4KQDA

The crystal structure of the n-terminal pas domain of the f plasmid traj
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
IDLLENLTAVIQDYPNPACIRDETGKFIFCNTLFHESFLTQDQSAEKWLLSQRDFCELISVTEMEAYRNEHTHLNLVEDVFIQNRFWTISVQSFLNGHRNIILWQFYDAAHVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TraJ
publication title The crystal Structure of the N-terminal PAS domain of the F plasmid TraJ
rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 30
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kqdA00
3ULFA 1LSWA 2PD8A 2A24A 3H7WB 2YKHA 1GSXA 1ODVA 2B02A 2J80A 4NXBA 4NXEA 5J3WA 1LT0A 5HWTA 2PYPA 5DJUA 1TS0A 2KX6A 4I3IA 1OT6A 2L4RA 1VB6A 4LRXC 4M4XA 3VE3A 4HNBA 1JNUA 3LIEA 1N9OA 4HQAA 3HJIA 3NOTC 1P97A 1DP8A 5F68A 4RQ9A 5EFWA 4GHIB 3GDIA 2PR5A 1OTIA 3E4OA 2QJ7A 1S4SA 5J4EA 5HDCA 4KUOA 4EEUA 3IBRA 1UGUA 2OWHA 4BBTA 2W27A 3F1OB 2Z6CA 2L1MA 4B9OA 2I9VA 1GSVA 2INWA 1XFNA 3BWLA 4L9EA 3F1NA 1EW0A 4LRYC 4HIAA 3PYPA 4GW9A 4R3AA 4NXFA 5HWVA 1UWPX 5DKLA 4L9FA 3NOPC 5G4ZA 2OOLA 1TS6A 2JHEA 4I5SA 3NOUC 1D7EA 4I38A 1OJ5A 1GSWA 5DKKA 2M1CA 4EEPA 3P7NA 1XFQA 5HD3A 1S4RA 1XJ2A 3FC7A 1OTEA 4LPZA 2W0NA 1F98A 4GS9B 3H9WA 4H6JB 5HDSA 4L9GA 1G28A 3KX0X 5TBMA 4HJ3A 3E4PA 1LSVA 1P0ZA 2CMNA 4JGQA 4EW7A 4EETB 3H82B 2VV7A 3NJAA 5HSQA 4YWZA 1XJ6A 2L0WA 1NWZA 1T1CA 3B33A 2KDKA 4BBVA 1S67L 5HZHA 3BY8A 3LYXA 3EEHA 3LICA 3UB9A 1S66L 2D02A 1WA9A 1DP9A 3F1PB 4JGPA 2QWSA 5F69A 4DJ3A 5G4YA 4F3LA 1UWNX 4XT2A 1BYWA 1XJ4A 4PKYG 2QKPA 4I3AA 5F5YA 3UMDA 3OLOA 3LUQA 3GECA 5HDDA 2WKQA 2VLGA 3D72A 5AVFA 3FG8A 4WL9A 1DP6A 1D06A 3UB8A 2PHYA 3ZQ5A 5AVEA 2YKFA 4HOIA 4LLOB 3LIAA 4HH2A 4MN5A 4HHDA 3CWFA 4WLAA 3RH8B 4KUKA 2PYRA 2V1AA 5F6AA 4HJ4A 1KOUA 3BY9A 4HY8A 2A24B 2ZOIA 2R78A 1S1YA 4R38A 4EXOA 4JGOA 4HP4A 2H28A 3F1OA 1OTDA 1V9ZA 4EQ1A 1N9NA 3ICYA 4WF0A 1S1ZA 2WKPA 3CAXA 4HH3A 4I3JA 1OTAA 2PR6A 3LIFA 1XJ3A 2JN7A 1OTBA 2VV6A 4EESA 4R6LA 2OWJA 1N9LA 4K08A 3C2WA 2VV8A 4WUJA 5I5LA 1T19A 3RTYA 1V9YA 3UB7A 3NHQA 3VOLA 3UB6A 4HJ6A 4BBUA 4NXGA 2V0WA 4EERA 3F1NB 1Y28A 3A0VA 4GS9A 4R70A 3A0SA 4H6JA 3A0RA 3EWKA 4WN5A 3MJQA 2Z6DA 1F9IA 4KQDA 2PDRA 3IS2A 3H82A 1LSXA 1LL8A 3LIBA 1T1AA 3CLOA 2ZOHA 3MQQA 4MN6A 5HWWA 3LI8A 1OJGA 2HV1A 3H7WA 3VE4A 2V1BA 2D01A 3T50A 1X0OA 3C8CA 3G6OA 5J7EA 2V0UA 1TS7A 5TBMB 4DJ2A 3E4QA 3K3CA 5HD5A 4HP9A 3F1PA 4PKYA 4LRZE 5KIZA 2PD7A 1T1BA 2EA9A 4HI4A 3PHYA 5IS1A 4JGRA 2QHKA 2ZBBA 3LI9A 4GHIA 4E04A 3SW1A 2V9AA 1MZUA 2QJ5A 3MQOA 3LIDA 3HJKA 1TS8A 2WKRA 5A8BA 1DRMA 3UMEA 1OT9A 2VEAA 5DJTA 4F3LB 4XT2B 2GJ3A 3K3DA 2K7SA 2BASA 3UE6A 3MR0A 3MXQA 1T18A 5IU1A 3IS2B 2P7JA 3MFXA 4GCZA 4I39A
chains in the Genus database with same CATH superfamily
4BLMA 4K0WA 3ULFA 1LSWA 3SS4A 4ID4A 4BD0A 3G35A 4FUWA 4XUXA 2J80A 3ZHHA 5CX7A 3N8LA 1LT0A 3O5YA 4LCLA 3IXDA 3D3OA 3LO7A 4Y13A 2XF3A 2NUTC 4LRXC 3WRZA 5L07A 2ZC7A 1NZOA 1ZC2A 3LIEA 4PPRA 1N9OA 3MQ0A 3HJIA 3JVUA 2PU4A 3CUEA 5F68A 5EFWA 4GHIB 5I94A 1PZOA 4KG2A 3T4QA 1S4SA 3MZFA 4WYYA 5J4EA 4OQIA 4KUOA 1Q2QA 4EEUA 1NYMA 1YM1A 2QPNA 1AXBA 4Q0IA 3RXXA 4BBTA 2Z6CA 3QP6A 4B9OA 3HVFA 3DTEA 2INWA 3OOVA 3NIAA 4AFIA 3BWLA 3OBFA 4MDZA 4L9EA 5M19A 4Y0UA 3ZFZA 1DJAA 5M1AA 4A5RA 4L9FA 1E4DA 3KSGA 1Q2PA 1BLHA 5G4ZA 2VGLM 4GKUA 1TS6A 4I5SA 3NOUC 4KZ7A 1L2SA 3ZNYA 1A0KA 1VM1A 4Q8IA 5GHXA 1S4RA 1NRJA 1HTZA 1BULA 3HLGA 4LPZA 1F98A 5A92A 2ZD8A 5A90A 1MKIA 5FAQA 4GS9B 1VETB 5HDSA 3DWKA 4L9GA 3KX0X 5TBMA 4WBGA 2Y79A 4HJ3A 4DF6A 1PRQA 1DY6A 4S2IA 3MMHA 5FL3A 3FYZA 2XLNA 4OH0A 1EWZA 1XJ6A 2L0WA 3B33A 2KDKA 2M7UA 4NEED 3CMZA 4O7DA 4BBVA 5FQ9A 4R4RA 1P9RA 1MBLA 2GNXA 3BY8A 2VZWA 5HAIA 1I2WA 4BL2A 4X56A 3LICA 3IX8A 2ZQAA 1S66L 4EBPA 1WA9A 2O9AA 3F1PB 4UA7A 3UE0A 4JGPA 4Y0TA 3PBSA 1N9BA 1CI8A 2GZAA 4R4SA 3SH9A 5GLDA 1D1JA 3EGDC 3UDIA 2Q9MA 3UN7A 4KZ3A 4XT2A 4CQHA 5IHVA 1XJ4A 4X6TA 3LR3A 1ESUA 2BLSA 3MS6A 4IVIA 5EVIB 2ZQ8A 5CHMA 1LHYA 3O3VA 4KQRA 4PM7A 3Q81A 5DTKA 4KZ8A 1IYPA 2E8IA 3D72A 5AVFA 2PBDP 4KG5A 5G18A 3IQAA 4K0XA 2PHYA 3C7UA 5AVEA 5CTNA 2YKFA 3QHYA 5C5KA 5E2HA 1PZPA 4FSFA 3IF6A 2WZZA 4WLAA 5HARA 2PYRA 1L0EA 1XKZA 1H3QA 4QU3A 4O8GA 4S2NC 3N8RA 5F82A 2O0YA 1K57C 1KVMA 3VP1A 3NECA 2ZL1A 2X02A 3VP4A 4R38A 4O01A 3T1SA 2ZM2A 4OLGA 4MBKA 2H28A 2JKGA 3HLCA 3F1OA 3G32A 3K2NA 1M6KA 3IT9A 5FA7A 3N4IA 3S22A 2RCXA 1N9NA 3D4FA 3IHBA 1KVLA 1SDEA 4I3JA 3T12B 4M3KA 2JN7A 3R4KA 3VV4A 2VV6A 4QY6A 2Q0OA 2A3UA 2XROA 4ESPA 1E3UD 3BM6A 4ETZA 2P04A 4WUJA 5FDHA 1E25A 5I5LA 1MKMA 1L3LA 2DRWA 2Q9NA 3IX3A 3LR0A 3UB6A 2Y2LA 1H8YA 4NXGA 3S7NA 4G3WA 2VGLS 3C30A 4B4XA 1Y28A 3L7HA 4RX2A 5GLCA 4BENA 2W1TB 4H6JA 3S7QA 2J9OA 4WN5A 4KQOA 4F94A 3WS0A 3P01A 1F9IA 1KDWA 1RP5A 3IS2A 3HUNA 4P0MA 3VSLA 1GA9A 3TW8A 1ONGA 4E3NA 3L9KA 4CLCC 2Y2PA 2XRNA 2XEPA 1QMEA 1ES2A 1TD5A 3UDFA 2W3FA 4MN6A 4FTXA 4LV2A 3VE4A 2Y2HA 3D9YA 3C8CA 4ZJ3A 5L2FA 2V0UA 4KZ5A 4OP8A 2Y2OA 4DJ2A 3K3CA 3ZYTA 4ZDXA 2PD7A 5DFXA 2V8CA 5AQAA 4GD8A 5EECA 5IS1A 1QMFA 4EWFA 4JGRA 3LI9A 4LENA 1NYYA 2ZQCA 1K55C 4KG6A 4IVKA 4E04A 3RFBA 1MZUA 5AQ9A 2W3GA 1TS8A 1STZA 2WKRA 2WYXA 3ZDJA 4PAUA 5JYOA 2VEAA 4KZ9A 5EV0A 5CXWA 