4KQDA

The crystal structure of the n-terminal pas domain of the f plasmid traj
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
IDLLENLTAVIQDYPNPACIRDETGKFIFCNTLFHESFLTQDQSAEKWLLSQRDFCELISVTEMEAYRNEHTHLNLVEDVFIQNRFWTISVQSFLNGHRNIILWQFYDAAHVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein TraJ
publication title The crystal Structure of the N-terminal PAS domain of the F plasmid TraJ
rcsb
source organism Escherichia coli
total genus 30
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kqdA00
1TS6A 3LIBA 3BY9A 4WF0A 3H7WA 2HV1A 1UWNX 5F5YA 1V9ZA 3NHQA 3T50A 4M4XA 1DRMA 4GS9B 1TS7A 2QJ7A 1T1CA 4MN6A 3CAXA 5AVFA 1GSVA 2OWJA 1OTDA 5EFWA 3C2WA 1DP9A 2VEAA 2QJ5A 2K7SA 3CWFA 2L4RA 2GJ3A 4H6JB 2A24B 3MQQA 4BBTA 5HSQA 4K08A 3E4QA 1OT6A 3LIDA 1D7EA 5A8BA 2Z6DA 4E04A 3UMEA 1P0ZA 2V9AA 4LRZE 3LYXA 4WUJA 5HWWA 2PYPA 4MN5A 2D02A 4KUOA 3SW1A 3LIAA 5IS1A 2PD8A 4GS9A 4GW9A 3BWLA 2QWSA 4NXGA 4I3AA 3LI8A 1XJ6A 3IBRA 4I3JA 3MJQA 2B02A 2P7JA 4F3LB 1BYWA 5HD5A 4EERA 3LI9A 1LL8A 3K3DA 3C8CA 1OTEA 1F98A 1DP6A 5HDDA 1T1BA 4NXEA 2A24A 2OWHA 4HNBA 1WA9A 4DJ3A 3B33A 5IU1A 4I38A 2EA9A 1LSXA 2V1AA 4R6LA 3MFXA 5TBMB 4HJ3A 3UMDA 4GCZA 3LIEA 2V1BA 4L9FA 4B9OA 4HH2A 4LRXC 1S4RA 1OTBA 2H28A 5J7EA 2PHYA 3CLOA 3PHYA 2J80A 4HY8A 1MZUA 2WKRA 4XT2A 4F3LA 1JNUA 2KDKA 4I5SA 3NOPC 4BBUA 3A0SA 4HIAA 3MR0A 3VE3A 1LSVA 3ICYA 4EQ1A 4PKYA 2JN7A 4HJ4A 2PR6A 4BBVA 3LIFA 1GSXA 3K3CA 5DJTA 5TBMA 3BY8A 1TS0A 3IS2B 3F1PB 4YWZA 2KX6A 5J4EA 3NOUC 3ULFA 2OOLA 4NXBA 3MQOA 2JHEA 5DKKA 2VLGA 3GDIA 1VB6A 1V9YA 1S66L 4PKYG 1EW0A 1T18A 5F6AA 3NOTC 4HQAA 4LPZA 5DKLA 1DP8A 4HH3A 2V0WA 3UB8A 1F9IA 3UB7A 3NJAA 1XJ3A 3G6OA 1OT9A 4R38A 4GHIB 4LRYC 5G4ZA 3ZQ5A 3EEHA 1N9OA 4EW7A 2D01A 1OJGA 4WLAA 5KIZA 1UGUA 4H6JA 1Y28A 2L0WA 1UWPX 3IS2A 1P97A 3H82B 2V0UA 3F1OB 3A0RA 4EEUA 4HJ6A 2W0NA 4KUKA 2QKPA 4WN5A 1S4SA 5J3WA 1XJ4A 4HP9A 4EESA 2ZOIA 2WKQA 4JGQA 1XFNA 1S67L 4R70A 3HJIA 4GHIA 5HDCA 3FG8A 3FC7A 2YKHA 3KX0X 4JGRA 4RQ9A 3UB6A 3F1NB 3EWKA 3H82A 3F1OA 3D72A 2Z6CA 2PD7A 5HD3A 4I39A 1X0OA 4WL9A 1S1ZA 2QHKA 2PR5A 2INWA 5I5LA 3HJKA 2ZBBA 3VE4A 5DJUA 4L9GA 4LLOB 3E4PA 1GSWA 4JGPA 2I9VA 1LT0A 5G4YA 3UE6A 2M1CA 2W27A 1LSWA 2BASA 1OTAA 5HZHA 3VOLA 3A0VA 2PDRA 1D06A 3GECA 2CMNA 4HOIA 5AVEA 4DJ2A 1S1YA 2WKPA 4R3AA 3F1NA 4L9EA 3LUQA 4KQDA 2YKFA 1T1AA 2PYRA 2ZOHA 2L1MA 5F68A 3H7WB 4HHDA 3F1PA 5HDSA 4EETB 3P7NA 1N9LA 1XFQA 4I3IA 4XT2B 5HWTA 4HP4A 3RTYA 4JGOA 3RH8B 3MXQA 5F69A 3E4OA 1OTIA 3OLOA 3LICA 5HWVA 1T19A 1N9NA 2VV8A 4HI4A 2R78A 1NWZA 4EEPA 2VV7A 3H9WA 3PYPA 1OJ5A 1ODVA 2VV6A 1KOUA 3UB9A 1TS8A 4EXOA 1G28A 1XJ2A 4NXFA
chains in the Genus database with same CATH superfamily
3ZFZA 2XFTA 3BLSA 4WF0A 5FQ9A 3H7WA 3LR0A 4MLLA 2LB9A 4N9KA 2IWBA 5A90A 3R4KA 3FPWA 4YINA 5A91A 4WYYA 3T50A 4WZ5A 4M4XA 3O5YA 1BLHA 4MN6A 4HEFA 3CAXA 4GOGA 5EFWA 4X53A 3C2WA 3UN7A 3RJUA 2BLSA 3HLDA 4X6TA 4KQOA 2Y2QA 3E0YA 3QP1A 5E2FA 1K57A 4MBFA 3S7OA 2FFFB 1MXOA 1HD8A 3BQAA 3Q82A 1SDNA 1ZKJA 3UMEA 3QNBA 2V9AA 2EFXA 4WEKA 3ZG5A 3IXBA 1JWZA 2Y4AA 3OBFA 3BECA 3LYXA 3G2YA 2P74A 5HWWA 3DTIA 4NKPA 3BLMA 2FFYA 2D02A 4KUOA 4N92A 4CLCB 1SZVA 1NRJA 5BOHA 1Y54A 4GS9A 4QY5A 2VGKA 1HZOA 1FQGA 1XJ6A 2C5WB 4C6YA 4I3JA 1BT5A 2P7JA 4WZ5C 3V50A 4F3LB 1TVFA 3HLEA 3JYIA 4QU3A 5E43A 3U4LP 1CF0A 5K5BA 1F98A 5HDDA 1T1BA 3VSKA 1ERMA 1WA9A 5HAPA 3B33A 3MMHA 5CERA 2EA9A 5GLDA 3N8SA 5EV0A 3ZGAB 2WZZA 4UQIM 3MFXA 5TBMB 1K57C 4BLMA 3IF5A 5CHMA 3N7WA 2PU2A 3GVBA 1K6SA 5EECA 3BYDA 4L9FA 3MBZA 4B9OA 1ES4A 1BLSA 4LRXC 5HX9A 3IX3A 3CLOA 1F2KA 4JBFA 3VP1A 3OZHA 1QMEA 1CJFA 3PHYA 2J80A 3WS2A 2X01A 4WEJA 5FI2A 4E6WA 1MZUA 1PW8A 3OPPA 3M2JA 3TG9A 4PMAA 1JNUA 3VV4A 2KDKA 3SH8A 4BBUA 3BFFA 3VE3A 3ICYA 2JN7A 1EWZA 2MJ6A 4EBPA 3DTKA 3NDEA 2WAFA 4H8RA 4QHCA 1FCOA 3WRTA 1Q2QA 4LV1A 1IFQA 3VMAA 4YWZA 2W3DA 2HF6A 1YQSA 4GJ4A 4KQRA 4NXBA 5HFOA 2XF3A 2PRFA 2JHEA 2W3EA 3D4FA 4LENA 5DKKA 2VLGA 1VB6A 1IYQA 1PRQA 5HAQA 4X1MA 1ZHHB 4E6XA 2A2LA 2VGLS 5HPFA 1NZOA 4GDNA 1S6RA 3NOTC 2P9VA 4OOLA 4PAUA 4R4RA 2XGNA 1H8MA 3G6OA 4S2MA 3D3OA 4ME4A 4KG5A 1FSYA 5D3OA 2D01A 1OJGA 5KIZA 1UGUA 4P6ZM 1MC0A 4FH4A 3PAEA 3S7PA 1M6KA 2XA7M 2R9XA 3H82B 3F1OB 2B95A 4EEUA 4HJ6A 3UB5P 3FYZA 2V2FF 1KDSA 2XQZA 5EVLA 4JF4A 3C30A 5EUAA 2J3TD 2QKPA 4WN5A 3W4QA 3QP5A 1YM1A 5TFQA 4HP9A 4EBLA 1PZPA 5EOEA 5EM0A 1S0WA 1VQQA 4KZ8A 1GA9A 4FD8A 2V1ZA 1XFNA 4R70A 3HJIA 3NCKA 5FI7A 4G3WA 4GHIA 2ACGA 3OPLA 2XD5A 4KZ3A 3T1SA 3HUOA 1W63M 2XLNA 3EEAA 2YKHA 5GHZA 1K38A 3DWKA 3GTCA 4O7DA 5IT5A 3CPTB 3TSGA 3N6IA 3ZYTA 5MC7A 4FTXA 4S2PA 3MFDA 1VETB 1X0OA 2EX2A 4DXCA 1YSPA 1PW1A 3HL9A 4D2OA 3BJNA 4B4XA 5DJUA 4L9GA 4LLOB 4GZBA 3E4PA 5HAIA 4DXBA 2I9VA 2Q9NA 4P87A 2XK1A 4O01A 4E3MA 1OTAA 3S7NA 3G35A 4OQIA 1Y4OA 3SZTA 1LL5A 5JYPA 2Y8HA 2EXBA 2CMNA 4YFMA 4S2LA 1CK3A 4HOIA 2PBDP 3PBRA 4C3QA 4Y13A 1MWSA 3F1NA 3GR2A 5FDSA 3LUQA 4EBNA 2YKFA 1K56A 3GV9A 4U0XA 4ARZA 2L1MA 5F68A 4MN7A 3H7WB 4Y0UA 4DN0A 3MKFA 4EETB 2HPBA 3P7NA 5DTSA 2J9OA 1XFQA 2M7VA 1K4FA 4IBRA 3E2LA 2JKTI 1SCWA 3GRJA 4YNRA 4HP4A 2XH9A 5F69A 2ZQCA 2VA0A 1ESUA 