3T1QB

Mgla bound to gppnhp in complex with mglb
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
LVLYGAPYAAAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALAAIAEEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/signaling protein
total genus 37
structure length 132
sequence length 132
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1qB00
2VK3A 3CPTA 4FUWA 4X25A 5EVEA 3T1XA 1SKOB 3L9KA 3KYEA 1YPRA 1PRQA 3NULA 3T1QB 3LEQA 4D60A 5EV0A 3MS6A 2ZL1B 1HLUP 3UB5P 1A0KA 1SZVA 2B95A 2ZL1A 1ACFA 1J3WA 1CJFA 3CHWP 1CQAA 2JKGA 2JKFA 1Y4OA 2PBDP 2PRFA 2HZ5A 4ESPA 3DAVA 2ACGA 2V8FA 3L7HA 1D1JA 2PAVP 5FEGA 4FTXA 3U4LP 4QWOA 1CF0A 3NECA 3T1SA 1Z09A 1K0KA 3LGOA 1PFLA 1FIKA 2E8JA 5FDSA 5EM1A 5FEFA 2BTFP 3D9YA 2V8CA 1VETB 1AWIA 4X1MA 5EM0A 1VEUB 1SKOA 1VETA 3T1RA 1PNEA 3T12B 1VEUA 3CPTB 1G5UA 4X1LA 1F2KA 3MSHA 1FILA
chains in the Genus database with same CATH superfamily
1NRJA 3TW8A 4KQDA 4MN5A 4Y0UA 3WS1A 4IBRA 4N1XA 4EBNA 4HQAA 3GVBA 4IUKA 4Z1WA 1CI8A 4FD8A 2V1BA 1MWRA 1U60A 2PT7A 3VP2A 3C38A 3KSGA 1K55C 3EGXC 4JGRA 4E3LA 2UWXA 2B02A 3K2NA 4C3QA 4EQ1A 5HL6A 4Y3IA 4RVAA 1GA9A 3BY9A 5M1AA 3C5AA 5U47A 2ZC7A 1NJ4A 2K2NA 4I5SA 3QP2A 3UY6A 1NLZA 4WBGA 2IWCA 2XQZA 5K5BA 3QP1A 2GNXA 3NDEA 5EVIB 3PXPA 2DMWA 4JXSA 5EFWA 3DTKA 3HLFA 4UAAA 1FCMA 3N8SA 1KVMA 2OWHA 1MKIA 3P98A 3MZDA 1ES3A 1KE4A 1QMEA 2ZM2A 3UMDA 3VV4A 1MWUA 2WZZA 4EETB 5GLDA 3BFEA 2Q9MA 3M6HA 4BMWA 3GMWA 5CHJA 4O7DA 4KZ4A 5HAQA 4OONA 5HDSA 5FDSA 3ZG7B 3UE6A 5FEFA 3D9YA 3ITAA 4S2PA 4LRXC 1S1YA 1LHYA 5FI2A 3ZYTA 4NXEA 1RCJA 3OPRA 1YLZA 2K31A 3UN7A 3KYZA 2O9CA 2ZLYA 5G4YA 2ZC3B 3MSHA 4OOMA 3OBFA 1XKZA 4FUWA 3B33A 5CGXA 4RA7A 1SKOB 4MLLA 1GSXA 3N8RA 1NZUA 3DTMA 1LSXA 1OTBA 1K55A 2XA7M 1NYYA 3MS6A 4DJ2A 2HJ9C 3GR2A 2D01A 1W63M 3VOZA 2JKTM 4E04A 4HESA 2XDMA 3U2AA 1IEMA 1WA9A 3CMZA 3ZG5A 2JKGA 1RGYA 1K25A 2IA2A 5J7EA 3GSGA 1XFNA 1XGIA 1WE4A 4KZBA 3QP6A 3K3CA 4Q0IA 1FR6A 3UPOA 3BY8A 1V9YA 1S1ZA 5HPFA 1JWPA 1NWZA 1GHIA 4QWOA 1ZTUA 5EECA 3UB9A 4MBHA 5CEBA 3IQAA 2GJ3A 1YT4A 1K0KA 2O9AA 3JVUA 3A0VA 4KG2A 1PZOA 1VM1A 3MXSA 3E4PA 2V8CA 4FH4A 3SS4A 4P85A 3ZVWA 3I7JA 3S7QA 2H0TA 2J9PA 1NZOA 3S7NA 2M1CA 3UE3A 2CC1A 4GS9A 1XFQA 4L9EA 3BQ8A 3HUNA 4GHIB 4BWIA 4X25A 5EVEA 4PM8A 4BQMA 2KOIA 4I3AA 1L0EA 3MQOA 3UPPA 3T1QB 1VQQA 2Y2HA 4GJ4A 4BJPA 5MC7A 2XD1A 2M7VA 1N4OA 2ZL1B 4GOGA 2ZQ9A 1SHVA 2EFUA 2W3FA 2B95A 2W0NA 2JKRM 3BFFA 4IUHA 4OVDA 3LR5A 2EX8A 3CJMA 3CZDA 5AVEA 4KENB 1OT6A 2LB9A 4BBTA 3B47A 4ZJ3A 4NK3A 2PYRA 1S0WA 1ES5A 2DNSA 4G3KA 4KZ5A 3W4PA 4DKIA 5EVIC 3WRTA 3CI6A 4OH0A 4EQIA 1ES4A 2H5SA 4HH2A 3FKWA 3O3VA 4FH2A 4OQIA 1FIKA 2J9OA 3IHBA 4UQIS 1S4RA 1ONGA 3LICA 2JKTI 3CUEC 2QZ6A 3T50A 1XA7A 4M4XA 3EGDC 2EXBA 3NCKA 1OJGA 5GHYA 2L1MA 3BJNA 3VFHA 1BT5A 3JVVA 3HLCA 3FV7A 1PRQA 3NULA 5A92A 2P7JA 4DDSA 2VGJA 4R23A 1OPXA 1YKDA 2NUTC 4M3KA 4S2NC 1J3WA 2H10A 1BTLA 3NOTC 4EW7A 2V1ZA 3GTCA 4D2OA 3JPUA 2H28A 5HWWA 3EEAA 4PKYA 4NG2A 1KVLA 1T18A 4ESPA 5GLCA 2DCFA 3F1OB 1TVFA 2Q9NA 5EVIA 3PYPA 3T4LA 2G2WA 1XJ4A 3BFCA 1UWPX 5HPIA 2O0YA 2EXAA 3ZG9B 2ZQCA 1IFQA 2WKEA 4DF6A 3LGOA 4S2MA 4BL2A 4IVIA 3OPHA 1K6RA 3OOVA 2QJ5A 3MJQA 2IWBA 3CUEA 1VETB 4E6WA 2WGWB 2Y2PA 4I3JA 1VEUB 2Z2LB 1EW0A 1YSQA 2G7UA 4I38A 4N9LA 4U3TA 4PAUA 1X0OA 3HUMA 1VB6A 1OTEA 3HBRA 1E3UD 4E3MA 5L2FA 4IBXA 1ESUA 4JF6A 2WAFA 4NXGA 5FAQA 5IU1A 5HWTA 1GCEA 5TGFA 4KZ3A 2XRNA 4S2KA 4DXBA 4QB8A 4R3AA 3CG5A 2XEPA 4DRTA 1OTDA 5J4EA 2RL3A 4B4XA 2Y2OA 4RQ9A 3H82A 3ZVTA 1XX2A 4S2NA 1LI9A 1KOUA 3UNWA 3EOIA 3C4OA 