1XGJA

Ampc beta-lactamase in complex with 3-(4-carboxy-2-hydroxy-phenylsulfamoyl)-thiophene-2-carboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-based optimization of a non-beta-lactam lead results in inhibitors that do not up-regulate beta-lactamase expression in cell culture.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 112
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xgjA00
3IF6B 2WK0A 1KGFA 4S2LA 3MZFA 4MBKA 5EOOA 2JE5A 3FKWA 2EFXA 3VOZA 3Q81A 4E3MA 1KGGA 3PBNA 3UY6A 4JXVA 4QB8A 1KDWA 2QMIA 3UDIA 2UWXA 2WGWB 4E6WA 2Z2MB 3OPHA 4ID4A 2J9PA 4OQGA 3OPPA 1E3UD 3IXBA 4A5RA 4Q8IA 5CGWA 4LCLA 3QNCA 2XGNA 4DXBA 1XA1A 1SCWA 3W8KA 1YLJA 5EVIB 4UA9A 3CJMA 2P74A 1K54C 3A3DA 4WM9A 4O7DA 4GN2A 1YLPA 4LV0A 5FI2A 3IXGA 3LY4A 2RCXA 4N1HA 5CGSA 4KZ7A 3G31A 3Q1FA 2V1ZA 4E3OA 1MPLA 3ZG7B 1TVFA 4XUZA 3G35A 3M6HA 2EX6A 3Q7VA 1S6RA 1YLZA 2P9VB 3IF6A 3AGDA 1QMEA 4KENB 3SS4A 4QD4A 3G2YA 4BLMA 3N8LA 1YMXA 3P98A 4N92A 3MKFA 1XGIA 3SH8A 2WGVA 4WEJA 1JWVA 4OLDA 3IQAA 2H0YA 3OZHA 5EUAA 1K4EA 5EVIA 4X55A 1BLSA 4JXSA 4BJPA 3SS5A 3NIAA 1G68A 5KSCA 3A3IA 3MKEA 1ZC2A 4BL3A 1M6KA 4BD0A 4OP5A 4K0XA 4RX2A 1XX2A 1K6SA 4OPYA 2FFFB 2Y2GA 1HZOA 5EVLA 2ZC3B 1MKIA 3N8SA 4MBFA 4UA7A 1NXYA 2JC7A 4HEFA 4N9KA 4KQRA 4RA7A 1XA7A 3PBQA 4JF5A 5CRFA 5CERA 3P09A 3WRZA 4S2PA 2CC1A 1RP5A 2P9VA 4WMCA 5HL1A 3Q82A 4KZAA 3EQVA 2ZC7A 4Y7PA 5F1GA 1HD8A 2EX9A 3GV9A 4IBXA 3WRTA 4GZBA 4LENA 3WS0A 2Y55A 1W5DA 3MZDA 1VQQA 3MXSA 4NK3A 4ZJ2A 1BT5A 1KDSA 3I7JA 2BG1A 2ZC4B 3VSKA 2XFSA 1EI5A 3CZDA 2OV5A 1S0WA 4DRTA 2WZZA 3AGEA 1L0EA 3HLWA 1LI0A 4H8RA 3FYZA 4P85A 3UO9A 3LY3A 3PAGA 1ZKJA 1FOFA 1JWPA 3CG5A 4OQ0A 5AQ7A 3V3RA 1Q2QA 2Y2HA 2JBFA 1K55A 2G2UA 3HUNA 3C5AA 5EE8A 2X02A 2J8YA 2HPBA 4Y0OA 3UPNA 3PBOA 1O7EA 5GLDA 3WS4A 5E43A 4JF6A 5FI7A 2ZC6B 4OPZA 1NYYA 3LEZA 3NBLA 4WBGA 4WZ5C 3E2LA 2EXBA 3VMAA 4QU3A 1ERMA 4GB7A 4E3KA 3C4PA 2HDQA 2EFUA 4OQHA 4X69A 3OC2A 4WELA 3HUOA 1AXBA 4OH0A 3NY4A 3DWZA 4MNRA 5HAPA 4PM6A 1IYPA 2ZQDA 3JYIA 2XF3A 2A49A 5AQAA 3ZNYA 1ONGA 2EXAA 4KG5A 1MXOA 5CGXA 3O86A 3AGFA 3W4OA 2Y2LA 1VM1A 4DF6A 3PBSA 5FA7A 3A3EA 1NJ4A 1JWZA 3Q7VB 1PIOA 3A3JA 1BSGA 5EOEA 3OCLA 4PM9A 1GCEA 1ERQA 1L0FA 4E3IA 1BLHA 2JCHA 5U47A 3RXWA 3HBRA 1I5QA 4PPRA 5F1FA 1U60A 2H10A 1IKGA 4IVKA 5HFOA 1YLWA 4R3JA 5FQJA 3UE1A 4EWFA 5E2HA 4DE3A 1IYSA 2V20A 1E3UA 1BLCA 1TEMA 3LO7A 3BLSA 3DWKA 4K91A 4OOMA 4XUXA 3GSGA 5IHVA 2ZQAA 4C6YA 5G18A 2Q9MA 1SDEA 1FQGA 1KVLA 1ZG4A 2WKIA 4JF4A 3VSLA 4ZDXA 2XR0A 2J9OA 1Q2PA 5CXWA 5A90A 2Y59A 4YFMA 1MWUA 5HARA 4WZ4A 3UN7A 1WE4A 2Y4AA 4OPQA 3S4XA 2V2FF 2XQZA 2IWCA 4KQOA 4XXRA 1ZG6A 4DE0A 1KE4A 1FR1A 1N4OA 3OCNA 4PM8A 3ZG9B 1MY8A 3ZFZA 3V39A 3QNBA 4QHCA 5DTSA 3GTCA 2X01A 2Y2KA 2ZQ7A 3G34A 3BYDA 3IWIA 2X71A 4JBFA 1YMSA 2GDNA 2ZQ8A 3UDXA 1PI5A 3TG9A 3VP1A 1BZAA 1MWTA 5AQBA 4S2KA 3BFFA 4GDNA 2OLUA 3VFFA 1NZOA 2XD5A 3ZG5A 3LCEA 2J7VA 3N7WA 1CI9A 4UHUA 1FCNA 2Y91A 5FATA 2HP9A 1NYMA 3VP0A 5A91A 3SS3A 4OP8A 2XK1A 4S2NC 4GDBA 4WYYA 5FAOA 3UDFA 2H0TA 4QY6A 2C6WB 1WYBA 1IEMA 3FKVA 2RL3A 2WUQA 4Y0TA 4HESA 5CHMA 4GD8A 1ES2A 1FR6A 2WKHA 1NY0A 4GOGA 1LL9A 1IKIA 4OQIA 2HP5A 4LCMA 4JXWA 5CTNA 1DJAA 3EQUA 1SKFA 5FASA 3HLBA 4WZ5A 1K56D 1NRFA 1W7FA 3PTEA 4B4XA 2PU2A 2ZD8A 1PWDA 2ZJ9A 1KVMA 1IELA 3WS2A 3O3VA 1L2SA 4KZ5A 1XP4A 3NC8A 3DTMA 3QHYA 5J8XA 5JYPA 1RCJA 1YLTA 2H5SA 5DVAA 3ZGAB 2WADA 3IF6C 2PBYA 5F82A 5CTMA 2EX2A 3ZDJA 1XKZA 3VP4A 4N1XA 5CEDA 1YLYA 5HX9A 1HVBA 5GLAA 4KZ6A 3TSGA 4RVAA 5E2GA 5FQKA 4E3NA 1IYOA 1LI9A 3RJUA 3BLMA 1FCMA 3Q07A 4HBUA 3G30A 4JKTA 1LLBA 4UAAA 2DRWA 3ZVTA 3M2KA 5EECA 5EVIC 1GHIA 4GKUA 4KZ3A 3ZG8B 1ES3A 5JYOA 3N6IA 1QMFA 2WAFA 4DDSA 4EBPA 1ESUA 2Y2OA 5EPHA 5HAIA 3ZCZA 2BLSA 4B88A 3MZEA 4Y0UA 3A3FA 1XPBA 3W4QA 3PBTA 2QZ6A 2ZMAA 2E8IA 1PW1A 4S2MA 3UE0A 3BECA 4FH2A 4EBNA 1K57C 4PM7A 1K54A 4ZTKA 2HDSA 4IBRA 1H5XA 3GVBA 4JXGA 3C7UA 2XFTA 1J9MA 3BRMA 4BL2A 4M3KA 2WZXA 4KZ4A 1XXMA 1KE3A 5D3OA 1BULA 3O87A 5CECA 5FQIA 1KGEA 2XH9A 1ES5A 1W8YA 2WYXA 3BFGA 4JPMA 2EX8A 1MBLA 1MWSA 3ISGA 3PAEA 5M18A 4KZ9A 5GLBA 2DNSA 3G2ZA 5CHUA 4OKPA 1I2SA 1SHVA 4WEKA 5HAQA 4U0XA 1K55C 1XGJA 3VP3A 5TR7A 4E3JA 4FD8A 1PWCA 1JTDA 1YQSA 1H8ZA 2PU4A 4P6BA 3M6BA 4EBLA 4DDYA 4QJGA 4DE2A 4QY5A 4E3LA 3IWQA 1GA9A 4S2NA 3BFEA 5FAQA 3HLEA 4S2JA 3VP2A 1TDGA 2R9XA 3OPRA 4X68A 2ZC5B 2B5RA 2IWDA 1K38A 5FQMA 4BD1A 5CHJA 4R23A 2ZLYA 2Y2MA 4JLFA 4MEZA 1BLPA 3SH9A 2WKEA 1PW8A 5AQ9A 4DE1A 3N4IA 5DF9A 3MBZA 3B3XA 4GD6A 4R0QA 3ITAA 4U3TA 1K4FA 5FQ9A 5E2FA 2ZM2A 3IHAA 4E6XA 2HDUA 3IWOA 1CK3A 1FSYA 5M1AA 3HLCA 2WGIA 4OOLA 1CI8A 3MXRA 4S2IA 4LV2A 5A92A 4D2OA 4K0WA 2R9WA 4OOYA 1GA0A 3IH9A 1KE0A 4LV3A 1GHMA 4R1GA 2G2WA 3IHBA 3S1YA 4IEDA 1BTLA 2WGWA 4BQMA 1G6AA 2Z2LB 4FSFA 1M40A 3DW0A 2WAEA 4EQIA 2XEPA 2ZQ9A 4B4ZA 5EVID 5KMWA 5KSHA 4UA6A 3G4PA 3V3SA 3OPLA 3GR2A 4IVIA 4S2OA 1PYYA 1H8YA 4MBHA 3HUMA 5FSRA 3GMWA 5GHYA 1K56A 1YT4A 3MFDA 5FDHA 2Q9NA 5I94A 5FQQA 4ZAMA 1LHYA 3BFCA 1CEGA 3NDGA 1PZPA 2VGKA 3G32A 4ZJ3A 2XD1A 3GRJA 1ONHA 4WMCD 5GLCA 4P0MA 3PBRA 3WWXA 1IYQA 4OLGA 1K57A 1DJCA 1PZOA 2Y2JA 2HDRA 4KG6A 4EV4A 2A3UA 5DF8A 4FH4A 4DXCA 5BOHA 3NDEA 4P87A 4OPRA 4C75A 4CPKA 3ZNTA 3FV7A 3C7VA 5A93A 3HLGA 1L0GA 3UPPA 2ZM8A 2ZQCA 4F94A 