3T1QB

Mgla bound to gppnhp in complex with mglb
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
LVLYGAPYAAAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALAAIAEEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/signaling protein
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 37
structure length 132
sequence length 132
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1qB00
3L9KA 5EVEA 2JKFA 1SZVA 4D60A 4FTXA 1SKOB 1PRQA 1VEUB 3UB5P 2JKGA 5EV0A 2B95A 2PAVP 1J3WA 5EM1A 1CQAA 1F2KA 3NULA 2VK3A 4QWOA 1VETA 3MS6A 3T1XA 2PBDP 1FILA 3LGOA 3T1RA 3KYEA 1D1JA 2ZL1A 2V8FA 5FEFA 1YPRA 3DAVA 2HZ5A 1ACFA 1A0KA 1HLUP 2ACGA 3CPTB 2V8CA 3T1SA 4ESPA 4X25A 1K0KA 1SKOA 1PFLA 1VEUA 3NECA 5FDSA 5EM0A 1CF0A 3LEQA 1Z09A 3MSHA 1CJFA 2BTFP 2E8JA 1AWIA 1G5UA 4X1MA 1VETB 3CHWP 3T1QB 5FEGA 3T12B 2PRFA 1FIKA 1PNEA 3L7HA 2ZL1B 1Y4OA 4FUWA 3D9YA 4X1LA 3CPTA 3U4LP
chains in the Genus database with same CATH superfamily
4KZ8A 5DKLA 1AXBA 1ERMA 1XXMA 1XJ4A 2HDQA 4QD4A 3EGXC 2HJ9C 2XK1A 1FCMA 2PR6A 4BL3A 4WL9A 3IF5A 3MXRA 5CGWA 3VSLA 1PZOA 3Q7ZA 2B5RA 3Q7VB 4KZ5A 2PAVP 3SOIA 1F2KA 2VGKA 4KZ6A 2NUPC 4ARZA 1DJAA 1KDWA 2E8IA 4PM8A 1QMFA 3DTKA 3MJQA 3G34A 1NRFA 2FH5A 3BFFA 5DF7A 1OT9A 1G6AA 1BTLA 2GNXA 1ZG6A 4Y3IA 3N8RA 1NZUA 3ICYA 1S1ZA 4X25A 4JXGA 1S6RA 1WE4A 2X01A 4GW9A 1K57C 4DXCA 4HIAA 4MBHA 1PFLA 1J9MA 3UB9A 3TE8A 4PKYA 3G32A 3QP8A 2V0UA 2PR5A 3H9WA 2VGLM 2JKRI 4CPKA 2WZXA 3NC8A 4B4ZA 1BUEA 4UA7A 3BJNA 1U60A 5AQ9A 2ZBBA 1YM1A 2PU2A 1KGGA 3HLGA 1MWUA 3DTEA 1EI5A 3VP0A 4GS9A 5EVIB 4FH4A 3S7PA 4PMAA 1SZVA 2Y2IA 2HGVA 3RFBA 1T19A 1TS0A 1H0MA 4I3JA 2EXBA 2Y55A 1W8YA 5K5BA 2JHEA 2HV1A 2EFXA 3ITAA 2Y79A 5IS1A 2H28A 4GHIA 1T1AA 2JKTI 4BMWA 4M4XA 3IH8A 2Y59A 5EFWA 5DF9A 4QY6A 2P7JA 2WYXA 2XF3A 1O7EA 2V2FF 2W1RA 1KGFA 4F94A 1GSWA 2O99A 2K7SA 1ONGA 2HP5A 2ZQ8A 2WK0A 1C3BA 5CX7A 2ACGA 3CPTB 1KVLA 3MZFA 1W63M 1K0KA 1P9RA 4P6BA 2XFSA 4HESA 4LCMA 4NXGA 1HTZA 1PIOA 3RJUA 2JE5A 4GKUA 3M6HA 4QB8A 1L2SA 3CJMA 3ISGA 4ARZB 2W0NA 3HVFA 4B88A 2W1TA 3NDEA 3HLCA 1G6OA 2NUTC 1VQQA 4IJGA 3OBFA 1ONHA 4MBFA 3LFVA 1BT5A 3D9YA 4JBFA 4GLQA 4P6ZS 4WEJA 1JTDA 4XXRA 3U4LP 1UGUA 5HX9A 3ZNYA 3BQAA 3MFXA 1XKZA 3SZTA 1S67L 1ES3A 1LT0A 3WS2A 3P98A 1YSPA 1K4FA 2VV7A 4OQ0A 2OWJA 1DJCA 3CUEA 2G7UA 3UB5P 1LSWA 1MWSA 2ZMFA 5J7EA 1MBLA 1FSYA 4RA7A 2B95A 4L9EA 4GJ4A 5EM1A 5E2EA 3MBZA 2YKHA 4RVAA 3IQAA 2PT7A 2XLNA 1FILA 2OAQ1 1S4RA 3O5YA 3QP1A 4LRYC 1SHVA 1YLJA 4OOYA 3UMDA 4GS9B 4L9FA 1P9WA 1ES4A 3S1YA 4CLCB 4IVIA 4Z1WA 4JGRA 3AGDA 4ME4A 5G4ZA 1K4EA 2V20A 4HI4A 5TJJA 4ZBEA 1S0WA 1OTBA 3FWLA 1IOUA 2XGNA 1M40A 5F5YA 4WLAA 1LI0A 3P7NA 3FKVA 1RCJA 4GHIB 3BECA 4BWIA 4HBTA 1NJ4A 1IYQA 4GZBA 5KIZA 4OLDA 4HEFA 2OWHA 5A92A 5HAIA 1K54A 4EQ1A 3P09A 1ES2A 3T4QA 2JC7A 2Y2PA 4KG2A 3UY6A 1PW8A 4EU0A 3IXGA 2ZQDA 2FFFB 2LB5A 4KUOA 4N9LA 3IX3A 2Y2MA 1GHIA 2YKFA 4RYEA 3D4FA 2JKGA 1DP9A 3ZG7B 3HLFA 3UE0A 1FCNA 2GDNA 3B47A 4GB7A 2VK3A 3ZQ5A 4R3AA 4ID4A 3S7NA 4D2OA 3JVUA 4OP8A 4CLCE 5HWVA 2W1TB 2V1ZA 4CLCD 2PD8A 2KLIA 1A0KA 3DW0A 4KG6A 2B02A 1SDNA 1XP4A 2ZOHA 3W4OA 3SS3A 4EBNA 1Q2QA 3BQ8A 3WRZA 4Q0JA 4UAAA 5G18A 5EE8A 2ZC4B 5FQIA 4L9GA 3N6IA 3MSHA 4OONA 3KSFA 4FH2A 4E3KA 3ZFZA 3PBTA 5HAQA 3O3VA 4Z9QA 5FASA 1PW1A 2P74A 3C38A 3C7UA 2J9OA 5GLDA 4BENA 5HL1A 1IYOA 2D01A 3DTMA 1LI9A 3LIEA 4PPRA 2GZAA 2I9VA 1XJ6A 4OOMA 1BLHA 4OQIA 5HAPA 5HD5A 3I7JA 4E6XA 3A0RA 4DKIA 4RX2A 5GLAA 4OLGA 3HJKA 3V67A 1LHYA 5AJGA 4E3IA 3C4OA 3QNCA 2J3WA 1OMEA 2J3TC 2VEAA 4NK3A 4U0TA 1YAXA 1TS8A 5CXWA 