4PPRA

Crystal structure of mycobacterium tuberculosis d,d-peptidase rv3330 in complex with meropenem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
306
structure length
300
Chain Sequence
PLPLVVPPTPVGGNALGGCGIITAPGSAPAPGDVSAEAWLVADLDSGAVIAARDPHGRHRPASVIKVLVAMASINTLTLNKSVAGTADDAAVEGTKVGVNTGGTYTVNQLLHGLLMHSGNDAAYALARQLGGMPAALEKINLLAAKLGGRDTRVATPSGLDGPGMSTSAYDIGLFYRYAWQNPVFADIVATRTFDFPGHGDHPGYELENDNQLLYNYPGALGGKTGYTDDAGQTFVGAANRDGRRLMTVLLHGTRQPIPPWEQAAHLLDYGFNTPAGTQIGTLIEPDPSLMSTDRRVDPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein DacB1
publication title Subfamily-specific adaptations in the structures of two penicillin-binding proteins from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 95
structure length 300
sequence length 306
ec nomenclature
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pprA00
2QZ6A 1BUEA 2Y2NA 3M6HA 4R0QA 1GHIA 3GR2A 4O7DA 2IWBA 4MBFA 2ZM2A 3G4PA 3UNWA 4PMAA 2WGVA 4D2OA 5EE8A 1NXYA 3PBNA 1PWDA 2EX6A 5L2FA 1K57C 3BFDA 3HLCA 1K6SA 4QU3A 3V5MA 1K54A 2ZJ9A 3BYDA 5GLAA 5JYOA 3OZHA 3VFFA 5A93A 1HVBA 1EROA 1L0DA 3E2KA 3ZVTA 4P6BA 1K56A 4B4XA 5HARA 3BLMA 3C4OA 4KZ9A 5CECA 5DTTA 3VFHA 1VQQA 2WKIA 4P0MA 2C6WB 2HDQA 1HTZA 1XGJA 2G2WA 2GDNA 4E3MA 5HL1A 3RXXA 3QNCA 3VP2A 4E6WA 5EVIA 1ALQA 3WS1A 2ZQAA 4U0XA 5IHVA 1L0GA 1JTGA 3ZG9B 1OMEA 4HESA 5FAQA 5JYPA 5CXWA 5FQKA 3LCEA 4IVKA 5CTNA 2DCFA 3UN7A 2OLUA 3ZHHA 2V1ZA 1G68A 4GOGA 1K4FA 2WAEA 1IYPA 1BLPA 1IEMA 2EFUA 4MBKA 4OOMA 1ES2A 3ZNYA 1DJAA 4WBGA 3S1YA 3PAEA 3UE1A 2Q9MA 2A3UA 2ZQ9A 4K91A 4OONA 4PPRA 2JE5A 3O3VA 1RCJA 2XH9A 2PBYA 5E2HA 3TSGA 2HPBA 4WMCA 1DY6A 4KQQA 1O7EA 2XD5A 3PTEA 5FQMA 4KZ4A 4JXSA 2FFYA 5TGFA 4UHUA 1ESIA 1K57A 4GD6A 1LLBA 2RL3A 3BLSA 3M2JA 2Y2JA 1S0WA 2ZC6B 3HLGA 4X55A 4ZBEA 1H8ZA 1EWZA 4KZ3A 2OSUA 2Y2LA 1RGYA 5F1FA 1FR6A 2X01A 4EBPA 1L2SA 1BZAA 3IXBA 3CMZA 4QB8A 2P9VB 3C4PA 5FQ9A 3W4OA 2H0TA 4OKPA 4XXRA 1SDNA 1LL9A 2J9PA 3V39A 1LL5A 4JF6A 1ONGA 5CTMA 2XD1A 1MKIA 5KSHA 2HDRA 5FI7A 4FCFA 2ZQCA 1SDEA 3UDIA 3IXGA 1Y54A 2WZZA 1ESUA 4GN2A 5CHMA 2WAFA 3HLFA 4C75A 3LY4A 3OC2A 4E6XA 1JWVA 2WGWB 4BLMA 3DWKA 4XUZA 3P09A 4LV3A 1NRFA 3MBZA 4ID4A 4PM7A 5CRFA 1XKZA 2R9XA 3VOYA 1PIOA 4DDYA 4E3KA 5FATA 1KE0A 3G2ZA 3IWOA 4ZJ1A 1E3UA 1MWRA 3G31A 4MLLA 3OCNA 1N9BA 3IHAA 5EUAA 2JC7A 4ZAMA 2J8YA 2PU4A 2Z2MB 3IT9A 4KQRA 3VSLA 3HUNA 1Z6FA 1CI8A 2Q9NA 1AXBA 1SKFA 3FV7A 4RVAA 4DE3A 4FH4A 4DE0A 3Q7ZA 2XFTA 4BJPA 5A90A 3CZDA 4MNRA 1I2WA 2XGNA 2Y2OA 1TDLA 3MXSA 5FQIA 4Y7PA 4JXWA 2H0YA 2I72A 5DTSA 3ZVWA 3BRMA 2HP9A 3OPLA 1JTDA 1I5QA 1MPLA 4KZAA 3LEZA 5D3OA 3HLWA 5CEBA 4KENB 2VGKA 4GD8A 4KZ6A 4MBHA 1K4EA 1XGIA 1MXOA 2P74A 1FR1A 4HBUA 4A5RA 3GV9A 4QY5A 4JF4A 3V3SA 2IWCA 1K38A 3Q7VB 4DF6A 2WK0A 5TFQA 5CEDA 2XFSA 5CGXA 3TG9A 2V20A 4KZ5A 3ZG8B 1FSYA 3AGDA 4H8RA 3HLEA 4R1GA 4R23A 4X53A 1W8QA 1H8YA 4GNUA 4KG5A 2CC1A 4JLFA 5M18A 2EX8A 3MZFA 1FCNA 1XPBA 1CI9A 1NYMA 2FFFB 3BFCA 4JF5A 4X68A 2IWDA 3N7WA 1ERQA 1W8YA 4S2LA 4HBTA 3PBOA 3G32A 4OQGA 2Y2HA 2J7VA 4UA9A 1XA1A 4JKTA 5FDHA 1KVMA 3S22A 4KZ7A 4KZBA 3A3EA 3SS5A 2G2UA 2Y91A 2OLVA 1IKIA 1ONHA 2EXAA 3A3JA 3BFEA 5GHYA 3UDXA 3W4PA 2ZC7A 3ZCZA 3UPOA 3A3IA 1BULA 3QNBA 4RYEA 4EBLA 1G6AA 3NC8A 4WEKA 1O07A 3TOIA 4OQ0A 3MXRA 4ZJ3A 3SOIA 2P9VA 3QHYA 1E4DA 4OP5A 4Y0OA 4U0TA 3WS2A 4S2NC 4L0LA 1KDWA 1LI0A 2ZLYA 4LV1A 1PYYA 3G2YA 4R3BA 4KG2A 3CJMA 5KMWA 1KDSA 1XXMA 3WWXA 3MKFA 1E25A 2EX2A 5M19A 3SS3A 3MZEA 3A3DA 5FAPA 3NIAA 4GB7A 3I7JA 4BENA 2ZMAA 4CJNA 4LCMA 1K6RA 4C6YA 2WGWA 3NI9A 5EPHA 3VOZA 4DKIA 1TDGA 5HAQA 2HDUA 3IXHA 3WS4A 2H5SA 3C7UA 5EVLA 5DF8A 1PZPA 3IHBA 4P87A 3M6BA 4FSFA 2EX9A 3G35A 3BEBA 3AGFA 5GHXA 1M6KA 3UPPA 2JCHA 2HDSA 1YMSA 4KG6A 5G18A 3N6IA 4R4RA 1NYYA 3N8RA 3PBSA 3UE3A 1IKGA 3VMAA 2VGJA 1PI4A 4NETA 3Q81A 1Q2QA 1ES5A 2XR0A 1GA0A 3MKEA 4GKUA 4MEZA 3OPPA 3UDFA 4PM6A 5HAPA 4X6TA 2ZD8A 4X69A 1NZOA 4OPRA 3ZG0A 4LV2A 4S2IA 2Y2KA 3RXWA 1GHMA 4RX2A 1K55C 3V50A 3IWIA 4QD4A 5CGWA 3G34A 4S2NA 5FASA 3PBTA 3IF6B 1PWCA 2H10A 1JWZA 5CERA 4IVIA 4E3NA 5EECA 5FQJA 3GMWA 2E8IA 1FSWA 4WZ4A 4S2MA 2DRWA 1YLTA 1K56D 2HP5A 4S2JA 4IEDA 3Q7VA 1VM1A 2Y2MA 5A92A 3O86A 3FZCA 2XEPA 4WZ5C 3HVFA 4DE2A 2EFXA 4DRTA 4EV4A 4GZBA 1EI5A 2BLSA 2WGIA 1M40A 5DF9A 4WM9A 5EVID 4N9KA 3FKVA 3FKWA 3HLDA 2XF3A 2V2FF 3IH9A 1GHPA 5AQ7A 3W4QA 3PBQA 1HD8A 4JXVA 3SH9A 2X02A 1BTLA 1DJCA 4DXCA 4OQHA 3NY4A 4X56A 5F82A 3NBLA 5GLBA 1NY0A 5GLCA 3BM6A 3G30A 3N8LA 1W5DA 4BQMA 2C5WB 1MBLA 3LY3A 4WMCD 1NJ4A 4JPMA 2OV5A 1K55A 4WYYA 1TVFA 1J9MA 2WKEA 2QMIA 1MWSA 5CGSA 1YLYA 4LENA 1U60A 2Z2LB 1L0FA 1YLJA 2ZC3B 4GDBA 3VP0A 5DVAA 2WZXA 1ZG6A 1C3BA 1XX2A 3IF6C 1ES4A 1GCEA 1WE4A 1ZKJA 4FH2A 4N1HA 5FQQA 3HUMA 4ZJ2A 4JXGA 1XA7A 5E2GA 4JBFA 3ZNTA 4IBXA 1KE4A 3FYZA 5CHJA 3ZG7B 2Y2PA 4NK3A 3Q82A 5DTKA 4OPYA 1QMFA 5HX9A 5FSRA 4WZ5A 3WRTA 4E3OA 4OVDA 4B4ZA 3V3RA 5AQBA 5HFOA 3ZG5A 1XP4A 1MWUA 3NCKA 4BL3A 4S2PA 5EOEA 1PI5A 5AQ9A 3IWQA 4KZ8A 1K25A 2EXBA 2XDMA 5HW3A 3GVBA 4Y0TA 4QHCA 5F83A 1YQSA 3ZGAB 5U47A 1MWTA 4C3QA 3GQZA 4QY6A 3BFFA 3IH8A 4ZTKA 3SH8A 3WS5A 1ERMA 2ZQ8A 4CPKA 4Q8IA 4S2KA 3GSGA 2B5RA 4B88A 1W79A 5CHUA 3Q07A 5FA7A 5FAOA 5HAIA 3UY6A 2J9OA 5BOHA 4OP8A 2QPNA 4OQIA 2Y2IA 3CG5A 3HBRA 3N4IA 4E3LA 3PAGA 1LI9A 2XQZA 1Q2PA 3WS0A 4OLGA 4OLDA 1YLZA 1BLSA 1BLHA 2X71A 1E3UD 3DWZA 3ITAA 1IYSA 4P85A 3A3FA 2ZQDA 5GL9A 4UAAA 3UE0A 3ZFZA 1KE3A 1IELA 3IF6A 3E2LA 4DE1A 1KGGA 4UA6A 2RCXA 5GLDA 5EOOA 3ZDJA 2Y59A 4K0WA 5FI6A 3MZDA 4M3KA 3EQVA 1PZOA 3AGEA 4GDNA 1PWGA 4S2OA 5FI2A 1SCWA 4BD1A 2A49A 3OPRA 1KGFA 1RP5A 1WYBA 1N4OA 3FWLA 4LCLA 4OPQA 3IQAA 1ZC2A 3W8KA 1FQGA 3SS4A 1CEGA 3VSKA 3HUOA 4K0XA 4EQIA 4BD0A 4YFMA 1DJBA 1W7FA 3OCLA 1MY8A 5E2EA 1L0EA 1TEMA 3C7VA 1RGZA 4N1XA 1YM1A 2Y2GA 5EVIB 3IXDA 4E3IA 4DDSA 4UA7A 4N92A 3JYIA 1QMEA 2ZQ7A 3ISGA 1ES3A 4IBRA 3BFGA 4FD8A 3VP3A 5TR7A 4BL2A 4Z9QA 1ZG4A 5J8XA 4R3JA 3HLBA 4OH0A 5F1GA 4RA7A 3OPHA 1BLCA 4N9LA 3VP4A 3D4FA 2Y2QA 4EUZA 3VP1A 1IYQA 2WUQA 4Y0UA 5A91A 4PM8A 5KZHA 1YMXA 5KSCA 1YLPA 3GTCA 2BG1A 1YT4A 4PM5A 1BSGA 2WADA 3P98A 2DNSA 4QJGA 1HZOA 2XK1A 3NDGA 4PM9A 3UO9A 5E43A 4EBNA 4EWFA 4E3JA 1H5XA 1K54C 1IYOA 3BECA 3M2KA 1FCMA 2UWXA 3GRJA 1PW8A 3O88A 3PBRA 1CK3A 4RX3A 5GHZA 3SH7A 1FOFA 3NDEA 5DF7A 3N8SA 2ZM0A 4OOLA 3RJUA 2Y4AA 1GA9A 4F94A 5E2FA 4OOYA 2XLNA 2ZC5B 2Y55A 3IF5A 3WRZA 1KGEA 4WEJA 3Q1FA 4R4SA 1NZUA 3O87A 1I2SA 1YLWA 1JVJA 4U3TA 2WKHA 4ZDXA 3MFDA 1S6RA 3LO7A 2WYXA 1BT5A 1WYCA 1FCOA 5EVIC 2JBFA 3HREA 3ITBA 2HP6A 5AQAA 4WELA 4HEFA 3EQUA 4OPZA 1LHYA 3DTMA 2ZM8A 1SHVA 5M1AA 2ZC4B 1PW1A 3HL9A 1KVLA 3C5AA 4LV0A 4YINA 4KQOA 2R9WA 3DW0A 1JWPA 5I94A 1CEFA 4XUXA 4DXBA 2PU2A 3B3XA 3S4XA 3UPNA
chains in the Genus database with same CATH superfamily
