3T1QB

Mgla bound to gppnhp in complex with mglb
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
b'LVLYGAPYAAAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALAAIAEEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/signaling protein
total genus 37
structure length 132
sequence length 132
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1qB00
3CPTB 3MS6A 3U4LP 5FEGA 3NECA 5FDSA 1AWIA 2B95A 5EM0A 5EM1A 2HZ5A 3CHWP 1CJFA 1SKOA 1VEUA 1A0KA 3KYEA 1ACFA 4D60A 2PBDP 2V8FA 1PNEA 1YPRA 1Z09A 1F2KA 4X1LA 3T1XA 2PAVP 3T1SA 1FIKA 1D1JA 5FEFA 3T12B 1PFLA 2JKGA 1FILA 3T1QB 3UB5P 1PRQA 3LEQA 3CPTA 1K0KA 4FTXA 1J3WA 2ZL1B 3LGOA 2BTFP 3NULA 3D9YA 5EVEA 2VK3A 2V8CA 3L9KA 2PRFA 1G5UA 1VEUB 1VETB 1HLUP 1SZVA 2ZL1A 3DAVA 1CQAA 2E8JA 4X1MA 4X25A 4QWOA 5EV0A 3T1RA 3MSHA 3L7HA 1VETA 1Y4OA 4ESPA 1SKOB 4FUWA 2JKFA 2ACGA 1CF0A
chains in the Genus database with same CATH superfamily
3V3SA 3E2KA 1T19A 3FC7A 2ZC7A 1H8ZA 4X53A 4DJ2A 4PMAA 1CJFA 5E2FA 1O07A 3LIBA 1VEUA 5U47A 4FCFA 2PBDP 5FQ9A 2VV6A 4H6JA 4QB8A 2GNXA 3VE3A 4E6WA 1LSVA 3LR4A 1TS0A 4N1HA 5HW3A 3H82B 2QYBA 3LYXA 4BBTA 1JVJA 2FH5A 4LV3A 1MXOA 2YKFA 3GMWA 1PRQA 1U60A 4F94A 1D06A 5FAOA 2W1TA 3CPTA 2W3HA 2V2FF 3NCKA 4PHTA 4DE1A 2ZQAA 2O0YA 3GR2A 2PYPA 5CEBA 4BJPA 1T1AA 3T4QA 1LL9A 4EEUA 2WKHA 1OT9A 3T4OA 1L2SA 4JXVA 5EVLA 4RYEA 1YLWA 3W4QA 4Y13A 4KG5A 4GLQA 1TVFA 3RXWA 2D01A 2HP6A 4DJ3A 3T4LA 2H28A 3ZG5A 3OC2A 2XQZA 2J80A 3MZFA 4KUKA 3EOIA 4Y3IA 2K7SA 4QY5A 1FR1A 4Y0OA 4OQ0A 4GHIA 2C6WB 1L0FA 4LENA 4Q0JA 4JBFA 2O9BA 4I3JA 1IYPA 1PW1A 4C3QA 4HI4A 4B9OA 3S22A 4OPYA 4KZ6A 3SS5A 3QP6A 4NK3A 1S4SA 3ZVWA 4EQIA 2M1CA 1K6SA 5HDSA 2B02A 1N9LA 1DY6A 1N4OA 3Q7ZA 2JN7A 4HP4A 1XGJA 2W3EA 4WN5A 1ES4A 3AGEA 4OLGA 4WZ4A 5KSCA 3T1XA 3BRMA 1PWGA 2UV0E 5DF7A 2W3GA 5CX7A 4KQOA 4GJ4A 1ZG4A 2EX8A 2OSUA 5IHVA 1MWUA 3C8CA 2Y2PA 2WKPA 3W2ZA 5EOEA 2R78A 1L0DA 2P9VB 4Y15A 3HLFA 2Y8HA 4ZJ3A 3VFHA 2HV1A 4WMCA 4GD8A 5CERA 3MXRA 1I5QA 3OPHA 4HBTA 3BY8A 3IXHA 3NJAA 3N8RA 3PR6A 4ZRRA 4LV1A 2A2LA 4RVAA 3MFXA 4QWOA 4KG6A 4GW9A 3T1RA 1YKDA 3GDIA 3IS2B 1ZTUA 3LFVA 4Y0UA 5D3OA 3HJKA 3P98A 2Z6DA 1ESUA 3OZHA 5E2HA 3OLOA 3R4KA 5TBMA 4PPRA 5CGXA 3HUNA 3UB9A 4JLFA 5DTKA 1WA9A 3ULFA 1DRMA 3HL9A 2PU4A 4FSFA 3QP1A 3H7WB 2J8YA 1GSXA 4DN0A 3E0YA 2Y2MA 1NYMA 1XFQA 3FG8A 1H8MA 3PBNA 4KZ3A 1BYWA 1CK3A 4S2NA 5HX9A 4IHQA 3IH8A 3UDXA 2EWWA 4BD1A 1K4FA 4MN7A 5AQ9A 4CQHA 2Z2LB 3K2NA 1FCOA 1LSXA 2WKIA 5FEFA 3TG9A 2JKGA 3PBRA 1PZPA 1SDEA 4OPRA 2W3DA 4X6TA 2JC7A 3DBAA 1FSWA 3D4FA 3HLDA 3V5MA 3H82A 3S7PA 5TGFA 3M2KA 3F1PB 5DFXA 5F6AA 3UE1A 1RCJA 4JXWA 3L9KA 1KGFA 3GVBA 2XLNA 3JYIA 1LSWA 3RFBA 4U0XA 5DJTA 1PYYA 4RX3A 2Y55A 3PAEA 2JCHA 3IBRA 3E4OA 3WS1A 1GA9A 1MWSA 3EQVA 3HLCA 5CECA 3OPPA 3P01A 3CG5A 1M40A 3ZG9B 4LLOB 1O7EA 1K6RA 4HOIA 3F1OA 5HAPA 2EX9A 3PBOA 1LL5A 1WYBA 2V0UA 2WZXA 4LFUA 2E8IA 2P04A 4MEZA 3A0VA 2WGWB 4M3KA 1GA0A 3LIDA 3G32A 1H0MA 5EM0A 3ZNYA 1K56D 5HWVA 5FQMA 4JXSA 3SS4A 1YQSA 3RH8B 3C30A 4GCZA 4P6BA 1W63M 5IU1A 2OV5A 5FI2A 2EX2A 3UPOA 3MF0A 3NI9A 1N9NA 2OLVA 4YINA 3AGFA 3D3OA 2JHEA 2WK0A 4B88A 2JBFA 4MBKA 1K55C 2XSSA 2GJ3A 1CEGA 4N9LA 4M4XA 2M7UA 4E3OA 2Q9NA 3LGOA 1ZKJA 2Z6CA 3Q1FA 2WUQA 5BOHA 4Y2FA 2EXBA 4Z9QA 4NG2A 3FYZA 1ODVA 5FQIA 3QNCA 1MPLA 3UDFA 1L0EA 5G18A 1E4DA 3NOTC 2EWVA 3UB8A 3VP1A 3LY3A 1MKMA 4I39A 1RP5A 1P9RA 4RX2A 1XJ6A 2X71A 4X69A 5TJJA 2VV7A 2P9VA 4GS9B 4X25A 1XA1A 4OPZA 5HD3A 4IVKA 1EW0A 3VSKA 3B33A 3HLEA 1JTDA 2UWXA 1LL8A 3AGDA 3VMAA 4ZDXA 5MC7A 2Y2QA 2G7UA 3O3VA 