1C3BA 3TOIA 5TFQA 3N8RA 4X56A 2Y2PA 1PWGA 3D4FA 2FFYA 4EUZA 2Y2QA 5E2EA 5GHZA 2IWBA 3BEBA 2Y2NA 3FWLA 3GQZA 3ZHHA 4N9LA 1JVJA 3HREA 4KZBA 5F83A 5FI6A 2Y2IA 4RX3A 4KZ8A 4ZBEA 3IT9A 1JTGA 1L0DA 1RGZA 2I72A 1BUEA 2OLVA 3Q7ZA 1MWRA 4C3QA 4R3BA 4KG2A 1EROA 3IF5A 5DTKA 1LL5A 1W8QA 2QPNA 1TDLA 2OSUA 2XDMA 3UE3A 4Z9QA 4KQQA 1W79A 4RYEA 3NCKA 5M19A 5TGFA 3HVFA 4PM5A 1YM1A 3IXHA 1CEFA 3V50A 4DKIA 3UPOA 1FSWA 1NZUA 1Z6FA 1I2WA 3HL9A 4L0LA 3O88A 5DTTA 4NETA 1EWZA 2C5WB 3C4OA 5DF7A 1FCOA 5KZHA 3M2JA 3W4PA 1O07A 1K6RA 3RXXA 3UNWA 3IH8A 3VOYA 3HLDA 3ZVWA 5HW3A 4PMAA 1E4DA 3E2KA 4LV1A 3ITBA 3HLFA 3BM6A 4BENA 2XLNA 1ESIA 2ZM0A 5L2FA 2HP6A 3SH7A 3ZG0A 5FAPA 4X6TA 1Y54A 3CMZA 5CEBA 1DY6A 4OONA 4YINA 1E25A 5GHXA 4U0TA 3BFDA 3FZCA 1HTZA 4R4SA 1ES4A 3V5MA 3VFHA 3SOIA 2DCFA 3NI9A 4FCFA 4ZJ1A 4X53A 3WS1A 3WS5A 1DJBA 1PI4A 1GHPA 1SDNA 1OMEA 4HBTA 1WYCA 2VGJA 4R4RA 4CJNA 5GL9A 3IXDA 1RGYA 1K25A 4OVDA 1N9BA 1ALQA 3S22A 4GNUA 4MLLA
chains in the Genus database with same CATH superfamily
3IF6B 2WK0A 1ACFA 3MZFA 2JKGA 4S2LA 1S67L 2EFXA 3CUEC 3NOPC 2FH5A 2VV6A 3OPHA 4OQGA 3QNCA 3H9WA 1YLJA 2PDRA 3CJMA 2P74A 3ICYA 4BWIA 1UGUA 4I38A 3IXGA 2PHYA 3G31A 1MPLA 3KSIA 5EV0A 5F6AA 3M6HA 4I3AA 2EX6A 4KENB 4QD4A 3UE6A 1YMXA 4GS9A 4N92A 3SH8A 4WEJA 2H0YA 1PFLA 3OZHA 4G3KA 5EFWA 3NIAA 5J4EA 1AWIA 4BD0A 4BL3A 4K0XA 1K6SA 2Y2GA 5EVLA 2A24B 2OAQ1 2ZC3B 1MKIA 3N8SA 4XT2A 2CMNA 2JC7A 4GLQA 4RA7A 4KQDA 4F3LB 1H0MA 4CLCC 4KZAA 3EQVA 4DMZA 4IBXA 4GZBA 2Y55A 1P9RA 1VQQA 4EU0A 3MSHA 4ZJ2A 1BT5A 1LSWA 3VOLA 4H8RA 1LI0A 3FYZA 3PAGA 4QWOA 3CG5A 1FOFA 3B47A 2HPBA 2OWJA 4IUKA 5HPFA 3WS4A 5FI7A 3LEZA 3LIAA 3NBLA 3VMAA 1ERMA 4GB7A 2HDQA 2EFUA 2JKTI 4OH0A 3NY4A 1NRJA 2O9CA 2PYRA 4LFUA 1ONGA 4KG5A 1VM1A 2KX6A 1P97A 4DF6A 4DJ2A 1JWZA 2Z6CA 1PIOA 3A3JA 3MQOA 1ERQA 4E3IA 1BLHA 3RXWA 1CQAA 2H10A 2GX5A 5F69A 4IVKA 5FQJA 5J3WA 4DE3A 1MKMA 3MMHA 4HI4A 3LO7A 1BLCA 4K91A 2Q9MA 1FQGA 1KVLA 4AFIA 4JF4A 3VSLA 2XR0A 1Q2PA 3UN7A 2HV1A 4M4XA 4HH2A 4XXRA 1ZG6A 5DKKA 1N4OA 3OCNA 3ZG9B 4EXOA 3V39A 3GTCA 3UMDA 5DFXA 3BYDA 1EW0A 2GDNA 2GZAA 3UDXA 4GDNA 2OLUA 4KUOA 2PAVP 1J3WA 3N7WA 2GNXA 4UHUA 1FCNA 3FPVA 5FATA 3VP0A 3SS3A 4GDBA 2P7JA 3T4QA 3UDFA 2WKPA 1SZVA 3MF0A 1S4SA 4HESA 2WKHA 1NY0A 3OBFA 1LL9A 1IKIA 4LRZE 2HP5A 2JKRI 1S66L 4WZ5A 1K56D 3S7OA 2D01A 2ZD8A 5TJJA 2ZJ9A 1L2SA 2K31A 2VEAA 1F2KA 4IJGA 1HVBA 1DRMA 5TBMB 5E2GA 1LI9A 3DAVA 4JKTA 3G30A 4WUJA 1WA9A 3IX4A 1DP6A 3ZG8B 5JYOA 1T1AA 1GSXA 2WAFA 1OTAA 3CHWP 4EBPA 5HD3A 3KSHA 1XPBA 2QZ6A 1YAXA 2ZMAA 4PM7A 2HDSA 2XRNA 4B9OA 1H5XA 4JXGA 3BRMA 4M3KA 1XXMA 4HP9A 2XH9A 3LFVA 3LIEA 1LSVA 1W8YA 2WYXA 3PAEA 4KZ9A 3G2ZA 3IBRA 3IX8A 2HF6A 4II7A 4FD8A 1JTDA 4YOFA 4DDYA 2BTFP 4QJGA 2W3HA 3L9KA 5FAQA 1TDGA 4X68A 3T4JA 4CLCA 2IWDA 4ESPA 2P08A 2A2LA 4GHIB 4MEZA 3N4IA 1YPRA 3MBZA 4GD6A 1T18A 4YWZA 3ITAA 5FQ9A 3IHAA 3PR6A 5M1AA 3BJNA 4S2IA 4ME4A 4UQIS 1XJ4A 5A92A 4D2OA 4MDZA 3S1YA 1BTLA 1M40A 4B4ZA 4UA6A 4MBHA 5I94A 5FQQA 4ZAMA 3DTKA 2XD1A 1ONHA 2Q0OA 3KYZA 4KG6A 5DF8A 4G3WA 2ACGA 1MZUA 2ZQCA 2IA2A 5TFQA 3D4FA 1IOUA 2Y2QA 5GHZA 2IWBA 3FWLA 3GQZA 2BASA 2Y2IA 4RX3A 1S1ZA 4ZBEA 3IT9A 2A24A 2I72A 2OLVA 3Q7ZA 4R3BA 2OSUA 3UMEA 4KQQA 4ETZA 3KO6A 3JVVA 4RYEA 3VV4A 4PM5A 3CITA 3UB7A 3UPOA 3HL9A 4L0LA 3O88A 4NETA 3H7WA 2GJ3A 2V8FA 1K6RA 3VOYA 5HW3A 5HL6A 3ITBA 1YSQA 5L2FA 5CX7A 2HP6A 4P6ZS 1Y54A 1E25A 3QP1A 1F5MA 3F1PB 4UEYA 3VFHA 1P9WA 2K2NA 2DCFA 3EGDC 3WS1A 4FCFA 1DJBA 1F98A 4CJNA 5GL9A 1T1BA 2PYPA 3S22A 4GNUA 4WEKA 1KGFA 4MBKA 2JE5A 4WF0A 4E3MA 2QMIA 5FEGA 2WGWB 4E6WA 2J9PA 4A5RA 4EW7A 1SCWA 4JGRA 5EVIB 4UA9A 5HZHA 2VV7A 4GN2A 5A8BA 2KDKA 2RCXA 4HHDA 1XFNA 3EWKA 4R70A 4HJ6A 3BQ8A 3G35A 2MJ6A 2P9VB 1OJ5A 3EEHA 3SS4A 4BLMA 3G2YA 3N8LA 4JGQA 3A0SA 4EEPA 3F1OB 3LR3A 1JWVA 4OLDA 5DFYA 4JXSA 4BJPA 3SS5A 4GW9A 3A3IA 2KLIA 4OP5A 2V0UA 2FFFB 4UA7A 4HEFA 3WRZA 2CC1A 4WMCA 5L10A 1ZTUA 2VGLM 2ZC7A 4Y7PA 1SKOA 1HD8A 3GV9A 3MZDA 3PXPA 3I7JA 2ZC4B 3VSKA 2XFSA 1EI5A 2R78A 2W3GA 3CZDA 2OV5A 2WZZA 3HLWA 3UO9A 3LY3A 1JWPA 4OQ0A 5AQ7A 1Q2QA 2V0WA 2G2UA 5EE8A 2J8YA 4Y0OA 1O7EA 5E43A 4JF6A 4OPZA 1NYYA 4WZ5C 4MMNA 3D72A 2PRFA 1AXBA 3LI8A 4MNRA 3DWZA 4DJ3A 2ZQDA 2UV0E 2A49A 3ZNYA 1NLYA 5CGXA 3O86A 3AGFA 5DJUA 2Y2LA 2M7UA 4HQAA 3Q7VB 5EOEA 2ZMFA 3TJZC 3OCLA 4PM9A 3PYPA 1L0FA 4PKYG 2JCHA 2QWSA 3MS6A 1I5QA 3CLOA 5F1FA 4I3IA 1HLUP 2XA7M 4JGPA 5HFOA 4EWFA 1G28A 3NULA 5E2HA 3LUQA 1TEMA 3BLSA 3DTIA 2ZQAA 4ZDXA 2L4RA 5A90A 1MWUA 1P0ZA 2IWCA 2PD7A 1FR1A 4PM8A 2YKHA 4CLCD 2X01A 2PR6A 4K08A 3G34A 1BZAA 4S2KA 3BFFA 2W1RA 2ZBBA 3VFFA 1NZOA 4L9EA 3K2NA 1CI9A 1W63M 4JGOA 5HSQA 1N9NA 1N9OA 5MC7A 1OTEA 5FAOA 2H0TA 1WYBA 3HJIA 2RL3A 2WUQA 4Y0TA 5CHMA 1ES2A 3LICA 1ZHHB 4GHIA 2W3FA 5HWVA 3BY8A 1TS8A 5FASA 3HLBA 1NRFA 1W7FA 1STZA 3PTEA 1XFQA 2V1BA 3WS2A 1IELA 4KZ5A 2QJ5A 1LT0A 3DTMA 3QHYA 5J8XA 3ZGAB 3IF6C 3JPUA 3VP4A 1VHMA 5CEDA 4D60A 5HX9A 3UB6A 5GLAA 3TSGA 5L8MA 3RJUA 2W27A 2JN7A 4B93A 1UWNX 1QMFA 3R4KA 1ESUA 4ETXA 2Y2OA 4GJ4A 3IS2B 5HDSA 2XSSA 3A3FA 3C30A 3PBTA 1TD5A 1PRQA 3ZYTA 3QP5A 4S2MA 3UE0A 3FG8A 1LSXA 3BECA 3C8CA 3E98A 3ZQ5A 4ZTKA 1OTBA 1J9MA 5HDCA 2Y79A 4NXGA 2D02A 1BULA 3O87A 5CECA 1NLZA 2JKTM 4JPMA 1MBLA 2DNSA 5HAQA 1K55C 3VP3A 5TR7A 