3KSGA 4P85A 3HLGA 3FV7A 4KZ5A 4N1HA 2FZ0A 2Y2GA 3KSFA 1MY8A 3CMZA 3SOIA 4JPMA 3SS3A 3R7WB 5EVIC 4EXOA 3S4XA 3P09A 1YLYA 1ONHA 1EI5A 2H0TA 3BY9A 5DFXA 2KLIA 3BRMA 2HV1A 2XD1A 2BG1A 1ZC2A 3OC2A 3ZG9B 3LR4A 3CG5A 3MSHA 3PBOA 2QYBA 2CC1A 5AQ7A 4CPKA 3CHWP 4GS9B 1TS7A 1GHMA 3WWXA 1T1CA 1KDWA 1PFLA 5AVFA 3M2KA 2Y2LA 4K0WA 1OTDA 3MF0A 3GQZA 3PBQA 3VP0A 3TW8A 4NK3A 2IWCA 4H6JB 3MQQA 1CI9A 3UDFA 3LR5A 4FUWA 4BL2A 4II7A 3UE3A 1KGFA 1D7EA 2JC7A 5F1GA 4BD0A 1PI4A 4GLQA 4MN5A 4E3JA 1BZAA 3LIAA 2UWXA 2PD8A 3UPPA 2Y2KA 4NXGA 3MQ0A 4KQQA 4Q0HA 4JXVA 4RA7A 4XUXA 2WAEA 5CTNA 2B02A 2JKRI 4KZ4A 1E3UD 1IEMA 2ZQAA 3DWZA 5CGSA 4EERA 4R3JA 2J7VA 1LL8A 3LI9A 5CGWA 4NXEA 2A24A 4DJ3A 4Z1WA 5IU1A 2IA2A 1KGEA 1LSXA 3CZDA 5GLBA 4R6LA 2QPNA 4GKUA 3SH9A 4WBGA 5FEFA 3BW6A 4OP5A 3IXDA 4HJ3A 3UMDA 4K91A 4R4SA 5GHXA 2J3WA 1K56D 4DE3A 4Y0TA 4KZ6A 3P01A 4HH2A 1W7FA 4HBTA 1OTBA 3ZNTA 2ZC7A 2PHYA 1TDLA 1ES5A 3UE1A 3MZEA 3JVUA 4QWOA 2O0YA 2XFSA 3UPNA 5FSRA 2WKHA 4MMNA 4DMZA 4IVIA 2ZQ7A 3WRZA 2P9VB 3DBAA 4LV2A 4HIAA 2PAVP 3MXRA 4ZRRA 1LSVA 3B47A 4EQ1A 1MKMA 1I5QA 2FH5A 4BBVA 1STZA 3ZHHA 1KVMA 3QP8A 3IT9A 3EOIA 3BY8A 4ETXA 3DW0A 3R7WA 4R1GA 2HJEA 1A0KA 5EVEA 3TE8A 1RGYA 5LBRA 3VP4A 3IQAA 3PAGA 3V3RA 1S66L 4BJPA 5EM1A 4KZ7A 4E3IA 4QPRA 4EV4A 2V8FA 2QMIA 1T18A 3BQ8A 5CX7A 5F6AA 5U47A 3NULA 3NI9A 2OV5A 3FKWA 4LPZA 4QY6A 4R0QA 3S22A 1DP8A 2HP5A 3MZDA 5E2HA 1NY0A 4GHIB 5G4ZA 4WELA 3ZQ5A 3I7JA 3EEHA 1I2SA 3JPUA 4UA9A 4WLAA 3A3EA 5DF8A 4IUHA 1IYSA 4H6JA 2JKTM 1UWPX 2E8IA 2VK3A 4U3TA 3IS2A 2V0UA 2LB5A 4MCWA 4O8GA 3IWOA 3CUEA 3HLWA 1K55A 1MWUA 2GNXA 1CI8A 2W0NA 5EOOA 3DTMA 1S4SA 1XJ4A 2DCFA 4R23A 5FQMA 1BULA 3T4OA 2J8YA 1J3WA 3C4PA 1SDEA 1G68A 4KZBA 3T12B 3MKEA 4QB8A 3CJMA 3T4QA 2VGJA 5M19A 3QP4A 5HPIA 4K0XA 4AFIA 4JLFA 1LI9A 3LO7A 3KX0X 4JGRA 4RQ9A 3UB6A 4MNRA 3F1NB 2C6WB 3D72A 3QP2A 2Z6CA 2W1TA 3NC8A 2PD7A 4E3NA 5HD3A 5FQJA 4I39A 4ARZB 2HDUA 4Z9QA 2PR5A 2XROA 2INWA 1WYCA 3CUEC 2ZC4B 1K55C 4OVDA 2E8JA 4JGPA 4UA6A 5A92A 5FA7A 4OOMA 1LT0A 3UE6A 1LSWA 3Q7VA 2WK0A 1MBLA 3T1QB 2PDRA 1D06A 3V3SA 3CI6A 4DF6A 2GX5A 4OLDA 1ZTUA 5CGXA 1L0DA 3O88A 2XR0A 4XXRA 1HTZA 1S1YA 2WKPA 2Y2PA 3KSHA 2O99A 3IF6C 5CTMA 2P08A 4KQDA 2JCHA 2ZC3B 4Y3IA 1LLBA 3O3VA 4NG2A 2HGVA 2JKRM 1PWGA 1YT4A 5GHYA 3TRCA 4BWIA 5DF7A 4HHDA 1J9MA 2HJ9C 2J9PA 4A5RA 1NRFA 2XSSA 4DKIA 1OPXA 2I72A 2VX8A 4XT2B 2WGVA 3C7UA 2EX6A 3RTYA 5AQBA 4E3LA 2XDMA 2EX9A 5FAOA 2ZJ9A 3RH8B 3MXQA 3OLOA 3LICA 1ONGA 4PPRA 4HI4A 1NWZA 1YLZA 4GD8A 1ZG4A 1NYYA 2EWVA 3B3XA 1RGZA 3VFHA 4OONA 4JXSA 1ODVA 5GL9A 3T1RA 3KO6A 5CEBA 1G28A 2DRWA 3IX8A 3UPOA 1TS6A 2PT7A 3FZCA 5AQ9A 4WZ4A 1TD5A 1UWNX 2B18A 2VGLM 2XRNA 2HDQA 1VEUB 3NHQA 4P6BA 1IYOA 4PM5A 1DRMA 3OCLA 1L0GA 2QJ7A 2A49A 1G5UA 1GSVA 1FCNA 1PZOA 2K7SA 1FCMA 3FPVA 2L4RA 2GJ3A 5GLAA 3HLCA 2A24B 1EROA 3FKVA 4BBTA 3AGFA 3G32A 5HSQA 4EU0A 2JBFA 5KZHA 3LR3A 4LGWA 1KE0A 1XPBA 3E4QA 5L10A 4B88A 2EX8A 3LIDA 1XP4A 1AWIA 1K54C 5EVIA 2Z6DA 5DVAA 2DNSA 2ZM8A 4GDBA 4WUJA 3G34A 3KYZA 3T4SA 3BM6A 3G31A 2PYPA 4CLCC 3QNCA 1CQAA 2JKFA 3O86A 3M6BA 4U0TA 2EWWA 1KGGA 4PM6A 5DF9A 4GW9A 3BWLA 2QWSA 3PBNA 1DJCA 4Y2FA 3IBRA 1LL9A 3WS1A 3MJQA 1ZG6A 5HD5A 2H0YA 2V8CA 4QD4A 3K3DA 3C8CA 4MEZA 1OTEA 1SHVA 4OQHA 1DP6A 3CITA 2Y2JA 3UY6A 3PR6A 4BD1A 4MDZA 4I38A 4EUZA 5EPHA 1YLWA 2X02A 3W8KA 2HZ5A 5F82A 3UNWA 3ISGA 5TJJA 3LIEA 1O07A 2NUTC 2WYXA 1S4RA 1PIOA 5CHJA 4HY8A 1YSQA 4X25A 3MS6A 1K0KA 4KZ9A 1WE4A 4M3KA 2G2UA 4XT2A 3KSIA 1FILA 3C38A 3NOPC 5DTKA 4EQIA 3A0SA 1NZUA 3D9YA 4ZTKA 1AXBA 5L2FA 4OH0A 3ZG0A 4HJ4A 3BFCA 4EUVA 3LIFA 3K3CA 5DJTA 2W3FA 1Q2PA 1CEGA 4DDSA 2ZC5B 3FWLA 3IS2B 4ZAMA 2Y79A 3NY4A 5J4EA 2Q0OA 3T4JA 3MQOA 3OPRA 4IEDA 1BLCA 1K25A 1V9YA 1E25A 2Y2HA 1MWTA 2GZAA 1EW0A 3IHAA 3B42A 2W3GA 1VEUA 1GCEA 4Y0OA 2RCXA 3HREA 4HQAA 5DKLA 2AVXA 3HLFA 1C3BA 1W8YA 2OAP1 4ZJ1A 1XX2A 2V0WA 3IBJA 3UB8A 3NJAA 5DTTA 1XJ3A 4F94A 2W1RA 1OT9A 1YLTA 3V5MA 1YMXA 1G6AA 2ZM2A 2ZQ9A 3PXPA 3SS5A 1Y28A 1FOFA 2ZM0A 5EVID 1P97A 1K6RA 3G2ZA 2ZMAA 2W1TB 1HLUP 1H8YA 4Y5FA 3KYEA 4CQHA 3ZG8B 2XEPA 4WMCA 3SS4A 1HVBA 1OMEA 1W5DA 3L7HA 1Z6FA 4EESA 1FIKA 5KMWA 2GDNA 2Y91A 3V67A 2Y59A 4X1LA 2B5RA 4LV0A 3MXSA 1W8QA 3Q7VB 1ES3A 1S67L 3LCEA 4PM8A 4WM9A 1YLPA 4DE0A 2EFUA 4B93A 1VM1A 3FC7A 5FATA 4E3KA 4LCLA 3PBSA 4YOFA 3G4PA 5FQKA 1SKOB 3N4IA 3EWKA 5CEDA 3GSGA 5KSHA 4PM7A 4BQMA 4BL3A 2Y2OA 4UQIS 4WL9A 5J8XA 3NBLA 5E2EA 1S1ZA 2QHKA 1BTLA 1RP5A 3WS0A 5I5LA 2ZBBA 5EE8A 1GSWA 3ZNYA 1YLJA 2JKGA 1F5MA 2M1CA 4KENB 5HZHA 2WGWA 1YAXA 2ZMVA 1GA0A 2ZLYA 4MBHA 1TDGA 3OOVA 5HARA 1N9BA 1N4OA 2DMWA 2O9CA 1W63Q 4OLGA 3VP3A 5I94A 4DJ2A 4LFUA 2P04A 3Q81A 5TGFA 1IKGA 1XA7A 2Y2NA 2ZD8A 3DAVA 4ZBEA 3BFDA 3WS4A 1T1AA 3IWIA 2Z2MB 5HL6A 2PYRA 4Q0JA 2ZOHA 2W3HA 2ZQDA 3IXHA 4QJGA 3LFVA 3A3FA 1RCJA 4EWFA 3HVFA 5HDSA 1N9LA 1P9RA 3UDIA 4ZJ3A 2M7UA 3TOIA 4X55A 1XXMA 5CHUA 4Q0IA 3E98A 4Q8IA 2ZL1A 4E3OA 4JGOA 3VFFA 5FQQA 1KVLA 3EGDC 2R78A 4EEPA 1PWDA 1IKIA 4D60A 1OJ5A 1TEMA 4JF6A 4OPZA 1KOUA 2ZMFA 1YMSA 2WUQA 3UE0A 4OPQA 1K4EA 2VKSA 1KE3A 5EVIB 4LCMA 3IF6A 5FAPA 3IH8A 3LIBA 1L2SA 1L0FA 