2EXAA 4WZ5A 3IS2A 3IT9A 1N9OA 1IELA 1LI9A 1MC0A 2IWBA 1PWCA 1J9MA 4KZ4A 3TE8A 4QPRA 1ACFA 3GTCA 3DTEA 4PM9A 4BMWA 1OTEA 4MN6A 3RXXA 3LR3A 1CI9A 2XH9A 2W0NA 3H7WA 4I3AA 2GX5A 1ALQA 4F3LB 2HDRA 3IXGA 3KSIA 4CLCA 1YLYA 4Y7PA 4Z1WA 1DJCA 3JVUA 3CWFA 2XFTA 2Y2HA 4UQIM 2Y2GA 2P08A 4WM9A 4E3JA 3UB7A 1YLTA 3BWLA 4DF6A 1YSQA 1YAXA 3C7VA 3UPNA 2R9WA 1JWPA 2DCFA 4C75A 5F5YA 2XRNA 3BFCA 2WADA 1K25A 2PYRA 1S66L 3ZCZA 2XF3A 1LT0A 1XJ4A 3CUEA 2ZQ8A 4QU3A 3F1PA 4K08A 1TDLA 3LIEA 2V1ZA 4GZBA 3FPVA 4E3MA 3IXDA 2PT7A 2ZQDA 3L7HA 1Y4OA 3PAGA 1NJ4A 3DW0A 4KZBA 2V20A 3LEZA 1D7EA 2PDRA 2ACGA 4R1GA 5HD5A 3I7JA 2ZBBA 4Q8IA 4MMNA 3P7NA 4KZAA 4LRYC 5AQ7A 5EVIC 1XJ3A 4CLCE 2KDKA 2O99A 2PD7A 5EM1A 3MKFA 1NRJA 3VOZA 2DNSA 3OCNA 4DMZA 2Y79A 3PHYA 3S1YA 2V8FA 5CHMA 1XPBA 2EX6A 2WGWA 1YLPA 1Z09A 3IWOA 4EQ1A 5J3WA 2M7VA 5TR7A 1H8YA 1D1JA 3DTIA 4HH2A 1K54A 1K57A 3MQ0A 4LCMA 4OP5A 1YMSA 5KMWA 5HZHA 1F9IA 1QMFA 1DJBA 4S2JA 4PM6A 4D2OA 3Q81A 3ICYA 4DXBA 1VB6A 3W8KA 2P74A 2J3TC 1EI5A 1JWVA 3KYZA 5A93A 3T4KA 4Y5FA 3N6IA 1OJGA 1XP4A 3C4OA 1PI5A 1G6AA 3MJQA 4Y0TA 1HD8A 1G28A 1T1CA 4FOFA 1GHPA 1K4EA 2L4RA 4JPMA 5FASA 5L2FA 1Z6FA 3E4QA 1YSPA 4FH4A 5A91A 3ZQ5A 4R23A 5GLDA 3D72A 3U4LP 5FEGA 1LHYA 3BY9A 3ZFZA 4ME4A 3IQAA 1JTGA 2LB5A 5G4ZA 2BASA 1Y28A 3CZDA 4B4XA 2V1AA 2I9VA 4BL3A 3HLGA 5DJUA 4MN5A 3LR5A 3UMEA 3VOYA 2ZM0A 3T4JA 3OPLA 2KX6A 4CJNA 4I3IA 3VP2A 4EW7A 5FQJA 4BBVA 1DP6A 1FIKA 1XA7A 3T1QB 1KE3A 3KX0X 2Y2OA 5HAIA 2JKRI 4EETB 2WYXA 2R9XA 2ZL1B 5F83A 1ZHHB 4RQ9A 4F3LA 4IEDA 3BFFA 1ZG6A 1H3QA 3BLSA 2H0TA 2JKRM 5FQKA 4XUZA 4KZ7A 4BBUA 5GHZA 4QHCA 3ZDJA 3CMZA 2INWA 4S2MA 5LBRA 1HZOA 2ZOIA 1XXMA 4PKYG 5HAQA 4E3KA 4ESPA 4S2KA 1STZA 3GRJA 1OMEA 4R3BA 3NY4A 2VEAA 3MZEA 3SH8A 3QHYA 3ZG8B 1F5MA 3O5YA 3VV4A 3Q7VB 2QKPA 1PW8A 1ONHA 5HPFA 1YLJA 4FD8A 3V50A 4OQGA 1BULA 4S2PA 2Y59A 5E43A 3C2WA 4XT2B 3G34A 4HJ4A 1KGEA 2C5WB 1PWDA 5DVAA 2VGKA 4G3VA 5GL9A 2FFFB 2CC1A 1OJ5A 2J7VA 3ITBA 3UE3A 5A90A 3M6BA 3D9YA 4PKYA 1ESIA 3KYQA 4NXGA 1BUEA 1IFQA 3WS0A 3UNWA 1DP9A 2EFXA 3UE6A 5FATA 3HUOA 4UAAA 5DFYA 2HDUA 5AQBA 5EECA 4X68A 3MMHA 3C7UA 3Q82A 4AFIA 3N8LA 5EOOA 2EFUA 5HWWA 3MXQA 5EVID 4UQIS 2LB9A 2HJEA 3SZTA 3HUMA 3MR0A 2JKFA 3S7OA 3UO9A 2VA0A 5FI6A 2G2UA 4HY8A 3MS6A 1SHVA 5AQAA 3OCLA 4HHDA 3LIAA 1YLZA 3SH9A 5GHXA 5HL1A 4WUJA 2W1RA 2A49A 2HPBA 2HZ5A 2NUTC 2ZMFA 1P97A 3FZCA 4HJ3A 1GSWA 4YFMA 4E04A 3T4SA 4WLAA 4WEJA 4HBUA 1YPRA 4I5SA 1F2KA 3ZGAB 2VGLM 1FQGA 2HP9A 2CMNA 2ZM2A 2JKTI 1NYYA 3G4PA 1FILA 3RTYA 4IVIA 3UB5P 4LRZE 2XFSA 1YT4A 1RGYA 3E4PA 2J3TD 2VLGA 4JF6A 2KLIA 3FWLA 3LEQA 4DXCA 1V9ZA 5EUAA 5F1FA 1UWNX 3PYPA 1K0KA 4UA9A 4FTXA 4KG2A 1W5DA 2BTFP 3NULA 3G35A 4BQMA 3EWKA 1W8QA 1JWZA 2H10A 1BTLA 5CGSA 5CXWA 1VEUB 4L9FA 2L1MA 5DKKA 1SZVA 3O88A 3VSLA 4ARZB 2ZL1A 3OOVA 3DAVA 4WYYA 3GSGA 2PBYA 4N92A 4OOMA 3EGXC 3G31A 1SKOB 4R3AA 4O7DA 4WEKA 5KIZA 4HNBA 4U0TA 4JKTA 3A3DA 3CPTB 3ISGA 4P0MA 4R0QA 1K56A 2O9AA 1Q2QA 4IJGA 1IOUA 1V9YA 1YMXA 3LCEA 1G68A 4HEFA 2RL3A 3DTMA 2XDMA 4KQQA 3R7WB 2WZZA 1NRFA 1T18A 5DTSA 1GHIA 2B5RA 5F69A 3WRZA 2XEPA 1TD5A 4NXFA 5J4EA 3LIFA 2X01A 1OTAA 4PM7A 2ZC3B 4EUVA 2PAVP 3Q7VA 1CI8A 2K31A 4OOLA 1MWRA 1S1YA 1PFLA 2HDQA 4KZ5A 3HCYA 1BLPA 4ZJ1A 1FCNA 2KOIA 4NETA 4G3KA 3A3EA 3NIAA 3B3XA 3W4OA 4DE3A 2FZ0A 3HJIA 1FCMA 2XA7M 3GECA 3G2YA 2H0YA 5EPHA 2ZD8A 3VP3A 1NLYA 1VM1A 2WGVA 3BLMA 4R38A 1KVMA 5HSQA 5JYOA 4GB7A 4YWZA 3ZG0A 5J7EA 3MKEA 3ZHHA 3FV7A 4FH2A 3BM6A 4LPZA 2X02A 1CQAA 3DWZA 2A24B 2Y2JA 4X55A 2XR0A 5E2GA 3O86A 5DF9A 3IF6C 1K38A 