1TS7A 3QHYA 1LL9A 4CQHA 4WELA 2ZM2A 1YLWA 2RL3A 1NXYA 3MQQA 5DTTA 1ES5A 1NYMA 4KQDA 3LIDA 4KZ7A 3KYZA 5DJTA 4X55A 3DAVA 4KZAA 2KX6A 1ACFA 5IHVA 5L09A 1SDEA 3N7WA 4WUJA 2Z6CA 2IA2A 3LIFA 3W4QA 1OJ5A 3Q07A 2V0WA 1F98A 3ZG9B 4DE2A 4FCFA 2H10A 2P04A 2ZQ9A 4YINA 5D3OA 5FDHA 5CHUA 1TF1A 4PM5A 4N92A 1Z09A 4OPQA 4OH0A 4S2MA 5AQ7A 5CGSA 4HP4A 5MC7A 4H6JA 1CEGA 4EEPA 5GLCA 2WKEA 1K6SA 1T1BA 1XPBA 3VSKA 2HF6A 1N9BA 3O86A 5DKKA 4OPRA 2R9XA 1LL5A 4HOIA 4UEYA 2QHKA 2OV5A 2OLUA 4GDNA 3DWKA 3BY9A 2JKFA 2XD1A 2VGJA 3UPOA 3DWZA 4UQIS 5G4YA 3IXHA 4NXFA 1YLZA 4F3LA 2QJ7A 2VA0A 2EX9A 2VJWA 4X69A 3VFHA 4JXWA 2W3DA 4YOFA 5M1AA 1L0FA 4HNBA 3IX4A 2HP9A 2V1BA 4BJPA 3PBRA 4LV3A 1GSVA 3GDIA 2BLSA 3S22A 2A24B 3C4PA 3MQOA 4S2JA 5IU1A 3IF6B 3A0SA 1KVMA 2WKIA 2Q9MA 3HLBA 5F69A 2WADA 4GDBA 2VKSA 1MKMA 2Q9NA 2P9VA 3HUOA 5KZHA 3LEZA 4G3WA 4NKPA 2H5SA 3Q1FA 5DTKA 1SKOA 3OCLA 3M6BA 4M3KA 3IWQA 3HJIA 1I2WA 3T4LA 3VOZA 2BG1A 3FYZA 4UHUA 1CJFA 2W3EA 1O07A 1JTGA 3JYIA 4II7A 4WZ4A 1UWNX 1ALQA 5JYOA 1W79A 3UE1A 1G5UA 5FAOA 5A91A 3GMWA 4PM9A 3CHWP 2DNSA 3WWXA 2VX8A 3VE3A 4X1LA 1G68A 3BYDA 4OQGA 4LV1A 3K3CA 2XRNA 4ZDXA 1KE3A 3CWFA 4X6TA 4IBRA 5EOOA 4BBTA 4R3JA 5M19A 4Y13A 1EROA 3ZGAB 2K31A 4YWZA 4NXEA 4U0XA 1Q2PA 4Y17A 2Y2HA 5AQBA 3ITBA 3IX8A 5TBMA 1OTEA 3P01A 2QJ5A 4GOGA 4B4XA 4CLCA 5KSCA 1MZUA 1IKIA 1L3LA 1VETA 4EQIA 3E4OA 4H6JB 3T1XA 3BY8A 1D1JA 3IS2A 5HWTA 3W8KA 1SKFA 3LUQA 1H3QA 2GX5A 1YPRA 2ZQCA 5AVFA 4S2NA 1F9IA 1VM1A 3EEHA 5A8BA 2D02A 3HREA 3ZCZA 3ZVWA 5GHYA 3BEBA 2WKQA 3E2KA 4N1HA 5CTMA 1NWZA 3PHYA 2EFUA 2J80A 4F3LB 3FV7A 3SH9A 4P85A 1BLSA 1VB6A 1XA1A 1MC0A 5FI7A 2J3TD 2XQZA 3QNBA 4MN5A 4WMCD 1PZPA 3UPPA 3V39A 3AGFA 5HPFA 3HLDA 3ZG0A 5JYPA 1Z6FA 1Y4OA 2JCHA 5L8MA 4BLMA 4DRTA 5HWWA 1V9ZA 1KE4A 1MWTA 2P9VB 2WKRA 3G2ZA 3Q81A 3VFFA 4ZRRA 1YMSA 2OAP1 4R6LA 4DF6A 3C2WA 1SKOB 3PR6A 3MXSA 2XA7M 4U3TA 2XFTA 4K91A 3CMZA 3G35A 1JWPA 4KQRA 2L0WA 1WYCA 2ZC7A 3K2NA 3VP4A 5EOEA 1JNUA 2MJ6A 4JXSA 2OSUA 4DN0A 1OT6A 4O7DA 3UPNA 1H5XA 5A93A 5I5LA 2QYBA 3GV9A 2V8FA 1BLCA 4I3AA 4BBUA 5FEFA 5J3WA 1HVBA 2Y2GA 3BFGA 4Y2FA 4R1GA 2FZ0A 3ZVTA 2PD7A 3CITA 3O88A 3T1SA 4HJ3A 1X0OA 4E3LA 3LI8A 3G2YA 1OPXA 1K55A 3H82A 3NIAA 1S1YA 5FQ9A 3QP5A 3BLMA 2Y4AA 5TBMB 2R9WA 2A49A 2WKHA 5FAPA 1GA9A 3PBOA 5J4EA 3W2ZA 3A3FA 1D06A 5KSHA 3G31A 4X1MA 1NLZA 1PYYA 1VETB 1DP6A 1ESIA 1V9YA 4QY5A 2WGWA 2PYPA 4IUKA 4WM9A 3IS2B 2Y8HA 4X68A 5HSQA 1FCOA 2EA9A 1XFQA 5TR7A 4MLLA 2AVXA 4MDZA 2HPBA 5FAQA 4L0LA 3V5MA 2J7VA 2W3GA 1K54C 3NOUC 3O87A 4NG2A 4LRXC 5CECA 3BFCA 5TGFA 1OTDA 5EV0A 4DMZA 4KQQA 4S2PA 3V3SA 3F1PA 1IYSA 4UQIM 4GD8A 3ZNTA 1FR1A 4JPMA 3C7VA 3PBNA 5FQQA 5L2FA 3KYEA 5L10A 3GR2A 5HL6A 4JXVA 1D7EA 1LLBA 2A3UA 5BOHA 4PHTA 2Y2LA 1SCWA 4BQMA 3F1NA 4Y0UA 3GTCA 1IYPA 1VEUA 4HP9A 4NEED 3RXWA 3MFDA 3S4XA 1WA9A 1ZC2A 3MKFA 4JGOA 4WZ5A 1S4SA 3WS0A 5EVLA 1CF0A 1K38A 4MN7A 4UA9A 3BLSA 2IWCA 3N8LA 2E8JA 3TW8A 3NBLA 1I5QA 1PI4A 3S7QA 2HJEA 4Y5FA 3PBSA 4S2IA 1FIKA 3DBAA 4R38A 5CEDA 4OQHA 5A90A 5FI2A 1GCEA 1YLTA 1LSXA 3LYXA 3GECA 3VP2A 3L9KA 5EVEA 3MZDA 4FSFA 4EESA 1ERQA 1CI9A 2EX6A 2J9PA 1ZHHB 5FQKA 2A24A 4C75A 3LR4A 4S2KA 1HZOA 2C5WB 3IF6A 2WGIA 4LV0A 1W63Q 3HLEA 1YLPA 4B93A 3H82B 1WYBA 2Z2LB 2JKTM 2VZWA 3UDXA 2PHYA 3A3IA 3R4KA 1YLYA 2XA7S 2ZQ7A 1GHMA 3SH8A 3NDGA 2W27A 3PAEA 4HHDA 1H8MA 1Y54A 3TJZC 3MQ0A 4O0PA 3UB7A 3CLOA 4R70A 3OPLA 2WGWB 3CZDA 4P0MA 3LICA 2VLGA 4Y7PA 1GHPA 1VHMA 3WS1A 2C6WB 2DRWA 1UWPX 1QMEA 4R3BA 4OP5A 4E6WA 1IEMA 2PYRA 3WS4A 4ZAMA 3MZEA 5F68A 4OOLA 4LGWA 4WMCA 2KOIA 