2MA 3OCLA 2J8YA 1PWDA 3PAGA 3S4XA 3GMWA 4HBUA 5FI6A 3WS5A 4GB7A 3PTEA 3A3IA 3VSKA 1BLPA 3NDEA 4JF6A 1NJ4A 1SKFA 5CHUA 5EVIC 1GHPA 4S2OA 3G4PA 4IVKA 3PBTA 1VM1A 5CHMA 2EX9A 1ALQA 4DE2A 4P0MA 3ITBA 2X01A 3FKVA 3BM6A 2Y2HA 1FCNA 1ERQA 1N9BA 4E3LA 5EVLA 5HFOA 5GLBA 1FR1A 3UE0A 4WELA 4DE3A 4F94A 1H8ZA 4NETA 1BSGA 1Q2PA 4U0XA 3IQAA 1QMFA 3JYIA 2G2WA 4ZJ3A 1LI0A 3S22A 3C5AA 5U47A 3VFFA 2ZC4B 1WYBA 4B88A 5FI2A 4E3IA 3FKWA 2ZC5B 5FAPA 3RXWA 5EOOA 4GZBA 4JXGA 1MWTA 4PM8A 4S2LA 5DTTA 2Y2LA 4LENA 3FYZA 1ERMA 4LV3A 5E43A 4WEKA 5AQ7A 5FAOA 2WZZA 1FR6A 4DXBA 3MKEA 2OLVA 4Y0UA 3WWXA 3UPPA 1XA1A 3M2KA 4JXWA 4UA6A 3IF6A 3MBZA 3N8LA 3S1YA 5FATA 1TDLA 3IWIA 4HEFA 5F83A 5A92A 3BFGA 1K54C 2WADA 4R4RA 2EXAA 3ZG5A 1NYMA 5KZHA 3Q07A 4XXRA 3W8KA 1NXYA 3CJMA 5EVIB 1CI8A 3GVBA 5CTMA 4C6YA 4EV4A 3SH7A 1SCWA 3WRTA 4K0XA 2B5RA 4R1GA 1LHYA 3IF5A 3LY4A 2P9VA 1FSYA 2ZM2A 2WGVA 3FWLA 3TG9A 4ZDXA 3Q7VB 1L0GA 1W79A 2Z2MB 4B4ZA 1RGZA 3Q82A 3TSGA 1FCOA 3GR2A 3SH9A 2XDMA 4DDYA 4JF4A 1S6RA 3NDGA 4ZBEA 5EE8A 4WEJA 5EUAA 1L0DA 1ZC2A 4S2KA 2OSUA 2WYXA 3M6BA 3HLFA 4E3MA 5EVIA 4E3KA 3N4IA 4MBFA 2ZM8A 3VSLA 3BFCA 5CTNA 4P6BA 2R9XA 3VP3A 3LO7A 1W8QA 5FI7A 1O07A 1KE3A 3VP0A 1G6AA 1NY0A 2X71A 4OPYA 3IT9A 3OCNA 4OLGA 1KE4A 1PI5A 4RX3A 2Y4AA 3NIAA 4DE1A 3BFFA 2EXBA 3SS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7F A;  4C75 A;  3ISG A;  2Y2O A;  4E3N A;  5E2E A;  1AXB A;  1Q2Q A;  4R23 A;  3QNC A;  1PW1 A;  2FFF B;  1LL5 A;  3HBR A;  2H0Y A;  2IWB A;  4EQI A;  1JWZ A;  2JBF A;  5HAI A;  1FCM A;  3UE1 A;  5DF7 A;  5FAS A;  4OOY A;  4U3T A;  3ZVT A;  3ITA A;  2XH9 A;  4N9K A;  4NK3 A;  4DF6 A;  3PBQ A;  4WBG A;  3OPR A;  3P09 A;  2H10 A;  2G2U A;  2DNS A;  3IHA A;  1K6S A;  3ZDJ A;  5F1F A;  1JTD A;  3VP1 A;  3GSG A;  4IBR A;  2GDN A;  1K54 A;  2CC1 A;  3ZNT A;  3V5M A;  5DF8 A;  5A90 A;  1XKZ A;  5CRF A;  2Y2Q A;  3ZFZ A;  4HES A;  1K4F A;  4GD8 A;  3HLE A;  4KQR A;  3G2Y A;  4GD6 A;  3G34 A;  4GDB A;  2H5S A;  2PU4 A;  3WS0 A;  1GCE A;  1W8Y A;  1YQS A;  4S2P A;  1XGJ A;  4WZ4 A;  1BT5 A;  4XUX A;  1YLP A;  1MXO A;  4KG2 A;  4JKT A;  1XP4 A;  4LV1 A;  4YIN A;  1YT4 A;  2H0T A;  1PZO A;  1RP5 A;  4BEN A;  1FSW A;  1GHM A;  3B3X A;  4QHC A;  5HL1 A;  3AGE A;  2XFT A;  2XLN A;  1MY8 A;  3EQU A;  2V2F F;  4EBN A;  2FFY A;  1ZKJ A;  5E2H A;  2ZQ9 A;  3WS1 A;  5CXW A;  5A93 A;  4Y7P A;  2PU2 A;  5A91 A;  3IH9 A;  4DKI A;  1MWS A;  4RYE A;  5GLC A;  3SH8 A;  3LY3 A;  4B4X A;  2Y2J A;  3A3F A;  3HLW A;  3IXD A;  4DRT A;  4LCM A;  1BLH A;  1MWR A;  4QB8 A;  3CZD A;  5GHZ A;  1GA9 A;  3VP2 A;  4BL2 A;  4DDS A;  4X6T A;  2I72 A;  5FQ9 A;  2R9W A;  1E3U A;  4OKP A;  1H8Y A;  5HAQ A;  1M40 A;  3GTC A;  3E2K A;  3P98 A;  4KZ5 A;  5FA7 A;  1K57 C;  1XPB A;  3O87 A;  2HDU A;  3BEB A;  2ZQA A;  1VQQ A;  1ES3 A;  1K4E A;  2VGK A;  1PWG A;  3HLB A;  1CEF A;  2C5W B;  4N1H A;  3V50 A;  1G68 A;  2RL3 A;  3G31 A;  5FAQ A;  5EPH A;  3UPN A;  3C4P A;  3A3J A;  1SDE A;  2RCX A;  4KZ4 A;  3UDF A;  4O7D A;  1HTZ A;  1BZA A;  4KZ9 A;  2V1Z A;  4XUZ A;  1XGI A;  1L2S A;  2ZLY A;  3O86 A;  1PIO A;  4OQ0 A;  4WM9 A;  1IYQ A;  1YLY A;  2ZC6 B;  1BLC A;  4OOL A;  4KZB A;  5AQ9 A;  1KVM A;  2ZC7 A;  4BD1 A;  1ZG6 A;  2HP5 A;  5DVA A;  2ZQD A;  4E6X A;  2VGJ A;  3V39 A;  5FDH A;  1KDS A;  4GKU A;  1SDN A;  1KGF A;  4WZ5 C;  2XF3 A;  1CEG A;  4GN2 A;  4JXS A;  5E2F A;  1RCJ A;  5E2G A;  3NC8 A;  1JWV A;  2WAE A;  5FQM A;  2QMI A;  4D2O A;  3VOY A;  4BD0 A;  4MBH A;  3LEZ A;  1NZO A;  4OP5 A;  3HLC A;  4MNR A;  4DE0 A;  2HP6 A;  4X68 A;  1XX2 A;  3HL9 A;  3Q7Z A;  2ZC3 B;  5D3O A;  4E3O A;  3NCK A;  1YLW A;  1LL9 A;  5M19 A;  3Q7V A;  1KE0 A;  4MBK A;  3WS4 A;  4ZJ2 A;  5JYO A;  2J9P A;  4ZAM A;  3VFH A;  1XA7 A;  3EQV A;  3N8R A;  5FQK A;  5KSH A;  3MZE A;  2ZD8 A;  1S0W A;  2Y2G A;  4IBX A;  2J7V A;  1K38 A;  1WE4 A;  3CMZ A;  4JPM A;  1C3B A;  1EI5 A;  3BLM A;  4KZA A;  4C3Q A;  1XXM A;  4KG6 A;  3NI9 A;  1IEM A;  4N9L A;  1PYY A;  3ZGA B;  1IYO A;  4WYY A;  3IWQ A;  3VOZ A;  3BRM A;  1YLJ A;  1K25 A;  1K57 A;  1E25 A;  3FZC A;  4OLD A;  5CGW A;  3RJU A;  1DJA A;  4P85 A;  4OON A;  3ZG7 B;  4Y0T A;  1E3U D;  2EFX