2XD5A 4OP8A 4BL2A 1IYQA 1KGGA 5C5KA 4II7A 5AJGA 3PBSA 4ZBEA 4EUZA 3MQOA 3G6OA 1ERMA 2Y2KA 4XUXA 5M19A 3ZYTA 3MQQA 2Y4AA 4HP9A 2B95A 5DF8A 2K2NA 4EV4A 2QWSA 3JPUA 1JNUA 3MFDA 3WWXA 4E6XA 3NDEA 4R4RA 4X1LA 4K0WA 2H5SA 3IHBA 4BENA 5CHJA 3T1SA 1ZC2A 5FAQA 2VX8A 1FSYA 4B4ZA 1MBLA 1XJ2A 1HTZA 3T4TA 4ID4A 3IBJA 2D02A 2A3UA 3IX3A 2VZWA 3BFGA 1HVBA 2ZQ7A 3BQ8A 5A8BA 4JF4A 3IWQA 4EBNA 1KVLA 4E3NA 4OOYA 1N9BA 1NWZA 2V1BA 4UA7A 4OVDA 3G2ZA 2IWDA 4ETXA 4A5RA 5L10A 4JF5A 5AVEA 2NUPC 4DDSA 3WS5A 4MBHA 4GDBA 1UGUA 5CTMA 3ZG7B 1W7FA 1FR6A 3QP5A 1H5XA 5FDHA 3LICA 3RJUA 5FQQA 1OTBA 3C5AA 4P6ZS 3KSHA 1UWPX 5FL3A 3MSHA 1PI4A 5M18A 3ZNTA 4ARZA 3S4XA 2W3FA 4S2LA 2WGIA 5M1AA 4GN2A 4BWIA 4K0XA 4ETZA 3LI9A 4OONA 3QP8A 4RA7A 5FDSA 3SW1A 5CRFA 5F68A 1Q2PA 1SKOA 3IF6B 1SCWA 2ZC4B 1LLBA 1DJAA 2BLSA 3KYEA 4IUHA 1PIOA 3VP0A 1YM1A 5HFOA 3M2JA 3S7QA 4GS9A 3M6HA 3UB6A 4BLMA 3BECA 1BLCA 4U3TA 4WZ5C 1W8YA 3H9WA 5F82A 1ES3A 3R7WA 2ZQ9A 3OBFA 5FI7A 1C3BA 5L07A 2OAP1 4Q0IA 5DKLA 4CPKA 5KSHA 1EWZA 3E98A 3F1OB 3TRCA 4UHUA 5G4YA 3W4PA 4JGQA 3QP2A 3DWKA 4LV2A 2ZC6B 1XX2A 4DKIA 2Y2IA 3T50A 1GSVA 1E25A 2HF6A 3V67A 5EVIB 5J8XA 4JGOA 1SDNA 3C38A 4CLCC 4WBGA 2OWJA 2ZM8A 1VETB 5IT5A 4WMCD 2WKRA 4E3IA 5JYPA 3C4PA 3KO6A 4UEYA 1EROA 1L0GA 1GHMA 1NZUA 2VGLS 4OPQA 3O87A 4S2IA 3KSFA 3N4IA 4GDNA 3CAXA 5CHUA 5GLAA 3NBLA 2Y91A 4O8GA 1KE0A 5TFQA 3CUEC 2A24A 3G30A 4ZTKA 4GOGA 4E3LA 1KDWA 3VE4A 4HH3A 1ONGA 3FKVA 3IF5A 3NECA 4JGPA 2OAQ1 3UPPA 2ZQCA 1F98A 4EESA 3IHAA 2DMWA 1IKIA 2O9CA 1K55A 3LY4A 3PBQA 1A0KA 4NEED 4GD6A 4HJ6A 4D60A 3LI8A 2VKSA 2ZC5B 1BLSA 3TSGA 2HP5A 4GNUA 5K5BA 1VHMA 2IA2A 5E2EA 3E2LA 1OT6A 4ZJ2A 3WS4A 5FAPA 1CEFA 2Q0OA 3T12B 1MY8A 4QD4A 4PM5A 2QJ7A 2OLUA 3BQAA 5CEDA 4MNRA 3TW8A 4ZAMA 4R6LA 2ZJ9A 1J3WA 3B42A 4MCWA 2ZMVA 3SS3A 1TS6A 4KZ8A 2VGJA 3CLOA 3VFFA 3WS2A 4P6ZM 2V8CA 2V0WA 3KSGA 3NHQA 2PRFA 1K54C 5DTTA 5I5LA 1K57C 3SH7A 4KUOA 1NXYA 3N7WA 1XFNA 3K3DA 4O01A 5HDCA 5GLCA 1TS8A 3A3JA 3HLWA 5EV0A 3GV9A 3CITA 3F1NB 4N9KA 2L0WA 5L09A 1XKZA 1KE4A 4BD0A 4CLCB 3S7NA 2RCXA 4C6YA 4EEPA 1ES2A 1S6RA 4WF0A 2V9AA 1BLHA 2P7JA 1CF0A 4Q0HA 3NOUC 2XA7S 1AXBA 2XGNA 2J9OA 4R70A 4X56A 3B47A 2WKQA 4PM8A 4XXRA 5HDDA 3GQZA 2BG1A 3EEHA 4K91A 1WYCA 2Y2LA 4HIAA 1IYSA 3TOIA 4MLLA 1MZUA 4OKPA 4OQIA 4IUKA 4G3WA 1T1BA 2HGVA 3IF6A 1NZOA 2Z2MB 4H8RA 3QNBA 3UDIA 1MWTA 4EWFA 4WL9A 1KOUA 4KQDA 3Q07A 3WRTA 1XGIA 3K3CA 4LV0A 1LI0A 4YNRA 5AVFA 4EBPA 1G5UA 4KENB 1HLUP 1IKGA 2VV8A 3EQUA 5HARA 5HWTA 5GHYA 5EVIA 2JKTM 3BYDA 1P9WA 4Y17A 2OOLA 3NDGA 1IEMA 4UA6A 2ZLYA 2Q9MA 1SKFA 2VJWA 2Y2NA 4IBRA 1VETA 2WAFA 4HQAA 4KZ9A 4KQRA 3MBZA 3SOIA 4FUWA 3BFEA 4L9EA 3OPRA 2WAEA 2QMIA 2GZAA 3PXPA 4H6JB 1S67L 4L9GA 1OTDA 1OTIA 2FFYA 2AVXA 1AWIA 1PZOA 1S0WA 4I38A 4EERA 3FKWA 5KZHA 2QHKA 3A0RA 2OWHA 3IX8A 4LRXC 1RGZA 2ZOHA 5F1GA 1VQQA 4OLDA 3EEAA 4P85A 5A92A 2HJ9C 2XD1A 2W1TB 4EBLA 2QZ6A 2EA9A 2QJ5A 3UN7A 1L3LA 4YOFA 3LR0A 4WELA 3NC8A 1DP8A 4CLCD 1GCEA 2JE5A 3HBRA 3JVVA 5CGWA 5CTNA 2GDNA 3EGDC 2QPNA 2J3WA 4HESA 3CJMA 3HLBA 5EVEA 1NY0A 1E3UD 3P09A 2VK3A 4MBFA 3PBTA 3A3IA 1TF1A 1TDGA 4NKPA 5EE8A 2IWCA 1IYOA 1TS7A 1QMEA 2YKHA 3BW6A 3LO7A 5GLBA 4GHIB 4XT2A 4S2NC 2E8JA 4N1XA 4X1MA 3QP4A 2HDSA 4L0LA 1BSGA 2I72A 2DRWA 3BFDA 3LUQA 2G2WA 4P87A 4DRTA 3V3RA 3U2AA 4NXBA 2W27A 4GKUA 4QJGA 3A0SA 2J9PA 4R4SA 3ZVTA 4O0PA 3BJNA 1I2WA 5IS1A 1NLZA 1S1ZA 4R3JA 5I94A 3F1NA 4NXEA 1BZAA 1OPXA 2PHYA 3UE0A 4QY6A 3TJZC 4B93A 4DE2A 5HPIA 5HL6A 3CHWP 5L8MA 3IWIA 1W63Q 3ITAA 4JGRA 2B18A 1M6KA 2XROA 1PNEA 3N8SA 1WE4A 1E3UA 4IBXA 3V39A 2PR5A 3VOLA 1P0ZA 2ZMAA 3HVFA 1ES5A 4LGWA 4OQHA 1BT5A 3MZDA 1KDSA 4S2OA 4MDZA 2PD8A 3CI6A 3PTEA 4PAUA 2MJ6A 4EXOA 1ERQA 1FOFA 2WKEA 3IXBA 1MKIA 2XK1A 4LCLA 1Y54A 3VP4A 3NOPC 3UMDA 4JXGA 3DTKA 3HREA 3IH9A 1TEMA 2PU2A 5TBMB 4EU0A 1S4RA 3MXSA 1W79A 1I2SA 3UY6A 3IX4A 5EFWA 3FPWA 2PR6A 5FSRA 4DDYA 5FA7A 1X0OA 3A3FA 4OH0A 4DE0A 1G6OA 3BEBA
