1NXYA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (sm2)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Recognition and Resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 100
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nxyA00
4WM9A 3UDFA 4R4SA 5CGWA 2ZC5B 2Y4AA 3D4FA 2Y2NA 4EQIA 4ZAMA 1W5DA 2HDQA 3HL9A 4DE0A 2VGKA 4DXBA 4GDBA 4LV1A 2C5WB 2XFSA 3OC2A 5GLDA 3NI9A 5HW3A 2X02A 4EWFA 1GHIA 1KGGA 4FH2A 5EECA 3AGFA 4PM5A 3BFGA 3BLMA 2H10A 3PBOA 2WADA 1YLYA 3HLWA 3NDEA 4MBHA 2J7VA 5CHMA 4JLFA 1I2WA 4OPYA 4WEJA 2HDRA 1ES4A 2Y2MA 1I5QA 4JXSA 3FYZA 4PM8A 2Y2PA 1H5XA 1HVBA 3IWQA 4WYYA 5CEBA 2RCXA 1KDSA 2Q9NA 3PBTA 4DF6A 5E2EA 4IVKA 3CJMA 4X6TA 3IHAA 1YLWA 2R9XA 1C3BA 5EOEA 2ZC7A 5GLAA 3UPNA 3C4PA 3MXSA 4GDNA 2OLVA 4P6BA 1ES2A 3G4PA 3W4PA 1L0EA 2XK1A 1E3UD 3IWOA 3TSGA 5GHXA 1SCWA 1SHVA 1IELA 1FSWA 3IH9A 1SDNA 3ZG7B 5FSRA 4QY5A 4BL2A 3BLSA 1ALQA 1KDWA 3IHBA 4PM9A 4WELA 4BD0A 5KSHA 2V1ZA 4GNUA 5M18A 3IF6B 4RX2A 2OV5A 4HBTA 3C4OA 1G68A 3Q1FA 3BECA 4X55A 1NXYA 1EI5A 4N92A 4S2NC 3W4QA 1FQGA 1IYQA 4IBRA 5EVLA 5EPHA 5GLBA 1IYSA 4XUXA 2A49A 1ESUA 3JYIA 4S2MA 4K0XA 1K6SA 1LI9A 2WKEA 4DE3A 2ZD8A 3GR2A 4MEZA 2Y55A 4U0XA 4X68A 1YLJA 3AGEA 5A92A 1L2SA 3WS1A 3G2YA 5FI6A 1KGFA 5I94A 4OPZA 2DCFA 1QMEA 3TOIA 2ZQDA 4O7DA 3G30A 1IYPA 3C7UA 3NIAA 4WZ4A 4JXVA 4E3NA 3RXXA 1CEFA 3IXHA 4KQOA 2UWXA 4M3KA 1FR1A 3QNCA 1YLZA 2QPNA 2XF3A 5JYPA 4X53A 3NDGA 1ES5A 1KVLA 1OMEA 1W7FA 1K54C 3HLBA 3WS2A 1JTDA 1PI4A 2IWCA 4RA7A 4RYEA 1K55C 3PBNA 4KZ3A 4BJPA 1IYOA 3Q81A 1SKFA 5F83A 3UDXA 1PI5A 3SS3A 3UN7A 3I7JA 3V50A 2E8IA 4WBGA 4WMCD 5FQIA 1BT5A 1I2SA 1K4EA 4JPMA 1ZG4A 4UA7A 1YLPA 2HP9A 2WYXA 3FZCA 1RCJA 3WRZA 3N8LA 3FKWA 5E2FA 3OCNA 4E3JA 2FFFB 4GOGA 4HEFA 1YQSA 3HUMA 4C75A 1WYBA 2HPBA 4XXRA 2WK0A 4FSFA 1ZC2A 4Z9QA 1JTGA 1Q2QA 1RGZA 2P9VB 1KE0A 5M19A 1MXOA 5CGSA 1DJAA 1KE3A 3E2LA 2ZC3B 2EX8A 2Y2OA 3VP3A 1BLPA 3UY6A 4EUZA 2ZQ8A 3HUOA 4GB7A 5EVID 3OPHA 4R4RA 5BOHA 3ZVTA 1W8YA 3MFDA 1GHPA 4S2NA 1QMFA 4U3TA 3VOZA 3ZCZA 4KQQA 3GQZA 5FI7A 2FFYA 1S0WA 3B3XA 1XKZA 5FAOA 4KZ5A 3ISGA 1NJ4A 1MWUA 3NBLA 3WS5A 2G2UA 1BULA 3BFDA 3HLCA 4HESA 4BD1A 3LY4A 2GDNA 3PBRA 5DTTA 3LO7A 1YLTA 2WGIA 4S2PA 3ITBA 5FI2A 1TEMA 4B88A 3IT9A 3OPRA 3ZG9B 5AQ7A 1TDLA 3N7WA 3VP2A 1XGJA 3ZVWA 1FSYA 5U47A 3G2ZA 1CI8A 5IHVA 1E3UA 1FCNA 1XXMA 2V2FF 4KQRA 2Y2QA 2P9VA 5KSCA 3LEZA 3IF6C 4ZJ3A 3VP0A 4ZDXA 4KG6A 3N8RA 4Q8IA 1XA1A 3V3SA 1K54A 3P09A 1GA9A 3VP1A 4GD6A 1K6RA 5KMWA 1Z6FA 1PIOA 2EXAA 2Y2HA 1K55A 3MZEA 4L0LA 4KZ6A 1YM1A 3FKVA 4MNRA 4OQGA 1ZKJA 2QZ6A 4GN2A 5DTKA 4BL3A 3MKFA 2XH9A 1WE4A 2CC1A 4P0MA 1MWSA 3A3DA 3LY3A 4UA9A 5FAQA 3HLGA 4UAAA 3ZNTA 4JKTA 4D2OA 3MKEA 5HX9A 4BENA 3IXBA 4Y0TA 1RGYA 4DKIA 5CGXA 5TFQA 1FR6A 4E3LA 4EBPA 3QNBA 5HARA 3ZG0A 3VSKA 3IQAA 5CRFA 4R1GA 3IH8A 1EROA 3O87A 4OOYA 4U0TA 3ZG8B 4QHCA 1N4OA 3WRTA 5FA7A 5GLCA 1U60A 5E43A 4LCMA 3V5MA 1IKIA 4DE2A 4QU3A 3EQUA 1K25A 1NRFA 3WS4A 4BLMA 4OP8A 2WKHA 5EOOA 2PBYA 1MWTA 3UPPA 2XDMA 2EX2A 3HLFA 2Z2MB 3IXGA 5EVIB 2ZQ7A 5HAIA 1O07A 3HBRA 3BFCA 1M40A 3SH7A 4LV2A 5J8XA 4K91A 5GHYA 4B4ZA 4H8RA 4LV3A 3HLEA 2Y2GA 4QJGA 1PW8A 2WGVA 3GSGA 2OLUA 4OONA 3WWXA 1YMXA 1K4FA 1HTZA 2QMIA 2WAEA 2XGNA 4QB8A 1CK3A 3PBQA 4KZ8A 5CECA 1KE4A 3MZDA 4PMAA 4WMCA 3CG5A 4GZBA 1JWPA 2G2WA 3SH8A 4X56A 1BLCA 1FOFA 5TR7A 4EBLA 1BSGA 3IF6A 3WS0A 2ZM0A 5DVAA 4DRTA 1K38A 3DTMA 1DJBA 4DDYA 1XGIA 3UDIA 1K56D 3ZG5A 5M1AA 3VSLA 3CZDA 3BYDA 5CHUA 1JVJA 1W8QA 4S2OA 3TG9A 3V39A 1L0FA 3C7VA 1DY6A 2DRWA 2WZXA 5FQQA 1VQQA 4Y0UA 1M6KA 4GD8A 4OQIA 3UO9A 1KVMA 5FQ9A 2ZQAA 5EVIA 2BLSA 2R9WA 2XD5A 4E3OA 4LV0A 3UE3A 4XUZA 1PZPA 3HVFA 4IBXA 3PAEA 4A5RA 4JBFA 2V20A 4MLLA 3UNWA 1IEMA 1XA7A 3S4XA 2XQZA 2JBFA 4N9KA 4JXWA 1PYYA 3Q07A 3HLDA 4R3BA 4S2IA 3ZDJA 3VP4A 4PPRA 3DWKA 2ZLYA 5E2GA 3N8SA 3G35A 5FQKA 3G32A 5F1GA 2ZM2A 1AXBA 2XR0A 1NY0A 4KZBA 4P87A 1LLBA 3BFEA 4E6WA 1E25A 4EBNA 3CMZA 3GTCA 4OVDA 3VMAA 3BM6A 4C3QA 2JE5A 4OH0A 1BTLA 4LENA 2IWBA 3BFFA 5FQMA 3ZGAB 3O3VA 2HP5A 2Y91A 2DNSA 4R23A 4Y7PA 3Q7VB 3N4IA 4UA6A 4E3KA 5CHJA 3O86A 1EWZA 2EX6A 3HREA 4R3JA 3FV7A 1XX2A 1LHYA 4KG5A 5D3OA 5CTMA 1IKGA 2H0YA 4CJNA 4OPQA 4MBKA 5A91A 4C6YA 5CXWA 2WZZA 1G6AA 2XEPA 1LI0A 1KGEA 3IWIA 4OP5A 1L0GA 5AQBA 3NY4A 4E3IA 4NK3A 4JF4A 5FATA 4MBFA 4OOLA 2BG1A 3BEBA 1H8ZA 1LL5A 2X01A 3O88A 1FCMA 1XP4A 4GKUA 1MBLA 3OPLA 4DDSA 2B5RA 1YT4A 5EVIC 5EE8A 4RX3A 3UE1A 4DE1A 3IF5A 1FCOA 3M6HA 1TVFA 2XFTA 3G34A 4S2JA 5HAQA 4CPKA 4RVAA 2ZM8A 4N1HA 1CEGA 1J9MA 4JF5A 3N6IA 2XLNA 1BZAA 5HFOA 4OKPA 1BUEA 1ERQA 2I72A 2Y2JA 3Q7VA 4LCLA 4QY6A 3W8KA 4WZ5C 4OQHA 3A3JA 4WEKA 5E2HA 2JCHA 1HZOA 1SDEA 2EFUA 1DJCA 1NYMA 4OQ0A 4ZJ2A 2ZQCA 1CI9A 1E4DA 2J9PA 2WUQA 3BRMA 4FD8A 3SS4A 3S22A 5KZHA 1K57C 5GHZA 1ONGA 4KG2A 2OSUA 1GHMA 2J8YA 2Y59A 2HDSA 3M2JA 4OPRA 2X71A 3GVBA 1Y54A 3OPPA 2Q9MA 4Y0OA 5CTNA 1PWCA 3ZNYA 5HAPA 5CERA 3FWLA 4S2LA 1ONHA 3C5AA 4HBUA 4N9LA 2PU4A 5CEDA 4PM7A 4JXGA 2A3UA 3ZFZA 3M2KA 3A3IA 3DW0A 1K56A 3NC8A 4E3MA 3NCKA 4ZTKA 3S1YA 4F94A 2ZJ9A 4R0QA 3GRJA 4JF6A 3Q7ZA 2EX9A 3P98A 2J9OA 3GV9A 3A3EA 3LCEA 2HDUA 1H8YA 3SOIA 3ZHHA 3PBSA 1MPLA 4S2KA 3RXWA 3AGDA 1ESIA 1L0DA 5EUAA 1ES3A 4IEDA 1RP5A 3QHYA 5FQJA 1WYCA 3GMWA 5G18A 1W79A 3UE0A 3IXDA 5DF9A 3VFHA 2HP6A 5JYOA 4KZ4A 1Q2PA 2C6WB 2RL3A 2IWDA 4PM6A 4OOMA 3PTEA 3Q82A 3MXRA 1GA0A 3HUNA 3W4OA 1BLSA 1PZOA 3OCLA 5A93A 1MY8A 3VFFA 2P74A 1JWVA 2H0TA 4K0WA 5L2FA 1NYYA 3G31A 1NZOA 3DWZA 1GCEA 5DTSA 4N1XA 4YINA 5DF7A 3SH9A 2WGWB 3VOYA 4UHUA 2Y2IA 3ITAA 4NETA 1ERMA 1PWGA 2JC7A 4QD4A 1VM1A 4FH4A 3V3RA 2VGJA 5HL1A 2PU2A 1HD8A 5FASA 4DXCA 1N9BA 4IVIA 5DF8A 4KZAA 4WZ5A 4FCFA 2ZQ9A 2WKIA 1MKIA 4KENB 3MZFA 1PW1A 5AQ9A 3E2KA 4OLGA 5GL9A 1JWZA 2EXBA 4OLDA 4ZJ1A 2ZMAA 2XD1A 1LL9A 4KZ7A 1K57A 1NZUA 5A90A 2Y2LA 2WAFA 3EQVA 3M6BA 5F82A 4X69A 3SS5A 2ZC6B 1TDGA 3UPOA 3PAGA 5F1FA 1XPBA 1O7EA 4YFMA 2Z2LB 4ZBEA 5TGFA 3MBZA 3RJUA 1YMSA 4ID4A 4P85A 4E6XA 5AQAA 1MWRA 1S6RA 1ZG6A 4B4XA 4BQMA 1BLHA 2Y2KA 3OZHA 5FAPA 2H5SA 1PWDA 5FDHA 2ZC4B 4KZ9A 4EV4A 2WGWA 2EFXA 3A3FA
chains in the Genus database with same CATH superfamily