5M1AA 1Z09A 3Q07A 4P6ZS 3T4LA 4IVKA 5F5YA 2J3TC 5C5KA 1QMFA 1WYBA 2OLVA 3W4OA 5CECA 1V9ZA 3C5AA 2XA7S 1IOUA 4WMCD 3LEZA 4BMWA 3PTEA 1NYMA 4L0LA 5JYOA 1L0EA 2QZ6A 4ETZA 4CLCE 2OWJA 4N9LA 3LY4A 1DP9A 2VEAA 2QJ5A 2ZQ8A 1DJBA 1KE4A 1H3QA 3IHBA 3CWFA 4G3VA 4OOYA 3SH7A 2OLUA 4K08A 3HBRA 5TR7A 1OT6A 3OCNA 4ESPA 4DE1A 5A8BA 5L09A 3EQVA 3PBTA 4E04A 1JVJA 1P0ZA 3UO9A 4LRZE 5L8MA 3HUMA 1MKIA 1SKOA 4C75A 1ALQA 3S1YA 3SW1A 3K2NA 5IS1A 5FEGA 5F83A 3QP6A 5FAQA 1PNEA 4I3AA 3LI8A 3BFGA 1LHYA 1NXYA 5DFYA 1BUEA 1BYWA 1BLPA 3T1XA 2X71A 4UA7A 2Y2IA 4OPYA 4KZAA 2KOIA 4X68A 2OWHA 4HNBA 2HP6A 3LGOA 1M40A 1U60A 4ZJ2A 1ESIA 4DDYA 5FI6A 3U2AA 2V1AA 4OPRA 1XGIA 4B4ZA 1H5XA 1K54A 1PWCA 4GCZA 3A3JA 3RXXA 2V1BA 3LEQA 4NEED 4S2JA 4CLCA 5CXWA 4MBKA 5AJGA 2H28A 5J7EA 1FR1A 4JXGA 1DY6A 1H8ZA 3G30A 1MPLA 2WKRA 4GNUA 5E2GA 5GLCA 5M18A 2PU4A 1XKZA 2HDRA 4GD6A 4F3LA 3QHYA 1D1JA 1MWRA 4I5SA 4P0MA 3P98A 1ES2A 4GB7A 3MZFA 3MR0A 3T4KA 4IBXA 2G7UA 5IHVA 2WKEA 3VOYA 4PKYA 4XUZA 1PI5A 4N1XA 2PR6A 3W2ZA 4DE2A 1JTGA 5HW3A 1GSXA 3AGDA 4X69A 5TBMA 5L07A 4X56A 3RFBA 3W4PA 1TS0A 1W79A 2Y55A 3F1PB 2KX6A 3ITAA 1IYPA 3NOUC 4IUKA 3ULFA 2EXAA 2OOLA 4DRTA 4OQGA 1YPRA 1E3UA 3GDIA 3HCYA 3NDGA 4O0PA 4RVAA 3E2KA 4PKYG 3ZDJA 4ID4A 2VJWA 3ZVTA 2ZC6B 1E4DA 3V39A 4HH3A 3KYQA 1BSGA 1ERQA 1F9IA 3UB7A 2WADA 1GHIA 4R38A 3ZVWA 4LRYC 3N8RA 1N9OA 4EW7A 4JF5A 5HL1A 1I2WA 1TF1A 4S2KA 2R9WA 2WZXA 2L0WA 4BENA 1GHPA 3JVVA 3IWQA 3NECA 3A0RA 4R3BA 3IXGA 4UAAA 4KUKA 3A3IA 4HBUA 2IWDA 3RXWA 5J3WA 3HUNA 3A3DA 4UHUA 2ZOIA 4RX3A 5FDHA 4FOFA 2WKQA 3ZCZA 2HDSA 4S2OA 4JGQA 2WGWB 4KG2A 3LY3A 4S2NA 1P9WA 5KSCA 5FQIA 4G3KA 3VOZA 2H5SA 3T4TA 4CJNA 2K2NA 3AGEA 5HDCA 3FG8A 1H0MA 3N8LA 3TJZC 4GN2A 2RL3A 3H82A 5AQAA 3VSLA 3IX4A 3ZG7B 3F1OA 2O9AA 4NETA 2VZWA 1VHMA 4FH2A 4OQ0A 3Q1FA 1L3LA 2G2WA 4Y7PA 1FR6A 3BFEA 3WS5A 3UDXA 4CLCD 4PHTA 5F1FA 2H10A 3HJKA 3VE4A 1JWPA 1G6OA 4LV3A 2HP9A 4PM9A 3BEBA 2WGIA 2Z2LB 4Y15A 5G4YA 5FASA 4OP8A 4FSFA 4S2IA 2ZL1B 2W27A 1NLZA 2BASA 3VOLA 1SKFA 1PYYA 3DTEA 3A0VA 3GECA 3HLBA 4FCFA 4JXWA 1XGJA 2PBYA 2OSUA 5AVEA 3O87A 3C7VA 4S2NC 3M6HA 4R3AA 2BTFP 4L9EA 3CPTA 2Y2MA 1YKDA 1JWVA 2NUPC 4KG6A 4JKTA 2OAQ1 1IELA 3IF6B 4RYEA 2JE5A 1VETA 1NLYA 5A93A 3F1PA 3IH9A 1FSWA 4ZDXA 3EQUA 2V20A 2O9BA 4IHQA 4UEYA 4I3IA 3ITBA 1DJAA 1JTDA 3GMWA 5HWTA 3S7QA 4Y17A 4OKPA 2WKIA 3C4OA 5G18A 1CEFA 3OPHA 3E4OA 3EGXC 1OTIA 1O7EA 5HWVA 1T19A 3NIAA 2UV0E 3Q7ZA 1N9NA 2VV8A 1XA1A 5FL3A 2VV7A 2A3UA 3H9WA 3PYPA 4RX2A 2Q9MA 1NJ4A 1ACFA 4IJGA 4HESA 2VV6A 2K31A 3UB9A 1TS8A 1XJ2A 3VP2A 4NXFA 5CRFA 3L9KA 1LI0A
chains in the Genus database with same CATH topology
1TS6A 2PT7A 3LIBA 3BY9A 5DFXA 4WF0A 2KLIA 3H7WA 2HV1A 1TD5A 1UWNX 4P6ZS 3LR0A 3T4LA 5F5YA 2B18A 2J3TC 2VGLM 5C5KA 2LB9A 2XRNA 3OC2A 1V9ZA 3LR4A 3FPWA 3R4KA 2XA7S 3PBOA 3NHQA 1IOUA 3T50A 2QYBA 4BMWA 4M4XA 1DRMA 3O5YA 4L0LA 4GS9B 3OCLA 1TS7A 2QJ7A 1T1CA 4ETZA 4MN6A 3CAXA 5AVFA 4CLCE 1GSVA 2OWJA 1OTDA 3MF0A 5EFWA 3C2WA 3PBQA 1DP9A 4KQOA 2VEAA 2QJ5A 1H3QA 3TW8A 2K7SA 3CWFA 4G3VA 3E0YA 3FPVA 2L4RA 2GJ3A 4H6JB 2A24B 3MQQA 4BBTA 5HSQA 4K08A 4EU0A 3LR3A 3E4QA 3LR5A 1OT6A 3S7OA 3OCNA 3LIDA 4II7A 3UE3A 1D7EA 5A8BA 3EQVA 2Z6DA 3PBTA 3BQAA 4E04A 3UMEA 1P0ZA 2V9AA 4WEKA 4LRZE 5L8MA 3OBFA 3LYXA 4WUJA 3KYZA 3T4SA 5HWWA 2PYPA 4GLQA 4CLCC 4NKPA 4MN5A 2D02A 4KUOA 4CLCB 3SW1A 3LIAA 3K2NA 1NRJA 2PD8A 5IS1A 2EWWA 4GS9A 5DF9A 4GW9A 3BWLA 2QWSA 4NXGA 3MQ0A 3PBNA 4Q0HA 4I3AA 3LI8A 1XJ6A 4Y2FA 3IBRA 4I3JA 3MJQA 2B02A 2P7JA 2JKRI 4F3LB 5DFYA 1BYWA 5HD5A 4EERA 3LI9A 1LL8A 3K3DA 3C8CA 5K5BA 1OTEA 1F98A 1DP6A 5HDDA 2KOIA 3CITA 1T1BA 3PR6A 2A24A 4NXEA 2OWHA 4HNBA 1WA9A 4Z1WA 3B33A 4MDZA 5IU1A 4DJ3A 2IA2A 3MMHA 4I38A 2EA9A 3U2AA 1LSXA 2V1AA 4UQIM 4R6LA 3MFXA 5TBMB 3BW6A 4HJ3A 3UMDA 5TJJA 4GCZA 3LIEA 2V1BA 2J3WA 2NUTC 4L9FA 4NEED 4B9OA 3P01A 4HH2A 4CLCA 4LRXC 1S4RA 1OTBA 5AJGA 2H28A 5J7EA 2PHYA 3CLOA 3PHYA 2J80A 3JVUA 4HY8A 1YSQA 4WEJA 2O0YA 1MZUA 2WKRA 4MMNA 4DMZA 4XT2A 3KSIA 4F3LA 3VV4A 1JNUA 2KDKA 3C38A 3DBAA 4I5SA 3NOPC 4BBUA 3A0SA 4HIAA 3MR0A 3T4KA 2G7UA 3VE3A 4ZRRA 1LSVA 3B47A 3ICYA 4EQ1A 4PKYA 2JN7A 1MKMA 4HJ4A 2PR6A 4EUVA 3W2ZA 2FH5A 2MJ6A 4BBVA 3LIFA 1STZA 1GSXA 3K3CA 5DJTA 5TBMA 2W3FA 3RFBA 3EOIA 3BY8A 4ETXA 1TS0A 3IS2B 3F1PB 1IFQA 2Y79A 4YWZA 3R7WA 2HJEA 2KX6A 3TE8A 5J4EA 2W3DA 2HF6A 3NOUC 4IUKA 3ULFA 5LBRA 3T4JA 4GJ4A 2OOLA 4NXBA 3MQOA 2JHEA 2W3EA 5DKKA 3GDIA 2VLGA 3HCYA 4O0PA 1VB6A 1V9YA 1S66L 4BJPA 4PKYG 4QPRA 2GZAA 1EW0A 3B42A 1ZHHB 2VJWA 3BQ8A 1T18A 5CX7A 2W3GA 2A2LA 2VGLS 5F6AA 5HPFA 3NOTC 4HQAA 4LPZA 5DKLA 4OOLA 4PAUA 1DP8A 2OAP1 4HH3A 3KYQA 2V0WA 3IBJA 3UB8A 1F9IA 3UB7A 3NJAA 1XJ3A 2W1RA 1H8MA 3G6OA 1OT9A 4R38A 3D3OA 4ME4A 4GHIB 4LRYC 5G4ZA 4WELA 3ZQ5A 3EEHA 1N9OA 4EW7A 2D01A 1OJGA 4WLAA 5KIZA 1UGUA 4P6ZM 1TF1A 3PXPA 4H6JA 1Y28A 4IUHA 1MC0A 2JKTM 2L0WA 1UWPX 3S7PA 3IS2A 1P97A 2XA7M 3JVVA 3H82B 2V0UA 3F1OB 2LB5A 3A0RA 4EEUA 4HJ6A 4MCWA 2W1TB 4O8GA 3CUEA 2GNXA 2W0NA 4KUKA 4Y5FA 4CQHA 3C30A 2J3TD 2QKPA 4WN5A 1S4SA 5J3WA 1XJ4A 4HP9A 4EESA 3T4OA 2ZOIA 3V67A 4FOFA 2WKQA 4JGQA 1XFNA 1S67L 3T4QA 4R70A 3HJIA 1P9WA 4G3WA 4GHIA 4G3KA 5HPIA 3T4TA 2K2NA 4B93A 5HDCA 3FG8A 4AFIA 1W63M 3EEAA 3FC7A 2YKHA 3KX0X 4JGRA 4RQ9A 3UB6A 3PBSA 3F1NB 3TJZC 5IT5A 4YOFA 3EWKA 3ZYTA 3H82A 5MC7A 3F1OA 3D72A 2O9AA 2Z6CA 2VZWA 2W1TA 5KSHA 1VHMA 2PD7A 5HD3A 4I39A 4ARZB 1X0OA 4UQIS 4WL9A 1S1ZA 2QHKA 1YSPA 2PR5A 4CLCD 2XROA 4PHTA 2INWA 3CUEC 5I5LA 3HJKA 2ZBBA 3BJNA 3VE4A 5DJUA 4L9GA 4LLOB 1G6OA 3E4PA 1GSWA 4JGPA 2I9VA 4OOMA 1LT0A 5G4YA 3UE6A 1F5MA 4FSFA 2M1CA 2W27A 4O01A 1LSWA 1NLZA 1OTAA 2BASA 5HZHA 3S7NA 3VOLA 1YAXA 2ZMVA 2Y8HA 2PDRA 1D06A 3A0VA 3GECA 2CMNA 3OOVA 3CI6A 2GX5A 1ZTUA 2DMWA 2O9CA 1W63Q 4HOIA 5AVEA 4DJ2A 2P04A 3PBRA 1S1YA 2WKPA 4R3AA 3F1NA 3KSHA 4L9EA 2O99A 1YKDA 3LUQA 2NUPC 2P08A 4KQDA 2OAQ1 4Y3IA 2YKFA 1T1AA 5HL6A 2PYRA 4Q0JA 2HGVA 2ZOHA 2JKRM 2W3HA 4ARZA 2L1MA 1NLYA 3TRCA 5F68A 4BWIA 4MN7A 3H7WB 3LFVA 4HHDA 3F1PA 2HJ9C 4DN0A 5HDSA 4EETB 3P7NA 1N9LA 3EQUA 1P9RA 2XSSA 1XFQA 2M7VA 2O9BA 4IHQA 4UEYA 1OPXA 4I3IA 2VX8A 4XT2B 2M7UA 2JKTI 4YNRA 5HWTA 4HP4A 3RTYA 3S7QA 4Q0IA 3E98A 4JGOA 3RH8B 3MXQA 5F69A 3E4OA 3EGXC 2VA0A 1OTIA 3OLOA 3LICA 5HWVA 1T19A 3KSGA 1N9NA 2VV8A 4HI4A 3EGDC 2R78A 2FZ0A 1NWZA 5FL3A 4EEPA 2VV7A 3KSFA 3H9WA 3PYPA 2EWVA 1OJ5A 4IJGA 1ODVA 2VV6A 1KOUA 2K31A 2ZMFA 3UB9A 3R7WB 1TS8A 3KO6A 4EXOA 2VKSA 1G28A 1XJ2A 4NXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS6 A;  3LIB A;  3BY9 A;  4WF0 A;  3H7W A;  2HV1 A;  1UWN X;  5F5Y A;  1V9Z A;  3NHQ A;  3T50 A;  4M4X A;  1DRM A;  4GS9 B;  1TS7 A;  2QJ7 A;  1T1C A;  4MN6 A;  3CAX A;  5AVF A;  1GSV A;  2OWJ A;  1OTD A;  5EFW A;  3C2W A;  1DP9 A;  2VEA A;  2QJ5 A;  2K7S A;  3CWF A;  2L4R A;  2GJ3 A;  4H6J B;  2A24 B;  3MQQ A;  4BBT A;  5HSQ A;  4K08 A;  3E4Q A;  1OT6 A;  3LID A;  1D7E A;  5A8B A;  2Z6D A;  4E04 A;  3UME A;  1P0Z A;  2V9A A;  4LRZ E;  3LYX A;  4WUJ A;  5HWW A;  2PYP A;  4MN5 A;  2D02 A;  4KUO A;  3SW1 A;  3LIA A;  5IS1 A;  2PD8 A;  4GS9 A;  4GW9 A;  3BWL A;  2QWS A;  4NXG A;  4I3A A;  3LI8 A;  1XJ6 A;  3IBR A;  4I3J A;  3MJQ A;  2B02 A;  2P7J A;  4F3L B;  1BYW A;  5HD5 A;  4EER A;  3LI9 A;  1LL8 A;  3K3D A;  3C8C A;  1OTE A;  1F98 A;  1DP6 A;  5HDD A;  1T1B A;  4NXE A;  2A24 A;  2OWH A;  4HNB A;  1WA9 A;  4DJ3 A;  3B33 A;  5IU1 A;  4I38 A;  2EA9 A;  1LSX A;  2V1A A;  4R6L A;  3MFX A;  5TBM B;  4HJ3 A;  3UMD A;  4GCZ A;  3LIE A;  2V1B A;  4L9F A;  4B9O A;  4HH2 A;  4LRX C;  1S4R A;  1OTB A;  2H28 A;  5J7E A;  2PHY A;  3CLO A;  3PHY A;  2J80 A;  4HY8 A;  1MZU A;  2WKR A;  4XT2 A;  4F3L A;  1JNU A;  2KDK A;  4I5S A;  3NOP C;  4BBU A;  3A0S A;  4HIA A;  3MR0 A;  3VE3 A;  1LSV A;  3ICY A;  4EQ1 A;  4PKY A;  2JN7 A;  4HJ4 A;  2PR6 A;  4BBV A;  3LIF A;  1GSX A;  3K3C A;  5DJT A;  5TBM A;  3BY8 A;  1TS0 A;  3IS2 B;  3F1P B;  4YWZ A;  2KX6 A;  5J4E A;  3NOU C;  3ULF A;  2OOL A;  4NXB A;  3MQO A;  2JHE A;  5DKK A;  2VLG A;  3GDI A;  1VB6 A;  1V9Y A;  1S66 L;  4PKY G;  1EW0 A;  1T18 A;  5F6A A;  3NOT C;  4HQA A;  4LPZ A;  5DKL A;  1DP8 A;  4HH3 A;  2V0W A;  3UB8 A;  1F9I A;  3UB7 A;  3NJA A;  1XJ3 A;  3G6O A;  1OT9 A;  4R38 A;  4GHI B;  4LRY C;  5G4Z A;  3ZQ5 A;  3EEH A;  1N9O A;  4EW7 A;  2D01 A;  1OJG A;  4WLA A;  5KIZ A;  1UGU A;  4H6J A;  1Y28 A;  2L0W A;  1UWP X;  3IS2 A;  1P97 A;  3H82 B;  2V0U A;  3F1O B;  3A0R A;  4EEU A;  4HJ6 A;  2W0N A;  4KUK A;  2QKP A;  4WN5 A;  1S4S A;  5J3W A;  1XJ4 A;  4HP9 A;  4EES A;  2ZOI A;  2WKQ A;  4JGQ A;  1XFN A;  1S67 L;  4R70 A;  3HJI A;  4GHI A;  5HDC A;  3FG8 A;  3FC7 A;  2YKH A;  3KX0 X;  4JGR A;  4RQ9 A;  3UB6 A;  3F1N B;  3EWK A;  3H82 A;  3F1O A;  3D72 A;  2Z6C A;  2PD7 A;  5HD3 A;  4I39 A;  1X0O A;  4WL9 A;  1S1Z A;  2QHK A;  2PR5 A;  2INW A;  5I5L A;  3HJK A;  2ZBB A;  3VE4 A;  5DJU A;  4L9G A;  4LLO B;  3E4P A;  1GSW A;  4JGP A;  2I9V A;  1LT0 A;  5G4Y A;  3UE6 A;  2M1C A;  2W27 A;  1LSW A;  2BAS A;  1OTA A;  5HZH A;  3VOL A;  3A0V A;  2PDR A;  1D06 A;  3GEC A;  2CMN A;  4HOI A;  5AVE A;  4DJ2 A;  1S1Y A;  2WKP A;  4R3A A;  3F1N A;  4L9E A;  3LUQ A;  4KQD A;  2YKF A;  1T1A A;  2PYR A;  2ZOH A;  2L1M A;  5F68 A;  3H7W B;  4HHD A;  3F1P A;  5HDS A;  4EET B;  3P7N A;  1N9L A;  1XFQ A;  4I3I A;  4XT2 B;  5HWT A;  4HP4 A;  3RTY A;  4JGO A;  3RH8 B;  3MXQ A;  5F69 A;  3E4O A;  1OTI A;  3OLO A;  3LIC A;  5HWV A;  1T19 A;  1N9N A;  2VV8 A;  4HI4 A;  2R78 A;  1NWZ A;  4EEP A;  2VV7 A;  3H9W A;  3PYP A;  1OJ5 A;  1ODV A;  2VV6 A;  1KOU A;  3UB9 A;  1TS8 A;  4EXO A;  1G28 A;  1XJ2 A;  4NXF A; 
#chains in the Genus database with same CATH topology