4K0WA 1W8QA 5FDSA 3ZDJA 3DTIA 5L07A 5F83A 3UB8A 3TG9A 1IELA 3OPRA 4PM6A 4X56A 3E4QA 3NOPC 3UDIA 1GSXA 1BLPA 2ZMVA 2ZM8A 3F1PB 5CHMA 2ZJ9A 3JPUA 4BD0A 2HDUA 4WBGA 3T1QB 1L0EA 3TOIA 3GVBA 5EVIC 3FC7A 3CAXA 3SH7A 3RXXA 4LLOB 4R23A 3IH9A 1TD5A 4E3MA 4N9KA 4FTXA 4IBXA 2W3HA 1K6RA 3F1NB 1PWGA 3OPHA 4ETXA 2Y2NA 3KSHA 1PRQA 3B33A 4DJ2A 5GLBA 1VEUB 3VP1A 4DE1A 3IT9A 1CI8A 1PI5A 1BULA 2M7UA 3E98A 5FA7A 1DRMA 2HDRA 3H7WA 1NLYA 1GA0A 2Q0OA 3T50A 4MEZA 3FKWA 3C5AA 3G30A 4QHCA 3MKEA 5IT5A 1STZA 3LY4A 1NYYA 3BM6A 3IWIA 4Q0HA 4HJ6A 1IKGA 2ZC6B 3LO7A 4UA6A 3T4KA 4Q0IA 3HBRA 3D72A 3LIAA 3EOIA 3OZHA 1OJGA 5EECA 3OPPA 2XSSA 2I72A 3K3DA 3VE4A 3CI6A 1ESUA 1EWZA 2H0YA 2ZM0A 3QP2A 3SS5A 5FATA 5DFYA 1DJBA 3LR5A 3KX0X 3AGEA 1OTAA 3T12B 2OLVA 1Y28A 3V3RA 3LI9A 3L7HA 4EW7A 1MWRA 1PWDA 3T4JA 3A3EA 3PAGA 2B18A 2M7VA 3FZCA 4DJ3A 3E2LA 1NY0A 4NXBA 4JF5A 3V50A 4GNUA 4D60A 2Y2KA 4Q8IA 1I2SA 1KDSA 2O9AA 1HD8A 5GHZA 3VOLA 1OTIA 3BRMA 4FD8A 1L0DA 5C5KA 3C30A 3E4PA 1PWCA 4K08A 3VMAA 3BFDA 5E2HA 4XT2A 3IBJA 1FOFA 3NULA 4JKTA 2K2NA 1S66L 2INWA 3LY3A 3LCEA 1CEFA 2PBDP 3KSIA 2HP6A 1K57A 3HUMA 3EWKA 4HJ4A 5DJUA 4GN2A 5FSRA 4CLCC 1W5DA 3M2KA 3IXDA 5E43A 2VV6A 3MMHA 2ZD8A 5HW3A 2WZZA 3MR0A 4K0XA 3IHBA 1TVFA 4ESPA 1LSVA 1KGEA 4KENB 3B42A 2QMIA 3QP6A 2RCXA 4HBUA 2QPNA 1IFQA 4JF6A 4XUZA 1NRJA 2L4RA 4ZTKA 4E04A 3UE3A 3G6OA 2XEPA 4H8RA 4S2NC 1E3UD 3U2AA 2VV8A 1T1CA 4EERA 2X71A 5AVEA 4QJGA 2O0YA 3H7WB 3N4IA 3E0YA 1N9LA 4DE0A 3LR0A 2PRFA 3M2JA 4EUZA 2EWWA 4BL2A 3EEAA 4P87A 3UNWA 5EPHA 3KSGA 4ZJ3A 4EEUA 3UMEA 3QP4A 2XD5A 3HCYA 5M18A 2R78A 3BW6A 1XGJA 1YQSA 4KZ4A 4E3NA 4WYYA 3F1OA 2UWXA 4A5RA 2BASA 4Y0TA 2WGVA 3HL9A 4LPZA 4MBKA 4QWOA 3MS6A 3OLOA 5EUAA 2GJ3A 3FG8A 4KZ9A 1JWVA 3T1RA 5HFOA 4BD1A 3W4PA 2CMNA 5GHXA 4WEKA 1XGIA 4HH2A 4MN6A 4GD6A 5DF8A 4YNRA 4LV2A 1NZOA 3Q82A 1K56D 5EVID 3LR3A 5LBRA 2PU4A 4FOFA 3NHQA 3UDFA 3CUEC 1MXOA 3NECA 1ZG4A 3NJAA 1JVJA 5EM0A 3UB6A 4I39A 2WAFA 1L0GA 4WF0A 4IUHA 5FQJA 4ZJ1A 1BSGA 5J8XA 5F1GA 1AWIA 3JVVA 2XR0A 4O8GA 5GL9A 4XT2B 1K55C 3T4OA 5E2GA 5F1FA 2QZ6A 1P97A 4EETB 5HDDA 3LIBA 5CGXA 4HY8A 4ZJ2A 3C8CA 4EXOA 3WS5A 4KUKA 1DP8A 4I3IA 1YSQA 4HH3A 1MKIA 3NI9A 3ULFA 4MMNA 3IWOA 3SS4A 4EUVA 1XFNA 3A0VA 4S2LA 3MXQA 2DCFA 3T4SA 3D3OA 1FSWA 5FL3A 3R7WA 3EGDC 4Y0OA 2G2UA 2IWBA 1E4DA 1H8YA 4RQ9A 5HDCA 1BZAA 4LRZE 1DY6A 2L1MA 2JBFA 3A3JA 5KMWA 4IHQA 3LGOA 1H8ZA 2ZL1A 1RGYA 3SW1A 4AFIA 2XROA 1E25A 3RH8B 2Z6DA 5TFQA 1YT4A 2VGLS 2J8YA 2ZC5B 3EQUA 3FPVA 1YMXA 3VP3A 3PYPA 5CERA 5HPIA 1TDLA 2EX8A 4R4RA 5FQMA 2BTFP 4IEDA 3F1OB 4MNRA 2KDKA 3IXBA 3WRTA 2CC1A 3EQVA 3B3XA 1BYWA 2XDMA 4X53A 3VV4A 4OKPA 2X02A 5F82A 1N4OA 4WZ5C 1PNEA 2JKRM 2ZOIA 5F6AA 3UN7A 3HUNA 4FUWA 4OVDA 4IVKA 5HD3A 2ZC3B 1KE0A 5E2FA 4LFUA 2O9BA 1P0ZA 2Z2MB 4DDSA 2V1AA 2PDRA 3IBRA 3TSGA 2EWVA 1RP5A 4EWFA 4LCLA 4Y15A 1TEMA 1G28A 4R4SA 4G3KA 1J3WA 1CQAA 2WAEA 3G4PA 5HZHA 2M1CA 3IF6C 3NOTC 2UV0E 1XA7A 1M6KA 4BBVA 1ODVA 4C6YA 1CK3A 2ZQAA 4KZ3A 4OPYA 4PKYG 3S7OA 5CTNA 4B9OA 2Y91A 3ZYTA 2W3FA 4JGQA 1HLUP 2EX2A 3NCKA 4PAUA 2V8CA 3TRCA 3PTEA 1E3UA 3KO6A 3PBQA 3CG5A 2QKPA 1XJ3A 5I94A 5HDSA 2FFYA 1N9NA 4ETZA 2JN7A 3Q7VA 3ZG5A 4DDYA 4XUXA 3R7WB 4RX3A 1ZTUA 3T4TA 5HARA 1FR6A 1ZKJA 4PM7A 3NY4A 2WKPA 5DTSA 4JGPA 4DE3A 4C3QA 4G3VA 5DFXA 4DXBA 4KZBA 2ZL1B 3BWLA 1KOUA 4EV4A 4N1XA 4CJNA 3MF0A 4JF4A 2H0TA 3GRJA 3UO9A 3BFEA 2OOLA 3ZG8B 2EXAA 3RTYA 1TDGA 1W7FA 4NETA 5CRFA 4QU3A 3VOYA 4OPZA 4KQOA 4I5SA 2Y2OA 4GCZA 1FQGA 4E3JA 2ZLYA 3GSGA 2QWSA 1JWZA 1XX2A 3KYQA 3ZHHA 3UE6A 1K56A 5EVIA 2DMWA 4QPRA 2HZ5A 2LB9A 1TS6A 5CEBA 2XH9A 1T18A 5AQAA 2A2LA 3PXPA 3OC2A 4EBPA 2O9CA 3N8SA 1XJ2A 4KG5A 1F5MA 5CHJA 4O01A 4E3OA 1MY8A 4LENA 3GQZA 4JLFA 4R0QA 2ZMAA 3OOVA 4I38A 4MCWA 2Y2JA 3LEQA 1YKDA 3HLWA 1LL8A 4S2OA 3OCNA 1RGZA 5U47A 3A3DA 2Y2QA 3IHAA 5FI6A 1MPLA 1N9OA 4HQAA 5FEGA 3FPWA 4P6ZM 1EW0A 5DVAA 2G2WA 2HDSA 2PBYA 4WN5A 2V9AA 3CPTA 2P08A 1K25A 4YFMA 2IWDA 2WUQA 4EBLA
