4PPRA

Crystal structure of mycobacterium tuberculosis d,d-peptidase rv3330 in complex with meropenem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
306
structure length
300
Chain Sequence
PLPLVVPPTPVGGNALGGCGIITAPGSAPAPGDVSAEAWLVADLDSGAVIAARDPHGRHRPASVIKVLVAMASINTLTLNKSVAGTADDAAVEGTKVGVNTGGTYTVNQLLHGLLMHSGNDAAYALARQLGGMPAALEKINLLAAKLGGRDTRVATPSGLDGPGMSTSAYDIGLFYRYAWQNPVFADIVATRTFDFPGHGDHPGYELENDNQLLYNYPGALGGKTGYTDDAGQTFVGAANRDGRRLMTVLLHGTRQPIPPWEQAAHLLDYGFNTPAGTQIGTLIEPDPSLMSTDRRVDPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Penicillin-binding protein DacB1
publication title Subfamily-specific adaptations in the structures of two penicillin-binding proteins from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 95
structure length 300
sequence length 306
ec nomenclature
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pprA00
3ZG7B 3GR2A 2CC1A 5HARA 3IHAA 3IWOA 1FCMA 3WRTA 3ISGA 1YM1A 4N1HA 3FV7A 5CXWA 2XR0A 1QMEA 2B5RA 2Y59A 3VP3A 1KVLA 2EX8A 3BFFA 3HLGA 1M40A 4S2NA 5CHJA 2Y2MA 2Y2IA 5L2FA 4WM9A 2WKIA 1YLZA 5F1GA 1XA7A 5U47A 4DE0A 3CJMA 3ZCZA 1IYPA 5E2HA 1K57A 4S2LA 4BLMA 4KG5A 2Y55A 4RYEA 4JKTA 4PM9A 1M6KA 2J9PA 1JWZA 4EBPA 1BTLA 4JBFA 3TSGA 1XGIA 4X55A 3ZG8B 1ESIA 1IYQA 1PIOA 2Y2KA 3G30A 4S2OA 3SS3A 1PW1A 5CERA 4BD0A 3FKVA 1OMEA 2JCHA 3V3RA 3HLBA 1E3UA 1K56D 2A49A 1KE3A 4WMCA 1H8ZA 5GHZA 3MBZA 5FI7A 3ZG5A 3UPNA 4E3LA 4BJPA 1NXYA 3UE3A 1IKGA 1MPLA 3AGFA 4BQMA 4GZBA 4ZTKA 3ZNYA 3ZG0A 3CZDA 5FAQA 2DRWA 3LEZA 5M18A 1HD8A 5HFOA 2HDRA 3GRJA 2I72A 3LCEA 2HDUA 3HLDA 4P87A 4E6XA 4FH4A 3VFHA 4LENA 3WS0A 3ZFZA 4CPKA 5E2EA 5KSCA 1KVMA 3G4PA 2ZLYA 4BL2A 3IF5A 3Q7ZA 1GHMA 1HVBA 3BFGA 4KQOA 4RX3A 4WZ4A 1O07A 2C5WB 3G35A 4PM5A 5GHYA 4QHCA 1NJ4A 2Z2LB 1KGEA 5E2GA 3NC8A 1I2WA 1IYOA 3IQAA 3HLFA 1YMXA 2E8IA 2XD1A 3QNCA 3VFFA 5CGSA 1KE0A 1GCEA 4OOLA 1WE4A 2OLVA 1EI5A 5E43A 3WS4A 3NBLA 4GDNA 4KZ7A 4WEKA 2XD5A 1GA0A 1HTZA 1K55C 1U60A 3GV9A 3G2ZA 3OPRA 2G2UA 5CTMA 4FH2A 4OLDA 2WK0A 3N8LA 3VOYA 2Q9NA 1L2SA 4GNUA 2HPBA 4WBGA 3WS1A 3V5MA 2ZC5B 4MBFA 5JYPA 4ZBEA 3DW0A 3NIAA 1E3UD 1L0FA 2WUQA 3BEBA 4LV3A 4WMCD 2XFTA 4DE1A 3UPOA 2WYXA 4DKIA 2WKEA 2XQZA 5F1FA 1HZOA 3Q7VB 2ZC6B 5HAQA 4XUZA 1K54C 3M2JA 5FAPA 4R1GA 4DXCA 3G31A 4BENA 3CG5A 5CTNA 1NYMA 1E25A 2Z2MB 4U3TA 4UHUA 2EFXA 4OH0A 3N6IA 4OKPA 3HUOA 1GA9A 4IVKA 2JBFA 4Y7PA 1FQGA 2OLUA 2Y2NA 4OQIA 3OCLA 3IXDA 4S2JA 5DVAA 3WS5A 5AQ7A 5EVID 4QY6A 4N9LA 1K55A 1YLWA 5AQAA 5CEBA 1K4EA 3G34A 5FQMA 4RVAA 3UE1A 3PBNA 4S2NC 2WADA 3SS4A 5CECA 1ERQA 4RA7A 2OV5A 1GHIA 4R4SA 1Q2PA 3IF6B 3UO9A 1LL5A 4KG2A 1ALQA 3BFDA 1ESUA 3VSKA 1K57C 2X02A 4MBKA 1VM1A 1ZKJA 1K56A 3AGDA 4E3IA 4R3JA 3CMZA 3PBQA 5E2FA 3BLSA 4L0LA 3BFEA 2Y91A 5GLDA 5A91A 4OQ0A 2QPNA 1K54A 4QD4A 5JYOA 4NETA 4U0XA 2JE5A 2ZD8A 2WAEA 5GLBA 3GMWA 3PBTA 1KGGA 1PZOA 1TVFA 2EX6A 3HUNA 4S2PA 3ZG9B 3D4FA 3HBRA 5A90A 1I5QA 4K0XA 2XF3A 3QNBA 5GL9A 3B3XA 1JTDA 1DJAA 1YLYA 3Q82A 2ZQDA 5CGXA 3SH8A 4S2IA 3E2LA 1BLSA 1DJCA 2VGJA 4PM7A 4UA7A 4X56A 4YINA 3UNWA 3ITBA 3OPPA 3MFDA 2DNSA 4C3QA 1YQSA 4A5RA 4R3BA 3DWZA 5FQKA 3BM6A 4DDYA 1YLTA 1YT4A 4XUXA 4ZJ2A 3M2KA 1XGJA 3Q1FA 5GLAA 1BLCA 5EVIC 1LLBA 2OSUA 4P85A 3WS2A 4JXGA 4Y0TA 4OLGA 4UA9A 1IYSA 5DF7A 4E3OA 5F82A 1LI0A 1FCOA 1VQQA 2FFYA 5G18A 1CI9A 3MZFA 5IHVA 3N8RA 2X71A 3O88A 3S4XA 1N9BA 1MWRA 4GD8A 4OPRA 2PBYA 4LV2A 5FASA 5GHXA 1BT5A 3UDIA 4NK3A 4IBXA 5KSHA 4MNRA 4KG6A 5CRFA 1TEMA 4R23A 1ES4A 4Y0OA 1RGZA 2EX2A 2WGVA 3V3SA 1LI9A 1PZPA 3PBSA 1K6SA 4R0QA 4S2MA 5HAIA 4EBLA 4KZ8A 4B4XA 2ZM0A 3A3EA 3QHYA 2ZC7A 4WZ5A 4JLFA 2ZQ7A 1FCNA 2J7VA 5EVIA 1SCWA 2J9OA 3UDXA 2FFFB 4MBHA 1LL9A 1JWVA 1SDNA 1XKZA 4OP5A 1L0GA 2IWDA 4F94A 5FI6A 3HLEA 4O7DA 5A92A 5F83A 5FQQA 2V1ZA 3GVBA 2ZQCA 4UAAA 3LY3A 4EBNA 3N7WA 4BD1A 2EXBA 4OONA 4MLLA 3GTCA 5KZHA 3NY4A 1NY0A 4KZ5A 1MBLA 4LCMA 5CHUA 5CEDA 5EECA 1MXOA 2XEPA 4GDBA 3E2KA 3GSGA 1G6AA 1PW8A 5EVLA 3OZHA 2BG1A 3IWIA 3HLWA 2PU4A 1MY8A 3RJUA 1WYCA 3OCNA 3M6HA 4P6BA 2XLNA 2C6WB 3Q81A 1ES3A 5DF9A 3BLMA 3SH9A 3V39A 3VOZA 4DDSA 4X68A 3AGEA 5FQIA 1K25A 4EQIA 4QJGA 1FR1A 3HL9A 4H8RA 2XGNA 5DTTA 1DY6A 3TG9A 3BFCA 5CGWA 2P9VB 1XP4A 3HUMA 4WELA 4E3NA 3Q7VA 5FATA 3ITAA 1TDLA 3C4PA 4FD8A 4OPZA 1L0DA 3RXXA 5EE8A 5HAPA 4WEJA 5HX9A 3G2YA 4ZAMA 1S0WA 3C7UA 3LY4A 1MKIA 3OPLA 1MWUA 5D3OA 2ZJ9A 4K91A 2DCFA 2WGWB 3IXHA 5EUAA 1ES5A 2IWBA 4OPYA 2ZC3B 4FCFA 1CI8A 1L0EA 3Q07A 4JPMA 3VP4A 4Q8IA 2HDSA 5FAOA 1SHVA 2Y2PA 1NYYA 4ZDXA 2RL3A 3IF6A 2ZMAA 3W4OA 3EQVA 5HW3A 3TOIA 1DJBA 3ZDJA 1CEGA 4E3JA 1MWSA 2IWCA 4X6TA 2XK1A 3EQUA 1XPBA 3V50A 4KZ6A 1ES2A 1G68A 4QB8A 3IH8A 3BRMA 4KZBA 1BLHA 3NDEA 1SKFA 4KENB 1JTGA 4HESA 1K38A 4U0TA 5DTSA 2Y2OA 2Y2HA 4QU3A 4M3KA 4EV4A 4JF4A 1PWGA 2Y2QA 4KZ3A 5BOHA 4X69A 1RGYA 1BLPA 2BLSA 4FSFA 2HDQA 5FA7A 4OQGA 2WAFA 1BUEA 1FSWA 3NCKA 1XX2A 3O87A 2WZZA 3VP1A 5EOEA 5TR7A 3VSLA 3P98A 1ZG6A 2Q9MA 2V20A 4ID4A 3C7VA 3FYZA 3ZVWA 1JVJA 2WZXA 4N1XA 4JF5A 4WZ5C 4IVIA 3MXRA 3W8KA 1XA1A 2P74A 2X01A 3ZGAB 3HLCA 3FKWA 4DRTA 3S1YA 3ZVTA 4UA6A 2QMIA 4Z9QA 1IEMA 3UPPA 4DXBA 1LHYA 3OC2A 3G32A 1E4DA 4JXVA 5CHMA 4KZ9A 4OP8A 3IWQA 3C4OA 1CEFA 1W5DA 1J9MA 3A3IA 4R4RA 1KE4A 1TDGA 3N8SA 5FQJA 4E3MA 4E6WA 3IXGA 4EWFA 2ZC4B 2HP5A 3P09A 1K4FA 1O7EA 1Y54A 4BL3A 2J8YA 1BSGA 4DE2A 5TFQA 3PTEA 4C6YA 1MWTA 2ZQ8A 5A93A 4GOGA 1PI5A 2WKHA 5M1AA 2V2FF 4ZJ3A 2EX9A 3WRZA 4D2OA 2EXAA 4PMAA 3N4IA 3ZHHA 1BZAA 2A3UA 1S6RA 4Y0UA 5J8XA 2JC7A 3A3JA 3FZCA 5FDHA 5FI2A 4MEZA 1YMSA 4XXRA 4OOYA 4LCLA 1W8QA 2HP9A 4OOMA 5FSRA 4C75A 3O86A 3C5AA 4GB7A 4P0MA 1W79A 2HP6A 5EVIB 4KZ4A 2R9WA 1PI4A 4N92A 3SH7A 1NZOA 4KQQA 4K0WA 3PBOA 3IT9A 2RCXA 3PBRA 1FSYA 2ZM2A 2GDNA 3UDFA 2H0TA 1YLPA 4KZAA 1KDSA 1W8YA 2G2WA 1W7FA 1IELA 2ZM8A 3S22A 1K6RA 1WYBA 5TGFA 1NRFA 1QMFA 3IF6C 3BYDA 3MKEA 3MZEA 3IH9A 4DE3A 2QZ6A 2WGIA 5KMWA 4OPQA 4WYYA 4HEFA 1EROA 3WWXA 3JYIA 3UY6A 4N9KA 3UE0A 4IEDA 2Y2LA 4S2KA 3A3FA 5DF8A 4JF6A 3MZDA 1YLJA 4DF6A 4OVDA 1EWZA 3LO7A 1SDEA 3BECA 2P9VA 4HBUA 4OQHA 2PU2A 3NDGA 1ZC2A 4QY5A 1BULA 1PYYA 1XXMA 3VP0A 3ZNTA 1KDWA 4PPRA 1ERMA 3A3DA 3IHBA 2Y4AA 3HVFA 4PM8A 4B88A 1FOFA 3DTMA 3RXWA 3PAEA 1FR6A 4GN2A 5HL1A 2XH9A 5DTKA 5AQBA 4JXSA 2H10A 3O3VA 4PM6A 2ZQAA 3HREA 4X53A 3SS5A 3VP2A 3W4QA 3MKFA 2UWXA 2WGWA 3M6BA 1H5XA 3IXBA 4KQRA 5EOOA 3SOIA 4JXWA 1ONGA 1JWPA 4E3KA 1H8YA 4EUZA 4YFMA 2XFSA 3NI9A 2H0YA 1Q2QA 1IKIA 3UN7A 5AQ9A 3GQZA 1I2SA 2XDMA 3MXSA 3I7JA 2H5SA 5GLCA 4CJNA 3VMAA 1Z6FA 1KGFA 1NZUA 4IBRA 2Y2GA 3PAGA 1ZG4A 2VGKA 4LV0A 1GHPA 1N4OA 4RX2A 5I94A 5FQ9A 5EPHA 1PWCA 2EFUA 1CK3A 3FWLA 4ZJ1A 2ZQ9A 1RCJA 1RP5A 2R9XA 3DWKA 4GD6A 5M19A 2Y2JA 1AXBA 3W4PA 1C3BA 1ONHA 1PWDA 3OPHA 4B4ZA 4GKUA 4LV1A 4HBTA
chains in the Genus database with same CATH superfamily