chains in the Genus database with same CATH topology
3CPTB 3MS6A 3U4LP 5FEGA 3NECA 5FDSA 1AWIA 2B95A 5EM0A 5EM1A 2HZ5A 3CHWP 1CJFA 1SKOA 1VEUA 1A0KA 3KYEA 1ACFA 4D60A 2PBDP 2V8FA 1PNEA 1YPRA 1Z09A 1F2KA 4X1LA 3T1XA 2PAVP 3T1SA 1FIKA 1D1JA 5FEFA 3T12B 1PFLA 2JKGA 1FILA 3T1QB 3UB5P 1PRQA 3LEQA 3CPTA 1K0KA 4FTXA 1J3WA 2ZL1B 3LGOA 2BTFP 3NULA 3D9YA 5EVEA 2VK3A 2V8CA 3L9KA 2PRFA 1G5UA 1VEUB 1VETB 1HLUP 1SZVA 2ZL1A 3DAVA 1CQAA 2E8JA 4X1MA 4X25A 4QWOA 5EV0A 3T1RA 3MSHA 3L7HA 1VETA 1Y4OA 4ESPA 1SKOB 4FUWA 2JKFA 2ACGA 1CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPT B;  3MS6 A;  3U4L P;  5FEG A;  3NEC A;  5FDS A;  1AWI A;  2B95 A;  5EM0 A;  5EM1 A;  2HZ5 A;  3CHW P;  1CJF A;  1SKO A;  1VEU A;  1A0K A;  3KYE A;  1ACF A;  4D60 A;  2PBD P;  2V8F A;  1PNE A;  1YPR A;  1Z09 A;  1F2K A;  4X1L A;  3T1X A;  2PAV P;  3T1S A;  1FIK A;  1D1J A;  5FEF A;  3T12 B;  1PFL A;  2JKG A;  1FIL A;  3T1Q B;  3UB5 P;  1PRQ A;  3LEQ A;  3CPT A;  1K0K A;  4FTX A;  1J3W A;  2ZL1 B;  3LGO A;  2BTF P;  3NUL A;  3D9Y A;  5EVE A;  2VK3 A;  2V8C A;  3L9K A;  2PRF A;  1G5U A;  1VEU B;  1VET B;  1HLU P;  1SZV A;  2ZL1 A;  3DAV A;  1CQA A;  2E8J A;  4X1M A;  4X25 A;  4QWO A;  5EV0 A;  3T1R A;  3MSH A;  3L7H A;  1VET A;  1Y4O A;  4ESP A;  1SKO B;  4FUW A;  2JKF A;  2ACG A;  1CF0 A; 
#chains in the Genus database with same CATH topology
 3V3S A;  3E2K A;  1T19 A;  3FC7 A;  2ZC7 A;  1H8Z A;  4X53 A;  4DJ2 A;  4PMA A;  1CJF A;  5E2F A;  1O07 A;  3LIB A;  1VEU A;  5U47 A;  4FCF A;  2PBD P;  5FQ9 A;  2VV6 A;  4H6J A;  4QB8 A;  2GNX A;  3VE3 A;  4E6W A;  1LSV A;  3LR4 A;  1TS0 A;  4N1H A;  5HW3 A;  3H82 B;  2QYB A;  3LYX A;  4BBT A;  1JVJ A;  2FH5 A;  4LV3 A;  1MXO A;  2YKF A;  3GMW A;  1PRQ A;  1U60 A;  4F94 A;  1D06 A;  5FAO A;  2W1T A;  3CPT A;  2W3H A;  2V2F F;  3NCK A;  4PHT A;  4DE1 A;  2ZQA A;  2O0Y A;  3GR2 A;  2PYP A;  5CEB A;  4BJP A;  1T1A A;  3T4Q A;  1LL9 A;  4EEU A;  2WKH A;  1OT9 A;  3T4O A;  1L2S A;  4JXV A;  5EVL A;  4RYE A;  1YLW A;  3W4Q A;  4Y13 A;  4KG5 A;  4GLQ A;  1TVF A;  3RXW A;  2D01 A;  2HP6 A;  4DJ3 A;  3T4L A;  2H28 A;  3ZG5 A;  3OC2 A;  2XQZ A;  2J80 A;  3MZF A;  4KUK A;  3EOI A;  4Y3I A;  2K7S A;  4QY5 A;  1FR1 A;  4Y0O A;  4OQ0 A;  4GHI A;  2C6W B;  1L0F A;  4LEN A;  4Q0J A;  4JBF A;  2O9B A;  4I3J A;  1IYP A;  1PW1 A;  4C3Q A;  4HI4 A;  4B9O A;  3S22 A;  4OPY A;  4KZ6 A;  3SS5 A;  3QP6 A;  4NK3 A;  1S4S A;  3ZVW A;  4EQI A;  2M1C A;  1K6S A;  5HDS A;  2B02 A;  1N9L A;  1DY6 A;  1N4O A;  3Q7Z A;  2JN7 A;  4HP4 A;  1XGJ A;  2W3E A;  4WN5 A;  1ES4 A;  3AGE A;  4OLG A;  4WZ4 A;  5KSC A;  3T1X A;  3BRM A;  1PWG A;  2UV0 E;  5DF7 A;  2W3G A;  5CX7 A;  4KQO A;  4GJ4 A;  1ZG4 A;  2EX8 A;  2OSU A;  5IHV A;  1MWU A;  3C8C A;  2Y2P A;  2WKP A;  3W2Z A;  5EOE A;  2R78 A;  1L0D A;  2P9V B;  4Y15 A;  3HLF A;  2Y8H A;  4ZJ3 A;  3VFH A;  2HV1 A;  4WMC A;  4GD8 A;  5CER A;  3MXR A;  1I5Q A;  3OPH A;  4HBT A;  3BY8 A;  3IXH A;  3NJA A;  3N8R A;  3PR6 A;  4ZRR A;  4LV1 A;  2A2L A;  4RVA A;  3MFX A;  4QWO A;  4KG6 A;  4GW9 A;  3T1R A;  1YKD A;  3GDI A;  3IS2 B;  1ZTU A;  