4WM9A 3UDFA 2Y2NA 2EA9A 5MC7A 2VGKA 4DXBA 1YKDA 2C5WB 3OC2A 5GLDA 5HW3A 2PT7A 1GHIA 4HHDA 3AGFA 2H10A 3K3DA 2J7VA 3PXPA 5CHMA 4MN7A 2Y2MA 2GX5A 1P97A 3FYZA 1H5XA 3IWQA 2NUPC 1KDSA 4DF6A 3IHAA 5EOEA 4CLCD 3P7NA 2XK1A 5HWVA 1IELA 1MC0A 1SDNA 3ZG7B 5FSRA 4BL2A 1ALQA 3IHBA 2QJ5A 4WELA 2H28A 1T1AA 3IF6B 1SZVA 4HBTA 1G68A 3BECA 4X55A 1NXYA 1EI5A 3PYPA 1FQGA 1IYQA 3VOLA 4I3AA 3KSGA 2XSSA 4FUWA 1T1CA 2NUTC 2JN7A 1K0KA 3F1PA 3JYIA 4S2MA 2ZD8A 2Y55A 4U0XA 3AGEA 5A92A 3WS1A 3G2YA 1KGFA 4UQIM 3TOIA 2ZQDA 4WZ4A 4JXVA 2PR6A 4M3KA 1FR1A 4F3LA 1YLZA 2GZAA 3SZTA 2XF3A 5TBMA 5JYPA 4X53A 1W7FA 3HLBA 1P0ZA 4BJPA 4G3WA 3BY9A 3IBJA 1GSXA 2QHKA 3UN7A 4WBGA 4JPMA 1ZG4A 4UA7A 2WYXA 5FEGA 1GSWA 4E3JA 1OTIA 2WK0A 1RGZA 2P9VB 5M19A 2W3HA 1DJAA 3F1NA 4LRZE 3ZVTA 1GHPA 2L4RA 3ZCZA 5FI7A 5FAOA 4KZ5A 2DMWA 2G2UA 3BFDA 4BD1A 3QP6A 3PBRA 3LO7A 1VETB 3ITBA 4B88A 4LRYC 3DTKA 3PR6A 1TDLA 3N7WA 1CI8A 5IHVA 1FCNA 1XXMA 3OBFA 5KSCA 3IF6C 4EERA 4ZJ3A 3GDIA 4KG6A 1GA9A 1K6RA 1Z6FA 2EXAA 2Y2HA 4MNRA 5DTKA 3KYEA 2XH9A 2CC1A 4UA9A 3E98A 4JKTA 4D2OA 1KOUA 1NRJA 2KDKA 3IXBA 2LB9A 1NWZA 5TFQA 3ZG0A 3IH8A 1EROA 2W3FA 3ZG8B 4JGRA 4FTXA 4LCMA 1GSVA 4BBTA 4BLMA 2XDMA 3IXGA 5EVIB 2ZQ7A 3LR3A 1P9WA 1LSXA 4K91A 3HLEA 3EGXC 3OOVA 4QJGA 1PFLA 1OTAA 2XGNA 1CK3A 1TD5A 4KUKA 5HL6A 1OTDA 1VEUA 4GZBA 3S7NA 2B02A 4NXGA 5J7EA 3DTMA 1DJBA 1XGIA 5DJTA 4S2OA 3V39A 5L07A 5EFWA 3C7VA 5FQQA 4Y0UA 4GD8A 4OQIA 3A0SA 2XD5A 3LUQA 1PZPA 4IBXA 3E4QA 3C30A 1XA7A 2PYPA 3QP5A 1LSVA 4JXWA 1F5MA 4G3VA 3DTIA 5E2GA 3CUEA 4KZBA 5F68A 1LLBA 2ZMVA 4NG2A 3UMDA 4OH0A 5HWWA 2HJ9C 4LPZA 3Q7VB 3O86A 3HREA 2E8JA 4Y5FA 4MBKA 4C6YA 5CXWA 5HZHA 1L0GA 5AQBA 4BMWA 3NY4A 4E3IA 4UQIS 4AFIA 5FATA 2BG1A 3BEBA 3LIEA 2JKFA 4HJ4A 1XP4A 3FPVA 5EVIC 4DE1A 4KQDA 3G34A 3UE6A 4S2JA 2J80A 3P01A 4JF5A 4Q0IA 4BBUA 4LCLA 2I72A 4HNBA 4PKYA 4WZ5C 4OQHA 1PRQA 2JCHA 2EFUA 3EEHA 1NYMA 3LEQA 1S4SA 4FD8A 1GHMA 4OPRA 3IX8A 1NLZA 2Q9MA 4Y0OA 3W2ZA 3ZNYA 3C5AA 4HBUA 5CEDA 4JXGA 5TJJA 3A3IA 4E3MA 4ZTKA 1L3LA 4R0QA 2PD8A 3MSHA 4JF6A 3GV9A 2HDUA 3SOIA 2O9BA 3U4LP 4H6JA 3EWKA 2V0WA 3QHYA 4DDYA 3MS6A 3GMWA 4LRXC 3VFHA 3IXDA 4YWZA 5LBRA 4I39A 1DRMA 2C6WB 2RL3A 4OOMA 3PTEA 1F2KA 3KSIA 3MXRA 1GA0A 3HUNA 4GCZA 3H82B 3OCLA 5F69A 4XT2A 4YNRA 3G31A 1HLUP 4NKPA 5DTSA 2WGWB 4GHIA 2OAQ1 4K08A 5HL1A 2PU2A 1HD8A 3R4KA 2WKRA 4KENB 3MZFA 1TS7A 5FL3A 1EW0A 4KZ7A 1K57A 5A90A 2WAFA 3EQVA 5F82A 2R78A 1TDGA 3PAGA 5F1FA 3UB5P 2Z2LB 3RJUA 4DJ3A 4ID4A 1MWRA 4BQMA 4B4XA 4CQHA 4WL9A 4KZ9A 1DP6A 5CGWA 5J3WA 2ZC5B 2Y4AA 4EQIA 4GDBA 4Y13A 3UB6A 3NI9A 2VZWA 4EW7A 2X02A 1KGGA 4PM5A 3PBOA 1XFQA 2VX8A 2WADA 3HLWA 3NDEA 1MKMA 2JKRM 1I2WA 2HDRA 4PM8A 1HVBA 5CEBA 2R9XA 3UPNA 3MFXA 2VV8A 3C4PA 1LSWA 2OLVA 2K2NA 4GDNA 4P6BA 3G4PA 3QP1A 1SHVA 3C2WA 3IH9A 3BLSA 1KDWA 4PM9A 4BD0A 2V1ZA 5G4YA 5M18A 4RX2A 4EUVA 2J3WA 4N92A 4PHTA 1CF0A 2WKQA 5GLBA 4XUXA 2A49A 3KSFA 1ESUA 4E04A 4K0XA 1K6SA 3GR2A 2VJWA 4X68A 1YLJA 5IU1A 4OPZA 4O7DA 3G30A 4LFUA 4CLCC 1IYPA 4E3NA 5HPFA 3RXXA 3IXHA 4KQOA 2HF6A 4B9OA 1AWIA 3NDGA 3VE3A 1K54C 4RYEA 4KZ3A 3Q81A 1PI5A 3SS3A 3V50A 5FQIA 3NECA 1YLPA 5E2FA 1YQSA 3HUMA 4Z9QA 5L09A 1KE0A 5HDDA 1KE3A 2VV6A 4P6ZM 2EX8A 2Y2OA 4EUZA 3HUOA 4S2NA 3VOZA 3JVVA 3T12B 3B3XA 1XKZA 3ISGA 1D06A 2Z6CA 3NBLA 3LYXA 3HLCA 1BULA 4JGPA 1T19A 3A0RA 4D60A 3IBRA 4X25A 4GJ4A 1TEMA 4HIAA 3OPRA 5AQ7A 1UWPX 3VP2A 4G3KA 3G2ZA 4KQRA 2Y2QA 2VA0A 2P9VA 3LEZA 2J3TD 2P04A 3E0YA 3VP0A 2P08A 1K55A 3MZEA 2MJ6A 4KZ6A 3B42A 3FKVA 1ZKJA 4EXOA 4P0MA 3A3DA 3LY3A 3D3OA 1Y28A 4WLAA 3T1SA 1FR6A 4E3LA 4IUHA 5HARA 3VSKA 3MR0A 1TS6A 1VETA 5CRFA 4OOYA 3WRTA 5FA7A 1XJ4A 5E43A 4UEYA 2GJ3A 4DE2A 1K25A 5A8BA 4HH3A 3WS4A 3ZYTA 4GLQA 2WKHA 1MWTA 2EX2A 2Z2MB 4Y2FA 2V0UA 2PD7A 3SH7A 3D72A 4LV2A 5J8XA 1PW8A 4EEUA 3E4PA 1XJ3A 2WAEA 4WN5A 2K31A 4KZ8A 5CECA 4PMAA 3CG5A 3KX0X 1J3WA 4BWIA 4DMZA 1YAXA 3CITA 4EBLA 1BSGA 3ZG5A 3CZDA 1TF1A 3DAVA 1OT6A 1L0FA 1IOUA 2WZXA 1IFQA 3UO9A 1KVMA 4HJ3A 5FQ9A 5EVIA 2BLSA 2JKTM 2KX6A 3C38A 3UE3A 2ZL1B 1H3QA 4MLLA 2V20A 2PBDP 4X1MA 3ZQ5A 5DJUA 4Q0JA 2XQZA 1S1YA 5L10A 2V1BA 3T4TA 4PPRA 2OWHA 2O99A 2PRFA 3G35A 5F1GA 1NY0A 3BFEA 1E25A 2JE5A 5HDCA 5HWTA 2IWBA 3ZGAB 3O3VA 2Y91A 2DNSA 4Y7PA 2HJEA 5EM0A 1EWZA 4GS9A 4KG5A 2H0YA 3FG8A 2XEPA 3IWIA 2QJ7A 5EVEA 4NK3A 4JF4A 1YPRA 2X01A 4GKUA 1MBLA 1YT4A 5EE8A 4O01A 1FCOA 3M6HA 1TVFA 2VK3A 4CPKA 3R7WB 2ZM8A 1J9MA 1H0MA 3N6IA 2XLNA 3HJIA 3F1PB 4LGWA 3HJKA 3T4LA 1ERQA 3Q7VA 5G4ZA 4ME4A 4OQ0A 4ZJ2A 2WUQA 3SS4A 5GHZA 2HDSA 3M2JA 4ARZB 4P6ZS 4S2LA 4HI4A 1OJGA 3ZFZA 2PYRA 3DW0A 3IX4A 1FILA 2ZJ9A 4HY8A 3F1OA 3P98A 4HH2A 3A3EA 1A0KA 1DP9A 4DJ2A 3TW8A 1MPLA 1W63Q 1L0DA 4IEDA 5G18A 2HP6A 5JYOA 4KZ4A 1PZOA 2I9VA 1MY8A 1JWVA 3S7PA 4Z1WA 4K0WA 2QKPA 3CAXA 3VOYA 2Y2IA 5HDSA 3KYQA 1YSQA 4DXCA 1N9BA 4KZAA 2YKHA 2ZQ9A 3BQ8A 1MKIA 3UMEA 5AQ9A 3E2KA 2KOIA 1JWZA 4OLDA 2XD1A 1OPXA 2A2LA 2XRNA 5AVEA 4ZRRA 2FZ0A 2LB5A 4ZBEA 3CHWP 1BLHA 2Y2KA 2H5SA 5FDHA 2ZC4B 3MJQA 3GECA 2WGWA 2EFXA 3A3FA 3LR5A 3HL9A 2XFSA 3BFGA 3BLMA 5DFYA 4B93A 1UGUA 4MDZA 5DKKA 4JLFA 4OPYA 4WEJA 3QP8A 4JXSA 2Y2PA 2RCXA 3PBTA 5E2EA 3U2AA 3CJMA 4X6TA 2ZC7A 3MXSA 1L0EA 3IWOA 1SCWA 1JNUA 3CWFA 1FSWA 1F98A 4QY5A 1G5UA 2W3GA 5KSHA 2VGLM 2VKSA 1V9ZA 4GNUA 4IJGA 3C4OA 3Q1FA 3W4QA 3L7HA 5EVLA 4PAUA 4HJ6A 3OLOA 4R3AA 3T50A 2WKEA 1S1ZA 5C5KA 2DCFA 2D02A 3C7UA 4NXEA 2L0WA 2UWXA 4I38A 5IT5A 1KVLA 1JTDA 2IWCA 1STZA 3LICA 5F83A 3LR4A 4NXFA 1BT5A 2HP9A 3FZCA 3N8LA 3O5YA 4GOGA 1DP8A 3KSHA 4HEFA 4CLCB 2AVXA 4XXRA 1Q2QA 5FDSA 5CGSA 2ZC3B 3UY6A 2ZQ8A 4GB7A 5EVID 5BOHA 1W8YA 1QMFA 2HV1A 4KQQA 1PNEA 3GQZA 2Y8HA 2PR5A 3IX3A 3EEAA 1MWUA 3H7WB 2M7UA 2GDNA 5DTTA 1YLTA 4S2PA 5FI2A 3T1RA 1X0OA 3IT9A 2XA7M 4R38A 5U47A 1E3UA 3HCYA 4ZDXA 3N8RA 3V3SA 4YOFA 2VEAA 4GD6A 4QWOA 3T4KA 3BW6A 1LT0A 4GN2A 4NXBA 3MKFA 1WE4A 1MWSA 5FAQA 3HLGA 3D9YA 4UAAA 3MKEA 5HX9A 4Y0TA 5CGXA 4EBPA 3E4OA 4H6JB 4U0TA 1UWNX 1U60A 3V5MA 3IS2B 4OP8A 3QP2A 5EOOA 3BY8A 5HAIA 3HBRA 4O8GA 2J3TC 2ZOIA 2BASA 2XROA 1VB6A 4WF0A 5GHYA 4H8RA 3GSGA 4OONA 2OLUA 1YMXA 1K4FA 1HTZA 1SKOB 3PBQA 1KE4A 3MZDA 4WMCA 1JWPA 4X56A 1FOFA 1FIKA 1TS8A 3IF6A 4EQ1A 3NHQA 4DRTA 1K38A 4I3IA 5M1AA 3VSLA 3MQOA 3BYDA 3MF0A 5CHUA 3TG9A 2PDRA 4X1LA 1DY6A 1VQQA 2HZ5A 2ZQAA 4KUOA 3HVFA 4A5RA 4JBFA 1N9LA 1IEMA 4R6LA 5DKLA 2JBFA 3BWLA 4O0PA 1NLYA 4R3BA 3VP4A 3DWKA 1XFNA 4I3JA 3G32A 2ZM2A 3LIFA 2V1AA 2VGLS 1ACFA 4P87A 4E6WA 3CMZA 4OVDA 4C3QA 3BM6A 3NULA 1BTLA 4LENA 3LIBA 5FQMA 2HP5A 4UA6A 5CHJA 2EX6A 3RH8B 2ZL1A 1LHYA 2Q0OA 5A91A 2WZZA 1G6AA 4OP5A 1KGEA 3QP4A 4RQ9A 1Y4OA 4OOLA 3K2NA 4Y3IA 1LL5A 1ODVA 1FCMA 3T4JA 3OPLA 4DDSA 2B5RA 1D1JA 3IF5A 2XFTA 5HAQA 4N1HA 1CEGA 3NOPC 3CPTB 1BZAA 3B47A 1ZHHB 2QYBA 5HFOA 4OKPA 4QY6A 5E2HA 1SDEA 2JKTI 1DJCA 4IHQA 1CI9A 3BRMA 3S22A 1N9NA 1K57C 1ONGA 2OSUA 2A24B 3LGOA 3OPPA 5CTNA 4EETB 2O9AA 1BYWA 1TS0A 5CERA 3FWLA 4PM7A 2A3UA 2L1MA 1K56A 3L9KA 4Y15A 1P9RA 5F6AA 3V67A 3NCKA 3FPWA 2FH5A 3R7WA 3NOUC 2J9OA 3LCEA 1H8YA 3PBSA 4R70A 1ESIA 2W1TB 3SW1A 1ES3A 1RP5A 1S4RA 1W79A 1ZTUA 3UE0A 5DF9A 2XA7S 2IWDA 4PM6A 4EU0A 1BLSA 5A93A 3LR0A 1H8MA 3DWZA 4ARZA 1GCEA 4N1XA 4EEPA 2KLIA 1G28A 2Y79A 2EWWA 1ERMA 1OTEA 1PWGA 4QD4A 2VGJA 2W1RA 3TJZC 5FASA 5DF8A 1G6OA 3MMHA 4WZ5A 2UV0E 2WKIA 2EXBA 4ZJ1A 3UB7A 2Y2LA 4Y17A 3T4QA 3SS5A 2ZC6B 1XPBA 3TE8A 1MZUA 5IS1A 3NOTC 3MBZA 5TGFA 4GW9A 4P85A 5AQAA 1ZG6A 5FAPA 1F9IA 2HGVA 4R4SA 3D4FA 1WA9A 4ZAMA 1W5DA 2HDQA 4DE0A 3T1QB 4LV1A 4EWFA 4FH2A 5EECA 2W3EA 1D7EA 3LI8A 1YLYA 4MBHA 2OOLA 2JKGA 1ES4A 1I5QA 4NEED 3KO6A 4WYYA 2O0YA 2Q9NA 3LI9A 4IVKA 