5FQ9A 2INWA 4AFIA 1N9LA 5DTKA 3LYXA 3AGFA 4ZBEA 1H8ZA 2W27A 2W1RA 2HP5A 3IX8A 4E6XA 3TOIA 3S4XA 4BBUA 2Y2KA 1M6KA 1KE0A 4ME4A 3UE0A 2J7VA 4ZRRA 1ZG4A 3SW1A 3T4TA 4DXCA 3OCLA 3RFBA 5E43A 3NIAA 1XJ2A 2X71A 4GDBA 4Q0HA 1LL5A 5TJJA 3S7OA 4WN5A 2YKFA 4JXGA 4P87A 1NY0A 3IWQA 4GKUA 4OQ0A 2VJWA 1RP5A 5HDCA 4GCZA 4PM5A 1SCWA 4UEYA 1N9OA 1XJ3A 1PFLA 3E98A 1G6OA 2V0WA 4MN6A 2ZOHA 2Z6CA 3IH8A 4JLFA 2EWWA 3IWIA 5L07A 3VP0A 1S67L 1FR1A 4R1GA 3VE3A 4HOIA 1MC0A 2OLVA 3O87A 4EUVA 5HFOA 1E25A 1LT0A 5HWVA 1FILA 1JTDA 5CTNA 4OOYA 5A8BA 1YPRA 1XPBA 1SKFA 5DKLA 1BLHA 3CLOA 2OV5A 1F98A 3K3DA 2XSSA 3IXHA 2PU2A 4JPMA 5JYPA 1HLUP 4DMZA 4PM9A 2ZL1A 5F1FA 5CECA 3NDGA 1CJFA 4RX2A 5CTMA 5TFQA 4MCWA 2VGLS 4DN0A 1DP9A 2V1AA 2MJ6A 5M18A 1J9MA 4R4SA 5FQMA 3ULFA 1DJBA 1P97A 3KYQA 2V9AA 4PHTA 4IEDA 4PM7A 3V3SA 4XUZA 5CGWA 5IHVA 3NOPC 3VOLA 1BLCA 5E2HA 1PZPA 3JYIA 5FSRA 4GB7A 2XFTA 2ZM8A 2JN7A 4P6ZS 2BLSA 3P01A 3PBTA 3ZFZA 2WYXA 3IHAA 1Z09A 4O01A 2NUPC 4BL3A 2J8YA 2X02A 1G28A 3G2ZA 2OSUA 1LSWA 3FYZA 1GHPA 4Y17A 4OLDA 2V0UA 1I2SA 3GRJA 3BLSA 2PR6A 3DBAA 4Y0OA 3NC8A 2Y2GA 3R7WB 2R9XA 3BECA 3PAEA 2Q0OA 4WEKA 1W79A 2QMIA 4JGQA 2A2LA 4Y15A 3OZHA 1PW8A 3Q82A 4NXBA 2PR5A 1F2KA 2ZBBA 1TDGA 2EWVA 4MMNA 5DJTA 4OP8A 3VP1A 4LV3A 1K4EA 1IELA 4KG6A 2Z2MB 3NJAA 1PYYA 4WZ4A 4YINA 1BULA 4MN7A 4WL9A 1WYBA 1IOUA 1ACFA 1IYOA 3A3FA 5GL9A 3HLEA 3ITBA 4HBUA 5GHXA 3G35A 3O5YA 2ZOIA 2WKHA 2XROA 3H82B 2ZJ9A 3Q81A 2HP6A 1LSVA 3D3OA 5I94A 5DFXA 2JHEA 3F1OA 4KQOA 1I2WA 4NEED 3IBJA 1CF0A 3IXGA 2ZMVA 5F6AA 5IS1A 3VP3A 4GN2A 4Y7PA 4LFUA 3IX3A 2ZC4B 3QNCA 5I5LA 3QP8A 2HDSA 1IYQA 1UGUA 3LO7A 2Y2LA 4BBVA 1LI0A 1AWIA 2VKSA 3LY3A 4R3JA 4X1MA 4EEPA 2GX5A 2P04A 2PD8A 3IXBA 1XGJA 5GHZA 1VETA 1JVJA 2PBYA 2WGWA 1MZUA 2Y55A 1VEUA 5FQJA 3WRZA 1YLPA 2GZAA 3AGDA 5HX9A 4X1LA 1YLWA 2M7UA 2Y2MA 4EEUA 4OOLA 4DE2A 1BSGA 5HDDA 1FSYA 3RH8B 5AJGA 3IH9A 3SH7A 3WWXA 1F9IA 4KZ9A 3LFVA 3P7NA 2EX9A 1P9WA 2BG1A 5BOHA 1XXMA 4KQRA 4HY8A 4FCFA 1ES2A 1YMXA 2XF3A 4LRYC 4G3WA 1G6AA 2P08A 1FQGA 4YFMA 5EVLA 5KMWA 2QHKA 4KUKA 3SOIA 2HZ5A 2IWDA 2W3GA 3TSGA 1TEMA 4WYYA 3GDIA 2OAP1 2VEAA 2VA0A 1V9ZA 2QYBA 3M2JA 3PBQA 3L7HA 4XT2A 3DTIA 5FQQA 3HLWA 3U4LP 3PTEA 2J80A 3FG8A 4OPRA 3NECA 1PI5A 3MF0A 1BYWA 5DVAA 1GSVA 2D02A 2WAEA 1PW1A 2E8JA 5DJUA 1PI4A 4MEZA 2WKRA 3PAGA 4S2LA 1CI9A 2XGNA 2VV8A 1DP8A 4QD4A 5L09A 4IVKA 1VHMA 4OPYA 1W63Q 4LV0A 4NXFA 3CPTB 5FAPA 2W3DA 1G5UA 5KIZA 3SH9A 4BD1A 1I5QA 3C4PA 3BFDA 1S66L 2VGKA 3N8LA 1PWCA 3L9KA 2VV7A 2QKPA 4I39A 2ZC5B 3E4OA 1MWTA 5M19A 4LV2A 4FOFA 2XLNA 1YAXA 1T1CA 1L3LA 4HBTA 1ZKJA 2WZXA 5A91A 1O7EA 4UHUA 3VMAA 4C75A 2QPNA 3LIAA 3E4QA 3LCEA 3TG9A 3QNBA 1L0DA 3ZDJA 4QJGA 4KQQA 3MZFA 4S2OA 2JC7A 3O88A 1MY8A 3N7WA 3HL9A 3ZNYA 1W8QA 4ETXA 4EWFA 2WKQA 4HJ4A 2A3UA 2A24B 3G31A 3NY4A 2V8FA 1TS0A 5G4ZA 5HD3A 4GZBA 3RXWA 4ZTKA 1FCOA 3VP4A 3MQQA 5AQ9A 2J3TD 3EWKA 2GDNA 1C3BA 5FI7A 1MBLA 5J3WA 2HDRA 4O0PA 1BLSA 3Q07A 3PBOA 1KDSA 3V50A 4KZ6A 5EPHA 3W2ZA 3KSHA 4II7A 1IYSA 2ZQ8A 3MFDA 2FZ0A 3R7WA 5CEDA 1DY6A 1K4FA 4F3LB 2I72A 3A3DA 3IX4A 4K08A 1CEGA 1MPLA 3W4OA 1KGFA 4HH3A 2JKRI 5F68A 2Y59A 3MZEA 3T4OA 4WF0A 4HIAA 4LV1A 1ODVA 3IF6B 4E3NA 4A5RA 1NRFA 1OMEA 3HUOA 2XD5A 1JWZA 4Q8IA 1CQAA 3WS2A 3KO6A 2X01A 2JKFA 2Y2JA 4DDYA 5DKKA 2ZQAA 2PBDP 4RYEA 1HTZA 3OCNA 4WM9A 1CEFA 5EE8A 4R4RA 3H7WB 3IS2A 5L10A 4IJGA 4L0LA 4Y5FA 5TBMB 2HP9A 4GLQA 1PWGA 2EA9A 4X55A 3UPNA 3C2WA 3A0RA 2BASA 5GLAA 2OWJA 2V2FF 4OLGA 1XA1A 4ZJ2A 5A90A 2Y2QA 4O8GA 4CPKA 2YKHA 4P6ZM 4XT2B 4EBPA 3S1YA 1ZHHB 2W1TB 