3LFV A;  4Y0U A;  5D3O A;  3HJK A;  3P98 A;  2Z6D A;  1ESU A;  3OZH A;  5E2H A;  3OLO A;  3R4K A;  5TBM A;  4PPR A;  5CGX A;  3HUN A;  3UB9 A;  4JLF A;  5DTK A;  1WA9 A;  3ULF A;  1DRM A;  3HL9 A;  2PU4 A;  4FSF A;  3QP1 A;  3H7W B;  2J8Y A;  1GSX A;  4DN0 A;  3E0Y A;  2Y2M A;  1NYM A;  1XFQ A;  3FG8 A;  1H8M A;  3PBN A;  4KZ3 A;  1BYW A;  1CK3 A;  4S2N A;  5HX9 A;  4IHQ A;  3IH8 A;  3UDX A;  2EWW A;  4BD1 A;  1K4F A;  4MN7 A;  5AQ9 A;  4CQH A;  2Z2L B;  3K2N A;  1FCO A;  1LSX A;  2WKI A;  5FEF A;  3TG9 A;  2JKG A;  3PBR A;  1PZP A;  1SDE A;  4OPR A;  2W3D A;  4X6T A;  2JC7 A;  3DBA A;  1FSW A;  3D4F A;  3HLD A;  3V5M A;  3H82 A;  3S7P A;  5TGF A;  3M2K A;  3F1P B;  5DFX A;  5F6A A;  3UE1 A;  1RCJ A;  4JXW A;  3L9K A;  1KGF A;  3GVB A;  2XLN A;  3JYI A;  1LSW A;  3RFB A;  4U0X A;  5DJT A;  1PYY A;  4RX3 A;  2Y55 A;  3PAE A;  2JCH A;  3IBR A;  3E4O A;  3WS1 A;  1GA9 A;  1MWS A;  3EQV A;  3HLC A;  5CEC A;  3OPP A;  3P01 A;  3CG5 A;  1M40 A;  3ZG9 B;  4LLO B;  1O7E A;  1K6R A;  4HOI A;  3F1O A;  5HAP A;  2EX9 A;  3PBO A;  1LL5 A;  1WYB A;  2V0U A;  2WZX A;  4LFU A;  2E8I A;  2P04 A;  4MEZ A;  3A0V A;  2WGW B;  4M3K A;  1GA0 A;  3LID A;  3G32 A;  1H0M A;  5EM0 A;  3ZNY A;  1K56 D;  5HWV A;  5FQM A;  4JXS A;  3SS4 A;  1YQS A;  3RH8 B;  3C30 A;  4GCZ A;  4P6B A;  1W63 M;  5IU1 A;  2OV5 A;  5FI2 A;  2EX2 A;  3UPO A;  3MF0 A;  3NI9 A;  1N9N A;  2OLV A;  4YIN A;  3AGF A;  3D3O A;  2JHE A;  2WK0 A;  4B88 A;  2JBF A;  4MBK A;  1K55 C;  2XSS A;  2GJ3 A;  1CEG A;  4N9L A;  4M4X A;  2M7U A;  4E3O A;  2Q9N A;  3LGO A;  1ZKJ A;  2Z6C A;  3Q1F A;  2WUQ A;  5BOH A;  4Y2F A;  2EXB A;  4Z9Q A;  4NG2 A;  3FYZ A;  1ODV A;  5FQI A;  3QNC A;  1MPL A;  3UDF A;  1L0E A;  5G18 A;  1E4D A;  3NOT C;  2EWV A;  3UB8 A;  3VP1 A;  3LY3 A;  1MKM A;  4I39 A;  1RP5 A;  1P9R A;  4RX2 A;  1XJ6 A;  2X71 A;  4X69 A;  5TJJ A;  2VV7 A;  2P9V A;  4GS9 B;  4X25 A;  1XA1 A;  4OPZ A;  5HD3 A;  4IVK A;  1EW0 A;  3VSK A;  3B33 A;  3HLE A;  1JTD A;  2UWX A;  1LL8 A;  3AGD A;  3VMA A;  4ZDX A;  5MC7 A;  2Y2Q A;  2G7U A;  3O3V A;  2EXA A;  4WZ5 A;  3IS2 A;  3IT9 A;  1N9O A;  1IEL A;  1LI9 A;  1MC0 A;  2IWB A;  1PWC A;  1J9M A;  4KZ4 A;  3TE8 A;  4QPR A;  1ACF A;  3GTC A;  3DTE A;  4PM9 A;  4BMW A;  1OTE A;  4MN6 A;  3RXX A;  3LR3 A;  1CI9 A;  2XH9 A;  2W0N A;  3H7W A;  4I3A A;  2GX5 A;  1ALQ A;  4F3L B;  2HDR A;  3IXG A;  3KSI A;  4CLC A;  1YLY A;  4Y7P A;  4Z1W A;  1DJC A;  3JVU A;  3CWF A;  2XFT A;  2Y2H A;  4UQI M;  2Y2G A;  2P08 A;  4WM9 A;  4E3J A;  3UB7 A;  1YLT A;  3BWL A;  4DF6 A;  1YSQ A;  1YAX A;  3C7V A;  3UPN A;  2R9W A;  1JWP A;  2DCF A;  4C75 A;  5F5Y A;  2XRN A;  3BFC A;  2WAD A;  1K25 A;  2PYR A;  1S66 L;  3ZCZ A;  2XF3 A;  1LT0 A;  1XJ4 A;  3CUE A;  2ZQ8 A;  4QU3 A;  3F1P A;  4K08 A;  1TDL A;  3LIE A;  2V1Z A;  4GZB A;  3FPV A;  4E3M A;  3IXD A;  2PT7 A;  2ZQD A;  3L7H A;  1Y4O A;  3PAG A;  1NJ4 A;  3DW0 A;  4KZB A;  2V20 A;  3LEZ A;  1D7E A;  2PDR A;  2ACG A;  4R1G A;  5HD5 A;  3I7J A;  2ZBB A;  4Q8I A;  4MMN A;  3P7N A;  4KZA A;  4LRY C;  5AQ7 A;  5EVI C;  1XJ3 A;  4CLC E;  2KDK A;  2O99 A;  2PD7 A;  5EM1 A;  3MKF A;  1NRJ A;  3VOZ A;  2DNS A;  3OCN A;  4DMZ A;  2Y79 A;  3PHY A;  3S1Y A;  2V8F A;  5CHM A;  1XPB A;  2EX6 A;  2WGW A;  1YLP A;  1Z09 A;  3IWO A;  4EQ1 A;  5J3W A;  2M7V A;  5TR7 A;  1H8Y A;  1D1J A;  3DTI A;  4HH2 A;  1K54 A;  1K57 A;  3MQ0 A;  4LCM A;  4OP5 A;  1YMS A;  5KMW A;  5HZH A;  1F9I A;  1QMF A;  