4D60A

Structure of a dimeric plasmodium falciparum profilin mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
161
structure length
161
Chain Sequence
EYSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords PROFILIN
publication title Two Independently Folding Units of Plasmodium Profilin Suggest Evolution Via Gene Fusion.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 31
structure length 161
sequence length 161
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4d60A00
2ACGA 4QWOA 2VK3A 3T1XA 4FUWA 1ACFA 1VETA 1HLUP 3MSHA 4X1LA 1G5UA 2E8JA 3UB5P 3T1SA 1AWIA 3NECA 3U4LP 5EM1A 3T1QB 3L7HA 2PRFA 1PFLA 1PNEA 4D60A 2B95A 2JKGA 3LEQA 3T12B 2ZL1B 1SKOB 5FDSA 1FILA 1J3WA 5EVEA 1VEUB 2PBDP 3NULA 4FTXA 1D1JA 1SZVA 4X25A 3L9KA 4X1MA 1K0KA 3KYEA 3DAVA 5FEGA 1A0KA 2PAVP 2ZL1A 3T1RA 1SKOA 2HZ5A 1VEUA 1CQAA 2BTFP 2JKFA 1Y4OA 3D9YA 5EM0A 3CPTB 3LGOA 5FEFA 4ESPA 1YPRA 1PRQA 1VETB 3MS6A 5EV0A 2V8FA 1CJFA 1F2KA 1Z09A 2V8CA 1FIKA 1CF0A 3CHWP 3CPTA
chains in the Genus database with same CATH superfamily
5CGXA 2Y2PA 1YLJA 3MXQA 2P08A 4HH3A 3H9WA 3T1QB 4R23A 4S2MA 4KZ8A 4KQRA 2KOIA 5HAQA 1T19A 4I3AA 1BLSA 1MPLA 1KDSA 3C8CA 3PBQA 5E2EA 1K25A 1X0OA 1FILA 5EVEA 1YKDA 1DY6A 3UDXA 4DE1A 1I2SA 1Y28A 2W1TA 3HUNA 2ZJ9A 2HP9A 3B47A 1K54C 1MKIA 4WMCA 3ZFZA 3IT9A 3WS1A 5FI2A 4CLCA 3OZHA 2HZ5A 2ZQAA 2EFXA 5HX9A 2W0NA 1EWZA 1GSVA 5E2GA 5AJGA 3HLBA 3D9YA 3M6HA 2HJ9C 4IJGA 5FAQA 1W7FA 1YQSA 3SS3A 5FEFA 5EOEA 3T4JA 2Y2OA 5GHYA 2V8FA 4QY5A 4RX2A 3ZG7B 2CMNA 1MKMA 1UWPX 3CAXA 4R3AA 3W4QA 4HI4A 1S1ZA 3ZCZA 3FPWA 1BTLA 2VEAA 3F1OA 1S67L 2VK3A 1JNUA 4JXWA 4ZBEA 5DJUA 5CHMA 4N1XA 4X1LA 3Q7VB 2P9VB 1ZTUA 5A90A 1IKIA 5GL9A 1ESIA 3FC7A 4OPQA 5HWVA 4P85A 3BY9A 3PBRA 2DNSA 2Z6DA 4KQQA 3V3RA 4MN6A 4JBFA 1FCMA 4S2JA 2C5WB 3GDIA 1LL5A 3H7WB 3VSKA 4N1HA 1LSXA 4E3JA 3WS4A 4MLLA 2XA7M 4NKPA 4Y5FA 1XJ2A 2WKPA 2XGNA 4KZ3A 3C7UA 2L4RA 4GHIA 5E2FA 2EXBA 4GB7A 4PM7A 2JE5A 5D3OA 4HESA 4Y3IA 5FDHA 4RYEA 3VP3A 1LL9A 5DJTA 2WZZA 3O86A 5M19A 2Y2LA 4IUHA 2R78A 3C4OA 1RCJA 1VEUA 1H8YA 2J3TC 1CEFA 1NZOA 3A0VA 4NG2A 3BEBA 4KZ4A 3DTEA 3OPLA 3BECA 4CLCC 1JWVA 3MBZA 4UHUA 3MF0A 4OOLA 5CGWA 2DMWA 3OPRA 1KGEA 5EUAA 2O9CA 4WUJA 1NZUA 2XSSA 4Z1WA 4KG6A 3ZYTA 4Y17A 3RH8B 3ITAA 1PZOA 3RJUA 1IOUA 1FCNA 2Y2NA 1BLCA 1L3LA 4PKYA 2X02A 1GSWA 1VM1A 2UV0E 3BFFA 5IS1A 1CI9A 1TS8A 3LR3A 4ARZA 4EXOA 4HOIA 3UB8A 4LLOB 5F69A 4M3KA 1IYQA 3HLGA 4X68A 2ZQ9A 2PBDP 3UE0A 3UE1A 2Y91A 3FV7A 1K56D 4IHQA 1K6SA 3VE4A 4R3BA 3H82B 1PZPA 4OPYA 3MFDA 1SKOA 1NRJA 1W5DA 3W4OA 4DXBA 3IHAA 2D01A 3TSGA 3A3JA 4PM8A 2WKQA 4QJGA 3V50A 3FWLA 1T1CA 2GNXA 4UAAA 1BYWA 1M40A 2Q0OA 3EGXC 1P97A 3HJIA 1LT0A 4CPKA 4OLGA 2JHEA 3IWQA 1CF0A 1ODVA 1JTGA 3VOLA 3KO6A 4R70A 2Y8HA 3IWIA 4WLAA 1NYYA 5EVLA 4EW7A 4LPZA 2EFUA 3S4XA 1CI8A 3BQAA 3KSHA 1K4EA 4MN5A 1BT5A 4I38A 3LY4A 5FA7A 2H5SA 4P6BA 3F1NA 4S2IA 1MWTA 4PAUA 5L8MA 1MWUA 2MJ6A 2IWBA 2YKHA 3VP4A 1KE4A 2Y2KA 2ZLYA 4D60A 4JF6A 2B18A 5A92A 1YMSA 3BLSA 5HDDA 4MMNA 4BJPA 5TR7A 4NETA 4ZTKA 3GRJA 3G4PA 3ZG9B 5FDSA 4ZJ3A 4GCZA 3UMDA 4GD8A 1MBLA 1N4OA 4GJ4A 4ZJ1A 1YAXA 3EEAA 3Q7ZA 3UMEA 4H6JB 4P0MA 2J3TD 4O0PA 2ZQDA 3Q82A 4WMCD 2V1ZA 4CLCD 4A5RA 2Z2LB 3GSGA 4RQ9A 5TGFA 5AQBA 5DF7A 3VE3A 4JF4A 4WL9A 4H8RA 3CMZA 1Z6FA 3W4PA 3E98A 4EEPA 3IX3A 1FQGA 1PRQA 5C5KA 4EQ1A 3Q07A 5AVFA 1CJFA 1KDWA 1YLYA 2WUQA 1D06A 4I3IA 5HL6A 1YSQA 4E04A 5FQJA 5DF8A 1U60A 2L0WA 4Q0HA 1HLUP 3T4KA 2DCFA 5CERA 1W79A 5EM1A 2ZOIA 4PM5A 2JCHA 3NOUC 4MBFA 2W3DA 2XLNA 1XA1A 4OKPA 3I7JA 1ZKJA 3LI8A 3LICA 