1ES3A 3C4PA 4FOFA 1G5UA 2KOIA 2GJ3A 3K3DA 2K7SA 2BASA 2X01A 2XK1A 3MR0A 4JBFA 1KGEA 3V5MA 2P7JA 2XFSA 3NC8A 2NUPC 1SKOA 1ERMA 3IH8A 4GOGA 3IXGA 3M2JA 4KENB 1AWIA 3TE8A 3GTCA 2WGVA 2A24A 3H7WB 2VGJA 1GSXA 1ODVA 4G3KA 1BZAA 3T4LA 4NXBA 4LGWA 5J3WA 4DXBA 3DTIA 3C5AA 3W4QA 5HWTA 3N6IA 4C75A 1BUEA 5FI6A 3Q7VA 4WMCD 2XD5A 1E3UA 4MN7A 1NRFA 5FEFA 4Y0OA 1FQGA 3IF5A 2W3HA 3NOTC 1MWTA 4P6BA 1TDGA 3TG9A 1P97A 4II7A 4JF6A 3WS1A 2FZ0A 1YLZA 2ZC3B 1H5XA 3AGDA 1IFQA 3SS3A 2PR5A 1OTIA 3E4OA 4PHTA 4JXGA 5AJGA 2XR0A 2Y59A 2VJWA 2W27A 1SDNA 4R1GA 2L1MA 1JVJA 2I9VA 1PYYA 1XFNA 3ZVTA 5HL1A 3GR2A 2X71A 1RCJA 4YFMA 4X69A 3F1NA 1LLBA 1EW0A 1MPLA 2R9WA 2Y2QA 3MFDA 4HIAA 4R3AA 4WELA 1WE4A 2LB9A 5HWVA 3MF0A 3T4TA 1UWPX 3UE1A 3QP1A 5DKLA 4U3TA 3V39A 3EQUA 4CLCB 3W4PA 4EBNA 1FR6A 2MJ6A 4N9LA 1J9MA 1D7EA 4I38A 1GSWA 2DMWA 2M1CA 4FCFA 2P9VA 3P7NA 1XFQA 4R0QA 1XJ2A 3FC7A 5HPFA 4NETA 3G4PA 2HP6A 4OQ0A 5HPIA 2OV5A 4PMAA 3OCNA 2G2WA 4JKTA 4IUKA 2ZQ9A 4EQIA 1LSVA 3Q1FA 4EW7A 4BL3A 4MCWA 1MXOA 1CQAA 3DTKA 2C6WB 4OQGA 2VK3A 3W2ZA 2K2NA 1KGFA 5HZHA 2H10A 1WYBA 5DF8A 3LY3A 3C7VA 3UB9A 5LBRA 2D02A 3FPWA 3JPUA 3SH7A 3HUOA 3TRCA 4X53A 5GLAA 3PBTA 1YSQA 5F69A 4ZAMA 5G4YA 4F3LA 2J3TC 2Y2NA 3BQ8A 2OLVA 3BFEA 3UMDA 3G34A 4NG2A 3OLOA 3LUQA 3VP3A 3IBJA 3A3FA 3FPVA 4WMCA 4X25A 5HDDA 3FZCA 3LGOA 1K56A 2Z2MB 1D06A 3PAEA 3ZNTA 2OLUA 3ZQ5A 3P98A 2WGWB 1U60A 4UEYA 2HDUA 5AQBA 4QD4A 1PI4A 5CGXA 4GNUA 2HP5A 2ZQ7A 5EVID 1LI9A 3WS4A 4MN5A 1FSWA 1TEMA 3HL9A 4OPRA 2ACGA 4WZ4A 3A3DA 4DDYA 4DE1A 3LR4A 5EVLA 3RH8B 4KUKA 2V1AA 5E2GA 3LEZA 2ZMVA 1HD8A 5F6AA 4OPYA 4HJ4A 5GLBA 5TGFA 4R3BA 3GQZA 2R78A 1S1YA 3ISGA 4D60A 4OONA 4HP4A 3KYEA 3MKEA 1DJCA 4MEZA 1OTDA 4EQ1A 3IX4A 4EUZA 4IEDA 5CGWA 4BQMA 2R9XA 3ICYA 1JWVA 4FH2A 3ZG7B 4NKPA 1YLWA 4ZBEA 5HL6A 5A93A 3U2AA 3UY6A 2UWXA 1XJ3A 3OCLA 3BLSA 4EESA 1M40A 5KSCA 4R6LA 5KMWA 3B42A 5FEGA 4B4ZA 1YMXA 3RTYA 4R3JA 5M18A 1K0KA 3LEQA 4BBUA 4DXCA 1ZG4A 2A2LA 4EERA 1CEGA 4S2LA 3HLWA 2Y2KA 4KZAA 4GS9A 1VQQA 1VETA 3E2KA 3WS2A 3MJQA 5FSRA 2ZM8A 1WYCA 1VEUA 3BFGA 4UAAA 3S4XA 2E8JA 1LSXA 4KZ4A 1PIOA 2C5WB 3DTMA 1HVBA 1PWGA 3LFVA 1H8MA 5CHJA 2H0YA 1OJGA 4N1XA 2DCFA 2HV1A 1CF0A 3OPLA 3SS5A 2A49A 2WAFA 2ZL1B 4IHQA 2HP9A 2D01A 4N92A 2J7VA 3E2LA 4JF4A 1TS7A 3UO9A 1NJ4A 1EROA 4HEFA 5HD5A 2BG1A 4HP9A 3F1PA 3OC2A 1IKIA 4PKYA 4YOFA 3UPPA 5DTTA 1S6RA 1YMSA 5E2EA 2W3DA 4IBXA 2OAP1 4U0TA 1W79A 1W8YA 2H5SA 1BLCA 3VP0A 5TR7A 3Q07A 3QNCA 3TSGA 2V9AA 2O99A 5FASA 5EVIA 5L09A 3MQOA 3LIDA 4GDBA 3UB5P 1F5MA 4P6ZM 4GZBA 1DRMA 4IUHA 3CITA 4DDSA 2Y8HA 3T1XA 3BW6A 4E3JA 4JXVA 4BWIA 4D2OA 2HDQA 3FKVA 3C4OA 2OAQ1 3KYQA 3QNBA 3UDXA 1W5DA 1P9WA 5HFOA 3E0YA 5DVAA 4BMWA 1T18A 5IU1A 2PU2A 3T4KA 1CEFA 3HUMA 3IS2B 3IWOA 5GHZA 3IH9A 5EM0A 2JKTM 1ESIA 5CEBA 2JKRI 1N4OA 3W8KA 1PWDA 2CC1A 2EXBA 3QP5A 4UQIS 1ZHHB 4PM6A 1GCEA 1YAXA 3ZCZA 4NXEA 2P08A 3IWIA 1VHMA 1ACFA 3IHAA 5DJUA 2KX6A 1NLZA 4I3IA 2L4RA 5FI2A 1OPXA 1VB6A 2HJ9C 5CECA 3PR6A 1ALQA 4HQAA 3S7OA 4QHCA 3E98A 3OPPA 1MWRA 3ZG0A 5DTSA 4EV4A 5F1GA 2VX8A 4Y15A 1KE0A 1UGUA 4JPMA 3OZHA 1FSYA 4N1HA 4G3VA 2QMIA 1GSVA 4FD8A 3IWQA 3V67A 1FR1A 2GX5A 1L0GA 5CTMA 2Y2IA 3PTEA 2Y2MA 3IXHA 2HF6A 2V2FF 2QYBA 2LB5A 4LRYC 4U0XA 3PYPA 4GW9A 2W1TA 4NXFA 4GLQA 3VFHA 4BJPA 3CPTB 1ES5A 3CUEC 2B18A 3NY4A 2XA7S 3NCKA 4H8RA 3M6HA 2KLIA 3NOPC 2VKSA 3M6BA 5L8MA 4GJ4A 2OSUA 3FV7A 2EX9A 5DKKA 1YLTA 4EEPA 3Q7ZA 1YSPA 4PM5A 5HD3A 1ZTUA 1YQSA 5KZHA 1OTEA 3G31A 4WZ5A 2W0NA 5KSHA 1BTLA 2W3EA 1G28A 3HLEA 4WM9A 4CLCD 3E4PA 2CMNA 4JGQA 2IWBA 4EETB 2J9PA 3H82B 2VV7A 4DRTA 3NJAA 3V50A 5HSQA 2ZJ9A 5EOEA 1T1CA 1IYSA 4S2KA 4ZJ2A 1OMEA 2JC7A 2ZC4B 4ETXA 3UPOA 3FKWA 3SOIA 3EEHA 3NDGA 4MBHA 4S2JA 4Q0JA 4OVDA 1DP9A 4CJNA 5D3OA 5DF9A 3R7WA 4E3KA 2QWSA 2ZQDA 2I72A 3KSHA 4DJ3A 2O9BA 1PWCA 2DNSA 4P6ZS 4PKYG 4KZ6A 4JF5A 3LCEA 5F5YA 3EQVA 1K4FA 4S2NA 3GECA 4LV3A 3HREA 1K57A 1GA0A 1H0MA 3OPRA 4Z9QA 4X68A 5F83A 3WS5A 3BFCA 4WL9A 3B3XA 4LV1A 1XPBA 3O87A 3NBLA 1SZVA 4LLOB 3EGXC 3LIAA 5HX9A 3I7JA 4XUZA 4MMNA 3RJUA 1MY8A 4UA9A 3CWFA 4E3OA 2WADA 2ZC5B 1SKFA 1G6AA 2XFTA 4X1LA 1H8ZA 4GN2A 1NZUA 3BRMA 3GMWA 2IWDA 1KOUA 3BY9A 4HY8A 4MBFA 3A3IA 2ZOIA 1EI5A 2JBFA 2PBYA 5HW3A 1L0DA 1K54A 5EOOA 4EXOA 3Q82A 1K25A 2WZXA 4RYEA 2JKFA 1YT4A 5FATA 4WEJA 1S0WA 4WF0A 1S1ZA 3IF6C 1G6OA 2WKPA 5FI7A 4RA7A 4HH3A 3C38A 2PR6A 3LIFA 4DE0A 1LL9A 1C3BA 1IYOA 3MXRA 4CLCA 4ARZA 2B5RA 1N9LA 1FCOA 1T19A 3UB7A 5MC7A 3NHQA 1NLYA 4HJ6A 2EX8A 4NK3A 1JWPA 3ZG8B 4QB8A 3O86A 3A0SA 3EWKA 1I2SA 1YLPA 4KQDA 5EUAA 4QWOA 4S2OA 2ZM0A 1GHIA 5EVEA 3CI6A 1T1AA 3CLOA 2ZOHA 3MQQA 3G30A 3BEBA 3ZG9B 1K55A 2XSSA 3AGFA 3LI8A 1KE4A 2G7UA 3MXSA 3MZEA 4LV0A 3T50A 4DMZA 4ME4A 5J7EA 1O7EA 5DF7A 3VSKA 1MWUA 5E43A 3ZG5A 5TBMB 4S2PA 4UQIM 1TF1A 2QZ6A 3T1RA 3PAGA 5E2FA 3A3EA 1HLUP 1T1BA 3GRJA 1IELA 4IBRA 4JXWA 4O0PA 2JE5A 1FCMA 4LCMA 1YKDA 4IJGA 4GHIA 4HESA 1ONHA 2HPBA 1IOUA 2IWCA 1YLYA 2HZ5A 3SW1A 3JVVA 2EXAA 4OLDA 2QJ5A 4JLFA 5A8BA 3SH8A 2VA0A 3SZTA 4CLCE 3UMEA 1K38A 2JKRM 4DE3A 1OT9A 2J3TD 4KQQA 4HBUA 2M7VA 1L0FA 4MLLA 2JCHA 3BFDA 2WGWA 5EE8A 5TFQA 