4KQDA

The crystal structure of the n-terminal pas domain of the f plasmid traj
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
IDLLENLTAVIQDYPNPACIRDETGKFIFCNTLFHESFLTQDQSAEKWLLSQRDFCELISVTEMEAYRNEHTHLNLVEDVFIQNRFWTISVQSFLNGHRNIILWQFYDAAHVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TraJ
publication title The crystal Structure of the N-terminal PAS domain of the F plasmid TraJ
rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 30
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kqdA00
1DRMA 3CLOA 2VV6A 4LRXC 5DJTA 3UMEA 2YKHA 5I5LA 1P0ZA 1VB6A 2QJ7A 3HJIA 5IS1A 2WKPA 2QJ5A 3FG8A 2V9AA 3NOPC 3IS2B 1JNUA 3H7WA 3IBRA 4XT2A 3MR0A 2R78A 2PR5A 5J3WA 3NHQA 3BWLA 2KX6A 2VEAA 3P7NA 1T1BA 5F69A 2CMNA 3H9WA 5F68A 1G28A 3NJAA 1XJ4A 3UB9A 3E4OA 3A0RA 3NOUC 3RH8B 1OTBA 2GJ3A 4JGPA 4RQ9A 5HSQA 2WKRA 1OTAA 1GSVA 2PDRA 1XJ3A 3LIAA 4KQDA 1S67L 2V0UA 2VV7A 3MFXA 4H6JA 2EA9A 2KDKA 2OWJA 4HY8A 1Y28A 4GS9A 4HNBA 5EFWA 1LT0A 2H28A 3GECA 1UWNX 5AVFA 3G6OA 3PYPA 2PYRA 1BYWA 2PHYA 4F3LB 1DP6A 3K3CA 4B9OA 1KOUA 4JGOA 3F1OB 2M1CA 1T1CA 4YWZA 2B02A 1UWPX 5HWTA 3LIBA 4I38A 1D7EA 3VE3A 3SW1A 3PHYA 4L9FA 4WL9A 5TBMB 1P97A 2JN7A 2PD7A 3UB7A 3A0SA 4L9EA 2ZOHA 1S1YA 3H82A 4BBVA 4NXEA 3BY9A 4NXFA 2VLGA 5J7EA 4HP9A 4WN5A 1GSWA 3MJQA 4E04A 2A24A 1N9NA 4EEUA 3A0VA 4I3AA 3C2WA 2D02A 4KUKA 4NXBA 4HI4A 1F98A 3IS2A 3ZQ5A 2W0NA 3EEHA 4EXOA 4NXGA 4BBTA 5HD5A 4I39A 3LIFA 4WLAA 2HV1A 3UB8A 4EEPA 1S4RA 4HH2A 1XFQA 4EERA 3BY8A 5DJUA 1EW0A 3T50A 1ODVA 2WKQA 3VOLA 3UE6A 4EETB 1N9LA 2I9VA 3LIEA 1UGUA 3B33A 3E4PA 2L1MA 3E4QA 4LRZE 5IU1A 5HDSA 2J80A 3EWKA 5G4ZA 1OJ5A 4JGQA 3OLOA 3LI8A 1DP8A 4L9GA 4R70A 3HJKA 1XJ6A 3CWFA 4GHIB 4R3AA 1OTIA 3GDIA 2PYPA 4EQ1A 4LLOB 4I3JA 1X0OA 1LSWA 5G4YA 3ULFA 4K08A 3KX0X 2L0WA 3K3DA 4R38A 1TS7A 4GCZA 1S66L 4WUJA 4M4XA 4KUOA 3LI9A 4HJ3A 2V0WA 3D72A 2ZOIA 1OJGA 1T19A 2K7SA 4HHDA 3LICA 1V9YA 4HOIA 3F1NB 1XFNA 5HDCA 3LUQA 3MQOA 3F1PB 3H82B 5HDDA 1NWZA 3FC7A 5F6AA 1S4SA 4HQAA 4HIAA 2P7JA 1D06A 5DKLA 5DKKA 1F9IA 3VE4A 2A24B 2YKFA 1T18A 1DP9A 2QKPA 4PKYG 5HD3A 4HP4A 3LYXA 1MZUA 3H7WB 1WA9A 3C8CA 3RTYA 4XT2B 4HJ6A 5HWWA 5J4EA 1N9OA 2V1AA 2VV8A 2QHKA 5A8BA 2BASA 4HH3A 3UB6A 2PD8A 1S1ZA 1TS0A 2JHEA 4WF0A 1LSXA 5KIZA 2D01A 4HJ4A 3NOTC 2QWSA 5F5YA 4I5SA 4DJ3A 1OT6A 4H6JB 4JGRA 3CAXA 2Z6DA 2INWA 4GS9B 1GSXA 1XJ2A 2W27A 4EW7A 4F3LA 1TS8A 4R6LA 3LIDA 1OTDA 3F1OA 3MQQA 1V9ZA 2OOLA 3ICYA 4GHIA 3MXQA 4EESA 1T1AA 2V1BA 2OWHA 4LPZA 4PKYA 5HWVA 1LL8A 5TBMA 5HZHA 4MN5A 2PR6A 2Z6CA 4DJ2A 4I3IA 1TS6A 4BBUA 2ZBBA 4MN6A 1LSVA 2L4RA 1OTEA 3UMDA 4GW9A 1OT9A 3F1NA 4LRYC 3F1PA 5AVEA
chains in the Genus database with same CATH superfamily
3W4QA 3DTIA 4LRXC 3UMEA 2YKHA 3ZG9B 1N4OA 2VGKA 5FA7A 4PM8A 4IVIA 4E3OA 3NOPC 3HL9A 2C5WB 4OPZA 1K0KA 4D60A 5CECA 2WYXA 3RXXA 1IYQA 3VSLA 3IBRA 4MLLA 4LV2A 3ZNTA 2EX9A 1HTZA 4E6XA 3VV4A 3SS3A 4JXGA 5J3WA 3NHQA 2HZ5A 1H3QA 4EUZA 5GLDA 2KX6A 3E0YA 2XQZA 4O7DA 2CMNA 3VP0A 4GJ4A 1PW1A 1XJ4A 3VP4A 2ZL1B 3NC8A 4WMCD 3NOUC 3AGFA 2HPBA 3PBSA 5HPIA 5BOHA 2WKRA 1IFQA 3NY4A 1ESUA 3OOVA 1S67L 1K55A 2HDRA 2V0UA 4R3BA 4H6JA 2XD1A 3DTEA 4BLMA 3A3DA 2EA9A 1MC0A 4E3NA 4YNRA 1LT0A 2H5SA 3GECA 4X56A 3S7NA 1Y4OA 4PM7A 5AVFA 5EUAA 3LR3A 5E2GA 2PU2A 1I2SA 1VHMA 3FPVA 1DP6A 1PFLA 3K3CA 1IYOA 1YMSA 3OPLA 2BTFP 2W1TB 1SCWA 4YWZA 1YSQA 1MWUA 1GA9A 3C7VA 4I38A 1D7EA 3VE3A 5MC7A 4CLCD 2HP6A 1P97A 3Q81A 4DN0A 5FATA 1JVJA 2ZMVA 4X1LA 3HUNA 4UQIM 5CGWA 4ZBEA 3S7PA 4P0MA 4NXFA 1L3LA 5J7EA 3R4KA 4DXBA 4MMNA 4PMAA 2JBFA 2XLNA 5CGSA 4OQHA 1K54A 3BFCA 4R23A 4E04A 2WKEA 2A24A 1I5QA 4P6ZM 1N9NA 4BD0A 5EVLA 1FSYA 2EFUA 1DY6A 1BT5A 2IWCA 4KUKA 3PBRA 3U4LP 3IHAA 3M2JA 3D3OA 2W0NA 5HAIA 1A0KA 3P98A 1DJCA 4BJPA 3ZG5A 4XUXA 2XK1A 1G6AA 4PPRA 5EVIC 3VOZA 1XFQA 4EERA 3BY8A 2O0YA 1EW0A 1ODVA 2PBDP 4ETXA 1P9RA 4MNRA 1MBLA 4DXCA 2W3DA 5A93A 3WRZA 1UGUA 4X55A 4DDYA 3KYZA 5GLCA 1L2SA 3G31A 3TRCA 2HGVA 1MKIA 4RX2A 1SZVA 3T4SA 2XSSA 4PM9A 5FASA 1OJ5A 4JGQA 4K91A 3LI8A 3Q1FA 4R70A 1DJBA 3HJKA 4AFIA 5LBRA 1OTIA 1VEUB 1LHYA 4EQ1A 3A3JA 2W1TA 3ULFA 1L0DA 1FQGA 2G2UA 3O5YA 5GLAA 2Q0OA 2VGLM 2Y4AA 3M2KA 1Q2PA 3IX4A 4HJ3A 1PI4A 3ITBA 2V0WA 3BM6A 4QWOA 3SZTA 4FSFA 1JWZA 3P09A 3GV9A 5TGFA 4CQHA 4D2OA 4S2MA 3DTMA 4HOIA 3F1NB 1JTGA 5AQ9A 3ZG0A 3H82B 5HDDA 1YMXA 2JKRM 4N1HA 2ZMFA 1KE4A 3EQVA 4HIAA 3OZHA 1SHVA 2R9WA 3V5MA 3HVFA 1W7FA 5DKKA 3LR5A 2EX2A 2WK0A 3UY6A 3VE4A 2YKFA 3EOIA 3SS5A 2A3UA 4HEFA 1ERQA 1T18A 1XA1A 4PKYG 2X71A 3LYXA 3R7WB 4XUZA 3RTYA 4XT2B 5F83A 2EWWA 4LFUA 5L09A 2NUPC 2VV8A 4KZ3A 3PAGA 1TD5A 5A8BA 4DE0A 3I7JA 2Y2HA 2BASA 2UV0E 3VP3A 4CLCB 5A90A 5FL3A 5EVEA 2FFYA 3NBLA 4Q8IA 4HJ4A 5F5YA 2HJ9C 3D9YA 1K56A 3IF6C 1MWSA 4JGRA 2Z6DA 3BFFA 4R4SA 2Y91A 1XGJA 3LIDA 3F1OA 2OOLA 1VEUA 3MXQA 4EESA 4N9LA 4FH2A 3T1RA 2W3FA 4B4XA 4PKYA 2B5RA 2Y2MA 4MN5A 2PR6A 4C75A 2PBYA 4DJ2A 2DRWA 3CUEC 3MMHA 4P87A 1YLPA 4RA7A 4BBUA 1GA0A 2ZBBA 4ID4A 4WEKA 4UAAA 2L4RA 1K25A 4GW9A 1RGYA 4C6YA 3F1NA 4LRYC 1IYPA 2EX6A 4LCMA 4BWIA 3HUOA 1BLSA 4Z1WA 2GZAA 4EBNA 2VV6A 1ZHHB 4GB7A 3GMWA 3KSIA 1CF0A 