4JF5A 2VKSA 2ZC3B 2P9VA 3Q7VA 3DWZA 3F1PB 4C3QA 2ZL1B 5CHUA 1N9OA 2W3HA 4BBVA 1TVFA 3IXGA 3R4KA 4HHDA 4KZ7A 1OJGA 3L9KA 5CEBA 3MZDA 3MMHA 3H7WA 5F6AA 3DAVA 4OH0A 4II7A 1J9MA 2A49A 1GCEA 3SH7A 4PHTA 5KIZA 1XP4A 5G4ZA 3E2KA 3HUOA 1F5MA 3CPTB 5IU1A 1GHMA 2V9AA 1TD5A 2XRNA 3TW8A 2X01A 1BUEA 5EVIB 3HLCA 5AQ9A 3ZVTA 2OLUA 4Y0UA 4JLFA 5CXWA 4GDNA 4LV1A 4EERA 5HFOA 2PR6A 4K08A 5HSQA 4NEED 4DJ2A 1SKFA 2VGLS 1NLYA 2FH5A 3HUMA 5FL3A 2VV6A 2QPNA 3LEZA 3LIFA 1FR1A 1YT4A 2J80A 1S0WA 3MXSA 3IBJA 2V1AA 4JXVA 3B33A 2D02A 3UB6A 5DF9A 5GHZA 3IQAA 4ETZA 1BSGA 3BFGA 3A3EA 4B4XA 1FSWA 2W3FA 5F83A 1XXMA 1PWGA 1SDNA 3LIBA 5M1AA 3CJMA 2WGVA 3BQ8A 3DTKA 3LI9A 4N9LA 3KYQA 4PPRA 4I39A 5HW3A 4ETXA 1SZVA 4E3OA 4HJ4A 3PAGA 4HP4A 4E6XA 1Q2QA 1W8YA 3IHBA 2BASA 4XUXA 3KSGA 4LGWA 4GLQA 2PAVP 3ZVWA 2WKEA 4S2PA 1P0ZA 5HPIA 2Y2MA 5FATA 5TBMB 1Y4OA 1C3BA 5EM0A 1RGYA 5GLAA 2OOLA 4P6ZS 4EUZA 3UNWA 2EX9A 1EROA 2ZMFA 3H82A 4ME4A 1YLTA 3PYPA 3LCEA 5EV0A 3UE3A 4ZDXA 2KX6A 1FIKA 4L9EA 4WF0A 3LYXA 1Y54A 1JWZA 4OQIA 1UGUA 2HDSA 2W1RA 3LR0A 3N8SA 3MFXA 5EECA 3EWKA 3BY8A 2HDUA 1KE0A 3BWLA 2ZM8A 2E8JA 4IVIA 3K3DA 2JKTI 2JN7A 2V0WA 3G31A 3UB5P 4CJNA 3W8KA 5CX7A 2P7JA 3MKEA 1KVLA 2I9VA 2JKTM 1NJ4A 5DVAA 3ZG5A 2PRFA 4OONA 4S2OA 4HY8A 2XR0A 3A3IA 2EWWA 3IXBA 4QU3A 5EE8A 3K2NA 3ZDJA 1YLWA 5K5BA 2PT7A 1XFQA 2VZWA 5I94A 4QY6A 4LRZE 2HP5A 2WGIA 4WN5A 4BL3A 1YM1A 3IXDA 4LRXC 3ULFA 1MZUA 4OP8A 1WE4A 2Y79A 1IELA 3QNBA 4DE3A 4U0XA 1XA7A 3U2AA 1QMEA 3K3CA 5EOOA 3AGDA 2HP6A 3IS2B 4QPRA 3PHYA 1FCOA 3T1RA 2FZ0A 2HDQA 2Q9NA 2ZQ8A 4DE2A 1E25A 3CG5A 4GDBA 3UDFA 4IEDA 4WZ5A 2VGKA 4XT2B 2QZ6A 2JKFA 4OQ0A 3TRCA 3OCNA 4KZ9A 5GHXA 2VV7A 3IX4A 2XH9A 3E4QA 3MZEA 1KOUA 1MC0A 2HF6A 5LBRA 4H6JA 3G34A 3MQ0A 2Y2IA 4N92A 3N8RA 3OOVA 3O5YA 3CZDA 3TOIA 5FQMA 4WM9A 2IWDA 2VGJA 1ZC2A 3LIDA 3HCYA 1EW0A 3PBOA 4D2OA 1V9ZA 1ONGA 4C6YA 5DFXA 4Q8IA 2RCXA 3ZQ5A 4JXGA 3WS2A 1HTZA 3ZG8B 1DP9A 1ES5A 4R4RA 4IVKA 2PD8A 3GR2A 4GN2A 1H8MA 2X71A 3N6IA 1T1BA 4Q0IA 2E8IA 2VLGA 3DWKA 5G18A 4DF6A 4G3KA 4R3JA 2JKGA 5GLCA 3S7PA 5F1GA 3EEHA 3UPOA 4Q0JA 3KX0X 3UPPA 1PIOA 3HL9A 4EEUA 5L09A 3NI9A 4C75A 4X6TA 2EX6A 4X1MA 3JVUA 4FSFA 3RFBA 5F5YA 2XK1A 5BOHA 1STZA 3F1PA 1A0KA 4L0LA 5A93A 5FEGA 2ZL1A 4OLDA 3V5MA 1M6KA 3A3DA 3PBTA 3P01A 3BFCA 2Y2GA 3HLDA 3WWXA 1CQAA 4UQIM 1TDLA 3VFFA 1MY8A 4L9GA 2H0TA 2R9XA 3T4QA 4HEFA 2OWJA 3KYZA 2WK0A 4MEZA 3R7WB 1XGIA 4P87A 3S7QA 4S2NA 2ZC4B 4WZ5C 3UN7A 3B3XA 3WRZA 3PBNA 3PTEA 1K57A 5HD3A 3QP4A 3CPTA 3IWOA 3GMWA 3M6BA 1JVJA 3S7NA 5EVIA 1P9WA 1V9YA 4HBUA 4FUWA 1H3QA 2ZOHA 1XKZA 5HPFA 1YMXA 1IEMA 1AWIA 5A8BA 3T4SA 4WEKA 2HPBA 2ZD8A 1L2SA 3PXPA 2AVXA 3ICYA 1S4RA 2Y2HA 1AXBA 1W63Q 3BRMA 4JGPA 4KG2A 3HREA 4E3LA 3S1YA 3EQVA 5HL1A 2WKIA 4X69A 3HJKA 2PDRA 4F94A 4MBKA 1PW8A 2KLIA 5HZHA 3PAEA 1TF1A 2XFTA 5F82A 3UO9A 4DMZA 1FR6A 2FFYA 5MC7A 1OTAA 5E43A 4NXGA 2OLVA 5FAPA 1GSXA 2I72A 1LL8A 1LLBA 3FKVA 3VP2A 1FOFA 5L10A 4GD6A 1ALQA 2OAQ1 2XA7S 2ZC5B 4JGRA 2HJEA 1VETB 3IF5A 3IF6B 2R9WA 1BLPA 3QP5A 2IA2A 5TBMA 2M7UA 1PI5A 4S2NC 3WS5A 4QWOA 3BLMA 1K55A 2XF3A 4AFIA 4S2KA 1NYMA 4JGOA 1K57C 3T1SA 3NECA 5J3WA 2W3EA 4NXEA 2EWVA 3QP6A 2JKRI 1PFLA 3QNCA 1L0EA 1RGZA 3JVVA 5EVIC 3VP1A 2JKRM 2UWXA 5CRFA 4KG5A 2G2WA 4UA6A 2V2FF 5AVEA 1FSYA 4HJ3A 5FQIA 5HWWA 3OCLA 4I5SA 3V67A 4EBLA 2ZC6B 4FH2A 1CK3A 4B9OA 3OC2A 3T4LA 2V20A 5GLBA 3DBAA 3KYEA 5AQ7A 3WRTA 1IFQA 2L1MA 2ZMAA 4NXFA 2BLSA 2Y55A 3SH8A 4EUVA 5E2HA 1XPBA 4OQGA 3IBRA 3N8LA 4E3IA 4UEYA 4QHCA 3MR0A 4OQHA 3FYZA 3IS2A 4R0QA 1P9RA 4O01A 1KGFA 2BG1A 4O8GA 3D4FA 