4XT2B 2FFYA 3BYDA 3UE6A 4E3IA 4WEKA 5IT5A 1PW1A 1VEUB 3UE3A 3MFXA 4GCZA 3BECA 4X55A 2EX6A 2XA7M 3O88A 3QP2A 2PD8A 2YKHA 2B02A 3BFFA 2H0TA 3P09A 2J8YA 4WZ5C 1KE3A 3BLMA 2PYPA 3T4JA 1TS0A 2WKHA 1OT6A 1JTGA 4M4XA 3BJNA 3IF6B 3VE3A 3ITAA 4HNBA 1JNUA 1BSGA 3DAVA 3T1QB 1DP8A 3LR5A 4RQ9A 3S1YA 5FQKA 3GDIA 4DE2A 3LY4A 2QJ7A 3UNWA 5HDCA 1PFLA 1RGYA 3MKFA 5FAPA 1BT5A 3PBNA 1PW8A 3CZDA 3IBRA 1W63M 4FH4A 2OWHA 4PM8A 1K4EA 1BLPA 3F1OB 4E3LA 1IEMA 2Z2LB 2EWWA 1PI5A 2V20A 1TDLA 5FQIA 4QJGA 5BOHA 1XX2A 2PRFA 2RL3A 2V8FA 4OPQA 4Y2FA 2WK0A 1CI9A 3N7WA 5FQQA 1XP4A 4PM9A 2OOLA 3WRTA 4EU0A 2JHEA 1NY0A 4BD1A 2UV0E 3T4SA 5J8XA 3KYZA 2XH9A 1OJ5A 1FCNA 2PAVP 3GV9A 1XA7A 4UHUA 1PNEA 3EOIA 3MSHA 3WWXA 4C6YA 4Z1WA 4L0LA 3H9WA 3AGEA 4H6JB 3W4OA 1GHPA 1LL5A 5CGSA 4OOYA 3CG5A 3ITBA 5GL9A 1P0ZA 3HCYA 4Q0HA 1K6SA 4YWZA 1NWZA 2HDRA 3EEAA 3U4LP 3FWLA 4QPRA 3M2KA 2Y4AA 2P74A 1ERQA 4MNRA 1S67L 3DBAA 3PBRA 2HJEA 3LYXA 4RVAA 1YPRA 4GDNA 4R23A 2XGNA 5DFYA 1K54C 4ZJ1A 5FDSA 4OPZA 3GVBA 2XD1A 4P87A 3PBQA 3VFFA 4GD6A 3UPNA 1JWZA 1MWSA 1UWNX 3MBZA 4RX3A 1BYWA 2QKPA 1NXYA 4I3AA 4DKIA 3NI9A 3VP2A 1ZKJA 2FFFB 2ZLYA 2VGKA 3VOZA 2Y91A 2WKQA 5FAOA 4ZTKA 2VLGA 4GB7A 3TJZC 2BTFP 3FG8A 1DP6A 3VOYA 1FILA 3T4OA 3UB8A 1ES4A 2GDNA 3DW0A 4HOIA 1CJFA 1Z09A 4HH2A 4OP5A 5F1FA 4HHDA 1I5QA 1SKOB 1Y54A 2G2UA 2V1ZA 2ZMAA 1IYQA 3A3JA 3ZVWA 4X1MA 4YINA 5GHYA 2A24B 3V3RA 4EBLA 4XXRA 4P85A 1O07A 4JGOA 1KDSA 5EM1A 5FQJA 3RXWA 1TVFA 1W8QA 1YLJA 3Q7VB 3QP4A 1V9ZA 3R7WB 4DN0A 4HBTA 5U47A 3TOIA 1W63Q 3IXBA 4CPKA 3NULA 2XDMA 1RGZA 3PBOA 1Z6FA 3CAXA 3GSGA 1OTAA 3HLDA 3CPTA 4B93A 5HAPA 1FIKA 2Y55A 1ZG6A 4UA6A 2AVXA 3ZGAB 1OTBA 5A91A 1F2KA 3QP8A 4QY5A 2OWJA 4K08A 3NDEA 3C2WA 2VV8A 4E6XA 1V9YA 2WKIA 2ZMFA 5CHUA 3VOLA 3KO6A 2IA2A 2V0WA 3PXPA 3CHWP 5CEDA 3F1NB 2PT7A 3A0VA 4R70A 1LI0A 3A0RA 3CJMA 4K91A 4OKPA 2Z6DA 4LFUA 2Y2JA 5AQ7A 2PDRA 2HDSA 3VMAA 3H82A 1JTDA 2JKTI 1LL8A 3JYIA 3LIBA 4JXSA 4EUVA 1K56D 3MZDA 2EWVA 1XGJA 4OQHA 5HWWA 3B47A 3V3SA 2P9VB 4YNRA 1GHMA 3HLBA 2XQZA 4OOLA 3H7WA 1CK3A 2J3WA 1HZOA 2V1BA 4Y5FA 2EX2A 1X0OA 3G6OA 1SHVA 4B88A 2WKEA 3KSFA 3E4QA 4E6WA 3G2ZA 1FOFA 2WAEA 4LRZE 4Y3IA 3HBRA 5KIZA 2FH5A 3KSIA 3S7PA 3BQAA 2EA9A 4HI4A 4KZBA 3N8SA 1XGIA 2K31A 5CRFA 5FQMA 3PHYA 2EFUA 3DWZA 2QHKA 2ZBBA 1K6RA 4ZRRA 2WUQA 1MC0A 1G68A 2HGVA 4OOMA 3OPHA 4E3MA 4ARZB 4Y17A 1KGGA 3HJKA 2WGIA 5HAQA 4Y7PA 1XXMA 5K5BA 2EFXA 1IKGA 1W7FA 5DJTA 4N9KA 4C3QA 4F3LB 2O9CA 2W1RA 2Y2GA 2ZC6B 1XA1A 5EPHA 1DJBA 3MXQA 4S2MA 1BLSA 5L10A 1SCWA 1Y4OA 5TJJA 3G2YA 5JYPA 1J3WA 5CERA 5EVIC 4I39A 2B95A 3HLFA
chains in the Genus database with same CATH topology
2XA7M 4UQIS 1LSWA 3ULFA 3TE8A 2PD8A 2A24A 3H7WB 1ZHHB 2YKHA 1GSXA 1ODVA 2B02A 1YAXA 2J80A 4G3KA 3T4LA 4NXBA 4NXEA 2P08A 5CX7A 5J3WA 1VHMA 1LT0A 5HWTA 2PYPA 3O5YA 3T4JA 5DJUA 1TS0A 2KX6A 3D3OA 1NLZA 4I3IA 1OT6A 2L4RA 1OPXA 1VB6A 2NUTC 2HJ9C 4LRXC 4M4XA 3BJNA 3VE3A 4HNBA 1JNUA 4MN7A 3PR6A 3LIEA 1N9OA 3MQ0A 3HJIA 4HQAA 2W3HA 3JVUA 3NOTC 1P97A 3S7OA 1DP8A 3CUEA 3LR5A 3E98A 4II7A 5F68A 4RQ9A 5EFWA 4GHIB 2FZ0A 3GDIA 1IFQA 2PR5A 1OTIA 3E4OA 2QJ7A 3T4QA 1S4SA 5J4EA 5HDCA 4KUOA 2VX8A 4PHTA 4EEUA 3PBNA 5AJGA 3IBRA 1UGUA 1W63M 2OWHA 4Q0IA 2VJWA 4BBTA 2W27A 3F1OB 2Z6CA 4G3VA 2L1MA 4B9OA 2I9VA 1GSVA 2INWA 3OOVA 3V67A 1XFNA 4AFIA 3BWLA 2GX5A 2EWWA 3OBFA 4MDZA 4L9EA 3F1NA 2HF6A 1EW0A 2QYBA 2LB5A 4LRYC 4HIAA 3PYPA 4GW9A 4R3AA 4WELA 2W1TA 4NXFA 4GLQA 2LB9A 5HWVA 3MF0A 3T4TA 1UWPX 4BJPA 5DKLA 4Y2FA 3CUEC 2B18A 4L9FA 2XA7S 3EQUA 3KSGA 2KLIA 3NOPC 5G4ZA 2VGLM 2VKSA 5L8MA 2OOLA 4EU0A 1TS6A 2JHEA 4CLCB 4GJ4A 2MJ6A 4I5SA 3NOUC 3T4SA 3KYZA 1D7EA 4I38A 1OJ5A 1GSWA 2DMWA 5DKKA 2M1CA 4EEPA 3P7NA 1YSPA 1XFQA 3EOIA 5HD3A 1S4RA 1NRJA 1XJ2A 1ZTUA 3FC7A 5HPFA 4Z1WA 1OTEA 4LPZA 5HPIA 2W0NA 1F98A 3OCNA 5KSHA 4GS9B 2W3EA 4L0LA 3H9WA 4H6JB 5HDSA 4L9GA 1G28A 3KX0X 4IUKA 5TBMA 2Y79A 4HJ3A 4CLCD 3E4PA 1LSVA 1P0ZA 2CMNA 3MMHA 4JGQA 5FL3A 4EETB 4EW7A 3H82B 2VV7A 3HCYA 4Q0HA 3NJAA 5HSQA 4MCWA 4YWZA 1XJ6A 2L0WA 1NWZA 1T1CA 3EEAA 3B33A 2KDKA 2M7UA 4NEED 4QPRA 3W2ZA 4BBVA 2K2NA 1S67L 3DBAA 5HZHA 3PBRA 1P9RA 4ETXA 3BY8A 2GNXA 2VZWA 2HJEA 3LYXA 3EEHA 3LICA 3UB9A 1S66L 4Q0JA 5LBRA 5DFYA 2D02A 1WA9A 1DP9A 2O9AA 3F1PB 3FPWA 4JGPA 5DF9A 3TRCA 3PBSA 3R7WA 2GZAA 2QWSA 3PBQA 3PBTA 1YSQA 5F69A 3KSHA 4DJ3A 3EGDC 5G4YA 4F3LA 2O9BA 1UWNX 4XT2A 4CQHA 2J3TC 4P6ZS 1BYWA 1XJ4A 3BQ8A 4PKYG 2QKPA 4I3AA 5F5YA 3LR3A 3UMDA 3EQVA 3OLOA 3LUQA 3IBJA 3FPVA 3GECA 5HDDA 2WKQA 2VLGA 3TJZC 3D72A 5AVFA 3FG8A 4WL9A 1DP6A 1D06A 3T4OA 3UB8A 2PHYA 3ZQ5A 5AVEA 2YKFA 4UEYA 4HOIA 5C5KA 4LLOB 3EGXC 3LIAA 4HH2A 4MMNA 4MN5A 4HHDA 4FSFA 3CWFA 3LR4A 4WLAA 3RH8B 4KUKA 2PYRA 2V1AA 1H3QA 2ZMVA 4O8GA 5F6AA 4HJ4A 1KOUA 3BY9A 4HY8A 2O0YA 2A24B 2ZOIA 2R78A 1S1YA 4R38A 4EXOA 4JGOA 4O01A 4HP4A 2H28A 3F1OA 1OTDA 1V9ZA 4EQ1A 3K2NA 3R7WB 4DN0A 4WEJA 1N9NA 1W63Q 3ICYA 4WF0A 1S1ZA 4NKPA 1G6OA 2WKPA 3PBOA 5HL6A 3CAXA 4HH3A 4I3JA 3U2AA 1OTAA 3C38A 2PR6A 3LIFA 4B93A 1XJ3A 3OCLA 2JN7A 3R4KA 3VV4A 1OTBA 2VV6A 4EESA 4CLCA 4ARZA 4R6LA 2OWJA 1N9LA 3B42A 2XROA 4K08A 4ETZA 3C2WA 