3PR6A 4OPYA 3WRTA 2QJ5A 1HVBA 2Z2MB 1W8QA 2O9CA 5AQAA 1ZG4A 3MZDA 3IS2B 4Q0HA 3UB5P 4Z9QA 1JNUA 3LEQA 3R7WA 5M19A 2VKSA 3B3XA 4NG2A 3N8LA 4XT2A 2Y2LA 1U60A 3MR0A 1H8MA 4Q0JA 2PR5A 5DTSA 4E3KA 5AJGA 5EM1A 3BWLA 3KSGA 1CEGA 1YM1A 3P7NA 4MCWA 1T1BA 1PZPA 3IT9A 4ESPA 5F68A 4CLCA 4YFMA 1Z6FA 2GJ3A 3HLWA 1STZA 2P04A 4GN2A 4ARZB 1H8YA 3OBFA 3MFXA 3BFGA 4JF6A 3IX3A 2WUQA 2FZ0A 4HY8A 1Y28A 5E43A 5EFWA 3BEBA 2H28A 2EFXA 3N7WA 4IJGA 1IKIA 2XDMA 2Y2PA 4WEJA 1BYWA 4KZBA 2PRFA 1SKFA 2K2NA 1K6SA 3ZHHA 2V8CA 4F3LB 1L0EA 4B9OA 4JGOA 3IXDA 2M7UA 3T1QB 3IXGA 5TJJA 3GRJA 5A92A 2B02A 2ZQCA 3V3SA 4EV4A 4R4RA 3LIBA 1K38A 4ZJ3A 5EVID 4BQMA 4QB8A 4Y15A 3MBZA 3PHYA 4L9FA 3JPUA 5IT5A 5TBMB 2V20A 3UB7A 4N92A 2ZOHA 5CEBA 5CX7A 1LL9A 3WS0A 4X53A 4B93A 4Y7PA 4DE2A 3BY9A 2VLGA 4EU0A 5FAOA 4IHQA 3ZNYA 3HLEA 4S2PA 3RXWA 4WYYA 3G2ZA 1FCMA 3MJQA 1BLHA 4GD8A 2GDNA 3A0VA 2FFFB 4OPQA 3C2WA 2C6WB 2D02A 1RCJA 3DW0A 4S2OA 5FQKA 2O99A 5HAPA 1ES5A 3IS2A 4K0WA 4CPKA 4R3JA 1NZUA 3OPPA 3ZG7B 3MQ0A 5HPFA 3S7OA 3LIFA 3FPWA 2IWBA 3S4XA 4OLGA 5CXWA 1GHMA 2O9BA 4Y5FA 1SDNA 4FUWA 4OQ0A 1CQAA 5FEGA 1S4RA 2Q9NA 3WS4A 1ZTUA 5EV0A 5DJUA 2IA2A 3LO7A 5E2EA 4FOFA 3VFFA 1TEMA 3ZYTA 1NRFA 4GLQA 3LIEA 4CJNA 1PI5A 3SH8A 4JXWA 3E4QA 3MF0A 5FAQA 3L9KA 4GDBA 2ZQ7A 4MBFA 1IELA 5G4ZA 2QPNA 2Y2JA 1W63Q 2GNXA 3CWFA 3MKEA 4O8GA 3GDIA 3AGEA 4G3VA 4LLOB 4I3JA 3BQAA 3HCYA 3HLCA 1W5DA 5G4YA 4OP8A 2HDUA 4K08A 4HBTA 4QY6A 4MEZA 3K3DA 4R38A 1TS7A 5A91A 2Y2NA 3BRMA 1PWGA 4KUOA 5GHZA 1IOUA 1W63M 3GVBA 3D72A 2ZOIA 1AWIA 4LENA 1OJGA 1T19A 2K7SA 2Y79A 3G4PA 4HHDA 1XFNA 1HZOA 3MQOA 3CITA 2ZC7A 4OLDA 5DTKA 4OOYA 1NWZA 3FC7A 2X02A 4HQAA 3LY4A 4R1GA 4O0PA 5FQJA 2P7JA 2PAVP 1LLBA 5DKLA 2HDQA 3SS4A 4DE1A 4QU3A 3QHYA 4X25A 2KOIA 3T1XA 4KZAA 2HF6A 4U3TA 3U2AA 1FCNA 5G18A 5EECA 4DF6A 3EQUA 5DF8A 1DP9A 3ZCZA 5HD3A 3HLGA 5EPHA 2Y2IA 1K57C 4UHUA 3H7WB 4Y3IA 3C8CA 4E3LA 3P01A 1RP5A 4E6WA 2K31A 3GQZA 1KE0A 1KVMA 1LL5A 3JYIA 3CPTB 5HL6A 2ZL1A 5HARA 1QMFA 5AQBA 3UPNA 5EVIB 1PWDA 2H10A 4JLFA 2PD8A 3GR2A 4WF0A 3CMZA 3OC2A 5KIZA 2D01A 3QP6A 1XKZA 2HP5A 3LGOA 4N1XA 4DJ3A 2G7UA 1OMEA 2FH5A 3ZVWA 1OT6A 4Y0TA 3NI9A 2XA7S 3VP2A 2ZM0A 3CAXA 4RYEA 1PRQA 4FH4A 4OP5A 4K0XA 2W27A 3Q07A 4QHCA 1XP4A 1KGFA 3TG9A 1TS8A 3BFEA 3VMAA 1OTDA 3G32A 3S7QA 5EE8A 1H0MA 1V9ZA 3ICYA 3TOIA 2QZ6A 1QMEA 4X69A 3FYZA 1LL8A 2H0YA 4FTXA 2WADA 1E3UD 2Z6CA 4I3IA 2ZLYA 1BLPA 1JTDA 2WGVA 4KENB 1L0FA 4MN6A 3NULA 3T1SA 1MXOA 1OTEA 2Y55A 1OT9A 1EWZA 4NEED 3UPOA 5CEDA 5CTNA 4S2NC 2XF3A 1DRMA 4U0TA 5DJTA 5DFYA 5FEFA 4WM9A 3G2YA 1M40A 1P0ZA 1VB6A 3CZDA 4WELA 3C5AA 2Y8HA 2Y2OA 2B95A 3M6HA 2V9AA 4S2KA 2EXBA 3IH9A 4X6TA 3WS5A 2A2LA 3N4IA 1ALQA 1BSGA 1KVLA 3OCNA 4KQOA 3H7WA 1K6RA 2OSUA 4EBLA 2P08A 4NETA 2ACGA 4DRTA 4EBPA 2BG1A 3CPTA 2JKTM 4UA9A 2X01A 4EUVA 5HFOA 1S6RA 2VEAA 3IQAA 3EEAA 3DBAA 3BLMA 5EVIA 2OLUA 3H9WA 1G28A 4KZ9A 3M6BA 3E4OA 3DWKA 3T4JA 1WE4A 5DFXA 1OTBA 2JE5A 4JGPA 4RQ9A 5FQMA 3S1YA 1OTAA 2VGJA 3LIAA 4KQDA 1BTLA 3KO6A 3IF6B 2OWJA 2KDKA 4DDSA 5FQQA 2V8FA 4HNBA 2JKGA 5M18A 2QYBA 5L8MA 3PYPA 3ZVTA 2PYRA 1FR6A 5M1AA 4KZ7A 2PHYA 3HBRA 3ISGA 3BLSA 2XH9A 4G3WA 2OV5A 4OKPA 5KSCA 1G5UA 2WAEA 1YLZA 2EXAA 3RJUA 5DVAA 1UWPX 2OAQ1 4ZJ2A 5GHYA 5HWTA 4E3MA 1NLZA 2A49A 1CI9A 2NUTC 4OVDA 1F2KA 2JN7A 1PNEA 3IX8A 4WMCA 1KE3A 2PD7A 2RL3A 1CEFA 1NY0A 2VX8A 3KYQA 3H82A 4WZ5C 1FSWA 4WZ4A 3EGDC 2ZQAA 1K4EA 1NRJA 3QP8A 4HP9A 1YLYA 4Y0OA 3E98A 4WN5A 1ONHA 1IKGA 3V50A 4EEUA 5JYOA 1YT4A 2VZWA 4DKIA 3TSGA 2XROA 3ZDJA 5J8XA 2Y2GA 1XPBA 4OOLA 2JC7A 4F94A 3EEHA 1XX2A 4EXOA 4IUHA 4ME4A 3NDGA 2W3GA 1IEMA 2HP9A 4ETZA 4RVAA 4OQIA 3GSGA 4WLAA 5HX9A 2XR0A 3UDFA 2IWDA 5CHJA 5TFQA 2OAP1 3DAVA 1XGIA 4HH2A 3SOIA 1D1JA 3WWXA 3O87A 4GKUA 3T50A 1NXYA 2GX5A 4KG6A 2WKQA 1YAXA 4X1MA 3VOLA 3V67A 2HJEA 4KZ6A 1H8ZA 1VQQA 2VA0A 3MFDA 1FOFA 3MS6A 2W3EA 1N9LA 2ZJ9A 3C4OA 2I9VA 1K55C 4KG2A 2W1RA 1GHIA 2XFSA 3UO9A 3IF6A 4KQRA 3E4PA 1FR1A 3LR4A 4P85A 3CG5A 4ZAMA 4LRZE 5C5KA 3CJMA 1TVFA 1SKOB 4NKPA 5IU1A 3SH9A 1PW8A 2J80A 3EWKA 2WZXA 2HDSA 3OLOA 5CTMA 2J3TC 4OONA 1XJ6A 3VSKA 4E3JA 5E2HA 5L10A 5CGXA 2B18A 5I94A 5FQ9A 4UA6A 3QP2A 2L0WA 4FCFA 4HESA 3ZGAB 2E8IA 4GCZA 5FI6A 1S66L 3MSHA 4WUJA 4Y0UA 3CUEA 4DE3A 3Q7VB 1NJ4A 3G34A 1EI5A 1OPXA 2LB5A 3ITAA 3OPHA 2Y59A 3LICA 1V9YA 3BQ8A 3LR0A 4X68A 1S4SA 3L7HA 4UA7A 2WAFA 4JBFA 1K54C 1K56D 5KZHA 3N8RA 1BLCA 2XD5A 1Q2QA 4YINA 3W2ZA 3NDEA 4DMZA 3UE0A 3G35A 4BMWA 4MN7A 2ZQ9A 2A24B 3MZFA 2QKPA 1ACFA 4HP4A 4KZ8A 1WA9A 3W4PA 5GHXA 2J3WA 4QPRA 4HJ6A 3CI6A 4IBXA 5AQ7A 4CLCE 5J4EA 4ZRRA 1E25A 2QMIA 1YKDA 1N9BA 2QHKA 1AXBA 4JKTA 3QP5A 1E3UA 4MDZA 3G30A 3BJNA 1FILA 2V1ZA 5DF9A 4UQIS 3C4PA 3OCLA 1S1ZA 1TS0A 3A3IA 3JVUA 2WGIA 3FZCA 4ARZA 1JWVA 3DTKA 1Y54A 2DMWA 2QWSA 2W3HA 3NOTC 3FKVA 1CJFA 2JCHA 2EWVA 4QD4A 1HD8A 4P6ZS 3IXHA 2ZQDA 1W79A 3MKFA 3HLBA 1SKOA 4GS9B 1YLJA 1GSXA 3VOYA 1G6OA 1KDWA 4F3LA 3V3RA 1J9MA 3UPPA 4ZJ1A 1S0WA 4R6LA 3DWZA 5CHMA 4Y2FA 3NIAA 4OOMA 2V1BA 4LPZA 4XXRA 5HWVA 1PYYA 5TBMA 5HZHA 2WGWB 1TS6A 3LCEA 2PU4A 2VJWA 3Q7VA 4ZDXA 5FQIA 4PAUA 5U47A 4EQIA 3UMDA 3EGXC 