1YLWA 1C3BA 5GLAA 1ES2A 3K3CA 3W4PA 1W63M 1E3UD 3TSGA 5GHXA 4MMNA 3S7QA 4LLOB 3BJNA 4F3LB 5TBMB 5FEFA 2OV5A 4S2NC 5HD5A 4IBRA 5EPHA 4BBVA 1IYSA 1LI9A 4DE3A 4M4XA 4MEZA 2ZOHA 2GNXA 4L9FA 1L2SA 4HQAA 5FI6A 5I94A 1QMEA 2V9AA 3T1XA 3F1NB 3H9WA 3NIAA 1VHMA 1CEFA 4L9GA 3QNCA 2QPNA 1ES5A 1OMEA 3LFVA 3WS2A 3JVUA 2PHYA 1PI4A 3MQ0A 4RA7A 1K55C 3PBNA 1IYOA 1SKFA 3UDXA 3I7JA 2E8IA 4WMCD 1I2SA 1K4EA 3WRZA 1RCJA 3FKWA 3OCNA 2FFFB 2WKPA 4GS9B 4C75A 1WYBA 2HPBA 5AJGA 4FSFA 1ZC2A 2INWA 3TRCA 1JTGA 5EM1A 4MN5A 4DN0A 1MXOA 4HP4A 2V8FA 3E2LA 3VP3A 1BLPA 3H82A 2BTFP 3OPHA 4R4RA 3MFDA 4U3TA 2OAP1 2FFYA 1XJ6A 1S0WA 2PAVP 2D01A 3UB8A 4CLCE 3B33A 1NJ4A 3WS5A 4HESA 3LY4A 1N9OA 2WGIA 5EV0A 3VV4A 1OJ5A 3ZG9B 4CLCA 3ZVWA 1XGJA 1FSYA 1S66L 2V2FF 5J4EA 2B18A 4Q8IA 1XA1A 1K54A 3P09A 3G6OA 3VP1A 5KMWA 1PIOA 4L0LA 4JGQA 3UB9A 1YM1A 4OQGA 2OWJA 2V8CA 2QZ6A 4BL3A 1T1BA 2VLGA 3ZNTA 3S7OA 4BENA 3F1OB 3H7WA 1RGYA 4PKYG 4DKIA 3T4SA 1VEUB 4II7A 3QNBA 3IQAA 3KYZA 4R1GA 3O87A 4QHCA 1N4OA 5GLCA 1LL8A 1OTBA 5K5BA 1IKIA 4QU3A 3EQUA 1NRFA 2PBYA 3UPPA 3EGDC 5DFXA 2ZMFA 3HLFA 5HPIA 1O07A 3BFCA 1M40A 3FC7A 4B4ZA 4LV3A 2Y2GA 2WGVA 3ICYA 3WWXA 2JHEA 3NJAA 2QMIA 2YKFA 4Q0HA 4QB8A 3C8CA 4ETXA 3PHYA 2G2WA 3SH8A 1BLCA 5TR7A 3WS0A 2ZM0A 5DVAA 5HD3A 2VV7A 4L9EA 3UDIA 1K56D 3IS2A 1JVJA 1W8QA 2DRWA 2Z6DA 1M6KA 4I5SA 3DBAA 2JKRI 5F5YA 2R9WA 4IUKA 4E3OA 4LV0A 4XUZA 3PAEA 2W3DA 3UNWA 3S4XA 4N9KA 1PYYA 3Q07A 3HLDA 4S2IA 3ZDJA 1SKOA 2ZLYA 3N8SA 2W0NA 5FQKA 1AXBA 2XR0A 2K7SA 4HOIA 2W27A 4EBNA 3VMAA 3GTCA 3BFFA 4QPRA 2EWVA 1XJ2A 4R23A 2ZBBA 3N4IA 4E3KA 3RFBA 1YSPA 5L8MA 4ETZA 4R3JA 3FV7A 1XX2A 4CJNA 2CMNA 5CTMA 1IKGA 5D3OA 4OPQA 1T18A 1LI0A 3CLOA 5HSQA 4MBFA 3EOIA 1H8ZA 4FOFA 4JGOA 3O88A 2M7VA 4EESA 4RX3A 3UE1A 1CJFA 2P7JA 4RVAA 5CX7A 3BQAA 3JPUA 1BUEA 2Y2JA 3W8KA 3A3JA 4WEKA 1HZOA 3CUEC 3LIDA 3VE4A 2ZQCA 1E4DA 2IA2A 2J9PA 5KZHA 3DTEA 4XT2B 4KG2A 2J8YA 2Y59A 2X71A 3GVBA 1Y54A 1PWCA 5HAPA 3MXQA 2ACGA 4MN6A 2O9CA 1ONHA 4GHIB 4MCWA 4N9LA 2PU4A 3M2KA 5KIZA 3NC8A 3S1YA 4F94A 5AVFA 4ESPA 3GRJA 3Q7ZA 2EX9A 3CPTA 4HP9A 3ZHHA 4S2KA 3RXWA 3AGDA 5EUAA 5FQJA 1WYCA 3T4OA 1Q2PA 1CQAA 3Q82A 3W4OA 2B95A 3VFFA 2P74A 2H0TA 5L2FA 1NYYA 2A24A 1NZOA 4YINA 1Z09A 5DF7A 3SH9A 4UHUA 5I5LA 3ITAA 4NETA 2JC7A 1VM1A 4FH4A 3CI6A 3V3RA 4IVIA 1S67L 4FCFA 1PW1A 3LIAA 4OLGA 5GL9A 1V9YA 2ZMAA 2W1TA 1LL9A 1NZUA 3M6BA 4X69A 3UPOA 1O7EA 3MQQA 4YFMA 1OT9A 3ULFA 1YMSA 4E6XA 1S6RA 2G7UA 3OZHA 2QWSA 1PWDA 4EV4A 4WUJA 3A0VA 3RTYA 2M1CA
chains in the Genus database with same CATH topology
4WM9A 3UDFA 4R4SA 5CGWA 2ZC5B 2Y4AA 3D4FA 2Y2NA 4EQIA 4ZAMA 1W5DA 2HDQA 3HL9A 4DE0A 2VGKA 4DXBA 4GDBA 4LV1A 2C5WB 2XFSA 3OC2A 5GLDA 3NI9A 5HW3A 2X02A 4EWFA 1GHIA 1KGGA 4FH2A 5EECA 3AGFA 4PM5A 3BFGA 3BLMA 2H10A 3PBOA 2WADA 1YLYA 3HLWA 3NDEA 4MBHA 2J7VA 5CHMA 4JLFA 1I2WA 4OPYA 4WEJA 2HDRA 1ES4A 2Y2MA 1I5QA 4JXSA 3FYZA 4PM8A 2Y2PA 1H5XA 1HVBA 3IWQA 4WYYA 5CEBA 2RCXA 1KDSA 2Q9NA 3PBTA 4DF6A 5E2EA 4IVKA 3CJMA 4X6TA 3IHAA 1YLWA 2R9XA 1C3BA 5EOEA 2ZC7A 5GLAA 3UPNA 3C4PA 3MXSA 4GDNA 2OLVA 4P6BA 1ES2A 3G4PA 3W4PA 1L0EA 2XK1A 1E3UD 3IWOA 3TSGA 5GHXA 1SCWA 1SHVA 1IELA 1FSWA 3IH9A 1SDNA 3ZG7B 5FSRA 4QY5A 4BL2A 3BLSA 1ALQA 1KDWA 3IHBA 4PM9A 4WELA 4BD0A 5KSHA 2V1ZA 4GNUA 5M18A 3IF6B 4RX2A 2OV5A 4HBTA 3C4OA 1G68A 3Q1FA 3BECA 4X55A 1NXYA 1EI5A 4N92A 4S2NC 3W4QA 1FQGA 1IYQA 4IBRA 5EVLA 5EPHA 5GLBA 1IYSA 4XUXA 2A49A 1ESUA 3JYIA 4S2MA 4K0XA 1K6SA 1LI9A 2WKEA 4DE3A 2ZD8A 3GR2A 4MEZA 2Y55A 4U0XA 4X68A 1YLJA 3AGEA 5A92A 1L2SA 3WS1A 3G2YA 5FI6A 1KGFA 5I94A 4OPZA 2DCFA 1QMEA 3TOIA 2ZQDA 4O7DA 3G30A 1IYPA 3C7UA 3NIAA 4WZ4A 4JXVA 4E3NA 3RXXA 1CEFA 3IXHA 4KQOA 2UWXA 4M3KA 1FR1A 3QNCA 1YLZA 2QPNA 2XF3A 5JYPA 4X53A 3NDGA 1ES5A 1KVLA 1OMEA 1W7FA 1K54C 3HLBA 3WS2A 1JTDA 1PI4A 2IWCA 4RA7A 4RYEA 1K55C 3PBNA 4KZ3A 4BJPA 1IYOA 3Q81A 1SKFA 5F83A 3UDXA 1PI5A 3SS3A 3UN7A 3I7JA 3V50A 2E8IA 4WBGA 4WMCD 5FQIA 1BT5A 1I2SA 1K4EA 4JPMA 1ZG4A 4UA7A 1YLPA 2HP9A 2WYXA 3FZCA 1RCJA 3WRZA 3N8LA 3FKWA 5E2FA 3OCNA 4E3JA 2FFFB 4GOGA 4HEFA 1YQSA 3HUMA 4C75A 1WYBA 2HPBA 4XXRA 2WK0A 4FSFA 1ZC2A 4Z9QA 1JTGA 1Q2QA 1RGZA 2P9VB 1KE0A 5M19A 1MXOA 5CGSA 1DJAA 1KE3A 3E2LA 2ZC3B 2EX8A 2Y2OA 3VP3A 1BLPA 3UY6A 4EUZA 2ZQ8A 3HUOA 4GB7A 5EVID 3OPHA 4R4RA 5BOHA 3ZVTA 1W8YA 3MFDA 1GHPA 4S2NA 1QMFA 4U3TA 3VOZA 3ZCZA 4KQQA 3GQZA 5FI7A 2FFYA 1S0WA 3B3XA 1XKZA 5FAOA 4KZ5A 3ISGA 1NJ4A 1MWUA 3NBLA 3WS5A 2G2UA 1BULA 3BFDA 3HLCA 4HESA 4BD1A 3LY4A 2GDNA 3PBRA 5DTTA 3LO7A 1YLTA 2WGIA 4S2PA 3ITBA 5FI2A 1TEMA 4B88A 3IT9A 3OPRA 3ZG9B 5AQ7A 1TDLA 3N7WA 3VP2A 1XGJA 3ZVWA 1FSYA 5U47A 3G2ZA 1CI8A 5IHVA 1E3UA 1FCNA 1XXMA 2V2FF 4KQRA 2Y2QA 2P9VA 5KSCA 3LEZA 3IF6C 4ZJ3A 3VP0A 4ZDXA 4KG6A 3N8RA 4Q8IA 1XA1A 3V3SA 1K54A 3P09A 1GA9A 3VP1A 4GD6A 1K6RA 5KMWA 1Z6FA 1PIOA 2EXAA 2Y2HA 1K55A 3MZEA 4L0LA 4KZ6A 1YM1A 3FKVA 4MNRA 4OQGA 1ZKJA 2QZ6A 4GN2A 5DTKA 4BL3A 3MKFA 2XH9A 1WE4A 2CC1A 4P0MA 1MWSA 3A3DA 3LY3A 4UA9A 5FAQA 3HLGA 4UAAA 3ZNTA 4JKTA 4D2OA 3MKEA 5HX9A 4BENA 3IXBA 4Y0TA 1RGYA 4DKIA 5CGXA 5TFQA 1FR6A 4E3LA 4EBPA 3QNBA 5HARA 3ZG0A 3VSKA 3IQAA 5CRFA 4R1GA 3IH8A 1EROA 3O87A 4OOYA 4U0TA 3ZG8B 4QHCA 1N4OA 3WRTA 5FA7A 5GLCA 1U60A 5E43A 4LCMA 3V5MA 1IKIA 4DE2A 4QU3A 3EQUA 1K25A 1NRFA 3WS4A 4BLMA 4OP8A 2WKHA 5EOOA 2PBYA 1MWTA 3UPPA 2XDMA 2EX2A 3HLFA 2Z2MB 3IXGA 5EVIB 2ZQ7A 5HAIA 1O07A 3HBRA 3BFCA 1M40A 3SH7A 4LV2A 5J8XA 4K91A 5GHYA 4B4ZA 4H8RA 4LV3A 3HLEA 2Y2GA 4QJGA 1PW8A 2WGVA 3GSGA 2OLUA 4OONA 3WWXA 1YMXA 1K4FA 1HTZA 2QMIA 2WAEA 2XGNA 4QB8A 1CK3A 3PBQA 4KZ8A 5CECA 1KE4A 3MZDA 4PMAA 4WMCA 3CG5A 4GZBA 1JWPA 2G2WA 3SH8A 4X56A 1BLCA 1FOFA 5TR7A 4EBLA 1BSGA 3IF6A 3WS0A 2ZM0A 5DVAA 4DRTA 1K38A 3DTMA 1DJBA 4DDYA 1XGIA 3UDIA 1K56D 3ZG5A 5M1AA 3VSLA 3CZDA 3BYDA 5CHUA 1JVJA 1W8QA 4S2OA 3TG9A 3V39A 1L0FA 3C7VA 1DY6A 2DRWA 2WZXA 5FQQA 1VQQA 4Y0UA 1M6KA 4GD8A 4OQIA 3UO9A 1KVMA 5FQ9A 2ZQAA 5EVIA 2BLSA 2R9WA 2XD5A 4E3OA 4LV0A 3UE3A 4XUZA 1PZPA 3HVFA 4IBXA 3PAEA 4A5RA 4JBFA 2V20A 4MLLA 3UNWA 1IEMA 1XA7A 3S4XA 2XQZA 2JBFA 4N9KA 4JXWA 1PYYA 3Q07A 3HLDA 4R3BA 4S2IA 3ZDJA 3VP4A 4PPRA 3DWKA 2ZLYA 5E2GA 3N8SA 3G35A 5FQKA 3G32A 5F1GA 2ZM2A 1AXBA 2XR0A 1NY0A 4KZBA 4P87A 1LLBA 3BFEA 4E6WA 1E25A 4EBNA 3CMZA 3GTCA 4OVDA 3VMAA 3BM6A 4C3QA 2JE5A 4OH0A 1BTLA 4LENA 2IWBA 3BFFA 5FQMA 3ZGAB 3O3VA 2HP5A 2Y91A 2DNSA 4R23A 4Y7PA 3Q7VB 3N4IA 4UA6A 4E3KA 5CHJA 3O86A 1EWZA 2EX6A 3HREA 4R3JA 3FV7A 1XX2A 1LHYA 4KG5A 5D3OA 5CTMA 1IKGA 2H0YA 4CJNA 4OPQA 4MBKA 5A91A 4C6YA 5CXWA 2WZZA 1G6AA 2XEPA 1LI0A 1KGEA 3IWIA 4OP5A 1L0GA 5AQBA 3NY4A 4E3IA 4NK3A 4JF4A 5FATA 4MBFA 4OOLA 2BG1A 3BEBA 1H8ZA 1LL5A 2X01A 3O88A 1FCMA 1XP4A 4GKUA 1MBLA 3OPLA 4DDSA 2B5RA 1YT4A 5EVIC 5EE8A 4RX3A 3UE1A 4DE1A 3IF5A 1FCOA 3M6HA 1TVFA 2XFTA 3G34A 4S2JA 5HAQA 4CPKA 4RVAA 2ZM8A 4N1HA 1CEGA 1J9MA 4JF5A 3N6IA 2XLNA 1BZAA 5HFOA 