4GDNA 3LUQA 3DWZA 5FI6A 3G32A 5HD5A 3T1RA 1K54A 3ZQ5A 1W7FA 3MBZA 4BD0A 2W3HA 1NXYA 4B88A 3FWLA 4E3OA 2VK3A 5E2GA 1GA0A 3PR6A 4JKTA 3MQ0A 1T1AA 5HAPA 3LEZA 2KX6A 3UB7A 4ARZB 4OQGA 1SDNA 1JTGA 1YM1A 4HI4A 3SZTA 4F94A 3AGEA 3CHWP 3FPWA 4FSFA 3C7UA 3KSIA 3LY4A 1HZOA 4S2JA 4X6TA 4H6JB 1OTIA 3UB8A 2FFYA 2FFFB 4GD6A 1F5MA 3DAVA 1HVBA 1GSWA 4CLCE 3PBSA 2DRWA 3OLOA 5J8XA 1FOFA 3UE1A 3TE8A 4N9KA 1BZAA 2PAVP 4QPRA 1WYCA 5HL1A 3LR4A 3T1SA 1ZC2A 1ERMA 4MBKA 3GV9A 1E4DA 1ONHA 3ZG0A 5EM1A 3SS3A 5JYOA 3DWKA 2B5RA 4EBLA 3QP4A 3V3RA 4X53A 2PHYA 5AVFA 3UO9A 2JE5A 3Q7VB 4RX3A 4NKPA 5KZHA 3E2KA 4WELA 3MKEA 1TS8A 2ZMFA 2HGVA 4X68A 3CPTA 4KG5A 3LIDA 2HV1A 1OJ5A 3UDFA 1S6RA 1Q2QA 3M6BA 3KYEA 1T19A 4E3KA 3LEQA 2PYPA 4D60A 4YOFA 4R6LA 1YLTA 2WGVA 5EV0A 3LI9A 3Q7ZA 5G18A 4EXOA 1YQSA 3NBLA 5E2FA 2L4RA 1CK3A 1STZA 4DJ3A 2JCHA 4JGOA 3UMEA 2PU4A 4I3IA 4YNRA 1N9BA 3W8KA 2L0WA 3IF6C 5FDHA 2R78A 3O86A 3T4QA 3T4JA 4CQHA 1Y4OA 2HDUA 3HLBA 3RXXA 2CMNA 1E3UA 3DW0A 2HDQA 1EWZA 3D4FA 4EV4A 3B42A 2ZD8A 3G2YA 3T4SA 4EESA 1H0MA 1L2SA 3BYDA 4U0XA 2XH9A 3MKFA 3OPPA 5DF7A 3LR3A 5FEGA 1XJ6A 2A24A 3BEBA 3C8CA 1S4SA 1DRMA 3WS5A 1D7EA 3NOUC 4K0WA 1L0FA 3IS2B 2ZC6B 5AQAA 2O99A 4N92A 4DE1A 3Q1FA 2J3WA 3GQZA 5FATA 3S7PA 4H8RA 1H5XA 1JWVA 4L9FA 1PNEA 3HLDA 2VLGA 2P74A 4GNUA 2Y8HA 1BUEA 1K57C 4BLMA 3OPLA 2OLUA 4MNRA 4OP5A 1DJCA 1K56D 4HHDA 5E2EA 4Y2FA 5DTTA 5EVID 1XP4A 4UQIM 3UDIA 3H9WA 4EUZA 1ALQA 5F5YA 5C5KA 3WS0A 4F3LA 3IXDA 4MBFA 1HD8A 4HP4A 2WGIA 4WUJA 5A93A 4KZAA 3HLGA 1A0KA 2LB5A 3QP5A 5HAIA 4R70A 5EUAA 3IF6A 3BWLA 3BQAA 4C6YA 4GW9A 4HNBA 5FASA 1T1BA 4WLAA 3F1PB 3N6IA 3F1NB 2UV0E 4OPQA 4P0MA 1Y54A 1H8MA 3RTYA 5CXWA 1KE3A 1M40A 3HJIA 2VV6A 3E2LA 5FL3A 4LPZA 3IT9A 1PIOA 5DTSA 1QMFA 3MXRA 1BLPA 4WMCD 3TRCA 1D1JA 3H7WA 3ICYA 3UB6A 4CLCB 3V39A 1SDEA 4HJ3A 5TBMA 3CAXA 4KUOA 4MDZA 3NI9A 4Z9QA 3FZCA 3IF5A 3WS4A 5D3OA 2BTFP 3LI8A 4JGPA 3KSFA 1FCNA 2P9VA 2XFSA 4PMAA 4WEJA 4X69A 2ZM0A 1P9RA 4JBFA 1IKIA 4UA7A 1TDLA 2W1TA 3T4KA 2OOLA 2KLIA 3T12B 5F1GA 3EQVA 1K57A 2WKPA 4OKPA 4EERA 3W4QA 3R4KA 5AQ7A 1YSPA 4UA9A 1DJAA 4B9OA 4LLOB 3GECA 2ZQ7A 4HP9A 1G68A 1ZG6A 2PD7A 2XA7S 1YLJA 4PKYG 1ESIA 2KDKA 3IBRA 4Y13A 3HCYA 4LCLA 4LRZE 3SH8A 5CERA 3EQUA 4ARZA 3HVFA 2EFXA 4Q0JA 3ZCZA 4ETZA 4ZAMA 5GLBA 1KGGA 1SZVA 4EU0A 1KGEA 3ISGA 1RGZA 2VX8A 2XR0A 2A49A 4DE3A 2C6WB 4ZDXA 3C7VA 3MR0A 5HARA 3BLMA 1KDWA 2RCXA 2PRFA 1IYPA 2C5WB 3QHYA 2QWSA 3RJUA 3BM6A 4H6JA 4QY6A 4CLCD 2ACGA 1ERQA 4JF4A 5L8MA 3ZG8B 1LL9A 3VSLA 4FTXA 5LBRA 3VOYA 4OPZA 4WZ5C 1OTAA 3BFGA 1IKGA 1P0ZA 1TS6A 5FA7A 4X56A 4QHCA 2Y2NA 1YLYA 3ZGAB 3A3IA 3ZHHA 4QY5A 5CGSA 3B3XA 3FKVA 4ID4A 3V67A 4E3JA 2I9VA 3TJZC 5CHUA 1UWNX 4P6BA 2K7SA 3Q7VA 2Y2IA 5CRFA 4QU3A 4HJ6A 3T1XA 4CJNA 4LENA 3SS5A 1LLBA 3G4PA 5FQIA 3DTEA 4S2IA 3C30A 1TF1A 4R0QA 5KSHA 2Y4AA 1O07A 4K91A 4KZ8A 5DF8A 1K54C 4ZJ1A 1PWDA 1K56A 2ZQDA 3UB5P 3CITA 2OAQ1 2HJEA 3IWOA 3MXQA 3A3JA 1DP6A 5HSQA 3EEHA 3G30A 5EOOA 2Z6DA 5CHMA 1EI5A 3MMHA 4UA6A 2ZMAA 2FH5A 5TR7A 3LIEA 2W3EA 4IHQA 4KZ7A 3P09A 3D72A 3E0YA 1TD5A 5AQBA 1D06A 1TS7A 3LIFA 3ZNTA 4JF5A 1OT9A 4WZ5A 4R3BA 5KSCA 4R38A 4CLCC 4XUXA 1MWSA 2VGLM 4WMCA 4E3IA 4U0TA 4GS9B 1SKOA 2O9BA 2VZWA 4JXWA 1N9NA 3CWFA 4G3VA 4GD8A 1FSWA 3VFFA 5EOEA 2Y79A 1L0GA 2XK1A 3A3EA 4LCMA 2P9VB 1LL8A 5FAOA 3FPVA 2R9WA 2JBFA 2EX6A 4N1HA 1H8YA 4B4ZA 3KX0X 4PPRA 1Q2PA 3G6OA 3UDXA 1JNUA 2AVXA 4BENA 1EROA 2J3TC 3PBNA 4B93A 1MXOA 5HW3A 1NYMA 2EX2A 5DF9A 5F82A 4Y0TA 4XXRA 4NETA 1H3QA 4K0XA 3PBRA 4LGWA 2V20A 2G2UA 5F69A 1MKMA 4YWZA 1Y28A 1Z6FA 2B18A 3MFXA 3F1PA 2QJ7A 2PDRA 3NHQA 3F1NA 1YMSA 1K6SA 1NLYA 2WADA 3G34A 1GHMA 1W8YA 2HPBA 2Y91A 5CX7A 3VE4A 3BW6A 3PHYA 3BRMA 5F83A 3OC2A 3N4IA 3A0SA 4HEFA 4PM6A 3FC7A 3HREA 2WUQA 4CLCA 2H0YA 3LIBA 5DFYA 3V5MA 5HZHA 2WKIA 1W5DA 1AXBA 4GHIA 4JXVA 3LR0A 5EM0A 3M2KA 4DE0A 2HF6A 3S22A 3VSKA 1K38A 2WK0A 5FQKA 5IT5A 4OQHA 4L9GA 2E8IA 3HJKA