4LV3A 2P9VB 4S2LA 5HW3A 3T12B 2DCFA 3T4OA 1NLYA 5CHUA 5FSRA 3CLOA 3ZFZA 2Y2QA 4M3KA 1H5XA 5I5LA 2QJ7A 1I2WA 1E4DA 3HJIA 4JF4A 5FI7A 5IS1A 2WKPA 2WKHA 3HREA 3FG8A 1YLWA 5F1GA 3E2KA 1Z09A 3C30A 1WYBA 4HBUA 3LFVA 5IHVA 1EROA 1PZOA 2AVXA 5GLBA 3QNBA 2Z2LB 3QP4A 2R78A 3MXSA 2VGLS 3T4QA 2XFTA 4B88A 4S2JA 5F69A 3LEZA 4S2IA 3NJAA 1L0GA 4IUKA 3UB9A 1BULA 3AGDA 5E2FA 3A0RA 3CHWP 3RH8B 1O07A 4WBGA 2Y2KA 3HLFA 3QNCA 3BYDA 1KGEA 5HSQA 1GSVA 2PDRA 1XJ3A 1WYCA 4LCLA 1FCOA 4JXSA 2VV7A 1YQSA 2ZC3B 5EM0A 4PHTA 2ZD8A 4GS9A 3UDIA 5DF7A 1G68A 4LV1A 1TF1A 5D3OA 3O3VA 1MWRA 2WKIA 1UWNX 3G6OA 5FDSA 4GD6A 3ZG8B 3C38A 3PBTA 5L2FA 1KOUA 3VFHA 3F1OB 5F1FA 4Y13A 2M1CA 3UN7A 1T1CA 5TR7A 4NK3A 1YPRA 1W8YA 4R0QA 4OH0A 3SW1A 3GTCA 2WGWA 4WL9A 1ES3A 3PTEA 4BENA 5K5BA 1HLUP 3A0SA 4L9EA 5FDHA 3IWOA 1S1YA 4BD1A 3N8SA 4OPRA 4L0LA 2J8YA 4BBVA 1MPLA 2P9VA 4NXEA 4OQGA 4GDNA 3WS1A 3TE8A 4LV0A 3V39A 4C3QA 4P6BA 3FV7A 3N6IA 1GSWA 3PBQA 2G2WA 3JVVA 4KZ4A 2ZC4B 3WS2A 2JKRI 4KZ5A 4I3AA 2KLIA 2XA7M 5KMWA 1MWTA 1ES4A 4U0XA 4NXBA 1M6KA 3UDXA 2J3TD 4LGWA 5EOEA 1P9WA 1ESIA 1MY8A 4HI4A 1F98A 3ZQ5A 3UE3A 1GCEA 4G3KA 4NXGA 1K57A 4MBKA 3IWIA 4BBTA 3HUMA 5HD5A 2OLVA 4BL3A 4I39A 4N9KA 4Y17A 3KSHA 1RGZA 4E3IA 2HV1A 3UB8A 4ZTKA 2EX8A 1PIOA 5GL9A 4IBRA 4KG5A 2LB9A 3TJZC 4EEPA 4CLCC 4O01A 2XRNA 3BECA 1DJAA 2I72A 3UE6A 3NECA 4QY5A 2JKTI 4EETB 3FWLA 3O86A 3B33A 3UE1A 3W4OA 2L1MA 3OPRA 3D4FA 1XA7A 4EWFA 4IEDA 2WZZA 1SDEA 3K2NA 5HDSA 1VM1A 1DP8A 5DTTA 4L9GA 3NCKA 1CK3A 1ERMA 3C7UA 4QJGA 3A3FA 4RX3A 4GHIB 4R3AA 2R9XA 5FAPA 2PYPA 4PM5A 5FI2A 1X0OA 1LSWA 1LI0A 4KQQA 3T4KA 3KX0X 3FKWA 2MJ6A 2Q9MA 4PM6A 2P74A 2O9AA 3HLDA 4JXVA 4H8RA 1BUEA 1F5MA 4M4XA 2BLSA 3LI9A 3MXRA 1XXMA 4UEYA 3IH8A 4B4ZA 3IWQA 1TDLA 2J9OA 3PAEA 1PWCA 1KGGA 1YLTA 2RCXA 3S22A 1MKMA 5CRFA 5HDCA 3LUQA 3F1PB 1VETB 2ZM2A 5F6AA 1C3BA 2ZM8A 5KSHA 3LY3A 1BZAA 4S2NA 4BL2A 4JPMA 3IBJA 1D06A 1ZG6A 5EOOA 1F9IA 4IVKA 2DNSA 2CC1A 3PXPA 2E8JA 3O88A 3A3EA 1YSPA 5HAQA 4FD8A 1MZUA 3VP1A 3IXBA 1CI8A 1ZC2A 2XEPA 3MZEA 5HWWA 1N9OA 2V1AA 1JWPA 5F82A 2J9PA 4JF5A 3E2LA 1FIKA 3T4TA 1ES2A 5HL1A 4Q0IA 3T4LA 3W8KA 2ZMAA 4HH3A 2UWXA 1ZKJA 3SH7A 3UB6A 2ZC6B 4MBHA 2JHEA 4A5RA 1LSXA 1LI9A 4I5SA 2XGNA 1NYMA 1KDSA 2PT7A 4H6JB 1NZOA 1IYSA 2INWA 2JKFA 1XJ2A 2M7VA 4YOFA 3PBNA 4EW7A 4GNUA 5L07A 2V2FF 4GZBA 1ONGA 5CERA 3IHBA 3MQQA 5JYPA 4GHIA 2ZQ8A 1T1AA 2VK3A 1K4FA 2J7VA 1GHPA 2OWHA 3Q82A 3KYEA 4GOGA 3QP1A 3UNWA 1TDGA 3BW6A 2H0TA 3IF5A 4II7A 3Q7ZA 1LSVA 3PBOA 3TW8A 1NYYA 3RFBA 4WZ5A 1O7EA 3KSFA 3B47A 3BFDA 3F1PA 5AVEA 1VETA 2ZC5B 3B42A 1J3WA
chains in the Genus database with same CATH topology
4Z1WA 2GZAA 1NLYA 1DRMA 3CLOA 2VV6A 1ZHHB 4LRXC 5DFYA 2YKHA 5DJTA 3UMEA 3KSIA 3PR6A 5I5LA 1P0ZA 1VB6A 4WELA 2QJ7A 3HJIA 5IS1A 2WKPA 2QJ5A 2Y8HA 3FG8A 2V9AA 3NOPC 2O9CA 3C30A 3LFVA 2A2LA 3IS2B 4Q0HA 3OCNA 1JNUA 4KQOA 3R7WA 3H7WA 2VKSA 3IBRA 4XT2A 3MR0A 2P08A 1H8MA 2R78A 4Q0JA 2PR5A 2VGLS 3T4QA 3VV4A 5AJGA 5J3WA 3NHQA 3BWLA 2JKTM 4EUVA 1H3QA 3KSGA 2KX6A 2VEAA 3P7NA 4MCWA 1T1BA 3E0YA 3EEAA 3DBAA 5F69A 2CMNA 3H9WA 5F68A 4GJ4A 1G28A 3NJAA 4IUKA 1XJ4A 3UB9A 4CLCA 3E4OA 3A0RA 3NOUC 3RH8B 3PBSA 3T4JA 5DFXA 1OTBA 2GJ3A 5HPIA 4JGPA 4RQ9A 5HSQA 2WKRA 1OTAA 1STZA 1GSVA 2PDRA 1IFQA 1XJ3A 2P04A 3OOVA 3LIAA 4KQDA 1S67L 4ARZB 3KO6A 3OBFA 2V0UA 2VV7A 3MFXA 4H6JA 2EA9A 2FZ0A 2KDKA 2OWJA 1MC0A 4HY8A 4PHTA 4YNRA 1Y28A 4GS9A 4HNBA 5EFWA 1LT0A 2H28A 1TF1A 3GECA 3S7NA 2QYBA 1UWNX 5AVFA 4IJGA 3G6OA 5L8MA 3LR3A 3PYPA 2PYRA 1BYWA 4WEJA 2K2NA 1VHMA 2PHYA 3FPVA 3C38A 3PBTA 4F3LB 1DP6A 4G3WA 3K3CA 4B9OA 1KOUA 4JGOA 2M7UA 3F1OB 2M1CA 5TJJA 2W1TB 1T1CA 4YWZA 1YSQA 2B02A 1UWPX 2OAQ1 5HWTA 3LIBA 1NLZA 4I38A 1D7EA 3VE3A 3SW1A 5MC7A 3PHYA 4L9FA 2NUTC 4WL9A 4CLCD 5IT5A 5TBMB 1P97A 2JN7A 5K5BA 2PD7A 3UB7A 4DN0A 3A0SA 4L9EA 2ZOHA 1S1YA 5CX7A 2VX8A 3KYQA 2ZMVA 3H82A 4L0LA 4BBVA 4B93A 4UQIM 3S7PA 4NXEA 3BY9A 4NXFA 3EGDC 2VLGA 4EU0A 3TE8A 5J7EA 3R4KA 4IHQA 4MMNA 1NRJA 4HP9A 3E98A 4WN5A 1GSWA 3PBQA 3MJQA 4E04A 2A24A 3JVVA 4P6ZM 1N9NA 2JKRI 4EEUA 3A0VA 4I3AA 2KLIA 2XA7M 2VZWA 3C2WA 2XROA 2D02A 4KUKA 3PBRA 4NXBA 2J3TD 1P9WA 2O99A 4HI4A 1F98A 3D3OA 3IS2A 4OOLA 3ZQ5A 2W0NA 3EEHA 3UE3A 4G3KA 4EXOA 4NXGA 4IUHA 4ME4A 2W3GA 4BBTA 3MQ0A 5HPFA 3S7OA 4BJPA 5HD5A 4I39A 4ETZA 3LIFA 3KSHA 3FPWA 4WLAA 2HV1A 3UB8A 2O9BA 4Y5FA 2OAP1 2LB9A 3TJZC 4EEPA 1S4RA 4HH2A 1XFQA 4EERA 3BY8A 4CLCC 1ZTUA 2O0YA 5DJUA 1EW0A 4O01A 3T50A 1ODVA 2GX5A 2WKQA 2IA2A 1YAXA 2XRNA 3VOLA 4ETXA 3V67A 1P9RA 2HJEA 3UE6A 4FOFA 3ZYTA 2VA0A 2JKTI 4GLQA 4EETB 2W3DA 2W3EA 1N9LA 2I9VA 3LIEA 2W1RA 1UGUA 3B33A 3KYZA 3E4PA 2L1MA 3LR4A 3E4QA 3MF0A 4LRZE 5C5KA 3TRCA 2HGVA 4NKPA 3T4SA 5IU1A 3K2NA 5HDSA 2XSSA 2J80A 3EWKA 5G4ZA 1OJ5A 4JGQA 3OLOA 3LI8A 2J3TC 1W63Q 1DP8A 2GNXA 4L9GA 4R70A 3HJKA 1XJ6A 3CWFA 4O8GA 4AFIA 4GHIB 4R3AA 5LBRA 1OTIA 3GDIA 2PYPA 4G3VA 4EQ1A 2B18A 4LLOB 4I3JA 3BQAA 1X0OA 3HCYA 1LSWA 2W1TA 5G4YA 3ULFA 3O5YA 3T4KA 4K08A 3KX0X 2L0WA 3K3DA 4R38A 1TS7A 2MJ6A 2VGLM 2O9AA 4GCZA 1S66L 4WUJA 1F5MA 4KUOA 4M4XA 3LI9A 4HJ3A 1IOUA 4UEYA 1W63M 3CUEA 2V0WA 