 3ZFZ A;  2XFT A;  3BLS A;  4WF0 A;  5FQ9 A;  3H7W A;  3LR0 A;  4MLL A;  2LB9 A;  4N9K A;  2IWB A;  5A90 A;  3R4K A;  3FPW A;  4YIN A;  5A91 A;  4WYY A;  3T50 A;  4WZ5 A;  4M4X A;  3O5Y A;  1BLH A;  4MN6 A;  4HEF A;  3CAX A;  4GOG A;  5EFW A;  4X53 A;  3C2W A;  3UN7 A;  3RJU A;  2BLS A;  3HLD A;  4X6T A;  4KQO A;  2Y2Q A;  3E0Y A;  3QP1 A;  5E2F A;  1K57 A;  4MBF A;  3S7O A;  2FFF B;  1MXO A;  1HD8 A;  3BQA A;  3Q82 A;  1SDN A;  1ZKJ A;  3UME A;  3QNB A;  2V9A A;  2EFX A;  4WEK A;  3ZG5 A;  3IXB A;  1JWZ A;  2Y4A A;  3OBF A;  3BEC A;  3LYX A;  3G2Y A;  2P74 A;  5HWW A;  3DTI A;  4NKP A;  3BLM A;  2FFY A;  2D02 A;  4KUO A;  4N92 A;  4CLC B;  1SZV A;  1NRJ A;  5BOH A;  1Y54 A;  4GS9 A;  4QY5 A;  2VGK A;  1HZO A;  1FQG A;  1XJ6 A;  2C5W B;  4C6Y A;  4I3J A;  1BT5 A;  2P7J A;  4WZ5 C;  3V50 A;  4F3L B;  1TVF A;  3HLE A;  3JYI A;  4QU3 A;  5E43 A;  3U4L P;  1CF0 A;  5K5B A;  1F98 A;  5HDD A;  1T1B A;  3VSK A;  1ERM A;  1WA9 A;  5HAP A;  3B33 A;  3MMH A;  5CER A;  2EA9 A;  5GLD A;  3N8S A;  5EV0 A;  3ZGA B;  2WZZ A;  4UQI M;  3MFX A;  5TBM B;  1K57 C;  4BLM A;  3IF5 A;  5CHM A;  3N7W A;  2PU2 A;  3GVB A;  1K6S A;  5EEC A;  3BYD A;  4L9F A;  3MBZ A;  4B9O A;  1ES4 A;  1BLS A;  4LRX C;  5HX9 A;  3IX3 A;  3CLO A;  1F2K A;  4JBF A;  3VP1 A;  3OZH A;  1QME A;  1CJF A;  3PHY A;  2J80 A;  3WS2 A;  2X01 A;  4WEJ A;  5FI2 A;  4E6W A;  1MZU A;  1PW8 A;  3OPP A;  3M2J A;  3TG9 A;  4PMA A;  1JNU A;  3VV4 A;  2KDK A;  3SH8 A;  4BBU A;  3BFF A;  3VE3 A;  3ICY A;  2JN7 A;  1EWZ A;  2MJ6 A;  4EBP A;  3DTK A;  3NDE A;  2WAF A;  4H8R A;  4QHC A;  1FCO A;  3WRT A;  1Q2Q A;  4LV1 A;  1IFQ A;  3VMA A;  4YWZ A;  2W3D A;  2HF6 A;  1YQS A;  4GJ4 A;  4KQR A;  4NXB A;  5HFO A;  2XF3 A;  2PRF A;  2JHE A;  2W3E A;  3D4F A;  4LEN A;  5DKK A;  2VLG A;  1VB6 A;  1IYQ A;  1PRQ A;  5HAQ A;  4X1M A;  1ZHH B;  4E6X A;  2A2L A;  2VGL S;  5HPF A;  1NZO A;  4GDN A;  1S6R A;  3NOT C;  2P9V A;  4OOL A;  4PAU A;  4R4R A;  2XGN A;  1H8M A;  3G6O A;  4S2M A;  3D3O A;  4ME4 A;  4KG5 A;  1FSY A;  5D3O A;  2D01 A;  1OJG A;  5KIZ A;  1UGU A;  4P6Z M;  1MC0 A;  4FH4 A;  3PAE A;  3S7P A;  1M6K A;  2XA7 M;  2R9X A;  3H82 B;  3F1O B;  2B95 A;  4EEU A;  4HJ6 A;  3UB5 P;  3FYZ A;  2V2F F;  1KDS A;  2XQZ A;  5EVL A;  4JF4 A;  3C30 A;  5EUA A;  2J3T D;  2QKP A;  4WN5 A;  3W4Q A;  3QP5 A;  1YM1 A;  5TFQ A;  4HP9 A;  4EBL A;  1PZP A;  5EOE A;  5EM0 A;  1S0W A;  1VQQ A;  4KZ8 A;  1GA9 A;  4FD8 A;  2V1Z A;  1XFN A;  4R70 A;  3HJI A;  3NCK A;  5FI7 A;  4G3W A;  4GHI A;  2ACG A;  3OPL A;  2XD5 A;  4KZ3 A;  3T1S A;  3HUO A;  1W63 M;  2XLN A;  3EEA A;  2YKH A;  5GHZ A;  1K38 A;  3DWK A;  3GTC A;  4O7D A;  5IT5 A;  3CPT B;  3TSG A;  3N6I A;  3ZYT A;  5MC7 A;  4FTX A;  4S2P A;  3MFD A;  1VET B;  1X0O A;  2EX2 A;  4DXC A;  1YSP A;  1PW1 A;  3HL9 A;  4D2O A;  3BJN A;  4B4X A;  5DJU A;  4L9G A;  4LLO B;  4GZB A;  3E4P A;  5HAI A;  4DXB A;  2I9V A;  2Q9N A;  4P87 A;  2XK1 A;  4O01 A;  4E3M A;  1OTA A;  3S7N A;  3G35 A;  4OQI A;  1Y4O A;  3SZT A;  1LL5 A;  5JYP A;  2Y8H A;  2EXB A;  2CMN A;  4YFM A;  4S2L A;  1CK3 A;  4HOI A;  2PBD P;  3PBR A;  4C3Q A;  4Y13 A;  1MWS A;  3F1N A;  3GR2 A;  5FDS A;  3LUQ A;  4EBN A;  2YKF A;  1K56 A;  3GV9 A;  4U0X A;  4ARZ A;  2L1M A;  5F68 A;  4MN7 A;  3H7W B;  4Y0U A;  4DN0 A;  3MKF A;  4EET B;  2HPB A;  3P7N A;  5DTS A;  2J9O A;  1XFQ A;  2M7V A;  1K4F A;  4IBR A;  3E2L A;  2JKT I;  1SCW A;  3GRJ A;  4YNR A;  4HP4 A;  2XH9 A;  5F69 A;  2ZQC A;  2VA0 A;  1ESU A;  3KSG A;  4P85 A;  3HLG A;  3FV7 A;  4KZ5 A;  4N1H A;  2FZ0 A;  2Y2G A;  3KSF A;  1MY8 A;  3CMZ A;  3SOI A;  4JPM A;  3SS3 A;  3R7W B;  5EVI C;  4EXO A;  3S4X A;  3P09 A;  1YLY A;  1ONH A;  1EI5 A;  2H0T A;  3BY9 A;  5DFX A;  2KLI A;  3BRM A;  2HV1 A;  2XD1 A;  2BG1 A;  1ZC2 A;  3OC2 A;  3ZG9 B;  3LR4 A;  3CG5 A;  3MSH A;  3PBO A;  2QYB A;  2CC1 A;  5AQ7 A;  4CPK A;  3CHW P;  4GS9 B;  1TS7 A;  1GHM A;  3WWX A;  1T1C A;  1KDW A;  1PFL A;  5AVF A;  3M2K A;  2Y2L A;  4K0W A;  1OTD A;  3MF0 A;  3GQZ A;  3PBQ A;  3VP0 A;  3TW8 A;  4NK3 A;  2IWC A;  4H6J B;  3MQQ A;  1CI9 A;  3UDF A;  3LR5 A;  4FUW A;  4BL2 A;  4II7 A;  3UE3 A;  1KGF A;  1D7E A;  2JC7 A;  5F1G A;  4BD0 A;  1PI4 A;  4GLQ A;  4MN5 A;  4E3J A;  1BZA A;  3LIA A;  2UWX A;  2PD8 A;  3UPP A;  2Y2K A;  4NXG A;  3MQ0 A;  4KQQ A;  4Q0H A;  4JXV A;  4RA7 A;  4XUX A;  2WAE A;  5CTN A;  2B02 A;  2JKR I;  4KZ4 A;  1E3U D;  1IEM A;  2ZQA A;  3DWZ A;  5CGS A;  4EER A;  4R3J A;  2J7V A;  1LL8 A;  3LI9 A;  5CGW A;  4NXE A;  2A24 A;  4DJ3 A;  4Z1W A;  5IU1 A;  2IA2 A;  1KGE A;  1LSX A;  3CZD A;  5GLB A;  4R6L A;  2QPN A;  4GKU A;  3SH9 A;  4WBG A;  5FEF A;  3BW6 A;  4OP5 A;  3IXD A;  4HJ3 A;  3UMD A;  4K91 A;  4R4S A;  5GHX A;  2J3W A;  1K56 D;  4DE3 A;  4Y0T A;  4KZ6 A;  3P01 A;  4HH2 A;  1W7F A;  4HBT A;  1OTB A;  3ZNT A;  2ZC7 A;  2PHY A;  1TDL A;  1ES5 A;  3UE1 A;  3MZE A;  3JVU A;  4QWO A;  2O0Y A;  2XFS A;  3UPN A;  5FSR A;  2WKH A;  4MMN A;  4DMZ A;  4IVI A;  2ZQ7 A;  3WRZ A;  2P9V B;  3DBA A;  4LV2 A;  4HIA A;  2PAV P;  3MXR A;  4ZRR A;  1LSV A;  3B47 A;  4EQ1 A;  1MKM A;  1I5Q A;  2FH5 A;  4BBV A;  1STZ A;  3ZHH A;  1KVM A;  3QP8 A;  3IT9 A;  3EOI A;  3BY8 A;  4ETX A;  3DW0 A;  3R7W A;  4R1G A;  2HJE A;  1A0K A;  5EVE A;  3TE8 A;  1RGY A;  5LBR A;  3VP4 A;  3IQA A;  3PAG A;  3V3R A;  1S66 L;  4BJP A;  5EM1 A;  4KZ7 A;  4E3I A;  4QPR A;  4EV4 A;  2V8F A;  2QMI A;  1T18 A;  3BQ8 A;  5CX7 A;  5F6A A;  5U47 A;  3NUL A;  