4OKPA 1BUEA 1ERQA 2I72A 2Y2JA 3Q7VA 4LCLA 4QY6A 3W8KA 4WZ5C 4OQHA 3A3JA 4WEKA 5E2HA 2JCHA 1HZOA 1SDEA 2EFUA 1DJCA 1NYMA 4OQ0A 4ZJ2A 2ZQCA 1CI9A 1E4DA 2J9PA 2WUQA 3BRMA 4FD8A 3SS4A 3S22A 5KZHA 1K57C 5GHZA 1ONGA 4KG2A 2OSUA 1GHMA 2J8YA 2Y59A 2HDSA 3M2JA 4OPRA 2X71A 3GVBA 1Y54A 3OPPA 2Q9MA 4Y0OA 5CTNA 1PWCA 3ZNYA 5HAPA 5CERA 3FWLA 4S2LA 1ONHA 3C5AA 4HBUA 4N9LA 2PU4A 5CEDA 4PM7A 4JXGA 2A3UA 3ZFZA 3M2KA 3A3IA 3DW0A 1K56A 3NC8A 4E3MA 3NCKA 4ZTKA 3S1YA 4F94A 2ZJ9A 4R0QA 3GRJA 4JF6A 3Q7ZA 2EX9A 3P98A 2J9OA 3GV9A 3A3EA 3LCEA 2HDUA 1H8YA 3SOIA 3ZHHA 3PBSA 1MPLA 4S2KA 3RXWA 3AGDA 1ESIA 1L0DA 5EUAA 1ES3A 4IEDA 1RP5A 3QHYA 5FQJA 1WYCA 3GMWA 5G18A 1W79A 3UE0A 3IXDA 5DF9A 3VFHA 2HP6A 5JYOA 4KZ4A 1Q2PA 2C6WB 2RL3A 2IWDA 4PM6A 4OOMA 3PTEA 3Q82A 3MXRA 1GA0A 3HUNA 3W4OA 1BLSA 1PZOA 3OCLA 5A93A 1MY8A 3VFFA 2P74A 1JWVA 2H0TA 4K0WA 5L2FA 1NYYA 3G31A 1NZOA 3DWZA 1GCEA 5DTSA 4N1XA 4YINA 5DF7A 3SH9A 2WGWB 3VOYA 4UHUA 2Y2IA 3ITAA 4NETA 1ERMA 1PWGA 2JC7A 4QD4A 1VM1A 4FH4A 3V3RA 2VGJA 5HL1A 2PU2A 1HD8A 5FASA 4DXCA 1N9BA 4IVIA 5DF8A 4KZAA 4WZ5A 4FCFA 2ZQ9A 2WKIA 1MKIA 4KENB 3MZFA 1PW1A 5AQ9A 3E2KA 4OLGA 5GL9A 1JWZA 2EXBA 4OLDA 4ZJ1A 2ZMAA 2XD1A 1LL9A 4KZ7A 1K57A 1NZUA 5A90A 2Y2LA 2WAFA 3EQVA 3M6BA 5F82A 4X69A 3SS5A 2ZC6B 1TDGA 3UPOA 3PAGA 5F1FA 1XPBA 1O7EA 4YFMA 2Z2LB 4ZBEA 5TGFA 3MBZA 3RJUA 1YMSA 4ID4A 4P85A 4E6XA 5AQAA 1MWRA 1S6RA 1ZG6A 4B4XA 4BQMA 1BLHA 2Y2KA 3OZHA 5FAPA 2H5SA 1PWDA 5FDHA 2ZC4B 4KZ9A 4EV4A 2WGWA 2EFXA 3A3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WM9 A;  3UDF A;  4R4S A;  5CGW A;  2ZC5 B;  2Y4A A;  3D4F A;  2Y2N A;  4EQI A;  4ZAM A;  1W5D A;  2HDQ A;  3HL9 A;  4DE0 A;  2VGK A;  4DXB A;  4GDB A;  4LV1 A;  2C5W B;  2XFS A;  3OC2 A;  5GLD A;  3NI9 A;  5HW3 A;  2X02 A;  4EWF A;  1GHI A;  1KGG A;  4FH2 A;  5EEC A;  3AGF A;  4PM5 A;  3BFG A;  3BLM A;  2H10 A;  3PBO A;  2WAD A;  1YLY A;  3HLW A;  3NDE A;  4MBH A;  2J7V A;  5CHM A;  4JLF A;  1I2W A;  4OPY A;  4WEJ A;  2HDR A;  1ES4 A;  2Y2M A;  1I5Q A;  4JXS A;  3FYZ A;  4PM8 A;  2Y2P A;  1H5X A;  1HVB A;  3IWQ A;  4WYY A;  5CEB A;  2RCX A;  1KDS A;  2Q9N A;  3PBT A;  4DF6 A;  5E2E A;  4IVK A;  3CJM A;  4X6T A;  3IHA A;  1YLW A;  2R9X A;  1C3B A;  5EOE A;  2ZC7 A;  5GLA A;  3UPN A;  3C4P A;  3MXS A;  4GDN A;  2OLV A;  4P6B A;  1ES2 A;  3G4P A;  3W4P A;  1L0E A;  2XK1 A;  1E3U D;  3IWO A;  3TSG A;  5GHX A;  1SCW A;  1SHV A;  1IEL A;  1FSW A;  3IH9 A;  1SDN A;  3ZG7 B;  5FSR A;  4QY5 A;  4BL2 A;  3BLS A;  1ALQ A;  1KDW A;  3IHB A;  4PM9 A;  4WEL A;  4BD0 A;  5KSH A;  2V1Z A;  4GNU A;  5M18 A;  3IF6 B;  4RX2 A;  2OV5 A;  4HBT A;  3C4O A;  1G68 A;  3Q1F A;  3BEC A;  4X55 A;  1NXY A;  1EI5 A;  4N92 A;  4S2N C;  3W4Q A;  1FQG A;  1IYQ A;  4IBR A;  5EVL A;  5EPH A;  5GLB A;  1IYS A;  4XUX A;  2A49 A;  1ESU A;  3JYI A;  4S2M A;  4K0X A;  1K6S A;  1LI9 A;  2WKE A;  4DE3 A;  2ZD8 A;  3GR2 A;  4MEZ A;  2Y55 A;  4U0X A;  4X68 A;  1YLJ A;  3AGE A;  5A92 A;  1L2S A;  3WS1 A;  3G2Y A;  5FI6 A;  1KGF A;  5I94 A;  4OPZ A;  2DCF A;  1QME A;  3TOI A;  2ZQD A;  4O7D A;  3G30 A;  1IYP A;  3C7U A;  3NIA A;  4WZ4 A;  4JXV A;  4E3N A;  3RXX A;  1CEF A;  3IXH A;  4KQO A;  2UWX A;  4M3K A;  1FR1 A;  3QNC A;  1YLZ A;  2QPN A;  2XF3 A;  5JYP A;  4X53 A;  3NDG A;  1ES5 A;  1KVL A;  1OME A;  1W7F A;  1K54 C;  3HLB A;  3WS2 A;  1JTD A;  1PI4 A;  2IWC A;  4RA7 A;  4RYE A;  1K55 C;  3PBN A;  4KZ3 A;  4BJP A;  1IYO A;  3Q81 A;  1SKF A;  5F83 A;  3UDX A;  1PI5 A;  3SS3 A;  3UN7 A;  3I7J A;  3V50 A;  2E8I A;  4WBG A;  4WMC D;  5FQI A;  1BT5 A;  1I2S A;  1K4E A;  4JPM A;  1ZG4 A;  4UA7 A;  1YLP A;  2HP9 A;  2WYX A;  3FZC A;  1RCJ A;  3WRZ A;  3N8L A;  3FKW A;  5E2F A;  3OCN A;  4E3J A;  2FFF B;  4GOG A;  4HEF A;  1YQS A;  3HUM A;  4C75 A;  1WYB A;  2HPB A;  4XXR A;  2WK0 A;  4FSF A;  1ZC2 A;  4Z9Q A;  1JTG A;  1Q2Q A;  1RGZ A;  2P9V B;  1KE0 A;  5M19 A;  1MXO A;  5CGS A;  1DJA A;  1KE3 A;  3E2L A;  2ZC3 B;  2EX8 A;  2Y2O A;  3VP3 A;  1BLP A;  3UY6 A;  4EUZ A;  2ZQ8 A;  3HUO A;  4GB7 A;  5EVI D;  3OPH A;  4R4R A;  5BOH A;  3ZVT A;  1W8Y A;  3MFD A;  1GHP A;  4S2N A;  1QMF A;  4U3T A;  3VOZ A;  3ZCZ A;  4KQQ A;  3GQZ A;  5FI7 A;  2FFY A;  1S0W A;  3B3X A;  1XKZ A;  5FAO A;  4KZ5 A;  3ISG A;  1NJ4 A;  1MWU A;  3NBL A;  3WS5 A;  2G2U A;  1BUL A;  3BFD A;  3HLC A;  4HES A;  4BD1 A;  3LY4 A;  2GDN A;  3PBR A;  5DTT A;  3LO7 A;  1YLT A;  2WGI A;  4S2P A;  3ITB A;  5FI2 A;  1TEM A;  4B88 A;  3IT9 A;  3OPR A;  3ZG9 B;  5AQ7 A;  1TDL A;  3N7W A;  3VP2 A;  1XGJ A;  3ZVW A;  1FSY A;  5U47 A;  3G2Z A;  1CI8 A;  5IHV A;  1E3U A;  1FCN A;  1XXM A;  2V2F F;  4KQR A;  2Y2Q A;  2P9V A;  5KSC A;  3LEZ A;  3IF6 C;  4ZJ3 A;  3VP0 A;  4ZDX A;  4KG6 A;  3N8R A;  4Q8I A;  1XA1 A;  3V3S A;  1K54 A;  3P09 A;  1GA9 A;  3VP1 A;  4GD6 A;  1K6R A;  5KMW A;  1Z6F A;  1PIO A;  2EXA A;  2Y2H A;  1K55 A;  3MZE A;  4L0L A;  4KZ6 A;  1YM1 A;  3FKV A;  4MNR A;  4OQG A;  1ZKJ A;  2QZ6 A;  4GN2 A;  5DTK A;  4BL3 A;  3MKF A;  2XH9 A;  1WE4 A;  2CC1 A;  4P0M A;  1MWS A;  3A3D A;  3LY3 A;  4UA9 A;  5FAQ A;  3HLG A;  4UAA A;  3ZNT A;  4JKT A;  4D2O A;  3MKE A;  5HX9 A;  4BEN A;  3IXB A;  4Y0T A;  1RGY A;  4DKI A;  5CGX A;  5TFQ A;  1FR6 A;  4E3L A;  4EBP A;  3QNB A;  5HAR A;  3ZG0 A;  3VSK A;  3IQA A;  5CRF A;  4R1G A;  3IH8 A;  1ERO A;  3O87 A;  4OOY A;  4U0T A;  3ZG8 B;  4QHC A;  1N4O A;  3WRT A;  5FA7 A;  5GLC A;  1U60 A;  5E43 A;  4LCM A;  3V5M A;  1IKI A;  4DE2 A;  4QU3 A;  3EQU A;  1K25 A;  1NRF A;  3WS4 A;  4BLM A;  4OP8 A;  2WKH A;  5EOO A;  2PBY A;  1MWT A;  3UPP A;  2XDM A;  2EX2 A;  3HLF A;  2Z2M B;  3IXG A;  5EVI B;  2ZQ7 A;  5HAI A;  1O07 A;  3HBR A;  3BFC A;  1M40 A;  3SH7 A;  4LV2 A;  5J8X A;  4K91 A;  5GHY A;  4B4Z A;  4H8R A;  4LV3 A;  3HLE A;  2Y2G A;  4QJG A;  1PW8 A;  2WGV A;  3GSG A;  2OLU A;  4OON A;  3WWX A;  1YMX A;  1K4F A;  1HTZ A;  2QMI A;  2WAE A;  2XGN A;  4QB8 A;  1CK3 A;  3PBQ A;  4KZ8 A;  5CEC A;  1KE4 A;  3MZD A;  4PMA A;  4WMC A;  3CG5 A;  4GZB A;  1JWP A;  2G2W A;  3SH8 A;  4X56 A;  1BLC A;  1FOF A;  5TR7 A;  4EBL A;  1BSG A;  3IF6 A;  3WS0 A;  2ZM0 A;  5DVA A;  4DRT A;  1K38 A;  3DTM A;  1DJB A;  4DDY A;  1XGI A;  3UDI A;  1K56 D;  3ZG5 A;  5M1A A;  3VSL A;  3CZD A;  3BYD A;  5CHU A;  1JVJ A;  1W8Q A;  4S2O A;  3TG9 A;  3V39 A;  1L0F A;  3C7V A;  1DY6 A;  2DRW A;  2WZX A;  5FQQ A;  1VQQ A;  4Y0U A;  1M6K A;  4GD8 A;  4OQI A;  3UO9 A;  1KVM A;  5FQ9 A;  2ZQA A;  5EVI A;  2BLS A;  2R9W A;  2XD5 A;  4E3O A;  4LV0 A;  3UE3 A;  4XUZ A;  1PZP A;  3HVF A;  4IBX A;  3PAE A;  4A5R A;  4JBF A;  2V20 A;  4MLL A;  3UNW A;  1IEM A;  1XA7 A;  3S4X A;  2XQZ A;  2JBF A;  4N9K A;  4JXW A;  1PYY A;  3Q07 A;  3HLD A;  4R3B A;  4S2I A;  3ZDJ A;  