4R0QA 1GHIA 1PWDA 4QU3A 2ZJ9A 3BYDA 5JYOA 2FZ0A 5A93A 1L0DA 1XJ6A 4P6BA 5L09A 2L1MA 4KZ9A 1VQQA 2WKIA 2XA7M 2C6WB 2W1RA 4WUJA 1W63Q 2JKTM 2Z6CA 2E8JA 4E6WA 2VV8A 5EVIA 1TS8A 2HJ9C 4LFUA 4HI4A 5JYPA 3F1PB 4IVKA 5CTNA 2ZMFA 2OLUA 1BLPA 2EFUA 4MBKA 1ES2A 3ZNYA 3H9WA 2A3UA 2ZQ9A 4PPRA 2JE5A 1RCJA 2PBYA 1KOUA 2HPBA 2XSSA 1K57A 1LLBA 1PNEA 5HPIA 4X55A 5HZHA 2PRFA 4KZ3A 4DMZA 2OSUA 5F1FA 1RGYA 1L2SA 1HLUP 4QB8A 2P9VB 3C4PA 5FQ9A 3BY9A 4O01A 3W4OA 1LL9A 3V39A 2XD1A 1MKIA 5KSHA 5FI7A 2M7UA 4FCFA 5HSQA 3IXGA 1Y54A 5MC7A 3HLFA 3LIFA 2WGWB 3P09A 4LV3A 4ID4A 3MBZA 4G3WA 1K0KA 1LSWA 1PIOA 3EOIA 1N9LA 4ZJ1A 3T50A 1MWRA 2PHYA 4MLLA 3D3OA 2W3GA 4HH2A 4L9FA 5EUAA 2JC7A 4ZAMA 2Q9NA 3KSHA 1SKFA 4KUOA 5A90A 3MXSA 5CX7A 1NWZA 4JXWA 2I72A 3TE8A 5D3OA 4KZAA 3LEZA 4NKPA 1DP6A 2Y79A 4EEPA 4MBHA 4KZ6A 2P74A 2IWCA 3FPWA 3ZYTA 1ZTUA 5CEDA 3F1NB 2XFSA 4KZ5A 3ZG8B 3LFVA 4H8RA 3FG8A 4R23A 3SZTA 3MXQA 2EX8A 2VZWA 3MZFA 4BBTA 2HZ5A 2NUTC 1TS7A 3T4KA 3N7WA 1W8YA 3GDIA 4UA9A 4IJGA 1KVMA 4KZBA 3SS5A 1IKIA 2EXAA 3A3JA 5GHYA 3UDXA 3A3IA 4RYEA 3TOIA 4OQ0A 2P9VA 4Y0OA 4U0TA 3WS2A 4S2NC 1PYYA 3G2YA 2XA7S 1IFQA 3I7JA 4GCZA 4CJNA 2KX6A 4LCMA 2WGWA 3BQ8A 4YNRA 3NI9A 2O0YA 5EPHA 3VOZA 4DKIA 3IXHA 1PZPA 5GHXA 2PR5A 1BYWA 1IKGA 1Q2QA 3MKEA 4GKUA 3OPPA 3B47A 4PM6A 4X69A 4S2IA 1K55C 3V50A 3PBTA 3T12B 1P9RA 2E8IA 1FSWA 4S2JA 3F1NA 1VM1A 3KSIA 3O86A 4GHIA 1YAXA 5HWWA 1EI5A 4WM9A 3IH9A 3W4QA 3PBQA 4H6JA 5IT5A 4FTXA 2VJWA 1P97A 2D02A 3G6OA 4HNBA 4OQHA 3EEHA 3LI8A 4LRYC 5GLCA 3N8LA 4M4XA 2VK3A 4JPMA 4WYYA 5FL3A 1MWSA 5CGSA 1U60A 2Z2LB 1XX2A 3IF6C 1QMFA 5FSRA 4WZ5A 3ULFA 3V3RA 1X0OA 3KSGA 1XP4A 3F1OB 1MWUA 1OTBA 4S2PA 5EOEA 3IWQA 5F83A 1LL8A 2L4RA 5EFWA 3IH8A 3WS5A 1ERMA 1G28A 4B88A 3LUQA 5FAOA 4WF0A 1DP8A 4WN5A 4EXOA 4OLGA 5AVEA 3O5YA 1YLZA 1BLHA 2W3DA 2W3EA 3T1RA 4BBUA 4CLCD 1KE3A 4IUHA 4ETZA 3C30A 2RCXA 5EOOA 4K0WA 3MZDA 3IX4A 3IS2A 1PZOA 4GDNA 1Y28A 5FI2A 1SCWA 4BD1A 3CAXA 3T4LA 3OPRA 5LBRA 1KGFA 1WYBA 4LCLA 1MC0A 2V1BA 1FQGA 1UWNX 1CEGA 3HUOA 4BD0A 3TRCA 4N1XA 2QJ7A 1OTEA 2Y2GA 2EA9A 4E3IA 3A0VA 1ODVA 2UV0E 3QP6A 5TR7A 4I3AA 3OOVA 4OH0A 4RA7A 1BLCA 3LI9A 2Y2QA 1IYQA 2V0UA 1YLPA 3GTCA 2WADA 2OAP1 2XK1A 3NDGA 5E43A 4EWFA 3BECA 1IYOA 3M2KA 5GHZA 5DF7A 4Y5FA 2Y4AA 3F1OA 4F94A 1CF0A 2ZC5B 3IF5A 5DJUA 1KGEA 1P0ZA 1V9ZA 4ZDXA 3TJZC 2K31A 1WYCA 5EVIC 4HJ3A 5AQAA 3NOUC 4OPZA 1SHVA 4R38A 4LV0A 2R9WA 3NECA 4DXBA 1PFLA 3GR2A 4Q0HA 2IWBA 2YKHA 4MBFA 4PMAA 1S1ZA 1K57C 1K6SA 4B93A 5KIZA 5GLAA 1F9IA 3T4SA 3VFFA 3BLMA 3C4OA 2HGVA 3VFHA 4Y3IA 1H0MA 2HDQA 2G2WA 3U4LP 2B95A 1VB6A 3QNCA 1ALQA 1G6OA 1JTGA 2DMWA 4HESA 3PHYA 3T1QB 3H7WB 3ZHHA 2V1ZA 4GOGA 1IYPA 1IEMA 3S7NA 3VOLA 4EERA 4OOMA 3L9KA 2M7VA 3S1YA 3QP5A 3UE1A 3O3VA 2XH9A 2XD5A 3PTEA 5FQMA 5TGFA 4JXSA 2H28A 4UQIM 3UMEA 2KDKA 2VKSA 2ZC6B 3HLGA 1H8ZA 3KO6A 4LPZA 3E4OA 1FR6A 3PR6A 4CQHA 2H0TA 2VV7A 1YPRA 4OKPA 4I5SA 1SDNA 2J9PA 5CTMA 1H3QA 1YSQA 1LT0A 4LLOB 4X1MA 2WZZA 4GN2A 3PYPA 3LY4A 3OC2A 5HWVA 4BLMA 2P7JA 3R4KA 5CRFA 2VLGA 1IOUA 1KE0A 3NULA 1VHMA 1N9BA 3IHAA 3IT9A 3LYXA 4I38A 5DKLA 4DE3A 4DE0A 4BJPA 4L9GA 3UB8A 1TDLA 4R3AA 4Y7PA 2QKPA 5EM1A 3VV4A 3ZVWA 3OPLA 1MPLA 5HDSA 3NHQA 3HLWA 4KENB 3CWFA 1MXOA 1FR1A 3GV9A 4JF4A 2W3HA 5CGXA 2A24B 1F5MA 1FSYA 4XT2B 3AGDA 2HV1A 3HLEA 2P04A 2V8CA 2QJ5A 2CC1A 4JLFA 1OT6A 5M18A 1N9OA 4EUVA 2FFFB 3BFCA 4L9EA 3EGXC 1OT9A 4HBTA 2J7VA 4HP9A 4JKTA 1GSXA 4KZ7A 3A3EA 3W4PA 3QNBA 4JGQA 1G6AA 4NEED 4ZJ3A 3MXRA 3SOIA 1TF1A 1KDWA 2ZLYA 4LV1A 4DJ3A 4KG2A 5KMWA 1KDSA 3VE3A 1STZA 2EX2A 5M19A 3LIAA 4EW7A 1WA9A 3SS3A 3A3DA 5FAPA 4GB7A 2ZMAA 2W1TA 1K6RA 4C6YA 3W2ZA 4ETXA 1TDGA 2H5SA 3C7UA 3MMHA 4P87A 2EX9A 3G35A 1M6KA 3UPPA 2HDSA 1YMSA 4IUKA 4LGWA 4G3VA 3N8RA 3PBSA 3UE3A 3VMAA 4UQIS 3Q81A 5TJJA 4X6TA 2ZD8A 2Y2KA 3ZQ5A 2JKGA 5CERA 5FQJA 4WZ4A 4S2MA 4QWOA 2XROA 3PXPA 2K7SA 4EU0A 2A24A 4HJ4A 4XT2A 1D1JA 3FZCA 2XEPA 1AWIA 4WZ5C 4F3LB 2QYBA 3HVFA 4EV4A 4LRXC 1F2KA 5EVID 3FKWA 3HLDA 4EQ1A 3KSFA 2JKRI 4JXVA 4GW9A 3SH9A 2X02A 1DJCA 4X56A 3A0RA 5F82A 1YKDA 3BM6A 1W5DA 3EWKA 4Y2FA 2C5WB 1MBLA 1NJ4A 3FC7A 2OV5A 1TVFA 1J9MA 3F1PA 2QMIA 1YLYA 4LENA 1L0FA 3CPTB 1YLJA 4YWZA 1C3BA 4EESA 1ES4A 4N1HA 1WE4A 1ZKJA 2PT7A 3HUMA 1XA7A 4JBFA 1VEUB 5G4YA 3FYZA 1FILA 2O9CA 5CHJA 3ZG7B 3Q82A 4BWIA 4OPYA 2BASA 2JN7A 4OVDA 1S4SA 3ZG5A 1N9NA 3QP1A 4BL3A 1PI5A 2XDMA 4PKYA 4CLCB 3B42A 1YQSA 3ZGAB 1MWTA 3MQOA 3GQZA 3K3DA 3BFFA 4Z1WA 4ZTKA 2ZQ8A 4Q8IA 3GSGA 2B5RA 4JGRA 1W79A 4E3LA 3HBRA 3N4IA 3PAGA 2XQZA 3WS0A 4OLDA 3DWZA 3LR4A 4GJ4A 3RTYA 1UGUA 4P85A 3A3FA 2ZQDA 3MSHA 3UE0A 3ZFZA 3E2LA 2Q0OA 1KGGA 5HPFA 3ZDJA 3EQVA 1PWGA 1CQAA 1XJ2A 3RFBA 3GECA 4F3LA 1ZC2A 3W8KA 3SS4A 3VSKA 4K0XA 1SKOB 3T4QA 3OCLA 1MY8A 2VA0A 1RGZA 2PAVP 4PHTA 4AFIA 3IXDA 2GZAA 4N92A 5F69A 2ACGA 3JYIA 4DJ2A 4IBRA 3KYEA 4I3IA 3VP3A 2PD7A 4BL2A 4Z9QA 3LEQA 3HLBA 1LSVA 3OPHA 3VP4A 4HHDA 4X25A 4EUZA 2GNXA 4Y0UA 5A91A 3CPTA 5KSCA 1TS0A 1YT4A 4PM5A 2V1AA 5HD3A 4QJGA 1HZOA 3UO9A 1VEUA 2W27A 2VGLS 4R70A 2VX8A 2UWXA 4HP4A 1GA9A 5E2FA 2G7UA 3WRZA 4CLCA 3Q1FA 4R4SA 1NZUA 3O87A 4U3TA 1JVJA 2WKHA 1T1AA 1S6RA 2PBDP 3HREA 2HP6A 4WELA 3DTMA 2ZM8A 2V9AA 4HY8A 5M1AA 2EWVA 2LB5A 3BW6A 4XUXA 1OPXA 2PU2A 3EGDC 3S4XA 3UPNA 2QZ6A 4E3OA 4ESPA 2Y2NA 3M6HA 2WKRA 4O7DA 3G4PA 4FUWA 5HL6A 3LIBA 1NXYA 5L2FA 3BFDA 3CLOA 4B9OA 1EROA 1HVBA 2O9BA 1K56A 4B4XA 3IBJA 5DTTA 4Y13A 4P0MA 1XGJA 5HL1A 4E3MA 2GDNA 4GLQA 3UB7A 3VP2A 1L0GA 2V8FA 1OTDA 3ZG9B 1OMEA 5FAQA 5FQKA 3KYZA 3LCEA 2DCFA 1G68A 1K4FA 2AVXA 1F98A 4E04A 1DJAA 3D9YA 4K91A 3UB6A 5E2HA 3TSGA 4WMCA 1J3WA 1DY6A 1O7EA 4KZ4A 2FFYA 1ESIA 2PDRA 1S0WA 1EWZA 2J3TC 2V0WA 3OBFA 2JKFA 3IXBA 3CMZA 4XXRA 4JGOA 2ZQCA 1SDEA 3UDIA 2WAFA 4C75A 1JWVA 4XUZA 4PM7A 3RH8B 2R9XA 3VOYA 4DDYA 5F5YA 4O8GA 1E3UA 3MFXA 2OWJA 3LR0A 2PU4A 2K2NA 4KQRA 3VSLA 3HUNA 1Z6FA 3CITA 1AXBA 3FV7A 4RVAA 4FH4A 3Q7ZA 2XFTA 1V9YA 1I2WA 2XGNA 2H0YA 5F68A 3BQAA 5DTSA 3BRMA 4DN0A 1G5UA 1JTDA 1I5QA 1S1YA 5CEBA 3A0SA 1CJFA 4GD8A 3V67A 1K4EA 4A5RA 1K38A 2HF6A 4DF6A 2WK0A 2J80A 3TG9A 4HH3A 4I39A 3S7PA 5AVFA 3CUEA 4R1GA 2LB9A 3T1SA 4GNUA 4HOIA 3S7QA 2OOLA 1CI9A 3FPVA 4X68A 4CLCE 4S2LA 3PBOA 3G32A 2Y2HA 3S22A 2Y91A 3BFEA 5IS1A 1ONHA 3ZCZA 2ZC7A 4EBLA 2R78A 3NC8A 3KYQA 3P7NA 4RQ9A 4L0LA 4WLAA 4Y15A 1S66L 3MKFA 1E25A 2QWSA 4EEUA 2ZBBA 5HAQA 2HDUA 3WS4A 3M6BA 4FSFA 3BEBA 2D01A 2XRNA 2JCHA 4KG6A 3N6IA 4R4RA 1PRQA 3IX3A 5EVEA 1PI4A 4NETA 5L8MA 2XR0A 3QP4A 1NZOA 4OPRA 3ZG0A 4LV2A 2HJEA 1YSPA 3IWIA 4QD4A 5CGWA 3HJKA 2H10A 1Y4OA 4IVIA 4E3NA 5EECA 4QPRA 3GMWA 2B02A 2DRWA 2HP5A 1XFNA 5K5BA 2ZMVA 2EFXA 4GZBA 2BLSA 2WGIA 1M40A 5DF9A 4N9KA 3FKVA 3LGOA 2INWA 3NY4A 3LICA 4NG2A 5GLBA 3CI6A 2PD8A 4MN6A 4MN5A 3MQ0A 3E0YA 2JKRM 3H7WA 4GDBA 2ZC3B 3VP0A 1T1CA 1GCEA 5FQQA 4ZJ2A 4JXGA 4NK3A 3D72A 4R6LA 1OJ5A 4B4ZA 5AQBA 5HFOA 5DFYA 2VEAA 2NUPC 5AQ9A 2EXBA 4QHCA 5U47A 4C3QA 1A0KA 2KOIA 2PR6A 3SH8A 4S2KA 2KLIA 5CHUA 3Q07A 4OP8A 2QPNA 4OQIA 2Y2IA 1BLSA 2X71A 1W63M 3MS6A 1MKMA 2IA2A 1IYSA 1DP9A 3BY8A 2J3TD 1IELA 3E4QA 4ZRRA 4HIAA 3CHWP 1VETB 4DE1A 4UA6A 2Y59A 1MZUA 3HJIA 4NXEA 4M3KA 3AGEA 4S2OA 