2P04A 2VV8A 4WUJA 1T19A 5I5LA 1MKMA 3RTYA 1V9YA 3UB7A 5MC7A 2ZMFA 3NHQA 3VOLA 1NLYA 3LR0A 3UB6A 3KO6A 4HJ6A 4BBUA 2IA2A 4NXGA 2V0WA 3S7NA 4G3WA 2VGLS 2A2LA 3PXPA 3C30A 4EERA 3F1NB 1Y28A 2PT7A 3A0VA 4GS9A 2W1TB 4R70A 3A0SA 4H6JA 3A0RA 3EWKA 3S7QA 4WN5A 3MJQA 4KQOA 2Z6DA 3P01A 1F9IA 4KQDA 2PDRA 3IS2A 3H82A 2JKTI 1LSXA 1LL8A 3LIBA 4EUVA 3TW8A 3CI6A 1T1AA 4CLCC 2XRNA 3CLOA 2ZOHA 1TD5A 3MQQA 2EWVA 3LFVA 1H8MA 2W3FA 2XSSA 3B47A 4MN6A 5HWWA 3LI8A 4YNRA 1OJGA 4OOLA 2G7UA 2HV1A 3H7WA 2J3WA 4Y5FA 2V1BA 4IHQA 3VE4A 2D01A 3T50A 4DMZA 1X0OA 3C8CA 3G6OA 4ME4A 5J7EA 2V0UA 1TS7A 3KSFA 5TBMB 4DJ2A 3E4QA 3K3CA 4UQIM 5HD5A 4HP9A 3F1PA 3OC2A 1TF1A 4PKYA 4YOFA 3ZYTA 4LRZE 4Y3IA 5KIZA 2FH5A 2PD7A 5DFXA 1T1BA 3KSIA 3S7PA 2W3DA 3BQAA 2EA9A 4HI4A 2OAP1 4O0PA 2K31A 3PHYA 5IS1A 4JGRA 1YKDA 2QHKA 2ZBBA 4IJGA 3LI9A 4GHIA 4ZRRA 1MC0A 1IOUA 2HGVA 4OOMA 4E04A 3SW1A 2V9AA 2O99A 3JVVA 3RFBA 1MZUA 4ARZB 2QJ5A 2W3GA 3MQOA 3LIDA 3HJKA 1TS8A 1STZA 2WKRA 1F5MA 4P6ZM 4PAUA 5A8BA 1DRMA 4IUHA 3CITA 2VA0A 4CLCE 3UMEA 2JKRM 1OT9A 2VEAA 5K5BA 2J3TD 2Y8HA 3BW6A 2M7VA 5DJTA 4BWIA 4F3LB 4FOFA 2O9CA 2W1RA 2KOIA 4XT2B 2GJ3A 3K3DA 2K7SA 2BASA 2OAQ1 3KYQA 3UE6A 3MR0A 1P9WA 4WEKA 3MXQA 5IT5A 3E0YA 4BMWA 1T18A 5IU1A 3T4KA 3UE3A 3IS2B 2P7JA 5TJJA 3MFXA 2NUPC 2JKTM 4GCZA 4I39A 2JKRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULF A;  1LSW A;  2PD8 A;  2A24 A;  3H7W B;  2YKH A;  1GSX A;  1ODV A;  2B02 A;  2J80 A;  4NXB A;  4NXE A;  5J3W A;  1LT0 A;  5HWT A;  2PYP A;  5DJU A;  1TS0 A;  2KX6 A;  4I3I A;  1OT6 A;  2L4R A;  1VB6 A;  4LRX C;  4M4X A;  3VE3 A;  4HNB A;  1JNU A;  3LIE A;  1N9O A;  4HQA A;  3HJI A;  3NOT C;  1P97 A;  1DP8 A;  5F68 A;  4RQ9 A;  5EFW A;  4GHI B;  3GDI A;  2PR5 A;  1OTI A;  3E4O A;  2QJ7 A;  1S4S A;  5J4E A;  5HDC A;  4KUO A;  4EEU A;  3IBR A;  1UGU A;  2OWH A;  4BBT A;  2W27 A;  3F1O B;  2Z6C A;  2L1M A;  4B9O A;  2I9V A;  1GSV A;  2INW A;  1XFN A;  3BWL A;  4L9E A;  3F1N A;  1EW0 A;  4LRY C;  4HIA A;  3PYP A;  4GW9 A;  4R3A A;  4NXF A;  5HWV A;  1UWP X;  5DKL A;  4L9F A;  3NOP C;  5G4Z A;  2OOL A;  1TS6 A;  2JHE A;  4I5S A;  3NOU C;  1D7E A;  4I38 A;  1OJ5 A;  1GSW A;  5DKK A;  2M1C A;  4EEP A;  3P7N A;  1XFQ A;  5HD3 A;  1S4R A;  1XJ2 A;  3FC7 A;  1OTE A;  4LPZ A;  2W0N A;  1F98 A;  4GS9 B;  3H9W A;  4H6J B;  5HDS A;  4L9G A;  1G28 A;  3KX0 X;  5TBM A;  4HJ3 A;  3E4P A;  1LSV A;  1P0Z A;  2CMN A;  4JGQ A;  4EW7 A;  4EET B;  3H82 B;  2VV7 A;  3NJA A;  5HSQ A;  4YWZ A;  1XJ6 A;  2L0W A;  1NWZ A;  1T1C A;  3B33 A;  2KDK A;  4BBV A;  1S67 L;  5HZH A;  3BY8 A;  3LYX A;  3EEH A;  3LIC A;  3UB9 A;  1S66 L;  2D02 A;  1WA9 A;  1DP9 A;  3F1P B;  4JGP A;  2QWS A;  5F69 A;  4DJ3 A;  5G4Y A;  4F3L A;  1UWN X;  4XT2 A;  1BYW A;  1XJ4 A;  4PKY G;  2QKP A;  4I3A A;  5F5Y A;  3UMD A;  3OLO A;  3LUQ A;  3GEC A;  5HDD A;  2WKQ A;  2VLG A;  3D72 A;  5AVF A;  3FG8 A;  4WL9 A;  1DP6 A;  1D06 A;  3UB8 A;  2PHY A;  3ZQ5 A;  5AVE A;  2YKF A;  4HOI A;  4LLO B;  3LIA A;  4HH2 A;  4MN5 A;  4HHD A;  3CWF A;  4WLA A;  3RH8 B;  4KUK A;  2PYR A;  2V1A A;  5F6A A;  4HJ4 A;  1KOU A;  3BY9 A;  4HY8 A;  2A24 B;  2ZOI A;  2R78 A;  1S1Y A;  4R38 A;  4EXO A;  4JGO A;  4HP4 A;  2H28 A;  3F1O A;  1OTD A;  1V9Z A;  4EQ1 A;  1N9N A;  3ICY A;  4WF0 A;  1S1Z A;  2WKP A;  3CAX A;  4HH3 A;  4I3J A;  1OTA A;  2PR6 A;  3LIF A;  1XJ3 A;  2JN7 A;  1OTB A;  2VV6 A;  4EES A;  4R6L A;  2OWJ A;  1N9L A;  4K08 A;  3C2W A;  2VV8 A;  4WUJ A;  5I5L A;  1T19 A;  3RTY A;  1V9Y A;  3UB7 A;  3NHQ A;  3VOL A;  3UB6 A;  4HJ6 A;  4BBU A;  4NXG A;  2V0W A;  4EER A;  3F1N B;  1Y28 A;  3A0V A;  4GS9 A;  4R70 A;  3A0S A;  4H6J A;  3A0R A;  3EWK A;  4WN5 A;  3MJQ A;  2Z6D A;  1F9I A;  4KQD A;  2PDR A;  3IS2 A;  3H82 A;  1LSX A;  1LL8 A;  3LIB A;  1T1A A;  3CLO A;  2ZOH A;  3MQQ A;  4MN6 A;  5HWW A;  3LI8 A;  1OJG A;  2HV1 A;  3H7W A;  3VE4 A;  2V1B A;  2D01 A;  3T50 A;  1X0O A;  3C8C A;  3G6O A;  5J7E A;  2V0U A;  1TS7 A;  5TBM B;  4DJ2 A;  3E4Q A;  3K3C A;  5HD5 A;  4HP9 A;  3F1P A;  4PKY A;  4LRZ E;  5KIZ A;  2PD7 A;  1T1B A;  2EA9 A;  4HI4 A;  3PHY A;  5IS1 A;  4JGR A;  2QHK A;  2ZBB A;  3LI9 A;  4GHI A;  4E04 A;  3SW1 A;  2V9A A;  1MZU A;  2QJ5 A;  3MQO A;  3LID A;  3HJK A;  1TS8 A;  2WKR A;  5A8B A;  1DRM A;  3UME A;  1OT9 A;  2VEA A;  5DJT A;  4F3L B;  4XT2 B;  2GJ3 A;  3K3D A;  2K7S A;  2BAS A;  3UE6 A;  3MR0 A;  3MXQ A;  1T18 A;  5IU1 A;  3IS2 B;  2P7J A;  3MFX A;  4GCZ A;  4I39 A; 
#chains in the Genus database with same CATH topology