1DJB A;  4S2J A;  4PM6 A;  4D2O A;  3Q81 A;  3ICY A;  4DXB A;  1VB6 A;  3W8K A;  2P74 A;  2J3T C;  1EI5 A;  1JWV A;  3KYZ A;  5A93 A;  3T4K A;  4Y5F A;  3N6I A;  1OJG A;  1XP4 A;  3C4O A;  1PI5 A;  1G6A A;  3MJQ A;  4Y0T A;  1HD8 A;  1G28 A;  1T1C A;  4FOF A;  1GHP A;  1K4E A;  2L4R A;  4JPM A;  5FAS A;  5L2F A;  1Z6F A;  3E4Q A;  1YSP A;  4FH4 A;  5A91 A;  3ZQ5 A;  4R23 A;  5GLD A;  3D72 A;  3U4L P;  5FEG A;  1LHY A;  3BY9 A;  3ZFZ A;  4ME4 A;  3IQA A;  1JTG A;  2LB5 A;  5G4Z A;  2BAS A;  1Y28 A;  3CZD A;  4B4X A;  2V1A A;  2I9V A;  4BL3 A;  3HLG A;  5DJU A;  4MN5 A;  3LR5 A;  3UME A;  3VOY A;  2ZM0 A;  3T4J A;  3OPL A;  2KX6 A;  4CJN A;  4I3I A;  3VP2 A;  4EW7 A;  5FQJ A;  4BBV A;  1DP6 A;  1FIK A;  1XA7 A;  3T1Q B;  1KE3 A;  3KX0 X;  2Y2O A;  5HAI A;  2JKR I;  4EET B;  2WYX A;  2R9X A;  2ZL1 B;  5F83 A;  1ZHH B;  4RQ9 A;  4F3L A;  4IED A;  3BFF A;  1ZG6 A;  1H3Q A;  3BLS A;  2H0T A;  2JKR M;  5FQK A;  4XUZ A;  4KZ7 A;  4BBU A;  5GHZ A;  4QHC A;  3ZDJ A;  3CMZ A;  2INW A;  4S2M A;  5LBR A;  1HZO A;  2ZOI A;  1XXM A;  4PKY G;  5HAQ A;  4E3K A;  4ESP A;  4S2K A;  1STZ A;  3GRJ A;  1OME A;  4R3B A;  3NY4 A;  2VEA A;  3MZE A;  3SH8 A;  3QHY A;  3ZG8 B;  1F5M A;  3O5Y A;  3VV4 A;  3Q7V B;  2QKP A;  1PW8 A;  1ONH A;  5HPF A;  1YLJ A;  4FD8 A;  3V50 A;  4OQG A;  1BUL A;  4S2P A;  2Y59 A;  5E43 A;  3C2W A;  4XT2 B;  3G34 A;  4HJ4 A;  1KGE A;  2C5W B;  1PWD A;  5DVA A;  2VGK A;  4G3V A;  5GL9 A;  2FFF B;  2CC1 A;  1OJ5 A;  2J7V A;  3ITB A;  3UE3 A;  5A90 A;  3M6B A;  3D9Y A;  4PKY A;  1ESI A;  3KYQ A;  4NXG A;  1BUE A;  1IFQ A;  3WS0 A;  3UNW A;  1DP9 A;  2EFX A;  3UE6 A;  5FAT A;  3HUO A;  4UAA A;  5DFY A;  2HDU A;  5AQB A;  5EEC A;  4X68 A;  3MMH A;  3C7U A;  3Q82 A;  4AFI A;  3N8L A;  5EOO A;  2EFU A;  5HWW A;  3MXQ A;  5EVI D;  4UQI S;  2LB9 A;  2HJE A;  3SZT A;  3HUM A;  3MR0 A;  2JKF A;  3S7O A;  3UO9 A;  2VA0 A;  5FI6 A;  2G2U A;  4HY8 A;  3MS6 A;  1SHV A;  5AQA A;  3OCL A;  4HHD A;  3LIA A;  1YLZ A;  3SH9 A;  5GHX A;  5HL1 A;  4WUJ A;  2W1R A;  2A49 A;  2HPB A;  2HZ5 A;  2NUT C;  2ZMF A;  1P97 A;  3FZC A;  4HJ3 A;  1GSW A;  4YFM A;  4E04 A;  3T4S A;  4WLA A;  4WEJ A;  4HBU A;  1YPR A;  4I5S A;  1F2K A;  3ZGA B;  2VGL M;  1FQG A;  2HP9 A;  2CMN A;  2ZM2 A;  2JKT I;  1NYY A;  3G4P A;  1FIL A;  3RTY A;  4IVI A;  3UB5 P;  4LRZ E;  2XFS A;  1YT4 A;  1RGY A;  3E4P A;  2J3T D;  2VLG A;  4JF6 A;  2KLI A;  3FWL A;  3LEQ A;  4DXC A;  1V9Z A;  5EUA A;  5F1F A;  1UWN X;  3PYP A;  1K0K A;  4UA9 A;  4FTX A;  4KG2 A;  1W5D A;  2BTF P;  3NUL A;  3G35 A;  4BQM A;  3EWK A;  1W8Q A;  1JWZ A;  2H10 A;  1BTL A;  5CGS A;  5CXW A;  1VEU B;  4L9F A;  2L1M A;  5DKK A;  1SZV A;  3O88 A;  3VSL A;  4ARZ B;  2ZL1 A;  3OOV A;  3DAV A;  4WYY A;  3GSG A;  2PBY A;  4N92 A;  4OOM A;  3EGX C;  3G31 A;  1SKO B;  4R3A A;  4O7D A;  4WEK A;  5KIZ A;  4HNB A;  4U0T A;  4JKT A;  3A3D A;  3CPT B;  3ISG A;  4P0M A;  4R0Q A;  1K56 A;  2O9A A;  1Q2Q A;  4IJG A;  1IOU A;  1V9Y A;  1YMX A;  3LCE A;  1G68 A;  4HEF A;  2RL3 A;  3DTM A;  2XDM A;  4KQQ A;  3R7W B;  2WZZ A;  1NRF A;  1T18 A;  5DTS A;  1GHI A;  2B5R A;  5F69 A;  3WRZ A;  2XEP A;  1TD5 A;  4NXF A;  5J4E A;  3LIF A;  2X01 A;  1OTA A;  4PM7 A;  2ZC3 B;  4EUV A;  2PAV P;  3Q7V A;  1CI8 A;  2K31 A;  4OOL A;  1MWR A;  1S1Y A;  1PFL A;  2HDQ A;  4KZ5 A;  3HCY A;  1BLP A;  4ZJ1 A;  1FCN A;  2KOI A;  4NET A;  4G3K A;  3A3E A;  3NIA A;  3B3X A;  3W4O A;  4DE3 A;  2FZ0 A;  3HJI A;  