3ZG7B 4G3VA 3D72A 1YM1A 4N1HA 1GSXA 2VV8A 3VP3A 2EX8A 3BFFA 5G4YA 4S2NA 2Y2MA 2Y2IA 5L2FA 1DP9A 5U47A 2FZ0A 4JGRA 5FL3A 2GJ3A 1DRMA 4S2LA 2PD7A 1PNEA 4DMZA 2J9PA 1JWZA 1LSWA 1XGIA 1ESIA 1PIOA 4S2OA 5HWVA 2VJWA 4BD0A 1PW1A 2JKFA 5GHZA 3ZG5A 3UPNA 1VHMA 3UE3A 2AVXA 4GZBA 3ZG0A 3CZDA 1WA9A 2G7UA 3GRJA 2I72A 3KO6A 3HLDA 3ZFZA 3HJKA 5E2EA 1P97A 3E98A 3Q7ZA 4RX3A 4PM5A 4QHCA 1NJ4A 3IBJA 3QNCA 1WE4A 3S7OA 3NBLA 4WEKA 1GA0A 1HTZA 1U60A 5CTMA 3E4OA 2K2NA 3S7NA 5JYPA 2PR5A 3DW0A 3H82A 1E3UD 4WMCD 3OBFA 4DE1A 2NUPC 4DKIA 2WKEA 3F1OB 3M2JA 5FAPA 3E4QA 4BENA 3CG5A 1DP8A 1NYMA 4GJ4A 5HWWA 3CPTB 3HUOA 1VETA 4Y7PA 2OLUA 4OQIA 4N9LA 5DKLA 1P9WA 4RVAA 1F9IA 2WADA 4XT2B 5CECA 1ERQA 2P7JA 1GHIA 3UMDA 1LL5A 2PT7A 3PBQA 4OQ0A 1ODVA 3LYXA 3C30A 4QD4A 5JYOA 4ETXA 1G28A 2WAEA 3GMWA 3IBRA 3PBTA 1K0KA 1KGGA 1TVFA 1JTDA 1T1BA 2J3WA 4YINA 3OPPA 4A5RA 2XRNA 3BM6A 2W3HA 4XUXA 3M2KA 5GLAA 3UE6A 4I39A 3WS2A 4JXGA 2CMNA 1YAXA 5DF7A 5LBRA 5F82A 2NUTC 1LI0A 1CI9A 3MZFA 3N8RA 2PRFA 1N9BA 4MDZA 4ARZA 1BT5A 2PYPA 3A0VA 5KSHA 2P04A 1ES4A 1RGZA 5J7EA 2WGVA 1LI9A 1PZPA 1K6SA 5HAIA 2J3TD 1CJFA 4EBLA 2ZM0A 3QP5A 4JLFA 2ZQ7A 3QP6A 4FOFA 3UDXA 1JWVA 1XKZA 3R7WA 1L0GA 4O7DA 4X1LA 4UAAA 3LY3A 4CLCB 1MBLA 3PYPA 5CHUA 2V1BA 1MXOA 3A0SA 2XEPA 4EEPA 1NLYA 1PW8A 3OZHA 1YPRA 4P6BA 3BLMA 4X25A 3VOZA 4BMWA 2V0WA 1FR1A 3HUMA 3C38A 1TDLA 2KX6A 3B47A 3C4PA 4FD8A 5EE8A 4WEJA 1S0WA 3LY4A 5EUAA 2ZC3B 2INWA 4JPMA 5FAOA 1VEUB 2JKRI 2RL3A 3A0RA 2ZMAA 3EQVA 1CEGA 1P9RA 2IWCA 1YSPA 3GECA 4HP4A 1T1CA 3V50A 4CLCD 3BRMA 1UWNX 1F5MA 4HESA 4U0TA 3BQAA 4QU3A 3F1PB 4M3KA 4JF4A 2QJ5A 2Y2QA 2O99A 4X69A 2ZOIA 5TR7A 3P98A 1ZG6A 2LB5A 2V20A 4ID4A 4O01A 3FYZA 3ZVWA 1S1YA 2WZXA 4WZ5C 3ZGAB 3CITA 1IEMA 4DXBA 1LHYA 5CHMA 4OP8A 3IWQA 1BYWA 1S4SA 1TDGA 3ZQ5A 3P09A 1K4FA 2E8JA 2J8YA 1TS6A 3PTEA 2KOIA 4GOGA 5F68A 3ZHHA 1S6RA 3S7PA 3FZCA 5J3WA 3CWFA 1S4RA 2OAQ1 2HP9A 2D01A 4OOMA 1S66L 3C5AA 1OTBA 4KZ4A 4R3AA 4WF0A 3PBOA 2RCXA 1P0ZA 2H0TA 2O0YA 3VE3A 1W7FA 1WYBA 1NRFA 2KLIA 3IH9A 2QZ6A 1HLUP 4OPQA 2PHYA 2VA0A 4O8GA 3UY6A 2Y2LA 4S2KA 3A3FA 4DF6A 3H82B 1SDEA 3BECA 4HBUA 3LFVA 1BULA 1PYYA 4EETB 2YKFA 4ME4A 3A3DA 3K2NA 2Y4AA 3HVFA 4PM8A 4PKYG 5HL1A 5AQBA 3FPWA 4JXSA 2H10A 1VETB 2UWXA 2WGWA 3M6BA 1FILA 3IXBA 5EOOA 1OJ5A 2UV0E 4CLCE 4EU0A 2ZMFA 5CX7A 2H0YA 3GQZA 4EESA 2JHEA 1J3WA 1NZUA 4IBRA 1ZG4A 2VGKA 4LV0A 4I3AA 3FWLA 4GW9A 3W4PA 1C3BA 1ONHA 3MF0A 4NEED 1XFQA 3GR2A 2HZ5A 2R78A 1FCMA 3UB5P 3UB7A 1QMEA 2Y59A 3KSGA 1KVLA 1XJ3A 3HLGA 5CHJA 2WKRA 2WKIA 1YLZA 2QJ7A 2MJ6A 3CJMA 3VOLA 3P01A 2O9CA 4PM9A 3NOTC 2JKTI 1BTLA 3TSGA 4X55A 2PDRA 3G30A 3T4KA 4ARZB 4GS9A 2VV6A 3SS3A 5CERA 1OMEA 4HH3A 3V3RA 3DTIA 3T1SA 1KE3A 4HJ4A 1GSWA 4BJPA 5HL6A 4BQMA 3ZNYA 5FAQA 1HD8A 2WKQA 2HDRA 3LCEA 4EW7A 2HDUA 4E6XA 4FH4A 3VFHA 4LENA 3R7WB 1T19A 4BL2A 1GHMA 1O07A 2C5WB 4MN7A 5HPIA 5GHYA 2Z2LB 4MN5A 5E2GA 3NC8A 2K7SA 4I5SA 1S67L 1YMXA 2E8IA 2XD1A 2Y8HA 3LUQA 5CGSA 2OLVA 1EI5A 1SKOA 3EGDC 4KZ7A 1K55C 3GV9A 2I9VA 3G2ZA 3LR4A 1G6OA 3QP8A 3VOYA 2VLGA 3V5MA 2ZC5B 3BEBA 4LRZE 3UPOA 2WYXA 2XQZA 5F1FA 2ZC6B 5HAQA 3CHWP 5CTNA 4U3TA 3N6IA 3TJZC 4ESPA 1K55A 1YLWA 3JVVA 3UE1A 4S2NC 4RA7A 1Q2PA 5F69A 3BFDA 3LR3A 3RTYA 3T4LA 1ESUA 1VM1A 3IX3A 4Y17A 3JVUA 4R3JA 4E3IA 5GLDA 3BFEA 2QPNA 5L8MA 1ACFA 4R38A 4NETA 1MKMA 2JE5A 3GDIA 1PZOA 5A90A 4S2PA 3ZG9B 4H6JA 3QNBA 4DJ3A 1IFQA 4X1MA 2ZQDA 4S2IA 3RFBA 5EM1A 4X56A 4IHQA 4R3BA 3U4LP 4ZJ2A 1H0MA 1BLCA 1LLBA 2OSUA 4Y0TA 1IYSA 1CQAA 3O5YA 2FFYA 1VQQA 5G18A 3D3OA 3LEQA 2P08A 4F3LA 1MWRA 2VX8A 4GD8A 1ZHHB 4DJ2A 2FH5A 5GHXA 4NK3A 4Q0IA 5EVEA 4IBXA 5CRFA 3BW6A 1Y4OA 3PBSA 4R0QA 3A3EA 3NECA 3QHYA 3MQ0A 4Y5FA 4MBHA 1LL9A 4OP5A 3MS6A 5FEGA 2QWSA 5F83A 2ZQCA 4EBNA 4GHIA 3GTCA 3BY9A 3NY4A 5CEDA 4GDBA 3GSGA 2BG1A 3EEAA 5F6AA 2PU4A 3RJUA 3OCNA 3EOIA 2XLNA 2Z6CA 4EQIA 4QJGA 2EWVA 4H8RA 2XGNA 5DTTA 1DY6A 3TG9A 4E3NA 3Q7VA 5FATA 3IX8A 4OPZA 4WUJA 3RXXA 2L1MA 2B18A 3G2YA 4ZAMA 3LIBA 3K3DA 3C7UA 1MKIA 5HZHA 1MWUA 5EFWA 3LR5A 4K91A 2DCFA 2WGWB 4ZRRA 1ES5A 4M4XA 3Q07A 1SHVA 1NYYA 1OJGA 1X0OA 3IF6A 1DP6A 3UB9A 2V8CA 3OOVA 4KZ6A 5HDCA 3IH8A 4KZBA 3NDEA 4KENB 2GZAA 1K38A 5DTSA 4HHDA 2VGLM 5IU1A 5HPFA 1RGYA 2BLSA 2HDQA 3NCKA 1FSWA 5TBMA 4LLOB 5EOEA 3VSLA 4B9OA 3C7VA 4IVIA 3MXRA 1XA1A 2X01A 2V8FA 3HLCA 3FKWA 3CUEC 3ZVTA 3DTKA 2ZMVA 4NXBA 2QMIA 4Z9QA 2W3GA 4HJ3A 1W5DA 1KE4A 5FQJA 2JKRM 3IXGA 2ZC4B 2HP5A 3BQ8A 1Y54A 4GS9B 4DE2A 5TFQA 2B02A 4ZJ3A 3NHQA 3L7HA 4L9FA 4PMAA 4LPZA 3CUEA 3L9KA 5J8XA 4HP9A 5AJGA 4MEZA 4OOYA 4LCLA 5FSRA 4C75A 3P7NA 2HP6A 3MXQA 5EVIB 1GSVA 4YWZA 4Q0HA 4N92A 3SH7A 4KQQA 3PBRA 1W63M 2GDNA 3T4JA 1KOUA 1TS7A 4KZAA 1KDSA 1IELA 2VK3A 1QMFA 1SKOB 3MKEA 3WWXA 3SZTA 3JYIA 3LIFA 4CQHA 1UGUA 3T1XA 2P9VA 4L9GA 4OQHA 3NDGA 5DFYA 4QY5A 4P6ZM 3TW8A 2VEAA 1XXMA 3VP0A 3ZNTA 3IHBA 1FOFA 3RXWA 3NJAA 3SW1A 1FR6A 2OAP1 4PHTA 2ZQAA 1LSVA 3HREA 3H9WA 3VP2A 3W4QA 3MKFA 2HGVA 1XJ2A 1ONGA 4E3KA 2XROA 1H8YA 4EUZA 3NI9A 2ZBBA 3NOPC 2XDMA 1D06A 5GLCA 1KGFA 5DKKA 5HSQA 3KYEA 4RX2A 3UMEA 5EPHA 1PWCA 2EFUA 4ZJ1A 4GD6A 3DWKA 5M19A 4H6JB 4UQIM 3OPHA 4LV1A 4HBTA 4Y15A 3IWOA 5CXWA 5AVFA 1LSXA 1F2KA 2DMWA 4IUHA 4HY8A 5F1GA 1XA7A 3IS2A 4DE0A 4HJ6A 3ZCZA 1IYPA 5E2HA 1K57A 4KG5A 2Y55A 1IOUA 4YNRA 1M6KA 5F5YA 3MMHA 4EBPA 3ZG8B 2JKGA 4F3LB 3UB8A 2JCHA 1E3UA 4WMCA 1H8ZA 3MBZA 3T4OA 2OWJA 4E3LA 3K3CA 1IKGA 1MPLA 3AGFA 2DRWA 5EM0A 3LIDA 4L9EA 3NULA 1YSQA 5HFOA 4EEUA 4P87A 3B42A 3WS0A 3MJQA 4CPKA 1KVMA 2HV1A 3G4PA 1L3LA 2ZLYA 3IF5A 4ETZA 1HVBA 3BFGA 4KQOA 4GHIB 3VFFA 4OOLA 5EV0A 3LI9A 3OPRA 2G2UA 2A24A 2J80A 2JN7A 4OLDA 4FTXA 1TF1A 4GNUA 2JKTM 2HPBA 4WBGA 4MBFA 4ZBEA 2WUQA 1D1JA 2HF6A 3Q7VB 4FUWA 4XUZA 1K54C 3T4TA 3G31A 1E25A 2Z2MB 4UHUA 4OKPA 3DAVA 2JBFA 1FQGA 4S2JA 5DVAA 4QY6A 5AQAA 5CEBA 5FQMA 3PBNA 3HJIA 3MR0A 2M7VA 2OV5A 3IF6B 3UO9A 1ALQA 3W2ZA 1ZKJA 1K56A 3AGDA 5E2FA 4L0LA 1K54A 2W3EA 4U0XA 2EX6A 3HUNA 1JNUA 3D4FA 3QP4A 1I5QA 4K0XA 3B3XA 1YLYA 5CGXA 3SH8A 3E2LA 1BLSA 1DJCA 3LIAA 4PM7A 4UA7A 3UNWA 5TBMB 2DNSA 3C8CA 1YQSA 5HD3A 5FQKA 2XSSA 4LRYC 3KSFA 4DDYA 3BY8A 4D60A 1YT4A 3F1NA 4G3WA 4O0PA 1XGJA 5EVIC 4P85A 4OLGA 4E3OA 2LB9A 5IT5A 2ZOHA 3O88A 3S4XA 2VV7A 2PBYA 5FASA 1PFLA 4DN0A 1PRQA 2KDKA 4KG6A 4R23A 2EX2A 4KZ8A 2J7VA 5EVIA 2J9OA 1T1AA 1MZUA 2FFFB 1SDNA 3KYZA 4F94A 3HLEA 5FQQA 2XA7M 3N7WA 4BD1A 2VZWA 4OONA 4MLLA 5KZHA 5HDSA 5EECA 1OTEA 1T18A 4JGOA 3E2KA 1G6AA 5EVLA 1WYCA 1ES3A 3SH9A 5KIZA 3AGEA 1K25A 4Y2FA 2O9AA 3HL9A 2Q0OA 1V9YA 2P9VB 1L0DA 2K31A 5K5BA 5DJTA 5D3OA 3IXHA 5FDSA 4FCFA 1CI8A 3VP4A 2HDSA 2Y2PA 4ZDXA 4G3KA 5HW3A 4NXFA 3ZDJA 4X6TA 2XK1A 3EQUA 1XPBA 3LICA 4I38A 4EERA 2Y2HA 3FPVA 1VB6A 4WL9A 4EV4A 4R70A 1PWGA 5BOHA 1ZTUA 5HWTA 4I3JA 1XX2A 1Z09A 2V9AA 4EUVA 4N1XA 4IJGA 4JF5A 3S1YA 3IS2B 2OWHA 3KSIA 3OC2A 3G32A 3V67A 4RQ9A 4KZ9A 3A3IA 4R4RA 1OTAA 4E3MA 4E6WA 2ACGA 1O7EA 4BL3A 3CI6A 2ZQ8A 5A93A 3ZYTA 1PI5A 5M1AA 2V2FF 5IS1A 2EXAA 2W3DA 3PXPA 5TJJA 2A3UA 4Y0UA 1LL8A 3QP1A 2JC7A 4HIAA 3A3JA 2W0NA 2L4RA 1W8QA 5I5LA 3O86A 4GB7A 2R9WA 4K0WA 3IT9A 1FSYA 2ZM2A 3UDFA 2ZM8A 3S22A 3T1RA 3EWKA 