 4BLM A;  4K0W A;  3ULF A;  1LSW A;  3SS4 A;  4ID4 A;  4BD0 A;  3G35 A;  4FUW A;  4XUX A;  2J80 A;  3ZHH A;  5CX7 A;  3N8L A;  1LT0 A;  3O5Y A;  4LCL A;  3IXD A;  3D3O A;  3LO7 A;  4Y13 A;  2XF3 A;  2NUT C;  4LRX C;  3WRZ A;  5L07 A;  2ZC7 A;  1NZO A;  1ZC2 A;  3LIE A;  4PPR A;  1N9O A;  3MQ0 A;  3HJI A;  3JVU A;  2PU4 A;  3CUE A;  5F68 A;  5EFW A;  4GHI B;  5I94 A;  1PZO A;  4KG2 A;  3T4Q A;  1S4S A;  3MZF A;  4WYY A;  5J4E A;  4OQI A;  4KUO A;  1Q2Q A;  4EEU A;  1NYM A;  1YM1 A;  2QPN A;  1AXB A;  4Q0I A;  3RXX A;  4BBT A;  2Z6C A;  3QP6 A;  4B9O A;  3HVF A;  3DTE A;  2INW A;  3OOV A;  3NIA A;  4AFI A;  3BWL A;  3OBF A;  4MDZ A;  4L9E A;  5M19 A;  4Y0U A;  3ZFZ A;  1DJA A;  5M1A A;  4A5R A;  4L9F A;  1E4D A;  3KSG A;  1Q2P A;  1BLH A;  5G4Z A;  2VGL M;  4GKU A;  1TS6 A;  4I5S A;  3NOU C;  4KZ7 A;  1L2S A;  3ZNY A;  1A0K A;  1VM1 A;  4Q8I A;  5GHX A;  1S4R A;  1NRJ A;  1HTZ A;  1BUL A;  3HLG A;  4LPZ A;  1F98 A;  5A92 A;  2ZD8 A;  5A90 A;  1MKI A;  5FAQ A;  4GS9 B;  1VET B;  5HDS A;  3DWK A;  4L9G A;  3KX0 X;  5TBM A;  4WBG A;  2Y79 A;  4HJ3 A;  4DF6 A;  1PRQ A;  1DY6 A;  4S2I A;  3MMH A;  5FL3 A;  3FYZ A;  2XLN A;  4OH0 A;  1EWZ A;  1XJ6 A;  2L0W A;  3B33 A;  2KDK A;  2M7U A;  4NEE D;  3CMZ A;  4O7D A;  4BBV A;  5FQ9 A;  4R4R A;  1P9R A;  1MBL A;  2GNX A;  3BY8 A;  2VZW A;  5HAI A;  1I2W A;  4BL2 A;  4X56 A;  3LIC A;  3IX8 A;  2ZQA A;  1S66 L;  4EBP A;  1WA9 A;  2O9A A;  3F1P B;  4UA7 A;  3UE0 A;  4JGP A;  4Y0T A;  3PBS A;  1N9B A;  1CI8 A;  2GZA A;  4R4S A;  3SH9 A;  5GLD A;  1D1J A;  3EGD C;  3UDI A;  2Q9M A;  3UN7 A;  4KZ3 A;  4XT2 A;  4CQH A;  5IHV A;  1XJ4 A;  4X6T A;  3LR3 A;  1ESU A;  2BLS A;  3MS6 A;  4IVI A;  5EVI B;  2ZQ8 A;  5CHM A;  1LHY A;  3O3V A;  4KQR A;  4PM7 A;  3Q81 A;  5DTK A;  4KZ8 A;  1IYP A;  2E8I A;  3D72 A;  5AVF A;  2PBD P;  4KG5 A;  5G18 A;  3IQA A;  4K0X A;  2PHY A;  3C7U A;  5AVE A;  5CTN A;  2YKF A;  3QHY A;  5C5K A;  5E2H A;  1PZP A;  4FSF A;  3IF6 A;  2WZZ A;  4WLA A;  5HAR A;  2PYR A;  1L0E A;  1XKZ A;  1H3Q A;  4QU3 A;  4O8G A;  4S2N C;  3N8R A;  5F82 A;  2O0Y A;  1K57 C;  1KVM A;  3VP1 A;  3NEC A;  2ZL1 A;  2X02 A;  3VP4 A;  4R38 A;  4O01 A;  3T1S A;  2ZM2 A;  4OLG A;  4MBK A;  2H28 A;  2JKG A;  3HLC A;  3F1O A;  3G32 A;  3K2N A;  1M6K A;  3IT9 A;  5FA7 A;  3N4I A;  3S22 A;  2RCX A;  1N9N A;  3D4F A;  3IHB A;  1KVL A;  1SDE A;  4I3J A;  3T12 B;  4M3K A;  2JN7 A;  3R4K A;  3VV4 A;  2VV6 A;  4QY6 A;  2Q0O A;  2A3U A;  2XRO A;  4ESP A;  1E3U D;  3BM6 A;  4ETZ A;  2P04 A;  4WUJ A;  5FDH A;  1E25 A;  5I5L A;  1MKM A;  1L3L A;  2DRW A;  2Q9N A;  3IX3 A;  3LR0 A;  3UB6 A;  2Y2L A;  1H8Y A;  4NXG A;  3S7N A;  4G3W A;  2VGL S;  3C30 A;  4B4X A;  1Y28 A;  3L7H A;  4RX2 A;  5GLC A;  4BEN A;  2W1T B;  4H6J A;  3S7Q A;  2J9O A;  4WN5 A;  4KQO A;  4F94 A;  3WS0 A;  3P01 A;  1F9I A;  1KDW A;  1RP5 A;  3IS2 A;  3HUN A;  4P0M A;  3VSL A;  1GA9 A;  3TW8 A;  1ONG A;  4E3N A;  3L9K A;  4CLC C;  2Y2P A;  2XRN A;  2XEP A;  1QME A;  1ES2 A;  1TD5 A;  3UDF A;  2W3F A;  4MN6 A;  4FTX A;  4LV2 A;  3VE4 A;  2Y2H A;  3D9Y A;  3C8C A;  4ZJ3 A;  5L2F A;  2V0U A;  4KZ5 A;  4OP8 A;  2Y2O A;  4DJ2 A;  3K3C A;  3ZYT A;  4ZDX A;  2PD7 A;  5DFX A;  2V8C A;  5AQA A;  4GD8 A;  5EEC A;  5IS1 A;  1QMF A;  4EWF A;  4JGR A;  3LI9 A;  4LEN A;  1NYY A;  2ZQC A;  1K55 C;  4KG6 A;  4IVK A;  4E04 A;  3RFB A;  1MZU A;  5AQ9 A;  2W3G A;  1TS8 A;  1STZ A;  2WKR A;  2WYX A;  3ZDJ A;  4PAU A;  5JYO A;  2VEA A;  4KZ9 A;  5EV0 A;  5CXW A;  1ES3 A;  3C4P A;  4FOF A;  1G5U A;  2KOI A;  2GJ3 A;  3K3D A;  2K7S A;  2BAS A;  2X01 A;  2XK1 A;  3MR0 A;  4JBF A;  1KGE A;  3V5M A;  2P7J A;  2XFS A;  3NC8 A;  2NUP C;  1SKO A;  1ERM A;  3IH8 A;  4GOG A;  3IXG A;  3M2J A;  4KEN B;  1AWI A;  3TE8 A;  3GTC A;  2WGV A;  2A24 A;  3H7W B;  2VGJ A;  1GSX A;  1ODV A;  4G3K A;  1BZA A;  3T4L A;  4NXB A;  4LGW A;  5J3W A;  4DXB A;  3DTI A;  3C5A A;  3W4Q A;  5HWT A;  3N6I A;  4C75 A;  1BUE A;  5FI6 A;  3Q7V A;  4WMC D;  2XD5 A;  1E3U A;  4MN7 A;  1NRF A;  5FEF A;  4Y0O A;  1FQG A;  3IF5 A;  2W3H A;  3NOT C;  1MWT A;  4P6B A;  1TDG A;  3TG9 A;  1P97 A;  4II7 A;  4JF6 A;  3WS1 A;  2FZ0 A;  1YLZ A;  2ZC3 B;  1H5X A;  3AGD A;  1IFQ A;  3SS3 A;  2PR5 A;  1OTI A;  3E4O A;  4PHT A;  4JXG A;  5AJG A;  2XR0 A;  2Y59 A;  2VJW A;  2W27 A;  1SDN A;  4R1G A;  2L1M A;  1JVJ A;  2I9V A;  1PYY A;  1XFN A;  3ZVT A;  5HL1 A;  3GR2 A;  2X71 A;  1RCJ A;  4YFM A;  4X69 A;  3F1N A;  1LLB A;  1EW0 A;  1MPL A;  2R9W A;  2Y2Q A;  3MFD A;  4HIA A;  4R3A A;  4WEL A;  1WE4 A;  2LB9 A;  5HWV A;  3MF0 A;  3T4T A;  1UWP X;  3UE1 A;  3QP1 A;  5DKL A;  4U3T A;  3V39 A;  3EQU A;  4CLC B;  3W4P A;  4EBN A;  1FR6 A;  2MJ6 A;  4N9L A;  1J9M A;  1D7E A;  4I38 A;  1GSW A;  2DMW A;  2M1C A;  4FCF A;  2P9V A;  3P7N A;  1XFQ A;  4R0Q A;  1XJ2 A;  3FC7 A;  5HPF A;  4NET A;  3G4P A;  2HP6 A;  4OQ0 A;  5HPI A;  2OV5 A;  4PMA A;  3OCN A;  2G2W A;  4JKT A;  4IUK A;  2ZQ9 A;  4EQI A;  1LSV A;  3Q1F A;  4EW7 A;  4BL3 A;  4MCW A;  1MXO A;  1CQA A;  3DTK A;  2C6W B;  4OQG A;  2VK3 A;  3W2Z A;  2K2N A;  1KGF A;  5HZH A;  2H10 A;  1WYB A;  5DF8 A;  3LY3 A;  3C7V A;  3UB9 A;  5LBR A;  2D02 A;  3FPW A;  3JPU A;  3SH7 A;  3HUO A;  3TRC A;  4X53 A;  5GLA A;  3PBT A;  1YSQ A;  5F69 A;  4ZAM A;  5G4Y A;  4F3L A;  2J3T C;  2Y2N A;  3BQ8 A;  2OLV A;  3BFE A;  3UMD A;  3G34 A;  4NG2 A;  3OLO A;  3LUQ A;  3VP3 A;  3IBJ A;  3A3F A;  3FPV A;  4WMC A;  4X25 A;  5HDD A;  3FZC A;  3LGO A;  