1RP5A 3IQAA 4PAUA 4EQIA 3JPUA 4YFMA 1TD5A 1TEMA 3C7VA 4CLCC 3C8CA 4NXFA 2P08A 4UA7A 1QMEA 2ZQ7A 3ISGA 4FD8A 2VGLM 5J7EA 5F1GA 2O99A 5J4EA 4N9LA 3NJAA 4G3KA 2WUQA 1XFQA 5TBMB 3U2AA 3MF0A 4Q0IA 2BG1A 5C5KA 2L0WA 3T4OA 4EBNA 5FEGA 3C2WA 4FOFA 2YKFA 3EEAA 3JVVA 3GRJA 4RX3A 2WKQA 3O88A 3PBRA 3SH7A 4MMNA 2B18A 1FOFA 3RJUA 5EV0A 4OOYA 5FEFA 1UWPX 2Y55A 2M1CA 1I2SA 3MFDA 1BT5A 4KQDA 1FCOA 3ITBA 1GSWA 4HEFA 5L07A 2ZOIA 2ZC4B 2BTFP 1PW1A 3HL9A 3C5AA 4D60A 5J3WA 3NOTC 3B3XA 1BUEA 4WL9A 4O0PA 2ZM2A 3UNWA 4D2OA 2WGVA 1VETA 4GHIB 5EE8A 2JKTI 3PBNA 2EX6A 3HLCA 3V5MA 4MN7A 1K54A 1ZHHB 3R7WB 3OZHA 3E2KA 3ZVTA 4H6JB 4IHQA 5HARA 2Z6DA 2ZOHA 1HTZA 3BJNA 3RXXA 3WS1A 2ZQAA 4U0XA 5IHVA 5CXWA 3UN7A 2WAEA 4WBGA 3PAEA 2Q9MA 4OONA 4MDZA 4KQQA 5TBMA 4UHUA 4GD6A 2RL3A 3BLSA 3JVUA 2Y2JA 3M2JA 4ZBEA 2Y2LA 3C38A 4Q0JA 1L3LA 2X01A 4EBPA 1BZAA 3QP2A 3L7HA 5HDCA 1LL5A 1TS6A 2PYRA 4JF6A 1ONGA 4P6ZM 4KUKA 3T4TA 2HDRA 1D06A 2ZL1B 2EWWA 1ESUA 5CHMA 4E6XA 3DWKA 1NRFA 3CUEC 1XKZA 4E3KA 5FATA 3G2ZA 3IWOA 3IS2B 3G31A 5EM0A 3OCNA 3LR5A 1LSXA 3E98A 2J8YA 2Z2MB 1CI8A 3K3CA 3R7WA 3CZDA 4MNRA 2Y2OA 5FQIA 4ME4A 2HP9A 3TW8A 2VGKA 1XGIA 3LIDA 4HBUA 4QY5A 3V3SA 1SZVA 3Q7VB 5TFQA 3DTEA 1T19A 2V20A 5HDDA 4X53A 1DRMA 1W8QA 1H8YA 3QP8A 4KG5A 3IX8A 1FCNA 1XPBA 4PKYG 1NYMA 4JF5A 2IWDA 1ERQA 1SKOA 5FDHA 4OQGA 4EETB 1XA1A 1FIKA 5CECA 2G2UA 4K08A 2OLVA 3UPOA 1Z09A 1EW0A 3LR3A 1BULA 4WEKA 1O07A 1OTAA 3QHYA 2MJ6A 1E4DA 4OP5A 1LI0A 4R3BA 3CJMA 1XXMA 2ZL1A 3WWXA 4NXBA 3MZEA 3NIAA 4BENA 4MCWA 4UEYA 1T1BA 5EVLA 5DF8A 3IHBA 3OLOA 1S4RA 3AGFA 1XJ4A 2W0NA 4HJ6A 3LIEA 5G18A 1NYYA 2OWHA 2VGJA 1ES5A 5HAPA 1GA0A 4MEZA 3UB9A 3UDFA 4HQAA 3ICYA 3SW1A 1NLYA 3RXWA 3VE4A 1GHMA 3IBRA 4RX2A 5AJGA 5DJTA 3G34A 4S2NA 5FASA 3IF6B 4GS9B 1PWCA 4Y17A 1JWZA 1OJGA 3BWLA 3NOPC 3H82B 4JGPA 1YLTA 1K56D 4IEDA 3Q7VA 3T1XA 4P6ZS 2Y2MA 2FH5A 5A92A 3MR0A 2CMNA 3B33A 1JNUA 4DE2A 4DRTA 5DKKA 2XF3A 2V2FF 5AQ7A 1GHPA 1GSVA 1HD8A 3DTKA 1BTLA 4DXCA 2QHKA 3NBLA 1NY0A 3DBAA 3E4PA 3G30A 4BQMA 3LY3A 4WMCD 2PYPA 4LRZE 1K55A 2WKEA 1D7EA 5DVAA 2WZXA 1ZG6A 4FH2A 5E2GA 3ZNTA 4IBXA 1KE4A 2Y2PA 5DTKA 5HX9A 3WRTA 4BMWA 1XJ3A 3NCKA 2A2LA 4KZ8A 4ARZB 1K25A 5HW3A 3GVBA 4Y0TA 4QY6A 4CPKA 3KX0X 5HAIA 5FA7A 3MQQA 3UY6A 2J9OA 5BOHA 3CG5A 1LI9A 1Q2PA 1E3UD 4YOFA 3ITAA 3MJQA 3UE6A 5L10A 1H8MA 2OAQ1 5GL9A 4UAAA 3IF6A 4GS9A 3H82A 2VV6A 5GLDA 5HWTA 5FDSA 5FI6A 1NLZA 5F6AA 5HD5A 1P9WA 2A49A 3FWLA 1N4OA 4OPQA 5G4ZA 2O9AA 1DJBA 1W7FA 5E2EA 1L0EA 1YM1A 5EVIB 4I3JA 4DDSA 1NRJA 1T18A 1ES3A 3BFGA 1ZG4A 2J3WA 5J8XA 4R3JA 2JHEA 4II7A 2WKPA 3D4FA 3VP1A 3K2NA 2GJ3A 4PM8A 5KZHA 5A8BA 1YMXA 2W1TB 1BSGA 3P98A 2DNSA 4PM9A 3T4JA 4E3JA 4X1LA 1H5XA 5IU1A 1ACFA 1K54C 1FCMA 1PW8A 1CK3A 4NXGA 3NDEA 3S7OA 3N8SA 2ZM0A 4OOLA 5DFXA 2XLNA 3HCYA 4ARZA 4WEJA 3UB5P 1YLWA 4BBVA 5I5LA 3DAVA 3LO7A 2WYXA 2JBFA 3EQUA 2GX5A 2Y8HA 1LHYA 3P01A 2I9VA 3UMDA 4YINA 1KVLA 1S67L 4KQOA 3DW0A 1JWPA 2W3FA 5I94A 3DTIA 1CEFA 1OTIA
chains in the Genus database with same CATH topology
2QZ6A 1BUEA 2Y2NA 3M6HA 4R0QA 1GHIA 3GR2A 4O7DA 2IWBA 4MBFA 2ZM2A 3G4PA 3UNWA 4PMAA 2WGVA 4D2OA 5EE8A 1NXYA 3PBNA 1PWDA 2EX6A 5L2FA 1K57C 3BFDA 3HLCA 1K6SA 4QU3A 3V5MA 1K54A 2ZJ9A 3BYDA 5GLAA 5JYOA 3OZHA 3VFFA 5A93A 1HVBA 1EROA 1L0DA 3E2KA 3ZVTA 4P6BA 1K56A 4B4XA 5HARA 3BLMA 3C4OA 4KZ9A 5CECA 5DTTA 3VFHA 1VQQA 2WKIA 4P0MA 2C6WB 2HDQA 1HTZA 1XGJA 2G2WA 2GDNA 4E3MA 5HL1A 3RXXA 3QNCA 3VP2A 4E6WA 5EVIA 1ALQA 3WS1A 2ZQAA 4U0XA 5IHVA 1L0GA 1JTGA 3ZG9B 1OMEA 4HESA 5FAQA 5JYPA 5CXWA 5FQKA 3LCEA 4IVKA 5CTNA 2DCFA 3UN7A 2OLUA 3ZHHA 2V1ZA 1G68A 4GOGA 1K4FA 2WAEA 1IYPA 1BLPA 1IEMA 2EFUA 4MBKA 4OOMA 1ES2A 3ZNYA 1DJAA 4WBGA 3S1YA 3PAEA 3UE1A 2Q9MA 2A3UA 2ZQ9A 4K91A 4OONA 4PPRA 2JE5A 3O3VA 1RCJA 2XH9A 2PBYA 5E2HA 3TSGA 2HPBA 4WMCA 1DY6A 4KQQA 1O7EA 2XD5A 3PTEA 5FQMA 4KZ4A 4JXSA 2FFYA 5TGFA 4UHUA 1ESIA 1K57A 4GD6A 1LLBA 2RL3A 3BLSA 3M2JA 2Y2JA 1S0WA 2ZC6B 3HLGA 4X55A 4ZBEA 1H8ZA 1EWZA 4KZ3A 2OSUA 2Y2LA 1RGYA 5F1FA 1FR6A 2X01A 4EBPA 1L2SA 1BZAA 3IXBA 3CMZA 4QB8A 2P9VB 3C4PA 5FQ9A 3W4OA 2H0TA 4OKPA 4XXRA 1SDNA 1LL9A 2J9PA 3V39A 1LL5A 4JF6A 1ONGA 5CTMA 2XD1A 1MKIA 5KSHA 2HDRA 5FI7A 4FCFA 2ZQCA 1SDEA 3UDIA 3IXGA 1Y54A 2WZZA 1ESUA 4GN2A 5CHMA 2WAFA 3HLFA 4C75A 3LY4A 3OC2A 4E6XA 1JWVA 2WGWB 4BLMA 3DWKA 4XUZA 3P09A 4LV3A 1NRFA 3MBZA 4ID4A 4PM7A 5CRFA 1XKZA 2R9XA 3VOYA 1PIOA 4DDYA 4E3KA 5FATA 1KE0A 3G2ZA 3IWOA 4ZJ1A 1E3UA 1MWRA 3G31A 4MLLA 3OCNA 1N9BA 3IHAA 5EUAA 2JC7A 4ZAMA 2J8YA 2PU4A 2Z2MB 3IT9A 4KQRA 3VSLA 3HUNA 1Z6FA 1CI8A 2Q9NA 1AXBA 1SKFA 3FV7A 4RVAA 4DE3A 4FH4A 4DE0A 3Q7ZA 2XFTA 4BJPA 5A90A 3CZDA 4MNRA 1I2WA 2XGNA 2Y2OA 1TDLA 3MXSA 5FQIA 4Y7PA 4JXWA 2H0YA 2I72A 5DTSA 3ZVWA 3BRMA 2HP9A 3OPLA 1JTDA 1I5QA 1MPLA 4KZAA 3LEZA 5D3OA 3HLWA 5CEBA 4KENB 2VGKA 4GD8A 4KZ6A 4MBHA 1K4EA 1XGIA 1MXOA 2P74A 1FR1A 4HBUA 4A5RA 3GV9A 4QY5A 4JF4A 3V3SA 2IWCA 1K38A 3Q7VB 4DF6A 2WK0A 5TFQA 5CEDA 2XFSA 5CGXA 3TG9A 2V20A 4KZ5A 3ZG8B 1FSYA 3AGDA 4H8RA 3HLEA 4R1GA 4R23A 4X53A 1W8QA 1H8YA 4GNUA 4KG5A 2CC1A 4JLFA 5M18A 2EX8A 3MZFA 1FCNA 1XPBA 1CI9A 1NYMA 2FFFB 3BFCA 4JF5A 4X68A 2IWDA 3N7WA 1ERQA 1W8YA 4S2LA 4HBTA 3PBOA 3G32A 4OQGA 2Y2HA 2J7VA 4UA9A 1XA1A 4JKTA 5FDHA 1KVMA 3S22A 4KZ7A 4KZBA 3A3EA 3SS5A 2G2UA 2Y91A 2OLVA 1IKIA 1ONHA 2EXAA 3A3JA 3BFEA 5GHYA 3UDXA 3W4PA 2ZC7A 3ZCZA 3UPOA 3A3IA 1BULA 3QNBA 4RYEA 4EBLA 1G6AA 3NC8A 4WEKA 1O07A 3TOIA 4OQ0A 3MXRA 4ZJ3A 3SOIA 2P9VA 3QHYA 1E4DA 4OP5A 4Y0OA 4U0TA 3WS2A 4S2NC 4L0LA 1KDWA 1LI0A 2ZLYA 4LV1A 1PYYA 3G2YA 4R3BA 4KG2A 3CJMA 5KMWA 1KDSA 1XXMA 3WWXA 3MKFA 1E25A 2EX2A 5M19A 3SS3A 3MZEA 3A3DA 5FAPA 3NIAA 4GB7A 3I7JA 4BENA 2ZMAA 4CJNA 4LCMA 1K6RA 4C6YA 2WGWA 3NI9A 5EPHA 3VOZA 4DKIA 1TDGA 5HAQA 2HDUA 3IXHA 3WS4A 2H5SA 3C7UA 5EVLA 5DF8A 1PZPA 3IHBA 4P87A 3M6BA 4FSFA 2EX9A 3G35A 3BEBA 3AGFA 5GHXA 1M6KA 3UPPA 2JCHA 2HDSA 1YMSA 4KG6A 5G18A 3N6IA 4R4RA 1NYYA 3N8RA 3PBSA 3UE3A 1IKGA 3VMAA 2VGJA 1PI4A 4NETA 3Q81A 1Q2QA 1ES5A 2XR0A 1GA0A 3MKEA 4GKUA 4MEZA 3OPPA 3UDFA 4PM6A 5HAPA 4X6TA 2ZD8A 4X69A 1NZOA 4OPRA 3ZG0A 4LV2A 4S2IA 2Y2KA 3RXWA 1GHMA 4RX2A 1K55C 3V50A 3IWIA 4QD4A 5CGWA 3G34A 4S2NA 5FASA 3PBTA 3IF6B 1PWCA 2H10A 1JWZA 5CERA 4IVIA 4E3NA 5EECA 5FQJA 3GMWA 2E8IA 1FSWA 4WZ4A 4S2MA 2DRWA 1YLTA 1K56D 2HP5A 4S2JA 4IEDA 3Q7VA 1VM1A 2Y2MA 5A92A 3O86A 3FZCA 2XEPA 4WZ5C 3HVFA 4DE2A 2EFXA 4DRTA 4EV4A 4GZBA 1EI5A 2BLSA 2WGIA 1M40A 5DF9A 4WM9A 5EVID 4N9KA 3FKVA 3FKWA 3HLDA 2XF3A 2V2FF 3IH9A 1GHPA 5AQ7A 3W4QA 3PBQA 1HD8A 4JXVA 3SH9A 2X02A 1BTLA 1DJCA 4DXCA 4OQHA 3NY4A 4X56A 5F82A 3NBLA 5GLBA 1NY0A 5GLCA 3BM6A 3G30A 3N8LA 1W5DA 4BQMA 2C5WB 1MBLA 3LY3A 4WMCD 1NJ4A 4JPMA 2OV5A 1K55A 4WYYA 1TVFA 1J9MA 2WKEA 2QMIA 1MWSA 5CGSA 1YLYA 4LENA 1U60A 2Z2LB 1L0FA 1YLJA 2ZC3B 4GDBA 3VP0A 5DVAA 2WZXA 1ZG6A 1C3BA 1XX2A 3IF6C 1ES4A 1GCEA 1WE4A 1ZKJA 4FH2A 4N1HA 5FQQA 3HUMA 4ZJ2A 4JXGA 1XA7A 5E2GA 4JBFA 3ZNTA 4IBXA 1KE4A 3FYZA 5CHJA 