A;  2EX6 A;  2WZX A;  5IHV A;  1KVL A;  1ZG4 A;  4IVI A;  1JTG A;  1W5D A;  2QZ6 A;  4JXV A;  3UE3 A;  3IH8 A;  4OH0 A;  3HUM A;  2E8I A;  4M3K A;  4BQM A;  1YLT A;  2Y2N A;  2WK0 A;  2ZQC A;  4QY6 A;  4YFM A;  4R4S A;  3C7V A;  4RX2 A;  2HP9 A;  1CK3 A;  5KMW A;  4FCF A;  5TR7 A;  3MFD A;  4IED A;  2JC7 A;  1MPL A;  3AGD A;  3E2L A;  2XGN A;  1GA0 A;  4OQI A;  1ESI A;  3LCE A;  3Q1F A;  3DTM A;  1L0E A;  2OLU A;  3IXH A;  4LCL A;  3O3V A;  4WZ5 A;  5AQB A;  2EFU A;  1U60 A;  4OQH A;  3UY6 A;  2Y2P A;  1PW8 A;  1ONH A;  2ZQ8 A;  1KDW A;  1DJC A;  3MKF A;  3C4O A;  1PWC A;  5CEC A;  5HAP A;  5HW3 A;  4N1X A;  3M6H A;  1NZU A;  4KEN B;  4KZ8 A;  5GLD A;  2EX2 A;  2WAF A;  1JVJ A;  5CEB A;  2ZM0 A;  3DW0 A;  2XEP A;  1Z6F A;  1FOF A;  4QD4 A;  1Y54 A;  3IWO A;  4HBT A;  1E4D A;  4Y0O A;  4FD8 A;  4X69 A;  2DRW A;  4S2N C;  3ZG8 B;  1HZO A;  4N92 A;  1BLS A;  5FQQ A;  2JCH A;  3N7W A;  4OPQ A;  3MXR A;  5EVI D;  3Q81 A;  3G32 A;  3PBS A;  1DJB A;  4OQG A;  5F82 A;  5GLA A;  1N4O A;  4CJN A;  1QME A;  3IHB A;  3BYD A;  5HX9 A;  1ES2 A;  4RA7 A;  5FQJ A;  4PPR A;  4UAA A;  3G2Z A;  1KGG A;  1NYY A;  3OZH A;  4JLF A;  4WMC A;  5BOH A;  2WKI A;  4GNU A;  4ZJ1 A;  4R3B A;  2WKE A;  3BLS A;  3GV9 A;  4PM6 A;  1KGE A;  1OME A;  4PM7 A;  4X53 A;  3VMA A;  4BL3 A;  3UPO A;  3HRE A;  3TOI A;  4PMA A;  1PI4 A;  3IF6 B;  2XK1 A;  2HPB A;  3PBN A;  4OPR A;  3IXB A;  2DCF A;  4KZ6 A;  3CG5 A;  4R3J A;  5CER A;  3ZG0 A;  3OPL A;  3OPP A;  1J9M A;  3HVF A;  1FQG A;  4GDN A;  3HUN A;  3PAE A;  4MLL A;  2Y91 A;  3PBO A;  2WGW B;  4S2J A;  5DTK A;  2Y2I A;  4E3J A;  3ZCZ A;  1L0F A;  1K55 C;  2Y59 A;  2ZQ7 A;  3UNW A;  4QJG A;  2P9V B;  2WUQ A;  2Y2K A;  1PZP A;  3HLD A;  2WKH A;  2C6W B;  4X55 A;  4BLM A;  3OPH A;  1BTL A;  5JYP A;  2XQZ A;  3MZD A;  4K0W A;  2Q9M A;  4JBF A;  3GQZ A;  5F1G A;  1BUL A;  4PM9 A;  5CGS A;  3UO9 A;  2QPN A;  1K56 A;  4ZTK A;  2XD1 A;  1HVB A;  5GHY A;  1LI9 A;  1IKI A;  1K6R A;  1ES5 A;  3N6I A;  2XR0 A;  3I7J A;  4A5R A;  3GRJ A;  4KQO A;  3MXS A;  2A3U A;  3IXG A;  3O88 A;  1YM1 A;  2WGW A;  3HLG A;  4Z9Q A;  1LLB A;  5KSC A;  1YLZ A;  2BLS A;  4X56 A;  3C7U A;  1I2S A;  3V3R A;  3NBL A;  1MWU A;  2J9O A;  3W4Q A;  1GHI A;  3BEC A;  3W4O A;  2WGI A;  1I5Q A;  5EEC A;  5TGF A;  2PBY A;  3BFE A;  4MEZ A;  3D4F A;  4S2N A;  1IYP A;  4PM5 A;  1YMS A;  4P87 A;  1CI9 A;  4JF5 A;  1HD8 A;  3UDI A;  4EBP A;  4EWF A;  2HDR A;  3BFD A;  1I2W A;  3V3S A;  3OC2 A;  5M18 A;  2HDS A;  5DF9 A;  4E6W A;  1TDG A;  3QHY A;  2ZJ9 A;  4KG5 A;  2IWD A;  1IKG A;  4LV2 A;  1ES4 A;  5CHJ A;  1TEM A;  4R0Q A;  4RVA A;  4UA9 A;  4ID4 A;  2EX8 A;  1SHV A;  5FQI A;  4EUZ A;  3ZG9 B;  1DY6 A;  1YMX A;  3SS4 A;  1M6K A;  4KQQ A;  3SS5 A;  1H5X A;  3UN7 A;  4CPK A;  4DXC A;  5TFQ A;  3ZHH A;  1ERO A;  2IWC A;  4K91 A;  4U0T A;  3AGF A;  1BUE A;  1IEL A;  5AQA A;  3SOI A;  1WYC A;  3VP4 A;  4WMC D;  5EOE A;  5FSR A;  5CGX A;  3RXX A;  3WS2 A;  3A3E A;  5I94 A;  1JWP A;  3A3D A;  1TVF A;  1ONG A;  5GHX A;  3HUO A;  4LV0 A;  3QNB A;  4QU3 A;  4FH4 A;  5M1A A;  4BJP A;  2A49 A;  3G35 A;  4OPZ A;  4UA7 A;  5HAR A;  1K55 A;  2X02 A;  2P74 A;  2Y55 A;  4OP8 A;  4S2M A;  3ZVW A;  3NY4 A;  3IF6 C;  4L0L A;  2OV5 A;  2Q9N A;  1MBL A;  2V20 A;  5CED A;  1MKI A;  1ESU A;  1EWZ A;  5L2F A;  3N8S A;  2Z2L B;  5DTS A;  4S2I A;  3ZNY A;  3PBR A;  2ZMA A;  3UDX A;  2HDQ A;  3G30 A;  2XFS A;  4QY5 A;  3M2J A;  4EBL A;  1NRF A;  1O7E A;  5G18 A;  2UWX A;  4FH2 A;  2BG1 A;  2XD5 A;  4Q8I A;  3WRZ A;  2JE5 A;  1K56 D;  4GOG A;  3DWK A;  5GL9 A;  3DWZ A;  1RGY A;  4FSF A;  5J8X A;  4OOM A;  3W4P A;  4KZ3 A;  1IYS A;  3MZF A;  4KZ7 A;  4UHU A;  4H8R A;  4OVD A;  3FV7 A;  2Y2M A;  3OCL A;  2J8Y A;  1PWD A;  3PAG A;  3S4X A;  3GMW A;  4HBU A;  5FI6 A;  3WS5 A;  4GB7 A;  3PTE A;  3A3I A;  3VSK A;  1BLP A;  3NDE A;  4JF6 A;  1NJ4 A;  1SKF A;  5CHU A;  5EVI C;  1GHP A;  4S2O A;  3G4P A;  4IVK A;  3PBT A;  1VM1 A;  5CHM A;  2EX9 A;  1ALQ A;  4DE2 A;  4P0M A;  3ITB A;  2X01 A;  3FKV A;  3BM6 A;  2Y2H A;  1FCN A;  1ERQ A;  1N9B A;  4E3L A;  5EVL A;  5HFO A;  5GLB A;  1FR1 A;  3UE0 A;  