4X1LA 4HJ4A 4BBTA 1H8ZA 3VE4A 4DE2A 4E3LA 3MQ0A 4S2NA 3BFEA 3HLEA 2OOLA 3OPRA 4O0PA 4CLCE 2ZLYA 5L09A 2WKEA 4DE1A 1FIKA 4YNRA 1DP9A 3T1XA 3B3XA 4NXEA 4U3TA 1K4FA 5EVEA 4E6XA 1Z09A 2ZM2A 1LL8A 3IWOA 2WGIA 3H82B 4OOYA 1KE0A 4R1GA 4IEDA 2WGWA 4EQIA 3P01A 2ZQ9A 4HY8A 4S2OA 3HUMA 3LR0A 5FSRA 1LHYA 3UB9A 3IBJA 1PZPA 3NHQA 2INWA 3BW6A 4ZJ3A 3F1NB 4WMCD 5DKLA 3PBRA 3RTYA 4PAUA 2DMWA 1DJCA 2Y2JA 2HDRA 5HPIA 3UB8A 4PKYA 3F1OA 4P87A 4C75A 1XJ6A 3R7WB 3FV7A 1OPXA 3CAXA 2ZM8A 4F94A 4ARZB 4X56A 2NUPC 3GECA 3BEBA 2PD8A 5F5YA 3HREA 5FI6A 1RGZA 2J3TC 3IF5A 5DTKA 1TDLA 5F68A 3UE3A 3U2AA 1W79A 5M19A 5FL3A 3TRCA 1CEFA 4DKIA 1FSWA 2NUTC 4BMWA 3W4PA 5FDSA 1O07A 3UNWA 3HLDA 4PMAA 4HP4A 3E2KA 4LV1A 4BENA 1ESIA 3ZG0A 5FAPA 4LRYC 4HH3A 3EEAA 4GCZA 1DY6A 1G6OA 3BFDA 3FZCA 3SOIA 2ZOHA 3NI9A 4X53A 3W2ZA 1SDNA 1WYCA 1RGYA 1S1YA 3E4OA 3TE8A 4OVDA 1ALQA 3T1RA 5CGSA 4Y15A 4MLLA 3L7HA 3CWFA 4Z1WA 5EOOA 3FKWA 3UY6A 1V9ZA 3UDIA 2UWXA 4ID4A 5G4ZA 2M7VA 4Q8IA 3IXBA 4LCLA 2XGNA 3W8KA 1K54C 4WM9A 4O7DA 1YLPA 4N1HA 4KZ7A 3T4OA 3Q1FA 2V1ZA 3CPTA 4E3OA 3B42A 4FTXA 4XUZA 3Q7VA 3IF6A 3AGDA 1QMEA 2VZWA 3P98A 1XGIA 2WGVA 3UB5P 3IQAA 4X55A 3T12B 2ZOIA 5L07A 2EA9A 2PBDP 1Y28A 5FEFA 3MKEA 1PNEA 3NOUC 1ZC2A 4NKPA 3IX3A 2FZ0A 4OPYA 2VKSA 1HZOA 4BBUA 1NXYA 5CRFA 3PBQA 2J3WA 2PR5A 4JF5A 5CERA 3P09A 5HL1A 3Q82A 3FPWA 5DJTA 4WLAA 4LENA 3WS0A 2B18A 3NOTC 1W5DA 3MXQA 3MXSA 4NK3A 4O8GA 1KDSA 4NEED 4LPZA 1VETB 2VX8A 1L0EA 3SW1A 3LIBA 1ZKJA 1K55A 1BYWA 3A0VA 3KYQA 4F3LA 3UPNA 4BBVA 2ZC6B 3RH8B 3T4KA 4LRXC 1TS6A 4WBGA 4Y17A 2EXBA 4QU3A 3E4PA 2ZL1B 1TS0A 3C4PA 2W1TB 4OQHA 3HUOA 5K5BA 4PM6A 1IYPA 3JYIA 2W3EA 2EXAA 2VV8A 5FA7A 3A3EA 3CI6A 1BSGA 1GCEA 5AVEA 2KOIA 4UQIM 5U47A 1T19A 1D06A 3LR5A 3NJAA 1V9YA 4R3JA 3UE1A 1IYSA 2V20A 1E3UA 4OOMA 5IHVA 3GSGA 5G18A 3K3DA 2J9OA 5CXWA 2W3DA 2Y59A 5HARA 4WZ4A 2Y4AA 4OPQA 3S4XA 2O0YA 2V2FF 4KQOA 1A0KA 4MCWA 1MY8A 2P04A 2Y2KA 4JBFA 5IU1A 3TG9A 3VP1A 1MWTA 2VLGA 3BWLA 2ZMVA 3ZG5A 3LCEA 3T1SA 3DBAA 2Y91A 2Y8HA 1K0KA 4FUWA 3HJKA 4EETB 5A91A 4O01A 4OP8A 4S2NC 3C38A 3FKVA 1OTDA 1D1JA 1FR6A 4OQIA 3EQUA 4IHQA 2PU2A 1PWDA 1KVMA 1MC0A 1XJ2A 3FC7A 3O3VA 1XP4A 2L1MA 5JYPA 1RCJA 2WADA 5F82A 4P6ZM 2EX2A 4CQHA 1XKZA 1YLYA 4RVAA 4E3NA 2B95A 3BLMA 3Q07A 1LLBA 4UAAA 4I5SA 3ZVTA 5EVIC 4GKUA 4KZ3A 1ES3A 3N6IA 4DDSA 5EPHA 3LGOA 3ZCZA 2BLSA 3MZEA 4Y0UA 1FILA 3BY9A 1PW1A 4EBNA 4R38A 2L0WA 1K54A 2VJWA 4IBRA 5TBMA 3R7WA 4BL2A 4KZ4A 4ARZA 5D3OA 5FQIA 1KGEA 4CLCB 3BFGA 1IFQA 4EERA 3ISGA 5M18A 1DP8A 5GLBA 4HJ3A 1OT6A 5CHUA 1I2SA 1SHVA 3T4SA 4U0XA 1XGJA 2V8CA 1YQSA 2PU4A 4EBLA 1VEUB 4EQ1A 4QY5A 3JVUA 1KOUA 3VP2A 2R9XA 2B5RA 3D3OA 3EOIA 5FQMA 5CHJA 4L9FA 3KSGA 1PW8A 1TS7A 2JKFA 4R3AA 2PT7A 4DN0A 2QJ7A 1CK3A 1FSYA 4L9GA 4OOLA 3MXRA 3LIDA 1YKDA 1GA0A 3IH9A 4LV3A 1GHMA 2V1AA 4H6JB 5HDDA 4BQMA 4FSFA 3DW0A 2WAEA 2XEPA 1UWPX 5KMWA 5KSHA 4WL9A 3G4PA 3GR2A 1PYYA 2E8JA 2O9AA 4LGWA 2LB9A 3GMWA 1YT4A 3MFDA 2Q9NA 1CEGA 3G32A 3NECA 3GRJA 3WWXA 4P0MA 1K57A 2WKRA 1PZOA 2A3UA 4DXCA 5BOHA 5AVFA 1F9IA 3ULFA 4CPKA 3BQAA 3C7VA 4X1MA 3KX0X 1L0GA 1YSPA 3H7WB 3N8RA 4G3VA 2Y2PA 1PWGA 1N9LA 2M1CA 3ZHHA 4N9LA 1JVJA 5F83A 4KZ8A 3OOVA 1JTGA 4C3QA 3A0RA 1BUEA 1MWRA 1S4RA 3HCYA 4KG2A 1EROA 1W8QA 2QPNA 2XDMA 1GSWA 4Z9QA 3S7PA 3NCKA 4RQ9A 2XROA 1ODVA 1YM1A 3T1QB 5DTTA 1EWZA 2C5WB 4NG2A 5DF7A 1FCOA 5KZHA 3IH8A 2QHKA 2EWVA 1VETA 3BM6A 4X6TA 3LR4A 4U0TA 1HTZA 4R4SA 3V5MA 3RFBA 4ZJ1A 3WS5A 1PI4A 4Q0HA 1OMEA 4WN5A 4R4RA 1L3LA 1N9BA 3V67A 3VOZA 3Q81A 1KGGA 3PBNA 4JXVA 4QB8A 1KDWA 2ZL1A 2HJ9C 2Z2MB 2W1TA 3OPPA 1E3UD 5CGWA 2LB5A 4I3JA 4Y5FA 4DXBA 1XA1A 4E04A 3A3DA 1G5UA 4HNBA 4LV0A 5FI2A 3LY4A 3F1PA 3C2WA 3ZG7B 1TVFA 1S6RA 1YLZA 2O9BA 3K3CA 3T4TA 1SKOB 3MKFA 2I9VA 3TW8A 4Y13A 3GDIA 1K4EA 2OWHA 5EVIA 1BLSA 1G68A 5KSCA 1M6KA 2H28A 4RX2A 2J3TD 1XX2A 4MBFA 2J80A 4N9KA 4KQRA 1XA7A 2JHEA 2HZ5A 4S2PA 1RP5A 2P9VA 2JKRM 5F1GA 2EX9A 3WRTA 5IT5A 1JNUA 3QP2A 1W63Q 2B02A 2BG1A 3D9YA 1S0WA 4DRTA 3AGEA 4HIAA 4P85A 1OT9A 3V3RA 2Y2HA 1GSVA 2JBFA 3LI9A 1CJFA 3HUNA 3C5AA 2X02A 3PBOA 3E0YA 5GLDA 4EUVA 2QYBA 4MN7A 3CUEA 3KSFA 3E2LA 1OJGA 2G7UA 4E3KA 3EGXC 3LIFA 5HWTA 1CF0A 3T4LA 4X69A 3OC2A 4WELA 5HAPA 4HOIA 2XF3A 5AQAA 3P7NA 1MXOA 1T1CA 3W4OA 4FOFA 2WKQA 3PBSA 1NJ4A 1H3QA 3HBRA 4PPRA 4GS9B 1U60A 1IKGA 1NWZA 1YLWA 3S7QA 3S7NA 3DWKA 4XUXA 4C6YA 1SDEA 3PHYA 1ZG4A 2WKIA 3QP6A 2V9AA 2VA0A 4YFMA 1WE4A 2XQZA 4DE0A 4XT2B 1KE4A 3ZFZA 3QNBA 4QHCA 5DTSA 3U4LP 2ZQ7A 4Y3IA 3IWIA 2X71A 1YMSA 3VE3A 2ZQ8A 5HWWA 1PI5A 3OLOA 5AQBA 3QP8A 4Q0IA 2XD5A 2J7VA 1H8MA 1VEUA 2HP9A 1NYMA 2XK1A 4WYYA 4QY6A 2C6WB 1IEMA 4GD8A 4GOGA 4JXWA 5CTNA 2AVXA 1DJAA 1SKFA 4B4XA 3LEQA 2Z6DA 3E4QA 5AJGA 3NC8A 1YLTA 2H5SA 5DVAA 4MN6A 2PBYA 4NXFA 5CTMA 2OAP1 4ZRRA 3ZDJA 4N1XA 4H6JA 4KZ6A 5FQKA 1IYOA 1FCMA 4HBUA 2DRWA 3M2KA 5EECA 1GHIA 4X25A 3B33A 1D7EA 1OTIA 5HAIA 4B88A 4Q0JA 3W4QA 2E8IA 2VGLS 3MJQA 4FH2A 1K57C 3GVBA 3C7UA 2XFTA 5EM0A 2WZXA 1TF1A 1KE3A 1ES5A 5I5LA 2HJEA 5IS1A 2EX8A 1MWSA 3IS2A 4PHTA 5HD5A 2O99A 4LLOB 4OKPA 4EESA 1Y4OA 4E3JA 1PWCA 3DTEA 5EM1A 4P6BA 3M6BA 3IWQA 1GA9A 4S2JA 2ZC5B 1K38A 4BD1A 4R23A 2K7SA 2Y2MA 3O5YA 2HGVA 3MQQA 4JLFA 3SH9A 1BLPA 5AQ9A 5DF9A 4R0QA 3T50A 4NXBA 5E2FA 2HDUA 3HLCA 1CI8A 4LV2A 4K0WA 2R9WA 4EEUA 2XA7S 2G2WA 3IHBA 1G6AA 2Z2LB 5EVID 3V3SA 3OPLA 4IVIA 5KIZA 1H8YA 3LYXA 5GHYA 1K56A 5FDHA 3SZTA 2YKFA 3BFCA 2EWWA 3NDGA 5C5KA 2VGKA 2VK3A 5GLCA 3H82A 1IYQA 4OLGA 4EV4A 4Y2FA 4FH4A 3NDEA 5LBRA 4OPRA 3G6OA 3ZNTA 1VB6A 5A93A 3HLGA 3UPPA 1C3BA 3TOIA 1X0OA 2FFYA 4EUZA 5E2EA 2Y2NA 2QKPA 3MR0A 4KZBA 1L0DA 3KYEA 4MN5A 1LL5A 1XJ3A 3F1NA 5TGFA 3HVFA 3IXHA 3V50A 1NZUA 1Z6FA 1I2WA 5G4YA 4QPRA 4IUHA 3C4OA 5J7EA 3M2JA 4I39A 3RXXA 3ZVWA 1E4DA 3HLFA 2XLNA 2ZM0A 3SH7A 3CMZA 5CEBA 4OONA 4YINA 5GHXA 4KUKA 3MFXA 1ES4A 4R6LA 3CPTB 1GHPA 4HBTA 2VGJA 3QP4A 3IXDA 2W0NA 1K25A 5EUAA 4LCMA