chains in the Genus database with same CATH topology
2VK3A 3CPTA 4FUWA 4X25A 5EVEA 3T1XA 1SKOB 3L9KA 3KYEA 1YPRA 1PRQA 3NULA 3T1QB 3LEQA 4D60A 5EV0A 3MS6A 2ZL1B 1HLUP 3UB5P 1A0KA 1SZVA 2B95A 2ZL1A 1ACFA 1J3WA 1CJFA 3CHWP 1CQAA 2JKGA 2JKFA 1Y4OA 2PBDP 2PRFA 2HZ5A 4ESPA 3DAVA 2ACGA 2V8FA 3L7HA 1D1JA 2PAVP 5FEGA 4FTXA 3U4LP 4QWOA 1CF0A 3NECA 3T1SA 1Z09A 1K0KA 3LGOA 1PFLA 1FIKA 2E8JA 5FDSA 5EM1A 5FEFA 2BTFP 3D9YA 2V8CA 1VETB 1AWIA 4X1MA 5EM0A 1VEUB 1SKOA 1VETA 3T1RA 1PNEA 3T12B 1VEUA 3CPTB 1G5UA 4X1LA 1F2KA 3MSHA 1FILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VK3 A;  3CPT A;  4FUW A;  4X25 A;  5EVE A;  3T1X A;  1SKO B;  3L9K A;  3KYE A;  1YPR A;  1PRQ A;  3NUL A;  3T1Q B;  3LEQ A;  4D60 A;  5EV0 A;  3MS6 A;  2ZL1 B;  1HLU P;  3UB5 P;  1A0K A;  1SZV A;  2B95 A;  2ZL1 A;  1ACF A;  1J3W A;  1CJF A;  3CHW P;  1CQA A;  2JKG A;  2JKF A;  1Y4O A;  2PBD P;  2PRF A;  2HZ5 A;  4ESP A;  3DAV A;  2ACG A;  2V8F A;  3L7H A;  1D1J A;  2PAV P;  5FEG A;  4FTX A;  3U4L P;  4QWO A;  1CF0 A;  3NEC A;  3T1S A;  1Z09 A;  1K0K A;  3LGO A;  1PFL A;  1FIK A;  2E8J A;  5FDS A;  5EM1 A;  5FEF A;  2BTF P;  3D9Y A;  2V8C A;  1VET B;  1AWI A;  4X1M A;  5EM0 A;  1VEU B;  1SKO A;  1VET A;  3T1R A;  1PNE A;  3T12 B;  1VEU A;  3CPT B;  1G5U A;  4X1L A;  1F2K A;  3MSH A;  1FIL A; 
#chains in the Genus database with same CATH topology
 1NRJ A;  3TW8 A;  4KQD A;  4MN5 A;  4Y0U A;  3WS1 A;  4IBR A;  4N1X A;  4EBN A;  4HQA A;  3GVB A;  4IUK A;  4Z1W A;  1CI8 A;  4FD8 A;  2V1B A;  1MWR A;  1U60 A;  2PT7 A;  3VP2 A;  3C38 A;  3KSG A;  1K55 C;  3EGX C;  4JGR A;  4E3L A;  2UWX A;  2B02 A;  3K2N A;  4C3Q A;  4EQ1 A;  5HL6 A;  4Y3I A;  4RVA A;  1GA9 A;  3BY9 A;  5M1A A;  3C5A A;  5U47 A;  2ZC7 A;  1NJ4 A;  2K2N A;  4I5S A;  3QP2 A;  3UY6 A;  1NLZ A;  4WBG A;  2IWC A;  2XQZ A;  5K5B A;  3QP1 A;  2GNX A;  3NDE A;  5EVI B;  3PXP A;  2DMW A;  4JXS A;  5EFW A;  3DTK A;  3HLF A;  4UAA A;  1FCM A;  3N8S A;  1KVM A;  2OWH A;  1MKI A;  3P98 A;  3MZD A;  1ES3 A;  1KE4 A;  1QME A;  2ZM2 A;  3UMD A;  3VV4 A;  1MWU A;  2WZZ A;  4EET B;  5GLD A;  3BFE A;  2Q9M A;  3M6H A;  4BMW A;  3GMW A;  5CHJ A;  4O7D A;  4KZ4 A;  5HAQ A;  4OON A;  5HDS A;  5FDS A;  3ZG7 B;  3UE6 A;  5FEF A;  3D9Y A;  3ITA A;  4S2P A;  4LRX C;  1S1Y A;  1LHY A;  5FI2 A;  3ZYT A;  4NXE A;  1RCJ A;  3OPR A;  1YLZ A;  2K31 A;  3UN7 A;  3KYZ A;  2O9C A;  2ZLY A;  5G4Y A;  2ZC3 B;  3MSH A;  4OOM A;  3OBF A;  1XKZ A;  4FUW A;  3B33 A;  5CGX A;  4RA7 A;  1SKO B;  4MLL A;  1GSX A;  3N8R A;  1NZU A;  3DTM A;  1LSX A;  1OTB A;  1K55 A;  2XA7 M;  1NYY A;  3MS6 A;  4DJ2 A;  2HJ9 C;  3GR2 A;  2D01 A;  1W63 M;  3VOZ A;  2JKT M;  4E04 A;  4HES A;  2XDM A;  3U2A A;  1IEM A;  1WA9 A;  3CMZ A;  3ZG5 A;  2JKG A;  1RGY A;  1K25 A;  2IA2 A;  5J7E A;  3GSG A;  1XFN A;  1XGI A;  1WE4 A;  4KZB A;  3QP6 A;  3K3C A;  4Q0I A;  1FR6 A;  3UPO A;  3BY8 A;  1V9Y A;  1S1Z A;  5HPF A;  1JWP A;  1NWZ A;  1GHI A;  4QWO A;  1ZTU A;  5EEC A;  3UB9 A;  4MBH A;  5CEB A;  3IQA A;  2GJ3 A;  1YT4 A;  1K0K A;  2O9A A;  3JVU A;  3A0V A;  4KG2 A;  1PZO A;  1VM1 A;  3MXS A;  