3IF6C 5HDDA 3BYDA 3MZEA 4DE3A 4WYYA 2A24B 4HEFA 1EROA 2H28A 4B93A 4IEDA 4JF6A 3MZDA 5FEFA 1EWZA 2PD8A 3LO7A 2PU2A 1ZC2A 3LIEA 4NKPA 4B88A 1D7EA 1TS8A 3PAEA 5DTKA 4X53A 3O3VA 4PM6A 1H5XA 2V0UA 3SOIA 4P6ZS 2HJ9C 5MC7A 4YFMA 2XFSA 4Y3IA 1Q2QA 1IKIA 3FC7A 3UN7A 4EXOA 5AQ9A 4I3IA 4GLQA 5DFXA 3MXSA 3I7JA 2H5SA 1V9ZA 4R6LA 3VMAA 1Z6FA 1XJ6A 2EA9A 3B33A 3PAGA 3TRCA 5FQ9A 5L10A 1CK3A 1AWIA 2ZQ9A 1RP5A 1S1ZA 2R9XA 1AXBA 1N9OA 1PWDA 4GKUA 4LFUA 2PR6A 2CC1A 5HARA 3IHAA 3T12B 3WRTA 3ISGA 3FV7A 2XR0A 2O9BA 3S7QA 2B5RA 2ZL1A 1M40A 4UQIS 1OTDA 4WM9A 2VKSA 3F1NB 3H7WB 4BLMA 4RYEA 4JKTA 4JBFA 1IYQA 2Y2KA 1STZA 3FKVA 3HLBA 1K56D 2A49A 5FI7A 2QHKA 5DJUA 1NXYA 3LGOA 1NLZA 3E0YA 2QYBA 4WLAA 3DBAA 4ZTKA 5M18A 3LEZA 1Y28A 2A2LA 3IX4A 4KUKA 2PAVP 5KSCA 3T4SA 4WZ4A 3G35A 1KGEA 1I2WA 1IYOA 3IQAA 3HLFA 1KE0A 1GCEA 4BBVA 5E43A 3WS4A 4GDNA 4EQ1A 2XD5A 4FH2A 1YKDA 2WK0A 3N8LA 5AVEA 2Q9NA 1L2SA 3WS1A 3NIAA 4LV3A 1L0FA 2XFTA 1HZOA 4R1GA 4DXCA 1NWZA 2EFXA 4OH0A 1GA9A 4IVKA 4MCWA 2W1TA 3MQQA 2Y2NA 3OCLA 3IXDA 3WS5A 5AQ7A 5EVID 1K4EA 3G34A 4BWIA 3JPUA 3SS4A 1OPXA 1TS0A 2L0WA 2EWWA 4R4SA 1H3QA 4Z1WA 3T4QA 4KG2A 4Q0JA 3VSKA 1K57C 2X02A 4MBKA 3CLOA 3EEHA 3CMZA 5A91A 3BLSA 2Y91A 4HH2A 2ZD8A 5GLBA 1TD5A 3HBRA 2XF3A 5GL9A 1DJAA 3Q82A 3KSHA 1FIKA 4MN6A 3PR6A 4KUOA 4PKYA 5L07A 4PAUA 2VGJA 3ITBA 4C3QA 3MFDA 1W63Q 3ICYA 3DWZA 3NOUC 3FG8A 3MQOA 1YLTA 5J4EA 1NRJA 3Q1FA 4HNBA 2W3FA 4UA9A 1UWPX 3R4KA 3ULFA 3UB6A 1XFNA 1H8MA 1FCOA 5IHVA 2X71A 4OPRA 4LV2A 3UDIA 4GCZA 1N9NA 4MNRA 1TEMA 4Y0OA 2HJEA 3V3SA 4HI4A 4S2MA 4B4XA 4II7A 2ZC7A 4WZ5A 3U2AA 1FCNA 1SCWA 2IWDA 5FI6A 5L09A 5A92A 1A0KA 2V1ZA 3GVBA 4KQDA 2EXBA 4NXGA 4JGPA 2GX5A 1NY0A 4KZ5A 4QPRA 4LCMA 4Y13A 4LGWA 1OT9A 3IWIA 3HLWA 1MY8A 2XA7S 3M6HA 2C6WB 3Q81A 5DF9A 3V39A 4DDSA 4X68A 5FQIA 2PYRA 1F98A 3BFCA 5CGWA 1XP4A 4WELA 3ITAA 3F1OA 3TE8A 5C5KA 5HAPA 2J3TC 3CPTA 5HX9A 4LRXC 3OPLA 2ZJ9A 3LR0A 2IWBA 4OPYA 1L0EA 3MFXA 4JGQA 4Q8IA 3DTEA 4XT2A 3W4OA 3TOIA 1DJBA 4E3JA 1MWSA 1G5UA 1ES2A 1G68A 4QB8A 4YOFA 3MSHA 1BLHA 1SKFA 1JTGA 1XJ4A 2Y2OA 4MMNA 4AFIA 4KZ3A 2BASA 1BLPA 4FSFA 5FA7A 4OQGA 1BUEA 2WAFA 2WKPA 3O87A 2WZZA 2W27A 3VP1A 2QKPA 2Q9MA 1JVJA 2ZL1B 3H7WA 3W8KA 2P74A 3VV4A 4DRTA 4UA6A 3BJNA 3UPPA 2B95A 1E4DA 3KX0X 4JXVA 3C4OA 1CEFA 1J9MA 4IUKA 3N8SA 1OT6A 3C2WA 3LI8A 4EWFA 3PHYA 4CLCC 2GNXA 1BSGA 1OTIA 4C6YA 1MWTA 3G6OA 3CAXA 2WKHA 5G4ZA 4BBTA 2EX9A 1SZVA 3WRZA 4D2OA 3N4IA 1BZAA 1N9LA 5FDHA 5FI2A 5HD5A 4NG2A 1YMSA 4XXRA 2PBDP 2M1CA 1CF0A 3OLOA 2M7UA 4P0MA 1W79A 1PI4A 1NZOA 4CLCA 1EW0A 4QWOA 1YLPA 1W8YA 2G2WA 4E04A 4BBUA 1K6RA 4WN5A 5TGFA 3QP2A 2WGIA 2IA2A 5KMWA 4UEYA 4N9KA 2OOLA 2W1RA 3UE0A 5DF8A 1YLJA 4OVDA 2V1AA 3HCYA 2Z6DA 3E4PA 4HOIA 1KDWA 4PPRA 1ERMA 3DTMA 3KYQA 5A8BA 4GN2A 2BTFP 2XH9A 3D9YA 3T1QB 3EGXC 3SS5A 2Y79A 2W1TB 3BWLA 4KQRA 4JXWA 4NXEA 1JWPA 1VEUA 2D02A 1I2SA 3RH8B 4CJNA 1MC0A 1LT0A 2Y2GA 1GHPA 1N4OA 4K08A 5I94A 3F1PA 1RCJA 2Y2JA 2YKHA 4HQAA 4B4ZA 3T50A 2VGLS 3VE4A
chains in the Genus database with same CATH topology
3ZG7B 3GR2A 2CC1A 5HARA 3IHAA 3IWOA 1FCMA 3WRTA 3ISGA 1YM1A 4N1HA 3FV7A 5CXWA 2XR0A 1QMEA 2B5RA 2Y59A 3VP3A 1KVLA 2EX8A 3BFFA 3HLGA 1M40A 4S2NA 5CHJA 2Y2MA 2Y2IA 5L2FA 4WM9A 2WKIA 1YLZA 5F1GA 1XA7A 5U47A 4DE0A 3CJMA 3ZCZA 1IYPA 5E2HA 1K57A 4S2LA 4BLMA 4KG5A 2Y55A 4RYEA 4JKTA 4PM9A 1M6KA 2J9PA 1JWZA 4EBPA 1BTLA 4JBFA 3TSGA 1XGIA 4X55A 3ZG8B 1ESIA 1IYQA 1PIOA 2Y2KA 3G30A 4S2OA 3SS3A 1PW1A 5CERA 4BD0A 3FKVA 1OMEA 2JCHA 3V3RA 3HLBA 1E3UA 1K56D 2A49A 1KE3A 4WMCA 1H8ZA 5GHZA 3MBZA 5FI7A 3ZG5A 3UPNA 4E3LA 4BJPA 1NXYA 3UE3A 1IKGA 1MPLA 3AGFA 4BQMA 4GZBA 4ZTKA 3ZNYA 3ZG0A 3CZDA 5FAQA 2DRWA 3LEZA 5M18A 1HD8A 5HFOA 2HDRA 3GRJA 2I72A 3LCEA 2HDUA 3HLDA 4P87A 4E6XA 4FH4A 3VFHA 4LENA 3WS0A 3ZFZA 4CPKA 5E2EA 5KSCA 1KVMA 3G4PA 2ZLYA 4BL2A 3IF5A 3Q7ZA 1GHMA 1HVBA 3BFGA 4KQOA 4RX3A 4WZ4A 1O07A 2C5WB 3G35A 4PM5A 5GHYA 4QHCA 1NJ4A 2Z2LB 1KGEA 5E2GA 3NC8A 1I2WA 1IYOA 3IQAA 3HLFA 1YMXA 2E8IA 2XD1A 3QNCA 3VFFA 5CGSA 1KE0A 1GCEA 4OOLA 1WE4A 2OLVA 1EI5A 5E43A 3WS4A 3NBLA 4GDNA 4KZ7A 4WEKA 2XD5A 1GA0A 1HTZA 1K55C 1U60A 3GV9A 3G2ZA 3OPRA 2G2UA 5CTMA 4FH2A 4OLDA 2WK0A 3N8LA 3VOYA 2Q9NA 1L2SA 4GNUA 2HPBA 4WBGA 3WS1A 3V5MA 2ZC5B 4MBFA 5JYPA 4ZBEA 3DW0A 3NIAA 1E3UD 1L0FA 2WUQA 3BEBA 4LV3A 4WMCD 2XFTA 4DE1A 3UPOA 2WYXA 4DKIA 2WKEA 2XQZA 5F1FA 1HZOA 3Q7VB 2ZC6B 5HAQA 4XUZA 1K54C 3M2JA 5FAPA 4R1GA 4DXCA 3G31A 4BENA 3CG5A 5CTNA 1NYMA 1E25A 2Z2MB 4U3TA 4UHUA 2EFXA 4OH0A 3N6IA 4OKPA 3HUOA 1GA9A 4IVKA 2JBFA 4Y7PA 1FQGA 2OLUA 2Y2NA 4OQIA 3OCLA 3IXDA 4S2JA 5DVAA 3WS5A 5AQ7A 5EVID 4QY6A 4N9LA 1K55A 1YLWA 5AQAA 5CEBA 1K4EA 3G34A 5FQMA 4RVAA 3UE1A 3PBNA 4S2NC 2WADA 3SS4A 5CECA 1ERQA 4RA7A 2OV5A 1GHIA 4R4SA 1Q2PA 3IF6B 3UO9A 1LL5A 4KG2A 1ALQA 3BFDA 1ESUA 3VSKA 1K57C 2X02A 4MBKA 1VM1A 1ZKJA 1K56A 3AGDA 4E3IA 4R3JA 3CMZA 3PBQA 5E2FA 3BLSA 4L0LA 3BFEA 2Y91A 5GLDA 5A91A 4OQ0A 2QPNA 1K54A 4QD4A 5JYOA 4NETA 4U0XA 2JE5A 2ZD8A 2WAEA 5GLBA 3GMWA 3PBTA 1KGGA 1PZOA 1TVFA 2EX6A 3HUNA 4S2PA 3ZG9B 3D4FA 3HBRA 5A90A 1I5QA 4K0XA 2XF3A 3QNBA 5GL9A 3B3XA 1JTDA 1DJAA 1YLYA 3Q82A 2ZQDA 5CGXA 3SH8A 4S2IA 3E2LA 1BLSA 1DJCA 2VGJA 4PM7A 4UA7A 4X56A 4YINA 3UNWA 3ITBA 3OPPA 3MFDA 2DNSA 4C3QA 1YQSA 4A5RA 4R3BA 3DWZA 5FQKA 3BM6A 4DDYA 1YLTA 1YT4A 4XUXA 4ZJ2A 3M2KA 1XGJA 3Q1FA 5GLAA 1BLCA 5EVIC 1LLBA 2OSUA 4P85A 3WS2A 4JXGA 4Y0TA 4OLGA 4UA9A 1IYSA 5DF7A 4E3OA 5F82A 1LI0A 1FCOA 1VQQA 2FFYA 5G18A 1CI9A 3MZFA 5IHVA 3N8RA 2X71A 3O88A 3S4XA 1N9BA 1MWRA 4GD8A 4OPRA 2PBYA 4LV2A 5FASA 5GHXA 1BT5A 3UDIA 4NK3A 4IBXA 5KSHA 4MNRA 4KG6A 5CRFA 1TEMA 4R23A 1ES4A 4Y0OA 1RGZA 2EX2A 2WGVA 3V3SA 1LI9A 1PZPA 3PBSA 1K6SA 4R0QA 4S2MA 5HAIA 4EBLA 4KZ8A 4B4XA 2ZM0A 3A3EA 3QHYA 2ZC7A 4WZ5A 4JLFA 2ZQ7A 1FCNA 2J7VA 5EVIA 1SCWA 2J9OA 3UDXA 2FFFB 4MBHA 1LL9A 1JWVA 1SDNA 1XKZA 4OP5A 1L0GA 2IWDA 4F94A 5FI6A 3HLEA 4O7DA 5A92A 5F83A 5FQQA 2V1ZA 3GVBA 2ZQCA 4UAAA 3LY3A 4EBNA 3N7WA 4BD1A 2EXBA 4OONA 4MLLA 3GTCA 5KZHA 3NY4A 1NY0A 4KZ5A 1MBLA 4LCMA 5CHUA 5CEDA 5EECA 1MXOA 2XEPA 4GDBA 3E2KA 3GSGA 1G6AA 1PW8A 5EVLA 3OZHA 2BG1A 3IWIA 3HLWA 2PU4A 1MY8A 3RJUA 1WYCA 3OCNA 3M6HA 4P6BA 2XLNA 2C6WB 3Q81A 1ES3A 5DF9A 3BLMA 3SH9A 3V39A 3VOZA 4DDSA 4X68A 3AGEA 5FQIA 1K25A 4EQIA 4QJGA 1FR1A 3HL9A 4H8RA 2XGNA 5DTTA 1DY6A 3TG9A 3BFCA 5CGWA 2P9VB 1XP4A 3HUMA 4WELA 4E3NA 3Q7VA 5FATA 3ITAA 1TDLA 3C4PA 4FD8A 4OPZA 1L0DA 3RXXA 5EE8A 5HAPA 4WEJA 5HX9A 3G2YA 4ZAMA 1S0WA 3C7UA 3LY4A 1MKIA 3OPLA 1MWUA 5D3OA 2ZJ9A 4K91A 2DCFA 2WGWB 3IXHA 5EUAA 1ES5A 2IWBA 4OPYA 2ZC3B 4FCFA 1CI8A 1L0EA 3Q07A 4JPMA 3VP4A 4Q8IA 2HDSA 5FAOA 1SHVA 2Y2PA 1NYYA 4ZDXA 2RL3A 3IF6A 2ZMAA 3W4OA 3EQVA 5HW3A 3TOIA 1DJBA 3ZDJA 1CEGA 4E3JA 1MWSA 2IWCA 4X6TA 2XK1A 3EQUA 1XPBA 3V50A 4KZ6A 1ES2A 1G68A 4QB8A 3IH8A 3BRMA 4KZBA 1BLHA 3NDEA 1SKFA 4KENB 1JTGA 4HESA 1K38A 4U0TA 5DTSA 2Y2OA 2Y2HA 4QU3A 4M3KA 4EV4A 4JF4A 1PWGA 2Y2QA 4KZ3A 5BOHA 4X69A 1RGYA 