1K56 A;  2Z2M B;  1D06 A;  3PAE A;  3ZNT A;  2OLU A;  3ZQ5 A;  3P98 A;  2WGW B;  1U60 A;  4UEY A;  2HDU A;  5AQB A;  4QD4 A;  1PI4 A;  5CGX A;  4GNU A;  2HP5 A;  2ZQ7 A;  5EVI D;  1LI9 A;  3WS4 A;  4MN5 A;  1FSW A;  1TEM A;  3HL9 A;  4OPR A;  2ACG A;  4WZ4 A;  3A3D A;  4DDY A;  4DE1 A;  3LR4 A;  5EVL A;  3RH8 B;  4KUK A;  2V1A A;  5E2G A;  3LEZ A;  2ZMV A;  1HD8 A;  5F6A A;  4OPY A;  4HJ4 A;  5GLB A;  5TGF A;  4R3B A;  3GQZ A;  2R78 A;  1S1Y A;  3ISG A;  4D60 A;  4OON A;  4HP4 A;  3KYE A;  3MKE A;  1DJC A;  4MEZ A;  1OTD A;  4EQ1 A;  3IX4 A;  4EUZ A;  4IED A;  5CGW A;  4BQM A;  2R9X A;  3ICY A;  1JWV A;  4FH2 A;  3ZG7 B;  4NKP A;  1YLW A;  4ZBE A;  5HL6 A;  5A93 A;  3U2A A;  3UY6 A;  2UWX A;  1XJ3 A;  3OCL A;  3BLS A;  4EES A;  1M40 A;  5KSC A;  4R6L A;  5KMW A;  3B42 A;  5FEG A;  4B4Z A;  1YMX A;  3RTY A;  4R3J A;  5M18 A;  1K0K A;  3LEQ A;  4BBU A;  4DXC A;  1ZG4 A;  2A2L A;  4EER A;  1CEG A;  4S2L A;  3HLW A;  2Y2K A;  4KZA A;  4GS9 A;  1VQQ A;  1VET A;  3E2K A;  3WS2 A;  3MJQ A;  5FSR A;  2ZM8 A;  1WYC A;  1VEU A;  3BFG A;  4UAA A;  3S4X A;  2E8J A;  1LSX A;  4KZ4 A;  1PIO A;  2C5W B;  3DTM A;  1HVB A;  1PWG A;  3LFV A;  1H8M A;  5CHJ A;  2H0Y A;  1OJG A;  4N1X A;  2DCF A;  2HV1 A;  1CF0 A;  3OPL A;  3SS5 A;  2A49 A;  2WAF A;  2ZL1 B;  4IHQ A;  2HP9 A;  2D01 A;  4N92 A;  2J7V A;  3E2L A;  4JF4 A;  1TS7 A;  3UO9 A;  1NJ4 A;  1ERO A;  4HEF A;  5HD5 A;  2BG1 A;  4HP9 A;  3F1P A;  3OC2 A;  1IKI A;  4PKY A;  4YOF A;  3UPP A;  5DTT A;  1S6R A;  1YMS A;  5E2E A;  2W3D A;  4IBX A;  2OAP 1;  4U0T A;  1W79 A;  1W8Y A;  2H5S A;  1BLC A;  3VP0 A;  5TR7 A;  3Q07 A;  3QNC A;  3TSG A;  2V9A A;  2O99 A;  5FAS A;  5EVI A;  5L09 A;  3MQO A;  3LID A;  4GDB A;  3UB5 P;  1F5M A;  4P6Z M;  4GZB A;  1DRM A;  4IUH A;  3CIT A;  4DDS A;  2Y8H A;  3T1X A;  3BW6 A;  4E3J A;  4JXV A;  4BWI A;  4D2O A;  2HDQ A;  3FKV A;  3C4O A;  2OAQ 1;  3KYQ A;  3QNB A;  3UDX A;  1W5D A;  1P9W A;  5HFO A;  3E0Y A;  5DVA A;  4BMW A;  1T18 A;  5IU1 A;  2PU2 A;  3T4K A;  1CEF A;  3HUM A;  3IS2 B;  3IWO A;  5GHZ A;  3IH9 A;  5EM0 A;  2JKT M;  1ESI A;  5CEB A;  2JKR I;  1N4O A;  3W8K A;  1PWD A;  2CC1 A;  2EXB A;  3QP5 A;  4UQI S;  1ZHH B;  4PM6 A;  1GCE A;  1YAX A;  3ZCZ A;  4NXE A;  2P08 A;  3IWI A;  1VHM A;  1ACF A;  3IHA A;  5DJU A;  2KX6 A;  1NLZ A;  4I3I A;  2L4R A;  5FI2 A;  1OPX A;  1VB6 A;  2HJ9 C;  5CEC A;  3PR6 A;  1ALQ A;  4HQA A;  3S7O A;  4QHC A;  3E98 A;  3OPP A;  1MWR A;  3ZG0 A;  5DTS A;  4EV4 A;  5F1G A;  2VX8 A;  4Y15 A;  1KE0 A;  1UGU A;  4JPM A;  3OZH A;  1FSY A;  4N1H A;  4G3V A;  2QMI A;  1GSV A;  4FD8 A;  3IWQ A;  3V67 A;  1FR1 A;  2GX5 A;  1L0G A;  5CTM A;  2Y2I A;  3PTE A;  2Y2M A;  3IXH A;  2HF6 A;  2V2F F;  2QYB A;  2LB5 A;  4LRY C;  4U0X A;  3PYP A;  4GW9 A;  2W1T A;  4NXF A;  4GLQ A;  3VFH A;  4BJP A;  3CPT B;  1ES5 A;  3CUE C;  2B18 A;  3NY4 A;  2XA7 S;  3NCK A;  4H8R A;  3M6H A;  2KLI A;  3NOP C;  2VKS A;  3M6B A;  5L8M A;  4GJ4 A;  2OSU A;  3FV7 A;  2EX9 A;  5DKK A;  1YLT A;  4EEP A;  3Q7Z A;  1YSP A;  4PM5 A;  5HD3 A;  1ZTU A;  1YQS A;  5KZH A;  1OTE A;  3G31 A;  4WZ5 A;  2W0N A;  5KSH A;  1BTL A;  2W3E A;  1G28 A;  3HLE A;  4WM9 A;  4CLC D;  3E4P A;  2CMN A;  4JGQ A;  2IWB A;  4EET B;  2J9P A;  3H82 B;  2VV7 A;  4DRT A;  3NJA A;  3V50 A;  5HSQ A;  2ZJ9 A;  5EOE A;  1T1C A;  1IYS A;  4S2K A;  4ZJ2 A;  1OME A;  2JC7 A;  2ZC4 B;  4ETX A;  3UPO A;  3FKW A;  3SOI A;  3EEH A;  3NDG A;  4MBH A;  4S2J A;  4Q0J A;  4OVD A;  1DP9 A;  4CJN A;  5D3O A;  5DF9 A;  3R7W A;  4E3K A;  2QWS A;  2ZQD A;  2I72 A;  3KSH A;  4DJ3 A;  2O9B A;  1PWC A;  2DNS A;  4P6Z S;  4PKY G;  4KZ6 A;  4JF5 A;  3LCE A;  5F5Y A;  3EQV A;  1K4F A;  4S2N A;  3GEC A;  4LV3 A;  3HRE A;  1K57 A;  1GA0 A;  1H0M A;  3OPR A;  4Z9Q A;  4X68 A;  5F83 A;  3WS5 A;  3BFC A;  4WL9 A;  3B3X A;  4LV1 A;  1XPB A;  3O87 A;  3NBL A;  1SZV A;  4LLO B;  3EGX C;  3LIA A;  5HX9 A;  3I7J A;  4XUZ A;  4MMN A;  3RJU A;  1MY8 A;  4UA9 A;  3CWF A;  4E3O A;  2WAD A;  2ZC5 B;  1SKF A;  1G6A A;  2XFT A;  4X1L A;  1H8Z A;  4GN2 A;  1NZU A;  3BRM A;  3GMW A;  2IWD A;  1KOU A;  3BY9 A;  4HY8 A;  4MBF A;  3A3I A;  2ZOI A;  1EI5 A;  2JBF A;  2PBY A;  5HW3 A;  1L0D A;  1K54 A;  5EOO A;  4EXO A;  3Q82 A;  1K25 A;  2WZX A;  4RYE A;  2JKF A;  1YT4 A;  5FAT A;  4WEJ A;  1S0W A;  4WF0 A;  1S1Z A;  3IF6 C;  1G6O A;  2WKP A;  5FI7 A;  4RA7 A;  4HH3 A;  3C38 A;  2PR6 A;  3LIF A;  4DE0 A;  1LL9 A;  1C3B A;  1IYO A;  3MXR A;  4CLC A;  4ARZ A;  2B5R A;  1N9L A;  1FCO A;  1T19 A;  3UB7 A;  5MC7 A;  3NHQ A;  1NLY A;  4HJ6 A;  2EX8 A;  4NK3 A;  1JWP A;  3ZG8 B;  4QB8 A;  3O86 A;  3A0S A;  3EWK A;  1I2S A;  1YLP A;  4KQD A;  5EUA A;  4QWO A;  4S2O A;  2ZM0 A;  1GHI A;  5EVE A;  3CI6 A;  1T1A A;  3CLO A;  2ZOH A;  3MQQ A;  3G30 A;  3BEB A;  3ZG9 B;  1K55 A;  2XSS A;  3AGF A;  3LI8 A;  1KE4 A;  2G7U A;  3MXS A;  3MZE A;  4LV0 A;  3T50 A;  4DMZ A;  4ME4 A;  5J7E A;  1O7E A;  5DF7 A;  3VSK A;  1MWU A;  5E43 A;  3ZG5 A;  