2PHYA 4UA7A 4QD4A 4XT2A 2K2NA 5TJJA 4KZAA 4FCFA 2OV5A 4LENA 4BENA 3NBLA 1HZOA 5TFQA 1IKGA 4N9KA 5IHVA 2QKPA 3UY6A 1XGJA 2ACGA 3ZNTA 4BQMA 2J9PA 3C4PA 1T1AA 1D7EA 4ID4A 4BD1A 4K0WA 4WBGA 3LY3A 3ISGA 3W2ZA 4HH2A 3NY4A 1XJ6A 3G2ZA 3MXRA 2XD1A 2OAP1 1OTDA 3DTIA 1TDGA 3VV4A 1K55C 3S7OA 5DKKA 2ZM0A 5HWTA 4HNBA 4GKUA 4FD8A 1N9NA 3RXWA 2GZAA 3NIAA 4MN7A 2XDMA 3LR5A 2O99A 2NUTC 1PWCA 4HP9A 1GHIA 4NXBA 3QHYA 4E3KA 5FQ9A 1I2WA 1LHYA 4CLCE 5CEDA 1TS7A 3C7VA 4KUKA 2GJ3A 1VHMA 4EETB 4WZ4A 5HDSA 4XUZA 1SHVA 2ZQ7A 1XX2A 1ZG4A 4Y0TA 1OTBA 3G30A 4BD0A 4DXCA 5J7EA 2A2LA 2PD7A 4MDZA 2INWA 5DTSA 3MQOA 5U47A 1G6AA 3VOYA 1YPRA 1TS6A 5CECA 1BULA 3FZCA 3SZTA 1E3UA 2V8CA 3G32A 3FG8A 4E6WA 3VOZA 1KVMA 1DJCA 4YWZA 2Q9MA 3R7WA 1S4SA 2W27A 5HAPA 2Z2MB 4YNRA 4DRTA 4Y0OA 5EVID 4K91A 3NHQA 4Z9QA 1EI5A 2A24B 2WYXA 4HIAA 1XJ3A 3UB7A 3RXXA 2VJWA 2EXAA 2EX8A 3N4IA 4E3NA 3VMAA 5AQAA 2LB9A 1Q2PA 3ZGAB 4DDSA 4F3LB 3NJAA 3T12B 2HGVA 4BMWA 1H5XA 4L9FA 3OLOA 3EQUA 3QP1A 3IXHA 4KUOA 3RTYA 4NK3A 2W3GA 4XXRA 1QMFA 2QJ7A 4HQAA 2OSUA 3T50A 4Y2FA 5FI6A 4I3JA 3P7NA 3O87A 2FFFB 2BTFP 2WGWA 1NXYA 3IH9A 4BLMA 2WZXA 3LGOA 2PYPA 3A0SA 4JPMA 3O88A 4ESPA 1YLPA 3SOIA 2O9AA 4CQHA 1LI0A 1YSPA 4YFMA 3HVFA 3LUQA 1MWRA 2YKFA 3GVBA 2RL3A 3DTMA 2J7VA 2K31A 3CHWP 4U0TA 1LSVA 4X53A 4M4XA 5EPHA 5KSCA 3T1XA 1VETA 4KQDA 3IF6A 3C38A 1IYSA 5CGSA 4DKIA 4B88A 3O3VA 3LIEA 4GS9B 3FPVA 5EFWA 4JXSA 5FASA 2H10A 3NC8A 4R4SA 4LCLA 5DFYA 1SCWA 4MNRA 1T18A 2K7SA 2V1BA 3SS4A 1K6RA 1O07A 2HV1A 2WAEA 1KGGA 1D1JA 5L07A 1UWNX 4WEJA 5JYOA 3D3OA 2H0YA 2V0UA 4LV2A 1TS0A 3NDEA 3MQQA 1GA9A 3IH8A 3GV9A 3AGFA 4OVDA 3BJNA 3BW6A 3TG9A 5L2FA 4DJ3A 4O7DA 4HJ6A 2EX2A 1LSWA 3CUEA 5DTTA 2CC1A 2QHKA 4EBPA 4ZJ2A 3NCKA 4GNUA 4OP5A 1PYYA 3DW0A 1LI9A 2DRWA 1E4DA 2NUPC 5M18A 3SS5A 5A91A 3LFVA 1XFNA 2XQZA 1ERMA 4FH4A 1G28A 1DJBA 1ONHA 1IYOA 1G6OA 4GW9A 1PWDA 2WKHA 1ZG6A 1CEGA 3MSHA 1PI4A 1G5UA 2Y2QA 1OT9A 5HAIA 2GDNA 5CTNA 3B42A 1NLZA 2J3WA 2Z6CA 3L7HA 4R6LA 4LCMA 1S66L 2W1TB 3UPNA 1HD8A 3IF6C 5JYPA 1BZAA 4EQIA 1ESUA 1H8ZA 3C5AA 4CLCB 4R1GA 5FI7A 5I5LA 2O0YA 4Y7PA 1J3WA 3ZHHA 2IWCA 5FAOA 3TJZC 3JPUA 1SDEA 2VX8A 3M2JA 3Q1FA 4X25A 3G2YA 4B93A 4WELA 4ZRRA 1K0KA 4PM6A 1DP8A 1K4FA 2VGLM 5DTKA 3QP8A 4BWIA 4IBXA 4EESA 3OBFA 5J8XA 3BM6A 3LIAA 3E0YA 2QJ5A 2J8YA 2ZC7A 4GOGA 4S2LA 5HD5A 4K0XA 1ERQA 2WGWB 2QMIA 4KZ6A 3GTCA 1WYCA 4EU0A 2KDKA 3P09A 3TE8A 3F1OB 3AGEA 3E2LA 4RA7A 1OJ5A 3D72A 3C30A 1F2KA 5CHJA 4IUKA 3CWFA 4R38A 3CUEC 1E3UD 4LRYC 4OPZA 1KE3A 2XFSA 1N9LA 3ITBA 1VB6A 3VFHA 3HBRA 2PU2A 2PBYA 1MXOA 2XD5A 3A3FA 3OPHA 5IT5A 3VSLA 1WYBA 3UB9A 4KZBA 1G68A 1GA0A 4RX3A 1ES4A 4PMAA 5KZHA 5G4YA 4GHIB 4G3VA 3GQZA 4QB8A 2C6WB 2LB5A 5F1FA 3FKWA 1JTDA 3NOTC 1L0GA 1TEMA 2Y2JA 2JC7A 4P6ZM 4Y15A 2WAFA 1DJAA 1VQQA 3N7WA 3HLFA 4RVAA 2A24A 3BYDA 4DN0A 3QP2A 3IX8A 3V39A 3M2KA 5HDCA 3HLEA 4KENB 1NY0A 1VEUB 5KMWA 2QWSA 2M1CA 3EGDC 4FTXA 4KZ5A 3CITA 2Y59A 3E4OA 2ZMVA 2G7UA 1DRMA 3PBSA 3HLWA 3VP0A 4PKYG 4F3LA 2XROA 4DDYA 3KSIA 1N9BA 1F98A 1RP5A 3GECA 3T4TA 3G35A 1ES3A 4BBTA 5J4EA 1W63M 4OPRA 1K38A 1YLZA 2Y4AA 5DKLA 2EA9A 3KSFA 3OPPA 4X55A 3WS0A 4Y13A 4LV0A 5FQKA 3EOIA 1L0DA 3NDGA 1Z09A 1HVBA 1MWSA 4JKTA 2WKRA 3BFEA 4EWFA 2J9OA 5GLDA 3MJQA 2QYBA 4BL2A 1S6RA 2VV8A 1H0MA 1IYPA 3S22A 4EV4A 3G6OA 1O7EA 4ARZB 1ACFA 1OTIA 3CI6A 2OWHA 3ZG0A 1S1YA 4UQIS 3SH9A 2G2UA 2ZBBA 4HBTA 3U4LP 4MBHA 3MKFA 2A3UA 5CTMA 1PNEA 4X56A 1BLHA 2B95A 3BFDA 2PR5A 4OOMA 3LO7A 4ZAMA 4E3MA 1NRFA 2JBFA 3LEQA 1K54A 4PM9A 1SKOB 4GS9A 2PU4A 2ZQCA 4JGQA 4WYYA 4BBUA 4EBNA 2VA0A 3C2WA 1GHPA 3V3SA 1K56A 4MCWA 3NULA 1ES2A 1JWPA 2B5RA 1OMEA 2B02A 1L0FA 2WADA 4DE0A 4G3WA 4U3TA 1OT6A 3LR4A 1OTEA 2H28A 2HDRA 3E4PA 3T4OA 1DP6A 3NOPC 3UDIA 3CLOA 3ZNYA 4FOFA 1ZHHB 1OPXA 4B4ZA 2PYRA 3P98A 1W8QA 4KQOA 4YOFA 1F9IA 2XEPA 2O9BA 1XJ4A 5KSHA 2GX5A 3MZFA 4GZBA 3A0RA 4LV3A 3UE6A 3MS6A 3PR6A 2M7VA 3F1NB 5FQQA 5HARA 5FSRA 2P04A 1WA9A 4IBRA 1NWZA 4OOYA 4UA9A 3SW1A 2ZM2A 4YINA 4LFUA 1PW1A 2P74A 1I5QA 3JYIA 3Q81A 5F68A
