4KQDA

The crystal structure of the n-terminal pas domain of the f plasmid traj
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
IDLLENLTAVIQDYPNPACIRDETGKFIFCNTLFHESFLTQDQSAEKWLLSQRDFCELISVTEMEAYRNEHTHLNLVEDVFIQNRFWTISVQSFLNGHRNIILWQFYDAAHVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal Structure of the N-terminal PAS domain of the F plasmid TraJ
rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Protein TraJ
total genus 30
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kqdA00
1LSVA 1P97A 4KUOA 5J3WA 5HSQA 1D7EA 2I9VA 1VB6A 1TS6A 3A0SA 3E4PA 4HQAA 4LPZA 4LRZE 1LL8A 3H9WA 4I3IA 3F1PB 1T1BA 1T18A 3BY9A 5J4EA 1N9NA 1OTEA 1T1AA 3IS2A 2PD7A 4L9EA 2QHKA 3C8CA 1LSWA 3HJIA 2A24A 2EA9A 1S1YA 1TS8A 5AVEA 5HDCA 2PD8A 4HJ6A 4HNBA 2M1CA 4LRYC 1D06A 2K7SA 2KDKA 2PR6A 3PHYA 4HH3A 3BY8A 4GW9A 4EQ1A 1GSVA 3H7WA 4JGPA 2QWSA 2VV6A 4GS9A 1T19A 5IS1A 2INWA 1OTDA 2VLGA 5A8BA 1V9YA 3FG8A 4I3JA 2YKHA 1JNUA 3EEHA 4HIAA 1TS0A 3UB7A 2KX6A 3LIEA 3MR0A 3SW1A 1LT0A 4WF0A 3F1NB 4L9FA 3CLOA 1N9OA 4BBUA 2OWHA 4I38A 4HHDA 4HI4A 4KUKA 1S4SA 3MFXA 4PKYG 5F68A 1EW0A 2W0NA 1GSWA 2R78A 1OTAA 3LIDA 5J7EA 2JHEA 1XFNA 5KIZA 3H82A 1N9LA 1V9ZA 4EETB 1X0OA 2H28A 3C2WA 3F1NA 3LIFA 2J80A 1GSXA 4NXEA 4EESA 4EXOA 1OT9A 3BWLA 3HJKA 2PHYA 1OTIA 3E4QA 4LRXC 1OJGA 3H82B 4HY8A 4HP4A 4I39A 3K3DA 5DJUA 4WUJA 5EFWA 4EW7A 1XJ4A 3PYPA 4GS9B 2WKRA 3CWFA 4H6JB 4HJ4A 2V0UA 3MQQA 2VV8A 5HWVA 4F3LB 4BBVA 4YWZA 4E04A 3UMEA 2CMNA 3T50A 3K3CA 4R6LA 2D02A 3UE6A 3RH8B 2B02A 5G4YA 1WA9A 2P7JA 2ZOIA 3GECA 4R3AA 3UB6A 3A0RA 4MN6A 1S67L 2A24B 1DP8A 2L1MA 1T1CA 2V1BA 4NXGA 1DRMA 3ICYA 1F98A 3LI9A 3IS2B 3F1OB 3UB8A 4WN5A 1XJ6A 1OTBA 2PDRA 3NOTC 4R38A 4MN5A 2GJ3A 5AVFA 3EWKA 5HD5A 3VE4A 2OWJA 5F5YA 5TBMA 2V0WA 3E4OA 5TBMB 3P7NA 3LI8A 5IU1A 3OLOA 3CAXA 4XT2B 2ZOHA 1KOUA 1MZUA 4L9GA 5HWTA 5DKKA 4GHIA 2VEAA 2ZBBA 4XT2A 2WKPA 2PYRA 5DJTA 3ULFA 3B33A 1UGUA 3NOPC 3VE3A 2PR5A 2PYPA 1F9IA 3F1PA 3LIBA 5HD3A 4B9OA 1S66L 4DJ3A 2OOLA 1XJ2A 4WLAA 4GCZA 1UWNX 3VOLA 4EEPA 3LUQA 4F3LA 3G6OA 4H6JA 3FC7A 5HDSA 4WL9A 1OJ5A 1Y28A 2L4RA 3F1OA 4EEUA 4RQ9A 1NWZA 5F6AA 5HDDA 3LYXA 2YKFA 4I5SA 2QKPA 4JGOA 1ODVA 4K08A 4HH2A 4BBTA 3MJQA 1G28A 4LLOB 4DJ2A 3RTYA 5HWWA 5F69A 3KX0X 4HJ3A 4NXFA 3IBRA 2V9AA 3ZQ5A 2JN7A 1OT6A 2V1AA 2Z6DA 3LIAA 2W27A 2Z6CA 3NHQA 4JGQA 1LSXA 1DP6A 2QJ7A 4JGRA 4KQDA 4R70A 3LICA 1UWPX 4NXBA 3UB9A 1XJ3A 3UMDA 3GDIA 3MXQA 1S1ZA 3NJAA 5DKLA 5HZHA 3H7WB 2D01A 2BASA 1BYWA 2VV7A 4HOIA 2QJ5A 2WKQA 5I5LA 3A0VA 2HV1A 3D72A 1S4RA 4HP9A 3NOUC 4EERA 1DP9A 4I3AA 4PKYA 1XFQA 1P0ZA 2L0WA 3MQOA 5G4ZA 4GHIB 4M4XA 1TS7A
chains in the Genus database with same CATH superfamily
3UDIA 2E8IA 1NRJA 4ME4A 4MBFA 5EE8A 1NLYA 5E2GA 2JCHA 3VP2A 4MDZA 2JKGA 5HDCA 2AVXA 3S22A 1K54A 5KMWA 2WAFA 3G34A 4U3TA 1GCEA 3FWLA 4HEFA 2O9AA 3QP6A 1ES5A 4O01A 3GR2A 3SH8A 4LV1A 2VKSA 1OTAA 3N7WA 2Q9NA 1TD5A 1GSXA 1OTIA 4JF4A 5DF7A 1XJ4A 1TDLA 4OLGA 4IVKA 1FSWA 2ZQAA 2XRNA 3UB6A 1EROA 3BJNA 1DP8A 4BMWA 4Y3IA 4WN5A 4MN5A 3TOIA 2Y2JA 1KOUA 4E3NA 3MKFA 3W2ZA 5JYPA 5HD3A 4ZAMA 1S66L 4DJ3A 4G3KA 1CK3A 1ZHHB 5L09A 3P09A 2J8YA 3A3JA 5JYOA 1VEUB 4FOFA 1PNEA 1SKOA 3LIAA 3WS2A 3HLEA 1K6SA 3IHBA 4DDSA 1Z6FA 1UWPX 3EQUA 3GDIA 5E2HA 1YKDA 4PKYA 3MQOA 4M4XA 2H10A 5GL9A 3C38A 4NK3A 1TS6A 3IF6B 3UE3A 2WZZA 3HBRA 2HP6A 3OCNA 2PD7A 4M3KA 4MLLA 1SDEA 4LENA 2G2UA 2G7UA 3VOZA 4EU0A 5IHVA 4O7DA 3LIEA 5EVEA 3G35A 3VP3A 2R78A 5FAPA 1ONGA 2O99A 3HCYA 2Y2KA 2PHYA 3HJKA 3E4QA 4ETXA 1LL9A 1XP4A 3A3IA 4Y13A 2PU4A 2UWXA 1NRFA 5GHZA 5DF8A 1G6AA 4OQ0A 4LV3A 5CHUA 2UV0E 2PDRA 3NOTC 1MKMA 4FUWA 2GJ3A 2Y2MA 4X53A 5DFXA 5AQBA 4A5RA 4LV2A 2K31A 4Y2FA 3NI9A 2Y79A 3VOLA 3LUQA 4H6JA 1SDNA 1DJCA 3ZNYA 1I2SA 2Q9MA 4KENB 3IXHA 3VSKA 1XKZA 2Y91A 1ES2A 4NETA 3LR4A 1W7FA 1CEGA 1W63Q 1JTDA 1CI8A 1SKOB 4KZ6A 5CHMA 3MXSA 1DP9A 1C3BA 2Z2LB 4C3QA 3Q7VA 3BFEA 2HGVA 3ZCZA 3IBJA 3Q7VB 3IS2A 4PPRA 3C8CA 2CC1A 4HNBA 1YQSA 2H0YA 2KX6A 2W3GA 2R9XA 1N9OA 2JE5A 3OC2A 3MFXA 3TJZC 3BLMA 1OT9A 2RL3A 1IFQA 2EX9A 2QYBA 2XQZA 4GOGA 1YM1A 4MNRA 1CQAA 2V0UA 4OPRA 3PBSA 4F3LB 2CMNA 4PM6A 5EVIC 3MZDA 4ZTKA 3F1OB 1FIKA 3IF5A 1PWGA 1O07A 3VOYA 3V50A 2ZC3B 1W8YA 2ZBBA 2WKPA 4JXWA 1ERMA 3Q7ZA 5EVIB 2NUPC 1STZA 1YLYA 4JGOA 2JC7A 4E3OA 3ZHHA 1F2KA 3JPUA 3T4KA 5U47A 3P01A 3VFFA 3NDEA 1CF0A 1LI0A 2PT7A 4IUKA 3T4TA 3IWOA 5AQAA 3LICA 4Y15A 1IYPA 1FILA 1G68A 4EERA 4I3AA 4X6TA 1XPBA 1LSVA 1K57C 2V2FF 5EUAA 1IYOA 2Y55A 1KE4A 3H9WA 3LR3A 2EX8A 4R0QA 3IF6A 5F83A 5J4EA 2XD1A 1MPLA 3HJIA 4N9LA 1D06A 3PHYA 1S0WA 5IS1A 4WEJA 3B42A 2VLGA 4BJPA 5FATA 5EVID 2XR0A 3KYZA 3E2LA 4IBXA 1YLJA 2O9BA 5F68A 1EW0A 1K55C 4CLCE 2ZQ8A 3D9YA 3C2WA 3HLFA 2ZC4B 3UB8A 2W1RA 3H82B 2O9CA 4U0XA 3T1SA 4HJ4A 3MQQA 4OLDA 2WGWA 3RH8B 5CGXA 4Y5FA 2FH5A 1VQQA 3LO7A 4IHQA 1DRMA 5HAQA 5AVFA 5K5BA 1FCMA 1HLUP 5TBMB 3WRTA 3KSFA 2R9WA 5E43A 5DJTA 3LY4A 3DTKA 3P98A 4GLQA 3NY4A 4GCZA 4RVAA 3G6OA 3HLCA 2L4RA 5FA7A 3VFHA 2HDQA 4BLMA 4II7A 2VA0A 1K56A 3IBRA 1OT6A 1YLWA 1YMSA 2Z6CA 4NEED 1U60A 1KVMA 1IYSA 1BYWA 4OQHA 2HPBA 5A91A 1ES4A 3A0VA 4EBPA 