3D72A 1OPXA 4FSFA 2LB5A 2ZOIA 1OJGA 1T19A 2K7SA 2Y79A 1MKMA 4HHDA 4CQHA 3LICA 1V9YA 4HOIA 3BQ8A 3F1NB 1XFNA 5HDCA 3LUQA 3MQOA 3CITA 3F1PB 3LR0A 3H82B 5HDDA 1NWZA 2JKRM 3FC7A 5F6AA 1S4SA 2ZMFA 4HQAA 5KSHA 3EQVA 4O0PA 4HIAA 2P7JA 3W2ZA 3IBJA 1D06A 5DKLA 4DMZA 4BMWA 5DKKA 1F9IA 3LR5A 4MN7A 2KOIA 2HF6A 3VE4A 3U2AA 2A24B 2YKFA 3EOIA 3PXPA 1T18A 3EQUA 1DP9A 2QKPA 1YSPA 4PKYG 5HD3A 4HP4A 3LYXA 3R7WB 1MZUA 3H7WB 4Y3IA 1WA9A 3C8CA 3P01A 3RTYA 4XT2B 2J3WA 4QPRA 2EWWA 4HJ6A 2K31A 3CI6A 2NUPC 4CLCE 5HWWA 5J4EA 4ZRRA 1N9OA 2V1AA 2VV8A 1YKDA 5HL6A 2QHKA 3T4TA 1TD5A 4Q0IA 5A8BA 3T4LA 4MDZA 3BJNA 2BASA 4HH3A 5DF9A 4UQIS 3UB6A 2PD8A 4CLCB 3OCLA 1S1ZA 1TS0A 5FL3A 2JHEA 4WF0A 1LSXA 3JVUA 3OC2A 5KIZA 2D01A 4HJ4A 4ARZA 3NOTC 2DMWA 2QWSA 2W3HA 5F5YA 2HJ9C 4I5SA 2EWVA 4DJ3A 2G7UA 2FH5A 2PT7A 4P6ZS 1OT6A 4H6JB 4JGRA 2XA7S 3CAXA 2Z6DA 2INWA 4GS9B 1GSXA 1XJ2A 2M7VA 4YOFA 3PBNA 2W27A 4EW7A 1G6OA 4F3LA 1TS8A 4R6LA 3LIDA 1OTDA 4Y2FA 3F1OA 3MQQA 3S7QA 1V9ZA 2OOLA 3ICYA 4GHIA 3MXQA 4EESA 4OOMA 1T1AA 2V1BA 2W3FA 2OWHA 4LPZA 4PKYA 5HWVA 1LL8A 5TBMA 5HZHA 4MN5A 2PR6A 2Z6CA 4DJ2A 4I3IA 3CUEC 3MMHA 1TS6A 4BBUA 2VJWA 2ZBBA 3BW6A 4WEKA 4MN6A 4II7A 3TW8A 1LSVA 2L4RA 3PBOA 4PAUA 1OTEA 3RFBA 3UMDA 4GW9A 1OT9A 3F1NA 4LRYC 3EGXC 4NEED 3KSFA 3B47A 3F1PA 5AVEA 4BWIA 3B42A 3T4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRM A;  3CLO A;  2VV6 A;  4LRX C;  5DJT A;  3UME A;  2YKH A;  5I5L A;  1P0Z A;  1VB6 A;  2QJ7 A;  3HJI A;  5IS1 A;  2WKP A;  2QJ5 A;  3FG8 A;  2V9A A;  3NOP C;  3IS2 B;  1JNU A;  3H7W A;  3IBR A;  4XT2 A;  3MR0 A;  2R78 A;  2PR5 A;  5J3W A;  3NHQ A;  3BWL A;  2KX6 A;  2VEA A;  3P7N A;  1T1B A;  5F69 A;  2CMN A;  3H9W A;  5F68 A;  1G28 A;  3NJA A;  1XJ4 A;  3UB9 A;  3E4O A;  3A0R A;  3NOU C;  3RH8 B;  1OTB A;  2GJ3 A;  4JGP A;  4RQ9 A;  5HSQ A;  2WKR A;  1OTA A;  1GSV A;  2PDR A;  1XJ3 A;  3LIA A;  4KQD A;  1S67 L;  2V0U A;  2VV7 A;  3MFX A;  4H6J A;  2EA9 A;  2KDK A;  2OWJ A;  4HY8 A;  1Y28 A;  4GS9 A;  4HNB A;  5EFW A;  1LT0 A;  2H28 A;  3GEC A;  1UWN X;  5AVF A;  3G6O A;  3PYP A;  2PYR A;  1BYW A;  2PHY A;  4F3L B;  1DP6 A;  3K3C A;  4B9O A;  1KOU A;  4JGO A;  3F1O B;  2M1C A;  1T1C A;  4YWZ A;  2B02 A;  1UWP X;  5HWT A;  3LIB A;  4I38 A;  1D7E A;  3VE3 A;  3SW1 A;  3PHY A;  4L9F A;  4WL9 A;  5TBM B;  1P97 A;  2JN7 A;  2PD7 A;  3UB7 A;  3A0S A;  4L9E A;  2ZOH A;  1S1Y A;  3H82 A;  4BBV A;  4NXE A;  3BY9 A;  4NXF A;  2VLG A;  5J7E A;  4HP9 A;  4WN5 A;  1GSW A;  3MJQ A;  4E04 A;  2A24 A;  1N9N A;  4EEU A;  3A0V A;  4I3A A;  3C2W A;  2D02 A;  4KUK A;  4NXB A;  4HI4 A;  1F98 A;  3IS2 A;  3ZQ5 A;  2W0N A;  3EEH A;  4EXO A;  4NXG A;  4BBT A;  5HD5 A;  4I39 A;  3LIF A;  4WLA A;  2HV1 A;  3UB8 A;  4EEP A;  1S4R A;  4HH2 A;  1XFQ A;  4EER A;  3BY8 A;  5DJU A;  1EW0 A;  3T50 A;  1ODV A;  2WKQ A;  3VOL A;  3UE6 A;  4EET B;  1N9L A;  2I9V A;  3LIE A;  1UGU A;  3B33 A;  3E4P A;  2L1M A;  3E4Q A;  4LRZ E;  5IU1 A;  5HDS A;  2J80 A;  3EWK A;  5G4Z A;  1OJ5 A;  4JGQ A;  3OLO A;  3LI8 A;  1DP8 A;  4L9G A;  4R70 A;  3HJK A;  1XJ6 A;  3CWF A;  4GHI B;  4R3A A;  1OTI A;  3GDI A;  2PYP A;  4EQ1 A;  4LLO B;  4I3J A;  1X0O A;  1LSW A;  5G4Y A;  3ULF A;  4K08 A;  3KX0 X;  2L0W A;  3K3D A;  4R38 A;  1TS7 A;  4GCZ A;  1S66 L;  4WUJ A;  4M4X A;  4KUO A;  3LI9 A;  4HJ3 A;  2V0W A;  3D72 A;  2ZOI A;  1OJG A;  1T19 A;  2K7S A;  4HHD A;  3LIC A;  1V9Y A;  4HOI A;  3F1N B;  1XFN A;  5HDC A;  3LUQ A;  3MQO A;  3F1P B;  3H82 B;  5HDD A;  1NWZ A;  3FC7 A;  5F6A A;  1S4S A;  4HQA A;  4HIA A;  2P7J A;  1D06 A;  5DKL A;  5DKK A;  1F9I A;  3VE4 A;  2A24 B;  2YKF A;  1T18 A;  1DP9 A;  2QKP A;  4PKY G;  5HD3 A;  4HP4 A;  3LYX A;  1MZU A;  3H7W B;  1WA9 A;  3C8C A;  3RTY A;  4XT2 B;  4HJ6 A;  5HWW A;  5J4E A;  1N9O A;  2V1A A;  2VV8 A;  2QHK A;  5A8B A;  2BAS A;  4HH3 A;  3UB6 A;  2PD8 A;  1S1Z A;  1TS0 A;  2JHE A;  4WF0 A;  1LSX A;  5KIZ A;  2D01 A;  4HJ4 A;  3NOT C;  2QWS A;  5F5Y A;  4I5S A;  4DJ3 A;  1OT6 A;  4H6J B;  4JGR A;  3CAX A;  2Z6D A;  2INW A;  4GS9 B;  1GSX A;  1XJ2 A;  2W27 A;  4EW7 A;  4F3L A;  1TS8 A;  4R6L A;  3LID A;  1OTD A;  3F1O A;  3MQQ A;  1V9Z A;  2OOL A;  3ICY A;  4GHI A;  3MXQ A;  4EES A;  1T1A A;  2V1B A;  2OWH A;  4LPZ A;  4PKY A;  5HWV A;  1LL8 A;  5TBM A;  5HZH A;  4MN5 A;  2PR6 A;  2Z6C A;  4DJ2 A;  4I3I A;  1TS6 A;  4BBU A;  2ZBB A;  4MN6 A;  1LSV A;  2L4R A;  1OTE A;  3UMD A;  4GW9 A;  1OT9 A;  3F1N A;  4LRY C;  3F1P A;  5AVE A; 
#chains in the Genus database with same CATH topology