3ZG7B 2Y2PA 4NK3A 3Q82A 5DTKA 4OPYA 1QMFA 5HX9A 5FSRA 4WZ5A 3WRTA 4E3OA 4OVDA 4B4ZA 3V3RA 5AQBA 5HFOA 3ZG5A 1XP4A 1MWUA 3NCKA 4BL3A 4S2PA 5EOEA 1PI5A 5AQ9A 3IWQA 4KZ8A 1K25A 2EXBA 2XDMA 5HW3A 3GVBA 4Y0TA 4QHCA 5F83A 1YQSA 3ZGAB 5U47A 1MWTA 4C3QA 3GQZA 4QY6A 3BFFA 3IH8A 4ZTKA 3SH8A 3WS5A 1ERMA 2ZQ8A 4CPKA 4Q8IA 4S2KA 3GSGA 2B5RA 4B88A 1W79A 5CHUA 3Q07A 5FA7A 5FAOA 5HAIA 3UY6A 2J9OA 5BOHA 4OP8A 2QPNA 4OQIA 2Y2IA 3CG5A 3HBRA 3N4IA 4E3LA 3PAGA 1LI9A 2XQZA 1Q2PA 3WS0A 4OLGA 4OLDA 1YLZA 1BLSA 1BLHA 2X71A 1E3UD 3DWZA 3ITAA 1IYSA 4P85A 3A3FA 2ZQDA 5GL9A 4UAAA 3UE0A 3ZFZA 1KE3A 1IELA 3IF6A 3E2LA 4DE1A 1KGGA 4UA6A 2RCXA 5GLDA 5EOOA 3ZDJA 2Y59A 4K0WA 5FI6A 3MZDA 4M3KA 3EQVA 1PZOA 3AGEA 4GDNA 1PWGA 4S2OA 5FI2A 1SCWA 4BD1A 2A49A 3OPRA 1KGFA 1RP5A 1WYBA 1N4OA 3FWLA 4LCLA 4OPQA 3IQAA 1ZC2A 3W8KA 1FQGA 3SS4A 1CEGA 3VSKA 3HUOA 4K0XA 4EQIA 4BD0A 4YFMA 1DJBA 1W7FA 3OCLA 1MY8A 5E2EA 1L0EA 1TEMA 3C7VA 1RGZA 4N1XA 1YM1A 2Y2GA 5EVIB 3IXDA 4E3IA 4DDSA 4UA7A 4N92A 3JYIA 1QMEA 2ZQ7A 3ISGA 1ES3A 4IBRA 3BFGA 4FD8A 3VP3A 5TR7A 4BL2A 4Z9QA 1ZG4A 5J8XA 4R3JA 3HLBA 4OH0A 5F1GA 4RA7A 3OPHA 1BLCA 4N9LA 3VP4A 3D4FA 2Y2QA 4EUZA 3VP1A 1IYQA 2WUQA 4Y0UA 5A91A 4PM8A 5KZHA 1YMXA 5KSCA 1YLPA 3GTCA 2BG1A 1YT4A 4PM5A 1BSGA 2WADA 3P98A 2DNSA 4QJGA 1HZOA 2XK1A 3NDGA 4PM9A 3UO9A 5E43A 4EBNA 4EWFA 4E3JA 1H5XA 1K54C 1IYOA 3BECA 3M2KA 1FCMA 2UWXA 3GRJA 1PW8A 3O88A 3PBRA 1CK3A 4RX3A 5GHZA 3SH7A 1FOFA 3NDEA 5DF7A 3N8SA 2ZM0A 4OOLA 3RJUA 2Y4AA 1GA9A 4F94A 5E2FA 4OOYA 2XLNA 2ZC5B 2Y55A 3IF5A 3WRZA 1KGEA 4WEJA 3Q1FA 4R4SA 1NZUA 3O87A 1I2SA 1YLWA 1JVJA 4U3TA 2WKHA 4ZDXA 3MFDA 1S6RA 3LO7A 2WYXA 1BT5A 1WYCA 1FCOA 5EVIC 2JBFA 3HREA 3ITBA 2HP6A 5AQAA 4WELA 4HEFA 3EQUA 4OPZA 1LHYA 3DTMA 2ZM8A 1SHVA 5M1AA 2ZC4B 1PW1A 3HL9A 1KVLA 3C5AA 4LV0A 4YINA 4KQOA 2R9WA 3DW0A 1JWPA 5I94A 1CEFA 4XUXA 4DXBA 2PU2A 3B3XA 3S4XA 3UPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZ6 A;  1BUE A;  2Y2N A;  3M6H A;  4R0Q A;  1GHI A;  3GR2 A;  4O7D A;  2IWB A;  4MBF A;  2ZM2 A;  3G4P A;  3UNW A;  4PMA A;  2WGV A;  4D2O A;  5EE8 A;  1NXY A;  3PBN A;  1PWD A;  2EX6 A;  5L2F A;  1K57 C;  3BFD A;  3HLC A;  1K6S A;  4QU3 A;  3V5M A;  1K54 A;  2ZJ9 A;  3BYD A;  5GLA A;  5JYO A;  3OZH A;  3VFF A;  5A93 A;  1HVB A;  1ERO A;  1L0D A;  3E2K A;  3ZVT A;  4P6B A;  1K56 A;  4B4X A;  5HAR A;  3BLM A;  3C4O A;  4KZ9 A;  5CEC A;  5DTT A;  3VFH A;  1VQQ A;  2WKI A;  4P0M A;  2C6W B;  2HDQ A;  1HTZ A;  1XGJ A;  2G2W A;  2GDN A;  4E3M A;  5HL1 A;  3RXX A;  3QNC A;  3VP2 A;  4E6W A;  5EVI A;  1ALQ A;  3WS1 A;  2ZQA A;  4U0X A;  5IHV A;  1L0G A;  1JTG A;  3ZG9 B;  1OME A;  4HES A;  5FAQ A;  5JYP A;  5CXW A;  5FQK A;  3LCE A;  4IVK A;  5CTN A;  2DCF A;  3UN7 A;  2OLU A;  3ZHH A;  2V1Z A;  1G68 A;  4GOG A;  1K4F A;  2WAE A;  1IYP A;  1BLP A;  1IEM A;  2EFU A;  4MBK A;  4OOM A;  1ES2 A;  3ZNY A;  1DJA A;  4WBG A;  3S1Y A;  3PAE A;  3UE1 A;  2Q9M A;  2A3U A;  2ZQ9 A;  4K91 A;  4OON A;  4PPR A;  2JE5 A;  3O3V A;  1RCJ A;  2XH9 A;  2PBY A;  5E2H A;  3TSG A;  2HPB A;  4WMC A;  1DY6 A;  4KQQ A;  1O7E A;  2XD5 A;  3PTE A;  5FQM A;  4KZ4 A;  4JXS A;  2FFY A;  5TGF A;  4UHU A;  1ESI A;  1K57 A;  4GD6 A;  1LLB A;  2RL3 A;  3BLS A;  3M2J A;  2Y2J A;  1S0W A;  2ZC6 B;  3HLG A;  4X55 A;  4ZBE A;  1H8Z A;  1EWZ A;  4KZ3 A;  2OSU A;  2Y2L A;  1RGY A;  5F1F A;  1FR6 A;  2X01 A;  4EBP A;  1L2S A;  1BZA A;  3IXB A;  3CMZ A;  4QB8 A;  2P9V B;  3C4P A;  5FQ9 A;  3W4O A;  2H0T A;  4OKP A;  4XXR A;  1SDN A;  1LL9 A;  2J9P A;  3V39 A;  1LL5 A;  4JF6 A;  1ONG A;  5CTM A;  2XD1 A;  1MKI A;  5KSH A;  2HDR A;  5FI7 A;  4FCF A;  2ZQC A;  1SDE A;  3UDI A;  3IXG A;  1Y54 A;  2WZZ A;  1ESU A;  4GN2 A;  5CHM A;  2WAF A;  3HLF A;  4C75 A;  3LY4 A;  3OC2 A;  4E6X A;  1JWV A;  2WGW B;  4BLM A;  3DWK A;  4XUZ A;  3P09 A;  4LV3 A;  1NRF A;  3MBZ A;  4ID4 A;  4PM7 A;  5CRF A;  1XKZ A;  2R9X A;  3VOY A;  1PIO A;  4DDY A;  4E3K A;  5FAT A;  1KE0 A;  3G2Z A;  3IWO A;  4ZJ1 A;  1E3U A;  1MWR A;  3G31 A;  4MLL A;  3OCN A;  1N9B A;  3IHA A;  5EUA A;  2JC7 A;  4ZAM A;  2J8Y A;  2PU4 A;  2Z2M B;  3IT9 A;  4KQR A;  3VSL A;  3HUN A;  1Z6F A;  1CI8 A;  2Q9N A;  1AXB A;  1SKF A;  3FV7 A;  4RVA A;  4DE3 A;  4FH4 A;  4DE0 A;  3Q7Z A;  2XFT A;  4BJP A;  5A90 A;  3CZD A;  4MNR A;  1I2W A;  2XGN A;  2Y2O A;  1TDL A;  3MXS A;  5FQI A;  4Y7P A;  4JXW A;  2H0Y A;  2I72 A;  5DTS A;  3ZVW A;  3BRM A;  2HP9 A;  3OPL A;  1JTD A;  1I5Q A;  1MPL A;  4KZA A;  3LEZ A;  5D3O A;  3HLW A;  5CEB A;  4KEN B;  2VGK A;  4GD8 A;  4KZ6 A;  4MBH A;  1K4E A;  1XGI A;  1MXO A;  2P74 A;  1FR1 A;  4HBU A;  4A5R A;  3GV9 A;  4QY5 A;  4JF4 A;  3V3S A;  2IWC A;  1K38 A;  3Q7V B;  4DF6 A;  2WK0 A;  5TFQ A;  5CED A;  2XFS A;  5CGX A;  3TG9 A;  2V20 A;  4KZ5 A;  3ZG8 B;  1FSY A;  3AGD A;  4H8R A;  3HLE A;  4R1G A;  4R23 A;  4X53 A;  1W8Q A;  1H8Y A;  4GNU A;  4KG5 A;  2CC1 A;  4JLF A;  5M18 A;  2EX8 A;  3MZF A;  1FCN A;  1XPB A;  1CI9 A;  1NYM A;  2FFF B;  3BFC A;  4JF5 A;  4X68 A;  2IWD A;  3N7W A;  1ERQ A;  1W8Y A;  4S2L A;  4HBT A;  3PBO A;  3G32 A;  4OQG A;  2Y2H A;  2J7V A;  4UA9 A;  1XA1 A;  4JKT A;  5FDH A;  1KVM A;  3S22 A;  4KZ7 A;  4KZB A;  3A3E A;  3SS5 A;  2G2U A;  2Y91 A;  2OLV A;  1IKI A;  1ONH A;  2EXA A;  3A3J A;  3BFE A;  5GHY A;  3UDX A;  3W4P A;  2ZC7 A;  3ZCZ A;  3UPO A;  3A3I A;  1BUL A;  3QNB A;  4RYE A;  4EBL A;  1G6A A;  3NC8 A;  4WEK A;  1O07 A;  3TOI A;  4OQ0 A;  3MXR A;  4ZJ3 A;  3SOI A;  2P9V A;  3QHY A;  1E4D A;  4OP5 A;  4Y0O A;  4U0T A;  3WS2 A;  4S2N C;  4L0L A;  1KDW A;  1LI0 A;  2ZLY A;  4LV1 A;  1PYY A;  3G2Y A;  4R3B A;  4KG2 A;  3CJM A;  5KMW A;  1KDS A;  1XXM A;  3WWX A;  3MKF A;  1E25 A;  2EX2 A;  5M19 A;  3SS3 A;  3MZE A;  3A3D A;  5FAP A;  3NIA A;  4GB7 A;  3I7J A;  4BEN A;  2ZMA A;  4CJN A;  4LCM A;  1K6R A;  4C6Y A;  2WGW A;  3NI9 A;  5EPH A;  3VOZ A;  4DKI A;  1TDG A;  5HAQ A;  2HDU A;  3IXH A;  3WS4 A;  2H5S A;  3C7U A;  5EVL A;  5DF8 A;  1PZP A;  3IHB A;  4P87 A;  3M6B A;  4FSF A;  2EX9 A;  3G35 A;  3BEB A;  3AGF A;  5GHX A;  1M6K A;  3UPP A;  2JCH A;  2HDS A;  1YMS A;  4KG6 A;  5G18 A;  3N6I A;  4R4R A;  1NYY A;  3N8R A;  3PBS A;  3UE3 A;  1IKG A;  3VMA A;  2VGJ A;  1PI4 A;  4NET A;  3Q81 A;  1Q2Q A;  1ES5 A;  2XR0 A;  1GA0 A;  3MKE A;  4GKU A;  4MEZ A;  3OPP A;  3UDF A;  4PM6 A;  5HAP A;  4X6T A;  2ZD8 A;  4X69 A;  1NZO A;  4OPR A;  3ZG0 A;  4LV2 A;  4S2I A;  2Y2K A;  3RXW A;  1GHM A;  4RX2 A;  1K55 C;  3V50 A;  3IWI A;  4QD4 A;  5CGW A;  3G34 A;  4S2N A;  5FAS A;  3PBT A;  3IF6 B;  1PWC A;  2H10 A;  1JWZ A;  5CER A;  4IVI A;  4E3N A;  5EEC A;  5FQJ A;  3GMW A;  2E8I A;  1FSW A;  4WZ4 A;  4S2M A;  2DRW A;  1YLT A;  1K56 D;  2HP5 A;  4S2J A;  4IED A;  3Q7V A;  1VM1 A;  2Y2M A;  5A92 A;  3O86 A;  3FZC A;  2XEP A;  4WZ5 C;  3HVF A;  4DE2 A;  