1BLPA 2BLSA 4FSFA 2HDQA 5FA7A 4OQGA 2WAFA 1BUEA 1FSWA 3NCKA 1XX2A 3O87A 2WZZA 3VP1A 5EOEA 5TR7A 3VSLA 3P98A 1ZG6A 2Q9MA 2V20A 4ID4A 3C7VA 3FYZA 3ZVWA 1JVJA 2WZXA 4N1XA 4JF5A 4WZ5C 4IVIA 3MXRA 3W8KA 1XA1A 2P74A 2X01A 3ZGAB 3HLCA 3FKWA 4DRTA 3S1YA 3ZVTA 4UA6A 2QMIA 4Z9QA 1IEMA 3UPPA 4DXBA 1LHYA 3OC2A 3G32A 1E4DA 4JXVA 5CHMA 4KZ9A 4OP8A 3IWQA 3C4OA 1CEFA 1W5DA 1J9MA 3A3IA 4R4RA 1KE4A 1TDGA 3N8SA 5FQJA 4E3MA 4E6WA 3IXGA 4EWFA 2ZC4B 2HP5A 3P09A 1K4FA 1O7EA 1Y54A 4BL3A 2J8YA 1BSGA 4DE2A 5TFQA 3PTEA 4C6YA 1MWTA 2ZQ8A 5A93A 4GOGA 1PI5A 2WKHA 5M1AA 2V2FF 4ZJ3A 2EX9A 3WRZA 4D2OA 2EXAA 4PMAA 3N4IA 3ZHHA 1BZAA 2A3UA 1S6RA 4Y0UA 5J8XA 2JC7A 3A3JA 3FZCA 5FDHA 5FI2A 4MEZA 1YMSA 4XXRA 4OOYA 4LCLA 1W8QA 2HP9A 4OOMA 5FSRA 4C75A 3O86A 3C5AA 4GB7A 4P0MA 1W79A 2HP6A 5EVIB 4KZ4A 2R9WA 1PI4A 4N92A 3SH7A 1NZOA 4KQQA 4K0WA 3PBOA 3IT9A 2RCXA 3PBRA 1FSYA 2ZM2A 2GDNA 3UDFA 2H0TA 1YLPA 4KZAA 1KDSA 1W8YA 2G2WA 1W7FA 1IELA 2ZM8A 3S22A 1K6RA 1WYBA 5TGFA 1NRFA 1QMFA 3IF6C 3BYDA 3MKEA 3MZEA 3IH9A 4DE3A 2QZ6A 2WGIA 5KMWA 4OPQA 4WYYA 4HEFA 1EROA 3WWXA 3JYIA 3UY6A 4N9KA 3UE0A 4IEDA 2Y2LA 4S2KA 3A3FA 5DF8A 4JF6A 3MZDA 1YLJA 4DF6A 4OVDA 1EWZA 3LO7A 1SDEA 3BECA 2P9VA 4HBUA 4OQHA 2PU2A 3NDGA 1ZC2A 4QY5A 1BULA 1PYYA 1XXMA 3VP0A 3ZNTA 1KDWA 4PPRA 1ERMA 3A3DA 3IHBA 2Y4AA 3HVFA 4PM8A 4B88A 1FOFA 3DTMA 3RXWA 3PAEA 1FR6A 4GN2A 5HL1A 2XH9A 5DTKA 5AQBA 4JXSA 2H10A 3O3VA 4PM6A 2ZQAA 3HREA 4X53A 3SS5A 3VP2A 3W4QA 3MKFA 2UWXA 2WGWA 3M6BA 1H5XA 3IXBA 4KQRA 5EOOA 3SOIA 4JXWA 1ONGA 1JWPA 4E3KA 1H8YA 4EUZA 4YFMA 2XFSA 3NI9A 2H0YA 1Q2QA 1IKIA 3UN7A 5AQ9A 3GQZA 1I2SA 2XDMA 3MXSA 3I7JA 2H5SA 5GLCA 4CJNA 3VMAA 1Z6FA 1KGFA 1NZUA 4IBRA 2Y2GA 3PAGA 1ZG4A 2VGKA 4LV0A 1GHPA 1N4OA 4RX2A 5I94A 5FQ9A 5EPHA 1PWCA 2EFUA 1CK3A 3FWLA 4ZJ1A 2ZQ9A 1RCJA 1RP5A 2R9XA 3DWKA 4GD6A 5M19A 2Y2JA 1AXBA 3W4PA 1C3BA 1ONHA 1PWDA 3OPHA 4B4ZA 4GKUA 4LV1A 4HBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZG7 B;  3GR2 A;  2CC1 A;  5HAR A;  3IHA A;  3IWO A;  1FCM A;  3WRT A;  3ISG A;  1YM1 A;  4N1H A;  3FV7 A;  5CXW A;  2XR0 A;  1QME A;  2B5R A;  2Y59 A;  3VP3 A;  1KVL A;  2EX8 A;  3BFF A;  3HLG A;  1M40 A;  4S2N A;  5CHJ A;  2Y2M A;  2Y2I A;  5L2F A;  4WM9 A;  2WKI A;  1YLZ A;  5F1G A;  1XA7 A;  5U47 A;  4DE0 A;  3CJM A;  3ZCZ A;  1IYP A;  5E2H A;  1K57 A;  4S2L A;  4BLM A;  4KG5 A;  2Y55 A;  4RYE A;  4JKT A;  4PM9 A;  1M6K A;  2J9P A;  1JWZ A;  4EBP A;  1BTL A;  4JBF A;  3TSG A;  1XGI A;  4X55 A;  3ZG8 B;  1ESI A;  1IYQ A;  1PIO A;  2Y2K A;  3G30 A;  4S2O A;  3SS3 A;  1PW1 A;  5CER A;  4BD0 A;  3FKV A;  1OME A;  2JCH A;  3V3R A;  3HLB A;  1E3U A;  1K56 D;  2A49 A;  1KE3 A;  4WMC A;  1H8Z A;  5GHZ A;  3MBZ A;  5FI7 A;  3ZG5 A;  3UPN A;  4E3L A;  4BJP A;  1NXY A;  3UE3 A;  1IKG A;  1MPL A;  3AGF A;  4BQM A;  4GZB A;  4ZTK A;  3ZNY A;  3ZG0 A;  3CZD A;  5FAQ A;  2DRW A;  3LEZ A;  5M18 A;  1HD8 A;  5HFO A;  2HDR A;  3GRJ A;  2I72 A;  3LCE A;  2HDU A;  3HLD A;  4P87 A;  4E6X A;  4FH4 A;  3VFH A;  4LEN A;  3WS0 A;  3ZFZ A;  4CPK A;  5E2E A;  5KSC A;  1KVM A;  3G4P A;  2ZLY A;  4BL2 A;  3IF5 A;  3Q7Z A;  1GHM A;  1HVB A;  3BFG A;  4KQO A;  4RX3 A;  4WZ4 A;  1O07 A;  2C5W B;  3G35 A;  4PM5 A;  5GHY A;  4QHC A;  1NJ4 A;  2Z2L B;  1KGE A;  5E2G A;  3NC8 A;  1I2W A;  1IYO A;  3IQA A;  3HLF A;  1YMX A;  2E8I A;  2XD1 A;  3QNC A;  3VFF A;  5CGS A;  1KE0 A;  1GCE A;  4OOL A;  1WE4 A;  2OLV A;  1EI5 A;  5E43 A;  3WS4 A;  3NBL A;  4GDN A;  4KZ7 A;  4WEK A;  2XD5 A;  1GA0 A;  1HTZ A;  1K55 C;  1U60 A;  3GV9 A;  3G2Z A;  3OPR A;  2G2U A;  5CTM A;  4FH2 A;  4OLD A;  2WK0 A;  3N8L A;  3VOY A;  2Q9N A;  1L2S A;  4GNU A;  2HPB A;  4WBG A;  3WS1 A;  3V5M A;  2ZC5 B;  4MBF A;  5JYP A;  4ZBE A;  3DW0 A;  3NIA A;  1E3U D;  1L0F A;  2WUQ A;  3BEB A;  4LV3 A;  4WMC D;  2XFT A;  4DE1 A;  3UPO A;  2WYX A;  4DKI A;  2WKE A;  2XQZ A;  5F1F A;  1HZO A;  3Q7V B;  2ZC6 B;  5HAQ A;  4XUZ A;  1K54 C;  3M2J A;  5FAP A;  4R1G A;  4DXC A;  3G31 A;  4BEN A;  3CG5 A;  5CTN A;  1NYM A;  1E25 A;  2Z2M B;  4U3T A;  4UHU A;  2EFX A;  4OH0 A;  3N6I A;  4OKP A;  3HUO A;  1GA9 A;  4IVK A;  2JBF A;  4Y7P A;  1FQG A;  2OLU A;  2Y2N A;  4OQI A;  3OCL A;  3IXD A;  4S2J A;  5DVA A;  3WS5 A;  5AQ7 A;  5EVI D;  4QY6 A;  4N9L A;  1K55 A;  1YLW A;  5AQA A;  5CEB A;  1K4E A;  3G34 A;  5FQM A;  4RVA A;  3UE1 A;  3PBN A;  4S2N C;  2WAD A;  3SS4 A;  5CEC A;  1ERQ A;  4RA7 A;  2OV5 A;  1GHI A;  4R4S A;  1Q2P A;  3IF6 B;  3UO9 A;  1LL5 A;  4KG2 A;  1ALQ A;  3BFD A;  1ESU A;  3VSK A;  1K57 C;  2X02 A;  4MBK A;  1VM1 A;  1ZKJ A;  1K56 A;  3AGD A;  4E3I A;  4R3J A;  3CMZ A;  3PBQ A;  5E2F A;  3BLS A;  4L0L A;  3BFE A;  2Y91 A;  5GLD A;  5A91 A;  4OQ0 A;  2QPN A;  1K54 A;  4QD4 A;  5JYO A;  4NET A;  4U0X A;  2JE5 A;  2ZD8 A;  2WAE A;  5GLB A;  3GMW A;  3PBT A;  1KGG A;  1PZO A;  1TVF A;  2EX6 A;  3HUN A;  4S2P A;  3ZG9 B;  3D4F A;  3HBR A;  5A90 A;  1I5Q A;  4K0X A;  2XF3 A;  3QNB A;  5GL9 A;  3B3X A;  1JTD A;  1DJA A;  1YLY A;  3Q82 A;  2ZQD A;  5CGX A;  3SH8 A;  4S2I A;  3E2L A;  1BLS A;  1DJC A;  2VGJ A;  4PM7 A;  4UA7 A;  4X56 A;  4YIN A;  3UNW A;  3ITB A;  3OPP A;  3MFD A;  2DNS A;  4C3Q A;  1YQS A;  4A5R A;  4R3B A;  3DWZ A;  5FQK A;  3BM6 A;  4DDY A;  1YLT A;  1YT4 A;  4XUX A;  4ZJ2 A;  3M2K A;  1XGJ A;  3Q1F A;  5GLA A;  1BLC A;  5EVI C;  1LLB A;  2OSU A;  4P85 A;  3WS2 A;  4JXG A;  4Y0T A;  4OLG A;  4UA9 A;  1IYS A;  5DF7 A;  4E3O A;  5F82 A;  1LI0 A;  1FCO A;  1VQQ A;  2FFY A;  5G18 A;  1CI9 A;  3MZF A;  5IHV A;  3N8R A;  2X71 A;  3O88 A;  3S4X A;  1N9B A;  1MWR A;  4GD8 A;  4OPR A;  2PBY A;  4LV2 A;  5FAS A;  5GHX A;  1BT5 A;  3UDI A;  4NK3 A;  4IBX A;  5KSH A;  4MNR A;  4KG6 A;  5CRF A;  1TEM A;  4R23 A;  1ES4 A;  4Y0O A;  1RGZ A;  2EX2 A;  2WGV A;  3V3S A;  1LI9 A;  1PZP A;  3PBS A;  1K6S A;  4R0Q A;  4S2M A;  5HAI A;  4EBL A;  4KZ8 A;  4B4X A;  2ZM0 A;  3A3E A;  3QHY A;  2ZC7 A;  4WZ5 A;  4JLF A;  2ZQ7 A;  1FCN A;  2J7V A;  5EVI A;  1SCW A;  2J9O A;  3UDX A;  2FFF B;  4MBH A;  1LL9 A;  1JWV A;  1SDN A;  1XKZ A;  4OP5 A;  1L0G A;  2IWD A;  4F94 A;  5FI6 A;  3HLE A;  4O7D A;  5A92 A;  5F83 A;  5FQQ A;  2V1Z A;  3GVB A;  2ZQC A;  4UAA A;  3LY3 A;  4EBN A;  3N7W A;  4BD1 A;  2EXB A;  4OON A;  4MLL A;  3GTC A;  5KZH A;  3NY4 A;  1NY0 A;  4KZ5 A;  1MBL A;  4LCM A;  5CHU A;  5CED A;  5EEC A;  1MXO A;  2XEP A;  4GDB A;  3E2K A;  3GSG A;  1G6A A;  1PW8 A;  5EVL A;  3OZH A;  2BG1 A;  3IWI A;  3HLW A;  2PU4 A;  1MY8 A;  3RJU A;  1WYC A;  3OCN A;  3M6H A;  4P6B A;  2XLN A;  2C6W B;  3Q81 A;  1ES3 A;  5DF9 A;  3BLM A;  3SH9 A;  3V39 A;  3VOZ A;  4DDS A;  4X68 A;  3AGE A;  5FQI A;  1K25 A;  4EQI A;  4QJG A;  1FR1 A;  3HL9 A;  4H8R A;  2XGN A;  5DTT A;  1DY6 A;  3TG9 A;  3BFC A;  5CGW A;  2P9V B;  1XP4 A;  3HUM A;  4WEL A;  4E3N A;  3Q7V A;  5FAT A;  3ITA