 3W4Q A;  3DTI A;  4LRX C;  3UME A;  2YKH A;  3ZG9 B;  1N4O A;  2VGK A;  5FA7 A;  4PM8 A;  4IVI A;  4E3O A;  3NOP C;  3HL9 A;  2C5W B;  4OPZ A;  1K0K A;  4D60 A;  5CEC A;  2WYX A;  3RXX A;  1IYQ A;  3VSL A;  3IBR A;  4MLL A;  4LV2 A;  3ZNT A;  2EX9 A;  1HTZ A;  4E6X A;  3VV4 A;  3SS3 A;  4JXG A;  5J3W A;  3NHQ A;  2HZ5 A;  1H3Q A;  4EUZ A;  5GLD A;  2KX6 A;  3E0Y A;  2XQZ A;  4O7D A;  2CMN A;  3VP0 A;  4GJ4 A;  1PW1 A;  1XJ4 A;  3VP4 A;  2ZL1 B;  3NC8 A;  4WMC D;  3NOU C;  3AGF A;  2HPB A;  3PBS A;  5HPI A;  5BOH A;  2WKR A;  1IFQ A;  3NY4 A;  1ESU A;  3OOV A;  1S67 L;  1K55 A;  2HDR A;  2V0U A;  4R3B A;  4H6J A;  2XD1 A;  3DTE A;  4BLM A;  3A3D A;  2EA9 A;  1MC0 A;  4E3N A;  4YNR A;  1LT0 A;  2H5S A;  3GEC A;  4X56 A;  3S7N A;  1Y4O A;  4PM7 A;  5AVF A;  5EUA A;  3LR3 A;  5E2G A;  2PU2 A;  1I2S A;  1VHM A;  3FPV A;  1DP6 A;  1PFL A;  3K3C A;  1IYO A;  1YMS A;  3OPL A;  2BTF P;  2W1T B;  1SCW A;  4YWZ A;  1YSQ A;  1MWU A;  1GA9 A;  3C7V A;  4I38 A;  1D7E A;  3VE3 A;  5MC7 A;  4CLC D;  2HP6 A;  1P97 A;  3Q81 A;  4DN0 A;  5FAT A;  1JVJ A;  2ZMV A;  4X1L A;  3HUN A;  4UQI M;  5CGW A;  4ZBE A;  3S7P A;  4P0M A;  4NXF A;  1L3L A;  5J7E A;  3R4K A;  4DXB A;  4MMN A;  4PMA A;  2JBF A;  2XLN A;  5CGS A;  4OQH A;  1K54 A;  3BFC A;  4R23 A;  4E04 A;  2WKE A;  2A24 A;  1I5Q A;  4P6Z M;  1N9N A;  4BD0 A;  5EVL A;  1FSY A;  2EFU A;  1DY6 A;  1BT5 A;  2IWC A;  4KUK A;  3PBR A;  3U4L P;  3IHA A;  3M2J A;  3D3O A;  2W0N A;  5HAI A;  1A0K A;  3P98 A;  1DJC A;  4BJP A;  3ZG5 A;  4XUX A;  2XK1 A;  1G6A A;  4PPR A;  5EVI C;  3VOZ A;  1XFQ A;  4EER A;  3BY8 A;  2O0Y A;  1EW0 A;  1ODV A;  2PBD P;  4ETX A;  1P9R A;  4MNR A;  1MBL A;  4DXC A;  2W3D A;  5A93 A;  3WRZ A;  1UGU A;  4X55 A;  4DDY A;  3KYZ A;  5GLC A;  1L2S A;  3G31 A;  3TRC A;  2HGV A;  1MKI A;  4RX2 A;  1SZV A;  3T4S A;  2XSS A;  4PM9 A;  5FAS A;  1OJ5 A;  4JGQ A;  4K91 A;  3LI8 A;  3Q1F A;  4R70 A;  1DJB A;  3HJK A;  4AFI A;  5LBR A;  1OTI A;  1VEU B;  1LHY A;  4EQ1 A;  3A3J A;  2W1T A;  3ULF A;  1L0D A;  1FQG A;  2G2U A;  3O5Y A;  5GLA A;  2Q0O A;  2VGL M;  2Y4A A;  3M2K A;  1Q2P A;  3IX4 A;  4HJ3 A;  1PI4 A;  3ITB A;  2V0W A;  3BM6 A;  4QWO A;  3SZT A;  4FSF A;  1JWZ A;  3P09 A;  3GV9 A;  5TGF A;  4CQH A;  4D2O A;  4S2M A;  3DTM A;  4HOI A;  3F1N B;  1JTG A;  5AQ9 A;  3ZG0 A;  3H82 B;  5HDD A;  1YMX A;  2JKR M;  4N1H A;  2ZMF A;  1KE4 A;  3EQV A;  4HIA A;  3OZH A;  1SHV A;  2R9W A;  3V5M A;  3HVF A;  1W7F A;  5DKK A;  3LR5 A;  2EX2 A;  2WK0 A;  3UY6 A;  3VE4 A;  2YKF A;  3EOI A;  3SS5 A;  2A3U A;  4HEF A;  1ERQ A;  1T18 A;  1XA1 A;  4PKY G;  2X71 A;  3LYX A;  3R7W B;  4XUZ A;  3RTY A;  4XT2 B;  5F83 A;  2EWW A;  4LFU A;  5L09 A;  2NUP C;  2VV8 A;  4KZ3 A;  3PAG A;  1TD5 A;  5A8B A;  4DE0 A;  3I7J A;  2Y2H A;  2BAS A;  2UV0 E;  3VP3 A;  4CLC B;  5A90 A;  5FL3 A;  5EVE A;  2FFY A;  3NBL A;  4Q8I A;  4HJ4 A;  5F5Y A;  2HJ9 C;  3D9Y A;  1K56 A;  3IF6 C;  1MWS A;  4JGR A;  2Z6D A;  3BFF A;  4R4S A;  2Y91 A;  1XGJ A;  3LID A;  3F1O A;  2OOL A;  1VEU A;  3MXQ A;  4EES A;  4N9L A;  4FH2 A;  3T1R A;  2W3F A;  4B4X A;  4PKY A;  2B5R A;  2Y2M A;  4MN5 A;  2PR6 A;  4C75 A;  2PBY A;  4DJ2 A;  2DRW A;  3CUE C;  3MMH A;  4P87 A;  1YLP A;  4RA7 A;  4BBU A;  1GA0 A;  2ZBB A;  4ID4 A;  4WEK A;  4UAA A;  2L4R A;  1K25 A;  4GW9 A;  1RGY A;  4C6Y A;  3F1N A;  4LRY C;  1IYP A;  2EX6 A;  4LCM A;  4BWI A;  3HUO A;  1BLS A;  4Z1W A;  2GZA A;  4EBN A;  2VV6 A;  1ZHH B;  4GB7 A;  3GMW A;  3KSI A;  1CF0 A;  3PR6 A;  4OPY A;  3WRT A;  2QJ5 A;  1HVB A;  2Z2M B;  1W8Q A;  2O9C A;  5AQA A;  1ZG4 A;  3MZD A;  3IS2 B;  4Q0H A;  3UB5 P;  4Z9Q A;  1JNU A;  3LEQ A;  3R7W A;  5M19 A;  2VKS A;  3B3X A;  4NG2 A;  3N8L A;  4XT2 A;  2Y2L A;  1U60 A;  3MR0 A;  1H8M A;  4Q0J A;  2PR5 A;  5DTS A;  4E3K A;  5AJG A;  5EM1 A;  3BWL A;  3KSG A;  1CEG A;  1YM1 A;  3P7N A;  4MCW A;  1T1B A;  1PZP A;  3IT9 A;  4ESP A;  5F68 A;  4CLC A;  4YFM A;  1Z6F A;  2GJ3 A;  3HLW A;  1STZ A;  2P04 A;  4GN2 A;  4ARZ B;  1H8Y A;  3OBF A;  3MFX A;  3BFG A;  4JF6 A;  3IX3 A;  2WUQ A;  2FZ0 A;  4HY8 A;  1Y28 A;  5E43 A;  5EFW A;  3BEB A;  2H28 A;  2EFX A;  3N7W A;  4IJG A;  1IKI A;  2XDM A;  2Y2P A;  4WEJ A;  1BYW A;  4KZB A;  2PRF A;  1SKF A;  2K2N A;  1K6S A;  3ZHH A;  2V8C A;  4F3L B;  1L0E A;  4B9O A;  4JGO A;  3IXD A;  2M7U A;  3T1Q B;  3IXG A;  5TJJ A;  3GRJ A;  5A92 A;  2B02 A;  2ZQC A;  3V3S A;  4EV4 A;  4R4R A;  3LIB A;  1K38 A;  4ZJ3 A;  5EVI D;  4BQM A;  4QB8 A;  4Y15 A;  3MBZ A;  3PHY A;  4L9F A;  3JPU A;  5IT5 A;  5TBM B;  2V20 A;  3UB7 A;  4N92 A;  2ZOH A;  5CEB A;  5CX7 A;  1LL9 A;  3WS0 A;  4X53 A;  4B93 A;  4Y7P A;  4DE2 A;  3BY9 A;  2VLG A;  4EU0 A;  5FAO A;  4IHQ A;  3ZNY A;  3HLE A;  4S2P A;  3RXW A;  4WYY A;  3G2Z A;  1FCM A;  3MJQ A;  1BLH A;  4GD8 A;  2GDN A;  3A0V A;  2FFF B;  4OPQ A;  3C2W A;  2C6W B;  2D02 A;  1RCJ A;  3DW0 A;  4S2O A;  5FQK A;  2O99 A;  5HAP A;  1ES5 A;  3IS2 A;  4K0W A;  4CPK A;  4R3J A;  1NZU A;  3OPP A;  3ZG7 B;  3MQ0 A;  5HPF A;  3S7O A;  3LIF A;  3FPW A;  2IWB A;  3S4X A;  4OLG A;  5CXW A;  1GHM A;  2O9B A;  4Y5F A;  1SDN A;  4FUW A;  4OQ0 A;  1CQA A;  5FEG A;  1S4R A;  2Q9N A;  3WS4 A;  1ZTU A;  5EV0 A;  5DJU A;  2IA2 A;  3LO7 A;  5E2E A;  4FOF A;  3VFF A;  1TEM A;  3ZYT A;  1NRF A;  4GLQ A;  3LIE A;  4CJN A;  1PI5 A;  3SH8 A;  4JXW A;  3E4Q A;  3MF0 A;  5FAQ A;  3L9K A;  4GDB A;  2ZQ7 A;  4MBF A;  1IEL A;  5G4Z A;  2QPN A;  2Y2J A;  1W63 Q;  2GNX A;  3CWF A;  