4WEL A;  4DE3 A;  4F94 A;  1H8Z A;  4NET A;  1BSG A;  1Q2P A;  4U0X A;  3IQA A;  1QMF A;  3JYI A;  2G2W A;  4ZJ3 A;  1LI0 A;  3S22 A;  3C5A A;  5U47 A;  3VFF A;  2ZC4 B;  1WYB A;  4B88 A;  5FI2 A;  4E3I A;  3FKW A;  2ZC5 B;  5FAP A;  3RXW A;  5EOO A;  4GZB A;  4JXG A;  1MWT A;  4PM8 A;  4S2L A;  5DTT A;  2Y2L A;  4LEN A;  3FYZ A;  1ERM A;  4LV3 A;  5E43 A;  4WEK A;  5AQ7 A;  5FAO A;  2WZZ A;  1FR6 A;  4DXB A;  3MKE A;  2OLV A;  4Y0U A;  3WWX A;  3UPP A;  1XA1 A;  3M2K A;  4JXW A;  4UA6 A;  3IF6 A;  3MBZ A;  3N8L A;  3S1Y A;  5FAT A;  1TDL A;  3IWI A;  4HEF A;  5F83 A;  5A92 A;  3BFG A;  1K54 C;  2WAD A;  4R4R A;  2EXA A;  3ZG5 A;  1NYM A;  5KZH A;  3Q07 A;  4XXR A;  3W8K A;  1NXY A;  3CJM A;  5EVI B;  1CI8 A;  3GVB A;  5CTM A;  4C6Y A;  4EV4 A;  3SH7 A;  1SCW A;  3WRT A;  4K0X A;  2B5R A;  4R1G A;  1LHY A;  3IF5 A;  3LY4 A;  2P9V A;  1FSY A;  2ZM2 A;  2WGV A;  3FWL A;  3TG9 A;  4ZDX A;  3Q7V B;  1L0G A;  1W79 A;  2Z2M B;  4B4Z A;  1RGZ A;  3Q82 A;  3TSG A;  1FCO A;  3GR2 A;  3SH9 A;  2XDM A;  4DDY A;  4JF4 A;  1S6R A;  3NDG A;  4ZBE A;  5EE8 A;  4WEJ A;  5EUA A;  1L0D A;  1ZC2 A;  4S2K A;  2OSU A;  2WYX A;  3M6B A;  3HLF A;  4E3M A;  5EVI A;  4E3K A;  3N4I A;  4MBF A;  2ZM8 A;  3VSL A;  3BFC A;  5CTN A;  4P6B A;  2R9X A;  3VP3 A;  3LO7 A;  1W8Q A;  5FI7 A;  1O07 A;  1KE3 A;  3VP0 A;  1G6A A;  1NY0 A;  2X71 A;  4OPY A;  3IT9 A;  3OCN A;  4OLG A;  1KE4 A;  1PI5 A;  4RX3 A;  2Y4A A;  3NIA A;  4DE1 A;  3BFF A;  2EXB A;  3SS3 A; 
#chains in the Genus database with same CATH topology
 1FIK A;  2XSS A;  3ISG A;  1AXB A;  1Q2Q A;  1PW1 A;  2FFF B;  3VV4 A;  1LL5 A;  5HWW A;  2JBF A;  4R38 A;  4NK3 A;  2QYB A;  2H10 A;  2DNS A;  5F1F A;  3GSG A;  4IBR A;  5A90 A;  2VV8 A;  4HES A;  3CUE A;  4B9O A;  3G2Y A;  4GD6 A;  4GDB A;  2H5S A;  5DKK A;  1XGJ A;  4XUX A;  4JGQ A;  2IA2 A;  4YIN A;  1P97 A;  2H0T A;  4WN5 A;  1PZO A;  2V1A A;  1ACF A;  5HL1 A;  3UB5 P;  3EQU A;  1ZKJ A;  2CMN A;  5E2H A;  3IX8 A;  5CXW A;  5A91 A;  3LR0 A;  2Y2J A;  4O8G A;  1BLH A;  1ZTU A;  4IUK A;  1GA9 A;  1E3U A;  3F1P B;  4OKP A;  1H8Y A;  4K08 A;  3E2K A;  1XPB A;  2ZQA A;  1K4E A;  2PYP A;  3V50 A;  3UB9 A;  5FAQ A;  4KUO A;  3R7W A;  3S7Q A;  1BZA A;  2V1Z A;  2XRN A;  2L4R A;  3BJN A;  4I39 A;  1YLY A;  1CF0 A;  2ZC6 B;  4UQI S;  4OOL A;  4KZB A;  1KVM A;  5FEG A;  2WKQ A;  4ARZ B;  2LB9 A;  5FDH A;  4GKU A;  1SDN A;  2YKF A;  5E2G A;  3NC8 A;  2WAE A;  4D2O A;  1NRJ A;  4DE0 A;  2HP6 A;  3QP6 A;  5D3O A;  1OTE A;  3MQQ A;  2V1B A;  3WS4 A;  3T4S A;  2J9P A;  3EQV A;  2JKT M;  2ZOI A;  3B33 A;  4IBX A;  2ZOH A;  3CMZ A;  3U2A A;  2K31 A;  3MXQ A;  4N9L A;  1IEM A;  4MDZ A;  3KSI A;  1IYO A;  2J80 A;  1K57 A;  3VOL A;  4FTX A;  4OON A;  4Y0T A;  4F3L B;  1KVL A;  1ZG4 A;  4IVI A;  1JTG A;  3UE3 A;  3IH8 A;  4OH0 A;  3KX0 X;  4M3K A;  3LIB A;  1YLT A;  2V8C A;  4IUH A;  4RX2 A;  5KMW A;  5TR7 A;  3MFD A;  5IT5 A;  3E2L A;  2XGN A;  3H82 B;  1GA0 A;  4OQI A;  3UME A;  3CHW P;  1L0E A;  3UE6 A;  2QHK A;  1FIL A;  3UY6 A;  1PW8 A;  1ONH A;  1KDW A;  1LSV A;  4JGP A;  4MMN A;  3EOI A;  3C4O A;  1OTA A;  5HAP A;  5HW3 A;  3M6H A;  4KEN B;  3JVV A;  1Z6F A;  1FOF A;  2V0W A;  4QD4 A;  2H28 A;  4S2N C;  5HZH A;  3N7W A;  3G32 A;  3PBS A;  4NXG A;  5F82 A;  1N4O A;  1PRQ A;  1QME A;  3GEC A;  4RA7 A;  4PPR A;  2XA7 M;  1NYY A;  3EWK A;  3OZH A;  4WMC A;  4GNU A;  5HPI A;  2O99 A;  1OTD A;  3BLS A;  4PM7 A;  3VMA A;  3HRE A;  3UB7 A;  3HJI A;  3ZG0 A;  3CG5 A;  2VJW A;  1J9M A;  2K2N A;  2VA0 A;  4GDN A;  3TJZ C;  4MLL A;  2WGW B;  4E3J A;  1K55 C;  2ZQ7 A;  4I3I A;  3HLD A;  4BBV A;  4GW9 A;  5JYP A;  4JBF A;  5F1G A;  1BUL A;  3UO9 A;  4GLQ A;  1T1C A;  2XD1 A;  1HVB A;  5GHY A;  4HJ4 A;  1IKI A;  1K6R A;  3N6I A;  3I7J A;  4A5R A;  4KQO A;  2M1C A;  3MXS A;  4HP9 A;  4HHD A;  2WGW A;  3E4P A;  4Y3I A;  3NBL A;  3BEC A;  1I5Q A;  3EGD C;  3HCY A;  4PM5 A;  1HD8 A;  4LRX C;  2BTF P;  5M18 A;  4E6W A;  5C5K A;  1OT9 A;  4KG5 A;  3LIA A;  4CLC A;  4LV2 A;  4MN7 A;  4EUZ A;  4R0Q A;  4RVA A;  4UA9 A;  4ID4 A;  5FQI A;  1SHV A;  3IX3 A;  3SS4 A;  4CPK A;  1ERO A;  5AQA A;  