5TBM B;  4S2P A;  4UQI M;  1TF1 A;  2QZ6 A;  3T1R A;  3PAG A;  5E2F A;  3A3E A;  1HLU P;  1T1B A;  3GRJ A;  1IEL A;  4IBR A;  4JXW A;  4O0P A;  2JE5 A;  1FCM A;  4LCM A;  1YKD A;  4IJG A;  4GHI A;  4HES A;  1ONH A;  2HPB A;  1IOU A;  2IWC A;  1YLY A;  2HZ5 A;  3SW1 A;  3JVV A;  2EXA A;  4OLD A;  2QJ5 A;  4JLF A;  5A8B A;  3SH8 A;  2VA0 A;  3SZT A;  4CLC E;  3UME A;  1K38 A;  2JKR M;  4DE3 A;  1OT9 A;  2J3T D;  4KQQ A;  4HBU A;  2M7V A;  1L0F A;  4MLL A;  2JCH A;  3BFD A;  2WGW A;  5EE8 A;  5TFQ A;  4XT2 B;  2FFY A;  3BYD A;  3UE6 A;  4E3I A;  4WEK A;  5IT5 A;  1PW1 A;  1VEU B;  3UE3 A;  3MFX A;  4GCZ A;  3BEC A;  4X55 A;  2EX6 A;  2XA7 M;  3O88 A;  3QP2 A;  2PD8 A;  2YKH A;  2B02 A;  3BFF A;  2H0T A;  3P09 A;  2J8Y A;  4WZ5 C;  1KE3 A;  3BLM A;  2PYP A;  3T4J A;  1TS0 A;  2WKH A;  1OT6 A;  1JTG A;  4M4X A;  3BJN A;  3IF6 B;  3VE3 A;  3ITA A;  4HNB A;  1JNU A;  1BSG A;  3DAV A;  3T1Q B;  1DP8 A;  3LR5 A;  4RQ9 A;  3S1Y A;  5FQK A;  3GDI A;  4DE2 A;  3LY4 A;  2QJ7 A;  3UNW A;  5HDC A;  1PFL A;  1RGY A;  3MKF A;  5FAP A;  1BT5 A;  3PBN A;  1PW8 A;  3CZD A;  3IBR A;  1W63 M;  4FH4 A;  2OWH A;  4PM8 A;  1K4E A;  1BLP A;  3F1O B;  4E3L A;  1IEM A;  2Z2L B;  2EWW A;  1PI5 A;  2V20 A;  1TDL A;  5FQI A;  4QJG A;  5BOH A;  1XX2 A;  2PRF A;  2RL3 A;  2V8F A;  4OPQ A;  4Y2F A;  2WK0 A;  1CI9 A;  3N7W A;  5FQQ A;  1XP4 A;  4PM9 A;  2OOL A;  3WRT A;  4EU0 A;  2JHE A;  1NY0 A;  4BD1 A;  2UV0 E;  3T4S A;  5J8X A;  3KYZ A;  2XH9 A;  1OJ5 A;  1FCN A;  2PAV P;  3GV9 A;  1XA7 A;  4UHU A;  1PNE A;  3EOI A;  3MSH A;  3WWX A;  4C6Y A;  4Z1W A;  4L0L A;  3H9W A;  3AGE A;  4H6J B;  3W4O A;  1GHP A;  1LL5 A;  5CGS A;  4OOY A;  3CG5 A;  3ITB A;  5GL9 A;  1P0Z A;  3HCY A;  4Q0H A;  1K6S A;  4YWZ A;  1NWZ A;  2HDR A;  3EEA A;  3U4L P;  3FWL A;  4QPR A;  3M2K A;  2Y4A A;  2P74 A;  1ERQ A;  4MNR A;  1S67 L;  3DBA A;  3PBR A;  2HJE A;  3LYX A;  4RVA A;  1YPR A;  4GDN A;  4R23 A;  2XGN A;  5DFY A;  1K54 C;  4ZJ1 A;  5FDS A;  4OPZ A;  3GVB A;  2XD1 A;  4P87 A;  3PBQ A;  3VFF A;  4GD6 A;  3UPN A;  1JWZ A;  1MWS A;  1UWN X;  3MBZ A;  4RX3 A;  1BYW A;  2QKP A;  1NXY A;  4I3A A;  4DKI A;  3NI9 A;  3VP2 A;  1ZKJ A;  2FFF B;  2ZLY A;  2VGK A;  3VOZ A;  2Y91 A;  2WKQ A;  5FAO A;  4ZTK A;  2VLG A;  4GB7 A;  3TJZ C;  2BTF P;  3FG8 A;  1DP6 A;  3VOY A;  1FIL A;  3T4O A;  3UB8 A;  1ES4 A;  2GDN A;  3DW0 A;  4HOI A;  1CJF A;  1Z09 A;  4HH2 A;  4OP5 A;  5F1F A;  4HHD A;  1I5Q A;  1SKO B;  1Y54 A;  2G2U A;  2V1Z A;  2ZMA A;  1IYQ A;  3A3J A;  3ZVW A;  4X1M A;  4YIN A;  5GHY A;  2A24 B;  3V3R A;  4EBL A;  4XXR A;  4P85 A;  1O07 A;  4JGO A;  1KDS A;  5EM1 A;  5FQJ A;  3RXW A;  1TVF A;  1W8Q A;  1YLJ A;  3Q7V B;  3QP4 A;  1V9Z A;  3R7W B;  4DN0 A;  4HBT A;  5U47 A;  3TOI A;  1W63 Q;  3IXB A;  4CPK A;  3NUL A;  2XDM A;  1RGZ A;  3PBO A;  1Z6F A;  3CAX A;  3GSG A;  1OTA A;  3HLD A;  3CPT A;  4B93 A;  5HAP A;  1FIK A;  2Y55 A;  1ZG6 A;  4UA6 A;  2AVX A;  3ZGA B;  1OTB A;  5A91 A;  1F2K A;  3QP8 A;  4QY5 A;  2OWJ A;  4K08 A;  3NDE A;  3C2W A;  2VV8 A;  4E6X A;  1V9Y A;  2WKI A;  2ZMF A;  5CHU A;  3VOL A;  3KO6 A;  2IA2 A;  2V0W A;  3PXP A;  3CHW P;  5CED A;  3F1N B;  2PT7 A;  3A0V A;  4R70 A;  1LI0 A;  3A0R A;  3CJM A;  4K91 A;  4OKP A;  2Z6D A;  4LFU A;  2Y2J A;  5AQ7 A;  2PDR A;  2HDS A;  3VMA A;  3H82 A;  1JTD A;  2JKT I;  1LL8 A;  3JYI A;  3LIB A;  4JXS A;  4EUV A;  1K56 D;  3MZD A;  2EWV A;  1XGJ A;  4OQH A;  5HWW A;  3B47 A;  3V3S A;  2P9V B;  4YNR A;  1GHM A;  3HLB A;  2XQZ A;  4OOL A;  3H7W A;  1CK3 A;  2J3W A;  1HZO A;  2V1B A;  4Y5F A;  2EX2 A;  1X0O A;  3G6O A;  1SHV A;  4B88 A;  2WKE A;  3KSF A;  3E4Q A;  4E6W A;  3G2Z A;  1FOF A;  2WAE A;  4LRZ E;  4Y3I A;  3HBR A;  5KIZ A;  2FH5 A;  3KSI A;  3S7P A;  3BQA A;  2EA9 A;  4HI4 A;  4KZB A;  3N8S A;  1XGI A;  2K31 A;  5CRF A;  5FQM A;  3PHY A;  2EFU A;  3DWZ A;  2QHK A;  2ZBB A;  1K6R A;  4ZRR A;  2WUQ A;  1MC0 A;  1G68 A;  2HGV A;  4OOM A;  3OPH A;  4E3M A;  4ARZ B;  4Y17 A;  1KGG A;  3HJK A;  2WGI A;  5HAQ A;  4Y7P A;  1XXM A;  5K5B A;  2EFX A;  1IKG A;  1W7F A;  5DJT A;  4N9K A;  4C3Q A;  4F3L B;  2O9C A;  2W1R A;  2Y2G A;  2ZC6 B;  1XA1 A;  5EPH A;  1DJB A;  3MXQ A;  4S2M A;  1BLS A;  5L10 A;  1SCW A;  1Y4O A;  5TJJ A;  3G2Y A;  5JYP A;  1J3W A;  5CER A;  5EVI C;  4I39 A;  2B95 A;  3HLF A; 
#chains in the Genus database with same CATH homology