1FCM A;  2XA7 M;  3GEC A;  3G2Y A;  2H0Y A;  5EPH A;  2ZD8 A;  3VP3 A;  1NLY A;  1VM1 A;  2WGV A;  3BLM A;  4R38 A;  1KVM A;  5HSQ A;  5JYO A;  4GB7 A;  4YWZ A;  3ZG0 A;  5J7E A;  3MKE A;  3ZHH A;  3FV7 A;  4FH2 A;  3BM6 A;  4LPZ A;  2X02 A;  1CQA A;  3DWZ A;  2A24 B;  2Y2J A;  4X55 A;  2XR0 A;  5E2G A;  3O86 A;  5DF9 A;  3IF6 C;  1K38 A;  2XD5 A;  4OP8 A;  4BL2 A;  1IYQ A;  1KGG A;  5C5K A;  4II7 A;  5AJG A;  3PBS A;  4ZBE A;  4EUZ A;  3MQO A;  3G6O A;  1ERM A;  2Y2K A;  4XUX A;  5M19 A;  3ZYT A;  3MQQ A;  2Y4A A;  4HP9 A;  2B95 A;  5DF8 A;  2K2N A;  4EV4 A;  2QWS A;  3JPU A;  1JNU A;  3MFD A;  3WWX A;  4E6X A;  3NDE A;  4R4R A;  4X1L A;  4K0W A;  2H5S A;  3IHB A;  4BEN A;  5CHJ A;  3T1S A;  1ZC2 A;  5FAQ A;  2VX8 A;  1FSY A;  4B4Z A;  1MBL A;  1XJ2 A;  1HTZ A;  3T4T A;  4ID4 A;  3IBJ A;  2D02 A;  2A3U A;  3IX3 A;  2VZW A;  3BFG A;  1HVB A;  2ZQ7 A;  3BQ8 A;  5A8B A;  4JF4 A;  3IWQ A;  4EBN A;  1KVL A;  4E3N A;  4OOY A;  1N9B A;  1NWZ A;  2V1B A;  4UA7 A;  4OVD A;  3G2Z A;  2IWD A;  4ETX A;  4A5R A;  5L10 A;  4JF5 A;  5AVE A;  2NUP C;  4DDS A;  3WS5 A;  4MBH A;  4GDB A;  1UGU A;  5CTM A;  3ZG7 B;  1W7F A;  1FR6 A;  3QP5 A;  1H5X A;  5FDH A;  3LIC A;  3RJU A;  5FQQ A;  1OTB A;  3C5A A;  4P6Z S;  3KSH A;  1UWP X;  5FL3 A;  3MSH A;  1PI4 A;  5M18 A;  3ZNT A;  4ARZ A;  3S4X A;  2W3F A;  4S2L A;  2WGI A;  5M1A A;  4GN2 A;  4BWI A;  4K0X A;  4ETZ A;  3LI9 A;  4OON A;  3QP8 A;  4RA7 A;  5FDS A;  3SW1 A;  5CRF A;  5F68 A;  1Q2P A;  1SKO A;  3IF6 B;  1SCW A;  2ZC4 B;  1LLB A;  1DJA A;  2BLS A;  3KYE A;  4IUH A;  1PIO A;  3VP0 A;  1YM1 A;  5HFO A;  3M2J A;  3S7Q A;  4GS9 A;  3M6H A;  3UB6 A;  4BLM A;  3BEC A;  1BLC A;  4U3T A;  4WZ5 C;  1W8Y A;  3H9W A;  5F82 A;  1ES3 A;  3R7W A;  2ZQ9 A;  3OBF A;  5FI7 A;  1C3B A;  5L07 A;  2OAP 1;  4Q0I A;  5DKL A;  4CPK A;  5KSH A;  1EWZ A;  3E98 A;  3F1O B;  3TRC A;  4UHU A;  5G4Y A;  3W4P A;  4JGQ A;  3QP2 A;  3DWK A;  4LV2 A;  2ZC6 B;  1XX2 A;  4DKI A;  2Y2I A;  3T50 A;  1GSV A;  1E25 A;  2HF6 A;  3V67 A;  5EVI B;  5J8X A;  4JGO A;  1SDN A;  3C38 A;  4CLC C;  4WBG A;  2OWJ A;  2ZM8 A;  1VET B;  5IT5 A;  4WMC D;  2WKR A;  4E3I A;  5JYP A;  3C4P A;  3KO6 A;  4UEY A;  1ERO A;  1L0G A;  1GHM A;  1NZU A;  2VGL S;  4OPQ A;  3O87 A;  4S2I A;  3KSF A;  3N4I A;  4GDN A;  3CAX A;  5CHU A;  5GLA A;  3NBL A;  2Y91 A;  4O8G A;  1KE0 A;  5TFQ A;  3CUE C;  2A24 A;  3G30 A;  4ZTK A;  4GOG A;  4E3L A;  1KDW A;  3VE4 A;  4HH3 A;  1ONG A;  3FKV A;  3IF5 A;  3NEC A;  4JGP A;  2OAQ 1;  3UPP A;  2ZQC A;  1F98 A;  4EES A;  3IHA A;  2DMW A;  1IKI A;  2O9C A;  1K55 A;  3LY4 A;  3PBQ A;  1A0K A;  4NEE D;  4GD6 A;  4HJ6 A;  4D60 A;  3LI8 A;  2VKS A;  2ZC5 B;  1BLS A;  3TSG A;  2HP5 A;  4GNU A;  5K5B A;  1VHM A;  2IA2 A;  5E2E A;  3E2L A;  1OT6 A;  4ZJ2 A;  3WS4 A;  5FAP A;  1CEF A;  2Q0O A;  3T12 B;  1MY8 A;  4QD4 A;  4PM5 A;  2QJ7 A;  2OLU A;  3BQA A;  5CED A;  4MNR A;  3TW8 A;  4ZAM A;  4R6L A;  2ZJ9 A;  1J3W A;  3B42 A;  4MCW A;  2ZMV A;  3SS3 A;  1TS6 A;  4KZ8 A;  2VGJ A;  3CLO A;  3VFF A;  3WS2 A;  4P6Z M;  2V8C A;  2V0W A;  3KSG A;  3NHQ A;  2PRF A;  1K54 C;  5DTT A;  5I5L A;  1K57 C;  3SH7 A;  4KUO A;  1NXY A;  3N7W A;  1XFN A;  3K3D A;  4O01 A;  5HDC A;  5GLC A;  1TS8 A;  3A3J A;  3HLW A;  5EV0 A;  3GV9 A;  3CIT A;  3F1N B;  4N9K A;  2L0W A;  5L09 A;  1XKZ A;  1KE4 A;  4BD0 A;  4CLC B;  3S7N A;  2RCX A;  4C6Y A;  4EEP A;  1ES2 A;  1S6R A;  4WF0 A;  2V9A A;  1BLH A;  2P7J A;  1CF0 