3VP4 A;  4PPR A;  3DWK A;  2ZLY A;  5E2G A;  3N8S A;  3G35 A;  5FQK A;  3G32 A;  5F1G A;  2ZM2 A;  1AXB A;  2XR0 A;  1NY0 A;  4KZB A;  4P87 A;  1LLB A;  3BFE A;  4E6W A;  1E25 A;  4EBN A;  3CMZ A;  3GTC A;  4OVD A;  3VMA A;  3BM6 A;  4C3Q A;  2JE5 A;  4OH0 A;  1BTL A;  4LEN A;  2IWB A;  3BFF A;  5FQM A;  3ZGA B;  3O3V A;  2HP5 A;  2Y91 A;  2DNS A;  4R23 A;  4Y7P A;  3Q7V B;  3N4I A;  4UA6 A;  4E3K A;  5CHJ A;  3O86 A;  1EWZ A;  2EX6 A;  3HRE A;  4R3J A;  3FV7 A;  1XX2 A;  1LHY A;  4KG5 A;  5D3O A;  5CTM A;  1IKG A;  2H0Y A;  4CJN A;  4OPQ A;  4MBK A;  5A91 A;  4C6Y A;  5CXW A;  2WZZ A;  1G6A A;  2XEP A;  1LI0 A;  1KGE A;  3IWI A;  4OP5 A;  1L0G A;  5AQB A;  3NY4 A;  4E3I A;  4NK3 A;  4JF4 A;  5FAT A;  4MBF A;  4OOL A;  2BG1 A;  3BEB A;  1H8Z A;  1LL5 A;  2X01 A;  3O88 A;  1FCM A;  1XP4 A;  4GKU A;  1MBL A;  3OPL A;  4DDS A;  2B5R A;  1YT4 A;  5EVI C;  5EE8 A;  4RX3 A;  3UE1 A;  4DE1 A;  3IF5 A;  1FCO A;  3M6H A;  1TVF A;  2XFT A;  3G34 A;  4S2J A;  5HAQ A;  4CPK A;  4RVA A;  2ZM8 A;  4N1H A;  1CEG A;  1J9M A;  4JF5 A;  3N6I A;  2XLN A;  1BZA A;  5HFO A;  4OKP A;  1BUE A;  1ERQ A;  2I72 A;  2Y2J A;  3Q7V A;  4LCL A;  4QY6 A;  3W8K A;  4WZ5 C;  4OQH A;  3A3J A;  4WEK A;  5E2H A;  2JCH A;  1HZO A;  1SDE A;  2EFU A;  1DJC A;  1NYM A;  4OQ0 A;  4ZJ2 A;  2ZQC A;  1CI9 A;  1E4D A;  2J9P A;  2WUQ A;  3BRM A;  4FD8 A;  3SS4 A;  3S22 A;  5KZH A;  1K57 C;  5GHZ A;  1ONG A;  4KG2 A;  2OSU A;  1GHM A;  2J8Y A;  2Y59 A;  2HDS A;  3M2J A;  4OPR A;  2X71 A;  3GVB A;  1Y54 A;  3OPP A;  2Q9M A;  4Y0O A;  5CTN A;  1PWC A;  3ZNY A;  5HAP A;  5CER A;  3FWL A;  4S2L A;  1ONH A;  3C5A A;  4HBU A;  4N9L A;  2PU4 A;  5CED A;  4PM7 A;  4JXG A;  2A3U A;  3ZFZ A;  3M2K A;  3A3I A;  3DW0 A;  1K56 A;  3NC8 A;  4E3M A;  3NCK A;  4ZTK A;  3S1Y A;  4F94 A;  2ZJ9 A;  4R0Q A;  3GRJ A;  4JF6 A;  3Q7Z A;  2EX9 A;  3P98 A;  2J9O A;  3GV9 A;  3A3E A;  3LCE A;  2HDU A;  1H8Y A;  3SOI A;  3ZHH A;  3PBS A;  1MPL A;  4S2K A;  3RXW A;  3AGD A;  1ESI A;  1L0D A;  5EUA A;  1ES3 A;  4IED A;  1RP5 A;  3QHY A;  5FQJ A;  1WYC A;  3GMW A;  5G18 A;  1W79 A;  3UE0 A;  3IXD A;  5DF9 A;  3VFH A;  2HP6 A;  5JYO A;  4KZ4 A;  1Q2P A;  2C6W B;  2RL3 A;  2IWD A;  4PM6 A;  4OOM A;  3PTE A;  3Q82 A;  3MXR A;  1GA0 A;  3HUN A;  3W4O A;  1BLS A;  1PZO A;  3OCL A;  5A93 A;  1MY8 A;  3VFF A;  2P74 A;  1JWV A;  2H0T A;  4K0W A;  5L2F A;  1NYY A;  3G31 A;  1NZO A;  3DWZ A;  1GCE A;  5DTS A;  4N1X A;  4YIN A;  5DF7 A;  3SH9 A;  2WGW B;  3VOY A;  4UHU A;  2Y2I A;  3ITA A;  4NET A;  1ERM A;  1PWG A;  2JC7 A;  4QD4 A;  1VM1 A;  4FH4 A;  3V3R A;  2VGJ A;  5HL1 A;  2PU2 A;  1HD8 A;  5FAS A;  4DXC A;  1N9B A;  4IVI A;  5DF8 A;  4KZA A;  4WZ5 A;  4FCF A;  2ZQ9 A;  2WKI A;  1MKI A;  4KEN B;  3MZF A;  1PW1 A;  5AQ9 A;  3E2K A;  4OLG A;  5GL9 A;  1JWZ A;  2EXB A;  4OLD A;  4ZJ1 A;  2ZMA A;  2XD1 A;  1LL9 A;  4KZ7 A;  1K57 A;  1NZU A;  5A90 A;  2Y2L A;  2WAF A;  3EQV A;  3M6B A;  5F82 A;  4X69 A;  3SS5 A;  2ZC6 B;  1TDG A;  3UPO A;  3PAG A;  5F1F A;  1XPB A;  1O7E A;  4YFM A;  2Z2L B;  4ZBE A;  5TGF A;  3MBZ A;  3RJU A;  1YMS A;  4ID4 A;  4P85 A;  4E6X A;  5AQA A;  1MWR A;  1S6R A;  1ZG6 A;  4B4X A;  4BQM A;  1BLH A;  2Y2K A;  3OZH A;  5FAP A;  2H5S A;  1PWD A;  5FDH A;  2ZC4 B;  4KZ9 A;  4EV4 A;  2WGW A;  2EFX A;  3A3F A; 
#chains in the Genus database with same CATH topology
 4WM9 A;  3UDF A;  2Y2N A;  2EA9 A;  5MC7 A;  2VGK A;  4DXB A;  1YKD A;  2C5W B;  3OC2 A;  5GLD A;  5HW3 A;  2PT7 A;  1GHI A;  4HHD A;  3AGF A;  2H10 A;  3K3D A;  2J7V A;  3PXP A;  5CHM A;  4MN7 A;  2Y2M A;  2GX5 A;  1P97 A;  3FYZ A;  1H5X A;  3IWQ A;  2NUP C;  1KDS A;  4DF6 A;  3IHA A;  5EOE A;  4CLC D;  3P7N A;  2XK1 A;  5HWV A;  1IEL A;  1MC0 A;  1SDN A;  3ZG7 B;  5FSR A;  4BL2 A;  1ALQ A;  3IHB A;  2QJ5 A;  4WEL A;  2H28 A;  1T1A A;  3IF6 B;  1SZV A;  4HBT A;  1G68 A;  3BEC A;  4X55 A;  1NXY A;  1EI5 A;  3PYP A;  1FQG A;  1IYQ A;  3VOL A;  4I3A A;  3KSG A;  2XSS A;  4FUW A;  1T1C A;  2NUT C;  2JN7 A;  1K0K A;  3F1P A;  3JYI A;  4S2M A;  2ZD8 A;  2Y55 A;  4U0X A;  3AGE A;  5A92 A;  3WS1 A;  3G2Y A;  1KGF A;  4UQI M;  3TOI A;  2ZQD A;  4WZ4 A;  4JXV A;  2PR6 A;  4M3K A;  1FR1 A;  4F3L A;  1YLZ A;  2GZA A;  3SZT A;  2XF3 A;  5TBM A;  5JYP A;  4X53 A;  1W7F A;  3HLB A;  1P0Z A;  4BJP A;  4G3W A;  3BY9 A;  3IBJ A;  1GSX A;  2QHK A;  3UN7 A;  4WBG A;  4JPM A;  1ZG4 A;  4UA7 A;  2WYX A;  5FEG A;  1GSW A;  4E3J A;  1OTI A;  2WK0 A;  1RGZ A;  2P9V B;  5M19 A;  2W3H A;  1DJA A;  3F1N A;  4LRZ E;  3ZVT A;  1GHP A;  2L4R A;  3ZCZ A;  5FI7 A;  5FAO A;  4KZ5 A;  2DMW A;  2G2U A;  3BFD A;  4BD1 A;  3QP6 A;  3PBR A;  3LO7 A;  1VET B;  3ITB A;  4B88 A;  4LRY C;  3DTK A;  3PR6 A;  1TDL A;  3N7W A;  1CI8 A;  5IHV A;  1FCN A;  1XXM A;  3OBF A;  5KSC A;  3IF6 C;  4EER A;  4ZJ3 A;  3GDI A;  4KG6 A;  1GA9 A;  1K6R A;  1Z6F A;  2EXA A;  2Y2H A;  4MNR A;  5DTK A;  3KYE A;  2XH9 A;  2CC1 A;  4UA9 A;  3E98 A;  4JKT A;  4D2O A;  1KOU A;  1NRJ A;  2KDK A;  3IXB A;  2LB9 A;  1NWZ A;  5TFQ A;  3ZG0 A;  3IH8 A;  1ERO A;  2W3F A;  3ZG8 B;  4JGR A;  4FTX A;  4LCM A;  1GSV A;  4BBT A;  4BLM A;  2XDM A;  3IXG A;  5EVI B;  2ZQ7 A;  3LR3 A;  1P9W A;  1LSX A;  4K91 A;  3HLE A;  3EGX C;  3OOV A;  4QJG A;  1PFL A;  1OTA A;  2XGN A;  1CK3 A;  1TD5 A;  4KUK A;  5HL6 A;  1OTD A;  1VEU A;  4GZB A;  3S7N A;  2B02 A;  4NXG A;  5J7E A;  3DTM A;  1DJB A;  1XGI A;  5DJT A;  4S2O A;  3V39 A;  5L07 A;  5EFW A;  3C7V A;  5FQQ A;  4Y0U A;  4GD8 A;  4OQI A;  3A0S A;  2XD5 A;  3LUQ A;  1PZP A;  4IBX A;  3E4Q A;  3C30 A;  1XA7 A;  2PYP A;  3QP5 A;  1LSV A;  4JXW A;  1F5M A;  4G3V A;  3DTI A;  5E2G A;  3CUE A;  4KZB A;  5F68 A;  1LLB A;  2ZMV A;  4NG2 A;  3UMD A;  4OH0 A;  5HWW A;  2HJ9 C;  4LPZ A;  3Q7V B;  3O86 A;  3HRE A;  2E8J A;  4Y5F A;  4MBK A;  4C6Y A;  5CXW A;  5HZH A;  1L0G A;  5AQB A;  4BMW A;  3NY4 A;  4E3I A;  4UQI S;  4AFI A;  5FAT A;  2BG1 A;  3BEB A;  3LIE A;  2JKF A;  4HJ4 A;  1XP4 A;  3FPV A;  5EVI C;  4DE1 A;  4KQD A;  3G34 A;  3UE6 A;  4S2J A;  2J80 A;  3P01 A;  4JF5 A;  4Q0I A;  4BBU A;  4LCL A;  2I72 A;  4HNB A;  4PKY A;  4WZ5 C;  4OQH A;  1PRQ A;  2JCH A;  2EFU A;  3EEH A;  1NYM A;  3LEQ A;  1S4S A;  4FD8 A;  1GHM A;  4OPR A;  3IX8 A;  1NLZ A;  2Q9M A;  4Y0O A;  3W2Z A;  3ZNY A;  3C5A A;  4HBU A;  5CED A;  4JXG A;  5TJJ A;  3A3I A;  4E3M A;  4ZTK A;  1L3L A;  4R0Q A;  2PD8 A;  3MSH A;  4JF6 A;  3GV9 A;  2HDU A;  3SOI A;  2O9B A;  3U4L P;  4H6J A;  3EWK A;  2V0W A;  3QHY A;  4DDY A;  3MS6 A;  3GMW A;  4LRX C;  3VFH A;  3IXD A;  4YWZ A;  5LBR A;  4I39 A;  1DRM A;  2C6W B;  2RL3 A;  4OOM A;  3PTE A;  1F2K A;  3KSI A;  3MXR A;  1GA0 A;  3HUN A;  4GCZ A;  3H82 B;  3OCL A;  