3SOI A;  5FSR A;  5CGX A;  4E04 A;  1HLU P;  2BAS A;  3WS2 A;  3A0V A;  3A3D A;  1ONG A;  2J3T C;  4LV0 A;  3TRC A;  2A49 A;  2LB5 A;  2X02 A;  2P74 A;  2Y55 A;  4S2M A;  3NY4 A;  2W3H A;  2OV5 A;  5KIZ A;  2Q9N A;  1ESU A;  3N8S A;  3ZNY A;  3U4L P;  1DP6 A;  4EBL A;  2VZW A;  2XD5 A;  1K56 D;  4LRY C;  5GL9 A;  3DWZ A;  4KZ3 A;  1IYS A;  3FV7 A;  3PAG A;  4EUV A;  3A3I A;  3VSK A;  3L9K A;  4JF6 A;  1D1J A;  1P0Z A;  1GHP A;  3G4P A;  3PBT A;  3T1R A;  4DE2 A;  2FZ0 A;  3BM6 A;  5IS1 A;  2Y2H A;  1ERQ A;  5EVL A;  1FR1 A;  1S4R A;  4WEL A;  4F94 A;  4U0X A;  2G2W A;  5EM1 A;  3T1S A;  3VFF A;  2ZC4 B;  3LR3 A;  3RFB A;  5HD3 A;  3KYE A;  2WKP A;  1SZV A;  4JXG A;  4LEN A;  5AQ7 A;  5FAO A;  3ICY A;  2B18 A;  2W1T B;  4DXB A;  2OLV A;  3UPP A;  3KYZ A;  4JXW A;  3IWI A;  4HEF A;  2P08 A;  4II7 A;  2GJ3 A;  4R4R A;  2D02 A;  2R78 A;  3ZG5 A;  3CUE C;  3W8K A;  1H8M A;  3IS2 A;  2M7U A;  2W1T A;  3FPW A;  1L0G A;  4BWI A;  1RGZ A;  1FCO A;  4NKP A;  3IX4 A;  2XDM A;  3NDG A;  4RQ9 A;  4LPZ A;  4HIA A;  3FG8 A;  1L0D A;  2Y8H A;  2WYX A;  2QJ5 A;  3ZYT A;  1L3L A;  3VP3 A;  1H3Q A;  2VX8 A;  3VP0 A;  2X71 A;  2GNX A;  3T1X A;  4RX3 A;  1KE4 A;  5J4E A;  3BFF A;  3LIF A;  4GCZ A;  3E0Y A;  3MSH A;  2H0Y A;  1FCM A;  4M4X A;  4Y5F A;  3ZVT A;  3RH8 B;  4HJ3 A;  3ITA A;  4YWZ A;  5J3W A;  3BQ8 A;  3PBQ A;  4WBG A;  4DF6 A;  1Z09 A;  2G2U A;  4JGO A;  3IHA A;  1K6S A;  3E4O A;  1K54 A;  5DF8 A;  2Y2Q A;  5L10 A;  3C8C A;  1XFQ A;  3WS0 A;  1W8Y A;  1YQS A;  4S2P A;  4WZ4 A;  1BT5 A;  1MXO A;  4KG2 A;  4JKT A;  1XP4 A;  2W3G A;  1YT4 A;  5G4Y A;  1RP5 A;  4DMZ A;  1GHM A;  4QHC A;  4GS9 B;  4WF0 A;  2JKR M;  2FFY A;  4Y7P A;  3A0R A;  3A0S A;  1MWS A;  4RYE A;  5GLC A;  3IXD A;  4EES A;  4LCM A;  1MWR A;  5GHZ A;  5HWV A;  4DDS A;  4GS9 A;  5J7E A;  4EEP A;  2R9W A;  5HAQ A;  1K57 C;  4YOF A;  2VGK A;  1PWG A;  3F1O A;  3G31 A;  3UPN A;  2FH5 A;  1SDE A;  4KZ4 A;  2Q0O A;  1HTZ A;  4YNR A;  1XGI A;  2ZLY A;  4WM9 A;  1IYQ A;  2PBD P;  5AQ9 A;  1H0M A;  1ZG6 A;  2ZQD A;  3V39 A;  2PT7 A;  1KDS A;  3F1N B;  2EA9 A;  2XF3 A;  1CEG A;  4GN2 A;  5E2F A;  4MBH A;  2W27 A;  3LEZ A;  1NZO A;  1S4S A;  3Q7Z A;  4E3O A;  3UB8 A;  4R3A A;  3Q7V A;  2Z6C A;  1F98 A;  3R4K A;  4PKY G;  3VFH A;  4R70 A;  2W1R A;  2VV7 A;  5FQK A;  1NLY A;  3MZE A;  2ZD8 A;  4XT2 B;  3QP4 A;  2J7V A;  1WE4 A;  1C3B A;  1S1Y A;  3BLM A;  4KZA A;  1XXM A;  3NI9 A;  1VET A;  3VOZ A;  4OLD A;  3BRM A;  1YLJ A;  1OPX A;  1DJA A;  4UEY A;  3ZG7 B;  1AWI A;  2EFX A;  3P01 A;  3PR6 A;  5AVE A;  2QZ6 A;  1G5U A;  4JXV A;  3SS3 A;  1P9R A;  2E8I A;  4BQM A;  2ZQC A;  4QY6 A;  4R4S A;  5EV0 A;  3C7V A;  4IED A;  2KX6 A;  3NHQ A;  3Q1F A;  3DTM A;  2PD8 A;  2OLU A;  3IXH A;  4LCL A;  4WZ5 A;  5AQB A;  2EFU A;  1U60 A;  2NUP C;  1V9Y A;  3QP5 A;  1TS7 A;  4NXF A;  1PWC A;  1NZU A;  5GLD A;  1W63 Q;  2WAF A;  4ZRR A;  5CEB A;  1Y54 A;  4IJG A;  4FD8 A;  3ZG8 B;  4I5S A;  2O9B A;  1BLS A;  4N92 A;  5FQQ A;  1EW0 A;  2JCH A;  3MXR A;  4QPR A;  4OQG A;  4P6Z M;  4R6L A;  5HPF A;  1OJG A;  4EEU A;  2L0W A;  2V9A A;  4CLC C;  5BOH A;  4DJ3 A;  4EER A;  4ZJ1 A;  2WKE A;  3GV9 A;  4PM6 A;  1OME A;  3LUQ A;  3TOI A;  1PI4 A;  3IF6 B;  3HJK A;  2HPB A;  3IXB A;  2DCF A;  5CER A;  4KUK A;  3F1P A;  3PBO A;  4Y15 A;  1N9N A;  4S2J A;  2Y2I A;  3ZCZ A;  1L0F A;  2Y2K A;  1V9Z A;  1PZP A;  4BLM A;  2Q9M A;  3GQZ A;  4PM9 A;  1K56 A;  1ES5 A;  2A3U A;  3IXG A;  1XJ3 A;  3HLG A;  2O9C A;  2VK3 A;  3V3R A;  4ARZ A;  1CJF A;  2WGI A;  5EEC A;  2PBY A;  4Q0H A;  1YMS A;  1CI9 A;  4JF5 A;  5FDS A;  2M7V A;  3E4Q A;  3UDI A;  3BFD A;  2HDS A;  5DF9 A;  1TDG A;  3QHY A;  1IKG A;  1TEM A;  1UGU A;  3ZG9 B;  4KQQ A;  1H5X A;  5TFQ A;  2IWC A;  4K91 A;  1BUE A;  1TS8 A;  3OLO A;  5EOE A;  3A3E A;  2JKT I;  3QP1 A;  5GHX A;  3BW6 A;  5M1A A;  3LR4 A;  5HAR A;  4GHI B;  4F3L A;  1X0O A;  1MBL A;  1JNU A;  1MKI A;  2OAP 1;  2XFS A;  2A2L A;  4QY5 A;  2HJ9 C;  1NRF A;  3W2Z A;  1O7E A;  1TS6 A;  2ZMV A;  2UWX A;  4FH2 A;  3B42 A;  2EWV A;  3H82 A;  1RGY A;  5J8X A;  3W4P A;  3MZF A;  4KZ7 A;  4UHU A;  4H8R A;  4X1M