chains in the Genus database with same CATH topology
3L9KA 5EVEA 2JKFA 1SZVA 4D60A 4FTXA 1SKOB 1PRQA 1VEUB 3UB5P 2JKGA 5EV0A 2B95A 2PAVP 1J3WA 5EM1A 1CQAA 1F2KA 3NULA 2VK3A 4QWOA 1VETA 3MS6A 3T1XA 2PBDP 1FILA 3LGOA 3T1RA 3KYEA 1D1JA 2ZL1A 2V8FA 5FEFA 1YPRA 3DAVA 2HZ5A 1ACFA 1A0KA 1HLUP 2ACGA 3CPTB 2V8CA 3T1SA 4ESPA 4X25A 1K0KA 1SKOA 1PFLA 1VEUA 3NECA 5FDSA 5EM0A 1CF0A 3LEQA 1Z09A 3MSHA 1CJFA 2BTFP 2E8JA 1AWIA 1G5UA 4X1MA 1VETB 3CHWP 3T1QB 5FEGA 3T12B 2PRFA 1FIKA 1PNEA 3L7HA 2ZL1B 1Y4OA 4FUWA 3D9YA 4X1LA 3CPTA 3U4LP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9K A;  5EVE A;  2JKF A;  1SZV A;  4D60 A;  4FTX A;  1SKO B;  1PRQ A;  1VEU B;  3UB5 P;  2JKG A;  5EV0 A;  2B95 A;  2PAV P;  1J3W A;  5EM1 A;  1CQA A;  1F2K A;  3NUL A;  2VK3 A;  4QWO A;  1VET A;  3MS6 A;  3T1X A;  2PBD P;  1FIL A;  3LGO A;  3T1R A;  3KYE A;  1D1J A;  2ZL1 A;  2V8F A;  5FEF A;  1YPR A;  3DAV A;  2HZ5 A;  1ACF A;  1A0K A;  1HLU P;  2ACG A;  3CPT B;  2V8C A;  3T1S A;  4ESP A;  4X25 A;  1K0K A;  1SKO A;  1PFL A;  1VEU A;  3NEC A;  5FDS A;  5EM0 A;  1CF0 A;  3LEQ A;  1Z09 A;  3MSH A;  1CJF A;  2BTF P;  2E8J A;  1AWI A;  1G5U A;  4X1M A;  1VET B;  3CHW P;  3T1Q B;  5FEG A;  3T12 B;  2PRF A;  1FIK A;  1PNE A;  3L7H A;  2ZL1 B;  1Y4O A;  4FUW A;  3D9Y A;  4X1L A;  3CPT A;  3U4L P; 
#chains in the Genus database with same CATH topology
 4KZ8 A;  5DKL A;  1AXB A;  1ERM A;  1XXM A;  1XJ4 A;  2HDQ A;  4QD4 A;  3EGX C;  2HJ9 C;  2XK1 A;  1FCM A;  2PR6 A;  4BL3 A;  4WL9 A;  3IF5 A;  3MXR A;  5CGW A;  3VSL A;  1PZO A;  3Q7Z A;  2B5R A;  3Q7V B;  4KZ5 A;  2PAV P;  3SOI A;  1F2K A;  2VGK A;  4KZ6 A;  2NUP C;  4ARZ A;  1DJA A;  1KDW A;  2E8I A;  4PM8 A;  1QMF A;  3DTK A;  3MJQ A;  3G34 A;  1NRF A;  2FH5 A;  3BFF A;  5DF7 A;  1OT9 A;  1G6A A;  1BTL A;  2GNX A;  1ZG6 A;  4Y3I A;  3N8R A;  1NZU A;  3ICY A;  1S1Z A;  4X25 A;  4JXG A;  1S6R A;  1WE4 A;  2X01 A;  4GW9 A;  1K57 C;  4DXC A;  4HIA A;  4MBH A;  1PFL A;  1J9M A;  3UB9 A;  3TE8 A;  4PKY A;  3G32 A;  3QP8 A;  2V0U A;  2PR5 A;  3H9W A;  2VGL M;  2JKR I;  4CPK A;  2WZX A;  3NC8 A;  4B4Z A;  1BUE A;  4UA7 A;  3BJN A;  1U60 A;  5AQ9 A;  2ZBB A;  1YM1 A;  2PU2 A;  1KGG A;  3HLG A;  1MWU A;  3DTE A;  1EI5 A;  3VP0 A;  4GS9 A;  5EVI B;  4FH4 A;  3S7P A;  4PMA A;  1SZV A;  2Y2I A;  2HGV A;  3RFB A;  1T19 A;  1TS0 A;  1H0M A;  4I3J A;  2EXB A;  2Y55 A;  1W8Y A;  5K5B A;  2JHE A;  2HV1 A;  2EFX A;  3ITA A;  2Y79 A;  5IS1 A;  2H28 A;  4GHI A;  1T1A A;  2JKT I;  4BMW A;  4M4X A;  3IH8 A;  2Y59 A;  5EFW A;  5DF9 A;  4QY6 A;  2P7J A;  2WYX A;  2XF3 A;  1O7E A;  2V2F F;  2W1R A;  1KGF A;  4F94 A;  1GSW A;  2O99 A;  2K7S A;  1ONG A;  2HP5 A;  2ZQ8 A;  2WK0 A;  1C3B A;  5CX7 A;  2ACG A;  3CPT B;  1KVL A;  3MZF A;  1W63 M;  1K0K A;  1P9R A;  4P6B A;  2XFS A;  4HES A;  4LCM A;  4NXG A;  1HTZ A;  1PIO A;  3RJU A;  2JE5 A;  4GKU A;  3M6H A;  4QB8 A;  1L2S A;  3CJM A;  3ISG A;  4ARZ B;  2W0N A;  3HVF A;  4B88 A;  2W1T A;  3NDE A;  3HLC A;  1G6O A;  2NUT C;  1VQQ A;  4IJG A;  3OBF A;  1ONH A;  4MBF A;  3LFV A;  1BT5 A;  3D9Y A;  4JBF A;  