4HP9A 3GRJA 3ZG0A 5G4ZA 4LPZA 1S6RA 2RCXA 1HZOA 1Y54A 1N9NA 3VP4A 4ETZA 5FQQA 2Y4AA 4HH3A 4R3JA 4GW9A 4E3LA 1AWIA 5KZHA 1GHMA 2INWA 1YSQA 4HIAA 4ZJ2A 3CLOA 1CEFA 4HHDA 4IBRA 3G32A 3MQ0A 2ZC5B 2XSSA 4WZ5A 4OPYA 4EUVA 4NXEA 4FH4A 5EFWA 5L8MA 4BQMA 4WUJA 4O0PA 2JKTI 3PXPA 2VV8A 1K4EA 4BBVA 2PBDP 3K3CA 3UE6A 2B02A 5G4YA 3WRZA 4CLCA 4B4ZA 4Y7PA 4GZBA 3DWZA 1FR6A 1WYCA 1DJBA 4OP5A 4PM5A 3G2YA 3MBZA 1K6RA 5DKKA 3OPHA 2VEAA 1BT5A 4UQIS 3IWIA 4E3KA 3QP2A 3OPRA 3FC7A 3WS4A 3F1OA 2GDNA 3IF6C 2Y2GA 2YKFA 3D3OA 5EOEA 4WYYA 2WGVA 1W8QA 3FPWA 5CTMA 2XLNA 5CX7A 2LB9A 4MEZA 5DVAA 1HVBA 3V67A 5AQ9A 2A2LA 2JN7A 2V1AA 3AGDA 2ZD8A 3RJUA 4BWIA 4B4XA 4HOIA 3V3RA 4WZ5C 5L07A 2V20A 1BLPA 4E3MA 1KDSA 1P97A 3VP1A 4E6XA 4OOMA 1I5QA 4E6WA 2P04A 4DDYA 1GHIA 2OLVA 2X01A 1FOFA 3CUEC 3HLWA 1L2SA 1SKFA 3LEZA 4MBHA 4C6YA 4BL2A 3MZEA 3RXXA 5GLAA 3OZHA 1OTDA 3DTEA 1V9YA 4GD6A 1PI4A 3N8LA 1LT0A 2VZWA 2QPNA 2XD5A 2I72A 5CEBA 5F1GA 2HP5A 1ESUA 1IEMA 2GZAA 4EETB 1BLCA 2J7VA 4IVIA 4KZAA 2B95A 4QU3A 4DKIA 1ZTUA 3LR0A 3S7NA 2Y2HA 3CHWP 3PBQA 3NDGA 2L1MA 2M7VA 1VETB 4BBTA 1OTBA 4KZ7A 3CI6A 5EM1A 2ACGA 4S2KA 4S2NA 4CQHA 2XFSA 3RXWA 2VGJA 3W4OA 5EOOA 3O87A 4S2OA 1VETA 1TDGA 5TFQA 1K57A 1J9MA 1XJ2A 3VSLA 4EEPA 4CPKA 2K2NA 3UPPA 3ZG7B 3LYXA 2QKPA 3GQZA 4KZ5A 1H5XA 2WYXA 4MBKA 3N8SA 4HBUA 1G28A 4OOLA 4JF6A 2VGLM 4YNRA 1PRQA 2FFYA 4Q0IA 4LFUA 4PAUA 2V8FA 1DP6A 3KSGA 4KQDA 4R70A 2J3TD 4S2MA 2Y8HA 5HZHA 2WKHA 3QP4A 5HAPA 1BULA 1KE3A 2HV1A 3JYIA 3PBTA 1PYYA 5F82A 3CPTB 3EEAA 4OQIA 2HDRA 5EVIA 4Q0HA 1LSWA 5CTNA 1KE0A 4WZ4A 1RP5A 1BLHA 2MJ6A 4UQIM 5FEFA 3H7WA 3UO9A 2QWSA 1O7EA 3GSGA 3C7VA 3MMHA 3T1RA 1KGEA 2B18A 1H8MA 4PKYG 2JHEA 1V9ZA 2FZ0A 1X0OA 4UEYA 2J80A 4GDNA 3K3DA 4EQIA 1BUEA 4P0MA 1RGYA 4IUHA 2ZOIA 1S67L 2A24B 1H3QA 3PBRA 1T1CA 2WAEA 2DCFA 1XA7A 2VGLS 3EWKA 4JLFA 3OOVA 4KZBA 3TE8A 2J9PA 5CECA 2J3TC 2C6WB 1SCWA 1LL5A 4WL9A 4P85A 4G3VA 3OPLA 3CG5A 4YOFA 1VM1A 1DJAA 3KX0X 1XGJA 3QNCA 4S2PA 3KSHA 3JVVA 4P6ZM 2W27A 2ZM8A 2KOIA 5EPHA 3NJAA 4KZ9A 3SZTA 2H0TA 2Y2PA 3HUOA 5I5LA 3ZG8B 3BFFA 3HUMA 1MKIA 4RX3A 5G18A 5J3WA 4LRZE 4RYEA 1XA1A 4I3IA 3R7WB 5CEDA 3F1PB 3OBFA 1OTEA 3KYQA 4YFMA 5CHJA 3TW8A 4BL3A 1TS8A 2P9VB 4N1XA 2M1CA 2K7SA 3GV9A 2EXAA 4JKTA 3ZG5A 4X25A 2IWDA 3W4QA 2W3FA 2ZC7A 3HUNA 2EFXA 1AXBA 4JPMA 1YSPA 4KZ3A 3NULA 5C5KA 3ULFA 4HP4A 3G31A 4GS9B 2HDSA 1NY0A 5A90A 1MC0A 1WE4A 1WA9A 3C5AA 3WS0A 3PBOA 4WMCD 2ZL1B 2BLSA 3LI8A 3CAXA 5TJJA 1Y4OA 1EI5A 2WADA 5J8XA 4OONA 4B9OA 4S2JA 1F9IA 4WLAA 2ZQDA 4X68A 1OJ5A 4DMZA 5M19A 3MSHA 1ODVA 2J3WA 2Y2IA 3N8RA 3ZYTA 1RGZA 3T1XA 1E25A 1J3WA 4NXFA 1A0KA 1N4OA 4PM7A 2Q0OA 1KVLA 5FEGA 3QP8A 5DTTA 3UE0A 4IEDA 4JBFA 5D3OA 1Q2PA 1K4FA 2JKFA 5DTKA 3BY9A 5EECA 2W1TA 3LFVA 1JVJA 2ZL1A 4LGWA 2PR6A 5KSHA 1NJ4A 1F5MA 2EX6A 3DW0A 4DXCA 2VX8A 3M6BA 1TS0A 1P9WA 1H8ZA 3A3EA 2JKRI 2OWHA 4WMCA 5J7EA 5KIZA 2H28A 4FSFA 3UY6A 1OJGA 2ZM0A 2D02A 4R3AA 1YPRA 2XGNA 3A0RA 2P08A 4N1HA 2OWJA 3BEBA 4IJGA 1OPXA 4Z9QA 4UA6A 5HWTA 1BTLA 3V3SA 3NOPC 2PR5A 3LIBA 4P6ZS 4F3LA 5HW3A 4E3JA 2X71A 1LLBA 4WEKA 3W8KA 1NWZA 3FYZA 4K0XA 4ZJ1A 4OP8A 5IT5A 1BZAA 3T12B 4HH2A 1ZC2A 5AQ7A 1IYQA 1M6KA 1LSXA 5FASA 4R23A 4S2LA 3UDFA 3UB9A 3PR6A 5DKLA 4AFIA 4Z1WA 3CMZA 4E3IA 1E4DA 2ZJ9A 3FKWA 1PWCA 2IA2A 2HP9A 2A24A 2EA9A 1MWSA 5FI7A 3L7HA 4PHTA 2BTFP 3B3XA 4ID4A 4N92A 4YINA 3DAVA 4L0LA 4Y0TA 2Y2QA 1GHPA 5FSRA 1S4SA 3IHAA 3TSGA 2W3HA 4EESA 4FD8A 4KQQA 5FQKA 4S2IA 4LRXC 4HY8A 1XXMA 3KYEA 4DRTA 3IT9A 4S2NC 2V1BA 5E2EA 5HD5A 2ZC6B 5E2FA 3QP5A 5F5YA 4DN0A 3E4OA 3S7QA 5HFOA 1MZUA 4WELA 3C4PA 3ZDJA 1H8YA 2PRFA 3U4LP 3ZNTA 3O88A 1UGUA 2ZLYA 2PYPA 2EXBA 3HLBA 5HDDA 2ZMAA 1ZKJA 2XFTA 3KO6A 4KZ4A 2VJWA 4EWFA 2Z6DA 4GDBA 1L0DA 4JGRA 1PW1A 3GVBA 1XJ3A 2BASA 2X02A 5FDSA 2WKQA 3GMWA 3MS6A 1G5UA 4UA7A 1VB6A 3A0SA 4HQAA 1LL8A 3R7WA 1MWUA 3I7JA 4R4SA 4D60A 3VMAA 2ZMVA 3E98A 1T1AA 3BW6A 3T4QA 1E3UD 3NECA 3E2KA 4JF5A 1YLPA 3BYDA 2WGIA 1FQGA 2XH9A 2VV6A 2Y59A 4QB8A 3FG8A 2JKRM 3UB7A 3EEHA 2ZQ7A 4ARZA 4L9FA 2PAVP 3ISGA 4WM9A 1CI9A 5HPFA 1XFNA 1N9LA 3Q81A 1ERQA 1H0MA 2V1ZA 3QP1A 3K2NA 3BWLA 4OOYA 1FCOA 2WKRA 1YLZA 4YWZA 3ITAA 1JWZA 1PZOA 3MKEA 4MN6A 1E3UA 3IS2B 5EVLA 4R38A 5TBMA 2KLIA 3SH9A 4BD0A 4XT2A 4Y17A 2W1TB 3FPVA 2ZQCA 1IELA 3EOIA 1OMEA 2BG1A 5HDSA 1Y28A 4RX2A 1PW8A 2W3DA 3VV4A 4DXBA 3UPNA 3OCLA 4OPZA 1P9RA 4GB7A 5CXWA 4KQRA 3CITA 4XUXA 2ZQ9A 4KG6A 2L0WA 1TF1A 3BFGA 2D01A 3IH9A 1S4RA 3LY3A 1K55A 5KSCA 3DTIA 1D7EA 3A3FA 3PAGA 4KG5A 3S4XA 5FQJA 3UDXA 3CPTA 2E8JA 4PM8A 5AVEA 2PD8A 4HJ6A 3C7UA 4EQ1A 3HL9A 2HJ9C 4GS9A 5FAOA 3UN7A 4WBGA 1ES3A 2DRWA 2HDUA 2W0NA 1GSWA 3T4SA 4K0WA 1NZOA 2A3UA 4MCWA 4OKPA 3B47A 1L3LA 4EBNA 1HD8A 4R6LA 5FQMA 3WS1A 4UAAA 1F98A 3NCKA 3QNBA 5AJGA 2G2WA 2WKIA 2XEPA 2PU2A 2XDMA 4L9GA 3LR5A 4GKUA 4UHUA 4FCFA 2Y2LA 3F1PA 1YLTA 5FI6A 3FZCA 2P74A 1M40A 1WYBA 2W3EA 1XX2A 4OH0A 5LBRA 3BQAA 2EWVA 5FQIA 4U0TA 4QPRA 3MJQA 4LLOB 2EX2A 1K54C 3BLSA 3IQAA 1Z09A 3ZQ5A 3MXRA 2Y2OA 1W79A 2EWWA 3M2KA 3MXQA 1FR1A 3IXDA 2VV7A 2QJ5A 4MN7A 3NOUC 1MY8A 3FKVA 2I9VA 2OAQ1 1MBLA 3E0YA 3CZDA 5FL3A 1SHVA 