3E4P A;  2V8C A;  4FH4 A;  3SS4 A;  4P85 A;  3ZVW A;  3I7J A;  3S7Q A;  2H0T A;  2J9P A;  1NZO A;  3S7N A;  2M1C A;  3UE3 A;  2CC1 A;  4GS9 A;  1XFQ A;  4L9E A;  3BQ8 A;  3HUN A;  4GHI B;  4BWI A;  4X25 A;  5EVE A;  4PM8 A;  4BQM A;  2KOI A;  4I3A A;  1L0E A;  3MQO A;  3UPP A;  3T1Q B;  1VQQ A;  2Y2H A;  4GJ4 A;  4BJP A;  5MC7 A;  2XD1 A;  2M7V A;  1N4O A;  2ZL1 B;  4GOG A;  2ZQ9 A;  1SHV A;  2EFU A;  2W3F A;  2B95 A;  2W0N A;  2JKR M;  3BFF A;  4IUH A;  4OVD A;  3LR5 A;  2EX8 A;  3CJM A;  3CZD A;  5AVE A;  4KEN B;  1OT6 A;  2LB9 A;  4BBT A;  3B47 A;  4ZJ3 A;  4NK3 A;  2PYR A;  1S0W A;  1ES5 A;  2DNS A;  4G3K A;  4KZ5 A;  3W4P A;  4DKI A;  5EVI C;  3WRT A;  3CI6 A;  4OH0 A;  4EQI A;  1ES4 A;  2H5S A;  4HH2 A;  3FKW A;  3O3V A;  4FH2 A;  4OQI A;  1FIK A;  2J9O A;  3IHB A;  4UQI S;  1S4R A;  1ONG A;  3LIC A;  2JKT I;  3CUE C;  2QZ6 A;  3T50 A;  1XA7 A;  4M4X A;  3EGD C;  2EXB A;  3NCK A;  1OJG A;  5GHY A;  2L1M A;  3BJN A;  3VFH A;  1BT5 A;  3JVV A;  3HLC A;  3FV7 A;  1PRQ A;  3NUL A;  5A92 A;  2P7J A;  4DDS A;  2VGJ A;  4R23 A;  1OPX A;  1YKD A;  2NUT C;  4M3K A;  4S2N C;  1J3W A;  2H10 A;  1BTL A;  3NOT C;  4EW7 A;  2V1Z A;  3GTC A;  4D2O A;  3JPU A;  2H28 A;  5HWW A;  3EEA A;  4PKY A;  4NG2 A;  1KVL A;  1T18 A;  4ESP A;  5GLC A;  2DCF A;  3F1O B;  1TVF A;  2Q9N A;  5EVI A;  3PYP A;  3T4L A;  2G2W A;  1XJ4 A;  3BFC A;  1UWP X;  5HPI A;  2O0Y A;  2EXA A;  3ZG9 B;  2ZQC A;  1IFQ A;  2WKE A;  4DF6 A;  3LGO A;  4S2M A;  4BL2 A;  4IVI A;  3OPH A;  1K6R A;  3OOV A;  2QJ5 A;  3MJQ A;  2IWB A;  3CUE A;  1VET B;  4E6W A;  2WGW B;  2Y2P A;  4I3J A;  1VEU B;  2Z2L B;  1EW0 A;  1YSQ A;  2G7U A;  4I38 A;  4N9L A;  4U3T A;  4PAU A;  1X0O A;  3HUM A;  1VB6 A;  1OTE A;  3HBR A;  1E3U D;  4E3M A;  5L2F A;  4IBX A;  1ESU A;  4JF6 A;  2WAF A;  4NXG A;  5FAQ A;  5IU1 A;  5HWT A;  1GCE A;  5TGF A;  4KZ3 A;  2XRN A;  4S2K A;  4DXB A;  4QB8 A;  4R3A A;  3CG5 A;  2XEP A;  4DRT A;  1OTD A;  5J4E A;  2RL3 A;  4B4X A;  2Y2O A;  4RQ9 A;  3H82 A;  3ZVT A;  1XX2 A;  4S2N A;  1LI9 A;  1KOU A;  3UNW A;  3EOI A;  3C4O A;  5FQ9 A;  2INW A;  4AFI A;  1N9L A;  5DTK A;  3LYX A;  3AGF A;  4ZBE A;  1H8Z A;  2W27 A;  2W1R A;  2HP5 A;  3IX8 A;  4E6X A;  3TOI A;  3S4X A;  4BBU A;  2Y2K A;  1M6K A;  1KE0 A;  4ME4 A;  3UE0 A;  2J7V A;  4ZRR A;  1ZG4 A;  3SW1 A;  3T4T A;  4DXC A;  3OCL A;  3RFB A;  5E43 A;  3NIA A;  1XJ2 A;  2X71 A;  4GDB A;  4Q0H A;  1LL5 A;  5TJJ A;  3S7O A;  4WN5 A;  2YKF A;  4JXG A;  4P87 A;  1NY0 A;  3IWQ A;  4GKU A;  4OQ0 A;  2VJW A;  1RP5 A;  5HDC A;  4GCZ A;  4PM5 A;  1SCW A;  4UEY A;  1N9O A;  1XJ3 A;  1PFL A;  3E98 A;  1G6O A;  2V0W A;  4MN6 A;  2ZOH A;  2Z6C A;  3IH8 A;  4JLF A;  2EWW A;  3IWI A;  5L07 A;  3VP0 A;  1S67 L;  1FR1 A;  4R1G A;  3VE3 A;  4HOI A;  1MC0 A;  2OLV A;  3O87 A;  4EUV A;  5HFO A;  1E25 A;  1LT0 A;  5HWV A;  1FIL A;  1JTD A;  5CTN A;  4OOY A;  5A8B A;  1YPR A;  1XPB A;  1SKF A;  5DKL A;  1BLH A;  3CLO A;  2OV5 A;  1F98 A;  3K3D A;  2XSS A;  3IXH A;  2PU2 A;  4JPM A;  5JYP A;  1HLU P;  4DMZ A;  4PM9 A;  2ZL1 A;  5F1F A;  5CEC A;  3NDG A;  1CJF A;  4RX2 A;  5CTM A;  5TFQ A;  4MCW A;  2VGL S;  4DN0 A;  1DP9 A;  2V1A A;  2MJ6 A;  5M18 A;  1J9M A;  4R4S A;  5FQM A;  3ULF A;  1DJB A;  1P97 A;  3KYQ A;  2V9A A;  4PHT A;  4IED A;  4PM7 A;  3V3S A;  4XUZ A;  5CGW A;  5IHV A;  3NOP C;  3VOL A;  1BLC A;  5E2H A;  1PZP A;  3JYI A;  5FSR A;  4GB7 A;  2XFT A;  2ZM8 A;  2JN7 A;  4P6Z S;  2BLS A;  