 2XA7 M;  4UQI S;  1LSW A;  3ULF A;  3TE8 A;  2PD8 A;  2A24 A;  3H7W B;  1ZHH B;  2YKH A;  1GSX A;  1ODV A;  2B02 A;  1YAX A;  2J80 A;  4G3K A;  3T4L A;  4NXB A;  4NXE A;  2P08 A;  5CX7 A;  5J3W A;  1VHM A;  1LT0 A;  5HWT A;  2PYP A;  3O5Y A;  3T4J A;  5DJU A;  1TS0 A;  2KX6 A;  3D3O A;  1NLZ A;  4I3I A;  1OT6 A;  2L4R A;  1OPX A;  1VB6 A;  2NUT C;  2HJ9 C;  4LRX C;  4M4X A;  3BJN A;  3VE3 A;  4HNB A;  1JNU A;  4MN7 A;  3PR6 A;  3LIE A;  1N9O A;  3MQ0 A;  3HJI A;  4HQA A;  2W3H A;  3JVU A;  3NOT C;  1P97 A;  3S7O A;  1DP8 A;  3CUE A;  3LR5 A;  3E98 A;  4II7 A;  5F68 A;  4RQ9 A;  5EFW A;  4GHI B;  2FZ0 A;  3GDI A;  1IFQ A;  2PR5 A;  1OTI A;  3E4O A;  2QJ7 A;  3T4Q A;  1S4S A;  5J4E A;  5HDC A;  4KUO A;  2VX8 A;  4PHT A;  4EEU A;  3PBN A;  5AJG A;  3IBR A;  1UGU A;  1W63 M;  2OWH A;  4Q0I A;  2VJW A;  4BBT A;  2W27 A;  3F1O B;  2Z6C A;  4G3V A;  2L1M A;  4B9O A;  2I9V A;  1GSV A;  2INW A;  3OOV A;  3V67 A;  1XFN A;  4AFI A;  3BWL A;  2GX5 A;  2EWW A;  3OBF A;  4MDZ A;  4L9E A;  3F1N A;  2HF6 A;  1EW0 A;  2QYB A;  2LB5 A;  4LRY C;  4HIA A;  3PYP A;  4GW9 A;  4R3A A;  4WEL A;  2W1T A;  4NXF A;  4GLQ A;  2LB9 A;  5HWV A;  3MF0 A;  3T4T A;  1UWP X;  4BJP A;  5DKL A;  4Y2F A;  3CUE C;  2B18 A;  4L9F A;  2XA7 S;  3EQU A;  3KSG A;  2KLI A;  3NOP C;  5G4Z A;  2VGL M;  2VKS A;  5L8M A;  2OOL A;  4EU0 A;  1TS6 A;  2JHE A;  4CLC B;  4GJ4 A;  2MJ6 A;  4I5S A;  3NOU C;  3T4S A;  3KYZ A;  1D7E A;  4I38 A;  1OJ5 A;  1GSW A;  2DMW A;  5DKK A;  2M1C A;  4EEP A;  3P7N A;  1YSP A;  1XFQ A;  3EOI A;  5HD3 A;  1S4R A;  1NRJ A;  1XJ2 A;  1ZTU A;  3FC7 A;  5HPF A;  4Z1W A;  1OTE A;  4LPZ A;  5HPI A;  2W0N A;  1F98 A;  3OCN A;  5KSH A;  4GS9 B;  2W3E A;  4L0L A;  3H9W A;  4H6J B;  5HDS A;  4L9G A;  1G28 A;  3KX0 X;  4IUK A;  5TBM A;  2Y79 A;  4HJ3 A;  4CLC D;  3E4P A;  1LSV A;  1P0Z A;  2CMN A;  3MMH A;  4JGQ A;  5FL3 A;  4EET B;  4EW7 A;  3H82 B;  2VV7 A;  3HCY A;  4Q0H A;  3NJA A;  5HSQ A;  4MCW A;  4YWZ A;  1XJ6 A;  2L0W A;  1NWZ A;  1T1C A;  3EEA A;  3B33 A;  2KDK A;  2M7U A;  4NEE D;  4QPR A;  3W2Z A;  4BBV A;  2K2N A;  1S67 L;  3DBA A;  5HZH A;  3PBR A;  1P9R A;  4ETX A;  3BY8 A;  2GNX A;  2VZW A;  2HJE A;  3LYX A;  3EEH A;  3LIC A;  3UB9 A;  1S66 L;  4Q0J A;  5LBR A;  5DFY A;  2D02 A;  1WA9 A;  1DP9 A;  2O9A A;  3F1P B;  3FPW A;  4JGP A;  5DF9 A;  3TRC A;  3PBS A;  3R7W A;  2GZA A;  2QWS A;  3PBQ A;  3PBT A;  1YSQ A;  5F69 A;  3KSH A;  4DJ3 A;  3EGD C;  5G4Y A;  4F3L A;  2O9B A;  1UWN X;  4XT2 A;  4CQH A;  2J3T C;  4P6Z S;  1BYW A;  1XJ4 A;  3BQ8 A;  4PKY G;  2QKP A;  4I3A A;  5F5Y A;  3LR3 A;  3UMD A;  3EQV A;  3OLO A;  3LUQ A;  3IBJ A;  3FPV A;  3GEC A;  5HDD A;  2WKQ A;  2VLG A;  3TJZ C;  3D72 A;  5AVF A;  3FG8 A;  4WL9 A;  1DP6 A;  1D06 A;  3T4O A;  3UB8 A;  2PHY A;  3ZQ5 A;  5AVE A;  2YKF A;  4UEY A;  4HOI A;  5C5K A;  4LLO B;  3EGX C;  3LIA A;  4HH2 A;  4MMN A;  4MN5 A;  4HHD A;  4FSF A;  3CWF A;  3LR4 A;  4WLA A;  3RH8 B;  4KUK A;  2PYR A;  2V1A A;  1H3Q A;  2ZMV A;  4O8G A;  5F6A A;  4HJ4 A;  1KOU A;  3BY9 A;  4HY8 A;  2O0Y A;  2A24 B;  2ZOI A;  2R78 A;  1S1Y A;  4R38 A;  4EXO A;  4JGO A;  4O01 A;  4HP4 A;  2H28 A;  3F1O A;  1OTD A;  1V9Z A;  4EQ1 A;  3K2N A;  3R7W B;  4DN0 A;  4WEJ A;  1N9N A;  1W63 Q;  3ICY A;  4WF0 A;  1S1Z A;  4NKP A;  1G6O A;  2WKP A;  3PBO A;  5HL6 A;  3CAX A;  4HH3 A;  4I3J A;  3U2A A;  1OTA A;  3C38 A;  2PR6 A;  3LIF A;  4B93 A;  1XJ3 A;  3OCL A;  2JN7 A;  3R4K A;  3VV4 A;  1OTB A;  2VV6 A;  4EES A;  4CLC A;  4ARZ A;  4R6L A;  2OWJ A;  1N9L A;  3B42 A;  2XRO A;  4K08 A;  4ETZ A;  3C2W A;  2P04 A;  2VV8 A;  4WUJ A;  1T19 A;  5I5L A;  1MKM A;  3RTY A;  1V9Y A;  3UB7 A;  5MC7 A;  2ZMF A;  3NHQ A;  3VOL A;  1NLY A;  3LR0 A;  3UB6 A;  3KO6 A;  4HJ6 A;  4BBU A;  2IA2 A;  4NXG A;  2V0W A;  3S7N A;  4G3W A;  2VGL S;  2A2L A;  3PXP A;  3C30 A;  4EER A;  3F1N B;  1Y28 A;  2PT7 A;  3A0V A;  4GS9 A;  2W1T B;  4R70 A;  3A0S A;  4H6J A;  3A0R A;  3EWK A;  3S7Q A;  4WN5 A;  3MJQ A;  4KQO A;  2Z6D A;  3P01 A;  1F9I A;  4KQD A;  2PDR A;  3IS2 A;  3H82 A;  2JKT I;  1LSX A;  1LL8 A;  3LIB A;  4EUV A;  3TW8 A;  3CI6 A;  1T1A A;  4CLC C;  2XRN A;  3CLO A;  2ZOH A;  1TD5 A;  3MQQ A;  2EWV A;  3LFV A;  1H8M A;  2W3F A;  2XSS A;  3B47 A;  4MN6 A;  5HWW A;  3LI8 A;  4YNR A;  1OJG A;  4OOL A;  2G7U A;  2HV1 A;  3H7W A;  2J3W A;  4Y5F A;  2V1B A;  4IHQ A;  3VE4 A;  2D01 A;  3T50 A;  4DMZ A;  1X0O A;  3C8C A;  3G6O A;  4ME4 A;  5J7E A;  2V0U A;  1TS7 A;  3KSF A;  5TBM B;  4DJ2 A;  3E4Q A;  3K3C A;  4UQI M;  5HD5 A;  4HP9 A;  3F1P A;  3OC2 A;  1TF1 A;  4PKY A;  4YOF A;  3ZYT A;  4LRZ E;  4Y3I A;  5KIZ A;  2FH5 A;  2PD7 A;  5DFX A;  1T1B A;  3KSI A;  3S7P A;  2W3D A;  3BQA A;  2EA9 A;  4HI4 A;  2OAP 1;  4O0P A;  2K31 A;  3PHY A;  5IS1 A;  4JGR A;  1YKD A;  2QHK A;  2ZBB A;  4IJG A;  3LI9 A;  4GHI A;  4ZRR A;  1MC0 A;  1IOU A;  2HGV A;  4OOM A;  4E04 A;  3SW1 A;  2V9A A;  2O99 A;  3JVV A;  3RFB A;  1MZU A;  4ARZ B;  2QJ5 A;  2W3G A;  3MQO A;  3LID A;  3HJK A;  1TS8 A;  1STZ A;  2WKR A;  1F5M A;  4P6Z M;  4PAU A;  5A8B A;  1DRM A;  4IUH A;  3CIT A;  2VA0 A;  4CLC E;  3UME A;  2JKR M;  1OT9 A;  2VEA A;  5K5B A;  2J3T D;  2Y8H A;  3BW6 A;  2M7V A;  5DJT A;  4BWI A;  4F3L B;  4FOF A;  2O9C A;  2W1R A;  2KOI A;  4XT2 B;  2GJ3 A;  3K3D A;  2K7S A;  2BAS A;  2OAQ 1;  3KYQ A;  3UE6 A;  3MR0 A;  1P9W A;  4WEK A;  3MXQ A;  5IT5 A;  3E0Y A;  4BMW A;  1T18 A;  5IU1 A;  3T4K A;  3UE3 A;  3IS2 B;  2P7J A;  5TJJ A;  3MFX A;  2NUP C;  2JKT M;  4GCZ A;  4I39 A;  2JKR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...