5F69 A;  4XT2 A;  4YNR A;  3G31 A;  1HLU P;  4NKP A;  5DTS A;  2WGW B;  4GHI A;  2OAQ 1;  4K08 A;  5HL1 A;  2PU2 A;  1HD8 A;  3R4K A;  2WKR A;  4KEN B;  3MZF A;  1TS7 A;  5FL3 A;  1EW0 A;  4KZ7 A;  1K57 A;  5A90 A;  2WAF A;  3EQV A;  5F82 A;  2R78 A;  1TDG A;  3PAG A;  5F1F A;  3UB5 P;  2Z2L B;  3RJU A;  4DJ3 A;  4ID4 A;  1MWR A;  4BQM A;  4B4X A;  4CQH A;  4WL9 A;  4KZ9 A;  1DP6 A;  5CGW A;  5J3W A;  2ZC5 B;  2Y4A A;  4EQI A;  4GDB A;  4Y13 A;  3UB6 A;  3NI9 A;  2VZW A;  4EW7 A;  2X02 A;  1KGG A;  4PM5 A;  3PBO A;  1XFQ A;  2VX8 A;  2WAD A;  3HLW A;  3NDE A;  1MKM A;  2JKR M;  1I2W A;  2HDR A;  4PM8 A;  1HVB A;  5CEB A;  2R9X A;  3UPN A;  3MFX A;  2VV8 A;  3C4P A;  1LSW A;  2OLV A;  2K2N A;  4GDN A;  4P6B A;  3G4P A;  3QP1 A;  1SHV A;  3C2W A;  3IH9 A;  3BLS A;  1KDW A;  4PM9 A;  4BD0 A;  2V1Z A;  5G4Y A;  5M18 A;  4RX2 A;  4EUV A;  2J3W A;  4N92 A;  4PHT A;  1CF0 A;  2WKQ A;  5GLB A;  4XUX A;  2A49 A;  3KSF A;  1ESU A;  4E04 A;  4K0X A;  1K6S A;  3GR2 A;  2VJW A;  4X68 A;  1YLJ A;  5IU1 A;  4OPZ A;  4O7D A;  3G30 A;  4LFU A;  4CLC C;  1IYP A;  4E3N A;  5HPF A;  3RXX A;  3IXH A;  4KQO A;  2HF6 A;  4B9O A;  1AWI A;  3NDG A;  3VE3 A;  1K54 C;  4RYE A;  4KZ3 A;  3Q81 A;  1PI5 A;  3SS3 A;  3V50 A;  5FQI A;  3NEC A;  1YLP A;  5E2F A;  1YQS A;  3HUM A;  4Z9Q A;  5L09 A;  1KE0 A;  5HDD A;  1KE3 A;  2VV6 A;  4P6Z M;  2EX8 A;  2Y2O A;  4EUZ A;  3HUO A;  4S2N A;  3VOZ A;  3JVV A;  3T12 B;  3B3X A;  1XKZ A;  3ISG A;  1D06 A;  2Z6C A;  3NBL A;  3LYX A;  3HLC A;  1BUL A;  4JGP A;  1T19 A;  3A0R A;  4D60 A;  3IBR A;  4X25 A;  4GJ4 A;  1TEM A;  4HIA A;  3OPR A;  5AQ7 A;  1UWP X;  3VP2 A;  4G3K A;  3G2Z A;  4KQR A;  2Y2Q A;  2VA0 A;  2P9V A;  3LEZ A;  2J3T D;  2P04 A;  3E0Y A;  3VP0 A;  2P08 A;  1K55 A;  3MZE A;  2MJ6 A;  4KZ6 A;  3B42 A;  3FKV A;  1ZKJ A;  4EXO A;  4P0M A;  3A3D A;  3LY3 A;  3D3O A;  1Y28 A;  4WLA A;  3T1S A;  1FR6 A;  4E3L A;  4IUH A;  5HAR A;  3VSK A;  3MR0 A;  1TS6 A;  1VET A;  5CRF A;  4OOY A;  3WRT A;  5FA7 A;  1XJ4 A;  5E43 A;  4UEY A;  2GJ3 A;  4DE2 A;  1K25 A;  5A8B A;  4HH3 A;  3WS4 A;  3ZYT A;  4GLQ A;  2WKH A;  1MWT A;  2EX2 A;  2Z2M B;  4Y2F A;  2V0U A;  2PD7 A;  3SH7 A;  3D72 A;  4LV2 A;  5J8X A;  1PW8 A;  4EEU A;  3E4P A;  1XJ3 A;  2WAE A;  4WN5 A;  2K31 A;  4KZ8 A;  5CEC A;  4PMA A;  3CG5 A;  3KX0 X;  1J3W A;  4BWI A;  4DMZ A;  1YAX A;  3CIT A;  4EBL A;  1BSG A;  3ZG5 A;  3CZD A;  1TF1 A;  3DAV A;  1OT6 A;  1L0F A;  1IOU A;  2WZX A;  1IFQ A;  3UO9 A;  1KVM A;  4HJ3 A;  5FQ9 A;  5EVI A;  2BLS A;  2JKT M;  2KX6 A;  3C38 A;  3UE3 A;  2ZL1 B;  1H3Q A;  4MLL A;  2V20 A;  2PBD P;  4X1M A;  3ZQ5 A;  5DJU A;  4Q0J A;  2XQZ A;  1S1Y A;  5L10 A;  2V1B A;  3T4T A;  4PPR A;  2OWH A;  2O99 A;  2PRF A;  3G35 A;  5F1G A;  1NY0 A;  3BFE A;  1E25 A;  2JE5 A;  5HDC A;  5HWT A;  2IWB A;  3ZGA B;  3O3V A;  2Y91 A;  2DNS A;  4Y7P A;  2HJE A;  5EM0 A;  1EWZ A;  4GS9 A;  4KG5 A;  2H0Y A;  3FG8 A;  2XEP A;  3IWI A;  2QJ7 A;  5EVE A;  4NK3 A;  4JF4 A;  1YPR A;  2X01 A;  4GKU A;  1MBL A;  1YT4 A;  5EE8 A;  4O01 A;  1FCO A;  3M6H A;  1TVF A;  2VK3 A;  4CPK A;  3R7W B;  2ZM8 A;  1J9M A;  1H0M A;  3N6I A;  2XLN A;  3HJI A;  3F1P B;  4LGW A;  3HJK A;  3T4L A;  1ERQ A;  3Q7V A;  5G4Z A;  4ME4 A;  4OQ0 A;  4ZJ2 A;  2WUQ A;  3SS4 A;  5GHZ A;  2HDS A;  3M2J A;  4ARZ B;  4P6Z S;  4S2L A;  4HI4 A;  1OJG A;  3ZFZ A;  2PYR A;  3DW0 A;  3IX4 A;  1FIL A;  2ZJ9 A;  4HY8 A;  3F1O A;  3P98 A;  4HH2 A;  3A3E A;  1A0K A;  1DP9 A;  4DJ2 A;  3TW8 A;  1MPL A;  1W63 Q;  1L0D A;  4IED A;  5G18 A;  2HP6 A;  5JYO A;  4KZ4 A;  1PZO A;  2I9V A;  1MY8 A;  1JWV A;  3S7P A;  4Z1W A;  4K0W A;  2QKP A;  3CAX A;  3VOY A;  2Y2I A;  5HDS A;  3KYQ A;  1YSQ A;  4DXC A;  1N9B A;  4KZA A;  2YKH A;  2ZQ9 A;  3BQ8 A;  1MKI A;  3UME A;  5AQ9 A;  3E2K A;  2KOI A;  1JWZ A;  4OLD A;  2XD1 A;  1OPX A;  2A2L A;  2XRN A;  5AVE A;  4ZRR A;  2FZ0 A;  2LB5 A;  4ZBE A;  3CHW P;  1BLH A;  2Y2K A;  2H5S A;  5FDH A;  2ZC4 B;  3MJQ A;  3GEC A;  2WGW A;  2EFX A;  3A3F A;  3LR5 A;  3HL9 A;  2XFS A;  3BFG A;  3BLM A;  5DFY A;  4B93 A;  1UGU A;  4MDZ A;  5DKK A;  4JLF A;  4OPY A;  4WEJ A;  3QP8 A;  4JXS A;  2Y2P A;  2RCX A;  3PBT A;  5E2E A;  3U2A A;  3CJM A;  4X6T A;  2ZC7 A;  3MXS A;  1L0E A;  3IWO A;  1SCW A;  1JNU A;  3CWF A;  1FSW A;  1F98 A;  4QY5 A;  1G5U A;  2W3G A;  5KSH A;  2VGL M;  2VKS A;  1V9Z A;  4GNU A;  4IJG A;  3C4O A;  3Q1F A;  3W4Q A;  3L7H A;  5EVL A;  4PAU A;  4HJ6 A;  3OLO A;  4R3A A;  3T50 A;  2WKE A;  1S1Z A;  5C5K A;  2DCF A;  2D02 A;  3C7U A;  4NXE A;  2L0W A;  2UWX A;  4I38 A;  5IT5 A;  1KVL A;  1JTD A;  2IWC A;  1STZ A;  3LIC A;  5F83 A;  3LR4 A;  4NXF A;  1BT5 A;  2HP9 A;  3FZC A;  3N8L A;  3O5Y A;  4GOG A;  1DP8 A;  3KSH A;  4HEF A;  4CLC B;  2AVX A;  4XXR A;  1Q2Q A;  5FDS A;  5CGS A;  2ZC3 B;  3UY6 A;  2ZQ8 A;  4GB7 A;  5EVI D;  5BOH A;  1W8Y A;  1QMF A;  2HV1 A;  4KQQ A;  1PNE A;  3GQZ A;  2Y8H A;  2PR5 A;  3IX3 A;  3EEA A;  1MWU A;  3H7W B;  2M7U A;  2GDN A;  5DTT A;  1YLT A;  4S2P A;  5FI2 A;  3T1R A;  1X0O A;  3IT9 A;  2XA7 M;  4R38 A;  5U47 A;  1E3U A;  3HCY A;  4ZDX A;  3N8R A;  3V3S A;  4YOF A;  2VEA A;  4GD6 A;  4QWO A;  3T4K A;  3BW6 A;  1LT0 A;  4GN2 A;  4NXB A;  3MKF A;  1WE4 A;  1MWS A;  5FAQ A;  3HLG A;  3D9Y A;  4UAA A;  3MKE A;  5HX9 A;  4Y0T A;  5CGX A;  4EBP A;  3E4O A;  4H6J B;  4U0T A;  1UWN X;  1U60 A;  3V5M A;  3IS2 B;  4OP8 A;  3QP2 A;  5EOO A;  3BY8 A;  5HAI A;  3HBR A;  4O8G A;  2J3T C;  2ZOI A;  2BAS A;  2XRO A;  1VB6 A;  4WF0 A;  5GHY A;  4H8R A;  3GSG A;  4OON A;  2OLU A;  1YMX A;  1K4F A;  1HTZ A;  1SKO B;  3PBQ A;  1KE4 A;  3MZD A;  4WMC A;  1JWP A;  4X56 A;  1FOF A;  1FIK A;  1TS8 A;  3IF6 A;  4EQ1 A;  3NHQ A;  4DRT A;  1K38 A;  4I3I A;  5M1A A;  3VSL A;  3MQO A;  3BYD A;  3MF0 A;  5CHU A;  3TG9 A;  2PDR A;  4X1L A;  1DY6 A;  1VQQ A;  2HZ5 A;  2ZQA A;  4KUO A;  3HVF A;  4A5R A;  4JBF A;  1N9L A;  1IEM A;  4R6L A;  5DKL A;  2JBF A;  3BWL A;  4O0P A;  1NLY A;  4R3B A;  3VP4 A;  3DWK A;  1XFN A;  4I3J A;  3G32 A;  2ZM2 A;  3LIF A;  2V1A A;  2VGL S;  1ACF A;  4P87 A;  4E6W A;  3CMZ A;  4OVD A;  4C3Q A;  3BM6 A;  3NUL A;  1BTL A;  4LEN A;  3LIB A;  5FQM A;  2HP5 A;  4UA6 A;  5CHJ A;  2EX6 A;  3RH8 B;  2ZL1 A;  1LHY A;  2Q0O A;  5A91 A;  2WZZ A;  1G6A A;  4OP5 A;  1KGE A;  3QP4 A;  4RQ9 A;  1Y4O A;  4OOL A;  3K2N A;  4Y3I A;  1LL5 A;  1ODV A;  1FCM A;  3T4J A;  3OPL A;  4DDS A;  2B5R A;  1D1J A;  3IF5 A;  2XFT A;  5HAQ A;  4N1H A;  1CEG A;  3NOP C;  3CPT B;  1BZA A;  3B47 A;  1ZHH B;  2QYB A;  5HFO A;  4OKP A;  4QY6 A;  5E2H A;  1SDE A;  2JKT I;  1DJC A;  4IHQ A;  1CI9 A;  3BRM A;  3S22 A;  1N9N A;  1K57 C;  1ONG A;  2OSU A;  2A24 B;  3LGO A;  