1S1YA 5FI2A 4LRYC 4ZRRA 4R1GA 1T19A 3QHYA 4I3JA 1JNUA 4KQOA 3CUEA 2XA7M 4B88A 3T4OA 2DNSA 1IKIA 4I38A 1JTGA 4K91A 1LHYA 4LV0A 3MF0A 5TR7A 1NYMA 5HAIA 3SH7A 3EGXC 1NYYA 5BOHA 4H6JB 2PBYA 3ZVWA 3T4JA 3UB5P 3UMEA 2WUQA 3S1YA 3T50A 1FSYA 4XUZA 1YAXA 3IXBA 3IX8A 3FV7A 3M6HA 2HF6A 2IWCA 2WK0A 1ZG6A 3PTEA 2V0WA 3OLOA 5DF9A 3ZVTA 4P87A 2ZOHA 1KGGA 3N4IA 4FH2A 1PZPA 1W63M 4JXSA 2V8CA 4QHCA 1RCJA 1HTZA 4QWOA 5F6AA 3R4KA 2IWBA 5HL1A 3N6IA 3C30A 3RTYA 4HJ3A 4R3BA 4KZ8A 2V9AA 1D1JA 3NC8A 4OPQA 1IOUA 1PI5A 1Q2QA 4OVDA 4QD4A 5HX9A 3AGFA 5L2FA 4JXVA 4BD1A 3UPOA 1K0KA 3IWQA 2XA7S 3BFCA 4L9EA 2QHKA 3TG9A 1DY6A 3PAEA 1VHMA 4ZJ3A 2LB5A 2KDKA 2QMIA 3W4PA 1L0EA 3BY8A 1IKGA 4Q8IA 4DE0A 4HBTA 5GHYA 3GTCA 2YKHA 4DE2A 1K56D 5GLBA 3CJMA 1LI9A 3AGEA 4Y0UA 3F1NB 4MMNA 4BBUA 4KUKA 1EWZA 3S7OA 5F1FA 3JVUA 4PM9A 4X56A 1VEUA 2OLUA 2M7UA 4EW7A 1ZG4A 4P6BA 3CWFA 4E04A 1ALQA 3EQVA 2Y2NA 5A93A 2P7JA 3V5MA 3BECA 3ICYA 4F94A 1XJ6A 5M1AA 1L0GA 3VE4A 3LEQA 5I94A 4H8RA 3P7NA 3L9KA 3T1QB 5L10A 4OQGA 3VE3A 4QJGA 4EUZA 4ESPA 2WKEA 1MXOA 3UE1A 1MWTA 2Z2MB 3C4OA 2WGWB 3VP0A 2NUTC 2GX5A 3M2JA 3BM6A 5F69A 5GHXA 3Q07A 2ZM2A 2OV5A 4JGQA 2C5WB 3DWKA 5EV0A 1S1ZA 3H7WB 4CLCD 3DTMA 3O5YA 3OPPA 4LCLA 5CGSA 1XFQA 4GHIB 4NXBA 4KUOA 1PIOA 5HSQA 4GNUA 5GLDA 2OAP1 5HPIA 2H5SA 1T1BA 1T18A 2VK3A 3KSIA 1MWRA 3BFDA 4X1LA 4BENA 4Y0OA 2XK1A 3HLGA 1QMEA 4ZDXA 4X1MA 5CRFA 4B93A 3Q1FA 4CLCB 2HJEA 3MR0A 5HL6A 3ZFZA 4XXRA 4HI4A 3G4PA 4DF6A 3DBAA 3LIFA 4LCMA 4CJNA 1N9BA 4EXOA 3RFBA 3ITBA 5EM0A 4I39A 4EBLA 3PYPA 4X69A 5HWVA 4G3WA 4DE3A 4NKPA 4ARZB 3S7PA 4Q0JA 4NXGA 4JXGA 3HLDA 1L0FA 4FTXA 5IU1A 1G6OA 2ZMFA 2A49A 2P9VA 1NXYA 1JWVA 4GHIA 2PYRA 3B33A 3IH8A 1PWDA 4GD8A 5HARA 3MZFA 4QY5A 2B5RA 1NZUA 2OOLA 3U2AA 1UWNX 1K38A 4QY6A 3LGOA 4X55A 2JKTM 1FCNA 4K08A 3D4FA 2VGKA 3HREA 5CGWA 5HWWA 1PFLA 3HVFA 1YT4A 2QZ6A 4RA7A 3G2ZA 3IXGA 3UMDA 1JWPA 4EV4A 4D2OA 3PBNA 5TGFA 4UA9A 1TEMA 3BQ8A 2XROA 1P0ZA 5FDHA 3SS5A 1K25A 3E4PA 5M18A 3O86A 4DE1A 3EGDC 4O8GA 4NG2A 1XGIA 3T4LA 3NIAA 5CERA 4CLCC 3ZGAB 1GA0A 1QMFA 1GSVA 4JGPA 4N9KA 4C75A 5A8BA 1YMXA 3SW1A 4WF0A 4R4RA 1ONHA 3NBLA 3LIDA 3UNWA 4GJ4A 3H82A 5DTSA 3F1NA 4HESA 3SOIA 3MFDA 1KGFA 5FQ9A 1KDWA 5A92A 5DJUA 3O3VA 1CJFA 1NLZA 2WZXA 3Q82A 2GNXA 2OSUA 2J9OA 3GECA 3SS4A 3LCEA 3WWXA 1BLSA 3LI9A 3WS5A 4PMAA 1ESIA 4XT2B 4ZBEA 2FFFB 3TRCA 1I2WA 5GLCA 1W5DA 3IX3A 1SZVA 4EEUA 4RQ9A 5MC7A 4I5SA 5DFYA 1BSGA 3A3DA 5FAQA 2XF3A 4DJ2A 4KG2A 2O0YA 1ACFA 2DMWA 3BRMA 1TVFA 3NHQA 1GA9A 2JBFA 2QJ7A 3IX4A 3V39A 3SS3A 3G30A 2HZ5A 3ZG9B 2EFUA 3D72A 4GN2A 1TS7A
chains in the Genus database with same CATH topology
1NRJA 2I9VA 4LPZA 2OAQ1 4ME4A 3E0YA 1NLYA 5FL3A 3BY9A 2W1TA 3LFVA 1N9NA 4MDZA 5HDCA 1S1YA 4ETZA 4LRYC 4ZRRA 2PR6A 4HH3A 5KSHA 1F5MA 4GW9A 1T19A 2VX8A 2INWA 2O9AA 4I3JA 1JNUA 1YSQA 4HIAA 1TS0A 4KQOA 3CUEA 1P9WA 2XA7M 4O01A 3CLOA 2JKRI 3T4OA 2OWHA 4I38A 4HHDA 2VKSA 3MQ0A 1OTAA 5J7EA 2XSSA 5KIZA 2H28A 4FSFA 1TD5A 1GSXA 3MF0A 4NXEA 4EUVA 3EGXC 1OTIA 1OJGA 5EFWA 5L8MA 4WUJA 1XJ4A 4O0PA 4H6JB 2JKTI 3PXPA 2VV8A 3T4JA 4BBVA 3UMEA 3T50A 3K3CA 2D02A 3UE6A 2B02A 5G4YA 4CLCA 2XRNA 4R3AA 3UB6A 3A0RA 3BJNA 1DP8A 4BMWA 4Y3IA 2P08A 2HF6A 4WN5A 4MN5A 2OWJA 2V0WA 4IJGA 3OLOA 5DF9A 1OPXA 2ZOHA 1KOUA 5HWTA 3W2ZA 5DKKA 2VEAA 4UQIS 3NOPC 2PR5A 3LIBA 4P6ZS 5HD3A 1W63M 1S66L 4DJ3A 4F3LA 4G3KA 1ZHHB 3FC7A 3F1OA 4WEKA 1NWZA 5F6AA 3R4KA 2YKFA 3D3OA 5IT5A 4FOFA 4HH2A 3FPWA 5CX7A 3C30A 3RTYA 2LB9A 4HJ3A 3V67A 2V9AA 2A2LA 2JN7A 2V1AA 3LIAA 1LSXA 1UWPX 3UB9A 3EQUA 3PR6A 4BWIA 3GDIA 5DKLA 1IOUA 4AFIA 4HOIA 1YKDA 4Z1WA 4PKYA 3MQOA 4M4XA 1P97A 3C38A 4OOMA 1TS6A 2P04A 3UE3A 3CUEC 2XA7S 3OCNA 4L9EA 2PD7A 2QHKA 2IA2A 2A24A 2EA9A 2G7UA 1VHMA 2LB5A 4EU0A 2KDKA 4PHTA 3BY8A 1OTDA 1V9YA 4L0LA 2YKHA 3LIEA 1LT0A 3F1NB 4MMNA 2VZWA 4BBUA 4KUKA 1S4SA 3S7OA 2R78A 2W3HA 2GZAA 4EESA 4EETB 3JVUA 2O99A 3HCYA 3HJKA 2PHYA 3E4QA 4LRXC 4HY8A 2M7UA 4EW7A 3CWFA 4ETXA 1ZTUA 3LR0A 4E04A 3S7NA 3EQVA 2P7JA 3PBQA 2L1MA 2M7VA 2V1BA 3ICYA 4BBTA 1XJ6A 1OTBA 2PDRA 1MKMA 3NOTC 5HD5A 2GJ3A 3CI6A 3VE4A 4CQHA 5F5YA 4DN0A 3E4OA 3S7QA 3P7NA 5DFXA 1MZUA 4WELA 2K31A 4Y2FA 1UGUA 3VE3A 2PYPA 2Y79A 3VOLA 1XJ2A 4EEPA 3LUQA 4H6JA 2K2NA 5HDDA 3LYXA 2QKPA 2NUTC 3KO6A 1G28A 4OOLA 2VGLM 2GX5A 4YNRA 5F69A 2VJWA 3LR4A 2Z6DA 4Q0IA 4JGQA 4PAUA 1DP6A 3KSGA 4JGRA 4KQDA 4R70A 2J3TD 1W63Q 1XJ3A 1S1ZA 2Y8HA 3H7WB 5HZHA 4CLCD 2BASA 2WKQA 3O5YA 2HV1A 1DP9A 1XFQA 3PBTA 4GHIB 4NXBA 4KUOA 5HSQA 1VB6A 2OAP1 3A0SA 3EEAA 4HQAA 5HPIA 1LL8A 3R7WA 1T1BA 1T18A 2HGVA 3KSIA 3IBJA 4Q0HA 2ZMVA 3E98A 1T1AA 3IS2A 3BW6A 1LSWA 3C8CA 3T4QA 4HNBA 2MJ6A 4UQIM 3H7WA 2QWSA 2VV6A 3UB7A 3FG8A 2JKRM 3EEHA 4B93A 3MMHA 2KX6A 4CLCB 2HJEA 3MR0A 4ARZA 2W3GA 5HL6A 4L9FA 2B18A 1N9OA 1H8MA 5HPFA 3OC2A 4HI4A 3MFXA 4PKYG 3TJZC 3DBAA 2JHEA 1XFNA 1N9LA 1V9ZA 2FZ0A 1X0OA 3LIFA 4UEYA 4EXOA 2J80A 3K2NA 1OT9A 3RFBA 1IFQA 3BWLA 4I39A 3K3DA 2QYBA 3PYPA 2WKRA 2V0UA 3PBSA 5HWVA 4F3LB 4G3WA 4YWZA 4IUHA 2CMNA 4NKPA 4ARZB 3S7PA 2ZOIA 4Q0JA 4MN6A 1S67L 2A24B 1H3QA 3PBRA 1T1CA 4NXGA 3IS2B 3F1OB 2VGLS 4R38A 3EWKA 