3MKE A;  4O8G A;  3GDI A;  3AGE A;  4G3V A;  4LLO B;  4I3J A;  3BQA A;  3HCY A;  3HLC A;  1W5D A;  5G4Y A;  4OP8 A;  2HDU A;  4K08 A;  4HBT A;  4QY6 A;  4MEZ A;  3K3D A;  4R38 A;  1TS7 A;  5A91 A;  2Y2N A;  3BRM A;  1PWG A;  4KUO A;  5GHZ A;  1IOU A;  1W63 M;  3GVB A;  3D72 A;  2ZOI A;  1AWI A;  4LEN A;  1OJG A;  1T19 A;  2K7S A;  2Y79 A;  3G4P A;  4HHD A;  1XFN A;  1HZO A;  3MQO A;  3CIT A;  2ZC7 A;  4OLD A;  5DTK A;  4OOY A;  1NWZ A;  3FC7 A;  2X02 A;  4HQA A;  3LY4 A;  4R1G A;  4O0P A;  5FQJ A;  2P7J A;  2PAV P;  1LLB A;  5DKL A;  2HDQ A;  3SS4 A;  4DE1 A;  4QU3 A;  3QHY A;  4X25 A;  2KOI A;  3T1X A;  4KZA A;  2HF6 A;  4U3T A;  3U2A A;  1FCN A;  5G18 A;  5EEC A;  4DF6 A;  3EQU A;  5DF8 A;  1DP9 A;  3ZCZ A;  5HD3 A;  3HLG A;  5EPH A;  2Y2I A;  1K57 C;  4UHU A;  3H7W B;  4Y3I A;  3C8C A;  4E3L A;  3P01 A;  1RP5 A;  4E6W A;  2K31 A;  3GQZ A;  1KE0 A;  1KVM A;  1LL5 A;  3JYI A;  3CPT B;  5HL6 A;  2ZL1 A;  5HAR A;  1QMF A;  5AQB A;  3UPN A;  5EVI B;  1PWD A;  2H10 A;  4JLF A;  2PD8 A;  3GR2 A;  4WF0 A;  3CMZ A;  3OC2 A;  5KIZ A;  2D01 A;  3QP6 A;  1XKZ A;  2HP5 A;  3LGO A;  4N1X A;  4DJ3 A;  2G7U A;  1OME A;  2FH5 A;  3ZVW A;  1OT6 A;  4Y0T A;  3NI9 A;  2XA7 S;  3VP2 A;  2ZM0 A;  3CAX A;  4RYE A;  1PRQ A;  4FH4 A;  4OP5 A;  4K0X A;  2W27 A;  3Q07 A;  4QHC A;  1XP4 A;  1KGF A;  3TG9 A;  1TS8 A;  3BFE A;  3VMA A;  1OTD A;  3G32 A;  3S7Q A;  5EE8 A;  1H0M A;  1V9Z A;  3ICY A;  3TOI A;  2QZ6 A;  1QME A;  4X69 A;  3FYZ A;  1LL8 A;  2H0Y A;  4FTX A;  2WAD A;  1E3U D;  2Z6C A;  4I3I A;  2ZLY A;  1BLP A;  1JTD A;  2WGV A;  4KEN B;  1L0F A;  4MN6 A;  3NUL A;  3T1S A;  1MXO A;  1OTE A;  2Y55 A;  1OT9 A;  1EWZ A;  4NEE D;  3UPO A;  5CED A;  5CTN A;  4S2N C;  2XF3 A;  1DRM A;  4U0T A;  5DJT A;  5DFY A;  5FEF A;  4WM9 A;  3G2Y A;  1M40 A;  1P0Z A;  1VB6 A;  3CZD A;  4WEL A;  3C5A A;  2Y8H A;  2Y2O A;  2B95 A;  3M6H A;  2V9A A;  4S2K A;  2EXB A;  3IH9 A;  4X6T A;  3WS5 A;  2A2L A;  3N4I A;  1ALQ A;  1BSG A;  1KVL A;  3OCN A;  4KQO A;  3H7W A;  1K6R A;  2OSU A;  4EBL A;  2P08 A;  4NET A;  2ACG A;  4DRT A;  4EBP A;  2BG1 A;  3CPT A;  2JKT M;  4UA9 A;  2X01 A;  4EUV A;  5HFO A;  1S6R A;  2VEA A;  3IQA A;  3EEA A;  3DBA A;  3BLM A;  5EVI A;  2OLU A;  3H9W A;  1G28 A;  4KZ9 A;  3M6B A;  3E4O A;  3DWK A;  3T4J A;  1WE4 A;  5DFX A;  1OTB A;  2JE5 A;  4JGP A;  4RQ9 A;  5FQM A;  3S1Y A;  1OTA A;  2VGJ A;  3LIA A;  4KQD A;  1BTL A;  3KO6 A;  3IF6 B;  2OWJ A;  2KDK A;  4DDS A;  5FQQ A;  2V8F A;  4HNB A;  2JKG A;  5M18 A;  2QYB A;  5L8M A;  3PYP A;  3ZVT A;  2PYR A;  1FR6 A;  5M1A A;  4KZ7 A;  2PHY A;  3HBR A;  3ISG A;  3BLS A;  2XH9 A;  4G3W A;  2OV5 A;  4OKP A;  5KSC A;  1G5U A;  2WAE A;  1YLZ A;  2EXA A;  3RJU A;  5DVA A;  1UWP X;  2OAQ 1;  4ZJ2 A;  5GHY A;  5HWT A;  4E3M A;  1NLZ A;  2A49 A;  1CI9 A;  2NUT C;  4OVD A;  1F2K A;  2JN7 A;  1PNE A;  3IX8 A;  4WMC A;  1KE3 A;  2PD7 A;  2RL3 A;  1CEF A;  1NY0 A;  2VX8 A;  3KYQ A;  3H82 A;  4WZ5 C;  1FSW A;  4WZ4 A;  3EGD C;  2ZQA A;  1K4E A;  1NRJ A;  3QP8 A;  4HP9 A;  1YLY A;  4Y0O A;  3E98 A;  4WN5 A;  1ONH A;  1IKG A;  3V50 A;  4EEU A;  5JYO A;  1YT4 A;  2VZW A;  4DKI A;  3TSG A;  2XRO A;  3ZDJ A;  5J8X A;  2Y2G A;  1XPB A;  4OOL A;  2JC7 A;  4F94 A;  3EEH A;  1XX2 A;  4EXO A;  4IUH A;  4ME4 A;  3NDG A;  2W3G A;  1IEM A;  2HP9 A;  4ETZ A;  4RVA A;  4OQI A;  3GSG A;  4WLA A;  5HX9 A;  2XR0 A;  3UDF A;  2IWD A;  5CHJ A;  5TFQ A;  2OAP 1;  3DAV A;  1XGI A;  4HH2 A;  3SOI A;  1D1J A;  3WWX A;  3O87 A;  4GKU A;  3T50 A;  1NXY A;  2GX5 A;  4KG6 A;  2WKQ A;  1YAX A;  4X1M A;  3VOL A;  3V67 A;  2HJE A;  4KZ6 A;  1H8Z A;  1VQQ A;  2VA0 A;  3MFD A;  1FOF A;  3MS6 A;  2W3E A;  1N9L A;  2ZJ9 A;  3C4O A;  2I9V A;  1K55 C;  4KG2 A;  2W1R A;  1GHI A;  2XFS A;  3UO9 A;  3IF6 A;  4KQR A;  3E4P A;  1FR1 A;  3LR4 A;  4P85 A;  3CG5 A;  4ZAM A;  4LRZ E;  5C5K A;  3CJM A;  1TVF A;  1SKO B;  4NKP A;  5IU1 A;  3SH9 A;  1PW8 A;  2J80 A;  3EWK A;  2WZX A;  2HDS A;  3OLO A;  5CTM A;  2J3T C;  4OON A;  1XJ6 A;  3VSK A;  4E3J A;  5E2H A;  5L10 A;  5CGX A;  2B18 A;  5I94 A;  5FQ9 A;  4UA6 A;  3QP2 A;  2L0W A;  4FCF A;  4HES A;  3ZGA B;  2E8I A;  4GCZ A;  5FI6 A;  1S66 L;  3MSH A;  4WUJ A;  4Y0U A;  3CUE A;  4DE3 A;  3Q7V B;  1NJ4 A;  3G34 A;  1EI5 A;  1OPX A;  2LB5 A;  3ITA A;  3OPH A;  2Y59 A;  3LIC A;  1V9Y A;  3BQ8 A;  3LR0 A;  4X68 A;  1S4S A;  3L7H A;  4UA7 A;  2WAF A;  4JBF A;  1K54 C;  1K56 D;  5KZH A;  3N8R A;  1BLC A;  2XD5 A;  1Q2Q A;  4YIN A;  3W2Z A;  3NDE A;  4DMZ A;  3UE0 A;  3G35 A;  4BMW A;  4MN7 A;  2ZQ9 A;  2A24 B;  3MZF A;  2QKP A;  1ACF A;  4HP4 A;  4KZ8 A;  1WA9 A;  3W4P A;  5GHX A;  2J3W A;  4QPR A;  4HJ6 A;  3CI6 A;  4IBX A;  5AQ7 A;  4CLC E;  5J4E A;  4ZRR A;  1E25 A;  2QMI A;  1YKD A;  1N9B A;  2QHK A;  1AXB A;  4JKT A;  3QP5 A;  1E3U A;  4MDZ A;  3G30 A;  3BJN A;  1FIL A;  2V1Z A;  5DF9 A;  4UQI S;  3C4P A;  3OCL A;  1S1Z A;  1TS0 A;  3A3I A;  3JVU A;  2WGI A;  3FZC A;  4ARZ A;  1JWV A;  3DTK A;  