3P01 A;  3PBT A;  3ZFZ A;  2WYX A;  3IHA A;  1Z09 A;  4O01 A;  2NUP C;  4BL3 A;  2J8Y A;  2X02 A;  1G28 A;  3G2Z A;  2OSU A;  1LSW A;  3FYZ A;  1GHP A;  4Y17 A;  4OLD A;  2V0U A;  1I2S A;  3GRJ A;  3BLS A;  2PR6 A;  3DBA A;  4Y0O A;  3NC8 A;  2Y2G A;  3R7W B;  2R9X A;  3BEC A;  3PAE A;  2Q0O A;  4WEK A;  1W79 A;  2QMI A;  4JGQ A;  2A2L A;  4Y15 A;  3OZH A;  1PW8 A;  3Q82 A;  4NXB A;  2PR5 A;  1F2K A;  2ZBB A;  1TDG A;  2EWV A;  4MMN A;  5DJT A;  4OP8 A;  3VP1 A;  4LV3 A;  1K4E A;  1IEL A;  4KG6 A;  2Z2M B;  3NJA A;  1PYY A;  4WZ4 A;  4YIN A;  1BUL A;  4MN7 A;  4WL9 A;  1WYB A;  1IOU A;  1ACF A;  1IYO A;  3A3F A;  5GL9 A;  3HLE A;  3ITB A;  4HBU A;  5GHX A;  3G35 A;  3O5Y A;  2ZOI A;  2WKH A;  2XRO A;  3H82 B;  2ZJ9 A;  3Q81 A;  2HP6 A;  1LSV A;  3D3O A;  5I94 A;  5DFX A;  2JHE A;  3F1O A;  4KQO A;  1I2W A;  4NEE D;  3IBJ A;  1CF0 A;  3IXG A;  2ZMV A;  5F6A A;  5IS1 A;  3VP3 A;  4GN2 A;  4Y7P A;  4LFU A;  3IX3 A;  2ZC4 B;  3QNC A;  5I5L A;  3QP8 A;  2HDS A;  1IYQ A;  1UGU A;  3LO7 A;  2Y2L A;  4BBV A;  1LI0 A;  1AWI A;  2VKS A;  3LY3 A;  4R3J A;  4X1M A;  4EEP A;  2GX5 A;  2P04 A;  2PD8 A;  3IXB A;  1XGJ A;  5GHZ A;  1VET A;  1JVJ A;  2PBY A;  2WGW A;  1MZU A;  2Y55 A;  1VEU A;  5FQJ A;  3WRZ A;  1YLP A;  2GZA A;  3AGD A;  5HX9 A;  4X1L A;  1YLW A;  2M7U A;  2Y2M A;  4EEU A;  4OOL A;  4DE2 A;  1BSG A;  5HDD A;  1FSY A;  3RH8 B;  5AJG A;  3IH9 A;  3SH7 A;  3WWX A;  1F9I A;  4KZ9 A;  3LFV A;  3P7N A;  2EX9 A;  1P9W A;  2BG1 A;  5BOH A;  1XXM A;  4KQR A;  4HY8 A;  4FCF A;  1ES2 A;  1YMX A;  2XF3 A;  4LRY C;  4G3W A;  1G6A A;  2P08 A;  1FQG A;  4YFM A;  5EVL A;  5KMW A;  2QHK A;  4KUK A;  3SOI A;  2HZ5 A;  2IWD A;  2W3G A;  3TSG A;  1TEM A;  4WYY A;  3GDI A;  2OAP 1;  2VEA A;  2VA0 A;  1V9Z A;  2QYB A;  3M2J A;  3PBQ A;  3L7H A;  4XT2 A;  3DTI A;  5FQQ A;  3HLW A;  3U4L P;  3PTE A;  2J80 A;  3FG8 A;  4OPR A;  3NEC A;  1PI5 A;  3MF0 A;  1BYW A;  5DVA A;  1GSV A;  2D02 A;  2WAE A;  1PW1 A;  2E8J A;  5DJU A;  1PI4 A;  4MEZ A;  2WKR A;  3PAG A;  4S2L A;  1CI9 A;  2XGN A;  2VV8 A;  1DP8 A;  4QD4 A;  5L09 A;  4IVK A;  1VHM A;  4OPY A;  1W63 Q;  4LV0 A;  4NXF A;  3CPT B;  5FAP A;  2W3D A;  1G5U A;  5KIZ A;  3SH9 A;  4BD1 A;  1I5Q A;  3C4P A;  3BFD A;  1S66 L;  2VGK A;  3N8L A;  1PWC A;  3L9K A;  2VV7 A;  2QKP A;  4I39 A;  2ZC5 B;  3E4O A;  1MWT A;  5M19 A;  4LV2 A;  4FOF A;  2XLN A;  1YAX A;  1T1C A;  1L3L A;  4HBT A;  1ZKJ A;  2WZX A;  5A91 A;  1O7E A;  4UHU A;  3VMA A;  4C75 A;  2QPN A;  3LIA A;  3E4Q A;  3LCE A;  3TG9 A;  3QNB A;  1L0D A;  3ZDJ A;  4QJG A;  4KQQ A;  3MZF A;  4S2O A;  2JC7 A;  3O88 A;  1MY8 A;  3N7W A;  3HL9 A;  3ZNY A;  1W8Q A;  4ETX A;  4EWF A;  2WKQ A;  4HJ4 A;  2A3U A;  2A24 B;  3G31 A;  3NY4 A;  2V8F A;  1TS0 A;  5G4Z A;  5HD3 A;  4GZB A;  3RXW A;  4ZTK A;  1FCO A;  3VP4 A;  3MQQ A;  5AQ9 A;  2J3T D;  3EWK A;  2GDN A;  1C3B A;  5FI7 A;  1MBL A;  5J3W A;  2HDR A;  4O0P A;  1BLS A;  3Q07 A;  3PBO A;  1KDS A;  3V50 A;  4KZ6 A;  5EPH A;  3W2Z A;  3KSH A;  4II7 A;  1IYS A;  2ZQ8 A;  3MFD A;  2FZ0 A;  3R7W A;  5CED A;  1DY6 A;  1K4F A;  4F3L B;  2I72 A;  3A3D A;  3IX4 A;  4K08 A;  1CEG A;  1MPL A;  3W4O A;  1KGF A;  4HH3 A;  2JKR I;  5F68 A;  2Y59 A;  3MZE A;  3T4O A;  4WF0 A;  4HIA A;  4LV1 A;  1ODV A;  3IF6 B;  4E3N A;  4A5R A;  1NRF A;  1OME A;  3HUO A;  2XD5 A;  1JWZ A;  4Q8I A;  1CQA A;  3WS2 A;  3KO6 A;  2X01 A;  2JKF A;  2Y2J A;  4DDY A;  5DKK A;  2ZQA A;  2PBD P;  4RYE A;  1HTZ A;  3OCN A;  4WM9 A;  1CEF A;  5EE8 A;  4R4R A;  3H7W B;  3IS2 A;  5L10 A;  4IJG A;  4L0L A;  4Y5F A;  5TBM B;  2HP9 A;  4GLQ A;  1PWG A;  2EA9 A;  4X55 A;  3UPN A;  3C2W A;  3A0R A;  2BAS A;  5GLA A;  2OWJ A;  2V2F F;  4OLG A;  1XA1 A;  4ZJ2 A;  5A90 A;  2Y2Q A;  4O8G A;  4CPK A;  2YKH A;  4P6Z M;  4XT2 B;  4EBP A;  3S1Y A;  1ZHH B;  2W1T B;  4GDN A;  3LUQ A;  3DWZ A;  5FI6 A;  3G32 A;  5HD5 A;  3T1R A;  1K54 A;  3ZQ5 A;  1W7F A;  3MBZ A;  4BD0 A;  2W3H A;  1NXY A;  4B88 A;  3FWL A;  4E3O A;  2VK3 A;  5E2G A;  1GA0 A;  3PR6 A;  4JKT A;  3MQ0 A;  1T1A A;  5HAP A;  3LEZ A;  2KX6 A;  3UB7 A;  4ARZ B;  4OQG A;  1SDN A;  1JTG A;  1YM1 A;  4HI4 A;  3SZT A;  4F94 A;  3AGE A;  3CHW P;  3FPW A;  4FSF A;  3C7U A;  3KSI A;  3LY4 A;  1HZO A;  4S2J A;  4X6T A;  4H6J B;  1OTI A;  3UB8 A;  2FFY A;  2FFF B;  4GD6 A;  1F5M A;  3DAV A;  1HVB A;  1GSW A;  4CLC E;  3PBS A;  2DRW A;  3OLO A;  5J8X A;  1FOF A;  3UE1 A;  3TE8 A;  4N9K A;  1BZA A;  2PAV P;  4QPR A;  1WYC A;  5HL1 A;  3LR4 A;  3T1S A;  1ZC2 A;  1ERM A;  4MBK A;  3GV9 A;  1E4D A;  1ONH A;  3ZG0 A;  5EM1 A;  3SS3 A;  5JYO A;  3DWK A;  2B5R A;  4EBL A;  3QP4 A;  3V3R A;  4X53 A;  2PHY A;  5AVF A;  3UO9 A;  2JE5 A;  3Q7V B;  4RX3 A;  4NKP A;  5KZH A;  3E2K A;  4WEL A;  3MKE A;  1TS8 A;  2ZMF A;  2HGV A;  4X68 A;  3CPT A;  4KG5 A;  3LID A;  2HV1 A;  1OJ5 A;  3UDF A;  1S6R A;  1Q2Q A;  3M6B A;  3KYE A;  1T19 A;  4E3K A;  3LEQ A;  2PYP A;  4D60 A;  4YOF A;  4R6L A;  1YLT A;  2WGV A;  5EV0 A;  3LI9 A;  3Q7Z A;  5G18 A;  4EXO A;  1YQS A;  3NBL A;  5E2F A;  2L4R A;  1CK3 A;  1STZ A;  4DJ3 A;  2JCH A;  4JGO A;  3UME A;  2PU4 A;  4I3I A;  4YNR A;  1N9B A;  3W8K A;  2L0W A;  3IF6 C;  5FDH A;  2R78 A;  3O86 A;  3T4Q A;  3T4J A;  4CQH A;  1Y4O A;  2HDU A;  3HLB A;  3RXX A;  2CMN A;  1E3U A;  3DW0 A;  2HDQ A;  1EWZ A;  3D4F A;  4EV4 A;  3B42 A;  2ZD8 A;  3G2Y A;  3T4S A;  4EES A;  1H0M A;  1L2S A;  3BYD A;  4U0X A;  2XH9 A;  3MKF A;  3OPP A;  5DF7 A;  3LR3 A;  5FEG A;  1XJ6 A;  2A24 A;  3BEB A;  3C8C A;  1S4S A;  1DRM A;  3WS5 A;  1D7E A;  3NOU C;  4K0W A;  1L0F A;  3IS2 B;  2ZC6 B;  5AQA A;  2O99 A;  4N92 A;  4DE1 A;  3Q1F A;  2J3W A;  3GQZ A;  5FAT A;  3S7P A;  4H8R A;  1H5X A;  1JWV A;  4L9F A;  1PNE A;  3HLD A;  2VLG A;  2P74 A;  4GNU A;  2Y8H A;  1BUE A;  1K57 C;  4BLM A;  3OPL A;  2OLU A;  4MNR A;  4OP5 A;  1DJC A;  1K56 D;  4HHD A;  5E2E A;  4Y2F A;  5DTT A;  5EVI D;  1XP4 A;  4UQI M;  3UDI A;  3H9W A;  4EUZ A;  1ALQ A;  5F5Y A;  5C5K A;  3WS0 A;  4F3L A;  3IXD A;  4MBF A;  1HD8 A;  4HP4 A;  2WGI A;  4WUJ A;  5A93 A;  4KZA A;  3HLG A;  1A0K A;  2LB5 A;  3QP5 A;  5HAI A;  4R70 A;  5EUA A;  3IF6 A;  3BWL A;  3BQA A;  4C6Y A;  4GW9 A;  4HNB A;  5FAS A;  1T1B A;  4WLA A;  3F1P B;  3N6I A;  3F1N B;  2UV0 E;  4OPQ A;  4P0M A;  1Y54 A;  1H8M A;  3RTY A;  5CXW A;  1KE3 A;  1M40 A;  3HJI A;  2VV6 A;  3E2L A;  5FL3 A;  4LPZ A;  3IT9 A;  1PIO A;  5DTS A;  1QMF A;  3MXR A;  1BLP A;  4WMC D;  3TRC A;  1D1J A;  3H7W A;  3ICY A;  3UB6 A;  4CLC B;  3V39 A;  1SDE A;  4HJ3 A;  5TBM A;  3CAX A;  4KUO A;  4MDZ A;  3NI9 A;  4Z9Q A;  3FZC A;  3IF5 A;  3WS4 A;  5D3O A;  2BTF P;  3LI8 A;  4JGP A;  3KSF A;  1FCN A;  2P9V A;  2XFS A;  4PMA A;  4WEJ A;  4X69 A;  2ZM0 A;  1P9R A;  4JBF A;  1IKI A;  4UA7 A;  1TDL A;  2W1T A;  3T4K A;  2OOL A;  2KLI A;  3T12 B;  5F1G A;  3EQV A;  1K57 A;  2WKP A;  4OKP A;  4EER A;  3W4Q A;  3R4K A;  5AQ7 A;  1YSP A;  4UA9 A;  1DJA A;  4B9O A;  4LLO