A;  4MN5 A;  3GMW A;  3UB6 A;  3MMH A;  3WS5 A;  4GB7 A;  3PTE A;  1Y4O A;  1BLP A;  3H7W B;  4IVK A;  1VM1 A;  1MKM A;  2X01 A;  3FKV A;  2ZL1 B;  4DE3 A;  4ZJ3 A;  1MZU A;  1LI0 A;  5U47 A;  1DRM A;  4B88 A;  5FI2 A;  4E3I A;  3RXW A;  2ZC5 B;  4G3W A;  2V8F A;  4WEK A;  2WZZ A;  1FR6 A;  2HGV A;  4ETZ A;  3S1Y A;  1TDL A;  3VE3 A;  2ZBB A;  1K54 C;  1VB6 A;  2EXA A;  3EEH A;  5KZH A;  3Q07 A;  5EVI B;  2B95 A;  3GVB A;  4C6Y A;  1SCW A;  1T1B A;  3T1Q B;  2B5R A;  1LHY A;  4CQH A;  1FSY A;  2KLI A;  1W79 A;  3Q82 A;  2OWH A;  1OT6 A;  3SH9 A;  4DDY A;  5EUA A;  2JHE A;  5L07 A;  5EVI A;  4E3K A;  3BFC A;  5CTN A;  5LBR A;  4IHQ A;  2R9X A;  1PNE A;  3MS6 A;  1VEU B;  1W8Q A;  5FI7 A;  4DN0 A;  1O07 A;  3DAV A;  1OTB A;  4OPY A;  3IT9 A;  4CLC E;  1PI5 A;  2Y4A A;  3SH7 A;  4DE1 A;  3GTC A;  1LSX A;  4C75 A;  2P7J A;  2Y2O A;  3CIT A;  4R23 A;  2GZA A;  3MF0 A;  4EQI A;  1XJ2 A;  2VGL S;  2OWJ A;  4OOY A;  5FAS A;  4X1L A;  1UWP X;  2XH9 A;  3CLO A;  3MQ0 A;  4H6J B;  3P09 A;  2V0U A;  1JTD A;  2GDN A;  2CC1 A;  3V5M A;  2OAQ 1;  5CRF A;  3ZFZ A;  3HLE A;  2YKH A;  3G34 A;  2PU4 A;  5K5B A;  1YLP A;  3LGO A;  3LIC A;  3C2W A;  3LFV A;  4BEN A;  1FSW A;  3B3X A;  2XFT A;  1MY8 A;  4EBN A;  3S7N A;  3WS1 A;  5A93 A;  2PU2 A;  2W0N A;  3IH9 A;  4Z1W A;  4DKI A;  3LY3 A;  4B4X A;  3A3F A;  3HLW A;  4HP4 A;  2VLG A;  3NOP C;  1ODV A;  2HJE A;  4DRT A;  4BL2 A;  3E98 A;  4MCW A;  1ZHH B;  1TS0 A;  3O87 A;  2HDU A;  3HLB A;  1VQQ A;  2UV0 E;  3DBA A;  2XRO A;  1CEF A;  2C5W B;  4N1H A;  4Y13 A;  1G68 A;  2RL3 A;  5DKL A;  4L9F A;  3UDF A;  2XA7 S;  3LID A;  4KZ9 A;  4XUZ A;  5HDC A;  1PIO A;  4OQ0 A;  3T50 A;  4BD1 A;  3IBJ A;  5DVA A;  4E6X A;  1N9O A;  3FC7 A;  4WZ5 C;  4JXS A;  5EVE A;  4EW7 A;  1RCJ A;  1JWV A;  2QMI A;  4HI4 A;  2QKP A;  3VOY A;  4BD0 A;  4OP5 A;  3HLC A;  4MNR A;  3HL9 A;  2ZC3 B;  3TE8 A;  4PHT A;  5M19 A;  1KE0 A;  4MBK A;  5JYO A;  4D60 A;  4ZAM A;  1XA7 A;  4G3V A;  1G6O A;  3N8R A;  1NWZ A;  5KSH A;  2JN7 A;  1S0W A;  2Y2G A;  1K38 A;  2OOL A;  4KG6 A;  3KSG A;  3DTI A;  1PYY A;  4L9G A;  1P9W A;  5F69 A;  3ZGA B;  3JVU A;  3IWQ A;  1S66 L;  1DP9 A;  3FZC A;  2VKS A;  2B02 A;  4EET B;  1STZ A;  2WZX A;  5IHV A;  5DJT A;  2MJ6 A;  2Y2N A;  2WK0 A;  2VV6 A;  1CK3 A;  3LYX A;  5HL6 A;  3LCE A;  3VE4 A;  3O3V A;  1S1Z A;  1CQA A;  2Y2P A;  2EWW A;  1DJC A;  4HY8 A;  1F9I A;  5AVF A;  5CEC A;  1YKD A;  5I5L A;  1LT0 A;  4KZ8 A;  2EX2 A;  3S7O A;  2ZM0 A;  2P04 A;  3IWO A;  4HBT A;  1E4D A;  4Y0O A;  2DRW A;  1HZO A;  4OPQ A;  5EVI D;  5GLA A;  1SKO B;  3BYD A;  5HX9 A;  5FQJ A;  3G2Z A;  3KO6 A;  2DMW A;  1KGG A;  2ZMF A;  4JLF A;  1GSX A;  4R3B A;  2JKR I;  4UQI M;  3UPO A;  4ME4 A;  4X53 A;  4I3J A;  4OPR A;  1A0K A;  3OPP A;  3PYP A;  1FQG A;  5IU1 A;  3HUN A;  2QWS A;  3PAE A;  2Y91 A;  5DTK A;  5TBM B;  2Y59 A;  3UNW A;  2P9V B;  2WUQ A;  2WKH A;  3RTY A;  1BTL A;  2XQZ A;  3MZD A;  4O01 A;  4ZTK A;  4AFI A;  1LI9 A;  2INW A;  3EEA A;  3H9W A;  3O88 A;  1YM1 A;  2W3F A;  5CX7 A;  5KSC A;  1LLB A;  2BLS A;  3W4Q A;  1GHI A;  3F1N A;  3W4O A;  1XFN A;  5TGF A;  2AVX A;  3T4Q A;  3BFE A;  3O5Y A;  3DTK A;  4P87 A;  2HDR A;  1I2W A;  3OC2 A;  1S67 L;  2EX8 A;  1DY6 A;  3SS5 A;  3UN7 A;  3AGF A;  1IEL A;  4XT2 A;  3OOV A;  4HNB A;  3NJA A;  1WA9 A;  1JWP A;  4QWO A;  1TVF A;  3HUO A;  3T12 B;  4BJP A;  2W3D A;  3G35 A;  3LI9 A;  4OPZ A;  4UA7 A;  4OP8 A;  3ZVW A;  2Y79 A;  4L0L A;  3LIE A;  2HF6 A;  4WLA A;  5DTS A;  3PBR A;  2ZMA A;  3UDX A;  2HDQ A;  1MC0 A;  3V67 A;  4NEE D;  2BG1 A;  5FL3 A;  4LFU A;  4GOG A;  4NG2 A;  1OTI A;  3T4L A;  4OOM A;  2Y2M A;  2J8Y A;  4HBU A;  5FI6 A;  3NDE A;  1SKF A;  5EVI C;  3B47 A;  4P0M A;  3ITB A;  3UE0 A;  3CAX A;  3R7W B;  3IQA A;  3JYI A;  3S22 A;  4ETX A;  1WYB A;  4HH2 A;  4LGW A;  4B93 A;  1NLZ A;  5EOO A;  1MWT A;  1VHM A;  2Y2L A;  5E43 A;  4LV3 A;  2VEA A;  3MKE A;  3WWX A;  1K0K A;  3M2K A;  4UA6 A;  3IF6 A;  3N8L A;  3LR5 A;  5F83 A;  5A92 A;  2A24 B;  3BY8 A;  5L8M A;  1Y28 A;  1NXY A;  3CJM A;  1CI8 A;  5CTM A;  3WRT A;  4K0X A;  4R1G A;  2WGV A;  3FWL A;  4ZDX A;  