A;  4Q0H A;  3NOU C;  2XA7 S;  1AXB A;  2XGN A;  2J9O A;  4R70 A;  4X56 A;  3B47 A;  2WKQ A;  4PM8 A;  4XXR A;  5HDD A;  3GQZ A;  2BG1 A;  3EEH A;  4K91 A;  1WYC A;  2Y2L A;  4HIA A;  1IYS A;  3TOI A;  4MLL A;  1MZU A;  4OKP A;  4OQI A;  4IUK A;  4G3W A;  1T1B A;  2HGV A;  3IF6 A;  1NZO A;  2Z2M B;  4H8R A;  3QNB A;  3UDI A;  1MWT A;  4EWF A;  4WL9 A;  1KOU A;  4KQD A;  3Q07 A;  3WRT A;  1XGI A;  3K3C A;  4LV0 A;  1LI0 A;  4YNR A;  5AVF A;  4EBP A;  1G5U A;  4KEN B;  1HLU P;  1IKG A;  2VV8 A;  3EQU A;  5HAR A;  5HWT A;  5GHY A;  5EVI A;  2JKT M;  3BYD A;  1P9W A;  4Y17 A;  2OOL A;  3NDG A;  1IEM A;  4UA6 A;  2ZLY A;  2Q9M A;  1SKF A;  2VJW A;  2Y2N A;  4IBR A;  1VET A;  2WAF A;  4HQA A;  4KZ9 A;  4KQR A;  3MBZ A;  3SOI A;  4FUW A;  3BFE A;  4L9E A;  3OPR A;  2WAE A;  2QMI A;  2GZA A;  3PXP A;  4H6J B;  1S67 L;  4L9G A;  1OTD A;  1OTI A;  2FFY A;  2AVX A;  1AWI A;  1PZO A;  1S0W A;  4I38 A;  4EER A;  3FKW A;  5KZH A;  2QHK A;  3A0R A;  2OWH A;  3IX8 A;  4LRX C;  1RGZ A;  2ZOH A;  5F1G A;  1VQQ A;  4OLD A;  3EEA A;  4P85 A;  5A92 A;  2HJ9 C;  2XD1 A;  2W1T B;  4EBL A;  2QZ6 A;  2EA9 A;  2QJ5 A;  3UN7 A;  1L3L A;  4YOF A;  3LR0 A;  4WEL A;  3NC8 A;  1DP8 A;  4CLC D;  1GCE A;  2JE5 A;  3HBR A;  3JVV A;  5CGW A;  5CTN A;  2GDN A;  3EGD C;  2QPN A;  2J3W A;  4HES A;  3CJM A;  3HLB A;  5EVE A;  1NY0 A;  1E3U D;  3P09 A;  2VK3 A;  4MBF A;  3PBT A;  3A3I A;  1TF1 A;  1TDG A;  4NKP A;  5EE8 A;  2IWC A;  1IYO A;  1TS7 A;  1QME A;  2YKH A;  3BW6 A;  3LO7 A;  5GLB A;  4GHI B;  4XT2 A;  4S2N C;  2E8J A;  4N1X A;  4X1M A;  3QP4 A;  2HDS A;  4L0L A;  1BSG A;  2I72 A;  2DRW A;  3BFD A;  3LUQ A;  2G2W A;  4P87 A;  4DRT A;  3V3R A;  3U2A A;  4NXB A;  2W27 A;  4GKU A;  4QJG A;  3A0S A;  2J9P A;  4R4S A;  3ZVT A;  4O0P A;  3BJN A;  1I2W A;  5IS1 A;  1NLZ A;  1S1Z A;  4R3J A;  5I94 A;  3F1N A;  4NXE A;  1BZA A;  1OPX A;  2PHY A;  3UE0 A;  4QY6 A;  3TJZ C;  4B93 A;  4DE2 A;  5HPI A;  5HL6 A;  3CHW P;  5L8M A;  3IWI A;  1W63 Q;  3ITA A;  4JGR A;  2B18 A;  1M6K A;  2XRO A;  1PNE A;  3N8S A;  1WE4 A;  1E3U A;  4IBX A;  3V39 A;  2PR5 A;  3VOL A;  1P0Z A;  2ZMA A;  3HVF A;  1ES5 A;  4LGW A;  4OQH A;  1BT5 A;  3MZD A;  1KDS A;  4S2O A;  4MDZ A;  2PD8 A;  3CI6 A;  3PTE A;  4PAU A;  2MJ6 A;  4EXO A;  1ERQ A;  1FOF A;  2WKE A;  3IXB A;  1MKI A;  2XK1 A;  4LCL A;  1Y54 A;  3VP4 A;  3NOP C;  3UMD A;  4JXG A;  3DTK A;  3HRE A;  3IH9 A;  1TEM A;  2PU2 A;  5TBM B;  4EU0 A;  1S4R A;  3MXS A;  1W79 A;  1I2S A;  3UY6 A;  3IX4 A;  5EFW A;  3FPW A;  2PR6 A;  5FSR A;  4DDY A;  5FA7 A;  1X0O A;  3A3F A;  4OH0 A;  4DE0 A;  1G6O A;  3BEB A; 
#chains in the Genus database with same CATH homology
 3CPT B;  3MS6 A;  3U4L P;  5FEG A;  3NEC A;  5FDS A;  1AWI A;  2B95 A;  5EM0 A;  5EM1 A;  2HZ5 A;  3CHW P;  1CJF A;  1SKO A;  1VEU A;  1A0K A;  3KYE A;  1ACF A;  4D60 A;  2PBD P;  2V8F A;  1PNE A;  1YPR A;  1Z09 A;  1F2K A;  4X1L A;  3T1X A;  2PAV P;  3T1S A;  1FIK A;  1D1J A;  5FEF A;  3T12 B;  1PFL A;  2JKG A;  1FIL A;  3T1Q B;  3UB5 P;  1PRQ A;  3LEQ A;  3CPT A;  1K0K A;  4FTX A;  1J3W A;  2ZL1 B;  3LGO A;  2BTF P;  3NUL A;  3D9Y A;  5EVE A;  2VK3 A;  2V8C A;  3L9K A;  2PRF A;  1G5U A;  1VEU B;  1VET B;  1HLU P;  1SZV A;  2ZL1 A;  3DAV A;  1CQA A;  2E8J A;  4X1M A;  4X25 A;  4QWO A;  5EV0 A;  3T1R A;  3MSH A;  3L7H A;  1VET A;  1Y4O A;  4ESP A;  1SKO B;  4FUW A;  2JKF A;  2ACG A;  1CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...