4GLQ A;  4P6Z S;  4WEJ A;  1JTD A;  4XXR A;  3U4L P;  1UGU A;  5HX9 A;  3ZNY A;  3BQA A;  3MFX A;  1XKZ A;  3SZT A;  1S67 L;  1ES3 A;  1LT0 A;  3WS2 A;  3P98 A;  1YSP A;  1K4F A;  2VV7 A;  4OQ0 A;  2OWJ A;  1DJC A;  3CUE A;  2G7U A;  3UB5 P;  1LSW A;  1MWS A;  2ZMF A;  5J7E A;  1MBL A;  1FSY A;  4RA7 A;  2B95 A;  4L9E A;  4GJ4 A;  5EM1 A;  5E2E A;  3MBZ A;  2YKH A;  4RVA A;  3IQA A;  2PT7 A;  2XLN A;  1FIL A;  2OAQ 1;  1S4R A;  3O5Y A;  3QP1 A;  4LRY C;  1SHV A;  1YLJ A;  4OOY A;  3UMD A;  4GS9 B;  4L9F A;  1P9W A;  1ES4 A;  3S1Y A;  4CLC B;  4IVI A;  4Z1W A;  4JGR A;  3AGD A;  4ME4 A;  5G4Z A;  1K4E A;  2V20 A;  4HI4 A;  5TJJ A;  4ZBE A;  1S0W A;  1OTB A;  3FWL A;  1IOU A;  2XGN A;  1M40 A;  5F5Y A;  4WLA A;  1LI0 A;  3P7N A;  3FKV A;  1RCJ A;  4GHI B;  3BEC A;  4BWI A;  4HBT A;  1NJ4 A;  1IYQ A;  4GZB A;  5KIZ A;  4OLD A;  4HEF A;  2OWH A;  5A92 A;  5HAI A;  1K54 A;  4EQ1 A;  3P09 A;  1ES2 A;  3T4Q A;  2JC7 A;  2Y2P A;  4KG2 A;  3UY6 A;  1PW8 A;  4EU0 A;  3IXG A;  2ZQD A;  2FFF B;  2LB5 A;  4KUO A;  4N9L A;  3IX3 A;  2Y2M A;  1GHI A;  2YKF A;  4RYE A;  3D4F A;  2JKG A;  1DP9 A;  3ZG7 B;  3HLF A;  3UE0 A;  1FCN A;  2GDN A;  3B47 A;  4GB7 A;  2VK3 A;  3ZQ5 A;  4R3A A;  4ID4 A;  3S7N A;  4D2O A;  3JVU A;  4OP8 A;  4CLC E;  5HWV A;  2W1T B;  2V1Z A;  4CLC D;  2PD8 A;  2KLI A;  1A0K A;  3DW0 A;  4KG6 A;  2B02 A;  1SDN A;  1XP4 A;  2ZOH A;  3W4O A;  3SS3 A;  4EBN A;  1Q2Q A;  3BQ8 A;  3WRZ A;  4Q0J A;  4UAA A;  5G18 A;  5EE8 A;  2ZC4 B;  5FQI A;  4L9G A;  3N6I A;  3MSH A;  4OON A;  3KSF A;  4FH2 A;  4E3K A;  3ZFZ A;  3PBT A;  5HAQ A;  3O3V A;  4Z9Q A;  5FAS A;  1PW1 A;  2P74 A;  3C38 A;  3C7U A;  2J9O A;  5GLD A;  4BEN A;  5HL1 A;  1IYO A;  2D01 A;  3DTM A;  1LI9 A;  3LIE A;  4PPR A;  2GZA A;  2I9V A;  1XJ6 A;  4OOM A;  1BLH A;  4OQI A;  5HAP A;  5HD5 A;  3I7J A;  4E6X A;  3A0R A;  4DKI A;  4RX2 A;  5GLA A;  4OLG A;  3HJK A;  3V67 A;  1LHY A;  5AJG A;  4E3I A;  3C4O A;  3QNC A;  2J3W A;  1OME A;  2J3T C;  2VEA A;  4NK3 A;  4U0T A;  1YAX A;  1TS8 A;  5CXW A;  1TS7 A;  3QHY A;  1LL9 A;  4CQH A;  4WEL A;  2ZM2 A;  1YLW A;  2RL3 A;  1NXY A;  3MQQ A;  5DTT A;  1ES5 A;  1NYM A;  4KQD A;  3LID A;  4KZ7 A;  3KYZ A;  5DJT A;  4X55 A;  3DAV A;  4KZA A;  2KX6 A;  1ACF A;  5IHV A;  5L09 A;  1SDE A;  3N7W A;  4WUJ A;  2Z6C A;  2IA2 A;  3LIF A;  3W4Q A;  1OJ5 A;  3Q07 A;  2V0W A;  1F98 A;  3ZG9 B;  4DE2 A;  4FCF A;  2H10 A;  2P04 A;  2ZQ9 A;  4YIN A;  5D3O A;  5FDH A;  5CHU A;  1TF1 A;  4PM5 A;  4N92 A;  1Z09 A;  4OPQ A;  4OH0 A;  4S2M A;  5AQ7 A;  5CGS A;  4HP4 A;  5MC7 A;  4H6J A;  1CEG A;  4EEP A;  5GLC A;  2WKE A;  1K6S A;  1T1B A;  1XPB A;  3VSK A;  2HF6 A;  1N9B A;  3O86 A;  5DKK A;  4OPR A;  2R9X A;  1LL5 A;  4HOI A;  4UEY A;  2QHK A;  2OV5 A;  2OLU A;  4GDN A;  3DWK A;  3BY9 A;  2JKF A;  2XD1 A;  2VGJ A;  3UPO A;  3DWZ A;  4UQI S;  5G4Y A;  3IXH A;  4NXF A;  1YLZ A;  4F3L A;  2QJ7 A;  2VA0 A;  2EX9 A;  2VJW A;  4X69 A;  3VFH A;  4JXW A;  2W3D A;  4YOF A;  5M1A A;  1L0F A;  4HNB A;  3IX4 A;  2HP9 A;  2V1B A;  4BJP A;  3PBR A;  4LV3 A;  1GSV A;  3GDI A;  2BLS A;  3S22 A;  2A24 B;  3C4P A;  3MQO A;  4S2J A;  5IU1 A;  3IF6 B;  3A0S A;  1KVM A;  2WKI A;  2Q9M A;  3HLB A;  5F69 A;  2WAD A;  4GDB A;  2VKS A;  1MKM A;  2Q9N A;  2P9V A;  3HUO A;  5KZH A;  3LEZ A;  4G3W A;  4NKP A;  2H5S A;  3Q1F A;  5DTK A;  1SKO A;  3OCL A;  3M6B A;  4M3K A;  3IWQ A;  3HJI A;  1I2W A;  3T4L A;  3VOZ A;  2BG1 A;  3FYZ A;  4UHU