3FPV A;  1W63 M;  3GR2 A;  2PHY A;  5DFX A;  4JF4 A;  2O9A A;  1S6R A;  4ZBE A;  2A24 A;  5EE8 A;  4WEJ A;  1ZC2 A;  3M6B A;  3HLF A;  3N4I A;  4MBF A;  4P6B A;  2I9V A;  5EM0 A;  3LO7 A;  4I3A A;  1NY0 A;  3C38 A;  3OCN A;  4OLG A;  2VGL M;  3NIA A;  1XJ6 A;  1W7F A;  4E3N A;  5E2E A;  1XJ4 A;  2KOI A;  3T4J A;  2KDK A;  3D9Y A;  3QNC A;  5DFY A;  3LI8 A;  3KSF A;  4KQD A;  2D01 A;  1YSQ A;  1YSP A;  3HBR A;  2IWB A;  1JWZ A;  5HAI A;  3UE1 A;  5DF7 A;  4U3T A;  1F5M A;  4N9K A;  5AJG A;  3OPR A;  2J3T D;  3ZDJ A;  3VP1 A;  3ZNT A;  1XKZ A;  1K4F A;  4GD8 A;  4KQR A;  3MR0 A;  1IOU A;  1GCE A;  4GHI A;  1TD5 A;  4LV1 A;  1LL8 A;  2PYR A;  3AGE A;  2XLN A;  2V2F F;  4WL9 A;  4NXE A;  2ZQ9 A;  5EFW A;  3L7H A;  3SH8 A;  3T4K A;  4QB8 A;  3CZD A;  3H7W A;  3VP2 A;  4X6T A;  2I72 A;  5FQ9 A;  1M40 A;  4GJ4 A;  3P98 A;  4KZ5 A;  5FA7 A;  3BEB A;  2L1M A;  1ES3 A;  4HH3 A;  4EXO A;  2ZL1 A;  1N9L A;  2NUT C;  4P6Z S;  5EPH A;  3C4P A;  3A3J A;  4BBT A;  2RCX A;  3UMD A;  4O7D A;  1L2S A;  3O86 A;  5DJU A;  2PRF A;  1BLC A;  3P7N A;  3ZQ5 A;  2ZC7 A;  2HP5 A;  3CWF A;  2VGJ A;  1KGF A;  2E8J A;  1D06 A;  5FQM A;  3BWL A;  5F5Y A;  3BY9 A;  3IBR A;  4X68 A;  1XX2 A;  3NCK A;  4CLC B;  1YLW A;  3MJQ A;  1LL9 A;  4EQ1 A;  2HV1 A;  4ZJ2 A;  3K3D A;  1G28 A;  4Y17 A;  2K7S A;  4JPM A;  1EI5 A;  4JGR A;  4C3Q A;  4WYY A;  1VEU A;  3RJU A;  1K25 A;  1E25 A;  5CGW A;  4P85 A;  1E3U D;  2EX6 A;  1W5D A;  3HUM A;  4Q0I A;  4YFM A;  1GSV A;  2HP9 A;  2G7U A;  4G3K A;  3MQO A;  4FCF A;  5F68 A;  2JC7 A;  1MPL A;  3AGD A;  4HQA A;  4LRZ E;  3EGX C;  3QP8 A;  1ESI A;  4H6J A;  4OQH A;  3KSH A;  2W3E A;  3CPT B;  2QJ7 A;  2ZQ8 A;  3MKF A;  1T19 A;  4HJ6 A;  4O0P A;  4NXB A;  4N1X A;  1J3W A;  1JVJ A;  3JPU A;  3DW0 A;  2XEP A;  1F2K A;  4X25 A;  4X69 A;  4I38 A;  5MC7 A;  2WKR A;  3Q81 A;  1DJB A;  3CPT A;  5HDS A;  3IHB A;  4CJN A;  4HOI A;  1ES2 A;  5FEF A;  4UAA A;  3TW8 A;  1PFL A;  2WKI A;  2JKF A;  3DTE A;  1KGE A;  4BL3 A;  3GDI A;  4PMA A;  2XK1 A;  3NOT C;  3PBN A;  4R3J A;  1YAX A;  4KZ6 A;  4EU0 A;  3OPL A;  3SW1 A;  3HVF A;  4ESP A;  3MFX A;  3IS2 B;  4QJG A;  3BQA A;  2C6W B;  4X55 A;  3OPH A;  4K0W A;  5CGS A;  2QPN A;  5HD5 A;  2XR0 A;  3GRJ A;  1GSW A;  4BBU A;  2HZ5 A;  4Z9Q A;  1YLZ A;  4X56 A;  3C7U A;  1I2S A;  3NEC A;  1MWU A;  2J9O A;  3LEQ A;  4MEZ A;  3D4F A;  4S2N A;  1IYP A;  3D3O A;  4EBP A;  4EWF A;  1IFQ A;  2GX5 A;  3V3S A;  2PD7 A;  2ZJ9 A;  5HSQ A;  2IWD A;  5CHJ A;  1ES4 A;  3SZT A;  3T4O A;  1YMX A;  1M6K A;  4DXC A;  3ZHH A;  3D72 A;  4U0T A;  4DJ2 A;  3VP4 A;  1WYC A;  4WMC D;  3RXX A;  2J3W A;  5I94 A;  5L09 A;  1UWN X;  4BMW A;  2PR6 A;  3QNB A;  4QU3 A;  4FH4 A;  4WUJ A;  1K55 A;  3IF6 C;  2V20 A;  5CED A;  1EWZ A;  5L2F A;  3NOU C;  5HWT A;  2Z2L B;  4FOF A;  4S2I A;  3G30 A;  3PXP A;  3G6O A;  3M2J A;  5G18 A;  4Q8I A;  3WRZ A;  2JE5 A;  3DWK A;  4FSF A;  2ACG A;  4OVD A;  1KOU A;  3QP2 A;  3OCL A;  1PWD A;  2PDR A;  3S4X A;  4Q0J A;  1NJ4 A;  5HDD A;  5CHU A;  4S2O A;  5CHM A;  2EX9 A;  1ALQ A;  3K2N A;  3NUL A;  1FCN A;  1N9B A;  4E3L A;  3F1O B;  5HFO A;  5GLB A;  4MN6 A;  1TF1 A;  1H8Z A;  1SKO A;  4NET A;  1BSG A;  1Q2P A;  1LSW A;  1QMF A;  4CLC D;  3C5A A;  3S7P A;  4PKY A;  5G4Z A;  4PAU A;  3FKW A;  5FAP A;  4GZB A;  1T18 A;  4PM8 A;  4S2L A;  5DTT A;  3ULF A;  3FYZ A;  1ERM A;  3T4T A;  4Y0U A;  5TJJ A;  1XA1 A;  3MBZ A;  5FAT A;  4Y2F A;  5F6A A;  2Z6D A;  3BFG A;  2WAD A;  3CI6 A;  3KYQ A;  3OBF A;  4LLO B;  1NYM A;  4XXR A;  1BYW A;  4EV4 A;  2PR5 A;  5A8B A;  5TBM A;  3IF5 A;  3LY4 A;  2P9V A;  2ZM2 A;  3TG9 A;  3PHY A;  3K3C A;  3Q7V B;  2Z2M B;  4B4Z A;  1T1A A;  3TSG A;  4FUW A;  1DP8 A;  2PAV P;  1D7E A;  3C30 A;  4S2K A;  2OSU A;  1YPR A;  4L9E A;  4E3M A;  2ZM8 A;  3VSL A;  1OJ5 A;  1VET B;  1KE3 A;  1G6A A;  2JKG A;  2EXB A;  2O0Y A; 
#chains in the Genus database with same CATH homology