2EFX A;  4DRT A;  4EV4 A;  4GZB A;  1EI5 A;  2BLS A;  2WGI A;  1M40 A;  5DF9 A;  4WM9 A;  5EVI D;  4N9K A;  3FKV A;  3FKW A;  3HLD A;  2XF3 A;  2V2F F;  3IH9 A;  1GHP A;  5AQ7 A;  3W4Q A;  3PBQ A;  1HD8 A;  4JXV A;  3SH9 A;  2X02 A;  1BTL A;  1DJC A;  4DXC A;  4OQH A;  3NY4 A;  4X56 A;  5F82 A;  3NBL A;  5GLB A;  1NY0 A;  5GLC A;  3BM6 A;  3G30 A;  3N8L A;  1W5D A;  4BQM A;  2C5W B;  1MBL A;  3LY3 A;  4WMC D;  1NJ4 A;  4JPM A;  2OV5 A;  1K55 A;  4WYY A;  1TVF A;  1J9M A;  2WKE A;  2QMI A;  1MWS A;  5CGS A;  1YLY A;  4LEN A;  1U60 A;  2Z2L B;  1L0F A;  1YLJ A;  2ZC3 B;  4GDB A;  3VP0 A;  5DVA A;  2WZX A;  1ZG6 A;  1C3B A;  1XX2 A;  3IF6 C;  1ES4 A;  1GCE A;  1WE4 A;  1ZKJ A;  4FH2 A;  4N1H A;  5FQQ A;  3HUM A;  4ZJ2 A;  4JXG A;  1XA7 A;  5E2G A;  4JBF A;  3ZNT A;  4IBX A;  1KE4 A;  3FYZ A;  5CHJ A;  3ZG7 B;  2Y2P A;  4NK3 A;  3Q82 A;  5DTK A;  4OPY A;  1QMF A;  5HX9 A;  5FSR A;  4WZ5 A;  3WRT A;  4E3O A;  4OVD A;  4B4Z A;  3V3R A;  5AQB A;  5HFO A;  3ZG5 A;  1XP4 A;  1MWU A;  3NCK A;  4BL3 A;  4S2P A;  5EOE A;  1PI5 A;  5AQ9 A;  3IWQ A;  4KZ8 A;  1K25 A;  2EXB A;  2XDM A;  5HW3 A;  3GVB A;  4Y0T A;  4QHC A;  5F83 A;  1YQS A;  3ZGA B;  5U47 A;  1MWT A;  4C3Q A;  3GQZ A;  4QY6 A;  3BFF A;  3IH8 A;  4ZTK A;  3SH8 A;  3WS5 A;  1ERM A;  2ZQ8 A;  4CPK A;  4Q8I A;  4S2K A;  3GSG A;  2B5R A;  4B88 A;  1W79 A;  5CHU A;  3Q07 A;  5FA7 A;  5FAO A;  5HAI A;  3UY6 A;  2J9O A;  5BOH A;  4OP8 A;  2QPN A;  4OQI A;  2Y2I A;  3CG5 A;  3HBR A;  3N4I A;  4E3L A;  3PAG A;  1LI9 A;  2XQZ A;  1Q2P A;  3WS0 A;  4OLG A;  4OLD A;  1YLZ A;  1BLS A;  1BLH A;  2X71 A;  1E3U D;  3DWZ A;  3ITA A;  1IYS A;  4P85 A;  3A3F A;  2ZQD A;  5GL9 A;  4UAA A;  3UE0 A;  3ZFZ A;  1KE3 A;  1IEL A;  3IF6 A;  3E2L A;  4DE1 A;  1KGG A;  4UA6 A;  2RCX A;  5GLD A;  5EOO A;  3ZDJ A;  2Y59 A;  4K0W A;  5FI6 A;  3MZD A;  4M3K A;  3EQV A;  1PZO A;  3AGE A;  4GDN A;  1PWG A;  4S2O A;  5FI2 A;  1SCW A;  4BD1 A;  2A49 A;  3OPR A;  1KGF A;  1RP5 A;  1WYB A;  1N4O A;  3FWL A;  4LCL A;  4OPQ A;  3IQA A;  1ZC2 A;  3W8K A;  1FQG A;  3SS4 A;  1CEG A;  3VSK A;  3HUO A;  4K0X A;  4EQI A;  4BD0 A;  4YFM A;  1DJB A;  1W7F A;  3OCL A;  1MY8 A;  5E2E A;  1L0E A;  1TEM A;  3C7V A;  1RGZ A;  4N1X A;  1YM1 A;  2Y2G A;  5EVI B;  3IXD A;  4E3I A;  4DDS A;  4UA7 A;  4N92 A;  3JYI A;  1QME A;  2ZQ7 A;  3ISG A;  1ES3 A;  4IBR A;  3BFG A;  4FD8 A;  3VP3 A;  5TR7 A;  4BL2 A;  4Z9Q A;  1ZG4 A;  5J8X A;  4R3J A;  3HLB A;  4OH0 A;  5F1G A;  4RA7 A;  3OPH A;  1BLC A;  4N9L A;  3VP4 A;  3D4F A;  2Y2Q A;  4EUZ A;  3VP1 A;  1IYQ A;  2WUQ A;  4Y0U A;  5A91 A;  4PM8 A;  5KZH A;  1YMX A;  5KSC A;  1YLP A;  3GTC A;  2BG1 A;  1YT4 A;  4PM5 A;  1BSG A;  2WAD A;  3P98 A;  2DNS A;  4QJG A;  1HZO A;  2XK1 A;  3NDG A;  4PM9 A;  3UO9 A;  5E43 A;  4EBN A;  4EWF A;  4E3J A;  1H5X A;  1K54 C;  1IYO A;  3BEC A;  3M2K A;  1FCM A;  2UWX A;  3GRJ A;  1PW8 A;  3O88 A;  3PBR A;  1CK3 A;  4RX3 A;  5GHZ A;  3SH7 A;  1FOF A;  3NDE A;  5DF7 A;  3N8S A;  2ZM0 A;  4OOL A;  3RJU A;  2Y4A A;  1GA9 A;  4F94 A;  5E2F A;  4OOY A;  2XLN A;  2ZC5 B;  2Y55 A;  3IF5 A;  3WRZ A;  1KGE A;  4WEJ A;  3Q1F A;  4R4S A;  1NZU A;  3O87 A;  1I2S A;  1YLW A;  1JVJ A;  4U3T A;  2WKH A;  4ZDX A;  3MFD A;  1S6R A;  3LO7 A;  2WYX A;  1BT5 A;  1WYC A;  1FCO A;  5EVI C;  2JBF A;  3HRE A;  3ITB A;  2HP6 A;  5AQA A;  4WEL A;  4HEF A;  3EQU A;  4OPZ A;  1LHY A;  3DTM A;  2ZM8 A;  1SHV A;  5M1A A;  2ZC4 B;  1PW1 A;  3HL9 A;  1KVL A;  3C5A A;  4LV0 A;  4YIN A;  4KQO A;  2R9W A;  3DW0 A;  1JWP A;  5I94 A;  1CEF A;  4XUX A;  4DXB A;  2PU2 A;  3B3X A;  3S4X A;  3UPN A; 
#chains in the Genus database with same CATH topology
 4R0Q A;  1GHI A;  1PWD A;  4QU3 A;  2ZJ9 A;  3BYD A;  5JYO A;  2FZ0 A;  5A93 A;  1L0D A;  1XJ6 A;  4P6B A;  5L09 A;  2L1M A;  4KZ9 A;  1VQQ A;  2WKI A;  2XA7 M;  2C6W B;  2W1R A;  4WUJ A;  1W63 Q;  2JKT M;  2Z6C A;  2E8J A;  4E6W A;  2VV8 A;  5EVI A;  1TS8 A;  2HJ9 C;  4LFU A;  4HI4 A;  5JYP A;  3F1P B;  4IVK A;  5CTN A;  2ZMF A;  2OLU A;  1BLP A;  2EFU A;  4MBK A;  1ES2 A;  3ZNY A;  3H9W A;  2A3U A;  2ZQ9 A;  4PPR A;  2JE5 A;  1RCJ A;  2PBY A;  1KOU A;  2HPB A;  2XSS A;  1K57 A;  1LLB A;  1PNE A;  5HPI A;  4X55 A;  5HZH A;  2PRF A;  4KZ3 A;  4DMZ A;  2OSU A;  5F1F A;  1RGY A;  1L2S A;  1HLU P;  4QB8 A;  2P9V B;  3C4P A;  5FQ9 A;  3BY9 A;  4O01 A;  3W4O A;  1LL9 A;  3V39 A;  2XD1 A;  1MKI A;  5KSH A;  5FI7 A;  2M7U A;  4FCF A;  5HSQ A;  3IXG A;  1Y54 A;  5MC7 A;  3HLF A;  3LIF A;  2WGW B;  3P09 A;  4LV3 A;  4ID4 A;  3MBZ A;  4G3W A;  1K0K A;  1LSW A;  1PIO A;  3EOI A;  1N9L A;  4ZJ1 A;  3T50 A;  1MWR A;  2PHY A;  4MLL A;  3D3O A;  2W3G A;  4HH2 A;  4L9F A;  5EUA A;  2JC7 A;  4ZAM A;  2Q9N A;  3KSH A;  1SKF A;  4KUO A;  5A90 A;  3MXS A;  5CX7 A;  1NWZ A;  4JXW A;  2I72 A;  3TE8 A;  5D3O A;  4KZA A;  3LEZ A;  4NKP A;  1DP6 A;  2Y79 A;  4EEP A;  4MBH A;  4KZ6 A;  2P74 A;  2IWC A;  3FPW A;  3ZYT A;  1ZTU A;  5CED A;  3F1N B;  2XFS A;  4KZ5 A;  3ZG8 B;  3LFV A;  4H8R A;  3FG8 A;  4R23 A;  3SZT A;  3MXQ A;  2EX8 A;  2VZW A;  3MZF A;  4BBT A;  2HZ5 A;  2NUT C;  1TS7 A;  3T4K A;  3N7W A;  1W8Y A;  3GDI A;  4UA9 A;  4IJG A;  1KVM A;  4KZB A;  3SS5 A;  1IKI A;  2EXA A;  3A3J A;  5GHY A;  3UDX A;  3A3I A;  4RYE A;  3TOI A;  4OQ0 A;  2P9V A;  4Y0O A;  4U0T A;  3WS2 A;  4S2N C;  1PYY A;  3G2Y A;  2XA7 S;  1IFQ A;  3I7J A;  4GCZ A;  4CJN A;  2KX6 A;  4LCM A;  2WGW A;  3BQ8 A;  4YNR A;  3NI9 A;  2O0Y A;  5EPH A;  3VOZ A;  4DKI A;  3IXH A;  1PZP A;  5GHX A;  2PR5 A;  1BYW A;  1IKG A;  1Q2Q A;  3MKE A;  4GKU A;  3OPP A;  3B47 A;  4PM6 A;  4X69 A;  4S2I A;  1K55 C;  3V50 A;  3PBT A;  3T12 B;  1P9R A;  2E8I A;  1FSW A;  4S2J A;  3F1N A;  1VM1 A;  3KSI A;  3O86 A;  4GHI A;  1YAX A;  5HWW A;  1EI5 A;  4WM9 A;  3IH9 A;  3W4Q A;  3PBQ A;  4H6J A;  5IT5 A;  4FTX A;  2VJW A;  1P97 A;  2D02 A;  3G6O A;  4HNB A;  4OQH A;  3EEH A;  3LI8 A;  4LRY C;  5GLC A;  3N8L A;  4M4X A;  2VK3 A;  4JPM A;  4WYY A;  5FL3 A;  1MWS A;  5CGS A;  1U60 A;  2Z2L B;  1XX2 A;  3IF6 C;  1QMF A;  5FSR A;  4WZ5 A;  3ULF A;  3V3R A;  1X0O A;  3KSG A;  1XP4 A;  3F1O B;  1MWU A;  1OTB A;  4S2P A;  5EOE A;  3IWQ A;  5F83 A;  1LL8 A;  2L4R A;  5EFW A;  3IH8 A;  3WS5 A;  1ERM A;  1G28 A;  4B88 A;  3LUQ A;  5FAO A;  4WF0 A;  1DP8 A;  4WN5 A;  4EXO A;  4OLG A;  5AVE A;  3O5Y A;  1YLZ A;  1BLH A;  2W3D A;  2W3E A;  3T1R A;  4BBU A;  4CLC D;  1KE3 A;  4IUH A;  4ETZ A;  3C30 A;  2RCX A;  5EOO A;  4K0W A;  3MZD A;  3IX4 A;  3IS2 A;  1PZO A;  4GDN A;  1Y28 A;  5FI2 A;  1SCW A;  4BD1 A;  3CAX A;  3T4L A;  3OPR A;  5LBR A;  1KGF A;  1WYB A;  4LCL A;  1MC0 A;  2V1B A;  1FQG A;  1UWN X;  1CEG A;  3HUO A;  4BD0 A;  3TRC A;  4N1X A;  2QJ7 A;  1OTE A;  2Y2G A;  2EA9 A;  4E3I A;  3A0V A;  1ODV