chains in the Genus database with same CATH topology
3IF6B 2WK0A 1KGFA 4S2LA 3MZFA 4MBKA 5EOOA 2JE5A 3FKWA 2EFXA 3VOZA 3Q81A 4E3MA 1KGGA 3PBNA 3UY6A 4JXVA 4QB8A 1KDWA 2QMIA 3UDIA 2UWXA 2WGWB 4E6WA 2Z2MB 3OPHA 4ID4A 2J9PA 4OQGA 3OPPA 1E3UD 3IXBA 4A5RA 4Q8IA 5CGWA 4LCLA 3QNCA 2XGNA 4DXBA 1XA1A 1SCWA 3W8KA 1YLJA 5EVIB 4UA9A 3CJMA 2P74A 1K54C 3A3DA 4WM9A 4O7DA 4GN2A 1YLPA 4LV0A 5FI2A 3IXGA 3LY4A 2RCXA 4N1HA 5CGSA 4KZ7A 3G31A 3Q1FA 2V1ZA 4E3OA 1MPLA 3ZG7B 1TVFA 4XUZA 3G35A 3M6HA 2EX6A 3Q7VA 1S6RA 1YLZA 2P9VB 3IF6A 3AGDA 1QMEA 4KENB 3SS4A 4QD4A 3G2YA 4BLMA 3N8LA 1YMXA 3P98A 4N92A 3MKFA 1XGIA 3SH8A 2WGVA 4WEJA 1JWVA 4OLDA 3IQAA 2H0YA 3OZHA 5EUAA 1K4EA 5EVIA 4X55A 1BLSA 4JXSA 4BJPA 3SS5A 3NIAA 1G68A 5KSCA 3A3IA 3MKEA 1ZC2A 4BL3A 1M6KA 4BD0A 4OP5A 4K0XA 4RX2A 1XX2A 1K6SA 4OPYA 2FFFB 2Y2GA 1HZOA 5EVLA 2ZC3B 1MKIA 3N8SA 4MBFA 4UA7A 1NXYA 2JC7A 4HEFA 4N9KA 4KQRA 4RA7A 1XA7A 3PBQA 4JF5A 5CRFA 5CERA 3P09A 3WRZA 4S2PA 2CC1A 1RP5A 2P9VA 4WMCA 5HL1A 3Q82A 4KZAA 3EQVA 2ZC7A 4Y7PA 5F1GA 1HD8A 2EX9A 3GV9A 4IBXA 3WRTA 4GZBA 4LENA 3WS0A 2Y55A 1W5DA 3MZDA 1VQQA 3MXSA 4NK3A 4ZJ2A 1BT5A 1KDSA 3I7JA 2BG1A 2ZC4B 3VSKA 2XFSA 1EI5A 3CZDA 2OV5A 1S0WA 4DRTA 2WZZA 3AGEA 1L0EA 3HLWA 1LI0A 4H8RA 3FYZA 4P85A 3UO9A 3LY3A 3PAGA 1ZKJA 1FOFA 1JWPA 3CG5A 4OQ0A 5AQ7A 3V3RA 1Q2QA 2Y2HA 2JBFA 1K55A 2G2UA 3HUNA 3C5AA 5EE8A 2X02A 2J8YA 2HPBA 4Y0OA 3UPNA 3PBOA 1O7EA 5GLDA 3WS4A 5E43A 4JF6A 5FI7A 2ZC6B 4OPZA 1NYYA 3LEZA 3NBLA 4WBGA 4WZ5C 3E2LA 2EXBA 3VMAA 4QU3A 1ERMA 4GB7A 4E3KA 3C4PA 2HDQA 2EFUA 4OQHA 4X69A 3OC2A 4WELA 3HUOA 1AXBA 4OH0A 3NY4A 3DWZA 4MNRA 5HAPA 4PM6A 1IYPA 2ZQDA 3JYIA 2XF3A 2A49A 5AQAA 3ZNYA 1ONGA 2EXAA 4KG5A 1MXOA 5CGXA 3O86A 3AGFA 3W4OA 2Y2LA 1VM1A 4DF6A 3PBSA 5FA7A 3A3EA 1NJ4A 1JWZA 3Q7VB 1PIOA 3A3JA 1BSGA 5EOEA 3OCLA 4PM9A 1GCEA 1ERQA 1L0FA 4E3IA 1BLHA 2JCHA 5U47A 3RXWA 3HBRA 1I5QA 4PPRA 5F1FA 1U60A 2H10A 1IKGA 4IVKA 5HFOA 1YLWA 4R3JA 5FQJA 3UE1A 4EWFA 5E2HA 4DE3A 1IYSA 2V20A 1E3UA 1BLCA 1TEMA 3LO7A 3BLSA 3DWKA 4K91A 4OOMA 4XUXA 3GSGA 5IHVA 2ZQAA 4C6YA 5G18A 2Q9MA 1SDEA 1FQGA 1KVLA 1ZG4A 2WKIA 4JF4A 3VSLA 4ZDXA 2XR0A 2J9OA 1Q2PA 5CXWA 5A90A 2Y59A 4YFMA 1MWUA 5HARA 4WZ4A 3UN7A 1WE4A 2Y4AA 4OPQA 3S4XA 2V2FF 2XQZA 2IWCA 4KQOA 4XXRA 1ZG6A 4DE0A 1KE4A 1FR1A 1N4OA 3OCNA 4PM8A 3ZG9B 1MY8A 3ZFZA 3V39A 3QNBA 4QHCA 5DTSA 3GTCA 2X01A 2Y2KA 2ZQ7A 3G34A 3BYDA 3IWIA 2X71A 4JBFA 1YMSA 2GDNA 2ZQ8A 3UDXA 1PI5A 3TG9A 3VP1A 1BZAA 1MWTA 5AQBA 4S2KA 3BFFA 4GDNA 2OLUA 3VFFA 1NZOA 2XD5A 3ZG5A 3LCEA 2J7VA 3N7WA 1CI9A 4UHUA 1FCNA 2Y91A 5FATA 2HP9A 1NYMA 3VP0A 5A91A 3SS3A 4OP8A 2XK1A 4S2NC 4GDBA 4WYYA 5FAOA 3UDFA 2H0TA 4QY6A 2C6WB 1WYBA 1IEMA 3FKVA 2RL3A 2WUQA 4Y0TA 4HESA 5CHMA 4GD8A 1ES2A 1FR6A 2WKHA 1NY0A 4GOGA 1LL9A 1IKIA 4OQIA 2HP5A 4LCMA 4JXWA 5CTNA 1DJAA 3EQUA 1SKFA 5FASA 3HLBA 4WZ5A 1K56D 1NRFA 1W7FA 3PTEA 4B4XA 2PU2A 2ZD8A 1PWDA 2ZJ9A 1KVMA 1IELA 3WS2A 3O3VA 1L2SA 4KZ5A 1XP4A 3NC8A 3DTMA 3QHYA 5J8XA 5JYPA 1RCJA 1YLTA 2H5SA 5DVAA 3ZGAB 2WADA 3IF6C 2PBYA 5F82A 5CTMA 2EX2A 3ZDJA 1XKZA 3VP4A 4N1XA 5CEDA 1YLYA 5HX9A 1HVBA 5GLAA 4KZ6A 3TSGA 4RVAA 5E2GA 5FQKA 4E3NA 1IYOA 1LI9A 3RJUA 3BLMA 1FCMA 3Q07A 4HBUA 3G30A 4JKTA 1LLBA 4UAAA 2DRWA 3ZVTA 3M2KA 5EECA 5EVIC 1GHIA 4GKUA 4KZ3A 3ZG8B 1ES3A 5JYOA 3N6IA 1QMFA 2WAFA 4DDSA 4EBPA 1ESUA 2Y2OA 5EPHA 5HAIA 3ZCZA 2BLSA 4B88A 3MZEA 4Y0UA 3A3FA 1XPBA 3W4QA 3PBTA 2QZ6A 2ZMAA 2E8IA 1PW1A 4S2MA 3UE0A 3BECA 4FH2A 4EBNA 1K57C 4PM7A 1K54A 4ZTKA 2HDSA 4IBRA 1H5XA 3GVBA 4JXGA 3C7UA 2XFTA 1J9MA 3BRMA 4BL2A 4M3KA 2WZXA 4KZ4A 1XXMA 1KE3A 5D3OA 1BULA 3O87A 5CECA 5FQIA 1KGEA 2XH9A 1ES5A 1W8YA 2WYXA 3BFGA 4JPMA 2EX8A 1MBLA 1MWSA 3ISGA 3PAEA 5M18A 4KZ9A 5GLBA 2DNSA 3G2ZA 5CHUA 4OKPA 1I2SA 1SHVA 4WEKA 5HAQA 4U0XA 1K55C 1XGJA 3VP3A 5TR7A 4E3JA 4FD8A 1PWCA 1JTDA 1YQSA 1H8ZA 2PU4A 4P6BA 3M6BA 4EBLA 4DDYA 4QJGA 4DE2A 4QY5A 4E3LA 3IWQA 1GA9A 4S2NA 3BFEA 5FAQA 3HLEA 4S2JA 3VP2A 1TDGA 2R9XA 3OPRA 4X68A 2ZC5B 2B5RA 2IWDA 1K38A 5FQMA 4BD1A 5CHJA 4R23A 2ZLYA 2Y2MA 4JLFA 4MEZA 1BLPA 3SH9A 2WKEA 1PW8A 5AQ9A 4DE1A 3N4IA 5DF9A 3MBZA 3B3XA 4GD6A 4R0QA 3ITAA 4U3TA 1K4FA 5FQ9A 5E2FA 2ZM2A 3IHAA 4E6XA 2HDUA 3IWOA 1CK3A 1FSYA 5M1AA 3HLCA 2WGIA 4OOLA 1CI8A 3MXRA 4S2IA 4LV2A 5A92A 4D2OA 4K0WA 2R9WA 4OOYA 1GA0A 3IH9A 1KE0A 4LV3A 1GHMA 4R1GA 2G2WA 3IHBA 3S1YA 4IEDA 1BTLA 2WGWA 4BQMA 1G6AA 2Z2LB 4FSFA 1M40A 3DW0A 2WAEA 4EQIA 2XEPA 2ZQ9A 4B4ZA 5EVID 5KMWA 5KSHA 4UA6A 3G4PA 3V3SA 3OPLA 3GR2A 4IVIA 4S2OA 1PYYA 1H8YA 4MBHA 3HUMA 5FSRA 3GMWA 5GHYA 1K56A 1YT4A 3MFDA 5FDHA 2Q9NA 5I94A 5FQQA 4ZAMA 1LHYA 3BFCA 1CEGA 3NDGA 1PZPA 