A;  1TDL A;  3C4P A;  4FD8 A;  4OPZ A;  1L0D A;  3RXX A;  5EE8 A;  5HAP A;  4WEJ A;  5HX9 A;  3G2Y A;  4ZAM A;  1S0W A;  3C7U A;  3LY4 A;  1MKI A;  3OPL A;  1MWU A;  5D3O A;  2ZJ9 A;  4K91 A;  2DCF A;  2WGW B;  3IXH A;  5EUA A;  1ES5 A;  2IWB A;  4OPY A;  2ZC3 B;  4FCF A;  1CI8 A;  1L0E A;  3Q07 A;  4JPM A;  3VP4 A;  4Q8I A;  2HDS A;  5FAO A;  1SHV A;  2Y2P A;  1NYY A;  4ZDX A;  2RL3 A;  3IF6 A;  2ZMA A;  3W4O A;  3EQV A;  5HW3 A;  3TOI A;  1DJB A;  3ZDJ A;  1CEG A;  4E3J A;  1MWS A;  2IWC A;  4X6T A;  2XK1 A;  3EQU A;  1XPB A;  3V50 A;  4KZ6 A;  1ES2 A;  1G68 A;  4QB8 A;  3IH8 A;  3BRM A;  4KZB A;  1BLH A;  3NDE A;  1SKF A;  4KEN B;  1JTG A;  4HES A;  1K38 A;  4U0T A;  5DTS A;  2Y2O A;  2Y2H A;  4QU3 A;  4M3K A;  4EV4 A;  4JF4 A;  1PWG A;  2Y2Q A;  4KZ3 A;  5BOH A;  4X69 A;  1RGY A;  1BLP A;  2BLS A;  4FSF A;  2HDQ A;  5FA7 A;  4OQG A;  2WAF A;  1BUE A;  1FSW A;  3NCK A;  1XX2 A;  3O87 A;  2WZZ A;  3VP1 A;  5EOE A;  5TR7 A;  3VSL A;  3P98 A;  1ZG6 A;  2Q9M A;  2V20 A;  4ID4 A;  3C7V A;  3FYZ A;  3ZVW A;  1JVJ A;  2WZX A;  4N1X A;  4JF5 A;  4WZ5 C;  4IVI A;  3MXR A;  3W8K A;  1XA1 A;  2P74 A;  2X01 A;  3ZGA B;  3HLC A;  3FKW A;  4DRT A;  3S1Y A;  3ZVT A;  4UA6 A;  2QMI A;  4Z9Q A;  1IEM A;  3UPP A;  4DXB A;  1LHY A;  3OC2 A;  3G32 A;  1E4D A;  4JXV A;  5CHM A;  4KZ9 A;  4OP8 A;  3IWQ A;  3C4O A;  1CEF A;  1W5D A;  1J9M A;  3A3I A;  4R4R A;  1KE4 A;  1TDG A;  3N8S A;  5FQJ A;  4E3M A;  4E6W A;  3IXG A;  4EWF A;  2ZC4 B;  2HP5 A;  3P09 A;  1K4F A;  1O7E A;  1Y54 A;  4BL3 A;  2J8Y A;  1BSG A;  4DE2 A;  5TFQ A;  3PTE A;  4C6Y A;  1MWT A;  2ZQ8 A;  5A93 A;  4GOG A;  1PI5 A;  2WKH A;  5M1A A;  2V2F F;  4ZJ3 A;  2EX9 A;  3WRZ A;  4D2O A;  2EXA A;  4PMA A;  3N4I A;  3ZHH A;  1BZA A;  2A3U A;  1S6R A;  4Y0U A;  5J8X A;  2JC7 A;  3A3J A;  3FZC A;  5FDH A;  5FI2 A;  4MEZ A;  1YMS A;  4XXR A;  4OOY A;  4LCL A;  1W8Q A;  2HP9 A;  4OOM A;  5FSR A;  4C75 A;  3O86 A;  3C5A A;  4GB7 A;  4P0M A;  1W79 A;  2HP6 A;  5EVI B;  4KZ4 A;  2R9W A;  1PI4 A;  4N92 A;  3SH7 A;  1NZO A;  4KQQ A;  4K0W A;  3PBO A;  3IT9 A;  2RCX A;  3PBR A;  1FSY A;  2ZM2 A;  2GDN A;  3UDF A;  2H0T A;  1YLP A;  4KZA A;  1KDS A;  1W8Y A;  2G2W A;  1W7F A;  1IEL A;  2ZM8 A;  3S22 A;  1K6R A;  1WYB A;  5TGF A;  1NRF A;  1QMF A;  3IF6 C;  3BYD A;  3MKE A;  3MZE A;  3IH9 A;  4DE3 A;  2QZ6 A;  2WGI A;  5KMW A;  4OPQ A;  4WYY A;  4HEF A;  1ERO A;  3WWX A;  3JYI A;  3UY6 A;  4N9K A;  3UE0 A;  4IED A;  2Y2L A;  4S2K A;  3A3F A;  5DF8 A;  4JF6 A;  3MZD A;  1YLJ A;  4DF6 A;  4OVD A;  1EWZ A;  3LO7 A;  1SDE A;  3BEC A;  2P9V A;  4HBU A;  4OQH A;  2PU2 A;  3NDG A;  1ZC2 A;  4QY5 A;  1BUL A;  1PYY A;  1XXM A;  3VP0 A;  3ZNT A;  1KDW A;  4PPR A;  1ERM A;  3A3D A;  3IHB A;  2Y4A A;  3HVF A;  4PM8 A;  4B88 A;  1FOF A;  3DTM A;  3RXW A;  3PAE A;  1FR6 A;  4GN2 A;  5HL1 A;  2XH9 A;  5DTK A;  5AQB A;  4JXS A;  2H10 A;  3O3V A;  4PM6 A;  2ZQA A;  3HRE A;  4X53 A;  3SS5 A;  3VP2 A;  3W4Q A;  3MKF A;  2UWX A;  2WGW A;  3M6B A;  1H5X A;  3IXB A;  4KQR A;  5EOO A;  3SOI A;  4JXW A;  1ONG A;  1JWP A;  4E3K A;  1H8Y A;  4EUZ A;  4YFM A;  2XFS A;  3NI9 A;  2H0Y A;  1Q2Q A;  1IKI A;  3UN7 A;  5AQ9 A;  3GQZ A;  1I2S A;  2XDM A;  3MXS A;  3I7J A;  2H5S A;  5GLC A;  4CJN A;  3VMA A;  1Z6F A;  1KGF A;  1NZU A;  4IBR A;  2Y2G A;  3PAG A;  1ZG4 A;  2VGK A;  4LV0 A;  1GHP A;  1N4O A;  4RX2 A;  5I94 A;  5FQ9 A;  5EPH A;  1PWC A;  2EFU A;  1CK3 A;  3FWL A;  4ZJ1 A;  2ZQ9 A;  1RCJ A;  1RP5 A;  2R9X A;  3DWK A;  4GD6 A;  5M19 A;  2Y2J A;  1AXB A;  3W4P A;  1C3B A;  1ONH A;  1PWD A;  3OPH A;  4B4Z A;  4GKU A;  4LV1 A;  4HBT A; 
#chains in the Genus database with same CATH topology
 3ZG7 B;  4G3V A;  3D72 A;  1YM1 A;  4N1H A;  1GSX A;  2VV8 A;  3VP3 A;  2EX8 A;  3BFF A;  5G4Y A;  4S2N A;  2Y2M A;  2Y2I A;  5L2F A;  1DP9 A;  5U47 A;  2FZ0 A;  4JGR A;  5FL3 A;  2GJ3 A;  1DRM A;  4S2L A;  2PD7 A;  1PNE A;  4DMZ A;  2J9P A;  1JWZ A;  1LSW A;  1XGI A;  1ESI A;  1PIO A;  4S2O A;  5HWV A;  2VJW A;  4BD0 A;  1PW1 A;  2JKF A;  5GHZ A;  3ZG5 A;  3UPN A;  1VHM A;  3UE3 A;  2AVX A;  4GZB A;  3ZG0 A;  3CZD A;  1WA9 A;  2G7U A;  3GRJ A;  2I72 A;  3KO6 A;  3HLD A;  3ZFZ A;  3HJK A;  5E2E A;  1P97 A;  3E98 A;  3Q7Z A;  4RX3 A;  4PM5 A;  4QHC A;  1NJ4 A;  3IBJ A;  3QNC A;  1WE4 A;  3S7O A;  3NBL A;  4WEK A;  1GA0 A;  1HTZ A;  1U60 A;  5CTM A;  3E4O A;  2K2N A;  3S7N A;  5JYP A;  2PR5 A;  3DW0 A;  3H82 A;  1E3U D;  4WMC D;  3OBF A;  4DE1 A;  2NUP C;  4DKI A;  2WKE A;  3F1O B;  3M2J A;  5FAP A;  3E4Q A;  4BEN A;  3CG5 A;  1DP8 A;  1NYM A;  4GJ4 A;  5HWW A;  3CPT B;  3HUO A;  1VET A;  4Y7P A;  2OLU A;  4OQI A;  4N9L A;  5DKL A;  1P9W A;  4RVA A;  1F9I A;  2WAD A;  4XT2 B;  5CEC A;  1ERQ A;  2P7J A;  1GHI A;  3UMD A;  1LL5 A;  2PT7 A;  3PBQ A;  4OQ0 A;  1ODV A;  3LYX A;  3C30 A;  4QD4 A;  5JYO A;  4ETX A;  1G28 A;  2WAE A;  3GMW A;  3IBR A;  3PBT A;  1K0K A;  1KGG A;  1TVF A;  1JTD A;  1T1B A;  2J3W A;  4YIN A;  3OPP A;  4A5R A;  2XRN A;  3BM6 A;  2W3H A;  4XUX A;  3M2K A;  5GLA A;  3UE6 A;  4I39 A;  3WS2 A;  4JXG A;  2CMN A;  1YAX A;  5DF7 A;  5LBR A;  5F82 A;  2NUT C;  1LI0 A;  1CI9 A;  3MZF A;  3N8R A;  2PRF A;  1N9B A;  4MDZ A;  4ARZ A;  1BT5 A;  2PYP A;  3A0V A;  5KSH A;  2P04 A;  1ES4 A;  1RGZ A;  5J7E A;  2WGV A;  1LI9 A;  1PZP A;  1K6S A;  5HAI A;  2J3T D;  1CJF A;  4EBL A;  2ZM0 A;  3QP5 A;  4JLF A;  2ZQ7 A;  3QP6 A;  4FOF A;  3UDX A;  1JWV A;  1XKZ A;  3R7W A;  1L0G A;  4O7D A;  4X1L A;  4UAA A;  3LY3 A;  4CLC B;  1MBL A;  3PYP A;  5CHU A;  2V1B A;  1MXO A;  3A0S A;  2XEP A;  4EEP A;  1NLY A;  1PW8 A;  3OZH A;  1YPR A;  4P6B A;  3BLM A;  4X25 A;  3VOZ A;  4BMW A;  2V0W A;  1FR1 A;  3HUM A;  3C38 A;  1TDL A;  2KX6 A;  3B47 A;  3C4P A;  4FD8 A;  5EE8 A;  4WEJ A;  1S0W A;  3LY4 A;  5EUA A;  2ZC3 B;  2INW A;  4JPM A;  5FAO A;  1VEU B;  2JKR I;  2RL3 A;  3A0R A;  2ZMA A;  3EQV A;  1CEG A;  1P9R A;  2IWC A;  1YSP A;  3GEC A;  4HP4 A;  1T1C A;  3V50 A;  4CLC D;  3BRM A;  1UWN X;  1F5M A;  4HES A;  4U0T A;  3BQA A;  4QU3 A;  3F1P B;  4M3K A;  4JF4 A;  2QJ5 A;  2Y2Q A;  2O99 A;  4X69 A;  2ZOI A;  5TR7 A;  3P98 A;  1ZG6 A;  2LB5 A;  2V20 A;  4ID4 A;  4O01 A;  3FYZ A;  3ZVW A;  1S1Y A;  2WZX A;  4WZ5 C;  3ZGA B;  3CIT A;  1IEM A;  4DXB A;  1LHY A;  5CHM A;  4OP8 A;  3IWQ A;  1BYW A;  1S4S A;  1TDG A;  3ZQ5 A;  3P09 A;  1K4F A;  2E8J A;  2J8Y A;  1TS6 A;  3PTE A;  2KOI A;  4GOG A;  5F68 A;  3ZHH A;  1S6R A;  3S7P A;  3FZC A;  5J3W A;  3CWF A;  1S4R A;  2OAQ 1;  2HP9 A;  2D01 A;  4OOM A;  1S66 L;  3C5A A;  1OTB A;  4KZ4 A;  4R3A A;  4WF0 A;  3PBO A;  2RCX A;  1P0Z A;  2H0T A;  2O0Y A;  3VE3 A;  1W7F A;  1WYB A;  1NRF A;  2KLI A;  3IH9 A;  2QZ6 A;  1HLU P;  4OPQ A;  2PHY A;  2VA0 A;  4O8G A;  3UY6 A;  2Y2L A;  4S2K