A;  2UV0 E;  3QP6 A;  5TR7 A;  4I3A A;  3OOV A;  4OH0 A;  4RA7 A;  1BLC A;  3LI9 A;  2Y2Q A;  1IYQ A;  2V0U A;  1YLP A;  3GTC A;  2WAD A;  2OAP 1;  2XK1 A;  3NDG A;  5E43 A;  4EWF A;  3BEC A;  1IYO A;  3M2K A;  5GHZ A;  5DF7 A;  4Y5F A;  2Y4A A;  3F1O A;  4F94 A;  1CF0 A;  2ZC5 B;  3IF5 A;  5DJU A;  1KGE A;  1P0Z A;  1V9Z A;  4ZDX A;  3TJZ C;  2K31 A;  1WYC A;  5EVI C;  4HJ3 A;  5AQA A;  3NOU C;  4OPZ A;  1SHV A;  4R38 A;  4LV0 A;  2R9W A;  3NEC A;  4DXB A;  1PFL A;  3GR2 A;  4Q0H A;  2IWB A;  2YKH A;  4MBF A;  4PMA A;  1S1Z A;  1K57 C;  1K6S A;  4B93 A;  5KIZ A;  5GLA A;  1F9I A;  3T4S A;  3VFF A;  3BLM A;  3C4O A;  2HGV A;  3VFH A;  4Y3I A;  1H0M A;  2HDQ A;  2G2W A;  3U4L P;  2B95 A;  1VB6 A;  3QNC A;  1ALQ A;  1G6O A;  1JTG A;  2DMW A;  4HES A;  3PHY A;  3T1Q B;  3H7W B;  3ZHH A;  2V1Z A;  4GOG A;  1IYP A;  1IEM A;  3S7N A;  3VOL A;  4EER A;  4OOM A;  3L9K A;  2M7V A;  3S1Y A;  3QP5 A;  3UE1 A;  3O3V A;  2XH9 A;  2XD5 A;  3PTE A;  5FQM A;  5TGF A;  4JXS A;  2H28 A;  4UQI M;  3UME A;  2KDK A;  2VKS A;  2ZC6 B;  3HLG A;  1H8Z A;  3KO6 A;  4LPZ A;  3E4O A;  1FR6 A;  3PR6 A;  4CQH A;  2H0T A;  2VV7 A;  1YPR A;  4OKP A;  4I5S A;  1SDN A;  2J9P A;  5CTM A;  1H3Q A;  1YSQ A;  1LT0 A;  4LLO B;  4X1M A;  2WZZ A;  4GN2 A;  3PYP A;  3LY4 A;  3OC2 A;  5HWV A;  4BLM A;  2P7J A;  3R4K A;  5CRF A;  2VLG A;  1IOU A;  1KE0 A;  3NUL A;  1VHM A;  1N9B A;  3IHA A;  3IT9 A;  3LYX A;  4I38 A;  5DKL A;  4DE3 A;  4DE0 A;  4BJP A;  4L9G A;  3UB8 A;  1TDL A;  4R3A A;  4Y7P A;  2QKP A;  5EM1 A;  3VV4 A;  3ZVW A;  3OPL A;  1MPL A;  5HDS A;  3NHQ A;  3HLW A;  4KEN B;  3CWF A;  1MXO A;  1FR1 A;  3GV9 A;  4JF4 A;  2W3H A;  5CGX A;  2A24 B;  1F5M A;  1FSY A;  4XT2 B;  3AGD A;  2HV1 A;  3HLE A;  2P04 A;  2V8C A;  2QJ5 A;  2CC1 A;  4JLF A;  1OT6 A;  5M18 A;  1N9O A;  4EUV A;  2FFF B;  3BFC A;  4L9E A;  3EGX C;  1OT9 A;  4HBT A;  2J7V A;  4HP9 A;  4JKT A;  1GSX A;  4KZ7 A;  3A3E A;  3W4P A;  3QNB A;  4JGQ A;  1G6A A;  4NEE D;  4ZJ3 A;  3MXR A;  3SOI A;  1TF1 A;  1KDW A;  2ZLY A;  4LV1 A;  4DJ3 A;  4KG2 A;  5KMW A;  1KDS A;  3VE3 A;  1STZ A;  2EX2 A;  5M19 A;  3LIA A;  4EW7 A;  1WA9 A;  3SS3 A;  3A3D A;  5FAP A;  4GB7 A;  2ZMA A;  2W1T A;  1K6R A;  4C6Y A;  3W2Z A;  4ETX A;  1TDG A;  2H5S A;  3C7U A;  3MMH A;  4P87 A;  2EX9 A;  3G35 A;  1M6K A;  3UPP A;  2HDS A;  1YMS A;  4IUK A;  4LGW A;  4G3V A;  3N8R A;  3PBS A;  3UE3 A;  3VMA A;  4UQI S;  3Q81 A;  5TJJ A;  4X6T A;  2ZD8 A;  2Y2K A;  3ZQ5 A;  2JKG A;  5CER A;  5FQJ A;  4WZ4 A;  4S2M A;  4QWO A;  2XRO A;  3PXP A;  2K7S A;  4EU0 A;  2A24 A;  4HJ4 A;  4XT2 A;  1D1J A;  3FZC A;  2XEP A;  1AWI A;  4WZ5 C;  4F3L B;  2QYB A;  3HVF A;  4EV4 A;  4LRX C;  1F2K A;  5EVI D;  3FKW A;  3HLD A;  4EQ1 A;  3KSF A;  2JKR I;  4JXV A;  4GW9 A;  3SH9 A;  2X02 A;  1DJC A;  4X56 A;  3A0R A;  5F82 A;  1YKD A;  3BM6 A;  1W5D A;  3EWK A;  4Y2F A;  2C5W B;  1MBL A;  1NJ4 A;  3FC7 A;  2OV5 A;  1TVF A;  1J9M A;  3F1P A;  2QMI A;  1YLY A;  4LEN A;  1L0F A;  3CPT B;  1YLJ A;  4YWZ A;  1C3B A;  4EES A;  1ES4 A;  4N1H A;  1WE4 A;  1ZKJ A;  2PT7 A;  3HUM A;  1XA7 A;  4JBF A;  1VEU B;  5G4Y A;  3FYZ A;  1FIL A;  2O9C A;  5CHJ A;  3ZG7 B;  3Q82 A;  4BWI A;  4OPY A;  2BAS A;  2JN7 A;  4OVD A;  1S4S A;  3ZG5 A;  1N9N A;  3QP1 A;  4BL3 A;  1PI5 A;  2XDM A;  4PKY A;  4CLC B;  3B42 A;  1YQS A;  3ZGA B;  1MWT A;  3MQO A;  3GQZ A;  3K3D A;  3BFF A;  4Z1W A;  4ZTK A;  2ZQ8 A;  4Q8I A;  3GSG A;  2B5R A;  4JGR A;  1W79 A;  4E3L A;  3HBR A;  3N4I A;  3PAG A;  2XQZ A;  3WS0 A;  4OLD A;  3DWZ A;  3LR4 A;  4GJ4 A;  3RTY A;  1UGU A;  4P85 A;  3A3F A;  2ZQD A;  3MSH A;  3UE0 A;  3ZFZ A;  3E2L A;  2Q0O A;  1KGG A;  5HPF A;  3ZDJ A;  3EQV A;  1PWG A;  1CQA A;  1XJ2 A;  3RFB A;  3GEC A;  4F3L A;  1ZC2 A;  3W8K A;  3SS4 A;  3VSK A;  4K0X A;  1SKO B;  3T4Q A;  3OCL A;  1MY8 A;  2VA0 A;  1RGZ A;  2PAV P;  4PHT A;  4AFI A;  3IXD A;  2GZA A;  4N92 A;  5F69 A;  2ACG A;  3JYI A;  4DJ2 A;  4IBR A;  3KYE A;  4I3I A;  3VP3 A;  2PD7 A;  4BL2 A;  4Z9Q A;  3LEQ A;  3HLB A;  1LSV A;  3OPH A;  3VP4 A;  4HHD A;  4X25 A;  4EUZ A;  2GNX A;  4Y0U A;  5A91 A;  3CPT A;  5KSC A;  1TS0 A;  1YT4 A;  4PM5 A;  2V1A A;  5HD3 A;  4QJG A;  1HZO A;  3UO9 A;  1VEU A;  2W27 A;  2VGL S;  4R70 A;  2VX8 A;  2UWX A;  4HP4 A;  1GA9 A;  5E2F A;  2G7U A;  3WRZ A;  4CLC A;  3Q1F A;  4R4S A;  1NZU A;  3O87 A;  4U3T A;  1JVJ A;  2WKH A;  1T1A A;  1S6R A;  2PBD P;  3HRE A;  2HP6 A;  4WEL A;  3DTM A;  2ZM8 A;  2V9A A;  4HY8 A;  5M1A A;  2EWV A;  2LB5 A;  3BW6 A;  4XUX A;  1OPX A;  2PU2 A;  3EGD C;  3S4X A;  3UPN A;  2QZ6 A;  4E3O A;  4ESP A;  2Y2N A;  3M6H A;  2WKR A;  4O7D A;  3G4P A;  4FUW A;  5HL6 A;  3LIB A;  1NXY A;  5L2F A;  3BFD A;  3CLO A;  4B9O A;  1ERO A;  1HVB A;  2O9B A;  1K56 A;  4B4X A;  3IBJ A;  5DTT A;  4Y13 A;  4P0M A;  1XGJ A;  5HL1 A;  4E3M A;  2GDN A;  4GLQ A;  3UB7 A;  3VP2 A;  1L0G A;  2V8F A;  1OTD A;  3ZG9 B;  1OME A;  5FAQ A;  5FQK A;  3KYZ A;  3LCE A;  2DCF A;  1G68 A;  1K4F A;  2AVX A;  1F98 A;  4E04 A;  1DJA A;  3D9Y A;  4K91 A;  3UB6 A;  5E2H A;  3TSG A;  4WMC A;  1J3W A;  1DY6 A;  1O7E A;  4KZ4 A;  2FFY A;  1ESI A;  2PDR A;  1S0W A;  1EWZ A;  2J3T C;  2V0W A;  3OBF A;  2JKF A;  3IXB A;  3CMZ A;  4XXR A;  4JGO A;  2ZQC A;  1SDE A;  3UDI A;  2WAF A;  4C75 A;  1JWV A;  4XUZ A;  4PM7 A;  3RH8 B;  2R9X A;  3VOY A;  4DDY A;  5F5Y A;  4O8G A;  1E3U A;  3MFX A;  2OWJ A;  3LR0 A;  2PU4 A;  2K2N A;  4KQR A;  3VSL A;  3HUN A;  1Z6F A;  3CIT A;  1AXB A;  3FV7 A;  4RVA A;  4FH4 A;  3Q7Z A;  2XFT A;  1V9Y A;  1I2W A;  2XGN A;  2H0Y A;  5F68 A;  3BQA A;  5DTS A;  3BRM A;  4DN0 A;  1G5U A;  1JTD A;  1I5Q A;  1S1Y A;  5CEB A;  3A0S A;  1CJF A;  4GD8 A;  3V67 A;  1K4E A;  4A5R A;  1K38 A;  2HF6 A;  4DF6 A;  2WK0 A;  2J80 A;  3TG9 A;  4HH3 A;  4I39 A;  3S7P A;  5AVF A;  3CUE A;  4R1G A;  2LB9 A;  3T1S A;  4GNU A;  4HOI A;  3S7Q A;  2OOL A;  1CI9 A;  3FPV A;  4X68 A;  4CLC E;  4S2L A;  3PBO A;  3G32 A;  2Y2H A;  3S22 A;  2Y91 A;  3BFE A;  5IS1 A;  1ONH A;  3ZCZ A;  2ZC7 A;  4EBL A;  2R78 A;  3NC8 A;  3KYQ A;  3P7N A;  4RQ9 A;  4L0L A;  4WLA A;  4Y15 A;  1S66 L;  3MKF A;  1E25 A;  2QWS A;  4EEU A;  2ZBB A;  5HAQ A;  2HDU A;  3WS4 A;  3M6B A;  4FSF A;  3BEB A;  2D01 A;  2XRN A;  2JCH A;  4KG6 A;  3N6I A;  4R4R A;  1PRQ A;  3IX3 A;  5EVE A;  1PI4 A;  4NET A;  5L8M A;  2XR0 A;  3QP4 A;  1NZO A;  4OPR A;  3ZG0 A;  4LV2 A;  2HJE A;  1YSP A;  3IWI A;  4QD4 A;  5CGW A;  3HJK A;  2H10 A;  1Y4O A;  4IVI A;  4E3N A;  5EEC A;  4QPR A;  3GMW A;  2B02 A;  2DRW A;  2HP5 A;  1XFN A;  5K5B A;  2ZMV A;  2EFX A;  4GZB A;  2BLS A;  2WGI A;  1M40 A;  5DF9 A;  4N9K A;  3FKV A;  3LGO A;  2INW A;  3NY4 A;  3LIC A;  4NG2 A;  5GLB A;  3CI6 A;  2PD8 A;  4MN6 A;  4MN5 A;  3MQ0 A;  3E0Y A;  2JKR