3NI9 A;  2OV5 A;  3FKW A;  4LPZ A;  4QY6 A;  4R0Q A;  3S22 A;  1DP8 A;  2HP5 A;  3MZD A;  5E2H A;  1NY0 A;  4GHI B;  5G4Z A;  4WEL A;  3ZQ5 A;  3I7J A;  3EEH A;  1I2S A;  3JPU A;  4UA9 A;  4WLA A;  3A3E A;  5DF8 A;  4IUH A;  1IYS A;  4H6J A;  2JKT M;  1UWP X;  2E8I A;  2VK3 A;  4U3T A;  3IS2 A;  2V0U A;  2LB5 A;  4MCW A;  4O8G A;  3IWO A;  3CUE A;  3HLW A;  1K55 A;  1MWU A;  2GNX A;  1CI8 A;  2W0N A;  5EOO A;  3DTM A;  1S4S A;  1XJ4 A;  2DCF A;  4R23 A;  5FQM A;  1BUL A;  3T4O A;  2J8Y A;  1J3W A;  3C4P A;  1SDE A;  1G68 A;  4KZB A;  3T12 B;  3MKE A;  4QB8 A;  3CJM A;  3T4Q A;  2VGJ A;  5M19 A;  3QP4 A;  5HPI A;  4K0X A;  4AFI A;  4JLF A;  1LI9 A;  3LO7 A;  3KX0 X;  4JGR A;  4RQ9 A;  3UB6 A;  4MNR A;  3F1N B;  2C6W B;  3D72 A;  3QP2 A;  2Z6C A;  2W1T A;  3NC8 A;  2PD7 A;  4E3N A;  5HD3 A;  5FQJ A;  4I39 A;  4ARZ B;  2HDU A;  4Z9Q A;  2PR5 A;  2XRO A;  2INW A;  1WYC A;  3CUE C;  2ZC4 B;  1K55 C;  4OVD A;  2E8J A;  4JGP A;  4UA6 A;  5A92 A;  5FA7 A;  4OOM A;  1LT0 A;  3UE6 A;  1LSW A;  3Q7V A;  2WK0 A;  1MBL A;  3T1Q B;  2PDR A;  1D06 A;  3V3S A;  3CI6 A;  4DF6 A;  2GX5 A;  4OLD A;  1ZTU A;  5CGX A;  1L0D A;  3O88 A;  2XR0 A;  4XXR A;  1HTZ A;  1S1Y A;  2WKP A;  2Y2P A;  3KSH A;  2O99 A;  3IF6 C;  5CTM A;  2P08 A;  4KQD A;  2JCH A;  2ZC3 B;  4Y3I A;  1LLB A;  3O3V A;  4NG2 A;  2HGV A;  2JKR M;  1PWG A;  1YT4 A;  5GHY A;  3TRC A;  4BWI A;  5DF7 A;  4HHD A;  1J9M A;  2HJ9 C;  2J9P A;  4A5R A;  1NRF A;  2XSS A;  4DKI A;  1OPX A;  2I72 A;  2VX8 A;  4XT2 B;  2WGV A;  3C7U A;  2EX6 A;  3RTY A;  5AQB A;  4E3L A;  2XDM A;  2EX9 A;  5FAO A;  2ZJ9 A;  3RH8 B;  3MXQ A;  3OLO A;  3LIC A;  1ONG A;  4PPR A;  4HI4 A;  1NWZ A;  1YLZ A;  4GD8 A;  1ZG4 A;  1NYY A;  2EWV A;  3B3X A;  1RGZ A;  3VFH A;  4OON A;  4JXS A;  1ODV A;  5GL9 A;  3T1R A;  3KO6 A;  5CEB A;  1G28 A;  2DRW A;  3IX8 A;  3UPO A;  1TS6 A;  2PT7 A;  3FZC A;  5AQ9 A;  4WZ4 A;  1TD5 A;  1UWN X;  2B18 A;  2VGL M;  2XRN A;  2HDQ A;  1VEU B;  3NHQ A;  4P6B A;  1IYO A;  4PM5 A;  1DRM A;  3OCL A;  1L0G A;  2QJ7 A;  2A49 A;  1G5U A;  1GSV A;  1FCN A;  1PZO A;  2K7S A;  1FCM A;  3FPV A;  2L4R A;  2GJ3 A;  5GLA A;  3HLC A;  2A24 B;  1ERO A;  3FKV A;  4BBT A;  3AGF A;  3G32 A;  5HSQ A;  4EU0 A;  2JBF A;  5KZH A;  3LR3 A;  4LGW A;  1KE0 A;  1XPB A;  3E4Q A;  5L10 A;  4B88 A;  2EX8 A;  3LID A;  1XP4 A;  1AWI A;  1K54 C;  5EVI A;  2Z6D A;  5DVA A;  2DNS A;  2ZM8 A;  4GDB A;  4WUJ A;  3G34 A;  3KYZ A;  3T4S A;  3BM6 A;  3G31 A;  2PYP A;  4CLC C;  3QNC A;  1CQA A;  2JKF A;  3O86 A;  3M6B A;  4U0T A;  2EWW A;  1KGG A;  4PM6 A;  5DF9 A;  4GW9 A;  3BWL A;  2QWS A;  3PBN A;  1DJC A;  4Y2F A;  3IBR A;  1LL9 A;  3WS1 A;  3MJQ A;  1ZG6 A;  5HD5 A;  2H0Y A;  2V8C A;  4QD4 A;  3K3D A;  3C8C A;  4MEZ A;  1OTE A;  1SHV A;  4OQH A;  1DP6 A;  3CIT A;  2Y2J A;  3UY6 A;  3PR6 A;  4BD1 A;  4MDZ A;  4I38 A;  4EUZ A;  5EPH A;  1YLW A;  2X02 A;  3W8K A;  2HZ5 A;  5F82 A;  3UNW A;  3ISG A;  5TJJ A;  3LIE A;  1O07 A;  2NUT C;  2WYX A;  1S4R A;  1PIO A;  5CHJ A;  4HY8 A;  1YSQ A;  4X25 A;  3MS6 A;  1K0K A;  4KZ9 A;  1WE4 A;  4M3K A;  2G2U A;  4XT2 A;  3KSI A;  1FIL A;  3C38 A;  3NOP C;  5DTK A;  4EQI A;  3A0S A;  1NZU A;  3D9Y A;  4ZTK A;  1AXB A;  5L2F A;  4OH0 A;  3ZG0 A;  4HJ4 A;  3BFC A;  4EUV A;  3LIF A;  3K3C A;  5DJT A;  2W3F A;  1Q2P A;  1CEG A;  4DDS A;  2ZC5 B;  3FWL A;  3IS2 B;  4ZAM A;  2Y79 A;  3NY4 A;  5J4E A;  2Q0O A;  3T4J A;  3MQO A;  3OPR A;  4IED A;  1BLC A;  1K25 A;  1V9Y A;  1E25 A;  2Y2H A;  1MWT A;  2GZA A;  1EW0 A;  3IHA A;  3B42 A;  2W3G A;  1VEU A;  1GCE A;  4Y0O A;  2RCX A;  3HRE A;  4HQA A;  5DKL A;  2AVX A;  3HLF A;  1C3B A;  1W8Y A;  2OAP 1;  4ZJ1 A;  1XX2 A;  2V0W A;  3IBJ A;  3UB8 A;  3NJA A;  5DTT A;  1XJ3 A;  4F94 A;  2W1R A;  1OT9 A;  1YLT A;  3V5M A;  1YMX A;  1G6A A;  2ZM2 A;  2ZQ9 A;  3PXP A;  3SS5 A;  1Y28 A;  1FOF A;  2ZM0 A;  5EVI D;  1P97 A;  1K6R A;  3G2Z A;  2ZMA A;  2W1T B;  1HLU P;  1H8Y A;  4Y5F A;  3KYE A;  4CQH A;  3ZG8 B;  2XEP A;  4WMC A;  3SS4 A;  1HVB A;  1OME A;  1W5D A;  3L7H A;  1Z6F A;  4EES A;  1FIK A;  5KMW A;  2GDN A;  2Y91 A;  3V67 A;  2Y59 A;  4X1L A;  2B5R A;  4LV0 A;  3MXS A;  1W8Q A;  3Q7V B;  1ES3 A;  1S67 L;  3LCE A;  4PM8 A;  4WM9 A;  1YLP A;  4DE0 A;  2EFU A;  4B93 A;  1VM1 A;  3FC7 A;  5FAT A;  4E3K A;  4LCL A;  3PBS A;  4YOF A;  3G4P A;  5FQK A;  1SKO B;  3N4I A;  3EWK A;  5CED A;  3GSG A;  5KSH A;  4PM7 A;  4BQM A;  4BL3 A;  2Y2O A;  4UQI S;  4WL9 A;  5J8X A;  3NBL A;  5E2E A;  1S1Z A;  2QHK A;  1BTL A;  1RP5 A;  3WS0 A;  5I5L A;  2ZBB A;  5EE8 A;  1GSW A;  3ZNY A;  1YLJ A;  2JKG A;  1F5M A;  2M1C A;  4KEN B;  5HZH A;  2WGW A;  1YAX A;  2ZMV A;  1GA0 A;  2ZLY A;  4MBH A;  1TDG A;  3OOV A;  5HAR A;  1N9B A;  1N4O A;  2DMW A;  2O9C A;  1W63 Q;  4OLG A;  3VP3 A;  5I94 A;  4DJ2 A;  4LFU A;  2P04 A;  3Q81 A;  5TGF A;  1IKG A;  1XA7 A;  2Y2N A;  2ZD8 A;  3DAV A;  4ZBE A;  3BFD A;  3WS4 A;  1T1A A;  3IWI A;  2Z2M B;  5HL6 A;  2PYR A;  4Q0J A;  