A;  1CJF A;  2W3E A;  1O07 A;  1JTG A;  3JYI A;  4II7 A;  4WZ4 A;  1UWN X;  1ALQ A;  5JYO A;  1W79 A;  3UE1 A;  1G5U A;  5FAO A;  5A91 A;  3GMW A;  4PM9 A;  3CHW P;  2DNS A;  3WWX A;  2VX8 A;  3VE3 A;  4X1L A;  1G68 A;  3BYD A;  4OQG A;  4LV1 A;  3K3C A;  2XRN A;  4ZDX A;  1KE3 A;  3CWF A;  4X6T A;  4IBR A;  5EOO A;  4BBT A;  4R3J A;  5M19 A;  4Y13 A;  1ERO A;  3ZGA B;  2K31 A;  4YWZ A;  4NXE A;  4U0X A;  1Q2P A;  4Y17 A;  2Y2H A;  5AQB A;  3ITB A;  3IX8 A;  5TBM A;  1OTE A;  3P01 A;  2QJ5 A;  4GOG A;  4B4X A;  4CLC A;  5KSC A;  1MZU A;  1IKI A;  1L3L A;  1VET A;  4EQI A;  3E4O A;  4H6J B;  3T1X A;  3BY8 A;  1D1J A;  3IS2 A;  5HWT A;  3W8K A;  1SKF A;  3LUQ A;  1H3Q A;  2GX5 A;  1YPR A;  2ZQC A;  5AVF A;  4S2N A;  1F9I A;  1VM1 A;  3EEH A;  5A8B A;  2D02 A;  3HRE A;  3ZCZ A;  3ZVW A;  5GHY A;  3BEB A;  2WKQ A;  3E2K A;  4N1H A;  5CTM A;  1NWZ A;  3PHY A;  2EFU A;  2J80 A;  4F3L B;  3FV7 A;  3SH9 A;  4P85 A;  1BLS A;  1VB6 A;  1XA1 A;  1MC0 A;  5FI7 A;  2J3T D;  2XQZ A;  3QNB A;  4MN5 A;  4WMC D;  1PZP A;  3UPP A;  3V39 A;  3AGF A;  5HPF A;  3HLD A;  3ZG0 A;  5JYP A;  1Z6F A;  1Y4O A;  2JCH A;  5L8M A;  4BLM A;  4DRT A;  5HWW A;  1V9Z A;  1KE4 A;  1MWT A;  2P9V B;  2WKR A;  3G2Z A;  3Q81 A;  3VFF A;  4ZRR A;  1YMS A;  2OAP 1;  4R6L A;  4DF6 A;  3C2W A;  1SKO B;  3PR6 A;  3MXS A;  2XA7 M;  4U3T A;  2XFT A;  4K91 A;  3CMZ A;  3G35 A;  1JWP A;  4KQR A;  2L0W A;  1WYC A;  2ZC7 A;  3K2N A;  3VP4 A;  5EOE A;  1JNU A;  2MJ6 A;  4JXS A;  2OSU A;  4DN0 A;  1OT6 A;  4O7D A;  3UPN A;  1H5X A;  5A93 A;  5I5L A;  2QYB A;  3GV9 A;  2V8F A;  1BLC A;  4I3A A;  4BBU A;  5FEF A;  5J3W A;  1HVB A;  2Y2G A;  3BFG A;  4Y2F A;  4R1G A;  2FZ0 A;  3ZVT A;  2PD7 A;  3CIT A;  3O88 A;  3T1S A;  4HJ3 A;  1X0O A;  4E3L A;  3LI8 A;  3G2Y A;  1OPX A;  1K55 A;  3H82 A;  3NIA A;  1S1Y A;  5FQ9 A;  3QP5 A;  3BLM A;  2Y4A A;  5TBM B;  2R9W A;  2A49 A;  2WKH A;  5FAP A;  1GA9 A;  3PBO A;  5J4E A;  3W2Z A;  3A3F A;  1D06 A;  5KSH A;  3G31 A;  4X1M A;  1NLZ A;  1PYY A;  1VET B;  1DP6 A;  1ESI A;  1V9Y A;  4QY5 A;  2WGW A;  2PYP A;  4IUK A;  4WM9 A;  3IS2 B;  2Y8H A;  4X68 A;  5HSQ A;  1FCO A;  2EA9 A;  1XFQ A;  5TR7 A;  4MLL A;  2AVX A;  4MDZ A;  2HPB A;  5FAQ A;  4L0L A;  3V5M A;  2J7V A;  2W3G A;  1K54 C;  3NOU C;  3O87 A;  4NG2 A;  4LRX C;  5CEC A;  3BFC A;  5TGF A;  1OTD A;  5EV0 A;  4DMZ A;  4KQQ A;  4S2P A;  3V3S A;  3F1P A;  1IYS A;  4UQI M;  4GD8 A;  3ZNT A;  1FR1 A;  4JPM A;  3C7V A;  3PBN A;  5FQQ A;  5L2F A;  3KYE A;  5L10 A;  3GR2 A;  5HL6 A;  4JXV A;  1D7E A;  1LLB A;  2A3U A;  5BOH A;  4PHT A;  2Y2L A;  1SCW A;  4BQM A;  3F1N A;  4Y0U A;  3GTC A;  1IYP A;  1VEU A;  4HP9 A;  4NEE D;  3RXW A;  3MFD A;  3S4X A;  1WA9 A;  1ZC2 A;  3MKF A;  4JGO A;  4WZ5 A;  1S4S A;  3WS0 A;  5EVL A;  1CF0 A;  1K38 A;  4MN7 A;  4UA9 A;  3BLS A;  2IWC A;  3N8L A;  2E8J A;  3TW8 A;  3NBL A;  1I5Q A;  1PI4 A;  3S7Q A;  2HJE A;  4Y5F A;  3PBS A;  4S2I A;  1FIK A;  3DBA A;  4R38 A;  5CED A;  4OQH A;  5A90 A;  5FI2 A;  1GCE A;  1YLT A;  1LSX A;  3LYX A;  3GEC A;  3VP2 A;  3L9K A;  5EVE A;  3MZD A;  4FSF A;  4EES A;  1ERQ A;  1CI9 A;  2EX6 A;  2J9P A;  1ZHH B;  5FQK A;  2A24 A;  4C75 A;  3LR4 A;  4S2K A;  1HZO A;  2C5W B;  3IF6 A;  2WGI A;  4LV0 A;  1W63 Q;  3HLE A;  1YLP A;  4B93 A;  3H82 B;  1WYB A;  2Z2L B;  2JKT M;  2VZW A;  3UDX A;  2PHY A;  3A3I A;  3R4K A;  1YLY A;  2XA7 S;  2ZQ7 A;  1GHM A;  3SH8 A;  3NDG A;  2W27 A;  3PAE A;  4HHD A;  1H8M