5TBMA 3OOVA 2KLIA 5IU1A 1G6OA 2ZMFA 3TE8A 4GHIA 2ZBBA 4XT2A 2WKPA 2PYRA 2W1TB 3FPVA 3B33A 2J3TC 2NUPC 3EOIA 2OOLA 1STZA 1UWNX 3U2AA 5HDSA 4WL9A 1Y28A 4G3VA 2W3DA 3VV4A 2JKTM 4JGOA 4K08A 4YOFA 3OCLA 5HWWA 3T4KA 3KX0X 3P01A 3KSHA 3JVVA 4P6ZM 2PT7A 2W27A 4IUKA 1P9RA 2KOIA 3T4TA 3LICA 3CITA 3UMDA 3NJAA 1TF1A 2D01A 3PBNA 5I5LA 4EERA 1S4RA 3BQ8A 4I3AA 2XROA 1P0ZA 1LSVA 5J3WA 1D7EA 3E4PA 4LRZE 3H9WA 4I3IA 3LR3A 3R7WB 3F1PB 3OBFA 5J4EA 1OTEA 3EGDC 3KYQA 4O8GA 3TW8A 3HJIA 5AVEA 1TS8A 2PD8A 4HJ6A 3T4LA 2M1CA 1D06A 2K7SA 3PHYA 4CLCC 4EQ1A 1GSVA 4JGPA 5IS1A 2HJ9C 4GS9A 4WEJA 3B42A 2VLGA 5A8BA 4BJPA 3SW1A 2W3FA 4WF0A 3KYZA 2O9BA 5F68A 1EW0A 2W0NA 1GSWA 1YSPA 3T4SA 3LIDA 4CLCE 4GJ4A 3H82A 3F1NA 3C2WA 5C5KA 3UB8A 3ULFA 2W1RA 3H82B 2O9CA 4MCWA 4HP4A 5DJUA 3B47A 1NLZA 4GS9B 4HJ4A 3MQQA 2GNXA 1MC0A 4R6LA 3RH8B 4Y5FA 2FH5A 1WA9A 3GECA 3PBOA 4IHQA 1DRMA 3LI9A 1F98A 5K5BA 5AVFA 5TBMB 5AJGA 3LI8A 3CAXA 5TJJA 4XT2B 3KSFA 4L9GA 3LR5A 3TRCA 5DJTA 4B9OA 3F1PA 1F9IA 4GLQA 4WLAA 4GCZA 3G6OA 2W3EA 1OJ5A 4DMZA 2L4RA 5LBRA 4EEUA 3BQAA 4RQ9A 5MC7A 2EWVA 4II7A 4I5SA 5DFYA 4QPRA 1ODVA 2J3WA 3MJQA 4LLOB 2VA0A 4DJ2A 3ZYTA 2O0YA 2DMWA 4NXFA 3IBRA 3ZQ5A 1OT6A 2Z6CA 3NHQA 2QJ7A 4NEED 2EWWA 3MXQA 1BYWA 2VV7A 2QJ5A 3A0VA 3D72A 4HP9A 3NOUC 4MN7A 5G4ZA 2L0WA 1TS7A 1YAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSV A;  1P97 A;  4KUO A;  5J3W A;  5HSQ A;  1D7E A;  2I9V A;  1VB6 A;  1TS6 A;  3A0S A;  3E4P A;  4HQA A;  4LPZ A;  4LRZ E;  1LL8 A;  3H9W A;  4I3I A;  3F1P B;  1T1B A;  1T18 A;  3BY9 A;  5J4E A;  1N9N A;  1OTE A;  1T1A A;  3IS2 A;  2PD7 A;  4L9E A;  2QHK A;  3C8C A;  1LSW A;  3HJI A;  2A24 A;  2EA9 A;  1S1Y A;  1TS8 A;  5AVE A;  5HDC A;  2PD8 A;  4HJ6 A;  4HNB A;  2M1C A;  4LRY C;  1D06 A;  2K7S A;  2KDK A;  2PR6 A;  3PHY A;  4HH3 A;  3BY8 A;  4GW9 A;  4EQ1 A;  1GSV A;  3H7W A;  4JGP A;  2QWS A;  2VV6 A;  4GS9 A;  1T19 A;  5IS1 A;  2INW A;  1OTD A;  2VLG A;  5A8B A;  1V9Y A;  3FG8 A;  4I3J A;  2YKH A;  1JNU A;  3EEH A;  4HIA A;  1TS0 A;  3UB7 A;  2KX6 A;  3LIE A;  3MR0 A;  3SW1 A;  1LT0 A;  4WF0 A;  3F1N B;  4L9F A;  3CLO A;  1N9O A;  4BBU A;  2OWH A;  4I38 A;  4HHD A;  4HI4 A;  4KUK A;  1S4S A;  3MFX A;  4PKY G;  5F68 A;  1EW0 A;  2W0N A;  1GSW A;  2R78 A;  1OTA A;  3LID A;  5J7E A;  2JHE A;  1XFN A;  5KIZ A;  3H82 A;  1N9L A;  1V9Z A;  4EET B;  1X0O A;  2H28 A;  3C2W A;  3F1N A;  3LIF A;  2J80 A;  1GSX A;  4NXE A;  4EES A;  4EXO A;  1OT9 A;  3BWL A;  3HJK A;  2PHY A;  1OTI A;  3E4Q A;  4LRX C;  1OJG A;  3H82 B;  4HY8 A;  4HP4 A;  4I39 A;  3K3D A;  5DJU A;  4WUJ A;  5EFW A;  4EW7 A;  1XJ4 A;  3PYP A;  4GS9 B;  2WKR A;  3CWF A;  4H6J B;  4HJ4 A;  2V0U A;  3MQQ A;  2VV8 A;  5HWV A;  4F3L B;  4BBV A;  4YWZ A;  4E04 A;  3UME A;  2CMN A;  3T50 A;  3K3C A;  4R6L A;  2D02 A;  3UE6 A;  3RH8 B;  2B02 A;  5G4Y A;  1WA9 A;  2P7J A;  2ZOI A;  3GEC A;  4R3A A;  3UB6 A;  3A0R A;  4MN6 A;  1S67 L;  2A24 B;  1DP8 A;  2L1M A;  1T1C A;  2V1B A;  4NXG A;  1DRM A;  3ICY A;  1F98 A;  3LI9 A;  3IS2 B;  3F1O B;  3UB8 A;  4WN5 A;  1XJ6 A;  1OTB A;  2PDR A;  3NOT C;  4R38 A;  4MN5 A;  2GJ3 A;  5AVF A;  3EWK A;  5HD5 A;  3VE4 A;  2OWJ A;  5F5Y A;  5TBM A;  2V0W A;  3E4O A;  5TBM B;  3P7N A;  3LI8 A;  5IU1 A;  3OLO A;  3CAX A;  4XT2 B;  2ZOH A;  1KOU A;  1MZU A;  4L9G A;  5HWT A;  5DKK A;  4GHI A;  2VEA A;  2ZBB A;  4XT2 A;  2WKP A;  2PYR A;  5DJT A;  3ULF A;  3B33 A;  1UGU A;  3NOP C;  3VE3 A;  2PR5 A;  2PYP A;  1F9I A;  3F1P A;  3LIB A;  5HD3 A;  4B9O A;  1S66 L;  4DJ3 A;  2OOL A;  1XJ2 A;  4WLA A;  4GCZ A;  1UWN X;  3VOL A;  4EEP A;  3LUQ A;  4F3L A;  3G6O A;  4H6J A;  3FC7 A;  5HDS A;  4WL9 A;  1OJ5 A;  1Y28 A;  2L4R A;  3F1O A;  4EEU A;  4RQ9 A;  1NWZ A;  5F6A A;  5HDD A;  3LYX A;  2YKF A;  4I5S A;  2QKP A;  4JGO A;  1ODV A;  4K08 A;  4HH2 A;  4BBT A;  3MJQ A;  1G28 A;  4LLO B;  4DJ2 A;  3RTY A;  5HWW A;  5F69 A;  3KX0 X;  4HJ3 A;  4NXF A;  3IBR A;  2V9A A;  3ZQ5 A;  2JN7 A;  1OT6 A;  2V1A A;  2Z6D A;  3LIA A;  2W27 A;  2Z6C A;  3NHQ A;  4JGQ A;  1LSX A;  1DP6 A;  2QJ7 A;  4JGR A;  4KQD A;  4R70 A;  3LIC A;  1UWP X;  4NXB A;  3UB9 A;  1XJ3 A;  3UMD A;  3GDI A;  3MXQ A;  1S1Z A;  3NJA A;  5DKL A;  5HZH A;  3H7W B;  2D01 A;  2BAS A;  1BYW A;  2VV7 A;  4HOI A;  2QJ5 A;  2WKQ A;  5I5L A;  3A0V A;  2HV1 A;  3D72 A;  1S4R A;  4HP9 A;  3NOU C;  4EER A;  1DP9 A;  4I3A A;  4PKY A;  1XFQ A;  1P0Z A;  2L0W A;  3MQO A;  5G4Z A;  4GHI B;  4M4X A;  1TS7 A; 
#chains in the Genus database with same CATH topology
 3UDI A;  2E8I A;  1NRJ A;  4ME4 A;  4MBF A;  5EE8 A;  1NLY A;  5E2G A;  2JCH A;  3VP2 A;  4MDZ A;  2JKG A;  5HDC A;  2AVX A;  3S22 A;  1K54 A;  5KMW A;  2WAF A;  3G34 A;  4U3T A;  1GCE A;  3FWL A;  4HEF A;  2O9A A;  3QP6 A;  1ES5 A;  4O01 A;  3GR2 A;  3SH8 A;  4LV1 A;  2VKS A;  1OTA A;  3N7W A;  2Q9N A;  1TD5 A;  1GSX A;  1OTI A;  4JF4 A;  5DF7 A;  1XJ4 A;  1TDL A;  4OLG A;  4IVK A;  1FSW A;  2ZQA A;  2XRN A;  3UB6 A;  1ERO A;  3BJN A;  1DP8 A;  4BMW A;  4Y3I A;  4WN5 A;  4MN5 A;  3TOI A;  2Y2J A;  1KOU A;  4E3N A;  3MKF A;  3W2Z A;  5JYP A;  5HD3 A;  4ZAM A;  1S66 L;  4DJ3 A;  4G3K A;  1CK3 A;  1ZHH B;  5L09 A;  3P09 A;  2J8Y A;  3A3J A;  5JYO A;  1VEU B;  4FOF A;  1PNE A;  1SKO A;  3LIA A;  3WS2 A;  3HLE A;  1K6S A;  3IHB A;  4DDS A;  1Z6F A;  1UWP X;  3EQU A;  3GDI A;  5E2H A;  1YKD A;  4PKY A;  3MQO A;  4M4X A;  2H10 A;  5GL9 A;  3C38 A;  4NK3 A;  1TS6 A;  3IF6 B;  3UE3 A;  2WZZ A;  3HBR A;  2HP6 A;  3OCN A;  2PD7 A;  4M3K A;  4MLL A;  1SDE A;  4LEN A;  2G2U A;  2G7U A;  3VOZ A;  4EU0 A;  5IHV A;  4O7D A;  3LIE A;  5EVE A;  3G35 A;  3VP3 A;  2R78 A;  5FAP A;  1ONG A;  2O99 A;  3HCY A;  2Y2K A;  2PHY A;  3HJK A;  3E4Q A;  4ETX A;  1LL9 A;  1XP4 A;  3A3I A;  4Y13 A;  2PU4 A;  2UWX A;  1NRF A;  5GHZ A;  5DF8 A;  1G6A A;  4OQ0 A;  4LV3 A;  5CHU A;  2UV0 E;  2PDR A;  3NOT C;  1MKM A;  4FUW A;  2GJ3 A;  2Y2M A;  4X53 A;  5DFX A;  5AQB A;  4A5R A;  4LV2 A;  2K31 A;  4Y2F A;  3NI9 A;  2Y79 A;  3VOL A;  3LUQ A;  4H6J A;  1SDN A;  1DJC A;  3ZNY A;  1I2S A;  2Q9M A;  4KEN B;  3IXH A;  3VSK A;  1XKZ A;  2Y91 A;  1ES2 A;  4NET A;  3LR4 A;  1W7F A;  1CEG A;  1W63 Q;  1JTD A;  1CI8 A;  1SKO B;  4KZ6 A;  5CHM A;  3MXS A;  1DP9 A;  1C3B A;  2Z2L B;  4C3Q A;  3Q7V A;  3BFE A;  2HGV A;  3ZCZ A;  3IBJ A;  3Q7V B;  3IS2 A;  4PPR A;  3C8C A;  2CC1 A;  4HNB A;  1YQS A;  2H0Y A;  2KX6 A;  2W3G A;  2R9X A;  1N9O A;  2JE5 A;  3OC2 A;  3MFX A;  3TJZ C;  3BLM A;  1OT9 A;  2RL3 A;  1IFQ A;  2EX9 A;  2QYB A;  2XQZ A;  4GOG A;  1YM1 A;  4MNR A;  1CQA A;  2V0U A;  4OPR A;  3PBS A;  4F3L B;  2CMN A;  4PM6 A;  5EVI C;  3MZD A;  4ZTK A;  3F1O B;  1FIK A;  3IF5 A;  1PWG A;  1O07 A;  3VOY A;  3V50 A;  2ZC3 B;  1W8Y A;  2ZBB A;  2WKP A;  4JXW A;  1ERM A;  3Q7Z A;  5EVI B;  2NUP C;  1STZ A;  1YLY A;  4JGO A;  2JC7 A;  4E3O A;  3ZHH A;  1F2K A;  3JPU A;  3T4K A;  5U47 A;  3P01 A;  3VFF A;  3NDE A;  1CF0 A;  1LI0 A;  2PT7 A;  4IUK A;  3T4T A;  3IWO A;  5AQA A;  3LIC A;  4Y15 A;  1IYP A;  1FIL A;  1G68 A;  4EER A;  4I3A A;  4X6T A;  1XPB A;  1LSV A;  1K57 C;  2V2F F;  5EUA A;  1IYO A;  2Y55 A;  1KE4 A;  3H9W A;  3LR3 A;  2EX8 A;  4R0Q A;  3IF6 A;  5F83 A;  5J4E A;  2XD1 A;  1MPL A;  3HJI A;  4N9L A;  1D06 A;  3PHY A;  1S0W A;  5IS1 A;  4WEJ A;  3B42 A;  2VLG A;  4BJP A;  5FAT A;  5EVI D;  2XR0 A;  3KYZ A;  3E2L A;  4IBX A;  1YLJ A;  2O9B A;  5F68 A;  1EW0 A;  1K55 C;  4CLC E;  2ZQ8 A;  3D9Y A;  3C2W A;  3HLF A;  2ZC4 B;  3UB8 A;  2W1R A;  3H82 B;  2O9C A;  4U0X A;  3T1S A;  4HJ4 A;  3MQQ A;  4OLD A;  2WGW A;  3RH8 B;  5CGX A;  4Y5F A;  2FH5 A;  1VQQ A;  3LO7 A;  4IHQ A;  1DRM A;  5HAQ A;  5AVF A;  5K5B A;  1FCM A;  1HLU P;  5TBM B;  3WRT A;  3KSF A;  2R9W A;  5E43 A;  5DJT A;  3LY4 A;  3DTK A;  3P98 A;  4GLQ A;  3NY4 A;  4GCZ A;  4RVA A;  3G6O A;  3HLC A;  2L4R A;  5FA7 A;  3VFH A;  2HDQ A;  4BLM A;  4II7 A;  2VA0 A;  1K56 A;  3IBR A;  1OT6 A;  1YLW A;  1YMS A;  2Z6C A;  4NEE D;  1U60 A;  1KVM A;  1IYS A;  1BYW A;  4OQH A;  2HPB A;  5A91 A;  1ES4 A;  3A0V A;  4EBP A;  4HP9 A;  3GRJ A;  3ZG0 A;  5G4Z A;  4LPZ A;  1S6R A;  2RCX A;  1HZO A;  1Y54 A;  1N9N A;  3VP4 A;  4ETZ A;  5FQQ A;  2Y4A A;  4HH3 A;  4R3J A;  4GW9 A;  4E3L A;  1AWI A;  5KZH A;  1GHM A;  2INW A;  1YSQ A;  4HIA A;  4ZJ2 A;  3CLO A;  1CEF A;  4HHD A;  4IBR A;  3G32 A;  3MQ0 A;  2ZC5 B;  2XSS A;  4WZ5 A;  4OPY A;  4EUV A;  4NXE A;  4FH4 A;  5EFW A;  5L8M A;  4BQM A;  4WUJ A;  4O0P A;  2JKT I;  3PXP A;  2VV8 A;  1K4E A;  4BBV A;  2PBD P;  3K3C A;  3UE6 A;  2B02 A;  5G4Y A;  3WRZ A;  4CLC A;  4B4Z A;  4Y7P A;  4GZB A;  3DWZ A;  1FR6 A;  1WYC A;  1DJB A;  4OP5 A;  4PM5 A;  3G2Y A;  3MBZ A;  1K6R A;  5DKK A;  3OPH A;  2VEA A;  1BT5 A;  4UQI S;  3IWI A;  4E3K A;  3QP2 A;  3OPR A;  3FC7 A;  3WS4 A;  3F1O A;  2GDN A;  3IF6 C;  2Y2G A;  2YKF A;  3D3O A;  5EOE A;  4WYY A;  2WGV A;  1W8Q A;  3FPW A;  5CTM A;  2XLN A;  5CX7 A;  2LB9 A;  4MEZ A;  5DVA A;  1HVB A;  3V67 A;  5AQ9 A;  2A2L A;  2JN7 A;  2V1A A;  3AGD A;  2ZD8 A;  3RJU A;  4BWI A;  4B4X A;  4HOI A;  3V3R A;  4WZ5 C;  5L07 A;  2V20 A;  1BLP A;  4E3M A;  1KDS A;  1P97 A;  3VP1 A;  4E6X A;  4OOM A;  1I5Q A;  4E6W A;  2P04 A;  4DDY A;  1GHI A;  2OLV A;  2X01 A;  1FOF A;  3CUE C;  3HLW A;  1L2S A;  1SKF A;  3LEZ A;  4MBH A;  4C6Y A;  4BL2 A;  3MZE A;  3RXX A;  5GLA A;  3OZH A;  1OTD A;  3DTE A;  1V9Y A;  4GD6 A;  1PI4 A;  3N8L A;  1LT0 A;  2VZW A;  2QPN A;  2XD5 A;  2I72 A;  5CEB A;  5F1G A;  2HP5 A;  1ESU A;  1IEM A;  2GZA A;  4EET B;  1BLC A;  2J7V A;  4IVI A;  4KZA A;  2B95 A;  4QU3 A;  4DKI A;  1ZTU A;  3LR0 A;  3S7N A;  2Y2H A;  3CHW P;  3PBQ A;  3NDG A;  2L1M A;  2M7V A;  1VET B;  4BBT A;  1OTB A;  4KZ7 A;  3CI6 A;  5EM1 A;  2ACG A;  4S2K A;  4S2N A;  4CQH A;  2XFS A;  3RXW A;  2VGJ A;  3W4O A;  5EOO A;  3O87 A;  4S2O A;  1VET A;  1TDG A;  5TFQ A;  1K57 A;  1J9M A;  1XJ2 A;  3VSL A;  4EEP A;  4CPK A;  2K2N A;  3UPP A;  3ZG7 B;  3LYX A;  2QKP A;  3GQZ A;  4KZ5 A;  1H5X A;  2WYX A;  4MBK A;  3N8S A;  4HBU A;  1G28 