chains in the Genus database with same CATH topology
2ACGA 4QWOA 2VK3A 3T1XA 4FUWA 1ACFA 1VETA 1HLUP 3MSHA 4X1LA 1G5UA 2E8JA 3UB5P 3T1SA 1AWIA 3NECA 3U4LP 5EM1A 3T1QB 3L7HA 2PRFA 1PFLA 1PNEA 4D60A 2B95A 2JKGA 3LEQA 3T12B 2ZL1B 1SKOB 5FDSA 1FILA 1J3WA 5EVEA 1VEUB 2PBDP 3NULA 4FTXA 1D1JA 1SZVA 4X25A 3L9KA 4X1MA 1K0KA 3KYEA 3DAVA 5FEGA 1A0KA 2PAVP 2ZL1A 3T1RA 1SKOA 2HZ5A 1VEUA 1CQAA 2BTFP 2JKFA 1Y4OA 3D9YA 5EM0A 3CPTB 3LGOA 5FEFA 4ESPA 1YPRA 1PRQA 1VETB 3MS6A 5EV0A 2V8FA 1CJFA 1F2KA 1Z09A 2V8CA 1FIKA 1CF0A 3CHWP 3CPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACG A;  4QWO A;  2VK3 A;  3T1X A;  4FUW A;  1ACF A;  1VET A;  1HLU P;  3MSH A;  4X1L A;  1G5U A;  2E8J A;  3UB5 P;  3T1S A;  1AWI A;  3NEC A;  3U4L P;  5EM1 A;  3T1Q B;  3L7H A;  2PRF A;  1PFL A;  1PNE A;  4D60 A;  2B95 A;  2JKG A;  3LEQ A;  3T12 B;  2ZL1 B;  1SKO B;  5FDS A;  1FIL A;  1J3W A;  5EVE A;  1VEU B;  2PBD P;  3NUL A;  4FTX A;  1D1J A;  1SZV A;  4X25 A;  3L9K A;  4X1M A;  1K0K A;  3KYE A;  3DAV A;  5FEG A;  1A0K A;  2PAV P;  2ZL1 A;  3T1R A;  1SKO A;  2HZ5 A;  1VEU A;  1CQA A;  2BTF P;  2JKF A;  1Y4O A;  3D9Y A;  5EM0 A;  3CPT B;  3LGO A;  5FEF A;  4ESP A;  1YPR A;  1PRQ A;  1VET B;  3MS6 A;  5EV0 A;  2V8F A;  1CJF A;  1F2K A;  1Z09 A;  2V8C A;  1FIK A;  1CF0 A;  3CHW P;  3CPT A; 
#chains in the Genus database with same CATH topology
 5CGX A;  2Y2P A;  1YLJ A;  3MXQ A;  2P08 A;  4HH3 A;  3H9W A;  3T1Q B;  4R23 A;  4S2M A;  4KZ8 A;  4KQR A;  2KOI A;  5HAQ A;  1T19 A;  4I3A A;  1BLS A;  1MPL A;  1KDS A;  3C8C A;  3PBQ A;  5E2E A;  1K25 A;  1X0O A;  1FIL A;  5EVE A;  1YKD A;  1DY6 A;  3UDX A;  4DE1 A;  1I2S A;  1Y28 A;  2W1T A;  3HUN A;  2ZJ9 A;  2HP9 A;  3B47 A;  1K54 C;  1MKI A;  4WMC A;  3ZFZ A;  3IT9 A;  3WS1 A;  5FI2 A;  4CLC A;  3OZH A;  2HZ5 A;  2ZQA A;  2EFX A;  5HX9 A;  2W0N A;  1EWZ A;  1GSV A;  5E2G A;  5AJG A;  3HLB A;  3D9Y A;  3M6H A;  2HJ9 C;  4IJG A;  5FAQ A;  1W7F A;  1YQS A;  3SS3 A;  5FEF A;  5EOE A;  3T4J A;  2Y2O A;  5GHY A;  2V8F A;  4QY5 A;  4RX2 A;  3ZG7 B;  2CMN A;  1MKM A;  1UWP X;  3CAX A;  4R3A A;  3W4Q A;  4HI4 A;  1S1Z A;  3ZCZ A;  3FPW A;  1BTL A;  2VEA A;  3F1O A;  1S67 L;  2VK3 A;  1JNU A;  4JXW A;  4ZBE A;  5DJU A;  5CHM A;  4N1X A;  4X1L A;  3Q7V B;  2P9V B;  1ZTU A;  5A90 A;  1IKI A;  5GL9 A;  1ESI A;  3FC7 A;  4OPQ A;  5HWV A;  4P85 A;  3BY9 A;  3PBR A;  2DNS A;  2Z6D A;  4KQQ A;  3V3R A;  4MN6 A;  4JBF A;  1FCM A;  4S2J A;  2C5W B;  3GDI A;  1LL5 A;  3H7W B;  3VSK A;  4N1H A;  1LSX A;  4E3J A;  3WS4 A;  4MLL A;  2XA7 M;  4NKP A;  4Y5F A;  1XJ2 A;  2WKP A;  2XGN A;  4KZ3 A;  3C7U A;  2L4R A;  4GHI A;  5E2F A;  2EXB A;  4GB7 A;  4PM7 A;  2JE5 A;  5D3O A;  4HES A;  4Y3I A;  5FDH A;  4RYE A;  3VP3 A;  1LL9 A;  5DJT A;  2WZZ A;  3O86 A;  5M19 A;  2Y2L A;  4IUH A;  2R78 A;  3C4O A;  1RCJ A;  1VEU A;  1H8Y A;  2J3T C;  1CEF A;  1NZO A;  3A0V A;  4NG2 A;  3BEB A;  4KZ4 A;  3DTE A;  3OPL A;  3BEC A;  4CLC C;  1JWV A;  3MBZ A;  4UHU A;  3MF0 A;  4OOL A;  5CGW A;  2DMW A;  3OPR A;  1KGE A;  