2ZOH A;  2W3H A;  2ZQD A;  3IXH A;  4QJG A;  3LFV A;  3A3F A;  1RCJ A;  4EWF A;  3HVF A;  5HDS A;  1N9L A;  1P9R A;  3UDI A;  4ZJ3 A;  2M7U A;  3TOI A;  4X55 A;  1XXM A;  5CHU A;  4Q0I A;  3E98 A;  4Q8I A;  2ZL1 A;  4E3O A;  4JGO A;  3VFF A;  5FQQ A;  1KVL A;  3EGD C;  2R78 A;  4EEP A;  1PWD A;  1IKI A;  4D60 A;  1OJ5 A;  1TEM A;  4JF6 A;  4OPZ A;  1KOU A;  2ZMF A;  1YMS A;  2WUQ A;  3UE0 A;  4OPQ A;  1K4E A;  2VKS A;  1KE3 A;  5EVI B;  4LCM A;  3IF6 A;  5FAP A;  3IH8 A;  3LIB A;  1L2S A;  1L0F A;  5M1A A;  1Z09 A;  3Q07 A;  4P6Z S;  3T4L A;  4IVK A;  5F5Y A;  2J3T C;  5C5K A;  1QMF A;  1WYB A;  2OLV A;  3W4O A;  5CEC A;  1V9Z A;  3C5A A;  2XA7 S;  1IOU A;  4WMC D;  3LEZ A;  4BMW A;  3PTE A;  1NYM A;  4L0L A;  5JYO A;  1L0E A;  2QZ6 A;  4ETZ A;  4CLC E;  2OWJ A;  4N9L A;  3LY4 A;  1DP9 A;  2VEA A;  2QJ5 A;  2ZQ8 A;  1DJB A;  1KE4 A;  1H3Q A;  3IHB A;  3CWF A;  4G3V A;  4OOY A;  3SH7 A;  2OLU A;  4K08 A;  3HBR A;  5TR7 A;  1OT6 A;  3OCN A;  4ESP A;  4DE1 A;  5A8B A;  5L09 A;  3EQV A;  3PBT A;  4E04 A;  1JVJ A;  1P0Z A;  3UO9 A;  4LRZ E;  5L8M A;  3HUM A;  1MKI A;  1SKO A;  4C75 A;  1ALQ A;  3S1Y A;  3SW1 A;  3K2N A;  5IS1 A;  5FEG A;  5F83 A;  3QP6 A;  5FAQ A;  1PNE A;  4I3A A;  3LI8 A;  3BFG A;  1LHY A;  1NXY A;  5DFY A;  1BUE A;  1BYW A;  1BLP A;  3T1X A;  2X71 A;  4UA7 A;  2Y2I A;  4OPY A;  4KZA A;  2KOI A;  4X68 A;  2OWH A;  4HNB A;  2HP6 A;  3LGO A;  1M40 A;  1U60 A;  4ZJ2 A;  1ESI A;  4DDY A;  5FI6 A;  3U2A A;  2V1A A;  4OPR A;  1XGI A;  4B4Z A;  1H5X A;  1K54 A;  1PWC A;  4GCZ A;  3A3J A;  3RXX A;  2V1B A;  3LEQ A;  4NEE D;  4S2J A;  4CLC A;  5CXW A;  4MBK A;  5AJG A;  2H28 A;  5J7E A;  1FR1 A;  4JXG A;  1DY6 A;  1H8Z A;  3G30 A;  1MPL A;  2WKR A;  4GNU A;  5E2G A;  5GLC A;  5M18 A;  2PU4 A;  1XKZ A;  2HDR A;  4GD6 A;  4F3L A;  3QHY A;  1D1J A;  1MWR A;  4I5S A;  4P0M A;  3P98 A;  1ES2 A;  4GB7 A;  3MZF A;  3MR0 A;  3T4K A;  4IBX A;  2G7U A;  5IHV A;  2WKE A;  3VOY A;  4PKY A;  4XUZ A;  1PI5 A;  4N1X A;  2PR6 A;  3W2Z A;  4DE2 A;  1JTG A;  5HW3 A;  1GSX A;  3AGD A;  4X69 A;  5TBM A;  5L07 A;  4X56 A;  3RFB A;  3W4P A;  1TS0 A;  1W79 A;  2Y55 A;  3F1P B;  2KX6 A;  3ITA A;  1IYP A;  3NOU C;  4IUK A;  3ULF A;  2EXA A;  2OOL A;  4DRT A;  4OQG A;  1YPR A;  1E3U A;  3GDI A;  3HCY A;  3NDG A;  4O0P A;  4RVA A;  3E2K A;  4PKY G;  3ZDJ A;  4ID4 A;  2VJW A;  3ZVT A;  2ZC6 B;  1E4D A;  3V39 A;  4HH3 A;  3KYQ A;  1BSG A;  1ERQ A;  1F9I A;  3UB7 A;  2WAD A;  1GHI A;  4R38 A;  3ZVW A;  4LRY C;  3N8R A;  1N9O A;  4EW7 A;  4JF5 A;  5HL1 A;  1I2W A;  1TF1 A;  4S2K A;  2R9W A;  2WZX A;  2L0W A;  4BEN A;  1GHP A;  3JVV A;  3IWQ A;  3NEC A;  3A0R A;  4R3B A;  3IXG A;  4UAA A;  4KUK A;  3A3I A;  4HBU A;  2IWD A;  3RXW A;  5J3W A;  3HUN A;  3A3D A;  4UHU A;  2ZOI A;  4RX3 A;  5FDH A;  4FOF A;  2WKQ A;  3ZCZ A;  2HDS A;  4S2O A;  4JGQ A;  2WGW B;  4KG2 A;  3LY3 A;  4S2N A;  1P9W A;  5KSC A;  5FQI A;  4G3K A;  3VOZ A;  2H5S A;  3T4T A;  4CJN A;  2K2N A;  3AGE A;  5HDC A;  3FG8 A;  1H0M A;  3N8L A;  3TJZ C;  4GN2 A;  2RL3 A;  3H82 A;  5AQA A;  3VSL A;  3IX4 A;  3ZG7 B;  3F1O A;  2O9A A;  4NET A;  2VZW A;  1VHM A;  4FH2 A;  4OQ0 A;  3Q1F A;  1L3L A;  2G2W A;  4Y7P A;  1FR6 A;  3BFE A;  3WS5 A;  3UDX A;  4CLC D;  4PHT A;  5F1F A;  2H10 A;  3HJK A;  3VE4 A;  1JWP A;  1G6O A;  4LV3 A;  2HP9 A;  4PM9 A;  3BEB A;  2WGI A;  2Z2L B;  4Y15 A;  5G4Y A;  5FAS A;  4OP8 A;  4FSF A;  4S2I A;  2ZL1 B;  2W27 A;  1NLZ A;  2BAS A;  3VOL A;  1SKF A;  1PYY A;  3DTE A;  3A0V A;  3GEC A;  3HLB A;  4FCF A;  4JXW A;  1XGJ A;  2PBY A;  2OSU A;  5AVE A;  3O87 A;  3C7V A;  4S2N C;  3M6H A;  4R3A A;  2BTF P;  4L9E A;  3CPT A;  2Y2M A;  1YKD A;  1JWV A;  2NUP C;  4KG6 A;  4JKT A;  2OAQ 1;  1IEL A;  3IF6 B;  4RYE A;  2JE5 A;  1VET A;  1NLY A;  5A93 A;  3F1P A;  3IH9 A;  1FSW A;  4ZDX A;  3EQU A;  2V20 A;  2O9B A;  4IHQ A;  4UEY A;  4I3I A;  3ITB A;  1DJA A;  1JTD A;  3GMW A;  5HWT A;  3S7Q A;  4Y17 A;  4OKP A;  2WKI A;  3C4O A;  5G18 A;  1CEF A;  3OPH A;  3E4O A;  3EGX C;  1OTI A;  1O7E A;  5HWV A;  1T19 A;  3NIA A;  2UV0 E;  3Q7Z A;  1N9N A;  2VV8 A;  1XA1 A;  5FL3 A;  2VV7 A;  2A3U A;  3H9W A;  3PYP A;  4RX2 A;  2Q9M A;  1NJ4 A;  1ACF A;  4IJG A;  4HES A;  2VV6 A;  2K31 A;  3UB9 A;  1TS8 A;  1XJ2 A;  3VP2 A;  4NXF A;  5CRF A;  3L9K A;  1LI0 A; 
#chains in the Genus database with same CATH homology