2VGKA 3G32A 4ZJ3A 2XD1A 3GRJA 1ONHA 4WMCD 5GLCA 4P0MA 3PBRA 3WWXA 1IYQA 4OLGA 1K57A 1DJCA 1PZOA 2Y2JA 2HDRA 4KG6A 4EV4A 2A3UA 5DF8A 4FH4A 4DXCA 5BOHA 3NDEA 4P87A 4OPRA 4C75A 4CPKA 3ZNTA 3FV7A 3C7VA 5A93A 3HLGA 1L0GA 3UPPA 2ZM8A 2ZQCA 4F94A 1C3BA 3TOIA 5TFQA 3N8RA 4X56A 2Y2PA 1PWGA 3D4FA 2FFYA 4EUZA 2Y2QA 5E2EA 5GHZA 2IWBA 3BEBA 2Y2NA 3FWLA 3GQZA 3ZHHA 4N9LA 1JVJA 3HREA 4KZBA 5F83A 5FI6A 2Y2IA 4RX3A 4KZ8A 4ZBEA 3IT9A 1JTGA 1L0DA 1RGZA 2I72A 1BUEA 2OLVA 3Q7ZA 1MWRA 4C3QA 4R3BA 4KG2A 1EROA 3IF5A 5DTKA 1LL5A 1W8QA 2QPNA 1TDLA 2OSUA 2XDMA 3UE3A 4Z9QA 4KQQA 1W79A 4RYEA 3NCKA 5M19A 5TGFA 3HVFA 4PM5A 1YM1A 3IXHA 1CEFA 3V50A 4DKIA 3UPOA 1FSWA 1NZUA 1Z6FA 1I2WA 3HL9A 4L0LA 3O88A 5DTTA 4NETA 1EWZA 2C5WB 3C4OA 5DF7A 1FCOA 5KZHA 3M2JA 3W4PA 1O07A 1K6RA 3RXXA 3UNWA 3IH8A 3VOYA 3HLDA 3ZVWA 5HW3A 4PMAA 1E4DA 3E2KA 4LV1A 3ITBA 3HLFA 3BM6A 4BENA 2XLNA 1ESIA 2ZM0A 5L2FA 2HP6A 3SH7A 3ZG0A 5FAPA 4X6TA 1Y54A 3CMZA 5CEBA 1DY6A 4OONA 4YINA 1E25A 5GHXA 4U0TA 3BFDA 3FZCA 1HTZA 4R4SA 1ES4A 3V5MA 3VFHA 3SOIA 2DCFA 3NI9A 4FCFA 4ZJ1A 4X53A 3WS1A 3WS5A 1DJBA 1PI4A 1GHPA 1SDNA 1OMEA 4HBTA 1WYCA 2VGJA 4R4RA 4CJNA 5GL9A 3IXDA 1RGYA 1K25A 4OVDA 1N9BA 1ALQA 3S22A 4GNUA 4MLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF6 B;  2WK0 A;  1KGF A;  4S2L A;  3MZF A;  4MBK A;  5EOO A;  2JE5 A;  3FKW A;  2EFX A;  3VOZ A;  3Q81 A;  4E3M A;  1KGG A;  3PBN A;  3UY6 A;  4JXV A;  4QB8 A;  1KDW A;  2QMI A;  3UDI A;  2UWX A;  2WGW B;  4E6W A;  2Z2M B;  3OPH A;  4ID4 A;  2J9P A;  4OQG A;  3OPP A;  1E3U D;  3IXB A;  4A5R A;  4Q8I A;  5CGW A;  4LCL A;  3QNC A;  2XGN A;  4DXB A;  1XA1 A;  1SCW A;  3W8K A;  1YLJ A;  5EVI B;  4UA9 A;  3CJM A;  2P74 A;  1K54 C;  3A3D A;  4WM9 A;  4O7D A;  4GN2 A;  1YLP A;  4LV0 A;  5FI2 A;  3IXG A;  3LY4 A;  2RCX A;  4N1H A;  5CGS A;  4KZ7 A;  3G31 A;  3Q1F A;  2V1Z A;  4E3O A;  1MPL A;  3ZG7 B;  1TVF A;  4XUZ A;  3G35 A;  3M6H A;  2EX6 A;  3Q7V A;  1S6R A;  1YLZ A;  2P9V B;  3IF6 A;  3AGD A;  1QME A;  4KEN B;  3SS4 A;  4QD4 A;  3G2Y A;  4BLM A;  3N8L A;  1YMX A;  3P98 A;  4N92 A;  3MKF A;  1XGI A;  3SH8 A;  2WGV A;  4WEJ A;  1JWV A;  4OLD A;  3IQA A;  2H0Y A;  3OZH A;  5EUA A;  1K4E A;  5EVI A;  4X55 A;  1BLS A;  4JXS A;  4BJP A;  3SS5 A;  3NIA A;  1G68 A;  5KSC A;  3A3I A;  3MKE A;  1ZC2 A;  4BL3 A;  1M6K A;  4BD0 A;  4OP5 A;  4K0X A;  4RX2 A;  1XX2 A;  1K6S A;  4OPY A;  2FFF B;  2Y2G A;  1HZO A;  5EVL A;  2ZC3 B;  1MKI A;  3N8S A;  4MBF A;  4UA7 A;  1NXY A;  2JC7 A;  4HEF A;  4N9K A;  4KQR A;  4RA7 A;  1XA7 A;  3PBQ A;  4JF5 A;  5CRF A;  5CER A;  3P09 A;  3WRZ A;  4S2P A;  2CC1 A;  1RP5 A;  2P9V A;  4WMC A;  5HL1 A;  3Q82 A;  4KZA A;  3EQV A;  2ZC7 A;  4Y7P A;  5F1G A;  1HD8 A;  2EX9 A;  3GV9 A;  4IBX A;  3WRT A;  4GZB A;  4LEN A;  3WS0 A;  2Y55 A;  1W5D A;  3MZD A;  1VQQ A;  3MXS A;  4NK3 A;  4ZJ2 A;  1BT5 A;  1KDS A;  3I7J A;  2BG1 A;  2ZC4 B;  3VSK A;  2XFS A;  1EI5 A;  3CZD A;  2OV5 A;  1S0W A;  4DRT A;  2WZZ A;  3AGE A;  1L0E A;  3HLW A;  1LI0 A;  4H8R A;  3FYZ A;  4P85 A;  3UO9 A;  3LY3 A;  3PAG A;  1ZKJ A;  1FOF A;  1JWP A;  3CG5 A;  4OQ0 A;  5AQ7 A;  3V3R A;  1Q2Q A;  2Y2H A;  2JBF A;  1K55 A;  2G2U A;  3HUN A;  3C5A A;  5EE8 A;  2X02 A;  2J8Y A;  2HPB A;  4Y0O A;  3UPN A;  3PBO A;  1O7E A;  5GLD A;  3WS4 A;  5E43 A;  4JF6 A;  5FI7 A;  2ZC6 B;  4OPZ A;  1NYY A;  3LEZ A;  3NBL A;  4WBG A;  4WZ5 C;  3E2L A;  2EXB A;  3VMA A;  4QU3 A;  1ERM A;  4GB7 A;  4E3K A;  3C4P A;  2HDQ A;  2EFU A;  4OQH A;  4X69 A;  3OC2 A;  4WEL A;  3HUO A;  1AXB A;  4OH0 A;  3NY4 A;  3DWZ A;  4MNR A;  5HAP A;  4PM6 A;  1IYP A;  2ZQD A;  3JYI A;  2XF3 A;  2A49 A;  5AQA A;  3ZNY A;  1ONG A;  2EXA A;  4KG5 A;  1MXO A;  5CGX A;  3O86 A;  3AGF A;  3W4O A;  2Y2L A;  1VM1 A;  4DF6 A;  3PBS A;  5FA7 A;  3A3E A;  1NJ4 A;  1JWZ A;  3Q7V B;  1PIO A;  3A3J A;  1BSG A;  5EOE A;  3OCL A;  4PM9 A;  1GCE A;  1ERQ A;  1L0F A;  4E3I A;  1BLH A;  2JCH A;  5U47 A;  3RXW A;  3HBR A;  1I5Q A;  4PPR A;  5F1F A;  1U60 A;  2H10 A;  1IKG A;  4IVK A;  5HFO A;  1YLW A;  4R3J A;  5FQJ A;  3UE1 A;  4EWF A;  5E2H A;  4DE3 A;  1IYS A;  2V20 A;  1E3U A;  1BLC A;  1TEM A;  3LO7 A;  3BLS A;  3DWK A;  4K91 A;  4OOM A;  4XUX A;  3GSG A;  5IHV A;  2ZQA A;  4C6Y A;  5G18 A;  2Q9M A;  1SDE A;  1FQG A;  1KVL A;  1ZG4 A;  2WKI A;  4JF4 A;  3VSL A;  4ZDX A;  2XR0 A;  2J9O A;  1Q2P A;  5CXW A;  5A90 A;  2Y59 A;  4YFM A;  1MWU A;  5HAR A;  4WZ4 A;  3UN7 A;  1WE4 A;  2Y4A A;  4OPQ A;  3S4X A;  2V2F F;  2XQZ A;  2IWC A;  4KQO A;  4XXR A;  1ZG6 A;  4DE0 A;  1KE4 A;  1FR1 A;  1N4O A;  3OCN A;  4PM8 A;  3ZG9 B;  1MY8 A;  3ZFZ A;  3V39 A;  3QNB A;  4QHC A;  5DTS A;  3GTC A;  2X01 A;  2Y2K A;  2ZQ7 A;  3G34 A;  3BYD A;  3IWI A;  2X71 A;  4JBF A;  1YMS A;  2GDN A;  2ZQ8 A;  3UDX A;  1PI5 A;  3TG9 A;  3VP1 A;  1BZA A;  1MWT A;  5AQB A;  4S2K A;  3BFF A;  4GDN A;  2OLU A;  3VFF A;  1NZO A;  2XD5 A;  3ZG5 A;  3LCE A;  2J7V A;  3N7W A;  1CI9 A;  4UHU A;  1FCN A;  2Y91 A;  5FAT A;  2HP9 A;  1NYM A;  3VP0 A;  5A91 A;  3SS3 A;  4OP8 A;  2XK1 A;  4S2N C;  4GDB A;  4WYY A;  5FAO A;  3UDF A;  2H0T A;  4QY6 A;  2C6W B;  1WYB A;  1IEM A;  3FKV A;  2RL3 