 1W7F A;  4C75 A;  3ISG A;  2Y2O A;  4E3N A;  5E2E A;  1AXB A;  1Q2Q A;  4R23 A;  3QNC A;  1PW1 A;  2FFF B;  1LL5 A;  3HBR A;  2H0Y A;  2IWB A;  4EQI A;  1JWZ A;  2JBF A;  5HAI A;  1FCM A;  3UE1 A;  5DF7 A;  5FAS A;  4OOY A;  4U3T A;  3ZVT A;  3ITA A;  2XH9 A;  4N9K A;  4NK3 A;  4DF6 A;  3PBQ A;  4WBG A;  3OPR A;  3P09 A;  2H10 A;  2G2U A;  2DNS A;  3IHA A;  1K6S A;  3ZDJ A;  5F1F A;  1JTD A;  3VP1 A;  3GSG A;  4IBR A;  2GDN A;  1K54 A;  2CC1 A;  3ZNT A;  3V5M A;  5DF8 A;  5A90 A;  1XKZ A;  5CRF A;  2Y2Q A;  3ZFZ A;  4HES A;  1K4F A;  4GD8 A;  3HLE A;  4KQR A;  3G2Y A;  4GD6 A;  3G34 A;  4GDB A;  2H5S A;  2PU4 A;  3WS0 A;  1GCE A;  1W8Y A;  1YQS A;  4S2P A;  1XGJ A;  4WZ4 A;  1BT5 A;  4XUX A;  1YLP A;  1MXO A;  4KG2 A;  4JKT A;  1XP4 A;  4LV1 A;  4YIN A;  1YT4 A;  2H0T A;  1PZO A;  1RP5 A;  4BEN A;  1FSW A;  1GHM A;  3B3X A;  4QHC A;  5HL1 A;  3AGE A;  2XFT A;  2XLN A;  1MY8 A;  3EQU A;  2V2F F;  4EBN A;  2FFY A;  1ZKJ A;  5E2H A;  2ZQ9 A;  3WS1 A;  5CXW A;  5A93 A;  4Y7P A;  2PU2 A;  5A91 A;  3IH9 A;  4DKI A;  1MWS A;  4RYE A;  5GLC A;  3SH8 A;  3LY3 A;  4B4X A;  2Y2J A;  3A3F A;  3HLW A;  3IXD A;  4DRT A;  4LCM A;  1BLH A;  1MWR A;  4QB8 A;  3CZD A;  5GHZ A;  1GA9 A;  3VP2 A;  4BL2 A;  4DDS A;  4X6T A;  2I72 A;  5FQ9 A;  2R9W A;  1E3U A;  4OKP A;  1H8Y A;  5HAQ A;  1M40 A;  3GTC A;  3E2K A;  3P98 A;  4KZ5 A;  5FA7 A;  1K57 C;  1XPB A;  3O87 A;  2HDU A;  3BEB A;  2ZQA A;  1VQQ A;  1ES3 A;  1K4E A;  2VGK A;  1PWG A;  3HLB A;  1CEF A;  2C5W B;  4N1H A;  3V50 A;  1G68 A;  2RL3 A;  3G31 A;  5FAQ A;  5EPH A;  3UPN A;  3C4P A;  3A3J A;  1SDE A;  2RCX A;  4KZ4 A;  3UDF A;  4O7D A;  1HTZ A;  1BZA A;  4KZ9 A;  2V1Z A;  4XUZ A;  1XGI A;  1L2S A;  2ZLY A;  3O86 A;  1PIO A;  4OQ0 A;  4WM9 A;  1IYQ A;  1YLY A;  2ZC6 B;  1BLC A;  4OOL A;  4KZB A;  5AQ9 A;  1KVM A;  2ZC7 A;  4BD1 A;  1ZG6 A;  2HP5 A;  5DVA A;  2ZQD A;  4E6X A;  2VGJ A;  3V39 A;  5FDH A;  1KDS A;  4GKU A;  1SDN A;  1KGF A;  4WZ5 C;  2XF3 A;  1CEG A;  4GN2 A;  4JXS A;  5E2F A;  1RCJ A;  5E2G A;  3NC8 A;  1JWV A;  2WAE A;  5FQM A;  2QMI A;  4D2O A;  3VOY A;  4BD0 A;  4MBH A;  3LEZ A;  1NZO A;  4OP5 A;  3HLC A;  4MNR A;  4DE0 A;  2HP6 A;  4X68 A;  1XX2 A;  3HL9 A;  3Q7Z A;  2ZC3 B;  5D3O A;  4E3O A;  3NCK A;  1YLW A;  1LL9 A;  5M19 A;  3Q7V A;  1KE0 A;  4MBK A;  3WS4 A;  4ZJ2 A;  5JYO A;  2J9P A;  4ZAM A;  3VFH A;  1XA7 A;  3EQV A;  3N8R A;  5FQK A;  5KSH A;  3MZE A;  2ZD8 A;  1S0W A;  2Y2G A;  4IBX A;  2J7V A;  1K38 A;  1WE4 A;  3CMZ A;  4JPM A;  1C3B A;  1EI5 A;  3BLM A;  4KZA A;  4C3Q A;  1XXM A;  4KG6 A;  3NI9 A;  1IEM A;  4N9L A;  1PYY A;  3ZGA B;  1IYO A;  4WYY A;  3IWQ A;  3VOZ A;  3BRM A;  1YLJ A;  1K25 A;  1K57 A;  1E25 A;  3FZC A;  4OLD A;  5CGW A;  3RJU A;  1DJA A;  4P85 A;  4OON A;  3ZG7 B;  4Y0T A;  1E3U D;  2EFX A;  2EX6 A;  2WZX A;  5IHV A;  1KVL A;  1ZG4 A;  4IVI A;  1JTG A;  1W5D A;  2QZ6 A;  4JXV A;  3UE3 A;  3IH8 A;  4OH0 A;  3HUM A;  2E8I A;  4M3K A;  4BQM A;  1YLT A;  2Y2N A;  2WK0 A;  2ZQC A;  4QY6 A;  4YFM A;  4R4S A;  3C7V A;  4RX2 A;  2HP9 A;  1CK3 A;  5KMW A;  4FCF A;  5TR7 A;  3MFD A;  4IED A;  2JC7 A;  1MPL A;  3AGD A;  3E2L A;  2XGN A;  1GA0 A;  4OQI A;  1ESI A;  3LCE A;  3Q1F A;  3DTM A;  1L0E A;  2OLU A;  3IXH A;  4LCL A;  3O3V A;  4WZ5 A;  5AQB A;  2EFU A;  1U60 A;  4OQH A;  3UY6 A;  2Y2P A;  1PW8 A;  1ONH A;  2ZQ8 A;  1KDW A;  1DJC A;  3MKF A;  3C4O A;  1PWC A;  5CEC A;  5HAP A;  5HW3 A;  4N1X A;  3M6H A;  1NZU A;  4KEN B;  4KZ8 A;  5GLD A;  2EX2 A;  2WAF A;  1JVJ A;  5CEB A;  2ZM0 A;  3DW0 A;  2XEP A;  1Z6F A;  1FOF A;  4QD4 A;  1Y54 A;  3IWO A;  4HBT A;  1E4D A;  4Y0O A;  4FD8 A;  4X69 A;  2DRW A;  4S2N C;  3ZG8 B;  1HZO A;  4N92 A;  1BLS A;  5FQQ A;  2JCH A;  3N7W A;  4OPQ A;  3MXR A;  5EVI D;  3Q81 A;  3G32 A;  3PBS A;  1DJB A;  4OQG A;  5F82 A;  5GLA A;  1N4O A;  4CJN A;  1QME A;  3IHB A;  3BYD A;  5HX9 A;  1ES2 A;  4RA7 A;  5FQJ A;  4PPR A;  4UAA A;  3G2Z A;  1KGG A;  1NYY A;  3OZH A;  4JLF A;  4WMC A;  5BOH A;  2WKI A;  4GNU A;  4ZJ1 A;  4R3B A;  2WKE A;  3BLS A;  3GV9 A;  4PM6 A;  1KGE A;  1OME A;  4PM7 A;  4X53 A;  3VMA A;  4BL3 A;  3UPO A;  3HRE A;  3TOI A;  4PMA A;  1PI4 A;  3IF6 B;  2XK1 A;  2HPB A;  3PBN A;  4OPR A;  3IXB A;  2DCF A;  4KZ6 A;  3CG5 A;  4R3J A;  5CER A;  3ZG0 A;  3OPL A;  3OPP A;  1J9M A;  3HVF A;  1FQG A;  4GDN A;  3HUN A;  3PAE A;  