 1TS6 A;  2PT7 A;  3LIB A;  3BY9 A;  5DFX A;  4WF0 A;  2KLI A;  3H7W A;  2HV1 A;  1TD5 A;  1UWN X;  4P6Z S;  3LR0 A;  3T4L A;  5F5Y A;  2B18 A;  2J3T C;  2VGL M;  5C5K A;  2LB9 A;  2XRN A;  3OC2 A;  1V9Z A;  3LR4 A;  3FPW A;  3R4K A;  2XA7 S;  3PBO A;  3NHQ A;  1IOU A;  3T50 A;  2QYB A;  4BMW A;  4M4X A;  1DRM A;  3O5Y A;  4L0L A;  4GS9 B;  3OCL A;  1TS7 A;  2QJ7 A;  1T1C A;  4ETZ A;  4MN6 A;  3CAX A;  5AVF A;  4CLC E;  1GSV A;  2OWJ A;  1OTD A;  3MF0 A;  5EFW A;  3C2W A;  3PBQ A;  1DP9 A;  4KQO A;  2VEA A;  2QJ5 A;  1H3Q A;  3TW8 A;  2K7S A;  3CWF A;  4G3V A;  3E0Y A;  3FPV A;  2L4R A;  2GJ3 A;  4H6J B;  2A24 B;  3MQQ A;  4BBT A;  5HSQ A;  4K08 A;  4EU0 A;  3LR3 A;  3E4Q A;  3LR5 A;  1OT6 A;  3S7O A;  3OCN A;  3LID A;  4II7 A;  3UE3 A;  1D7E A;  5A8B A;  3EQV A;  2Z6D A;  3PBT A;  3BQA A;  4E04 A;  3UME A;  1P0Z A;  2V9A A;  4WEK A;  4LRZ E;  5L8M A;  3OBF A;  3LYX A;  4WUJ A;  3KYZ A;  3T4S A;  5HWW A;  2PYP A;  4GLQ A;  4CLC C;  4NKP A;  4MN5 A;  2D02 A;  4KUO A;  4CLC B;  3SW1 A;  3LIA A;  3K2N A;  1NRJ A;  2PD8 A;  5IS1 A;  2EWW A;  4GS9 A;  5DF9 A;  4GW9 A;  3BWL A;  2QWS A;  4NXG A;  3MQ0 A;  3PBN A;  4Q0H A;  4I3A A;  3LI8 A;  1XJ6 A;  4Y2F A;  3IBR A;  4I3J A;  3MJQ A;  2B02 A;  2P7J A;  2JKR I;  4F3L B;  5DFY A;  1BYW A;  5HD5 A;  4EER A;  3LI9 A;  1LL8 A;  3K3D A;  3C8C A;  5K5B A;  1OTE A;  1F98 A;  1DP6 A;  5HDD A;  2KOI A;  3CIT A;  1T1B A;  3PR6 A;  2A24 A;  4NXE A;  2OWH A;  4HNB A;  1WA9 A;  4Z1W A;  3B33 A;  4MDZ A;  5IU1 A;  4DJ3 A;  2IA2 A;  3MMH A;  4I38 A;  2EA9 A;  3U2A A;  1LSX A;  2V1A A;  4UQI M;  4R6L A;  3MFX A;  5TBM B;  3BW6 A;  4HJ3 A;  3UMD A;  5TJJ A;  4GCZ A;  3LIE A;  2V1B A;  2J3W A;  2NUT C;  4L9F A;  4NEE D;  4B9O A;  3P01 A;  4HH2 A;  4CLC A;  4LRX C;  1S4R A;  1OTB A;  5AJG A;  2H28 A;  5J7E A;  2PHY A;  3CLO A;  3PHY A;  2J80 A;  3JVU A;  4HY8 A;  1YSQ A;  4WEJ A;  2O0Y A;  1MZU A;  2WKR A;  4MMN A;  4DMZ A;  4XT2 A;  3KSI A;  4F3L A;  3VV4 A;  1JNU A;  2KDK A;  3C38 A;  3DBA A;  4I5S A;  3NOP C;  4BBU A;  3A0S A;  4HIA A;  3MR0 A;  3T4K A;  2G7U A;  3VE3 A;  4ZRR A;  1LSV A;  3B47 A;  3ICY A;  4EQ1 A;  4PKY A;  2JN7 A;  1MKM A;  4HJ4 A;  2PR6 A;  4EUV A;  3W2Z A;  2FH5 A;  2MJ6 A;  4BBV A;  3LIF A;  1STZ A;  1GSX A;  3K3C A;  5DJT A;  5TBM A;  2W3F A;  3RFB A;  3EOI A;  3BY8 A;  4ETX A;  1TS0 A;  3IS2 B;  3F1P B;  1IFQ A;  2Y79 A;  4YWZ A;  3R7W A;  2HJE A;  2KX6 A;  3TE8 A;  5J4E A;  2W3D A;  2HF6 A;  3NOU C;  4IUK A;  3ULF A;  5LBR A;  3T4J A;  4GJ4 A;  2OOL A;  4NXB A;  3MQO A;  2JHE A;  2W3E A;  5DKK A;  3GDI A;  2VLG A;  3HCY A;  4O0P A;  1VB6 A;  1V9Y A;  1S66 L;  4BJP A;  4PKY G;  4QPR A;  2GZA A;  1EW0 A;  3B42 A;  1ZHH B;  2VJW A;  3BQ8 A;  1T18 A;  5CX7 A;  2W3G A;  2A2L A;  2VGL S;  5F6A A;  5HPF A;  3NOT C;  4HQA A;  4LPZ A;  5DKL A;  4OOL A;  4PAU A;  1DP8 A;  2OAP 1;  4HH3 A;  3KYQ A;  2V0W A;  3IBJ A;  3UB8 A;  1F9I A;  3UB7 A;  3NJA A;  1XJ3 A;  2W1R A;  1H8M A;  3G6O A;  1OT9 A;  4R38 A;  3D3O A;  4ME4 A;  4GHI B;  4LRY C;  5G4Z A;  4WEL A;  3ZQ5 A;  3EEH A;  1N9O A;  4EW7 A;  2D01 A;  1OJG A;  4WLA A;  5KIZ A;  1UGU A;  4P6Z M;  1TF1 A;  3PXP A;  4H6J A;  1Y28 A;  4IUH A;  1MC0 A;  2JKT M;  2L0W A;  1UWP X;  3S7P A;  3IS2 A;  1P97 A;  2XA7 M;  3JVV A;  3H82 B;  2V0U A;  3F1O B;  2LB5 A;  3A0R A;  4EEU A;  4HJ6 A;  4MCW A;  2W1T B;  4O8G A;  3CUE A;  2GNX A;  2W0N A;  4KUK A;  4Y5F A;  4CQH A;  3C30 A;  2J3T D;  2QKP A;  4WN5 A;  1S4S A;  5J3W A;  1XJ4 A;  4HP9 A;  4EES A;  3T4O A;  2ZOI A;  3V67 A;  4FOF A;  2WKQ A;  4JGQ A;  1XFN A;  1S67 L;  3T4Q A;  4R70 A;  3HJI A;  1P9W A;  4G3W A;  4GHI A;  4G3K A;  5HPI A;  3T4T A;  2K2N A;  4B93 A;  5HDC A;  3FG8 A;  4AFI A;  1W63 M;  3EEA A;  3FC7 A;  2YKH A;  3KX0 X;  4JGR A;  4RQ9 A;  3UB6 A;  3PBS A;  3F1N B;  3TJZ C;  5IT5 A;  4YOF A;  3EWK A;  3ZYT A;  3H82 A;  5MC7 A;  3F1O A;  3D72 A;  2O9A A;  2Z6C A;  2VZW A;  2W1T A;  5KSH A;  1VHM A;  2PD7 A;  5HD3 A;  4I39 A;  4ARZ B;  1X0O A;  4UQI S;  4WL9 A;  1S1Z A;  2QHK A;  1YSP A;  2PR5 A;  4CLC D;  2XRO A;  4PHT A;  2INW A;  3CUE C;  5I5L A;  3HJK A;  2ZBB A;  3BJN A;  3VE4 A;  5DJU A;  4L9G A;  4LLO B;  1G6O A;  3E4P A;  1GSW A;  4JGP A;  2I9V A;  4OOM A;  1LT0 A;  5G4Y A;  3UE6 A;  1F5M A;  4FSF A;  2M1C A;  2W27 A;  4O01 A;  1LSW A;  1NLZ A;  1OTA A;  2BAS A;  5HZH A;  3S7N A;  3VOL A;  1YAX A;  2ZMV A;  2Y8H A;  2PDR A;  1D06 A;  3A0V A;  3GEC A;  2CMN A;  3OOV A;  3CI6 A;  2GX5 A;  1ZTU A;  2DMW A;  2O9C A;  1W63 Q;  4HOI A;  5AVE A;  4DJ2 A;  2P04 A;  3PBR A;  1S1Y A;  2WKP A;  4R3A A;  3F1N A;  3KSH A;  4L9E A;  2O99 A;  1YKD A;  3LUQ A;  2NUP C;  2P08 A;  4KQD A;  2OAQ 1;  4Y3I A;  2YKF A;  1T1A A;  5HL6 A;  2PYR A;  4Q0J A;  2HGV A;  2ZOH A;  2JKR M;  2W3H A;  4ARZ A;  2L1M A;  1NLY A;  3TRC A;  5F68 A;  4BWI A;  4MN7 A;  3H7W B;  3LFV A;  4HHD A;  3F1P A;  2HJ9 C;  4DN0 A;  5HDS A;  4EET B;  3P7N A;  1N9L A;  3EQU A;  1P9R A;  2XSS A;  1XFQ A;  2M7V A;  2O9B A;  4IHQ A;  4UEY A;  1OPX A;  4I3I A;  2VX8 A;  4XT2 B;  2M7U A;  2JKT I;  4YNR A;  5HWT A;  4HP4 A;  3RTY A;  3S7Q A;  4Q0I A;  3E98 A;  4JGO A;  3RH8 B;  3MXQ A;  5F69 A;  3E4O A;  3EGX C;  2VA0 A;  1OTI A;  3OLO A;  3LIC A;  5HWV A;  1T19 A;  3KSG A;  1N9N A;  2VV8 A;  4HI4 A;  3EGD C;  2R78 A;  2FZ0 A;  1NWZ A;  5FL3 A;  4EEP A;  2VV7 A;  3KSF A;  3H9W A;  3PYP A;  2EWV A;  1OJ5 A;  4IJG A;  1ODV A;  2VV6 A;  1KOU A;  2K31 A;  2ZMF A;  3UB9 A;  3R7W B;  1TS8 A;  3KO6 A;  4EXO A;  2VKS A;  1G28 A;  1XJ2 A;  4NXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...