A;  2WUQ A;  4Y0T A;  4HES A;  5CHM A;  4GD8 A;  1ES2 A;  1FR6 A;  2WKH A;  1NY0 A;  4GOG A;  1LL9 A;  1IKI A;  4OQI A;  2HP5 A;  4LCM A;  4JXW A;  5CTN A;  1DJA A;  3EQU A;  1SKF A;  5FAS A;  3HLB A;  4WZ5 A;  1K56 D;  1NRF A;  1W7F A;  3PTE A;  4B4X A;  2PU2 A;  2ZD8 A;  1PWD A;  2ZJ9 A;  1KVM A;  1IEL A;  3WS2 A;  3O3V A;  1L2S A;  4KZ5 A;  1XP4 A;  3NC8 A;  3DTM A;  3QHY A;  5J8X A;  5JYP A;  1RCJ A;  1YLT A;  2H5S A;  5DVA A;  3ZGA B;  2WAD A;  3IF6 C;  2PBY A;  5F82 A;  5CTM A;  2EX2 A;  3ZDJ A;  1XKZ A;  3VP4 A;  4N1X A;  5CED A;  1YLY A;  5HX9 A;  1HVB A;  5GLA A;  4KZ6 A;  3TSG A;  4RVA A;  5E2G A;  5FQK A;  4E3N A;  1IYO A;  1LI9 A;  3RJU A;  3BLM A;  1FCM A;  3Q07 A;  4HBU A;  3G30 A;  4JKT A;  1LLB A;  4UAA A;  2DRW A;  3ZVT A;  3M2K A;  5EEC A;  5EVI C;  1GHI A;  4GKU A;  4KZ3 A;  3ZG8 B;  1ES3 A;  5JYO A;  3N6I A;  1QMF A;  2WAF A;  4DDS A;  4EBP A;  1ESU A;  2Y2O A;  5EPH A;  5HAI A;  3ZCZ A;  2BLS A;  4B88 A;  3MZE A;  4Y0U A;  3A3F A;  1XPB A;  3W4Q A;  3PBT A;  2QZ6 A;  2ZMA A;  2E8I A;  1PW1 A;  4S2M A;  3UE0 A;  3BEC A;  4FH2 A;  4EBN A;  1K57 C;  4PM7 A;  1K54 A;  4ZTK A;  2HDS A;  4IBR A;  1H5X A;  3GVB A;  4JXG A;  3C7U A;  2XFT A;  1J9M A;  3BRM A;  4BL2 A;  4M3K A;  2WZX A;  4KZ4 A;  1XXM A;  1KE3 A;  5D3O A;  1BUL A;  3O87 A;  5CEC A;  5FQI A;  1KGE A;  2XH9 A;  1ES5 A;  1W8Y A;  2WYX A;  3BFG A;  4JPM A;  2EX8 A;  1MBL A;  1MWS A;  3ISG A;  3PAE A;  5M18 A;  4KZ9 A;  5GLB A;  2DNS A;  3G2Z A;  5CHU A;  4OKP A;  1I2S A;  1SHV A;  4WEK A;  5HAQ A;  4U0X A;  1K55 C;  1XGJ A;  3VP3 A;  5TR7 A;  4E3J A;  4FD8 A;  1PWC A;  1JTD A;  1YQS A;  1H8Z A;  2PU4 A;  4P6B A;  3M6B A;  4EBL A;  4DDY A;  4QJG A;  4DE2 A;  4QY5 A;  4E3L A;  3IWQ A;  1GA9 A;  4S2N A;  3BFE A;  5FAQ A;  3HLE A;  4S2J A;  3VP2 A;  1TDG A;  2R9X A;  3OPR A;  4X68 A;  2ZC5 B;  2B5R A;  2IWD A;  1K38 A;  5FQM A;  4BD1 A;  5CHJ A;  4R23 A;  2ZLY A;  2Y2M A;  4JLF A;  4MEZ A;  1BLP A;  3SH9 A;  2WKE A;  1PW8 A;  5AQ9 A;  4DE1 A;  3N4I A;  5DF9 A;  3MBZ A;  3B3X A;  4GD6 A;  4R0Q A;  3ITA A;  4U3T A;  1K4F A;  5FQ9 A;  5E2F A;  2ZM2 A;  3IHA A;  4E6X A;  2HDU A;  3IWO A;  1CK3 A;  1FSY A;  5M1A A;  3HLC A;  2WGI A;  4OOL A;  1CI8 A;  3MXR A;  4S2I A;  4LV2 A;  5A92 A;  4D2O A;  4K0W A;  2R9W A;  4OOY A;  1GA0 A;  3IH9 A;  1KE0 A;  4LV3 A;  1GHM A;  4R1G A;  2G2W A;  3IHB A;  3S1Y A;  4IED A;  1BTL A;  2WGW A;  4BQM A;  1G6A A;  2Z2L B;  4FSF A;  1M40 A;  3DW0 A;  2WAE A;  4EQI A;  2XEP A;  2ZQ9 A;  4B4Z A;  5EVI D;  5KMW A;  5KSH A;  4UA6 A;  3G4P A;  3V3S A;  3OPL A;  3GR2 A;  4IVI A;  4S2O A;  1PYY A;  1H8Y A;  4MBH A;  3HUM A;  5FSR A;  3GMW A;  5GHY A;  1K56 A;  1YT4 A;  3MFD A;  5FDH A;  2Q9N A;  5I94 A;  5FQQ A;  4ZAM A;  1LHY A;  3BFC A;  1CEG A;  3NDG A;  1PZP A;  2VGK A;  3G32 A;  4ZJ3 A;  2XD1 A;  3GRJ A;  1ONH A;  4WMC D;  5GLC A;  4P0M A;  3PBR A;  3WWX A;  1IYQ A;  4OLG A;  1K57 A;  1DJC A;  1PZO A;  2Y2J A;  2HDR A;  4KG6 A;  4EV4 A;  2A3U A;  5DF8 A;  4FH4 A;  4DXC A;  5BOH A;  3NDE A;  4P87 A;  4OPR A;  4C75 A;  4CPK A;  3ZNT A;  3FV7 A;  3C7V A;  5A93 A;  3HLG A;  1L0G A;  3UPP A;  2ZM8 A;  2ZQC A;  4F94 A;  1C3B A;  3TOI A;  5TFQ A;  3N8R A;  4X56 A;  2Y2P A;  1PWG A;  3D4F A;  2FFY A;  4EUZ A;  2Y2Q A;  5E2E A;  5GHZ A;  2IWB A;  3BEB A;  2Y2N A;  3FWL A;  3GQZ A;  3ZHH A;  4N9L A;  1JVJ A;  3HRE A;  4KZB A;  5F83 A;  5FI6 A;  2Y2I A;  4RX3 A;  4KZ8 A;  4ZBE A;  3IT9 A;  1JTG A;  1L0D A;  1RGZ A;  2I72 A;  1BUE A;  2OLV A;  3Q7Z A;  1MWR A;  4C3Q A;  4R3B A;  4KG2 A;  1ERO A;  3IF5 A;  5DTK A;  1LL5 A;  1W8Q A;  2QPN A;  1TDL A;  2OSU A;  2XDM A;  3UE3 A;  4Z9Q A;  4KQQ A;  1W79 A;  4RYE A;  3NCK A;  5M19 A;  5TGF A;  3HVF A;  4PM5 A;  1YM1 A;  3IXH A;  1CEF A;  3V50 A;  4DKI A;  3UPO A;  1FSW A;  1NZU A;  1Z6F A;  1I2W A;  3HL9 A;  4L0L A;  3O88 A;  5DTT A;  4NET A;  1EWZ A;  2C5W B;  3C4O A;  5DF7 A;  1FCO A;  5KZH A;  3M2J A;  3W4P A;  1O07 A;  1K6R A;  3RXX A;  3UNW A;  3IH8 A;  3VOY A;  3HLD A;  3ZVW A;  5HW3 A;  4PMA A;  1E4D A;  3E2K A;  4LV1 A;  3ITB A;  3HLF A;  3BM6 A;  4BEN A;  2XLN A;  1ESI A;  2ZM0 A;  5L2F A;  2HP6 A;  3SH7 A;  3ZG0 A;  5FAP A;  4X6T A;  1Y54 A;  3CMZ A;  5CEB A;  1DY6 A;  4OON A;  4YIN A;  1E25 A;  5GHX A;  4U0T A;  3BFD A;  3FZC A;  1HTZ A;  4R4S A;  1ES4 A;  3V5M A;  3VFH A;  3SOI A;  2DCF A;  3NI9 A;  4FCF A;  4ZJ1 A;  4X53 A;  3WS1 A;  3WS5 A;  1DJB A;  1PI4 A;  1GHP A;  1SDN A;  1OME A;  4HBT A;  1WYC A;  2VGJ A;  4R4R A;  4CJN A;  5GL9 A;  3IXD A;  1RGY A;  1K25 A;  4OVD A;  1N9B A;  1ALQ A;  3S22 A;  4GNU A;  4MLL A; 
#chains in the Genus database with same CATH topology