5EUA A;  2O9C A;  4WUJ A;  1NZU A;  2XSS A;  4Z1W A;  4KG6 A;  3ZYT A;  4Y17 A;  3RH8 B;  3ITA A;  1PZO A;  3RJU A;  1IOU A;  1FCN A;  2Y2N A;  1BLC A;  1L3L A;  4PKY A;  2X02 A;  1GSW A;  1VM1 A;  2UV0 E;  3BFF A;  5IS1 A;  1CI9 A;  1TS8 A;  3LR3 A;  4ARZ A;  4EXO A;  4HOI A;  3UB8 A;  4LLO B;  5F69 A;  4M3K A;  1IYQ A;  3HLG A;  4X68 A;  2ZQ9 A;  2PBD P;  3UE0 A;  3UE1 A;  2Y91 A;  3FV7 A;  1K56 D;  4IHQ A;  1K6S A;  3VE4 A;  4R3B A;  3H82 B;  1PZP A;  4OPY A;  3MFD A;  1SKO A;  1NRJ A;  1W5D A;  3W4O A;  4DXB A;  3IHA A;  2D01 A;  3TSG A;  3A3J A;  4PM8 A;  2WKQ A;  4QJG A;  3V50 A;  3FWL A;  1T1C A;  2GNX A;  4UAA A;  1BYW A;  1M40 A;  2Q0O A;  3EGX C;  1P97 A;  3HJI A;  1LT0 A;  4CPK A;  4OLG A;  2JHE A;  3IWQ A;  1CF0 A;  1ODV A;  1JTG A;  3VOL A;  3KO6 A;  4R70 A;  2Y8H A;  3IWI A;  4WLA A;  1NYY A;  5EVL A;  4EW7 A;  4LPZ A;  2EFU A;  3S4X A;  1CI8 A;  3BQA A;  3KSH A;  1K4E A;  4MN5 A;  1BT5 A;  4I38 A;  3LY4 A;  5FA7 A;  2H5S A;  4P6B A;  3F1N A;  4S2I A;  1MWT A;  4PAU A;  5L8M A;  1MWU A;  2MJ6 A;  2IWB A;  2YKH A;  3VP4 A;  1KE4 A;  2Y2K A;  2ZLY A;  4D60 A;  4JF6 A;  2B18 A;  5A92 A;  1YMS A;  3BLS A;  5HDD A;  4MMN A;  4BJP A;  5TR7 A;  4NET A;  4ZTK A;  3GRJ A;  3G4P A;  3ZG9 B;  5FDS A;  4ZJ3 A;  4GCZ A;  3UMD A;  4GD8 A;  1MBL A;  1N4O A;  4GJ4 A;  4ZJ1 A;  1YAX A;  3EEA A;  3Q7Z A;  3UME A;  4H6J B;  4P0M A;  2J3T D;  4O0P A;  2ZQD A;  3Q82 A;  4WMC D;  2V1Z A;  4CLC D;  4A5R A;  2Z2L B;  3GSG A;  4RQ9 A;  5TGF A;  5AQB A;  5DF7 A;  3VE3 A;  4JF4 A;  4WL9 A;  4H8R A;  3CMZ A;  1Z6F A;  3W4P A;  3E98 A;  4EEP A;  3IX3 A;  1FQG A;  1PRQ A;  5C5K A;  4EQ1 A;  3Q07 A;  5AVF A;  1CJF A;  1KDW A;  1YLY A;  2WUQ A;  1D06 A;  4I3I A;  5HL6 A;  1YSQ A;  4E04 A;  5FQJ A;  5DF8 A;  1U60 A;  2L0W A;  4Q0H A;  1HLU P;  3T4K A;  2DCF A;  5CER A;  1W79 A;  5EM1 A;  2ZOI A;  4PM5 A;  2JCH A;  3NOU C;  4MBF A;  2W3D A;  2XLN A;  1XA1 A;  4OKP A;  3I7J A;  1ZKJ A;  3LI8 A;  3LIC A;  4JF5 A;  2VKS A;  2ZC3 B;  2P9V A;  3Q7V A;  3DWZ A;  3F1P B;  4C3Q A;  2ZL1 B;  5CHU A;  1N9O A;  2W3H A;  4BBV A;  1TVF A;  3IXG A;  3R4K A;  4HHD A;  4KZ7 A;  1OJG A;  3L9K A;  5CEB A;  3MZD A;  3MMH A;  3H7W A;  5F6A A;  3DAV A;  4OH0 A;  4II7 A;  1J9M A;  2A49 A;  1GCE A;  3SH7 A;  4PHT A;  5KIZ A;  1XP4 A;  5G4Z A;  3E2K A;  3HUO A;  1F5M A;  3CPT B;  5IU1 A;  1GHM A;  2V9A A;  1TD5 A;  2XRN A;  3TW8 A;  2X01 A;  1BUE A;  5EVI B;  3HLC A;  5AQ9 A;  3ZVT A;  2OLU A;  4Y0U A;  4JLF A;  5CXW A;  4GDN A;  4LV1 A;  4EER A;  5HFO A;  2PR6 A;  4K08 A;  5HSQ A;  4NEE D;  4DJ2 A;  1SKF A;  2VGL S;  1NLY A;  2FH5 A;  3HUM A;  5FL3 A;  2VV6 A;  2QPN A;  3LEZ A;  3LIF A;  1FR1 A;  1YT4 A;  2J80 A;  1S0W A;  3MXS A;  3IBJ A;  2V1A A;  4JXV A;  3B33 A;  2D02 A;  3UB6 A;  5DF9 A;  5GHZ A;  3IQA A;  4ETZ A;  1BSG A;  3BFG A;  3A3E A;  4B4X A;  1FSW A;  2W3F A;  5F83 A;  1XXM A;  1PWG A;  1SDN A;  3LIB A;  5M1A A;  3CJM A;  2WGV A;  3BQ8 A;  3DTK A;  3LI9 A;  4N9L A;  3KYQ A;  4PPR A;  4I39 A;  5HW3 A;  4ETX A;  1SZV A;  4E3O A;  4HJ4 A;  3PAG A;  4HP4 A;  4E6X A;  1Q2Q A;  1W8Y A;  3IHB A;  2BAS A;  4XUX A;  3KSG A;  4LGW A;  4GLQ A;  2PAV P;  3ZVW A;  2WKE A;  4S2P A;  1P0Z A;  5HPI A;  2Y2M A;  5FAT A;  5TBM B;  1Y4O A;  1C3B A;  5EM0 A;  1RGY A;  5GLA A;  2OOL A;  4P6Z S;  4EUZ A;  3UNW A;  2EX9 A;  1ERO A;  2ZMF A;  3H82 A;  4ME4 A;  1YLT A;  3PYP A;  3LCE A;  5EV0 A;  3UE3 A;  4ZDX A;  2KX6 A;  1FIK A;  4L9E A;  4WF0 A;  3LYX A;  