A;  3A3F A;  4DF6 A;  3H82 B;  1SDE A;  3BEC A;  4HBU A;  3LFV A;  1BUL A;  1PYY A;  4EET B;  2YKF A;  4ME4 A;  3A3D A;  3K2N A;  2Y4A A;  3HVF A;  4PM8 A;  4PKY G;  5HL1 A;  5AQB A;  3FPW A;  4JXS A;  2H10 A;  1VET B;  2UWX A;  2WGW A;  3M6B A;  1FIL A;  3IXB A;  5EOO A;  1OJ5 A;  2UV0 E;  4CLC E;  4EU0 A;  2ZMF A;  5CX7 A;  2H0Y A;  3GQZ A;  4EES A;  2JHE A;  1J3W A;  1NZU A;  4IBR A;  1ZG4 A;  2VGK A;  4LV0 A;  4I3A A;  3FWL A;  4GW9 A;  3W4P A;  1C3B A;  1ONH A;  3MF0 A;  4NEE D;  1XFQ A;  3GR2 A;  2HZ5 A;  2R78 A;  1FCM A;  3UB5 P;  3UB7 A;  1QME A;  2Y59 A;  3KSG A;  1KVL A;  1XJ3 A;  3HLG A;  5CHJ A;  2WKR A;  2WKI A;  1YLZ A;  2QJ7 A;  2MJ6 A;  3CJM A;  3VOL A;  3P01 A;  2O9C A;  4PM9 A;  3NOT C;  2JKT I;  1BTL A;  3TSG A;  4X55 A;  2PDR A;  3G30 A;  3T4K A;  4ARZ B;  4GS9 A;  2VV6 A;  3SS3 A;  5CER A;  1OME A;  4HH3 A;  3V3R A;  3DTI A;  3T1S A;  1KE3 A;  4HJ4 A;  1GSW A;  4BJP A;  5HL6 A;  4BQM A;  3ZNY A;  5FAQ A;  1HD8 A;  2WKQ A;  2HDR A;  3LCE A;  4EW7 A;  2HDU A;  4E6X A;  4FH4 A;  3VFH A;  4LEN A;  3R7W B;  1T19 A;  4BL2 A;  1GHM A;  1O07 A;  2C5W B;  4MN7 A;  5HPI A;  5GHY A;  2Z2L B;  4MN5 A;  5E2G A;  3NC8 A;  2K7S A;  4I5S A;  1S67 L;  1YMX A;  2E8I A;  2XD1 A;  2Y8H A;  3LUQ A;  5CGS A;  2OLV A;  1EI5 A;  1SKO A;  3EGD C;  4KZ7 A;  1K55 C;  3GV9 A;  2I9V A;  3G2Z A;  3LR4 A;  1G6O A;  3QP8 A;  3VOY A;  2VLG A;  3V5M A;  2ZC5 B;  3BEB A;  4LRZ E;  3UPO A;  2WYX A;  2XQZ A;  5F1F A;  2ZC6 B;  5HAQ A;  3CHW P;  5CTN A;  4U3T A;  3N6I A;  3TJZ C;  4ESP A;  1K55 A;  1YLW A;  3JVV A;  3UE1 A;  4S2N C;  4RA7 A;  1Q2P A;  5F69 A;  3BFD A;  3LR3 A;  3RTY A;  3T4L A;  1ESU A;  1VM1 A;  3IX3 A;  4Y17 A;  3JVU A;  4R3J A;  4E3I A;  5GLD A;  3BFE A;  2QPN A;  5L8M A;  1ACF A;  4R38 A;  4NET A;  1MKM A;  2JE5 A;  3GDI A;  1PZO A;  5A90 A;  4S2P A;  3ZG9 B;  4H6J A;  3QNB A;  4DJ3 A;  1IFQ A;  4X1M A;  2ZQD A;  4S2I A;  3RFB A;  5EM1 A;  4X56 A;  4IHQ A;  4R3B A;  3U4L P;  4ZJ2 A;  1H0M A;  1BLC A;  1LLB A;  2OSU A;  4Y0T A;  1IYS A;  1CQA A;  3O5Y A;  2FFY A;  1VQQ A;  5G18 A;  3D3O A;  3LEQ A;  2P08 A;  4F3L A;  1MWR A;  2VX8 A;  4GD8 A;  1ZHH B;  4DJ2 A;  2FH5 A;  5GHX A;  4NK3 A;  4Q0I A;  5EVE A;  4IBX A;  5CRF A;  3BW6 A;  1Y4O A;  3PBS A;  4R0Q A;  3A3E A;  3NEC A;  3QHY A;  3MQ0 A;  4Y5F A;  4MBH A;  1LL9 A;  4OP5 A;  3MS6 A;  5FEG A;  2QWS A;  5F83 A;  2ZQC A;  4EBN A;  4GHI A;  3GTC A;  3BY9 A;  3NY4 A;  5CED A;  4GDB A;  3GSG A;  2BG1 A;  3EEA A;  5F6A A;  2PU4 A;  3RJU A;  3OCN A;  3EOI A;  2XLN A;  2Z6C A;  4EQI A;  4QJG A;  2EWV A;  4H8R A;  2XGN A;  5DTT A;  1DY6 A;  3TG9 A;  4E3N A;  3Q7V A;  5FAT A;  3IX8 A;  4OPZ A;  4WUJ A;  3RXX A;  2L1M A;  2B18 A;  3G2Y A;  4ZAM A;  3LIB A;  3K3D A;  3C7U A;  1MKI A;  5HZH A;  1MWU A;  5EFW A;  3LR5 A;  4K91 A;  2DCF A;  2WGW B;  4ZRR A;  1ES5 A;  4M4X A;  3Q07 A;  1SHV A;  1NYY A;  1OJG A;  1X0O A;  3IF6 A;  1DP6 A;  3UB9 A;  2V8C A;  3OOV A;  4KZ6 A;  5HDC A;  3IH8 A;  4KZB A;  3NDE A;  4KEN B;  2GZA A;  1K38 A;  5DTS A;  4HHD A;  2VGL M;  5IU1 A;  5HPF A;  1RGY A;  2BLS A;  2HDQ A;  3NCK A;  1FSW A;  5TBM A;  4LLO B;  5EOE A;  3VSL A;  4B9O A;  3C7V A;  4IVI A;  3MXR A;  1XA1 A;  2X01 A;  2V8F A;  3HLC A;  3FKW A;  3CUE C;  3ZVT A;  3DTK A;  2ZMV A;  4NXB A;  2QMI A;  4Z9Q A;  2W3G A;  4HJ3 A;  1W5D A;  1KE4 A;  5FQJ A;  2JKR M;  3IXG A;  2ZC4 B;  2HP5 A;  3BQ8 A;  1Y54 A;  4GS9 B;  4DE2 A;  5TFQ A;  2B02 A;  4ZJ3 A;  3NHQ A;  3L7H A;  4L9F A;  4PMA A;  4LPZ A;  3CUE A;  3L9K A;  5J8X A;  4HP9 A;  5AJG A;  4MEZ A;  4OOY A;  4LCL A;  5FSR A;  4C75 A;  3P7N A;  2HP6 A;  3MXQ A;  5EVI B;  1GSV A;  4YWZ A;  4Q0H A;  4N92 A;  3SH7 A;  4KQQ A;  3PBR A;  1W63 M;  2GDN A;  3T4J A;  1KOU A;  1TS7 A;  4KZA A;  1KDS A;  1IEL A;  2VK3 A;  1QMF A;  1SKO B;  3MKE A;  3WWX A;  3SZT A;  3JYI A;  3LIF A;  4CQH A;  1UGU A;  3T1X A;  2P9V A;  4L9G A;  4OQH A;  3NDG A;  5DFY A;  4QY5 A;  4P6Z M;  3TW8 A;  2VEA A;  1XXM A;  3VP0 A;  3ZNT A;  3IHB A;  1FOF A;  3RXW A;  3NJA A;  3SW1 A;  1FR6 A;  2OAP 1;  4PHT A;  2ZQA A;  1LSV A;  3HRE A;  3H9W A;  3VP2 A;  3W4Q A;  3MKF A;  2HGV A;  1XJ2 A;  1ONG A;  4E3K A;  2XRO A;  1H8Y A;  4EUZ A;  3NI9 A;  2ZBB A;  3NOP C;  2XDM A;  1D06 A;  5GLC A;  1KGF A;  5DKK A;  5HSQ A;  3KYE A;  4RX2 A;  3UME A;  5EPH A;  1PWC A;  2EFU A;  4ZJ1 A;  4GD6 A;  3DWK A;  5M19 A;  4H6J B;  4UQI M;  3OPH A;  4LV1 A;  4HBT A;  4Y15 A;  3IWO A;  5CXW A;  5AVF A;  1LSX A;  1F2K A;  2DMW A;  4IUH A;  4HY8 A;  5F1G A;  1XA7 A;  3IS2 A;  4DE0 A;  4HJ6 A;  3ZCZ A;  1IYP A;  5E2H A;  1K57 A;  4KG5 A;  2Y55 A;  1IOU A;  4YNR A;  1M6K A;  5F5Y A;  3MMH A;  4EBP A;  3ZG8 B;  2JKG A;  4F3L B;  3UB8 A;  2JCH A;  1E3U A;  4WMC A;  1H8Z A;  3MBZ A;  3T4O A;  2OWJ A;  4E3L A;  3K3C A;  1IKG A;  1MPL A;  3AGF A;  2DRW A;  5EM0 A;  3LID A;  4L9E A;  3NUL A;  1YSQ A;  5HFO A;  4EEU A;  4P87 A;  3B42 A;  3WS0 A;  3MJQ A;  4CPK A;  1KVM A;  2HV1 A;  3G4P A;  1L3L A;  2ZLY A;  3IF5 A;  4ETZ A;  1HVB A;  3BFG A;  4KQO A;  4GHI B;  3VFF A;  4OOL A;  5EV0 A;  3LI9 A;  3OPR A;  2G2U A;  2A24 A;  2J80 A;  2JN7 A;  4OLD A;  4FTX A;  1TF1 A;  4GNU A;  2JKT M;  2HPB A;  4WBG A;  4MBF A;  4ZBE A;  2WUQ A;  1D1J A;  2HF6 A;  3Q7V B;  4FUW A;  4XUZ A;  1K54 C;  3T4T A;  3G31 A;  1E25 A;  2Z2M B;  4UHU A;  4OKP A;  3DAV A;  2JBF A;  1FQG A;  4S2J A;  5DVA A;  4QY6 A;  5AQA A;  5CEB A;  5FQM A;  3PBN A;  3HJI A;  3MR0 A;  2M7V A;  2OV5 A;  3IF6 B;  3UO9 A;  1ALQ A;  3W2Z A;  1ZKJ A;  1K56 A;  3AGD A;  5E2F A;  4L0L A;  1K54 A;  2W3E A;  4U0X A;  2EX6 A;  3HUN A;  1JNU A;  3D4F A;  3QP4 A;  1I5Q A;  4K0X A;  3B3X A;  1YLY A;  5CGX A;  3SH8 A;  3E2L A;  1BLS A;  1DJC A;  3LIA A;  4PM7 A;  4UA7 A;  3UNW A;  5TBM B;  2DNS A;  3C8C A;  1YQS A;  5HD3 A;  5FQK A;  2XSS A;  4LRY C;  3KSF A;  4DDY A;  3BY8 A;  4D60 A;  1YT4 A;  3F1N A;  4G3W A;  4O0P A;  1XGJ A;  5EVI C;  4P85 A;  4OLG A;  4E3O A;  2LB9 A;  5IT5 A;  2ZOH A;  3O88 A;  3S4X A;  2VV7 A;  2PBY A;  5FAS A;  1PFL A;  4DN0 A;  1PRQ A;  2KDK A;  4KG6 A;  4R23 A;  2EX2 A;  4KZ8 A;  2J7V A;  5EVI A;  2J9O A;  1T1A A;  1MZU A;  2FFF B;  1SDN A;  3KYZ A;  4F94 A;  3HLE A;  5FQQ A;  2XA7 M;  3N7W A;  4BD1 A;  2VZW A;  4OON A;  4MLL A;  5KZH A;  5HDS A;  5EEC A;  1OTE A;  1T18 A;  4JGO A;  3E2K A;  1G6A A;  5EVL A;  1WYC A;  1ES3 A;  3SH9 A;  5KIZ A;  3AGE A;  1K25 A;  4Y2F A;  2O9A A;  3HL9 A;  2Q0O A;  1V9Y A;  2P9V B;  1L0D A;  2K31 A;  5K5B A;  5DJT A;  5D3O A;  3IXH A;  5FDS A;  4FCF A;  1CI8 A;  3VP4 A;  2HDS A;  2Y2P A;  4ZDX A;  4G3K A;  5HW3 A;  4NXF A;  3ZDJ A;  4X6T A;  2XK1 A;  3EQU A;  1XPB A;  3LIC A;  4I38 A;  4EER A;  2Y2H A;  3FPV A;  1VB6 A;  4WL9 A;  4EV4 A;  4R70 A;  1PWG A;  5BOH A;  1ZTU A;  5HWT A;  4I3J A;  