1Y54 A;  2DMW A;  2QWS A;  2W3H A;  3NOT C;  3FKV A;  1CJF A;  2JCH A;  2EWV A;  4QD4 A;  1HD8 A;  4P6Z S;  3IXH A;  2ZQD A;  1W79 A;  3MKF A;  3HLB A;  1SKO A;  4GS9 B;  1YLJ A;  1GSX A;  3VOY A;  1G6O A;  1KDW A;  4F3L A;  3V3R A;  1J9M A;  3UPP A;  4ZJ1 A;  1S0W A;  4R6L A;  3DWZ A;  5CHM A;  4Y2F A;  3NIA A;  4OOM A;  2V1B A;  4LPZ A;  4XXR A;  5HWV A;  1PYY A;  5TBM A;  5HZH A;  2WGW B;  1TS6 A;  3LCE A;  2PU4 A;  2VJW A;  3Q7V A;  4ZDX A;  5FQI A;  4PAU A;  5U47 A;  4EQI A;  3UMD A;  3EGX C;  4LV3 A;  2P9V B;  4S2L A;  5HW3 A;  3T12 B;  2DCF A;  3T4O A;  1NLY A;  5CHU A;  5FSR A;  3CLO A;  3ZFZ A;  2Y2Q A;  4M3K A;  1H5X A;  5I5L A;  2QJ7 A;  1I2W A;  1E4D A;  3HJI A;  4JF4 A;  5FI7 A;  5IS1 A;  2WKP A;  2WKH A;  3HRE A;  3FG8 A;  1YLW A;  5F1G A;  3E2K A;  1Z09 A;  3C30 A;  1WYB A;  4HBU A;  3LFV A;  5IHV A;  1ERO A;  1PZO A;  2AVX A;  5GLB A;  3QNB A;  2Z2L B;  3QP4 A;  2R78 A;  3MXS A;  2VGL S;  3T4Q A;  2XFT A;  4B88 A;  4S2J A;  5F69 A;  3LEZ A;  4S2I A;  3NJA A;  1L0G A;  4IUK A;  3UB9 A;  1BUL A;  3AGD A;  5E2F A;  3A0R A;  3CHW P;  3RH8 B;  1O07 A;  4WBG A;  2Y2K A;  3HLF A;  3QNC A;  3BYD A;  1KGE A;  5HSQ A;  1GSV A;  2PDR A;  1XJ3 A;  1WYC A;  4LCL A;  1FCO A;  4JXS A;  2VV7 A;  1YQS A;  2ZC3 B;  5EM0 A;  4PHT A;  2ZD8 A;  4GS9 A;  3UDI A;  5DF7 A;  1G68 A;  4LV1 A;  1TF1 A;  5D3O A;  3O3V A;  1MWR A;  2WKI A;  1UWN X;  3G6O A;  5FDS A;  4GD6 A;  3ZG8 B;  3C38 A;  3PBT A;  5L2F A;  1KOU A;  3VFH A;  3F1O B;  5F1F A;  4Y13 A;  2M1C A;  3UN7 A;  1T1C A;  5TR7 A;  4NK3 A;  1YPR A;  1W8Y A;  4R0Q A;  4OH0 A;  3SW1 A;  3GTC A;  2WGW A;  4WL9 A;  1ES3 A;  3PTE A;  4BEN A;  5K5B A;  1HLU P;  3A0S A;  4L9E A;  5FDH A;  3IWO A;  1S1Y A;  4BD1 A;  3N8S A;  4OPR A;  4L0L A;  2J8Y A;  4BBV A;  1MPL A;  2P9V A;  4NXE A;  4OQG A;  4GDN A;  3WS1 A;  3TE8 A;  4LV0 A;  3V39 A;  4C3Q A;  4P6B A;  3FV7 A;  3N6I A;  1GSW A;  3PBQ A;  2G2W A;  3JVV A;  4KZ4 A;  2ZC4 B;  3WS2 A;  2JKR I;  4KZ5 A;  4I3A A;  2KLI A;  2XA7 M;  5KMW A;  1MWT A;  1ES4 A;  4U0X A;  4NXB A;  1M6K A;  3UDX A;  2J3T D;  4LGW A;  5EOE A;  1P9W A;  1ESI A;  1MY8 A;  4HI4 A;  1F98 A;  3ZQ5 A;  3UE3 A;  1GCE A;  4G3K A;  4NXG A;  1K57 A;  4MBK A;  3IWI A;  4BBT A;  3HUM A;  5HD5 A;  2OLV A;  4BL3 A;  4I39 A;  4N9K A;  4Y17 A;  3KSH A;  1RGZ A;  4E3I A;  2HV1 A;  3UB8 A;  4ZTK A;  2EX8 A;  1PIO A;  5GL9 A;  4IBR A;  4KG5 A;  2LB9 A;  3TJZ C;  4EEP A;  4CLC C;  4O01 A;  2XRN A;  3BEC A;  1DJA A;  2I72 A;  3UE6 A;  3NEC A;  4QY5 A;  2JKT I;  4EET B;  3FWL A;  3O86 A;  3B33 A;  3UE1 A;  3W4O A;  2L1M A;  3OPR A;  3D4F A;  1XA7 A;  4EWF A;  4IED A;  2WZZ A;  1SDE A;  3K2N A;  5HDS A;  1VM1 A;  1DP8 A;  5DTT A;  4L9G A;  3NCK A;  1CK3 A;  1ERM A;  3C7U A;  4QJG A;  3A3F A;  4RX3 A;  4GHI B;  4R3A A;  2R9X A;  5FAP A;  2PYP A;  4PM5 A;  5FI2 A;  1X0O A;  1LSW A;  1LI0 A;  4KQQ A;  3T4K A;  3KX0 X;  3FKW A;  2MJ6 A;  2Q9M A;  4PM6 A;  2P74 A;  2O9A A;  3HLD A;  4JXV A;  4H8R A;  1BUE A;  1F5M A;  4M4X A;  2BLS A;  3LI9 A;  3MXR A;  1XXM A;  4UEY A;  3IH8 A;  4B4Z A;  3IWQ A;  1TDL A;  2J9O A;  3PAE A;  1PWC A;  1KGG A;  1YLT A;  2RCX A;  3S22 A;  1MKM A;  5CRF A;  5HDC A;  3LUQ A;  3F1P B;  1VET B;  2ZM2 A;  5F6A A;  1C3B A;  2ZM8 A;  5KSH A;  3LY3 A;  1BZA A;  4S2N A;  4BL2 A;  4JPM A;  3IBJ A;  1D06 A;  1ZG6 A;  5EOO A;  1F9I A;  4IVK A;  2DNS A;  2CC1 A;  3PXP A;  2E8J A;  3O88 A;  3A3E A;  1YSP A;  5HAQ A;  4FD8 A;  1MZU A;  3VP1 A;  3IXB A;  1CI8 A;  1ZC2 A;  2XEP A;  3MZE A;  5HWW A;  1N9O A;  2V1A A;  1JWP A;  5F82 A;  2J9P A;  4JF5 A;  3E2L A;  1FIK A;  3T4T A;  1ES2 A;  5HL1 A;  4Q0I A;  3T4L A;  3W8K A;  2ZMA A;  4HH3 A;  2UWX A;  1ZKJ A;  3SH7 A;  3UB6 A;  2ZC6 B;  4MBH A;  2JHE A;  4A5R A;  1LSX A;  1LI9 A;  4I5S A;  2XGN A;  1NYM A;  1KDS A;  2PT7 A;  4H6J B;  1NZO A;  1IYS A;  2INW A;  2JKF A;  1XJ2 A;  2M7V A;  4YOF A;  3PBN A;  4EW7 A;  4GNU A;  5L07 A;  2V2F F;  4GZB A;  1ONG A;  5CER A;  3IHB A;  3MQQ A;  5JYP A;  4GHI A;  2ZQ8 A;  1T1A A;  2VK3 A;  1K4F A;  2J7V A;  1GHP A;  2OWH A;  3Q82 A;  3KYE A;  4GOG A;  3QP1 A;  3UNW A;  1TDG A;  3BW6 A;  2H0T A;  3IF5 A;  4II7 A;  3Q7Z A;  1LSV A;  3PBO A;  3TW8 A;  1NYY A;  3RFB A;  4WZ5 A;  1O7E A;  3KSF A;  3B47 A;  3BFD A;  3F1P A;  5AVE A;  1VET A;  2ZC5 B;  3B42 A;  1J3W A; 
#chains in the Genus database with same CATH homology