1Y54 A;  1JWZ A;  4OQI A;  1UGU A;  2HDS A;  2W1R A;  3LR0 A;  3N8S A;  3MFX A;  5EEC A;  3EWK A;  3BY8 A;  2HDU A;  1KE0 A;  3BWL A;  2ZM8 A;  2E8J A;  4IVI A;  3K3D A;  2JKT I;  2JN7 A;  2V0W A;  3G31 A;  3UB5 P;  4CJN A;  3W8K A;  5CX7 A;  2P7J A;  3MKE A;  1KVL A;  2I9V A;  2JKT M;  1NJ4 A;  5DVA A;  3ZG5 A;  2PRF A;  4OON A;  4S2O A;  4HY8 A;  2XR0 A;  3A3I A;  2EWW A;  3IXB A;  4QU3 A;  5EE8 A;  3K2N A;  3ZDJ A;  1YLW A;  5K5B A;  2PT7 A;  1XFQ A;  2VZW A;  5I94 A;  4QY6 A;  4LRZ E;  2HP5 A;  2WGI A;  4WN5 A;  4BL3 A;  1YM1 A;  3IXD A;  4LRX C;  3ULF A;  1MZU A;  4OP8 A;  1WE4 A;  2Y79 A;  1IEL A;  3QNB A;  4DE3 A;  4U0X A;  1XA7 A;  3U2A A;  1QME A;  3K3C A;  5EOO A;  3AGD A;  2HP6 A;  3IS2 B;  4QPR A;  3PHY A;  1FCO A;  3T1R A;  2FZ0 A;  2HDQ A;  2Q9N A;  2ZQ8 A;  4DE2 A;  1E25 A;  3CG5 A;  4GDB A;  3UDF A;  4IED A;  4WZ5 A;  2VGK A;  4XT2 B;  2QZ6 A;  2JKF A;  4OQ0 A;  3TRC A;  3OCN A;  4KZ9 A;  5GHX A;  2VV7 A;  3IX4 A;  2XH9 A;  3E4Q A;  3MZE A;  1KOU A;  1MC0 A;  2HF6 A;  5LBR A;  4H6J A;  3G34 A;  3MQ0 A;  2Y2I A;  4N92 A;  3N8R A;  3OOV A;  3O5Y A;  3CZD A;  3TOI A;  5FQM A;  4WM9 A;  2IWD A;  2VGJ A;  1ZC2 A;  3LID A;  3HCY A;  1EW0 A;  3PBO A;  4D2O A;  1V9Z A;  1ONG A;  4C6Y A;  5DFX A;  4Q8I A;  2RCX A;  3ZQ5 A;  4JXG A;  3WS2 A;  1HTZ A;  3ZG8 B;  1DP9 A;  1ES5 A;  4R4R A;  4IVK A;  2PD8 A;  3GR2 A;  4GN2 A;  1H8M A;  2X71 A;  3N6I A;  1T1B A;  4Q0I A;  2E8I A;  2VLG A;  3DWK A;  5G18 A;  4DF6 A;  4G3K A;  4R3J A;  2JKG A;  5GLC A;  3S7P A;  5F1G A;  3EEH A;  3UPO A;  4Q0J A;  3KX0 X;  3UPP A;  1PIO A;  3HL9 A;  4EEU A;  5L09 A;  3NI9 A;  4C75 A;  4X6T A;  2EX6 A;  4X1M A;  3JVU A;  4FSF A;  3RFB A;  5F5Y A;  2XK1 A;  5BOH A;  1STZ A;  3F1P A;  1A0K A;  4L0L A;  5A93 A;  5FEG A;  2ZL1 A;  4OLD A;  3V5M A;  1M6K A;  3A3D A;  3PBT A;  3P01 A;  3BFC A;  2Y2G A;  3HLD A;  3WWX A;  1CQA A;  4UQI M;  1TDL A;  3VFF A;  1MY8 A;  4L9G A;  2H0T A;  2R9X A;  3T4Q A;  4HEF A;  2OWJ A;  3KYZ A;  2WK0 A;  4MEZ A;  3R7W B;  1XGI A;  4P87 A;  3S7Q A;  4S2N A;  2ZC4 B;  4WZ5 C;  3UN7 A;  3B3X A;  3WRZ A;  3PBN A;  3PTE A;  1K57 A;  5HD3 A;  3QP4 A;  3CPT A;  3IWO A;  3GMW A;  3M6B A;  1JVJ A;  3S7N A;  5EVI A;  1P9W A;  1V9Y A;  4HBU A;  4FUW A;  1H3Q A;  2ZOH A;  1XKZ A;  5HPF A;  1YMX A;  1IEM A;  1AWI A;  5A8B A;  3T4S A;  4WEK A;  2HPB A;  2ZD8 A;  1L2S A;  3PXP A;  2AVX A;  3ICY A;  1S4R A;  2Y2H A;  1AXB A;  1W63 Q;  3BRM A;  4JGP A;  4KG2 A;  3HRE A;  4E3L A;  3S1Y A;  3EQV A;  5HL1 A;  2WKI A;  4X69 A;  3HJK A;  2PDR A;  4F94 A;  4MBK A;  1PW8 A;  2KLI A;  5HZH A;  3PAE A;  1TF1 A;  2XFT A;  5F82 A;  3UO9 A;  4DMZ A;  1FR6 A;  2FFY A;  5MC7 A;  1OTA A;  5E43 A;  4NXG A;  2OLV A;  5FAP A;  1GSX A;  2I72 A;  1LL8 A;  1LLB A;  3FKV A;  3VP2 A;  1FOF A;  5L10 A;  4GD6 A;  1ALQ A;  2OAQ 1;  2XA7 S;  2ZC5 B;  4JGR A;  2HJE A;  1VET B;  3IF5 A;  3IF6 B;  2R9W A;  1BLP A;  3QP5 A;  2IA2 A;  5TBM A;  2M7U A;  1PI5 A;  4S2N C;  3WS5 A;  4QWO A;  3BLM A;  1K55 A;  2XF3 A;  4AFI A;  4S2K A;  1NYM A;  4JGO A;  1K57 C;  3T1S A;  3NEC A;  5J3W A;  2W3E A;  4NXE A;  2EWV A;  3QP6 A;  2JKR I;  1PFL A;  3QNC A;  1L0E A;  1RGZ A;  3JVV A;  5EVI C;  3VP1 A;  2JKR M;  2UWX A;  5CRF A;  4KG5 A;  2G2W A;  4UA6 A;  2V2F F;  5AVE A;  1FSY A;  4HJ3 A;  5FQI A;  5HWW A;  3OCL A;  4I5S A;  3V67 A;  4EBL A;  2ZC6 B;  4FH2 A;  1CK3 A;  4B9O A;  3OC2 A;  3T4L A;  2V20 A;  5GLB A;  3DBA A;  3KYE A;  5AQ7 A;  3WRT A;  1IFQ A;  2L1M A;  2ZMA A;  4NXF A;  2BLS A;  2Y55 A;  3SH8 A;  4EUV A;  5E2H A;  1XPB A;  4OQG A;  3IBR A;  3N8L A;  4E3I A;  4UEY A;  4QHC A;  3MR0 A;  4OQH A;  3FYZ A;  3IS2 A;  4R0Q A;  1P9R A;  4O01 A;  1KGF A;  2BG1 A;  4O8G A;  3D4F A;  2PHY A;  4UA7 A;  4QD4 A;  4XT2 A;  2K2N A;  5TJJ A;  4KZA A;  4FCF A;  2OV5 A;  4LEN A;  4BEN A;  3NBL A;  1HZO A;  5TFQ A;  1IKG A;  4N9K A;  5IHV A;  2QKP A;  3UY6 A;  1XGJ A;  2ACG A;  3ZNT A;  4BQM A;  2J9P A;  3C4P A;  1T1A A;  1D7E A;  4ID4 A;  4BD1 A;  4K0W A;  4WBG A;  3LY3 A;  3ISG A;  3W2Z A;  4HH2 A;  3NY4 A;  1XJ6 A;  3G2Z A;  3MXR A;  2XD1 A;  2OAP 1;  1OTD A;  3DTI A;  1TDG A;  3VV4 A;  1K55 C;  3S7O A;  5DKK A;  2ZM0 A;  5HWT A;  4HNB A;  4GKU A;  4FD8 A;  1N9N A;  3RXW A;  2GZA A;  3NIA A;  4MN7 A;  2XDM A;  3LR5 A;  2O99 A;  2NUT C;  1PWC A;  4HP9 A;  1GHI A;  4NXB A;  3QHY A;  4E3K A;  5FQ9 A;  1I2W A;  1LHY A;  4CLC E;  5CED A;  1TS7 A;  3C7V A;  4KUK A;  2GJ3 A;  1VHM A;  4EET B;  4WZ4 A;  5HDS A;  4XUZ A;  1SHV A;  2ZQ7 A;  1XX2 A;  1ZG4 A;  4Y0T A;  1OTB A;  3G30 A;  4BD0 A;  4DXC A;  5J7E A;  2A2L A;  2PD7 A;  4MDZ A;  2INW A;  5DTS A;  3MQO A;  5U47 A;  1G6A A;  3VOY A;  1YPR A;  1TS6 A;  5CEC A;  1BUL A;  3FZC A;  3SZT A;  1E3U A;  2V8C A;  3G32 A;  3FG8 A;  4E6W A;  3VOZ A;  1KVM A;  1DJC A;  4YWZ A;  2Q9M A;  3R7W A;  1S4S A;  2W27 A;  5HAP A;  2Z2M B;  4YNR A;  4DRT A;  4Y0O A;  5EVI D;  4K91 A;  3NHQ A;  4Z9Q A;  1EI5 A;  2A24 B;  2WYX A;  4HIA A;  1XJ3 A;  3UB7 A;  3RXX A;  2VJW A;  2EXA A;  2EX8 A;  3N4I A;  4E3N A;  3VMA A;  5AQA A;  2LB9 A;  1Q2P A;  3ZGA B;  4DDS A;  4F3L B;  3NJA A;  3T12 B;  2HGV A;  4BMW A;  1H5X A;  4L9F A;  3OLO A;  3EQU A;  3QP1 A;  3IXH A;  4KUO A;  3RTY A;  4NK3 A;  2W3G A;  4XXR A;  1QMF A;  2QJ7 A;  4HQA A;  2OSU A;  3T50 A;  4Y2F A;  5FI6 A;  4I3J A;  3P7N A;  3O87 A;  2FFF B;  2BTF P;  2WGW A;  1NXY A;  3IH9 A;  4BLM A;  2WZX A;  3LGO A;  2PYP A;  3A0S A;  4JPM A;  3O88 A;  4ESP A;  1YLP A;  3SOI A;  2O9A A;  4CQH A;  1LI0 A;  1YSP A;  4YFM A;  3HVF A;  3LUQ A;  1MWR A;  2YKF A;  3GVB A;  2RL3 A;  3DTM A;  2J7V A;  2K31 A;  3CHW P;  4U0T A;  1LSV A;  4X53 A;  4M4X A;  5EPH A;  5KSC A;  3T1X A;  1VET A;  4KQD A;  3IF6 A;  3C38 A;  1IYS A;  5CGS A;  4DKI A;  4B88 A;  3O3V A;  3LIE A;  4GS9 B;  3FPV A;  5EFW A;  4JXS A;  5FAS A;  2H10 A;  3NC8 A;  4R4S A;  4LCL A;  5DFY A;  1SCW A;  4MNR A;  1T18 A;  2K7S A;  2V1B A;  3SS4 A;  1K6R A;  1O07 A;  2HV1 A;  2WAE A;  1KGG A;  1D1J A;  5L07 A;  1UWN X;  4WEJ A;  5JYO A;  3D3O A;  2H0Y A;  2V0U A;  4LV2 A;  1TS0 A;  3NDE A;  3MQQ A;  1GA9 A;  3IH8 A;  3GV9 A;  3AGF A;  4OVD A;  3BJN A;  3BW6 A;  3TG9 A;  5L2F A;  4DJ3 A;  4O7D A;  4HJ6 A;  2EX2 A;  1LSW A;  3CUE A;  5DTT A;  2CC1 A;  2QHK A;  4EBP A;  4ZJ2 A;  3NCK A;  4GNU A;  4OP5 A;  1PYY A;  3DW0 A;  1LI9 A;  2DRW A;  1E4D A;  2NUP C;  5M18 A;  3SS5 A;  5A91 A;  3LFV A;  1XFN A;  2XQZ A;  1ERM A;  4FH4 A;  1G28 A;  1DJB A;  1ONH A;  1IYO A;  1G6O A;  4GW9 A;  1PWD A;  2WKH A;  1ZG6 A;  1CEG A;  3MSH A;  1PI4 A;  1G5U A;  2Y2Q A;  1OT9 A;  5HAI A;  2GDN A;  5CTN A;  3B42 A;  1NLZ A;  2J3W A;  2Z6C A;  3L7H A;  4R6L A;  4LCM A;  1S66 L;  2W1T B;  3UPN A;  1HD8 A;  3IF6 C;  5JYP A;  1BZA A;  4EQI A;  1ESU A;  1H8Z A;  3C5A A;  4CLC B;  4R1G A;  5FI7 A;  5I5L A;  2O0Y A;  4Y7P A;  1J3W A;  3ZHH A;  2IWC A;  5FAO A;  3TJZ C;  3JPU A;  1SDE A;  2VX8 A;  3M2J A;  3Q1F A;  4X25 A;  3G2Y A;  4B93 A;  4WEL A;  4ZRR A;  1K0K