 3IF6 B;  2WK0 A;  1ACF A;  3MZF A;  2JKG A;  4S2L A;  1S67 L;  2EFX A;  3CUE C;  3NOP C;  2FH5 A;  2VV6 A;  3OPH A;  4OQG A;  3QNC A;  3H9W A;  1YLJ A;  2PDR A;  3CJM A;  2P74 A;  3ICY A;  4BWI A;  1UGU A;  4I38 A;  3IXG A;  2PHY A;  3G31 A;  1MPL A;  3KSI A;  5EV0 A;  5F6A A;  3M6H A;  4I3A A;  2EX6 A;  4KEN B;  4QD4 A;  3UE6 A;  1YMX A;  4GS9 A;  4N92 A;  3SH8 A;  4WEJ A;  2H0Y A;  1PFL A;  3OZH A;  4G3K A;  5EFW A;  3NIA A;  5J4E A;  1AWI A;  4BD0 A;  4BL3 A;  4K0X A;  1K6S A;  2Y2G A;  5EVL A;  2A24 B;  2OAQ 1;  2ZC3 B;  1MKI A;  3N8S A;  4XT2 A;  2CMN A;  2JC7 A;  4GLQ A;  4RA7 A;  4KQD A;  4F3L B;  1H0M A;  4CLC C;  4KZA A;  3EQV A;  4DMZ A;  4IBX A;  4GZB A;  2Y55 A;  1P9R A;  1VQQ A;  4EU0 A;  3MSH A;  4ZJ2 A;  1BT5 A;  1LSW A;  3VOL A;  4H8R A;  1LI0 A;  3FYZ A;  3PAG A;  4QWO A;  3CG5 A;  1FOF A;  3B47 A;  2HPB A;  2OWJ A;  4IUK A;  5HPF A;  3WS4 A;  5FI7 A;  3LEZ A;  3LIA A;  3NBL A;  3VMA A;  1ERM A;  4GB7 A;  2HDQ A;  2EFU A;  2JKT I;  4OH0 A;  3NY4 A;  1NRJ A;  2O9C A;  2PYR A;  4LFU A;  1ONG A;  4KG5 A;  1VM1 A;  2KX6 A;  1P97 A;  4DF6 A;  4DJ2 A;  1JWZ A;  2Z6C A;  1PIO A;  3A3J A;  3MQO A;  1ERQ A;  4E3I A;  1BLH A;  3RXW A;  1CQA A;  2H10 A;  2GX5 A;  5F69 A;  4IVK A;  5FQJ A;  5J3W A;  4DE3 A;  1MKM A;  3MMH A;  4HI4 A;  3LO7 A;  1BLC A;  4K91 A;  2Q9M A;  1FQG A;  1KVL A;  4AFI A;  4JF4 A;  3VSL A;  2XR0 A;  1Q2P A;  3UN7 A;  2HV1 A;  4M4X A;  4HH2 A;  4XXR A;  1ZG6 A;  5DKK A;  1N4O A;  3OCN A;  3ZG9 B;  4EXO A;  3V39 A;  3GTC A;  3UMD A;  5DFX A;  3BYD A;  1EW0 A;  2GDN A;  2GZA A;  3UDX A;  4GDN A;  2OLU A;  4KUO A;  2PAV P;  1J3W A;  3N7W A;  2GNX A;  4UHU A;  1FCN A;  3FPV A;  5FAT A;  3VP0 A;  3SS3 A;  4GDB A;  2P7J A;  3T4Q A;  3UDF A;  2WKP A;  1SZV A;  3MF0 A;  1S4S A;  4HES A;  2WKH A;  1NY0 A;  3OBF A;  1LL9 A;  1IKI A;  4LRZ E;  2HP5 A;  2JKR I;  1S66 L;  4WZ5 A;  1K56 D;  3S7O A;  2D01 A;  2ZD8 A;  5TJJ A;  2ZJ9 A;  1L2S A;  2K31 A;  2VEA A;  1F2K A;  4IJG A;  1HVB A;  1DRM A;  5TBM B;  5E2G A;  1LI9 A;  3DAV A;  4JKT A;  3G30 A;  4WUJ A;  1WA9 A;  3IX4 A;  1DP6 A;  3ZG8 B;  5JYO A;  1T1A A;  1GSX A;  2WAF A;  1OTA A;  3CHW P;  4EBP A;  5HD3 A;  3KSH A;  1XPB A;  2QZ6 A;  1YAX A;  2ZMA A;  4PM7 A;  2HDS A;  2XRN A;  4B9O A;  1H5X A;  4JXG A;  3BRM A;  4M3K A;  1XXM A;  4HP9 A;  2XH9 A;  3LFV A;  3LIE A;  1LSV A;  1W8Y A;  2WYX A;  3PAE A;  4KZ9 A;  3G2Z A;  3IBR A;  3IX8 A;  2HF6 A;  4II7 A;  4FD8 A;  1JTD A;  4YOF A;  4DDY A;  2BTF P;  4QJG A;  2W3H A;  3L9K A;  5FAQ A;  1TDG A;  4X68 A;  3T4J A;  4CLC A;  2IWD A;  4ESP A;  2P08 A;  2A2L A;  4GHI B;  4MEZ A;  3N4I A;  1YPR A;  3MBZ A;  4GD6 A;  1T18 A;  4YWZ A;  3ITA A;  5FQ9 A;  3IHA A;  3PR6 A;  5M1A A;  3BJN A;  4S2I A;  4ME4 A;  4UQI S;  1XJ4 A;  5A92 A;  4D2O A;  4MDZ A;  3S1Y A;  1BTL A;  1M40 A;  4B4Z A;  4UA6 A;  4MBH A;  5I94 A;  5FQQ A;  4ZAM A;  3DTK A;  2XD1 A;  1ONH A;  2Q0O A;  3KYZ A;  4KG6 A;  5DF8 A;  4G3W A;  2ACG A;  1MZU A;  2ZQC A;  2IA2 A;  5TFQ A;  3D4F A;  1IOU A;  2Y2Q A;  5GHZ A;  2IWB A;  3FWL A;  3GQZ A;  2BAS A;  2Y2I A;  4RX3 A;  1S1Z A;  4ZBE A;  3IT9 A;  2A24 A;  2I72 A;  2OLV A;  3Q7Z A;  4R3B A;  2OSU A;  3UME A;  4KQQ A;  4ETZ A;  3KO6 A;  3JVV A;  4RYE A;  3VV4 A;  4PM5 A;  3CIT A;  3UB7 A;  3UPO A;  3HL9 A;  4L0L A;  3O88 A;  4NET A;  3H7W A;  2GJ3 A;  2V8F A;  1K6R A;  3VOY A;  5HW3 A;  5HL6 A;  3ITB A;  1YSQ A;  5L2F A;  5CX7 A;  2HP6 A;  4P6Z S;  1Y54 A;  1E25 A;  3QP1 A;  1F5M A;  3F1P B;  4UEY A;  3VFH A;  1P9W A;  2K2N A;  2DCF A;  3EGD C;  3WS1 A;  4FCF A;  1DJB A;  1F98 A;  4CJN A;  5GL9 A;  1T1B A;  2PYP A;  3S22 A;  4GNU A;  4WEK A;  1KGF A;  4MBK A;  2JE5 A;  4WF0 A;  4E3M A;  2QMI A;  5FEG A;  2WGW B;  4E6W A;  2J9P A;  4A5R A;  4EW7 A;  1SCW A;  4JGR A;  5EVI B;  4UA9 A;  5HZH A;  2VV7 A;  4GN2 A;  5A8B A;  2KDK A;  2RCX A;  4HHD A;  1XFN A;  3EWK A;  4R70 A;  4HJ6 A;  3BQ8 A;  3G35 A;  2MJ6 A;  2P9V B;  1OJ5 A;  3EEH A;  3SS4 A;  4BLM A;  3G2Y A;  3N8L A;  4JGQ A;  3A0S A;  4EEP A;  3F1O B;  3LR3 A;  1JWV A;  4OLD A;  5DFY A;  4JXS A;  4BJP A;  3SS5 A;  4GW9 A;  3A3I A;  2KLI A;  4OP5 A;  2V0U A;  2FFF B;  4UA7 A;  4HEF A;  3WRZ A;  2CC1 A;  4WMC A;  5L10 A;  1ZTU A;  2VGL M;  2ZC7 A;  4Y7P A;  1SKO A;  1HD8 A;  3GV9 A;  3MZD A;  3PXP A;  3I7J A;  2ZC4 B;  3VSK A;  2XFS A;  1EI5 A;  2R78 A;  2W3G A;  3CZD A;  2OV5 A;  2WZZ A;  3HLW A;  3UO9 A;  3LY3 A;  1JWP A;  4OQ0 A;  5AQ7 A;  1Q2Q A;  2V0W A;  2G2U A;  5EE8 A;  2J8Y A;  4Y0O A;  1O7E A;  5E43 A;  4JF6 A;  4OPZ A;  1NYY A;  4WZ5 C;  4MMN A;  3D72 A;  2PRF A;  1AXB A;  3LI8 A;  4MNR A;  3DWZ A;  4DJ3 A;  2ZQD A;  2UV0 E;  2A49 A;  3ZNY A;  1NLY A;  5CGX A;  3O86 A;  3AGF A;  5DJU A;  2Y2L A;  2M7U A;  4HQA A;  3Q7V B;  5EOE A;  2ZMF A;  3TJZ C;  3OCL A;  4PM9 A;  3PYP A;  1L0F A;  4PKY G;  2JCH A;  2QWS A;  3MS6 A;  1I5Q A;  3CLO A;  5F1F A;  4I3I A;  1HLU P;  2XA7 M;  4JGP A;  5HFO A;  4EWF A;  1G28 A;  3NUL A;  5E2H A;  3LUQ A;  1TEM A;  3BLS A;  3DTI A;  2ZQA A;  4ZDX A;  2L4R A;  5A90 A;  1MWU A;  1P0Z A;  2IWC A;  2PD7 A;  1FR1 A;  4PM8 A;  2YKH A;  4CLC D;  2X01 A;  2PR6 A;  4K08 A;  3G34 A;  1BZA A;  4S2K A;  3BFF A;  2W1R A;  2ZBB A;  3VFF A;  1NZO A;  4L9E A;  3K2N A;  1CI9 A;  1W63 M;  4JGO A;  5HSQ A;  1N9N A;  1N9O A;  5MC7 A;  1OTE A;  5FAO A;  2H0T A;  1WYB A;  3HJI A;  2RL3 A;  2WUQ A;  4Y0T A;  5CHM A;  1ES2 A;  3LIC A;  1ZHH B;  4GHI A;  2W3F A;  5HWV A;  3BY8 A;  1TS8 A;  5FAS A;  3HLB A;  1NRF A;  1W7F A;  1STZ A;  3PTE A;  1XFQ A;  2V1B A;  3WS2 A;  1IEL A;  4KZ5 A;  2QJ5 A;  1LT0 A;  