3OPP A;  5CTN A;  4EET B;  2O9A A;  1BYW A;  1TS0 A;  5CER A;  3FWL A;  4PM7 A;  2A3U A;  2L1M A;  1K56 A;  3L9K A;  4Y15 A;  1P9R A;  5F6A A;  3V67 A;  3NCK A;  3FPW A;  2FH5 A;  3R7W A;  3NOU C;  2J9O A;  3LCE A;  1H8Y A;  3PBS A;  4R70 A;  1ESI A;  2W1T B;  3SW1 A;  1ES3 A;  1RP5 A;  1S4R A;  1W79 A;  1ZTU A;  3UE0 A;  5DF9 A;  2XA7 S;  2IWD A;  4PM6 A;  4EU0 A;  1BLS A;  5A93 A;  3LR0 A;  1H8M A;  3DWZ A;  4ARZ A;  1GCE A;  4N1X A;  4EEP A;  2KLI A;  1G28 A;  2Y79 A;  2EWW A;  1ERM A;  1OTE A;  1PWG A;  4QD4 A;  2VGJ A;  2W1R A;  3TJZ C;  5FAS A;  5DF8 A;  1G6O A;  3MMH A;  4WZ5 A;  2UV0 E;  2WKI A;  2EXB A;  4ZJ1 A;  3UB7 A;  2Y2L A;  4Y17 A;  3T4Q A;  3SS5 A;  2ZC6 B;  1XPB A;  3TE8 A;  1MZU A;  5IS1 A;  3NOT C;  3MBZ A;  5TGF A;  4GW9 A;  4P85 A;  5AQA A;  1ZG6 A;  5FAP A;  1F9I A;  2HGV A;  4R4S A;  3D4F A;  1WA9 A;  4ZAM A;  1W5D A;  2HDQ A;  4DE0 A;  3T1Q B;  4LV1 A;  4EWF A;  4FH2 A;  5EEC A;  2W3E A;  1D7E A;  3LI8 A;  1YLY A;  4MBH A;  2OOL A;  2JKG A;  1ES4 A;  1I5Q A;  4NEE D;  3KO6 A;  4WYY A;  2O0Y A;  2Q9N A;  3LI9 A;  4IVK A;  1YLW A;  1C3B A;  5GLA A;  1ES2 A;  3K3C A;  3W4P A;  1W63 M;  1E3U D;  3TSG A;  5GHX A;  4MMN A;  3S7Q A;  4LLO B;  3BJN A;  4F3L B;  5TBM B;  5FEF A;  2OV5 A;  4S2N C;  5HD5 A;  4IBR A;  5EPH A;  4BBV A;  1IYS A;  1LI9 A;  4DE3 A;  4M4X A;  4MEZ A;  2ZOH A;  2GNX A;  4L9F A;  1L2S A;  4HQA A;  5FI6 A;  5I94 A;  1QME A;  2V9A A;  3T1X A;  3F1N B;  3H9W A;  3NIA A;  1VHM A;  1CEF A;  4L9G A;  3QNC A;  2QPN A;  1ES5 A;  1OME A;  3LFV A;  3WS2 A;  3JVU A;  2PHY A;  1PI4 A;  3MQ0 A;  4RA7 A;  1K55 C;  3PBN A;  1IYO A;  1SKF A;  3UDX A;  3I7J A;  2E8I A;  4WMC D;  1I2S A;  1K4E A;  3WRZ A;  1RCJ A;  3FKW A;  3OCN A;  2FFF B;  2WKP A;  4GS9 B;  4C75 A;  1WYB A;  2HPB A;  5AJG A;  4FSF A;  1ZC2 A;  2INW A;  3TRC A;  1JTG A;  5EM1 A;  4MN5 A;  4DN0 A;  1MXO A;  4HP4 A;  2V8F A;  3E2L A;  3VP3 A;  1BLP A;  3H82 A;  2BTF P;  3OPH A;  4R4R A;  3MFD A;  4U3T A;  2OAP 1;  2FFY A;  1XJ6 A;  1S0W A;  2PAV P;  2D01 A;  3UB8 A;  4CLC E;  3B33 A;  1NJ4 A;  3WS5 A;  4HES A;  3LY4 A;  1N9O A;  2WGI A;  5EV0 A;  3VV4 A;  1OJ5 A;  3ZG9 B;  4CLC A;  3ZVW A;  1XGJ A;  1FSY A;  1S66 L;  2V2F F;  5J4E A;  2B18 A;  4Q8I A;  1XA1 A;  1K54 A;  3P09 A;  3G6O A;  3VP1 A;  5KMW A;  1PIO A;  4L0L A;  4JGQ A;  3UB9 A;  1YM1 A;  4OQG A;  2OWJ A;  2V8C A;  2QZ6 A;  4BL3 A;  1T1B A;  2VLG A;  3ZNT A;  3S7O A;  4BEN A;  3F1O B;  3H7W A;  1RGY A;  4PKY G;  4DKI A;  3T4S A;  1VEU B;  4II7 A;  3QNB A;  3IQA A;  3KYZ A;  4R1G A;  3O87 A;  4QHC A;  1N4O A;  5GLC A;  1LL8 A;  1OTB A;  5K5B A;  1IKI A;  4QU3 A;  3EQU A;  1NRF A;  2PBY A;  3UPP A;  3EGD C;  5DFX A;  2ZMF A;  3HLF A;  5HPI A;  1O07 A;  3BFC A;  1M40 A;  3FC7 A;  4B4Z A;  4LV3 A;  2Y2G A;  2WGV A;  3ICY A;  3WWX A;  2JHE A;  3NJA A;  2QMI A;  2YKF A;  4Q0H A;  4QB8 A;  3C8C A;  4ETX A;  3PHY A;  2G2W A;  3SH8 A;  1BLC A;  5TR7 A;  3WS0 A;  2ZM0 A;  5DVA A;  5HD3 A;  2VV7 A;  4L9E A;  3UDI A;  1K56 D;  3IS2 A;  1JVJ A;  1W8Q A;  2DRW A;  2Z6D A;  1M6K A;  4I5S A;  3DBA A;  2JKR I;  5F5Y A;  2R9W A;  4IUK A;  4E3O A;  4LV0 A;  4XUZ A;  3PAE A;  2W3D A;  3UNW A;  3S4X A;  4N9K A;  1PYY A;  3Q07 A;  3HLD A;  4S2I A;  3ZDJ A;  1SKO A;  2ZLY A;  3N8S A;  2W0N A;  5FQK A;  1AXB A;  2XR0 A;  2K7S A;  4HOI A;  2W27 A;  4EBN A;  3VMA A;  3GTC A;  3BFF A;  4QPR A;  2EWV A;  1XJ2 A;  4R23 A;  2ZBB A;  3N4I A;  4E3K A;  3RFB A;  1YSP A;  5L8M A;  4ETZ A;  4R3J A;  3FV7 A;  1XX2 A;  4CJN A;  2CMN A;  5CTM A;  1IKG A;  5D3O A;  4OPQ A;  1T18 A;  1LI0 A;  3CLO A;  5HSQ A;  4MBF A;  3EOI A;  1H8Z A;  4FOF A;  4JGO A;  3O88 A;  2M7V A;  4EES A;  4RX3 A;  3UE1 A;  1CJF A;  2P7J A;  4RVA A;  5CX7 A;  3BQA A;  3JPU A;  1BUE A;  2Y2J A;  3W8K A;  3A3J A;  4WEK A;  1HZO A;  3CUE C;  3LID A;  3VE4 A;  2ZQC A;  1E4D A;  2IA2 A;  2J9P A;  5KZH A;  3DTE A;  4XT2 B;  4KG2 A;  2J8Y A;  2Y59 A;  2X71 A;  3GVB A;  1Y54 A;  1PWC A;  5HAP A;  3MXQ A;  2ACG A;  4MN6 A;  2O9C A;  1ONH A;  4GHI B;  4MCW A;  4N9L A;  2PU4 A;  3M2K A;  5KIZ A;  3NC8 A;  3S1Y A;  4F94 A;  5AVF A;  4ESP A;  3GRJ A;  3Q7Z A;  2EX9 A;  3CPT A;  4HP9 A;  3ZHH A;  4S2K A;  3RXW A;  3AGD A;  5EUA A;  5FQJ A;  1WYC A;  3T4O A;  1Q2P A;  1CQA A;  3Q82 A;  3W4O A;  2B95 A;  3VFF A;  2P74 A;  2H0T A;  5L2F A;  1NYY A;  2A24 A;  1NZO A;  4YIN A;  1Z09 A;  5DF7 A;  3SH9 A;  4UHU A;  5I5L A;  3ITA A;  4NET A;  2JC7 A;  1VM1 A;  4FH4 A;  3CI6 A;  3V3R A;  4IVI A;  1S67 L;  4FCF A;  1PW1 A;  3LIA A;  4OLG A;  5GL9 A;  1V9Y A;  2ZMA A;  2W1T A;  1LL9 A;  1NZU A;  3M6B A;  4X69 A;  3UPO A;  1O7E A;  3MQQ A;  4YFM A;  1OT9 A;  3ULF A;  1YMS A;  4E6X A;  1S6R A;  2G7U A;  3OZH A;  2QWS A;  1PWD A;  4EV4 A;  4WUJ A;  3A0V A;  3RTY A;  2M1C A; 
#chains in the Genus database with same CATH homology
 4WM9 A;  3UDF A;  4R4S A;  5CGW A;  2ZC5 B;  2Y4A A;  3D4F A;  2Y2N A;  4EQI A;  4ZAM A;  1W5D A;  2HDQ A;  3HL9 A;  4DE0 A;  2VGK A;  4DXB A;  4GDB A;  4LV1 A;  2C5W B;  2XFS A;  3OC2 A;  5GLD A;  3NI9 A;  5HW3 A;  2X02 A;  4EWF A;  1GHI A;  1KGG A;  4FH2 A;  5EEC A;  3AGF A;  4PM5 A;  3BFG A;  3BLM A;  2H10 A;  3PBO A;  2WAD A;  1YLY A;  3HLW A;  3NDE A;  4MBH A;  2J7V A;  5CHM A;  4JLF A;  1I2W A;  4OPY A;  4WEJ A;  2HDR A;  1ES4 A;  2Y2M A;  1I5Q A;  4JXS A;  3FYZ A;  4PM8 A;  2Y2P A;  1H5X A;  1HVB A;  3IWQ A;  4WYY A;  5CEB A;  2RCX A;  1KDS A;  2Q9N A;  3PBT A;  4DF6 A;  5E2E A;  4IVK A;  3CJM A;  4X6T A;  3IHA A;  1YLW A;  2R9X A;  1C3B A;  5EOE A;  2ZC7 A;  5GLA A;  3UPN A;  3C4P A;  3MXS A;  4GDN A;  2OLV A;  4P6B A;  1ES2 A;  3G4P A;  3W4P A;  1L0E A;  2XK1 A;  1E3U D;  3IWO A;  3TSG A;  5GHX A;  1SCW A;  1SHV A;  1IEL A;  1FSW A;  3IH9 A;  1SDN A;  3ZG7 B;  5FSR A;  4QY5 A;  4BL2 A;  3BLS A;  1ALQ A;  1KDW A;  3IHB A;  4PM9 A;  4WEL A;  4BD0 A;  5KSH A;  2V1Z A;  4GNU A;  5M18 A;  3IF6 B;  4RX2 A;  2OV5 A;  4HBT A;  3C4O A;  1G68 A;  3Q1F A;  3BEC A;  4X55 A;  1NXY A;  1EI5 A;  4N92 A;  4S2N C;  3W4Q A;  1FQG A;  1IYQ A;  4IBR A;  5EVL A;  5EPH A;  5GLB A;  1IYS A;  4XUX A;  2A49 A;  1ESU A;  3JYI A;  4S2M A;  4K0X A;  1K6S A;  1LI9 A;  2WKE A;  4DE3 A;  2ZD8 A;  3GR2 A;  4MEZ A;  2Y55 A;  4U0X A;  4X68 A;  1YLJ A;  3AGE A;  5A92 A;  1L2S A;  3WS1 A;  3G2Y A;  5FI6 A;  1KGF A;  5I94 A;  4OPZ A;  2DCF A;  1QME A;  3TOI A;  2ZQD A;  4O7D A;  3G30 A;  1IYP A;  3C7U A;  3NIA A;  4WZ4 A;  4JXV A;  4E3N A;  3RXX A;  1CEF A;  3IXH A;  4KQO A;  2UWX A;  4M3K A;  1FR1 A;  3QNC A;  1YLZ A;  2QPN A;  2XF3 A;  5JYP A;  4X53 A;  3NDG A;  1ES5 A;  1KVL A;  1OME A;  1W7F A;  1K54 C;  3HLB A;  3WS2 A;  1JTD A;  1PI4 A;  2IWC A;  4RA7 A;  4RYE A;  1K55 