B;  3GEC A;  2ZQ7 A;  4HP9 A;  1G68 A;  1ZG6 A;  2PD7 A;  2XA7 S;  1YLJ A;  4PKY G;  1ESI A;  2KDK A;  3IBR A;  4Y13 A;  3HCY A;  4LCL A;  4LRZ E;  3SH8 A;  5CER A;  3EQU A;  4ARZ A;  3HVF A;  2EFX A;  4Q0J A;  3ZCZ A;  4ETZ A;  4ZAM A;  5GLB A;  1KGG A;  1SZV A;  4EU0 A;  1KGE A;  3ISG A;  1RGZ A;  2VX8 A;  2XR0 A;  2A49 A;  4DE3 A;  2C6W B;  4ZDX A;  3C7V A;  3MR0 A;  5HAR A;  3BLM A;  1KDW A;  2RCX A;  2PRF A;  1IYP A;  2C5W B;  3QHY A;  2QWS A;  3RJU A;  3BM6 A;  4H6J A;  4QY6 A;  4CLC D;  2ACG A;  1ERQ A;  4JF4 A;  5L8M A;  3ZG8 B;  1LL9 A;  3VSL A;  4FTX A;  5LBR A;  3VOY A;  4OPZ A;  4WZ5 C;  1OTA A;  3BFG A;  1IKG A;  1P0Z A;  1TS6 A;  5FA7 A;  4X56 A;  4QHC A;  2Y2N A;  1YLY A;  3ZGA B;  3A3I A;  3ZHH A;  4QY5 A;  5CGS A;  3B3X A;  3FKV A;  4ID4 A;  3V67 A;  4E3J A;  2I9V A;  3TJZ C;  5CHU A;  1UWN X;  4P6B A;  2K7S A;  3Q7V A;  2Y2I A;  5CRF A;  4QU3 A;  4HJ6 A;  3T1X A;  4CJN A;  4LEN A;  3SS5 A;  1LLB A;  3G4P A;  5FQI A;  3DTE A;  4S2I A;  3C30 A;  1TF1 A;  4R0Q A;  5KSH A;  2Y4A A;  1O07 A;  4K91 A;  4KZ8 A;  5DF8 A;  1K54 C;  4ZJ1 A;  1PWD A;  1K56 A;  2ZQD A;  3UB5 P;  3CIT A;  2OAQ 1;  2HJE A;  3IWO A;  3MXQ A;  3A3J A;  1DP6 A;  5HSQ A;  3EEH A;  3G30 A;  5EOO A;  2Z6D A;  5CHM A;  1EI5 A;  3MMH A;  4UA6 A;  2ZMA A;  2FH5 A;  5TR7 A;  3LIE A;  2W3E A;  4IHQ A;  4KZ7 A;  3P09 A;  3D72 A;  3E0Y A;  1TD5 A;  5AQB A;  1D06 A;  1TS7 A;  3LIF A;  3ZNT A;  4JF5 A;  1OT9 A;  4WZ5 A;  4R3B A;  5KSC A;  4R38 A;  4CLC C;  4XUX A;  1MWS A;  2VGL M;  4WMC A;  4E3I A;  4U0T A;  4GS9 B;  1SKO A;  2O9B A;  2VZW A;  4JXW A;  1N9N A;  3CWF A;  4G3V A;  4GD8 A;  1FSW A;  3VFF A;  5EOE A;  2Y79 A;  1L0G A;  2XK1 A;  3A3E A;  4LCM A;  2P9V B;  1LL8 A;  5FAO A;  3FPV A;  2R9W A;  2JBF A;  2EX6 A;  4N1H A;  1H8Y A;  4B4Z A;  3KX0 X;  4PPR A;  1Q2P A;  3G6O A;  3UDX A;  1JNU A;  2AVX A;  4BEN A;  1ERO A;  2J3T C;  3PBN A;  4B93 A;  1MXO A;  5HW3 A;  1NYM A;  2EX2 A;  5DF9 A;  5F82 A;  4Y0T A;  4XXR A;  4NET A;  1H3Q A;  4K0X A;  3PBR A;  4LGW A;  2V20 A;  2G2U A;  5F69 A;  1MKM A;  4YWZ A;  1Y28 A;  1Z6F A;  2B18 A;  3MFX A;  3F1P A;  2QJ7 A;  2PDR A;  3NHQ A;  3F1N A;  1YMS A;  1K6S A;  1NLY A;  2WAD A;  3G34 A;  1GHM A;  1W8Y A;  2HPB A;  2Y91 A;  5CX7 A;  3VE4 A;  3BW6 A;  3PHY A;  3BRM A;  5F83 A;  3OC2 A;  3N4I A;  3A0S A;  4HEF A;  4PM6 A;  3FC7 A;  3HRE A;  2WUQ A;  4CLC A;  2H0Y A;  3LIB A;  5DFY A;  3V5M A;  5HZH A;  2WKI A;  1W5D A;  1AXB A;  4GHI A;  4JXV A;  3LR0 A;  5EM0 A;  3M2K A;  4DE0 A;  2HF6 A;  3S22 A;  3VSK A;  1K38 A;  2WK0 A;  5FQK A;  5IT5 A;  4OQH A;  4L9G A;  2E8I A;  3HJK A; 
#chains in the Genus database with same CATH homology
 2VK3 A;  3CPT A;  4FUW A;  4X25 A;  5EVE A;  3T1X A;  1SKO B;  3L9K A;  3KYE A;  1YPR A;  1PRQ A;  3NUL A;  3T1Q B;  3LEQ A;  4D60 A;  5EV0 A;  3MS6 A;  2ZL1 B;  1HLU P;  3UB5 P;  1A0K A;  1SZV A;  2B95 A;  2ZL1 A;  1ACF A;  1J3W A;  1CJF A;  3CHW P;  1CQA A;  2JKG A;  2JKF A;  1Y4O A;  2PBD P;  2PRF A;  2HZ5 A;  4ESP A;  3DAV A;  2ACG A;  2V8F A;  3L7H A;  1D1J A;  2PAV P;  5FEG A;  4FTX A;  3U4L P;  4QWO A;  1CF0 A;  3NEC A;  3T1S A;  1Z09 A;  1K0K A;  3LGO A;  1PFL A;  1FIK A;  2E8J A;  5FDS A;  5EM1 A;  5FEF A;  2BTF P;  3D9Y A;  2V8C A;  1VET B;  1AWI A;  4X1M A;  5EM0 A;  1VEU B;  1SKO A;  1VET A;  3T1R A;  1PNE A;  3T12 B;  1VEU A;  3CPT B;  1G5U A;  4X1L A;  1F2K A;  3MSH A;  1FIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...