M;  3H7W A;  4GDB A;  2ZC3 B;  3VP0 A;  1T1C A;  1GCE A;  5FQQ A;  4ZJ2 A;  4JXG A;  4NK3 A;  3D72 A;  4R6L A;  1OJ5 A;  4B4Z A;  5AQB A;  5HFO A;  5DFY A;  2VEA A;  2NUP C;  5AQ9 A;  2EXB A;  4QHC A;  5U47 A;  4C3Q A;  1A0K A;  2KOI A;  2PR6 A;  3SH8 A;  4S2K A;  2KLI A;  5CHU A;  3Q07 A;  4OP8 A;  2QPN A;  4OQI A;  2Y2I A;  1BLS A;  2X71 A;  1W63 M;  3MS6 A;  1MKM A;  2IA2 A;  1IYS A;  1DP9 A;  3BY8 A;  2J3T D;  1IEL A;  3E4Q A;  4ZRR A;  4HIA A;  3CHW P;  1VET B;  4DE1 A;  4UA6 A;  2Y59 A;  1MZU A;  3HJI A;  4NXE A;  4M3K A;  3AGE A;  4S2O A;  1RP5 A;  3IQA A;  4PAU A;  4EQI A;  3JPU A;  4YFM A;  1TD5 A;  1TEM A;  3C7V A;  4CLC C;  3C8C A;  4NXF A;  2P08 A;  4UA7 A;  1QME A;  2ZQ7 A;  3ISG A;  4FD8 A;  2VGL M;  5J7E A;  5F1G A;  2O99 A;  5J4E A;  4N9L A;  3NJA A;  4G3K A;  2WUQ A;  1XFQ A;  5TBM B;  3U2A A;  3MF0 A;  4Q0I A;  2BG1 A;  5C5K A;  2L0W A;  3T4O A;  4EBN A;  5FEG A;  3C2W A;  4FOF A;  2YKF A;  3EEA A;  3JVV A;  3GRJ A;  4RX3 A;  2WKQ A;  3O88 A;  3PBR A;  3SH7 A;  4MMN A;  2B18 A;  1FOF A;  3RJU A;  5EV0 A;  4OOY A;  5FEF A;  1UWP X;  2Y55 A;  2M1C A;  1I2S A;  3MFD A;  1BT5 A;  4KQD A;  1FCO A;  3ITB A;  1GSW A;  4HEF A;  5L07 A;  2ZOI A;  2ZC4 B;  2BTF P;  1PW1 A;  3HL9 A;  3C5A A;  4D60 A;  5J3W A;  3NOT C;  3B3X A;  1BUE A;  4WL9 A;  4O0P A;  2ZM2 A;  3UNW A;  4D2O A;  2WGV A;  1VET A;  4GHI B;  5EE8 A;  2JKT I;  3PBN A;  2EX6 A;  3HLC A;  3V5M A;  4MN7 A;  1K54 A;  1ZHH B;  3R7W B;  3OZH A;  3E2K A;  3ZVT A;  4H6J B;  4IHQ A;  5HAR A;  2Z6D A;  2ZOH A;  1HTZ A;  3BJN A;  3RXX A;  3WS1 A;  2ZQA A;  4U0X A;  5IHV A;  5CXW A;  3UN7 A;  2WAE A;  4WBG A;  3PAE A;  2Q9M A;  4OON A;  4MDZ A;  4KQQ A;  5TBM A;  4UHU A;  4GD6 A;  2RL3 A;  3BLS A;  3JVU A;  2Y2J A;  3M2J A;  4ZBE A;  2Y2L A;  3C38 A;  4Q0J A;  1L3L A;  2X01 A;  4EBP A;  1BZA A;  3QP2 A;  3L7H A;  5HDC A;  1LL5 A;  1TS6 A;  2PYR A;  4JF6 A;  1ONG A;  4P6Z M;  4KUK A;  3T4T A;  2HDR A;  1D06 A;  2ZL1 B;  2EWW A;  1ESU A;  5CHM A;  4E6X A;  3DWK A;  1NRF A;  3CUE C;  1XKZ A;  4E3K A;  5FAT A;  3G2Z A;  3IWO A;  3IS2 B;  3G31 A;  5EM0 A;  3OCN A;  3LR5 A;  1LSX A;  3E98 A;  2J8Y A;  2Z2M B;  1CI8 A;  3K3C A;  3R7W A;  3CZD A;  4MNR A;  2Y2O A;  5FQI A;  4ME4 A;  2HP9 A;  3TW8 A;  2VGK A;  1XGI A;  3LID A;  4HBU A;  4QY5 A;  3V3S A;  1SZV A;  3Q7V B;  5TFQ A;  3DTE A;  1T19 A;  2V20 A;  5HDD A;  4X53 A;  1DRM A;  1W8Q A;  1H8Y A;  3QP8 A;  4KG5 A;  3IX8 A;  1FCN A;  1XPB A;  4PKY G;  1NYM A;  4JF5 A;  2IWD A;  1ERQ A;  1SKO A;  5FDH A;  4OQG A;  4EET B;  1XA1 A;  1FIK A;  5CEC A;  2G2U A;  4K08 A;  2OLV A;  3UPO A;  1Z09 A;  1EW0 A;  3LR3 A;  1BUL A;  4WEK A;  1O07 A;  1OTA A;  3QHY A;  2MJ6 A;  1E4D A;  4OP5 A;  1LI0 A;  4R3B A;  3CJM A;  1XXM A;  2ZL1 A;  3WWX A;  4NXB A;  3MZE A;  3NIA A;  4BEN A;  4MCW A;  4UEY A;  1T1B A;  5EVL A;  5DF8 A;  3IHB A;  3OLO A;  1S4R A;  3AGF A;  1XJ4 A;  2W0N A;  4HJ6 A;  3LIE A;  5G18 A;  1NYY A;  2OWH A;  2VGJ A;  1ES5 A;  5HAP A;  1GA0 A;  4MEZ A;  3UB9 A;  3UDF A;  4HQA A;  3ICY A;  3SW1 A;  1NLY A;  3RXW A;  3VE4 A;  1GHM A;  3IBR A;  4RX2 A;  5AJG A;  5DJT A;  3G34 A;  4S2N A;  5FAS A;  3IF6 B;  4GS9 B;  1PWC A;  4Y17 A;  1JWZ A;  1OJG A;  3BWL A;  3NOP C;  3H82 B;  4JGP A;  1YLT A;  1K56 D;  4IED A;  3Q7V A;  3T1X A;  4P6Z S;  2Y2M A;  2FH5 A;  5A92 A;  3MR0 A;  2CMN A;  3B33 A;  1JNU A;  4DE2 A;  4DRT A;  5DKK A;  2XF3 A;  2V2F F;  5AQ7 A;  1GHP A;  1GSV A;  1HD8 A;  3DTK A;  1BTL A;  4DXC A;  2QHK A;  3NBL A;  1NY0 A;  3DBA A;  3E4P A;  3G30 A;  4BQM A;  3LY3 A;  4WMC D;  2PYP A;  4LRZ E;  1K55 A;  2WKE A;  1D7E A;  5DVA A;  2WZX A;  1ZG6 A;  4FH2 A;  5E2G A;  3ZNT A;  4IBX A;  1KE4 A;  2Y2P A;  5DTK A;  5HX9 A;  3WRT A;  4BMW A;  1XJ3 A;  3NCK A;  2A2L A;  4KZ8 A;  4ARZ B;  1K25 A;  5HW3 A;  3GVB A;  4Y0T A;  4QY6 A;  4CPK A;  3KX0 X;  5HAI A;  5FA7 A;  3MQQ A;  3UY6 A;  2J9O A;  5BOH A;  3CG5 A;  1LI9 A;  1Q2P A;  1E3U D;  4YOF A;  3ITA A;  3MJQ A;  3UE6 A;  5L10 A;  1H8M A;  2OAQ 1;  5GL9 A;  4UAA A;  3IF6 A;  4GS9 A;  3H82 A;  2VV6 A;  5GLD A;  5HWT A;  5FDS A;  5FI6 A;  1NLZ A;  5F6A A;  5HD5 A;  1P9W A;  2A49 A;  3FWL A;  1N4O A;  4OPQ A;  5G4Z A;  2O9A A;  1DJB A;  1W7F A;  5E2E A;  1L0E A;  1YM1 A;  5EVI B;  4I3J A;  4DDS A;  1NRJ A;  1T18 A;  1ES3 A;  3BFG A;  1ZG4 A;  2J3W A;  5J8X A;  4R3J A;  2JHE A;  4II7 A;  2WKP A;  3D4F A;  3VP1 A;  3K2N A;  2GJ3 A;  4PM8 A;  5KZH A;  5A8B A;  1YMX A;  2W1T B;  1BSG A;  3P98 A;  2DNS A;  4PM9 A;  3T4J A;  4E3J A;  4X1L A;  1H5X A;  5IU1 A;  1ACF A;  1K54 C;  1FCM A;  1PW8 A;  1CK3 A;  4NXG A;  3NDE A;  3S7O A;  3N8S A;  2ZM0 A;  4OOL A;  5DFX A;  2XLN A;  3HCY A;  4ARZ A;  4WEJ A;  3UB5 P;  1YLW A;  4BBV A;  5I5L A;  3DAV A;  3LO7 A;  2WYX A;  2JBF A;  3EQU A;  2GX5 A;  2Y8H A;  1LHY A;  3P01 A;  2I9V A;  3UMD A;  4YIN A;  1KVL A;  1S67 L;  4KQO A;  3DW0 A;  1JWP A;  2W3F A;  5I94 A;  3DTI A;  1CEF A;  1OTI A; 
#chains in the Genus database with same CATH homology
 2QZ6 A;  1BUE A;  2Y2N A;  3M6H A;  4R0Q A;  1GHI A;  3GR2 A;  4O7D A;  2IWB A;  4MBF A;  2ZM2 A;  3G4P A;  3UNW A;  4PMA A;  2WGV A;  4D2O A;  5EE8 A;  1NXY A;  3PBN A;  1PWD A;  2EX6 A;  5L2F A;  1K57 C;  3BFD A;  3HLC A;  1K6S A;  4QU3 A;  3V5M A;  1K54 A;  2ZJ9 A;  3BYD A;  5GLA A;  5JYO A;  3OZH A;  3VFF A;  5A93 A;  1HVB A;  1ERO A;  1L0D A;  3E2K A;  3ZVT A;  4P6B A;  1K56 A;  4B4X A;  5HAR A;  3BLM A;  3C4O A;  4KZ9 A;  5CEC A;  5DTT A;  3VFH A;  1VQQ A;  2WKI A;  4P0M A;  2C6W B;  2HDQ A;  1HTZ A;  1XGJ A;  2G2W A;  2GDN A;  4E3M A;  5HL1 A;  3RXX A;  3QNC A;  3VP2 A;  4E6W A;  5EVI A;  1ALQ A;  3WS1 A;  2ZQA A;  4U0X A;  5IHV A;  1L0G A;  1JTG A;  3ZG9 B;  1OME A;  4HES A;  5FAQ A;  5JYP A;  5CXW A;  5FQK A;  3LCE A;  4IVK A;  5CTN A;  2DCF A;  3UN7 A;  2OLU A;  3ZHH A;  2V1Z A;  1G68 A;  4GOG A;  1K4F A;  2WAE A;  1IYP A;  1BLP A;  1IEM A;  2EFU A;  4MBK A;  4OOM A;  1ES2 A;  3ZNY A;  1DJA A;  4WBG A;  3S1Y A;  3PAE A;  3UE1 A;  2Q9M A;  2A3U A;  2ZQ9 A;  4K91 A;  4OON A;  4PPR A;  2JE5 A;  3O3V A;  1RCJ A;  2XH9 A;  2PBY A;  5E2H A;  3TSG A;  2HPB A;  4WMC A;  1DY6 A;  4KQQ A;  1O7E A;  2XD5 A;  3PTE A;  5FQM A;  4KZ4 A;  4JXS A;  2FFY A;  5TGF A;  4UHU A;  1ESI A;  1K57 A;  4GD6 A;  1LLB A;  2RL3 A;  3BLS A;  3M2J A;  2Y2J A;  1S0W A;  2ZC6 B;  3HLG A;  4X55 A;  4ZBE A;  1H8Z A;  1EWZ A;  4KZ3 A;  2OSU A;  2Y2L A;  1RGY A;  5F1F A;  1FR6 A;  2X01 A;  4EBP A;  1L2S A;  1BZA A;  3IXB A;  3CMZ A;  4QB8 A;  2P9V B;  3C4P A;  5FQ9 A;  3W4O A;  2H0T A;  4OKP A;  4XXR A;  1SDN A;  1LL9 A;  2J9P A;  3V39 A;  1LL5 A;  4JF6 A;  1ONG A;  5CTM A;  2XD1 A;  1MKI A;  5KSH A;  2HDR A;  5FI7 A;  4FCF A;  2ZQC A;  1SDE A;  3UDI A;  3IXG A;  1Y54 A;  2WZZ A;  1ESU A;  4GN2 A;  5CHM