C;  3PBN A;  4KZ3 A;  4BJP A;  1IYO A;  3Q81 A;  1SKF A;  5F83 A;  3UDX A;  1PI5 A;  3SS3 A;  3UN7 A;  3I7J A;  3V50 A;  2E8I A;  4WBG A;  4WMC D;  5FQI A;  1BT5 A;  1I2S A;  1K4E A;  4JPM A;  1ZG4 A;  4UA7 A;  1YLP A;  2HP9 A;  2WYX A;  3FZC A;  1RCJ A;  3WRZ A;  3N8L A;  3FKW A;  5E2F A;  3OCN A;  4E3J A;  2FFF B;  4GOG A;  4HEF A;  1YQS A;  3HUM A;  4C75 A;  1WYB A;  2HPB A;  4XXR A;  2WK0 A;  4FSF A;  1ZC2 A;  4Z9Q A;  1JTG A;  1Q2Q A;  1RGZ A;  2P9V B;  1KE0 A;  5M19 A;  1MXO A;  5CGS A;  1DJA A;  1KE3 A;  3E2L A;  2ZC3 B;  2EX8 A;  2Y2O A;  3VP3 A;  1BLP A;  3UY6 A;  4EUZ A;  2ZQ8 A;  3HUO A;  4GB7 A;  5EVI D;  3OPH A;  4R4R A;  5BOH A;  3ZVT A;  1W8Y A;  3MFD A;  1GHP A;  4S2N A;  1QMF A;  4U3T A;  3VOZ A;  3ZCZ A;  4KQQ A;  3GQZ A;  5FI7 A;  2FFY A;  1S0W A;  3B3X A;  1XKZ A;  5FAO A;  4KZ5 A;  3ISG A;  1NJ4 A;  1MWU A;  3NBL A;  3WS5 A;  2G2U A;  1BUL A;  3BFD A;  3HLC A;  4HES A;  4BD1 A;  3LY4 A;  2GDN A;  3PBR A;  5DTT A;  3LO7 A;  1YLT A;  2WGI A;  4S2P A;  3ITB A;  5FI2 A;  1TEM A;  4B88 A;  3IT9 A;  3OPR A;  3ZG9 B;  5AQ7 A;  1TDL A;  3N7W A;  3VP2 A;  1XGJ A;  3ZVW A;  1FSY A;  5U47 A;  3G2Z A;  1CI8 A;  5IHV A;  1E3U A;  1FCN A;  1XXM A;  2V2F F;  4KQR A;  2Y2Q A;  2P9V A;  5KSC A;  3LEZ A;  3IF6 C;  4ZJ3 A;  3VP0 A;  4ZDX A;  4KG6 A;  3N8R A;  4Q8I A;  1XA1 A;  3V3S A;  1K54 A;  3P09 A;  1GA9 A;  3VP1 A;  4GD6 A;  1K6R A;  5KMW A;  1Z6F A;  1PIO A;  2EXA A;  2Y2H A;  1K55 A;  3MZE A;  4L0L A;  4KZ6 A;  1YM1 A;  3FKV A;  4MNR A;  4OQG A;  1ZKJ A;  2QZ6 A;  4GN2 A;  5DTK A;  4BL3 A;  3MKF A;  2XH9 A;  1WE4 A;  2CC1 A;  4P0M A;  1MWS A;  3A3D A;  3LY3 A;  4UA9 A;  5FAQ A;  3HLG A;  4UAA A;  3ZNT A;  4JKT A;  4D2O A;  3MKE A;  5HX9 A;  4BEN A;  3IXB A;  4Y0T A;  1RGY A;  4DKI A;  5CGX A;  5TFQ A;  1FR6 A;  4E3L A;  4EBP A;  3QNB A;  5HAR A;  3ZG0 A;  3VSK A;  3IQA A;  5CRF A;  4R1G A;  3IH8 A;  1ERO A;  3O87 A;  4OOY A;  4U0T A;  3ZG8 B;  4QHC A;  1N4O A;  3WRT A;  5FA7 A;  5GLC A;  1U60 A;  5E43 A;  4LCM A;  3V5M A;  1IKI A;  4DE2 A;  4QU3 A;  3EQU A;  1K25 A;  1NRF A;  3WS4 A;  4BLM A;  4OP8 A;  2WKH A;  5EOO A;  2PBY A;  1MWT A;  3UPP A;  2XDM A;  2EX2 A;  3HLF A;  2Z2M B;  3IXG A;  5EVI B;  2ZQ7 A;  5HAI A;  1O07 A;  3HBR A;  3BFC A;  1M40 A;  3SH7 A;  4LV2 A;  5J8X A;  4K91 A;  5GHY A;  4B4Z A;  4H8R A;  4LV3 A;  3HLE A;  2Y2G A;  4QJG A;  1PW8 A;  2WGV A;  3GSG A;  2OLU A;  4OON A;  3WWX A;  1YMX A;  1K4F A;  1HTZ A;  2QMI A;  2WAE A;  2XGN A;  4QB8 A;  1CK3 A;  3PBQ A;  4KZ8 A;  5CEC A;  1KE4 A;  3MZD A;  4PMA A;  4WMC A;  3CG5 A;  4GZB A;  1JWP A;  2G2W A;  3SH8 A;  4X56 A;  1BLC A;  1FOF A;  5TR7 A;  4EBL A;  1BSG A;  3IF6 A;  3WS0 A;  2ZM0 A;  5DVA A;  4DRT A;  1K38 A;  3DTM A;  1DJB A;  4DDY A;  1XGI A;  3UDI A;  1K56 D;  3ZG5 A;  5M1A A;  3VSL A;  3CZD A;  3BYD A;  5CHU A;  1JVJ A;  1W8Q A;  4S2O A;  3TG9 A;  3V39 A;  1L0F A;  3C7V A;  1DY6 A;  2DRW A;  2WZX A;  5FQQ A;  1VQQ A;  4Y0U A;  1M6K A;  4GD8 A;  4OQI A;  3UO9 A;  1KVM A;  5FQ9 A;  2ZQA A;  5EVI A;  2BLS A;  2R9W A;  2XD5 A;  4E3O A;  4LV0 A;  3UE3 A;  4XUZ A;  1PZP A;  3HVF A;  4IBX A;  3PAE A;  4A5R A;  4JBF A;  2V20 A;  4MLL A;  3UNW A;  1IEM A;  1XA7 A;  3S4X A;  2XQZ A;  2JBF A;  4N9K A;  4JXW A;  1PYY A;  3Q07 A;  3HLD A;  4R3B A;  4S2I A;  3ZDJ A;  3VP4 A;  4PPR A;  3DWK A;  2ZLY A;  5E2G A;  3N8S A;  3G35 A;  5FQK A;  3G32 A;  5F1G A;  2ZM2 A;  1AXB A;  2XR0 A;  1NY0 A;  4KZB A;  4P87 A;  1LLB A;  3BFE A;  4E6W A;  1E25 A;  4EBN A;  3CMZ A;  3GTC A;  4OVD A;  3VMA A;  3BM6 A;  4C3Q A;  2JE5 A;  4OH0 A;  1BTL A;  4LEN A;  2IWB A;  3BFF A;  5FQM A;  3ZGA B;  3O3V A;  2HP5 A;  2Y91 A;  2DNS A;  4R23 A;  4Y7P A;  3Q7V B;  3N4I A;  4UA6 A;  4E3K A;  5CHJ A;  3O86 A;  1EWZ A;  2EX6 A;  3HRE A;  4R3J A;  3FV7 A;  1XX2 A;  1LHY A;  4KG5 A;  5D3O A;  5CTM A;  1IKG A;  2H0Y A;  4CJN A;  4OPQ A;  4MBK A;  5A91 A;  4C6Y A;  5CXW A;  2WZZ A;  1G6A A;  2XEP A;  1LI0 A;  1KGE A;  3IWI A;  4OP5 A;  1L0G A;  5AQB A;  3NY4 A;  4E3I A;  4NK3 A;  4JF4 A;  5FAT A;  4MBF A;  4OOL A;  2BG1 A;  3BEB A;  1H8Z A;  1LL5 A;  2X01 A;  3O88 A;  1FCM A;  1XP4 A;  4GKU A;  1MBL A;  3OPL A;  4DDS A;  2B5R A;  1YT4 A;  5EVI C;  5EE8 A;  4RX3 A;  3UE1 A;  4DE1 A;  3IF5 A;  1FCO A;  3M6H A;  1TVF A;  2XFT A;  3G34 A;  4S2J A;  5HAQ A;  4CPK A;  4RVA A;  2ZM8 A;  4N1H A;  1CEG A;  1J9M A;  4JF5 A;  3N6I A;  2XLN A;  1BZA A;  5HFO A;  4OKP A;  1BUE A;  1ERQ A;  2I72 A;  2Y2J A;  3Q7V A;  4LCL A;  4QY6 A;  3W8K A;  4WZ5 C;  4OQH A;  3A3J A;  4WEK A;  5E2H A;  2JCH A;  1HZO A;  1SDE A;  2EFU A;  1DJC A;  1NYM A;  4OQ0 A;  4ZJ2 A;  2ZQC A;  1CI9 A;  1E4D A;  2J9P A;  2WUQ A;  3BRM A;  4FD8 A;  3SS4 A;  3S22 A;  5KZH A;  1K57 C;  5GHZ A;  1ONG A;  4KG2 A;  2OSU A;  1GHM A;  2J8Y A;  2Y59 A;  2HDS A;  3M2J A;  4OPR A;  2X71 A;  3GVB A;  1Y54 A;  3OPP A;  2Q9M A;  4Y0O A;  5CTN A;  1PWC A;  3ZNY A;  5HAP A;  5CER A;  3FWL A;  4S2L A;  1ONH A;  3C5A A;  4HBU A;  4N9L A;  2PU4 A;  5CED A;  4PM7 A;  4JXG A;  2A3U A;  3ZFZ A;  3M2K A;  3A3I A;  3DW0 A;  1K56 A;  3NC8 A;  4E3M A;  3NCK A;  4ZTK A;  3S1Y A;  4F94 A;  2ZJ9 A;  4R0Q A;  3GRJ A;  4JF6 A;  3Q7Z A;  2EX9 A;  3P98 A;  2J9O A;  3GV9 A;  3A3E A;  3LCE A;  2HDU A;  1H8Y A;  3SOI A;  3ZHH A;  3PBS A;  1MPL A;  4S2K A;  3RXW A;  3AGD A;  1ESI A;  1L0D A;  5EUA A;  1ES3 A;  4IED A;  1RP5 A;  3QHY A;  5FQJ A;  1WYC A;  3GMW A;  5G18 A;  1W79 A;  3UE0 A;  3IXD A;  5DF9 A;  3VFH A;  2HP6 A;  5JYO A;  4KZ4 A;  1Q2P A;  2C6W B;  2RL3 A;  2IWD A;  4PM6 A;  4OOM A;  3PTE A;  3Q82 A;  3MXR A;  1GA0 A;  3HUN A;  3W4O A;  1BLS A;  1PZO A;  3OCL A;  5A93 A;  1MY8 A;  3VFF A;  2P74 A;  1JWV A;  2H0T A;  4K0W A;  5L2F A;  1NYY A;  3G31 A;  1NZO A;  3DWZ A;  1GCE A;  5DTS A;  4N1X A;  4YIN A;  5DF7 A;  3SH9 A;  2WGW B;  3VOY A;  4UHU A;  2Y2I A;  3ITA A;  4NET A;  1ERM A;  1PWG A;  2JC7 A;  4QD4 A;  1VM1 A;  4FH4 A;  3V3R A;  2VGJ A;  5HL1 A;  2PU2 A;  1HD8 A;  5FAS A;  4DXC A;  1N9B A;  4IVI A;  5DF8 A;  4KZA A;  4WZ5 A;  4FCF A;  2ZQ9 A;  2WKI A;  1MKI A;  4KEN B;  3MZF A;  1PW1 A;  5AQ9 A;  3E2K A;  4OLG A;  5GL9 A;  1JWZ A;  2EXB A;  4OLD A;  4ZJ1 A;  2ZMA A;  2XD1 A;  1LL9 A;  4KZ7 A;  1K57 A;  1NZU A;  5A90 A;  2Y2L A;  2WAF A;  3EQV A;  3M6B A;  5F82 A;  4X69 A;  3SS5 A;  2ZC6 B;  1TDG A;  3UPO A;  3PAG A;  5F1F A;  1XPB A;  1O7E A;  4YFM A;  2Z2L B;  4ZBE A;  5TGF A;  3MBZ A;  3RJU A;  1YMS A;  4ID4 A;  4P85 A;  4E6X A;  5AQA A;  1MWR A;  1S6R A;  1ZG6 A;  4B4X A;  4BQM A;  1BLH A;  2Y2K A;  3OZH A;  5FAP A;  2H5S A;  1PWD A;  5FDH A;  2ZC4 B;  4KZ9 A;  4EV4 A;  2WGW A;  2EFX A;  3A3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...