A;  4OOL A;  4JF6 A;  2VGL M;  4YNR A;  1PRQ A;  2FFY A;  4Q0I A;  4LFU A;  4PAU A;  2V8F A;  1DP6 A;  3KSG A;  4KQD A;  4R70 A;  2J3T D;  4S2M A;  2Y8H A;  5HZH A;  2WKH A;  3QP4 A;  5HAP A;  1BUL A;  1KE3 A;  2HV1 A;  3JYI A;  3PBT A;  1PYY A;  5F82 A;  3CPT B;  3EEA A;  4OQI A;  2HDR A;  5EVI A;  4Q0H A;  1LSW A;  5CTN A;  1KE0 A;  4WZ4 A;  1RP5 A;  1BLH A;  2MJ6 A;  4UQI M;  5FEF A;  3H7W A;  3UO9 A;  2QWS A;  1O7E A;  3GSG A;  3C7V A;  3MMH A;  3T1R A;  1KGE A;  2B18 A;  1H8M A;  4PKY G;  2JHE A;  1V9Z A;  2FZ0 A;  1X0O A;  4UEY A;  2J80 A;  4GDN A;  3K3D A;  4EQI A;  1BUE A;  4P0M A;  1RGY A;  4IUH A;  2ZOI A;  1S67 L;  2A24 B;  1H3Q A;  3PBR A;  1T1C A;  2WAE A;  2DCF A;  1XA7 A;  2VGL S;  3EWK A;  4JLF A;  3OOV A;  4KZB A;  3TE8 A;  2J9P A;  5CEC A;  2J3T C;  2C6W B;  1SCW A;  1LL5 A;  4WL9 A;  4P85 A;  4G3V A;  3OPL A;  3CG5 A;  4YOF A;  1VM1 A;  1DJA A;  3KX0 X;  1XGJ A;  3QNC A;  4S2P A;  3KSH A;  3JVV A;  4P6Z M;  2W27 A;  2ZM8 A;  2KOI A;  5EPH A;  3NJA A;  4KZ9 A;  3SZT A;  2H0T A;  2Y2P A;  3HUO A;  5I5L A;  3ZG8 B;  3BFF A;  3HUM A;  1MKI A;  4RX3 A;  5G18 A;  5J3W A;  4LRZ E;  4RYE A;  1XA1 A;  4I3I A;  3R7W B;  5CED A;  3F1P B;  3OBF A;  1OTE A;  3KYQ A;  4YFM A;  5CHJ A;  3TW8 A;  4BL3 A;  1TS8 A;  2P9V B;  4N1X A;  2M1C A;  2K7S A;  3GV9 A;  2EXA A;  4JKT A;  3ZG5 A;  4X25 A;  2IWD A;  3W4Q A;  2W3F A;  2ZC7 A;  3HUN A;  2EFX A;  1AXB A;  4JPM A;  1YSP A;  4KZ3 A;  3NUL A;  5C5K A;  3ULF A;  4HP4 A;  3G31 A;  4GS9 B;  2HDS A;  1NY0 A;  5A90 A;  1MC0 A;  1WE4 A;  1WA9 A;  3C5A A;  3WS0 A;  3PBO A;  4WMC D;  2ZL1 B;  2BLS A;  3LI8 A;  3CAX A;  5TJJ A;  1Y4O A;  1EI5 A;  2WAD A;  5J8X A;  4OON A;  4B9O A;  4S2J A;  1F9I A;  4WLA A;  2ZQD A;  4X68 A;  1OJ5 A;  4DMZ A;  5M19 A;  3MSH A;  1ODV A;  2J3W A;  2Y2I A;  3N8R A;  3ZYT A;  1RGZ A;  3T1X A;  1E25 A;  1J3W A;  4NXF A;  1A0K A;  1N4O A;  4PM7 A;  2Q0O A;  1KVL A;  5FEG A;  3QP8 A;  5DTT A;  3UE0 A;  4IED A;  4JBF A;  5D3O A;  1Q2P A;  1K4F A;  2JKF A;  5DTK A;  3BY9 A;  5EEC A;  2W1T A;  3LFV A;  1JVJ A;  2ZL1 A;  4LGW A;  2PR6 A;  5KSH A;  1NJ4 A;  1F5M A;  2EX6 A;  3DW0 A;  4DXC A;  2VX8 A;  3M6B A;  1TS0 A;  1P9W A;  1H8Z A;  3A3E A;  2JKR I;  2OWH A;  4WMC A;  5J7E A;  5KIZ A;  2H28 A;  4FSF A;  3UY6 A;  1OJG A;  2ZM0 A;  2D02 A;  4R3A A;  1YPR A;  2XGN A;  3A0R A;  2P08 A;  4N1H A;  2OWJ A;  3BEB A;  4IJG A;  1OPX A;  4Z9Q A;  4UA6 A;  5HWT A;  1BTL A;  3V3S A;  3NOP C;  2PR5 A;  3LIB A;  4P6Z S;  4F3L A;  5HW3 A;  4E3J A;  2X71 A;  1LLB A;  4WEK A;  3W8K A;  1NWZ A;  3FYZ A;  4K0X A;  4ZJ1 A;  4OP8 A;  5IT5 A;  1BZA A;  3T12 B;  4HH2 A;  1ZC2 A;  5AQ7 A;  1IYQ A;  1M6K A;  1LSX A;  5FAS A;  4R23 A;  4S2L A;  3UDF A;  3UB9 A;  3PR6 A;  5DKL A;  4AFI A;  4Z1W A;  3CMZ A;  4E3I A;  1E4D A;  2ZJ9 A;  3FKW A;  1PWC A;  2IA2 A;  2HP9 A;  2A24 A;  2EA9 A;  1MWS A;  5FI7 A;  3L7H A;  4PHT A;  2BTF P;  3B3X A;  4ID4 A;  4N92 A;  4YIN A;  3DAV A;  4L0L A;  4Y0T A;  2Y2Q A;  1GHP A;  5FSR A;  1S4S A;  3IHA A;  3TSG A;  2W3H A;  4EES A;  4FD8 A;  4KQQ A;  5FQK A;  4S2I A;  4LRX C;  4HY8 A;  1XXM A;  3KYE A;  4DRT A;  3IT9 A;  4S2N C;  2V1B A;  5E2E A;  5HD5 A;  2ZC6 B;  5E2F A;  3QP5 A;  5F5Y A;  4DN0 A;  3E4O A;  3S7Q A;  5HFO A;  1MZU A;  4WEL A;  3C4P A;  3ZDJ A;  1H8Y A;  2PRF A;  3U4L P;  3ZNT A;  3O88 A;  1UGU A;  2ZLY A;  2PYP A;  2EXB A;  3HLB A;  5HDD A;  2ZMA A;  1ZKJ A;  2XFT A;  3KO6 A;  4KZ4 A;  2VJW A;  4EWF A;  2Z6D A;  4GDB A;  1L0D A;  4JGR A;  1PW1 A;  3GVB A;  1XJ3 A;  2BAS A;  2X02 A;  5FDS A;  2WKQ A;  3GMW A;  3MS6 A;  1G5U A;  4UA7 A;  1VB6 A;  3A0S A;  4HQA A;  1LL8 A;  3R7W A;  1MWU A;  3I7J A;  4R4S A;  4D60 A;  3VMA A;  2ZMV A;  3E98 A;  1T1A A;  3BW6 A;  3T4Q A;  1E3U D;  3NEC A;  3E2K A;  4JF5 A;  1YLP A;  3BYD A;  2WGI A;  1FQG A;  2XH9 A;  2VV6 A;  2Y59 A;  4QB8 A;  3FG8 A;  2JKR M;  3UB7 A;  3EEH A;  2ZQ7 A;  4ARZ A;  4L9F A;  2PAV P;  3ISG A;  4WM9 A;  1CI9 A;  5HPF A;  1XFN A;  1N9L A;  3Q81 A;  1ERQ A;  1H0M A;  2V1Z A;  3QP1 A;  3K2N A;  3BWL A;  4OOY A;  1FCO A;  2WKR A;  1YLZ A;  4YWZ A;  3ITA A;  1JWZ A;  1PZO A;  3MKE A;  4MN6 A;  1E3U A;  3IS2 B;  5EVL A;  4R38 A;  5TBM A;  2KLI A;  3SH9 A;  4BD0 A;  4XT2 A;  4Y17 A;  2W1T B;  3FPV A;  2ZQC A;  1IEL A;  3EOI A;  1OME A;  2BG1 A;  5HDS A;  1Y28 A;  4RX2 A;  1PW8 A;  2W3D A;  3VV4 A;  4DXB A;  3UPN A;  3OCL A;  4OPZ A;  1P9R A;  4GB7 A;  5CXW A;  4KQR A;  3CIT A;  4XUX A;  2ZQ9 A;  4KG6 A;  2L0W A;  1TF1 A;  3BFG A;  2D01 A;  3IH9 A;  1S4R A;  3LY3 A;  1K55 A;  5KSC A;  3DTI A;  1D7E A;  3A3F A;  3PAG A;  4KG5 A;  3S4X A;  5FQJ A;  3UDX A;  3CPT A;  2E8J A;  4PM8 A;  5AVE A;  2PD8 A;  4HJ6 A;  3C7U A;  4EQ1 A;  3HL9 A;  2HJ9 C;  4GS9 A;  5FAO A;  3UN7 A;  4WBG A;  1ES3 A;  2DRW A;  2HDU A;  2W0N A;  1GSW A;  3T4S A;  4K0W A;  1NZO A;  2A3U A;  4MCW A;  4OKP A;  3B47 A;  1L3L A;  4EBN A;  1HD8 A;  4R6L A;  5FQM A;  3WS1 A;  4UAA A;  1F98 A;  3NCK A;  3QNB A;  5AJG