A;  2WAF A;  3HLF A;  4C75 A;  3LY4 A;  3OC2 A;  4E6X A;  1JWV A;  2WGW B;  4BLM A;  3DWK A;  4XUZ A;  3P09 A;  4LV3 A;  1NRF A;  3MBZ A;  4ID4 A;  4PM7 A;  5CRF A;  1XKZ A;  2R9X A;  3VOY A;  1PIO A;  4DDY A;  4E3K A;  5FAT A;  1KE0 A;  3G2Z A;  3IWO A;  4ZJ1 A;  1E3U A;  1MWR A;  3G31 A;  4MLL A;  3OCN A;  1N9B A;  3IHA A;  5EUA A;  2JC7 A;  4ZAM A;  2J8Y A;  2PU4 A;  2Z2M B;  3IT9 A;  4KQR A;  3VSL A;  3HUN A;  1Z6F A;  1CI8 A;  2Q9N A;  1AXB A;  1SKF A;  3FV7 A;  4RVA A;  4DE3 A;  4FH4 A;  4DE0 A;  3Q7Z A;  2XFT A;  4BJP A;  5A90 A;  3CZD A;  4MNR A;  1I2W A;  2XGN A;  2Y2O A;  1TDL A;  3MXS A;  5FQI A;  4Y7P A;  4JXW A;  2H0Y A;  2I72 A;  5DTS A;  3ZVW A;  3BRM A;  2HP9 A;  3OPL A;  1JTD A;  1I5Q A;  1MPL A;  4KZA A;  3LEZ A;  5D3O A;  3HLW A;  5CEB A;  4KEN B;  2VGK A;  4GD8 A;  4KZ6 A;  4MBH A;  1K4E A;  1XGI A;  1MXO A;  2P74 A;  1FR1 A;  4HBU A;  4A5R A;  3GV9 A;  4QY5 A;  4JF4 A;  3V3S A;  2IWC A;  1K38 A;  3Q7V B;  4DF6 A;  2WK0 A;  5TFQ A;  5CED A;  2XFS A;  5CGX A;  3TG9 A;  2V20 A;  4KZ5 A;  3ZG8 B;  1FSY A;  3AGD A;  4H8R A;  3HLE A;  4R1G A;  4R23 A;  4X53 A;  1W8Q A;  1H8Y A;  4GNU A;  4KG5 A;  2CC1 A;  4JLF A;  5M18 A;  2EX8 A;  3MZF A;  1FCN A;  1XPB A;  1CI9 A;  1NYM A;  2FFF B;  3BFC A;  4JF5 A;  4X68 A;  2IWD A;  3N7W A;  1ERQ A;  1W8Y A;  4S2L A;  4HBT A;  3PBO A;  3G32 A;  4OQG A;  2Y2H A;  2J7V A;  4UA9 A;  1XA1 A;  4JKT A;  5FDH A;  1KVM A;  3S22 A;  4KZ7 A;  4KZB A;  3A3E A;  3SS5 A;  2G2U A;  2Y91 A;  2OLV A;  1IKI A;  1ONH A;  2EXA A;  3A3J A;  3BFE A;  5GHY A;  3UDX A;  3W4P A;  2ZC7 A;  3ZCZ A;  3UPO A;  3A3I A;  1BUL A;  3QNB A;  4RYE A;  4EBL A;  1G6A A;  3NC8 A;  4WEK A;  1O07 A;  3TOI A;  4OQ0 A;  3MXR A;  4ZJ3 A;  3SOI A;  2P9V A;  3QHY A;  1E4D A;  4OP5 A;  4Y0O A;  4U0T A;  3WS2 A;  4S2N C;  4L0L A;  1KDW A;  1LI0 A;  2ZLY A;  4LV1 A;  1PYY A;  3G2Y A;  4R3B A;  4KG2 A;  3CJM A;  5KMW A;  1KDS A;  1XXM A;  3WWX A;  3MKF A;  1E25 A;  2EX2 A;  5M19 A;  3SS3 A;  3MZE A;  3A3D A;  5FAP A;  3NIA A;  4GB7 A;  3I7J A;  4BEN A;  2ZMA A;  4CJN A;  4LCM A;  1K6R A;  4C6Y A;  2WGW A;  3NI9 A;  5EPH A;  3VOZ A;  4DKI A;  1TDG A;  5HAQ A;  2HDU A;  3IXH A;  3WS4 A;  2H5S A;  3C7U A;  5EVL A;  5DF8 A;  1PZP A;  3IHB A;  4P87 A;  3M6B A;  4FSF A;  2EX9 A;  3G35 A;  3BEB A;  3AGF A;  5GHX A;  1M6K A;  3UPP A;  2JCH A;  2HDS A;  1YMS A;  4KG6 A;  5G18 A;  3N6I A;  4R4R A;  1NYY A;  3N8R A;  3PBS A;  3UE3 A;  1IKG A;  3VMA A;  2VGJ A;  1PI4 A;  4NET A;  3Q81 A;  1Q2Q A;  1ES5 A;  2XR0 A;  1GA0 A;  3MKE A;  4GKU A;  4MEZ A;  3OPP A;  3UDF A;  4PM6 A;  5HAP A;  4X6T A;  2ZD8 A;  4X69 A;  1NZO A;  4OPR A;  3ZG0 A;  4LV2 A;  4S2I A;  2Y2K A;  3RXW A;  1GHM A;  4RX2 A;  1K55 C;  3V50 A;  3IWI A;  4QD4 A;  5CGW A;  3G34 A;  4S2N A;  5FAS A;  3PBT A;  3IF6 B;  1PWC A;  2H10 A;  1JWZ A;  5CER A;  4IVI A;  4E3N A;  5EEC A;  5FQJ A;  3GMW A;  2E8I A;  1FSW A;  4WZ4 A;  4S2M A;  2DRW A;  1YLT A;  1K56 D;  2HP5 A;  4S2J A;  4IED A;  3Q7V A;  1VM1 A;  2Y2M A;  5A92 A;  3O86 A;  3FZC A;  2XEP A;  4WZ5 C;  3HVF A;  4DE2 A;  2EFX A;  4DRT A;  4EV4 A;  4GZB A;  1EI5 A;  2BLS A;  2WGI A;  1M40 A;  5DF9 A;  4WM9 A;  5EVI D;  4N9K A;  3FKV A;  3FKW A;  3HLD A;  2XF3 A;  2V2F F;  3IH9 A;  1GHP A;  5AQ7 A;  3W4Q A;  3PBQ A;  1HD8 A;  4JXV A;  3SH9 A;  2X02 A;  1BTL A;  1DJC A;  4DXC A;  4OQH A;  3NY4 A;  4X56 A;  5F82 A;  3NBL A;  5GLB A;  1NY0 A;  5GLC A;  3BM6 A;  3G30 A;  3N8L A;  1W5D A;  4BQM A;  2C5W B;  1MBL A;  3LY3 A;  4WMC D;  1NJ4 A;  4JPM A;  2OV5 A;  1K55 A;  4WYY A;  1TVF A;  1J9M A;  2WKE A;  2QMI A;  1MWS A;  5CGS A;  1YLY A;  4LEN A;  1U60 A;  2Z2L B;  1L0F A;  1YLJ A;  2ZC3 B;  4GDB A;  3VP0 A;  5DVA A;  2WZX A;  1ZG6 A;  1C3B A;  1XX2 A;  3IF6 C;  1ES4 A;  1GCE A;  1WE4 A;  1ZKJ A;  4FH2 A;  4N1H A;  5FQQ A;  3HUM A;  4ZJ2 A;  4JXG A;  1XA7 A;  5E2G A;  4JBF A;  3ZNT A;  4IBX A;  1KE4 A;  3FYZ A;  5CHJ A;  3ZG7 B;  2Y2P A;  4NK3 A;  3Q82 A;  5DTK A;  4OPY A;  1QMF A;  5HX9 A;  5FSR A;  4WZ5 A;  3WRT A;  4E3O A;  4OVD A;  4B4Z A;  3V3R A;  5AQB A;  5HFO A;  3ZG5 A;  1XP4 A;  1MWU A;  3NCK A;  4BL3 A;  4S2P A;  5EOE A;  1PI5 A;  5AQ9 A;  3IWQ A;  4KZ8 A;  1K25 A;  2EXB A;  2XDM A;  5HW3 A;  3GVB A;  4Y0T A;  4QHC A;  5F83 A;  1YQS A;  3ZGA B;  5U47 A;  1MWT A;  4C3Q A;  3GQZ A;  4QY6 A;  3BFF A;  3IH8 A;  4ZTK A;  3SH8 A;  3WS5 A;  1ERM A;  2ZQ8 A;  4CPK A;  4Q8I A;  4S2K A;  3GSG A;  2B5R A;  4B88 A;  1W79 A;  5CHU A;  3Q07 A;  5FA7 A;  5FAO A;  5HAI A;  3UY6 A;  2J9O A;  5BOH A;  4OP8 A;  2QPN A;  4OQI A;  2Y2I A;  3CG5 A;  3HBR A;  3N4I A;  4E3L A;  3PAG A;  1LI9 A;  2XQZ A;  1Q2P A;  3WS0 A;  4OLG A;  4OLD A;  1YLZ A;  1BLS A;  1BLH A;  2X71 A;  1E3U D;  3DWZ A;  3ITA A;  1IYS A;  4P85 A;  3A3F A;  2ZQD A;  5GL9 A;  4UAA A;  3UE0 A;  3ZFZ A;  1KE3 A;  1IEL A;  3IF6 A;  3E2L A;  4DE1 A;  1KGG A;  4UA6 A;  2RCX A;  5GLD A;  5EOO A;  3ZDJ A;  2Y59 A;  4K0W A;  5FI6 A;  3MZD A;  4M3K A;  3EQV A;  1PZO A;  3AGE A;  4GDN A;  1PWG A;  4S2O A;  5FI2 A;  1SCW A;  4BD1 A;  2A49 A;  3OPR A;  1KGF A;  1RP5 A;  1WYB A;  1N4O A;  3FWL A;  4LCL A;  4OPQ A;  3IQA A;  1ZC2 A;  3W8K A;  1FQG A;  3SS4 A;  1CEG A;  3VSK A;  3HUO A;  4K0X A;  4EQI A;  4BD0 A;  4YFM A;  1DJB A;  1W7F A;  3OCL A;  1MY8 A;  5E2E A;  1L0E A;  1TEM A;  3C7V A;  1RGZ A;  4N1X A;  1YM1 A;  2Y2G A;  5EVI B;  3IXD A;  4E3I A;  4DDS A;  4UA7 A;  4N92 A;  3JYI A;  1QME A;  2ZQ7 A;  3ISG A;  1ES3 A;  4IBR A;  3BFG A;  4FD8 A;  3VP3 A;  5TR7 A;  4BL2 A;  4Z9Q A;  1ZG4 A;  5J8X A;  4R3J A;  3HLB A;  4OH0 A;  5F1G A;  4RA7 A;  3OPH A;  1BLC A;  4N9L A;  3VP4 A;  3D4F A;  2Y2Q A;  4EUZ A;  3VP1 A;  1IYQ A;  2WUQ A;  4Y0U A;  5A91 A;  4PM8 A;  5KZH A;  1YMX A;  5KSC A;  1YLP A;  3GTC A;  2BG1 A;  1YT4 A;  4PM5 A;  1BSG A;  2WAD A;  3P98 A;  2DNS A;  4QJG A;  1HZO A;  2XK1 A;  3NDG A;  4PM9 A;  3UO9 A;  5E43 A;  4EBN A;  4EWF A;  4E3J A;  1H5X A;  1K54 C;  1IYO A;  3BEC A;  3M2K A;  1FCM A;  2UWX A;  3GRJ A;  1PW8 A;  3O88 A;  3PBR A;  1CK3 A;  4RX3 A;  5GHZ A;  3SH7 A;  1FOF A;  3NDE A;  5DF7 A;  3N8S A;  2ZM0 A;  4OOL A;  3RJU A;  2Y4A A;  1GA9 A;  4F94 A;  5E2F A;  4OOY A;  2XLN A;  2ZC5 B;  2Y55 A;  3IF5 A;  3WRZ A;  1KGE A;  4WEJ A;  3Q1F A;  4R4S A;  1NZU A;  3O87 A;  1I2S A;  1YLW A;  1JVJ A;  4U3T A;  2WKH A;  4ZDX A;  3MFD A;  1S6R A;  3LO7 A;  2WYX A;  1BT5 A;  1WYC A;  1FCO A;  5EVI C;  2JBF A;  3HRE A;  3ITB A;  2HP6 A;  5AQA A;  4WEL A;  4HEF A;  3EQU A;  4OPZ A;  1LHY A;  3DTM A;  2ZM8 A;  1SHV A;  5M1A A;  2ZC4 B;  1PW1 A;  3HL9 A;  1KVL A;  3C5A A;  4LV0 A;  4YIN A;  4KQO A;  2R9W A;  3DW0 A;  1JWP A;  5I94 A;  1CEF A;  4XUX A;  4DXB A;  2PU2 A;  3B3X A;  3S4X A;  3UPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...