1XX2 A;  1Z09 A;  2V9A A;  4EUV A;  4N1X A;  4IJG A;  4JF5 A;  3S1Y A;  3IS2 B;  2OWH A;  3KSI A;  3OC2 A;  3G32 A;  3V67 A;  4RQ9 A;  4KZ9 A;  3A3I A;  4R4R A;  1OTA A;  4E3M A;  4E6W A;  2ACG A;  1O7E A;  4BL3 A;  3CI6 A;  2ZQ8 A;  5A93 A;  3ZYT A;  1PI5 A;  5M1A A;  2V2F F;  5IS1 A;  2EXA A;  2W3D A;  3PXP A;  5TJJ A;  2A3U A;  4Y0U A;  1LL8 A;  3QP1 A;  2JC7 A;  4HIA A;  3A3J A;  2W0N A;  2L4R A;  1W8Q A;  5I5L A;  3O86 A;  4GB7 A;  2R9W A;  4K0W A;  3IT9 A;  1FSY A;  2ZM2 A;  3UDF A;  2ZM8 A;  3S22 A;  3T1R A;  3EWK A;  3IF6 C;  5HDD A;  3BYD A;  3MZE A;  4DE3 A;  4WYY A;  2A24 B;  4HEF A;  1ERO A;  2H28 A;  4B93 A;  4IED A;  4JF6 A;  3MZD A;  5FEF A;  1EWZ A;  2PD8 A;  3LO7 A;  2PU2 A;  1ZC2 A;  3LIE A;  4NKP A;  4B88 A;  1D7E A;  1TS8 A;  3PAE A;  5DTK A;  4X53 A;  3O3V A;  4PM6 A;  1H5X A;  2V0U A;  3SOI A;  4P6Z S;  2HJ9 C;  5MC7 A;  4YFM A;  2XFS A;  4Y3I A;  1Q2Q A;  1IKI A;  3FC7 A;  3UN7 A;  4EXO A;  5AQ9 A;  4I3I A;  4GLQ A;  5DFX A;  3MXS A;  3I7J A;  2H5S A;  1V9Z A;  4R6L A;  3VMA A;  1Z6F A;  1XJ6 A;  2EA9 A;  3B33 A;  3PAG A;  3TRC A;  5FQ9 A;  5L10 A;  1CK3 A;  1AWI A;  2ZQ9 A;  1RP5 A;  1S1Z A;  2R9X A;  1AXB A;  1N9O A;  1PWD A;  4GKU A;  4LFU A;  2PR6 A;  2CC1 A;  5HAR A;  3IHA A;  3T12 B;  3WRT A;  3ISG A;  3FV7 A;  2XR0 A;  2O9B A;  3S7Q A;  2B5R A;  2ZL1 A;  1M40 A;  4UQI S;  1OTD A;  4WM9 A;  2VKS A;  3F1N B;  3H7W B;  4BLM A;  4RYE A;  4JKT A;  4JBF A;  1IYQ A;  2Y2K A;  1STZ A;  3FKV A;  3HLB A;  1K56 D;  2A49 A;  5FI7 A;  2QHK A;  5DJU A;  1NXY A;  3LGO A;  1NLZ A;  3E0Y A;  2QYB A;  4WLA A;  3DBA A;  4ZTK A;  5M18 A;  3LEZ A;  1Y28 A;  2A2L A;  3IX4 A;  4KUK A;  2PAV P;  5KSC A;  3T4S A;  4WZ4 A;  3G35 A;  1KGE A;  1I2W A;  1IYO A;  3IQA A;  3HLF A;  1KE0 A;  1GCE A;  4BBV A;  5E43 A;  3WS4 A;  4GDN A;  4EQ1 A;  2XD5 A;  4FH2 A;  1YKD A;  2WK0 A;  3N8L A;  5AVE A;  2Q9N A;  1L2S A;  3WS1 A;  3NIA A;  4LV3 A;  1L0F A;  2XFT A;  1HZO A;  4R1G A;  4DXC A;  1NWZ A;  2EFX A;  4OH0 A;  1GA9 A;  4IVK A;  4MCW A;  2W1T A;  3MQQ A;  2Y2N A;  3OCL A;  3IXD A;  3WS5 A;  5AQ7 A;  5EVI D;  1K4E A;  3G34 A;  4BWI A;  3JPU A;  3SS4 A;  1OPX A;  1TS0 A;  2L0W A;  2EWW A;  4R4S A;  1H3Q A;  4Z1W A;  3T4Q A;  4KG2 A;  4Q0J A;  3VSK A;  1K57 C;  2X02 A;  4MBK A;  3CLO A;  3EEH A;  3CMZ A;  5A91 A;  3BLS A;  2Y91 A;  4HH2 A;  2ZD8 A;  5GLB A;  1TD5 A;  3HBR A;  2XF3 A;  5GL9 A;  1DJA A;  3Q82 A;  3KSH A;  1FIK A;  4MN6 A;  3PR6 A;  4KUO A;  4PKY A;  5L07 A;  4PAU A;  2VGJ A;  3ITB A;  4C3Q A;  3MFD A;  1W63 Q;  3ICY A;  3DWZ A;  3NOU C;  3FG8 A;  3MQO A;  1YLT A;  5J4E A;  1NRJ A;  3Q1F A;  4HNB A;  2W3F A;  4UA9 A;  1UWP X;  3R4K A;  3ULF A;  3UB6 A;  1XFN A;  1H8M A;  1FCO A;  5IHV A;  2X71 A;  4OPR A;  4LV2 A;  3UDI A;  4GCZ A;  1N9N A;  4MNR A;  1TEM A;  4Y0O A;  2HJE A;  3V3S A;  4HI4 A;  4S2M A;  4B4X A;  4II7 A;  2ZC7 A;  4WZ5 A;  3U2A A;  1FCN A;  1SCW A;  2IWD A;  5FI6 A;  5L09 A;  5A92 A;  1A0K A;  2V1Z A;  3GVB A;  4KQD A;  2EXB A;  4NXG A;  4JGP A;  2GX5 A;  1NY0 A;  4KZ5 A;  4QPR A;  4LCM A;  4Y13 A;  4LGW A;  1OT9 A;  3IWI A;  3HLW A;  1MY8 A;  2XA7 S;  3M6H A;  2C6W B;  3Q81 A;  5DF9 A;  3V39 A;  4DDS A;  4X68 A;  5FQI A;  2PYR A;  1F98 A;  3BFC A;  5CGW A;  1XP4 A;  4WEL A;  3ITA A;  3F1O A;  3TE8 A;  5C5K A;  5HAP A;  2J3T C;  3CPT A;  5HX9 A;  4LRX C;  3OPL A;  2ZJ9 A;  3LR0 A;  2IWB A;  4OPY A;  1L0E A;  3MFX A;  4JGQ A;  4Q8I A;  3DTE A;  4XT2 A;  3W4O A;  3TOI A;  1DJB A;  4E3J A;  1MWS A;  1G5U A;  1ES2 A;  1G68 A;  4QB8 A;  4YOF A;  3MSH A;  1BLH A;  1SKF A;  1JTG A;  1XJ4 A;  2Y2O A;  4MMN A;  4AFI A;  4KZ3 A;  2BAS A;  1BLP A;  4FSF A;  5FA7 A;  4OQG A;  1BUE A;  2WAF A;  2WKP A;  3O87 A;  2WZZ A;  2W27 A;  3VP1 A;  2QKP A;  2Q9M A;  1JVJ A;  2ZL1 B;  3H7W A;  3W8K A;  2P74 A;  3VV4 A;  4DRT A;  4UA6 A;  3BJN A;  3UPP A;  2B95 A;  1E4D A;  3KX0 X;  4JXV A;  3C4O A;  1CEF A;  1J9M A;  4IUK A;  3N8S A;  1OT6 A;  3C2W A;  3LI8 A;  4EWF A;  3PHY A;  4CLC C;  2GNX A;  1BSG A;  1OTI A;  4C6Y A;  1MWT A;  3G6O A;  3CAX A;  2WKH A;  5G4Z A;  4BBT A;  2EX9 A;  1SZV A;  3WRZ A;  4D2O A;  3N4I A;  1BZA A;  1N9L A;  5FDH A;  5FI2 A;  5HD5 A;  4NG2 A;  1YMS A;  4XXR A;  2PBD P;  2M1C A;  1CF0 A;  3OLO A;  2M7U A;  4P0M A;  1W79 A;  1PI4 A;  1NZO A;  4CLC A;  1EW0 A;  4QWO A;  1YLP A;  1W8Y A;  2G2W A;  4E04 A;  4BBU A;  1K6R A;  4WN5 A;  5TGF A;  3QP2 A;  2WGI A;  2IA2 A;  5KMW A;  4UEY A;  4N9K A;  2OOL A;  2W1R A;  3UE0 A;  5DF8 A;  1YLJ A;  4OVD A;  2V1A A;  3HCY A;  2Z6D A;  3E4P A;  4HOI A;  1KDW A;  4PPR A;  1ERM A;  3DTM A;  3KYQ A;  5A8B A;  4GN2 A;  2BTF P;  2XH9 A;  3D9Y A;  3T1Q B;  3EGX C;  3SS5 A;  2Y79 A;  2W1T B;  3BWL A;  4KQR A;  4JXW A;  4NXE A;  1JWP A;  1VEU A;  2D02 A;  1I2S A;  3RH8 B;  4CJN A;  1MC0 A;  1LT0 A;  2Y2G A;  1GHP A;  1N4O A;  4K08 A;  5I94 A;  3F1P A;  1RCJ A;  2Y2J A;  2YKH A;  4HQA A;  4B4Z A;  3T50 A;  2VGL S;  3VE4 A; 
#chains in the Genus database with same CATH homology
 3ZG7 B;  3GR2 A;  2CC1 A;  5HAR A;  3IHA A;  3IWO A;  1FCM A;  3WRT A;  3ISG A;  1YM1 A;  4N1H A;  3FV7 A;  5CXW A;  2XR0 A;  1QME A;  2B5R A;  2Y59 A;  3VP3 A;  1KVL A;  2EX8 A;  3BFF A;  3HLG A;  1M40 A;  4S2N A;  5CHJ A;  2Y2M A;  2Y2I A;  5L2F A;  4WM9 A;  2WKI A;  1YLZ A;  5F1G A;  1XA7 A;  5U47 A;  4DE0 A;  3CJM A;  3ZCZ A;  1IYP A;  5E2H A;  1K57 A;  4S2L A;  4BLM A;  4KG5 A;  2Y55 A;  4RYE A;  4JKT A;  4PM9 A;  1M6K A;  2J9P A;  1JWZ A;  4EBP A;  1BTL A;  4JBF A;  3TSG A;  1XGI A;  4X55 A;  3ZG8 B;  1ESI A;  1IYQ A;  1PIO A;  2Y2K A;  3G30 A;  4S2O A;  3SS3 A;  1PW1 A;  5CER A;  4BD0 A;  3FKV A;  1OME A;  2JCH A;  3V3R A;  3HLB A;  1E3U A;  1K56 D;  2A49 A;  1KE3 A;  4WMC A;  1H8Z A;  5GHZ A;  3MBZ A;  5FI7 A;  3ZG5 A;  3UPN A;  4E3L A;  4BJP A;  1NXY A;  3UE3 A;  1IKG A;  1MPL A;  3AGF A;  4BQM A;  4GZB A;  4ZTK A;  3ZNY A;  3ZG0 A;  3CZD A;  5FAQ A;  2DRW A;  3LEZ A;  5M18 A;  1HD8 A;  5HFO A;  2HDR A;  3GRJ A;  2I72 A;  3LCE A;  2HDU A;  3HLD A;  4P87 A;  4E6X A;  4FH4 A;  3VFH A;  4LEN A;  3WS0 A;  3ZFZ A;  4CPK A;  5E2E A;  5KSC A;  1KVM A;  3G4P A;  2ZLY A;  4BL2 A;  3IF5 A;  3Q7Z A;  1GHM A;  1HVB A;  3BFG A;  4KQO A;  4RX3 A;  4WZ4 A;  1O07 A;  2C5W B;  3G35 A;  4PM5 A;  5GHY A;  4QHC A;  1NJ4 A;  2Z2L B;  1KGE A;  5E2G A;  3NC8 A;  1I2W A;  1IYO A;  3IQA A;  3HLF A;  1YMX A;  2E8I A;  2XD1 A;  3QNC A;  3VFF A;  5CGS A;  1KE0 A;  1GCE A;  4OOL A;  1WE4 A;  2OLV A;  1EI5 A;  5E43 A;  3WS4 A;  3NBL A;  4GDN A;  4KZ7 A;  4WEK A;  2XD5 A;  1GA0 A;  1HTZ A;  1K55 C;  1U60 A;  3GV9 A;  3G2Z A;  3OPR A;  2G2U A;  5CTM A;  4FH2 A;  4OLD A;  2WK0 A;  3N8L A;  3VOY A;  2Q9N A;  1L2S A;  4GNU A;  2HPB A;  4WBG A;  3WS1 A;  3V5M A;  2ZC5 B;  4MBF A;  5JYP A;  4ZBE A;  