A;  2G2W A;  2WKI A;  2XEP A;  2PU2 A;  2XDM A;  4L9G A;  3LR5 A;  4GKU A;  4UHU A;  4FCF A;  2Y2L A;  3F1P A;  1YLT A;  5FI6 A;  3FZC A;  2P74 A;  1M40 A;  1WYB A;  2W3E A;  1XX2 A;  4OH0 A;  5LBR A;  3BQA A;  2EWV A;  5FQI A;  4U0T A;  4QPR A;  3MJQ A;  4LLO B;  2EX2 A;  1K54 C;  3BLS A;  3IQA A;  1Z09 A;  3ZQ5 A;  3MXR A;  2Y2O A;  1W79 A;  2EWW A;  3M2K A;  3MXQ A;  1FR1 A;  3IXD A;  2VV7 A;  2QJ5 A;  4MN7 A;  3NOU C;  1MY8 A;  3FKV A;  2I9V A;  2OAQ 1;  1MBL A;  3E0Y A;  3CZD A;  5FL3 A;  1SHV A;  1S1Y A;  5FI2 A;  4LRY C;  4ZRR A;  4R1G A;  1T19 A;  3QHY A;  4I3J A;  1JNU A;  4KQO A;  3CUE A;  2XA7 M;  4B88 A;  3T4O A;  2DNS A;  1IKI A;  4I38 A;  1JTG A;  4K91 A;  1LHY A;  4LV0 A;  3MF0 A;  5TR7 A;  1NYM A;  5HAI A;  3SH7 A;  3EGX C;  1NYY A;  5BOH A;  4H6J B;  2PBY A;  3ZVW A;  3T4J A;  3UB5 P;  3UME A;  2WUQ A;  3S1Y A;  3T50 A;  1FSY A;  4XUZ A;  1YAX A;  3IXB A;  3IX8 A;  3FV7 A;  3M6H A;  2HF6 A;  2IWC A;  2WK0 A;  1ZG6 A;  3PTE A;  2V0W A;  3OLO A;  5DF9 A;  3ZVT A;  4P87 A;  2ZOH A;  1KGG A;  3N4I A;  4FH2 A;  1PZP A;  1W63 M;  4JXS A;  2V8C A;  4QHC A;  1RCJ A;  1HTZ A;  4QWO A;  5F6A A;  3R4K A;  2IWB A;  5HL1 A;  3N6I A;  3C30 A;  3RTY A;  4HJ3 A;  4R3B A;  4KZ8 A;  2V9A A;  1D1J A;  3NC8 A;  4OPQ A;  1IOU A;  1PI5 A;  1Q2Q A;  4OVD A;  4QD4 A;  5HX9 A;  3AGF A;  5L2F A;  4JXV A;  4BD1 A;  3UPO A;  1K0K A;  3IWQ A;  2XA7 S;  3BFC A;  4L9E A;  2QHK A;  3TG9 A;  1DY6 A;  3PAE A;  1VHM A;  4ZJ3 A;  2LB5 A;  2KDK A;  2QMI A;  3W4P A;  1L0E A;  3BY8 A;  1IKG A;  4Q8I A;  4DE0 A;  4HBT A;  5GHY A;  3GTC A;  2YKH A;  4DE2 A;  1K56 D;  5GLB A;  3CJM A;  1LI9 A;  3AGE A;  4Y0U A;  3F1N B;  4MMN A;  4BBU A;  4KUK A;  1EWZ A;  3S7O A;  5F1F A;  3JVU A;  4PM9 A;  4X56 A;  1VEU A;  2OLU A;  2M7U A;  4EW7 A;  1ZG4 A;  4P6B A;  3CWF A;  4E04 A;  1ALQ A;  3EQV A;  2Y2N A;  5A93 A;  2P7J A;  3V5M A;  3BEC A;  3ICY A;  4F94 A;  1XJ6 A;  5M1A A;  1L0G A;  3VE4 A;  3LEQ A;  5I94 A;  4H8R A;  3P7N A;  3L9K A;  3T1Q B;  5L10 A;  4OQG A;  3VE3 A;  4QJG A;  4EUZ A;  4ESP A;  2WKE A;  1MXO A;  3UE1 A;  1MWT A;  2Z2M B;  3C4O A;  2WGW B;  3VP0 A;  2NUT C;  2GX5 A;  3M2J A;  3BM6 A;  5F69 A;  5GHX A;  3Q07 A;  2ZM2 A;  2OV5 A;  4JGQ A;  2C5W B;  3DWK A;  5EV0 A;  1S1Z A;  3H7W B;  4CLC D;  3DTM A;  3O5Y A;  3OPP A;  4LCL A;  5CGS A;  1XFQ A;  4GHI B;  4NXB A;  4KUO A;  1PIO A;  5HSQ A;  4GNU A;  5GLD A;  2OAP 1;  5HPI A;  2H5S A;  1T1B A;  1T18 A;  2VK3 A;  3KSI A;  1MWR A;  3BFD A;  4X1L A;  4BEN A;  4Y0O A;  2XK1 A;  3HLG A;  1QME A;  4ZDX A;  4X1M A;  5CRF A;  4B93 A;  3Q1F A;  4CLC B;  2HJE A;  3MR0 A;  5HL6 A;  3ZFZ A;  4XXR A;  4HI4 A;  3G4P A;  4DF6 A;  3DBA A;  3LIF A;  4LCM A;  4CJN A;  1N9B A;  4EXO A;  3RFB A;  3ITB A;  5EM0 A;  4I39 A;  4EBL A;  3PYP A;  4X69 A;  5HWV A;  4G3W A;  4DE3 A;  4NKP A;  4ARZ B;  3S7P A;  4Q0J A;  4NXG A;  4JXG A;  3HLD A;  1L0F A;  4FTX A;  5IU1 A;  1G6O A;  2ZMF A;  2A49 A;  2P9V A;  1NXY A;  1JWV A;  4GHI A;  2PYR A;  3B33 A;  3IH8 A;  1PWD A;  4GD8 A;  5HAR A;  3MZF A;  4QY5 A;  2B5R A;  1NZU A;  2OOL A;  3U2A A;  1UWN X;  1K38 A;  4QY6 A;  3LGO A;  4X55 A;  2JKT M;  1FCN A;  4K08 A;  3D4F A;  2VGK A;  3HRE A;  5CGW A;  5HWW A;  1PFL A;  3HVF A;  1YT4 A;  2QZ6 A;  4RA7 A;  3G2Z A;  3IXG A;  3UMD A;  1JWP A;  4EV4 A;  4D2O A;  3PBN A;  5TGF A;  4UA9 A;  1TEM A;  3BQ8 A;  2XRO A;  1P0Z A;  5FDH A;  3SS5 A;  1K25 A;  3E4P A;  5M18 A;  3O86 A;  4DE1 A;  3EGD C;  4O8G A;  4NG2 A;  1XGI A;  3T4L A;  3NIA A;  5CER A;  4CLC C;  3ZGA B;  1GA0 A;  1QMF A;  1GSV A;  4JGP A;  4N9K A;  4C75 A;  5A8B A;  1YMX A;  3SW1 A;  4WF0 A;  4R4R A;  1ONH A;  3NBL A;  3LID A;  3UNW A;  4GJ4 A;  3H82 A;  5DTS A;  3F1N A;  4HES A;  3SOI A;  3MFD A;  1KGF A;  5FQ9 A;  1KDW A;  5A92 A;  5DJU A;  3O3V A;  1CJF A;  1NLZ A;  2WZX A;  3Q82 A;  2GNX A;  2OSU A;  2J9O A;  3GEC A;  3SS4 A;  3LCE A;  3WWX A;  1BLS A;  3LI9 A;  3WS5 A;  4PMA A;  1ESI A;  4XT2 B;  4ZBE A;  2FFF B;  3TRC A;  1I2W A;  5GLC A;  1W5D A;  3IX3 A;  1SZV A;  4EEU A;  4RQ9 A;  5MC7 A;  4I5S A;  5DFY A;  1BSG A;  3A3D A;  5FAQ A;  2XF3 A;  4DJ2 A;  4KG2 A;  2O0Y A;  1ACF A;  2DMW A;  3BRM A;  1TVF A;  3NHQ A;  1GA9 A;  2JBF A;  2QJ7 A;  3IX4 A;  3V39 A;  3SS3 A;  3G30 A;  2HZ5 A;  3ZG9 B;  2EFU A;  3D72 A;  4GN2 A;  1TS7 A; 
#chains in the Genus database with same CATH homology