A;  4PM6 A;  1DP8 A;  1K4F A;  2VGL M;  5DTK A;  3QP8 A;  4BWI A;  4IBX A;  4EES A;  3OBF A;  5J8X A;  3BM6 A;  3LIA A;  3E0Y A;  2QJ5 A;  2J8Y A;  2ZC7 A;  4GOG A;  4S2L A;  5HD5 A;  4K0X A;  1ERQ A;  2WGW B;  2QMI A;  4KZ6 A;  3GTC A;  1WYC A;  4EU0 A;  2KDK A;  3P09 A;  3TE8 A;  3F1O B;  3AGE A;  3E2L A;  4RA7 A;  1OJ5 A;  3D72 A;  3C30 A;  1F2K A;  5CHJ A;  4IUK A;  3CWF A;  4R38 A;  3CUE C;  1E3U D;  4LRY C;  4OPZ A;  1KE3 A;  2XFS A;  1N9L A;  3ITB A;  1VB6 A;  3VFH A;  3HBR A;  2PU2 A;  2PBY A;  1MXO A;  2XD5 A;  3A3F A;  3OPH A;  5IT5 A;  3VSL A;  1WYB A;  3UB9 A;  4KZB A;  1G68 A;  1GA0 A;  4RX3 A;  1ES4 A;  4PMA A;  5KZH A;  5G4Y A;  4GHI B;  4G3V A;  3GQZ A;  4QB8 A;  2C6W B;  2LB5 A;  5F1F A;  3FKW A;  1JTD A;  3NOT C;  1L0G A;  1TEM A;  2Y2J A;  2JC7 A;  4P6Z M;  4Y15 A;  2WAF A;  1DJA A;  1VQQ A;  3N7W A;  3HLF A;  4RVA A;  2A24 A;  3BYD A;  4DN0 A;  3QP2 A;  3IX8 A;  3V39 A;  3M2K A;  5HDC A;  3HLE A;  4KEN B;  1NY0 A;  1VEU B;  5KMW A;  2QWS A;  2M1C A;  3EGD C;  4FTX A;  4KZ5 A;  3CIT A;  2Y59 A;  3E4O A;  2ZMV A;  2G7U A;  1DRM A;  3PBS A;  3HLW A;  3VP0 A;  4PKY G;  4F3L A;  2XRO A;  4DDY A;  3KSI A;  1N9B A;  1F98 A;  1RP5 A;  3GEC A;  3T4T A;  3G35 A;  1ES3 A;  4BBT A;  5J4E A;  1W63 M;  4OPR A;  1K38 A;  1YLZ A;  2Y4A A;  5DKL A;  2EA9 A;  3KSF A;  3OPP A;  4X55 A;  3WS0 A;  4Y13 A;  4LV0 A;  5FQK A;  3EOI A;  1L0D A;  3NDG A;  1Z09 A;  1HVB A;  1MWS A;  4JKT A;  2WKR A;  3BFE A;  4EWF A;  2J9O A;  5GLD A;  3MJQ A;  2QYB A;  4BL2 A;  1S6R A;  2VV8 A;  1H0M A;  1IYP A;  3S22 A;  4EV4 A;  3G6O A;  1O7E A;  4ARZ B;  1ACF A;  1OTI A;  3CI6 A;  2OWH A;  3ZG0 A;  1S1Y A;  4UQI S;  3SH9 A;  2G2U A;  2ZBB A;  4HBT A;  3U4L P;  4MBH A;  3MKF A;  2A3U A;  5CTM A;  1PNE A;  4X56 A;  1BLH A;  2B95 A;  3BFD A;  2PR5 A;  4OOM A;  3LO7 A;  4ZAM A;  4E3M A;  1NRF A;  2JBF A;  3LEQ A;  1K54 A;  4PM9 A;  1SKO B;  4GS9 A;  2PU4 A;  2ZQC A;  4JGQ A;  4WYY A;  4BBU A;  4EBN A;  2VA0 A;  3C2W A;  1GHP A;  3V3S A;  1K56 A;  4MCW A;  3NUL A;  1ES2 A;  1JWP A;  2B5R A;  1OME A;  2B02 A;  1L0F A;  2WAD A;  4DE0 A;  4G3W A;  4U3T A;  1OT6 A;  3LR4 A;  1OTE A;  2H28 A;  2HDR A;  3E4P A;  3T4O A;  1DP6 A;  3NOP C;  3UDI A;  3CLO A;  3ZNY A;  4FOF A;  1ZHH B;  1OPX A;  4B4Z A;  2PYR A;  3P98 A;  1W8Q A;  4KQO A;  4YOF A;  1F9I A;  2XEP A;  2O9B A;  1XJ4 A;  5KSH A;  2GX5 A;  3MZF A;  4GZB A;  3A0R A;  4LV3 A;  3UE6 A;  3MS6 A;  3PR6 A;  2M7V A;  3F1N B;  5FQQ A;  5HAR A;  5FSR A;  2P04 A;  1WA9 A;  4IBR A;  1NWZ A;  4OOY A;  4UA9 A;  3SW1 A;  2ZM2 A;  4YIN A;  4LFU A;  1PW1 A;  2P74 A;  1I5Q A;  3JYI A;  3Q81 A;  5F68 A; 
#chains in the Genus database with same CATH homology
 2ACG A;  4QWO A;  2VK3 A;  3T1X A;  4FUW A;  1ACF A;  1VET A;  1HLU P;  3MSH A;  4X1L A;  1G5U A;  2E8J A;  3UB5 P;  3T1S A;  1AWI A;  3NEC A;  3U4L P;  5EM1 A;  3T1Q B;  3L7H A;  2PRF A;  1PFL A;  1PNE A;  4D60 A;  2B95 A;  2JKG A;  3LEQ A;  3T12 B;  2ZL1 B;  1SKO B;  5FDS A;  1FIL A;  1J3W A;  5EVE A;  1VEU B;  2PBD P;  3NUL A;  4FTX A;  1D1J A;  1SZV A;  4X25 A;  3L9K A;  4X1M A;  1K0K A;  3KYE A;  3DAV A;  5FEG A;  1A0K A;  2PAV P;  2ZL1 A;  3T1R A;  1SKO A;  2HZ5 A;  1VEU A;  1CQA A;  2BTF P;  2JKF A;  1Y4O A;  3D9Y A;  5EM0 A;  3CPT B;  3LGO A;  5FEF A;  4ESP A;  1YPR A;  1PRQ A;  1VET B;  3MS6 A;  5EV0 A;  2V8F A;  1CJF A;  1F2K A;  1Z09 A;  2V8C A;  1FIK A;  1CF0 A;  3CHW P;  3CPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...