 4Z1W A;  2GZA A;  1NLY A;  1DRM A;  3CLO A;  2VV6 A;  1ZHH B;  4LRX C;  5DFY A;  2YKH A;  5DJT A;  3UME A;  3KSI A;  3PR6 A;  5I5L A;  1P0Z A;  1VB6 A;  4WEL A;  2QJ7 A;  3HJI A;  5IS1 A;  2WKP A;  2QJ5 A;  2Y8H A;  3FG8 A;  2V9A A;  3NOP C;  2O9C A;  3C30 A;  3LFV A;  2A2L A;  3IS2 B;  4Q0H A;  3OCN A;  1JNU A;  4KQO A;  3R7W A;  3H7W A;  2VKS A;  3IBR A;  4XT2 A;  3MR0 A;  2P08 A;  1H8M A;  2R78 A;  4Q0J A;  2PR5 A;  2VGL S;  3T4Q A;  3VV4 A;  5AJG A;  5J3W A;  3NHQ A;  3BWL A;  2JKT M;  4EUV A;  1H3Q A;  3KSG A;  2KX6 A;  2VEA A;  3P7N A;  4MCW A;  1T1B A;  3E0Y A;  3EEA A;  3DBA A;  5F69 A;  2CMN A;  3H9W A;  5F68 A;  4GJ4 A;  1G28 A;  3NJA A;  4IUK A;  1XJ4 A;  3UB9 A;  4CLC A;  3E4O A;  3A0R A;  3NOU C;  3RH8 B;  3PBS A;  3T4J A;  5DFX A;  1OTB A;  2GJ3 A;  5HPI A;  4JGP A;  4RQ9 A;  5HSQ A;  2WKR A;  1OTA A;  1STZ A;  1GSV A;  2PDR A;  1IFQ A;  1XJ3 A;  2P04 A;  3OOV A;  3LIA A;  4KQD A;  1S67 L;  4ARZ B;  3KO6 A;  3OBF A;  2V0U A;  2VV7 A;  3MFX A;  4H6J A;  2EA9 A;  2FZ0 A;  2KDK A;  2OWJ A;  1MC0 A;  4HY8 A;  4PHT A;  4YNR A;  1Y28 A;  4GS9 A;  4HNB A;  5EFW A;  1LT0 A;  2H28 A;  1TF1 A;  3GEC A;  3S7N A;  2QYB A;  1UWN X;  5AVF A;  4IJG A;  3G6O A;  5L8M A;  3LR3 A;  3PYP A;  2PYR A;  1BYW A;  4WEJ A;  2K2N A;  1VHM A;  2PHY A;  3FPV A;  3C38 A;  3PBT A;  4F3L B;  1DP6 A;  4G3W A;  3K3C A;  4B9O A;  1KOU A;  4JGO A;  2M7U A;  3F1O B;  2M1C A;  5TJJ A;  2W1T B;  1T1C A;  4YWZ A;  1YSQ A;  2B02 A;  1UWP X;  2OAQ 1;  5HWT A;  3LIB A;  1NLZ A;  4I38 A;  1D7E A;  3VE3 A;  3SW1 A;  5MC7 A;  3PHY A;  4L9F A;  2NUT C;  4WL9 A;  4CLC D;  5IT5 A;  5TBM B;  1P97 A;  2JN7 A;  5K5B A;  2PD7 A;  3UB7 A;  4DN0 A;  3A0S A;  4L9E A;  2ZOH A;  1S1Y A;  5CX7 A;  2VX8 A;  3KYQ A;  2ZMV A;  3H82 A;  4L0L A;  4BBV A;  4B93 A;  4UQI M;  3S7P A;  4NXE A;  3BY9 A;  4NXF A;  3EGD C;  2VLG A;  4EU0 A;  3TE8 A;  5J7E A;  3R4K A;  4IHQ A;  4MMN A;  1NRJ A;  4HP9 A;  3E98 A;  4WN5 A;  1GSW A;  3PBQ A;  3MJQ A;  4E04 A;  2A24 A;  3JVV A;  4P6Z M;  1N9N A;  2JKR I;  4EEU A;  3A0V A;  4I3A A;  2KLI A;  2XA7 M;  2VZW A;  3C2W A;  2XRO A;  2D02 A;  4KUK A;  3PBR A;  4NXB A;  2J3T D;  1P9W A;  2O99 A;  4HI4 A;  1F98 A;  3D3O A;  3IS2 A;  4OOL A;  3ZQ5 A;  2W0N A;  3EEH A;  3UE3 A;  4G3K A;  4EXO A;  4NXG A;  4IUH A;  4ME4 A;  2W3G A;  4BBT A;  3MQ0 A;  5HPF A;  3S7O A;  4BJP A;  5HD5 A;  4I39 A;  4ETZ A;  3LIF A;  3KSH A;  3FPW A;  4WLA A;  2HV1 A;  3UB8 A;  2O9B A;  4Y5F A;  2OAP 1;  2LB9 A;  3TJZ C;  4EEP A;  1S4R A;  4HH2 A;  1XFQ A;  4EER A;  3BY8 A;  4CLC C;  1ZTU A;  2O0Y A;  5DJU A;  1EW0 A;  4O01 A;  3T50 A;  1ODV A;  2GX5 A;  2WKQ A;  2IA2 A;  1YAX A;  2XRN A;  3VOL A;  4ETX A;  3V67 A;  1P9R A;  2HJE A;  3UE6 A;  4FOF A;  3ZYT A;  2VA0 A;  2JKT I;  4GLQ A;  4EET B;  2W3D A;  2W3E A;  1N9L A;  2I9V A;  3LIE A;  2W1R A;  1UGU A;  3B33 A;  3KYZ A;  3E4P A;  2L1M A;  3LR4 A;  3E4Q A;  3MF0 A;  4LRZ E;  5C5K A;  3TRC A;  2HGV A;  4NKP A;  3T4S A;  5IU1 A;  3K2N A;  5HDS A;  2XSS A;  2J80 A;  3EWK A;  5G4Z A;  1OJ5 A;  4JGQ A;  3OLO A;  3LI8 A;  2J3T C;  1W63 Q;  1DP8 A;  2GNX A;  4L9G A;  4R70 A;  3HJK A;  1XJ6 A;  3CWF A;  4O8G A;  4AFI A;  4GHI B;  4R3A A;  5LBR A;  1OTI A;  3GDI A;  2PYP A;  4G3V A;  4EQ1 A;  2B18 A;  4LLO B;  4I3J A;  3BQA A;  1X0O A;  3HCY A;  1LSW A;  2W1T A;  5G4Y A;  3ULF A;  3O5Y A;  3T4K A;  4K08 A;  3KX0 X;  2L0W A;  3K3D A;  4R38 A;  1TS7 A;  2MJ6 A;  2VGL M;  2O9A A;  4GCZ A;  1S66 L;  4WUJ A;  1F5M A;  4KUO A;  4M4X A;  3LI9 A;  4HJ3 A;  1IOU A;  4UEY A;  1W63 M;  3CUE A;  2V0W A;  3D72 A;  1OPX A;  4FSF A;  2LB5 A;  2ZOI A;  1OJG A;  1T19 A;  2K7S A;  2Y79 A;  1MKM A;  4HHD A;  4CQH A;  3LIC A;  1V9Y A;  4HOI A;  3BQ8 A;  3F1N B;  1XFN A;  5HDC A;  3LUQ A;  3MQO A;  3CIT A;  3F1P B;  3LR0 A;  3H82 B;  5HDD A;  1NWZ A;  2JKR M;  3FC7 A;  5F6A A;  1S4S A;  2ZMF A;  4HQA A;  5KSH A;  3EQV A;  4O0P A;  4HIA A;  2P7J A;  3W2Z A;  3IBJ A;  1D06 A;  5DKL A;  4DMZ A;  4BMW A;  5DKK A;  1F9I A;  3LR5 A;  4MN7 A;  2KOI A;  2HF6 A;  3VE4 A;  3U2A A;  2A24 B;  2YKF A;  3EOI A;  3PXP A;  1T18 A;  3EQU A;  1DP9 A;  2QKP A;  1YSP A;  4PKY G;  5HD3 A;  4HP4 A;  3LYX A;  3R7W B;  1MZU A;  3H7W B;  4Y3I A;  1WA9 A;  3C8C A;  3P01 A;  3RTY A;  4XT2 B;  2J3W A;  4QPR A;  2EWW A;  4HJ6 A;  2K31 A;  3CI6 A;  2NUP C;  4CLC E;  5HWW A;  5J4E A;  4ZRR A;  1N9O A;  2V1A A;  2VV8 A;  1YKD A;  5HL6 A;  2QHK A;  3T4T A;  1TD5 A;  4Q0I A;  5A8B A;  3T4L A;  4MDZ A;  3BJN A;  2BAS A;  4HH3 A;  5DF9 A;  4UQI S;  3UB6 A;  2PD8 A;  4CLC B;  3OCL A;  1S1Z A;  1TS0 A;  5FL3 A;  2JHE A;  4WF0 A;  1LSX A;  3JVU A;  3OC2 A;  5KIZ A;  2D01 A;  4HJ4 A;  4ARZ A;  3NOT C;  2DMW A;  2QWS A;  2W3H A;  5F5Y A;  2HJ9 C;  4I5S A;  2EWV A;  4DJ3 A;  2G7U A;  2FH5 A;  2PT7 A;  4P6Z S;  1OT6 A;  4H6J B;  4JGR A;  2XA7 S;  3CAX A;  2Z6D A;  2INW A;  4GS9 B;  1GSX A;  1XJ2 A;  2M7V A;  4YOF A;  3PBN A;  2W27 A;  4EW7 A;  1G6O A;  4F3L A;  1TS8 A;  4R6L A;  3LID A;  1OTD A;  4Y2F A;  3F1O A;  3MQQ A;  3S7Q A;  1V9Z A;  2OOL A;  3ICY A;  4GHI A;  3MXQ A;  4EES A;  4OOM A;  1T1A A;  2V1B A;  2W3F A;  2OWH A;  4LPZ A;  4PKY A;  5HWV A;  1LL8 A;  5TBM A;  5HZH A;  4MN5 A;  2PR6 A;  2Z6C A;  4DJ2 A;  4I3I A;  3CUE C;  3MMH A;  1TS6 A;  4BBU A;  2VJW A;  2ZBB A;  3BW6 A;  4WEK A;  4MN6 A;  4II7 A;  3TW8 A;  1LSV A;  2L4R A;  3PBO A;  4PAU A;  1OTE A;  3RFB A;  3UMD A;  4GW9 A;  1OT9 A;  3F1N A;  4LRY C;  3EGX C;  4NEE D;  3KSF A;  3B47 A;  3F1P A;  5AVE A;  4BWI A;  3B42 A;  3T4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...