3DW0 A;  3NIA A;  1E3U D;  1L0F A;  2WUQ A;  3BEB A;  4LV3 A;  4WMC D;  2XFT A;  4DE1 A;  3UPO A;  2WYX A;  4DKI A;  2WKE A;  2XQZ A;  5F1F A;  1HZO A;  3Q7V B;  2ZC6 B;  5HAQ A;  4XUZ A;  1K54 C;  3M2J A;  5FAP A;  4R1G A;  4DXC A;  3G31 A;  4BEN A;  3CG5 A;  5CTN A;  1NYM A;  1E25 A;  2Z2M B;  4U3T A;  4UHU A;  2EFX A;  4OH0 A;  3N6I A;  4OKP A;  3HUO A;  1GA9 A;  4IVK A;  2JBF A;  4Y7P A;  1FQG A;  2OLU A;  2Y2N A;  4OQI A;  3OCL A;  3IXD A;  4S2J A;  5DVA A;  3WS5 A;  5AQ7 A;  5EVI D;  4QY6 A;  4N9L A;  1K55 A;  1YLW A;  5AQA A;  5CEB A;  1K4E A;  3G34 A;  5FQM A;  4RVA A;  3UE1 A;  3PBN A;  4S2N C;  2WAD A;  3SS4 A;  5CEC A;  1ERQ A;  4RA7 A;  2OV5 A;  1GHI A;  4R4S A;  1Q2P A;  3IF6 B;  3UO9 A;  1LL5 A;  4KG2 A;  1ALQ A;  3BFD A;  1ESU A;  3VSK A;  1K57 C;  2X02 A;  4MBK A;  1VM1 A;  1ZKJ A;  1K56 A;  3AGD A;  4E3I A;  4R3J A;  3CMZ A;  3PBQ A;  5E2F A;  3BLS A;  4L0L A;  3BFE A;  2Y91 A;  5GLD A;  5A91 A;  4OQ0 A;  2QPN A;  1K54 A;  4QD4 A;  5JYO A;  4NET A;  4U0X A;  2JE5 A;  2ZD8 A;  2WAE A;  5GLB A;  3GMW A;  3PBT A;  1KGG A;  1PZO A;  1TVF A;  2EX6 A;  3HUN A;  4S2P A;  3ZG9 B;  3D4F A;  3HBR A;  5A90 A;  1I5Q A;  4K0X A;  2XF3 A;  3QNB A;  5GL9 A;  3B3X A;  1JTD A;  1DJA A;  1YLY A;  3Q82 A;  2ZQD A;  5CGX A;  3SH8 A;  4S2I A;  3E2L A;  1BLS A;  1DJC A;  2VGJ A;  4PM7 A;  4UA7 A;  4X56 A;  4YIN A;  3UNW A;  3ITB A;  3OPP A;  3MFD A;  2DNS A;  4C3Q A;  1YQS A;  4A5R A;  4R3B A;  3DWZ A;  5FQK A;  3BM6 A;  4DDY A;  1YLT A;  1YT4 A;  4XUX A;  4ZJ2 A;  3M2K A;  1XGJ A;  3Q1F A;  5GLA A;  1BLC A;  5EVI C;  1LLB A;  2OSU A;  4P85 A;  3WS2 A;  4JXG A;  4Y0T A;  4OLG A;  4UA9 A;  1IYS A;  5DF7 A;  4E3O A;  5F82 A;  1LI0 A;  1FCO A;  1VQQ A;  2FFY A;  5G18 A;  1CI9 A;  3MZF A;  5IHV A;  3N8R A;  2X71 A;  3O88 A;  3S4X A;  1N9B A;  1MWR A;  4GD8 A;  4OPR A;  2PBY A;  4LV2 A;  5FAS A;  5GHX A;  1BT5 A;  3UDI A;  4NK3 A;  4IBX A;  5KSH A;  4MNR A;  4KG6 A;  5CRF A;  1TEM A;  4R23 A;  1ES4 A;  4Y0O A;  1RGZ A;  2EX2 A;  2WGV A;  3V3S A;  1LI9 A;  1PZP A;  3PBS A;  1K6S A;  4R0Q A;  4S2M A;  5HAI A;  4EBL A;  4KZ8 A;  4B4X A;  2ZM0 A;  3A3E A;  3QHY A;  2ZC7 A;  4WZ5 A;  4JLF A;  2ZQ7 A;  1FCN A;  2J7V A;  5EVI A;  1SCW A;  2J9O A;  3UDX A;  2FFF B;  4MBH A;  1LL9 A;  1JWV A;  1SDN A;  1XKZ A;  4OP5 A;  1L0G A;  2IWD A;  4F94 A;  5FI6 A;  3HLE A;  4O7D A;  5A92 A;  5F83 A;  5FQQ A;  2V1Z A;  3GVB A;  2ZQC A;  4UAA A;  3LY3 A;  4EBN A;  3N7W A;  4BD1 A;  2EXB A;  4OON A;  4MLL A;  3GTC A;  5KZH A;  3NY4 A;  1NY0 A;  4KZ5 A;  1MBL A;  4LCM A;  5CHU A;  5CED A;  5EEC A;  1MXO A;  2XEP A;  4GDB A;  3E2K A;  3GSG A;  1G6A A;  1PW8 A;  5EVL A;  3OZH A;  2BG1 A;  3IWI A;  3HLW A;  2PU4 A;  1MY8 A;  3RJU A;  1WYC A;  3OCN A;  3M6H A;  4P6B A;  2XLN A;  2C6W B;  3Q81 A;  1ES3 A;  5DF9 A;  3BLM A;  3SH9 A;  3V39 A;  3VOZ A;  4DDS A;  4X68 A;  3AGE A;  5FQI A;  1K25 A;  4EQI A;  4QJG A;  1FR1 A;  3HL9 A;  4H8R A;  2XGN A;  5DTT A;  1DY6 A;  3TG9 A;  3BFC A;  5CGW A;  2P9V B;  1XP4 A;  3HUM A;  4WEL A;  4E3N A;  3Q7V A;  5FAT A;  3ITA A;  1TDL A;  3C4P A;  4FD8 A;  4OPZ A;  1L0D A;  3RXX A;  5EE8 A;  5HAP A;  4WEJ A;  5HX9 A;  3G2Y A;  4ZAM A;  1S0W A;  3C7U A;  3LY4 A;  1MKI A;  3OPL A;  1MWU A;  5D3O A;  2ZJ9 A;  4K91 A;  2DCF A;  2WGW B;  3IXH A;  5EUA A;  1ES5 A;  2IWB A;  4OPY A;  2ZC3 B;  4FCF A;  1CI8 A;  1L0E A;  3Q07 A;  4JPM A;  3VP4 A;  4Q8I A;  2HDS A;  5FAO A;  1SHV A;  2Y2P A;  1NYY A;  4ZDX A;  2RL3 A;  3IF6 A;  2ZMA A;  3W4O A;  3EQV A;  5HW3 A;  3TOI A;  1DJB A;  3ZDJ A;  1CEG A;  4E3J A;  1MWS A;  2IWC A;  4X6T A;  2XK1 A;  3EQU A;  1XPB A;  3V50 A;  4KZ6 A;  1ES2 A;  1G68 A;  4QB8 A;  3IH8 A;  3BRM A;  4KZB A;  1BLH A;  3NDE A;  1SKF A;  4KEN B;  1JTG A;  4HES A;  1K38 A;  4U0T A;  5DTS A;  2Y2O A;  2Y2H A;  4QU3 A;  4M3K A;  4EV4 A;  4JF4 A;  1PWG A;  2Y2Q A;  4KZ3 A;  5BOH A;  4X69 A;  1RGY A;  1BLP A;  2BLS A;  4FSF A;  2HDQ A;  5FA7 A;  4OQG A;  2WAF A;  1BUE A;  1FSW A;  3NCK A;  1XX2 A;  3O87 A;  2WZZ A;  3VP1 A;  5EOE A;  5TR7 A;  3VSL A;  3P98 A;  1ZG6 A;  2Q9M A;  2V20 A;  4ID4 A;  3C7V A;  3FYZ A;  3ZVW A;  1JVJ A;  2WZX A;  4N1X A;  4JF5 A;  4WZ5 C;  4IVI A;  3MXR A;  3W8K A;  1XA1 A;  2P74 A;  2X01 A;  3ZGA B;  3HLC A;  3FKW A;  4DRT A;  3S1Y A;  3ZVT A;  4UA6 A;  2QMI A;  4Z9Q A;  1IEM A;  3UPP A;  4DXB A;  1LHY A;  3OC2 A;  3G32 A;  1E4D A;  4JXV A;  5CHM A;  4KZ9 A;  4OP8 A;  3IWQ A;  3C4O A;  1CEF A;  1W5D A;  1J9M A;  3A3I A;  4R4R A;  1KE4 A;  1TDG A;  3N8S A;  5FQJ A;  4E3M A;  4E6W A;  3IXG A;  4EWF A;  2ZC4 B;  2HP5 A;  3P09 A;  1K4F A;  1O7E A;  1Y54 A;  4BL3 A;  2J8Y A;  1BSG A;  4DE2 A;  5TFQ A;  3PTE A;  4C6Y A;  1MWT A;  2ZQ8 A;  5A93 A;  4GOG A;  1PI5 A;  2WKH A;  5M1A A;  2V2F F;  4ZJ3 A;  2EX9 A;  3WRZ A;  4D2O A;  2EXA A;  4PMA A;  3N4I A;  3ZHH A;  1BZA A;  2A3U A;  1S6R A;  4Y0U A;  5J8X A;  2JC7 A;  3A3J A;  3FZC A;  5FDH A;  5FI2 A;  4MEZ A;  1YMS A;  4XXR A;  4OOY A;  4LCL A;  1W8Q A;  2HP9 A;  4OOM A;  5FSR A;  4C75 A;  3O86 A;  3C5A A;  4GB7 A;  4P0M A;  1W79 A;  2HP6 A;  5EVI B;  4KZ4 A;  2R9W A;  1PI4 A;  4N92 A;  3SH7 A;  1NZO A;  4KQQ A;  4K0W A;  3PBO A;  3IT9 A;  2RCX A;  3PBR A;  1FSY A;  2ZM2 A;  2GDN A;  3UDF A;  2H0T A;  1YLP A;  4KZA A;  1KDS A;  1W8Y A;  2G2W A;  1W7F A;  1IEL A;  2ZM8 A;  3S22 A;  1K6R A;  1WYB A;  5TGF A;  1NRF A;  1QMF A;  3IF6 C;  3BYD A;  3MKE A;  3MZE A;  3IH9 A;  4DE3 A;  2QZ6 A;  2WGI A;  5KMW A;  4OPQ A;  4WYY A;  4HEF A;  1ERO A;  3WWX A;  3JYI A;  3UY6 A;  4N9K A;  3UE0 A;  4IED A;  2Y2L A;  4S2K A;  3A3F A;  5DF8 A;  4JF6 A;  3MZD A;  1YLJ A;  4DF6 A;  4OVD A;  1EWZ A;  3LO7 A;  1SDE A;  3BEC A;  2P9V A;  4HBU A;  4OQH A;  2PU2 A;  3NDG A;  1ZC2 A;  4QY5 A;  1BUL A;  1PYY A;  1XXM A;  3VP0 A;  3ZNT A;  1KDW A;  4PPR A;  1ERM A;  3A3D A;  3IHB A;  2Y4A A;  3HVF A;  4PM8 A;  4B88 A;  1FOF A;  3DTM A;  3RXW A;  3PAE A;  1FR6 A;  4GN2 A;  5HL1 A;  2XH9 A;  5DTK A;  5AQB A;  4JXS A;  2H10 A;  3O3V A;  4PM6 A;  2ZQA A;  3HRE A;  4X53 A;  3SS5 A;  3VP2 A;  3W4Q A;  3MKF A;  2UWX A;  2WGW A;  3M6B A;  1H5X A;  3IXB A;  4KQR A;  5EOO A;  3SOI A;  4JXW A;  1ONG A;  1JWP A;  4E3K A;  1H8Y A;  4EUZ A;  4YFM A;  2XFS A;  3NI9 A;  2H0Y A;  1Q2Q A;  1IKI A;  3UN7 A;  5AQ9 A;  3GQZ A;  1I2S A;  2XDM A;  3MXS A;  3I7J A;  2H5S A;  5GLC A;  4CJN A;  3VMA A;  1Z6F A;  1KGF A;  1NZU A;  4IBR A;  2Y2G A;  3PAG A;  1ZG4 A;  2VGK A;  4LV0 A;  1GHP A;  1N4O A;  4RX2 A;  5I94 A;  5FQ9 A;  5EPH A;  1PWC A;  2EFU A;  1CK3 A;  3FWL A;  4ZJ1 A;  2ZQ9 A;  1RCJ A;  1RP5 A;  2R9X A;  3DWK A;  4GD6 A;  5M19 A;  2Y2J A;  1AXB A;  3W4P A;  1C3B A;  1ONH A;  1PWD A;  3OPH A;  4B4Z A;  4GKU A;  4LV1 A;  4HBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...