 1NRJ A;  2I9V A;  4LPZ A;  2OAQ 1;  4ME4 A;  3E0Y A;  1NLY A;  5FL3 A;  3BY9 A;  2W1T A;  3LFV A;  1N9N A;  4MDZ A;  5HDC A;  1S1Y A;  4ETZ A;  4LRY C;  4ZRR A;  2PR6 A;  4HH3 A;  5KSH A;  1F5M A;  4GW9 A;  1T19 A;  2VX8 A;  2INW A;  2O9A A;  4I3J A;  1JNU A;  1YSQ A;  4HIA A;  1TS0 A;  4KQO A;  3CUE A;  1P9W A;  2XA7 M;  4O01 A;  3CLO A;  2JKR I;  3T4O A;  2OWH A;  4I38 A;  4HHD A;  2VKS A;  3MQ0 A;  1OTA A;  5J7E A;  2XSS A;  5KIZ A;  2H28 A;  4FSF A;  1TD5 A;  1GSX A;  3MF0 A;  4NXE A;  4EUV A;  3EGX C;  1OTI A;  1OJG A;  5EFW A;  5L8M A;  4WUJ A;  1XJ4 A;  4O0P A;  4H6J B;  2JKT I;  3PXP A;  2VV8 A;  3T4J A;  4BBV A;  3UME A;  3T50 A;  3K3C A;  2D02 A;  3UE6 A;  2B02 A;  5G4Y A;  4CLC A;  2XRN A;  4R3A A;  3UB6 A;  3A0R A;  3BJN A;  1DP8 A;  4BMW A;  4Y3I A;  2P08 A;  2HF6 A;  4WN5 A;  4MN5 A;  2OWJ A;  2V0W A;  4IJG A;  3OLO A;  5DF9 A;  1OPX A;  2ZOH A;  1KOU A;  5HWT A;  3W2Z A;  5DKK A;  2VEA A;  4UQI S;  3NOP C;  2PR5 A;  3LIB A;  4P6Z S;  5HD3 A;  1W63 M;  1S66 L;  4DJ3 A;  4F3L A;  4G3K A;  1ZHH B;  3FC7 A;  3F1O A;  4WEK A;  1NWZ A;  5F6A A;  3R4K A;  2YKF A;  3D3O A;  5IT5 A;  4FOF A;  4HH2 A;  3FPW A;  5CX7 A;  3C30 A;  3RTY A;  2LB9 A;  4HJ3 A;  3V67 A;  2V9A A;  2A2L A;  2JN7 A;  2V1A A;  3LIA A;  1LSX A;  1UWP X;  3UB9 A;  3EQU A;  3PR6 A;  4BWI A;  3GDI A;  5DKL A;  1IOU A;  4AFI A;  4HOI A;  1YKD A;  4Z1W A;  4PKY A;  3MQO A;  4M4X A;  1P97 A;  3C38 A;  4OOM A;  1TS6 A;  2P04 A;  3UE3 A;  3CUE C;  2XA7 S;  3OCN A;  4L9E A;  2PD7 A;  2QHK A;  2IA2 A;  2A24 A;  2EA9 A;  2G7U A;  1VHM A;  2LB5 A;  4EU0 A;  2KDK A;  4PHT A;  3BY8 A;  1OTD A;  1V9Y A;  4L0L A;  2YKH A;  3LIE A;  1LT0 A;  3F1N B;  4MMN A;  2VZW A;  4BBU A;  4KUK A;  1S4S A;  3S7O A;  2R78 A;  2W3H A;  2GZA A;  4EES A;  4EET B;  3JVU A;  2O99 A;  3HCY A;  3HJK A;  2PHY A;  3E4Q A;  4LRX C;  4HY8 A;  2M7U A;  4EW7 A;  3CWF A;  4ETX A;  1ZTU A;  3LR0 A;  4E04 A;  3S7N A;  3EQV A;  2P7J A;  3PBQ A;  2L1M A;  2M7V A;  2V1B A;  3ICY A;  4BBT A;  1XJ6 A;  1OTB A;  2PDR A;  1MKM A;  3NOT C;  5HD5 A;  2GJ3 A;  3CI6 A;  3VE4 A;  4CQH A;  5F5Y A;  4DN0 A;  3E4O A;  3S7Q A;  3P7N A;  5DFX A;  1MZU A;  4WEL A;  2K31 A;  4Y2F A;  1UGU A;  3VE3 A;  2PYP A;  2Y79 A;  3VOL A;  1XJ2 A;  4EEP A;  3LUQ A;  4H6J A;  2K2N A;  5HDD A;  3LYX A;  2QKP A;  2NUT C;  3KO6 A;  1G28 A;  4OOL A;  2VGL M;  2GX5 A;  4YNR A;  5F69 A;  2VJW A;  3LR4 A;  2Z6D A;  4Q0I A;  4JGQ A;  4PAU A;  1DP6 A;  3KSG A;  4JGR A;  4KQD A;  4R70 A;  2J3T D;  1W63 Q;  1XJ3 A;  1S1Z A;  2Y8H A;  3H7W B;  5HZH A;  4CLC D;  2BAS A;  2WKQ A;  3O5Y A;  2HV1 A;  1DP9 A;  1XFQ A;  3PBT A;  4GHI B;  4NXB A;  4KUO A;  5HSQ A;  1VB6 A;  2OAP 1;  3A0S A;  3EEA A;  4HQA A;  5HPI A;  1LL8 A;  3R7W A;  1T1B A;  1T18 A;  2HGV A;  3KSI A;  3IBJ A;  4Q0H A;  2ZMV A;  3E98 A;  1T1A A;  3IS2 A;  3BW6 A;  1LSW A;  3C8C A;  3T4Q A;  4HNB A;  2MJ6 A;  4UQI M;  3H7W A;  2QWS A;  2VV6 A;  3UB7 A;  3FG8 A;  2JKR M;  3EEH A;  4B93 A;  3MMH A;  2KX6 A;  4CLC B;  2HJE A;  3MR0 A;  4ARZ A;  2W3G A;  5HL6 A;  4L9F A;  2B18 A;  1N9O A;  1H8M A;  5HPF A;  3OC2 A;  4HI4 A;  3MFX A;  4PKY G;  3TJZ C;  3DBA A;  2JHE A;  1XFN A;  1N9L A;  1V9Z A;  2FZ0 A;  1X0O A;  3LIF A;  4UEY A;  4EXO A;  2J80 A;  3K2N A;  1OT9 A;  3RFB A;  1IFQ A;  3BWL A;  4I39 A;  3K3D A;  2QYB A;  3PYP A;  2WKR A;  2V0U A;  3PBS A;  5HWV A;  4F3L B;  4G3W A;  4YWZ A;  4IUH A;  2CMN A;  4NKP A;  4ARZ B;  3S7P A;  2ZOI A;  4Q0J A;  4MN6 A;  1S67 L;  2A24 B;  1H3Q A;  3PBR A;  1T1C A;  4NXG A;  3IS2 B;  3F1O B;  2VGL S;  4R38 A;  3EWK A;  5TBM A;  3OOV A;  2KLI A;  5IU1 A;  1G6O A;  2ZMF A;  3TE8 A;  4GHI A;  2ZBB A;  4XT2 A;  2WKP A;  2PYR A;  2W1T B;  3FPV A;  3B33 A;  2J3T C;  2NUP C;  3EOI A;  2OOL A;  1STZ A;  1UWN X;  3U2A A;  5HDS A;  4WL9 A;  1Y28 A;  4G3V A;  2W3D A;  3VV4 A;  2JKT M;  4JGO A;  4K08 A;  4YOF A;  3OCL A;  5HWW A;  3T4K A;  3KX0 X;  3P01 A;  3KSH A;  3JVV A;  4P6Z M;  2PT7 A;  2W27 A;  4IUK A;  1P9R A;  2KOI A;  3T4T A;  3LIC A;  3CIT A;  3UMD A;  3NJA A;  1TF1 A;  2D01 A;  3PBN A;  5I5L A;  4EER A;  1S4R A;  3BQ8 A;  4I3A A;  2XRO A;  1P0Z A;  1LSV A;  5J3W A;  1D7E A;  3E4P A;  4LRZ E;  3H9W A;  4I3I A;  3LR3 A;  3R7W B;  3F1P B;  3OBF A;  5J4E A;  1OTE A;  3EGD C;  3KYQ A;  4O8G A;  3TW8 A;  3HJI A;  5AVE A;  1TS8 A;  2PD8 A;  4HJ6 A;  3T4L A;  2M1C A;  1D06 A;  2K7S A;  3PHY A;  4CLC C;  4EQ1 A;  1GSV A;  4JGP A;  5IS1 A;  2HJ9 C;  4GS9 A;  4WEJ A;  3B42 A;  2VLG A;  5A8B A;  4BJP A;  3SW1 A;  2W3F A;  4WF0 A;  3KYZ A;  2O9B A;  5F68 A;  1EW0 A;  2W0N A;  1GSW A;  1YSP A;  3T4S A;  3LID A;  4CLC E;  4GJ4 A;  3H82 A;  3F1N A;  3C2W A;  5C5K A;  3UB8 A;  3ULF A;  2W1R A;  3H82 B;  2O9C A;  4MCW A;  4HP4 A;  5DJU A;  3B47 A;  1NLZ A;  4GS9 B;  4HJ4 A;  3MQQ A;  2GNX A;  1MC0 A;  4R6L A;  3RH8 B;  4Y5F A;  2FH5 A;  1WA9 A;  3GEC A;  3PBO A;  4IHQ A;  1DRM A;  3LI9 A;  1F98 A;  5K5B A;  5AVF A;  5TBM B;  5AJG A;  3LI8 A;  3CAX A;  5TJJ A;  4XT2 B;  3KSF A;  4L9G A;  3LR5 A;  3TRC A;  5DJT A;  4B9O A;  3F1P A;  1F9I A;  4GLQ A;  4WLA A;  4GCZ A;  3G6O A;  2W3E A;  1OJ5 A;  4DMZ A;  2L4R A;  5LBR A;  4EEU A;  3BQA A;  4RQ9 A;  5MC7 A;  2EWV A;  4II7 A;  4I5S A;  5DFY A;  4QPR A;  1ODV A;  2J3W A;  3MJQ A;  4LLO B;  2VA0 A;  4DJ2 A;  3ZYT A;  2O0Y A;  2DMW A;  4NXF A;  3IBR A;  3ZQ5 A;  1OT6 A;  2Z6C A;  3NHQ A;  2QJ7 A;  4NEE D;  2EWW A;  3MXQ A;  1BYW A;  2VV7 A;  2QJ5 A;  3A0V A;  3D72 A;  4HP9 A;  3NOU C;  4MN7 A;  5G4Z A;  2L0W A;  1TS7 A;  1YAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...