4MLL A;  2Y91 A;  3PBO A;  2WGW B;  4S2J A;  5DTK A;  2Y2I A;  4E3J A;  3ZCZ A;  1L0F A;  1K55 C;  2Y59 A;  2ZQ7 A;  3UNW A;  4QJG A;  2P9V B;  2WUQ A;  2Y2K A;  1PZP A;  3HLD A;  2WKH A;  2C6W B;  4X55 A;  4BLM A;  3OPH A;  1BTL A;  5JYP A;  2XQZ A;  3MZD A;  4K0W A;  2Q9M A;  4JBF A;  3GQZ A;  5F1G A;  1BUL A;  4PM9 A;  5CGS A;  3UO9 A;  2QPN A;  1K56 A;  4ZTK A;  2XD1 A;  1HVB A;  5GHY A;  1LI9 A;  1IKI A;  1K6R A;  1ES5 A;  3N6I A;  2XR0 A;  3I7J A;  4A5R A;  3GRJ A;  4KQO A;  3MXS A;  2A3U A;  3IXG A;  3O88 A;  1YM1 A;  2WGW A;  3HLG A;  4Z9Q A;  1LLB A;  5KSC A;  1YLZ A;  2BLS A;  4X56 A;  3C7U A;  1I2S A;  3V3R A;  3NBL A;  1MWU A;  2J9O A;  3W4Q A;  1GHI A;  3BEC A;  3W4O A;  2WGI A;  1I5Q A;  5EEC A;  5TGF A;  2PBY A;  3BFE A;  4MEZ A;  3D4F A;  4S2N A;  1IYP A;  4PM5 A;  1YMS A;  4P87 A;  1CI9 A;  4JF5 A;  1HD8 A;  3UDI A;  4EBP A;  4EWF A;  2HDR A;  3BFD A;  1I2W A;  3V3S A;  3OC2 A;  5M18 A;  2HDS A;  5DF9 A;  4E6W A;  1TDG A;  3QHY A;  2ZJ9 A;  4KG5 A;  2IWD A;  1IKG A;  4LV2 A;  1ES4 A;  5CHJ A;  1TEM A;  4R0Q A;  4RVA A;  4UA9 A;  4ID4 A;  2EX8 A;  1SHV A;  5FQI A;  4EUZ A;  3ZG9 B;  1DY6 A;  1YMX A;  3SS4 A;  1M6K A;  4KQQ A;  3SS5 A;  1H5X A;  3UN7 A;  4CPK A;  4DXC A;  5TFQ A;  3ZHH A;  1ERO A;  2IWC A;  4K91 A;  4U0T A;  3AGF A;  1BUE A;  1IEL A;  5AQA A;  3SOI A;  1WYC A;  3VP4 A;  4WMC D;  5EOE A;  5FSR A;  5CGX A;  3RXX A;  3WS2 A;  3A3E A;  5I94 A;  1JWP A;  3A3D A;  1TVF A;  1ONG A;  5GHX A;  3HUO A;  4LV0 A;  3QNB A;  4QU3 A;  4FH4 A;  5M1A A;  4BJP A;  2A49 A;  3G35 A;  4OPZ A;  4UA7 A;  5HAR A;  1K55 A;  2X02 A;  2P74 A;  2Y55 A;  4OP8 A;  4S2M A;  3ZVW A;  3NY4 A;  3IF6 C;  4L0L A;  2OV5 A;  2Q9N A;  1MBL A;  2V20 A;  5CED A;  1MKI A;  1ESU A;  1EWZ A;  5L2F A;  3N8S A;  2Z2L B;  5DTS A;  4S2I A;  3ZNY A;  3PBR A;  2ZMA A;  3UDX A;  2HDQ A;  3G30 A;  2XFS A;  4QY5 A;  3M2J A;  4EBL A;  1NRF A;  1O7E A;  5G18 A;  2UWX A;  4FH2 A;  2BG1 A;  2XD5 A;  4Q8I A;  3WRZ A;  2JE5 A;  1K56 D;  4GOG A;  3DWK A;  5GL9 A;  3DWZ A;  1RGY A;  4FSF A;  5J8X A;  4OOM A;  3W4P A;  4KZ3 A;  1IYS A;  3MZF A;  4KZ7 A;  4UHU A;  4H8R A;  4OVD A;  3FV7 A;  2Y2M A;  3OCL A;  2J8Y A;  1PWD A;  3PAG A;  3S4X A;  3GMW A;  4HBU A;  5FI6 A;  3WS5 A;  4GB7 A;  3PTE A;  3A3I A;  3VSK A;  1BLP A;  3NDE A;  4JF6 A;  1NJ4 A;  1SKF A;  5CHU A;  5EVI C;  1GHP A;  4S2O A;  3G4P A;  4IVK A;  3PBT A;  1VM1 A;  5CHM A;  2EX9 A;  1ALQ A;  4DE2 A;  4P0M A;  3ITB A;  2X01 A;  3FKV A;  3BM6 A;  2Y2H A;  1FCN A;  1ERQ A;  1N9B A;  4E3L A;  5EVL A;  5HFO A;  5GLB A;  1FR1 A;  3UE0 A;  4WEL A;  4DE3 A;  4F94 A;  1H8Z A;  4NET A;  1BSG A;  1Q2P A;  4U0X A;  3IQA A;  1QMF A;  3JYI A;  2G2W A;  4ZJ3 A;  1LI0 A;  3S22 A;  3C5A A;  5U47 A;  3VFF A;  2ZC4 B;  1WYB A;  4B88 A;  5FI2 A;  4E3I A;  3FKW A;  2ZC5 B;  5FAP A;  3RXW A;  5EOO A;  4GZB A;  4JXG A;  1MWT A;  4PM8 A;  4S2L A;  5DTT A;  2Y2L A;  4LEN A;  3FYZ A;  1ERM A;  4LV3 A;  5E43 A;  4WEK A;  5AQ7 A;  5FAO A;  2WZZ A;  1FR6 A;  4DXB A;  3MKE A;  2OLV A;  4Y0U A;  3WWX A;  3UPP A;  1XA1 A;  3M2K A;  4JXW A;  4UA6 A;  3IF6 A;  3MBZ A;  3N8L A;  3S1Y A;  5FAT A;  1TDL A;  3IWI A;  4HEF A;  5F83 A;  5A92 A;  3BFG A;  1K54 C;  2WAD A;  4R4R A;  2EXA A;  3ZG5 A;  1NYM A;  5KZH A;  3Q07 A;  4XXR A;  3W8K A;  1NXY A;  3CJM A;  5EVI B;  1CI8 A;  3GVB A;  5CTM A;  4C6Y A;  4EV4 A;  3SH7 A;  1SCW A;  3WRT A;  4K0X A;  2B5R A;  4R1G A;  1LHY A;  3IF5 A;  3LY4 A;  2P9V A;  1FSY A;  2ZM2 A;  2WGV A;  3FWL A;  3TG9 A;  4ZDX A;  3Q7V B;  1L0G A;  1W79 A;  2Z2M B;  4B4Z A;  1RGZ A;  3Q82 A;  3TSG A;  1FCO A;  3GR2 A;  3SH9 A;  2XDM A;  4DDY A;  4JF4 A;  1S6R A;  3NDG A;  4ZBE A;  5EE8 A;  4WEJ A;  5EUA A;  1L0D A;  1ZC2 A;  4S2K A;  2OSU A;  2WYX A;  3M6B A;  3HLF A;  4E3M A;  5EVI A;  4E3K A;  3N4I A;  4MBF A;  2ZM8 A;  3VSL A;  3BFC A;  5CTN A;  4P6B A;  2R9X A;  3VP3 A;  3LO7 A;  1W8Q A;  5FI7 A;  1O07 A;  1KE3 A;  3VP0 A;  1G6A A;  1NY0 A;  2X71 A;  4OPY A;  3IT9 A;  3OCN A;  4OLG A;  1KE4 A;  1PI5 A;  4RX3 A;  2Y4A A;  3NIA A;  4DE1 A;  3BFF A;  2EXB A;  3SS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...