A;  1Y54 A;  3TJZ C;  3MQ0 A;  4O0P A;  3UB7 A;  3CLO A;  4R70 A;  3OPL A;  2WGW B;  3CZD A;  4P0M A;  3LIC A;  2VLG A;  4Y7P A;  1GHP A;  1VHM A;  3WS1 A;  2C6W B;  2DRW A;  1UWP X;  1QME A;  4R3B A;  4OP5 A;  4E6W A;  1IEM A;  2PYR A;  3WS4 A;  4ZAM A;  3MZE A;  5F68 A;  4OOL A;  4LGW A;  4WMC A;  2KOI A;  4K0W A;  1W8Q A;  5FDS A;  3ZDJ A;  3DTI A;  5L07 A;  5F83 A;  3UB8 A;  3TG9 A;  1IEL A;  3OPR A;  4PM6 A;  4X56 A;  3E4Q A;  3NOP C;  3UDI A;  1GSX A;  1BLP A;  2ZMV A;  2ZM8 A;  3F1P B;  5CHM A;  2ZJ9 A;  3JPU A;  4BD0 A;  2HDU A;  4WBG A;  3T1Q B;  1L0E A;  3TOI A;  3GVB A;  5EVI C;  3FC7 A;  3CAX A;  3SH7 A;  3RXX A;  4LLO B;  4R23 A;  3IH9 A;  1TD5 A;  4E3M A;  4N9K A;  4FTX A;  4IBX A;  2W3H A;  1K6R A;  3F1N B;  1PWG A;  3OPH A;  4ETX A;  2Y2N A;  3KSH A;  1PRQ A;  3B33 A;  4DJ2 A;  5GLB A;  1VEU B;  3VP1 A;  4DE1 A;  3IT9 A;  1CI8 A;  1PI5 A;  1BUL A;  2M7U A;  3E98 A;  5FA7 A;  1DRM A;  2HDR A;  3H7W A;  1NLY A;  1GA0 A;  2Q0O A;  3T50 A;  4MEZ A;  3FKW A;  3C5A A;  3G30 A;  4QHC A;  3MKE A;  5IT5 A;  1STZ A;  3LY4 A;  1NYY A;  3BM6 A;  3IWI A;  4Q0H A;  4HJ6 A;  1IKG A;  2ZC6 B;  3LO7 A;  4UA6 A;  3T4K A;  4Q0I A;  3HBR A;  3D72 A;  3LIA A;  3EOI A;  3OZH A;  1OJG A;  5EEC A;  3OPP A;  2XSS A;  2I72 A;  3K3D A;  3VE4 A;  3CI6 A;  1ESU A;  1EWZ A;  2H0Y A;  2ZM0 A;  3QP2 A;  3SS5 A;  5FAT A;  5DFY A;  1DJB A;  3LR5 A;  3KX0 X;  3AGE A;  1OTA A;  3T12 B;  2OLV A;  1Y28 A;  3V3R A;  3LI9 A;  3L7H A;  4EW7 A;  1MWR A;  1PWD A;  3T4J A;  3A3E A;  3PAG A;  2B18 A;  2M7V A;  3FZC A;  4DJ3 A;  3E2L A;  1NY0 A;  4NXB A;  4JF5 A;  3V50 A;  4GNU A;  4D60 A;  2Y2K A;  4Q8I A;  1I2S A;  1KDS A;  2O9A A;  1HD8 A;  5GHZ A;  3VOL A;  1OTI A;  3BRM A;  4FD8 A;  1L0D A;  5C5K A;  3C30 A;  3E4P A;  1PWC A;  4K08 A;  3VMA A;  3BFD A;  5E2H A;  4XT2 A;  3IBJ A;  1FOF A;  3NUL A;  4JKT A;  2K2N A;  1S66 L;  2INW A;  3LY3 A;  3LCE A;  1CEF A;  2PBD P;  3KSI A;  2HP6 A;  1K57 A;  3HUM A;  3EWK A;  4HJ4 A;  5DJU A;  4GN2 A;  5FSR A;  4CLC C;  1W5D A;  3M2K A;  3IXD A;  5E43 A;  2VV6 A;  3MMH A;  2ZD8 A;  5HW3 A;  2WZZ A;  3MR0 A;  4K0X A;  3IHB A;  1TVF A;  4ESP A;  1LSV A;  1KGE A;  4KEN B;  3B42 A;  2QMI A;  3QP6 A;  2RCX A;  4HBU A;  2QPN A;  1IFQ A;  4JF6 A;  4XUZ A;  1NRJ A;  2L4R A;  4ZTK A;  4E04 A;  3UE3 A;  3G6O A;  2XEP A;  4H8R A;  4S2N C;  1E3U D;  3U2A A;  2VV8 A;  1T1C A;  4EER A;  2X71 A;  5AVE A;  4QJG A;  2O0Y A;  3H7W B;  3N4I A;  3E0Y A;  1N9L A;  4DE0 A;  3LR0 A;  2PRF A;  3M2J A;  4EUZ A;  2EWW A;  4BL2 A;  3EEA A;  4P87 A;  3UNW A;  5EPH A;  3KSG A;  4ZJ3 A;  4EEU A;  3UME A;  3QP4 A;  2XD5 A;  3HCY A;  5M18 A;  2R78 A;  3BW6 A;  1XGJ A;  1YQS A;  4KZ4 A;  4E3N A;  4WYY A;  3F1O A;  2UWX A;  4A5R A;  2BAS A;  4Y0T A;  2WGV A;  3HL9 A;  4LPZ A;  4MBK A;  4QWO A;  3MS6 A;  3OLO A;  5EUA A;  2GJ3 A;  3FG8 A;  4KZ9 A;  1JWV A;  3T1R A;  5HFO A;  4BD1 A;  3W4P A;  2CMN A;  5GHX A;  4WEK A;  1XGI A;  4HH2 A;  4MN6 A;  4GD6 A;  5DF8 A;  4YNR A;  4LV2 A;  1NZO A;  3Q82 A;  1K56 D;  5EVI D;  3LR3 A;  5LBR A;  2PU4 A;  4FOF A;  3NHQ A;  3UDF A;  3CUE C;  1MXO A;  3NEC A;  1ZG4 A;  3NJA A;  1JVJ A;  5EM0 A;  3UB6 A;  4I39 A;  2WAF A;  1L0G A;  4WF0 A;  4IUH A;  5FQJ A;  4ZJ1 A;  1BSG A;  5J8X A;  5F1G A;  1AWI A;  3JVV A;  2XR0 A;  4O8G A;  5GL9 A;  4XT2 B;  1K55 C;  3T4O A;  5E2G A;  5F1F A;  2QZ6 A;  1P97 A;  4EET B;  5HDD A;  3LIB A;  5CGX A;  4HY8 A;  4ZJ2 A;  3C8C A;  4EXO A;  3WS5 A;  4KUK A;  1DP8 A;  4I3I A;  1YSQ A;  4HH3 A;  1MKI A;  3NI9 A;  3ULF A;  4MMN A;  3IWO A;  3SS4 A;  4EUV A;  1XFN A;  3A0V A;  4S2L A;  3MXQ A;  2DCF A;  3T4S A;  3D3O A;  1FSW A;  5FL3 A;  3R7W A;  3EGD C;  4Y0O A;  2G2U A;  2IWB A;  1E4D A;  1H8Y A;  4RQ9 A;  5HDC A;  1BZA A;  4LRZ E;  1DY6 A;  2L1M A;  2JBF A;  3A3J A;  5KMW A;  4IHQ A;  3LGO A;  1H8Z A;  2ZL1 A;  1RGY A;  3SW1 A;  4AFI A;  2XRO A;  1E25 A;  3RH8 B;  2Z6D A;  5TFQ A;  1YT4 A;  2VGL S;  2J8Y A;  2ZC5 B;  3EQU A;  3FPV A;  1YMX A;  3VP3 A;  3PYP A;  5CER A;  5HPI A;  1TDL A;  2EX8 A;  4R4R A;  5FQM A;  2BTF P;  4IED A;  3F1O B;  4MNR A;  2KDK A;  3IXB A;  3WRT A;  2CC1 A;  3EQV A;  3B3X A;  1BYW A;  2XDM A;  4X53 A;  3VV4 A;  4OKP A;  2X02 A;  5F82 A;  1N4O A;  4WZ5 C;  1PNE A;  2JKR M;  2ZOI A;  5F6A A;  3UN7 A;  3HUN A;  4FUW A;  4OVD A;  4IVK A;  5HD3 A;  2ZC3 B;  1KE0 A;  5E2F A;  4LFU A;  2O9B A;  1P0Z A;  2Z2M B;  4DDS A;  2V1A A;  2PDR A;  3IBR A;  3TSG A;  2EWV A;  1RP5 A;  4EWF A;  4LCL A;  4Y15 A;  1TEM A;  1G28 A;  4R4S A;  4G3K A;  1J3W A;  1CQA A;  2WAE A;  3G4P A;  5HZH A;  2M1C A;  3IF6 C;  3NOT C;  2UV0 E;  1XA7 A;  1M6K A;  4BBV A;  1ODV A;  4C6Y A;  1CK3 A;  2ZQA A;  4KZ3 A;  4OPY A;  4PKY G;  3S7O A;  5CTN A;  4B9O A;  2Y91 A;  3ZYT A;  2W3F A;  4JGQ A;  1HLU P;  2EX2 A;  3NCK A;  4PAU A;  2V8C A;  3TRC A;  3PTE A;  1E3U A;  3KO6 A;  3PBQ A;  3CG5 A;  2QKP A;  1XJ3 A;  5I94 A;  5HDS A;  2FFY A;  1N9N A;  4ETZ A;  2JN7 A;  3Q7V A;  3ZG5 A;  4DDY A;  4XUX A;  3R7W B;  4RX3 A;  1ZTU A;  3T4T A;  5HAR A;  1FR6 A;  1ZKJ A;  4PM7 A;  3NY4 A;  2WKP A;  5DTS A;  4JGP A;  4DE3 A;  4C3Q A;  4G3V A;  5DFX A;  4DXB A;  4KZB A;  2ZL1 B;  3BWL A;  1KOU A;  4EV4 A;  4N1X A;  4CJN A;  3MF0 A;  4JF4 A;  2H0T A;  3GRJ A;  3UO9 A;  3BFE A;  2OOL A;  3ZG8 B;  2EXA A;  3RTY A;  1TDG A;  1W7F A;  4NET A;  5CRF A;  4QU3 A;  3VOY A;  4OPZ A;  4KQO A;  4I5S A;  2Y2O A;  4GCZ A;  1FQG A;  4E3J A;  2ZLY A;  3GSG A;  2QWS A;  1JWZ A;  1XX2 A;  3KYQ A;  3ZHH A;  3UE6 A;  1K56 A;  5EVI A;  2DMW A;  4QPR A;  2HZ5 A;  2LB9 A;  1TS6 A;  5CEB A;  2XH9 A;  1T18 A;  5AQA A;  2A2L A;  3PXP A;  3OC2 A;  4EBP A;  2O9C A;  3N8S A;  1XJ2 A;  4KG5 A;  1F5M A;  5CHJ A;  4O01 A;  4E3O A;  1MY8 A;  4LEN A;  3GQZ A;  4JLF A;  4R0Q A;  2ZMA A;  3OOV A;  4I38 A;  4MCW A;  2Y2J A;  3LEQ A;  1YKD A;  3HLW A;  1LL8 A;  4S2O A;  3OCN A;  1RGZ A;  5U47 A;  3A3D A;  2Y2Q A;  3IHA A;  5FI6 A;  1MPL A;  1N9O A;  4HQA A;  5FEG A;  3FPW A;  4P6Z M;  1EW0 A;  5DVA A;  2G2W A;  2HDS A;  2PBY A;  4WN5 A;  2V9A A;  3CPT A;  2P08 A;  1K25 A;  4YFM A;  2IWD A;  2WUQ A;  4EBL A; 
#chains in the Genus database with same CATH homology
 3L9K A;  5EVE A;  2JKF A;  1SZV A;  4D60 A;  4FTX A;  1SKO B;  1PRQ A;  1VEU B;  3UB5 P;  2JKG A;  5EV0 A;  2B95 A;  2PAV P;  1J3W A;  5EM1 A;  1CQA A;  1F2K A;  3NUL A;  2VK3 A;  4QWO A;  1VET A;  3MS6 A;  3T1X A;  2PBD P;  1FIL A;  3LGO A;  3T1R A;  3KYE A;  1D1J A;  2ZL1 A;  2V8F A;  5FEF A;  1YPR A;  3DAV A;  2HZ5 A;  1ACF A;  1A0K A;  1HLU P;  2ACG A;  3CPT B;  2V8C A;  3T1S A;  4ESP A;  4X25 A;  1K0K A;  1SKO A;  1PFL A;  1VEU A;  3NEC A;  5FDS A;  5EM0 A;  1CF0 A;  3LEQ A;  1Z09 A;  3MSH A;  1CJF A;  2BTF P;  2E8J A;  1AWI A;  1G5U A;  4X1M A;  1VET B;  3CHW P;  3T1Q B;  5FEG A;  3T12 B;  2PRF A;  1FIK A;  1PNE A;  3L7H A;  2ZL1 B;  1Y4O A;  4FUW A;  3D9Y A;  4X1L A;  3CPT A;  3U4L P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...