3DTM A;  3QHY A;  5J8X A;  3ZGA B;  3IF6 C;  3JPU A;  3VP4 A;  1VHM A;  5CED A;  4D60 A;  5HX9 A;  3UB6 A;  5GLA A;  3TSG A;  5L8M A;  3RJU A;  2W27 A;  2JN7 A;  4B93 A;  1UWN X;  1QMF A;  3R4K A;  1ESU A;  4ETX A;  2Y2O A;  4GJ4 A;  3IS2 B;  5HDS A;  2XSS A;  3A3F A;  3C30 A;  3PBT A;  1TD5 A;  1PRQ A;  3ZYT A;  3QP5 A;  4S2M A;  3UE0 A;  3FG8 A;  1LSX A;  3BEC A;  3C8C A;  3E98 A;  3ZQ5 A;  4ZTK A;  1OTB A;  1J9M A;  5HDC A;  2Y79 A;  4NXG A;  2D02 A;  1BUL A;  3O87 A;  5CEC A;  1NLZ A;  2JKT M;  4JPM A;  1MBL A;  2DNS A;  5HAQ A;  1K55 C;  3VP3 A;  5TR7 A;  4X1L A;  4HJ4 A;  4BBT A;  1H8Z A;  3VE4 A;  4DE2 A;  4E3L A;  3MQ0 A;  4S2N A;  3BFE A;  3HLE A;  2OOL A;  3OPR A;  4O0P A;  4CLC E;  2ZLY A;  5L09 A;  2WKE A;  4DE1 A;  1FIK A;  4YNR A;  1DP9 A;  3T1X A;  3B3X A;  4NXE A;  4U3T A;  1K4F A;  5EVE A;  4E6X A;  1Z09 A;  2ZM2 A;  1LL8 A;  3IWO A;  2WGI A;  3H82 B;  4OOY A;  1KE0 A;  4R1G A;  4IED A;  2WGW A;  4EQI A;  3P01 A;  2ZQ9 A;  4HY8 A;  4S2O A;  3HUM A;  3LR0 A;  5FSR A;  1LHY A;  3UB9 A;  3IBJ A;  1PZP A;  3NHQ A;  2INW A;  3BW6 A;  4ZJ3 A;  3F1N B;  4WMC D;  5DKL A;  3PBR A;  3RTY A;  4PAU A;  2DMW A;  1DJC A;  2Y2J A;  2HDR A;  5HPI A;  3UB8 A;  4PKY A;  3F1O A;  4P87 A;  4C75 A;  1XJ6 A;  3R7W B;  3FV7 A;  1OPX A;  3CAX A;  2ZM8 A;  4F94 A;  4ARZ B;  4X56 A;  2NUP C;  3GEC A;  3BEB A;  2PD8 A;  5F5Y A;  3HRE A;  5FI6 A;  1RGZ A;  2J3T C;  3IF5 A;  5DTK A;  1TDL A;  5F68 A;  3UE3 A;  3U2A A;  1W79 A;  5M19 A;  5FL3 A;  3TRC A;  1CEF A;  4DKI A;  1FSW A;  2NUT C;  4BMW A;  3W4P A;  5FDS A;  1O07 A;  3UNW A;  3HLD A;  4PMA A;  4HP4 A;  3E2K A;  4LV1 A;  4BEN A;  1ESI A;  3ZG0 A;  5FAP A;  4LRY C;  4HH3 A;  3EEA A;  4GCZ A;  1DY6 A;  1G6O A;  3BFD A;  3FZC A;  3SOI A;  2ZOH A;  3NI9 A;  4X53 A;  3W2Z A;  1SDN A;  1WYC A;  1RGY A;  1S1Y A;  3E4O A;  3TE8 A;  4OVD A;  1ALQ A;  3T1R A;  5CGS A;  4Y15 A;  4MLL A;  3L7H A;  3CWF A;  4Z1W A;  5EOO A;  3FKW A;  3UY6 A;  1V9Z A;  3UDI A;  2UWX A;  4ID4 A;  5G4Z A;  2M7V A;  4Q8I A;  3IXB A;  4LCL A;  2XGN A;  3W8K A;  1K54 C;  4WM9 A;  4O7D A;  1YLP A;  4N1H A;  4KZ7 A;  3T4O A;  3Q1F A;  2V1Z A;  3CPT A;  4E3O A;  3B42 A;  4FTX A;  4XUZ A;  3Q7V A;  3IF6 A;  3AGD A;  1QME A;  2VZW A;  3P98 A;  1XGI A;  2WGV A;  3UB5 P;  3IQA A;  4X55 A;  3T12 B;  2ZOI A;  5L07 A;  2EA9 A;  2PBD P;  1Y28 A;  5FEF A;  3MKE A;  1PNE A;  3NOU C;  1ZC2 A;  4NKP A;  3IX3 A;  2FZ0 A;  4OPY A;  2VKS A;  1HZO A;  4BBU A;  1NXY A;  5CRF A;  3PBQ A;  2J3W A;  2PR5 A;  4JF5 A;  5CER A;  3P09 A;  5HL1 A;  3Q82 A;  3FPW A;  5DJT A;  4WLA A;  4LEN A;  3WS0 A;  2B18 A;  3NOT C;  1W5D A;  3MXQ A;  3MXS A;  4NK3 A;  4O8G A;  1KDS A;  4NEE D;  4LPZ A;  1VET B;  2VX8 A;  1L0E A;  3SW1 A;  3LIB A;  1ZKJ A;  1K55 A;  1BYW A;  3A0V A;  3KYQ A;  4F3L A;  3UPN A;  4BBV A;  2ZC6 B;  3RH8 B;  3T4K A;  4LRX C;  1TS6 A;  4WBG A;  4Y17 A;  2EXB A;  4QU3 A;  3E4P A;  2ZL1 B;  1TS0 A;  3C4P A;  2W1T B;  4OQH A;  3HUO A;  5K5B A;  4PM6 A;  1IYP A;  3JYI A;  2W3E A;  2EXA A;  2VV8 A;  5FA7 A;  3A3E A;  3CI6 A;  1BSG A;  1GCE A;  5AVE A;  2KOI A;  4UQI M;  5U47 A;  1T19 A;  1D06 A;  3LR5 A;  3NJA A;  1V9Y A;  4R3J A;  3UE1 A;  1IYS A;  2V20 A;  1E3U A;  4OOM A;  5IHV A;  3GSG A;  5G18 A;  3K3D A;  2J9O A;  5CXW A;  2W3D A;  2Y59 A;  5HAR A;  4WZ4 A;  2Y4A A;  4OPQ A;  3S4X A;  2O0Y A;  2V2F F;  4KQO A;  1A0K A;  4MCW A;  1MY8 A;  2P04 A;  2Y2K A;  4JBF A;  5IU1 A;  3TG9 A;  3VP1 A;  1MWT A;  2VLG A;  3BWL A;  2ZMV A;  3ZG5 A;  3LCE A;  3T1S A;  3DBA A;  2Y91 A;  2Y8H A;  1K0K A;  4FUW A;  3HJK A;  4EET B;  5A91 A;  4O01 A;  4OP8 A;  4S2N C;  3C38 A;  3FKV A;  1OTD A;  1D1J A;  1FR6 A;  4OQI A;  3EQU A;  4IHQ A;  2PU2 A;  1PWD A;  1KVM A;  1MC0 A;  1XJ2 A;  3FC7 A;  3O3V A;  1XP4 A;  2L1M A;  5JYP A;  1RCJ A;  2WAD A;  5F82 A;  4P6Z M;  2EX2 A;  4CQH A;  1XKZ A;  1YLY A;  4RVA A;  4E3N A;  2B95 A;  3BLM A;  3Q07 A;  1LLB A;  4UAA A;  4I5S A;  3ZVT A;  5EVI C;  4GKU A;  4KZ3 A;  1ES3 A;  3N6I A;  4DDS A;  5EPH A;  3LGO A;  3ZCZ A;  2BLS A;  3MZE A;  4Y0U A;  1FIL A;  3BY9 A;  1PW1 A;  4EBN A;  4R38 A;  2L0W A;  1K54 A;  2VJW A;  4IBR A;  5TBM A;  3R7W A;  4BL2 A;  4KZ4 A;  4ARZ A;  5D3O A;  5FQI A;  1KGE A;  4CLC B;  3BFG A;  1IFQ A;  4EER A;  3ISG A;  5M18 A;  1DP8 A;  5GLB A;  4HJ3 A;  1OT6 A;  5CHU A;  1I2S A;  1SHV A;  3T4S A;  4U0X A;  1XGJ A;  2V8C A;  1YQS A;  2PU4 A;  4EBL A;  1VEU B;  4EQ1 A;  4QY5 A;  3JVU A;  1KOU A;  3VP2 A;  2R9X A;  2B5R A;  3D3O A;  3EOI A;  5FQM A;  5CHJ A;  4L9F A;  3KSG A;  1PW8 A;  1TS7 A;  2JKF A;  4R3A A;  2PT7 A;  4DN0 A;  2QJ7 A;  1CK3 A;  1FSY A;  4L9G A;  4OOL A;  3MXR A;  3LID A;  1YKD A;  1GA0 A;  3IH9 A;  4LV3 A;  1GHM A;  2V1A A;  4H6J B;  5HDD A;  4BQM A;  4FSF A;  3DW0 A;  2WAE A;  2XEP A;  1UWP X;  5KMW A;  5KSH A;  4WL9 A;  3G4P A;  3GR2 A;  1PYY A;  2E8J A;  2O9A A;  4LGW A;  2LB9 A;  3GMW A;  1YT4 A;  3MFD A;  2Q9N A;  1CEG A;  3G32 A;  3NEC A;  3GRJ A;  3WWX A;  4P0M A;  1K57 A;  2WKR A;  1PZO A;  2A3U A;  4DXC A;  5BOH A;  5AVF A;  1F9I A;  3ULF A;  4CPK A;  3BQA A;  3C7V A;  4X1M A;  3KX0 X;  1L0G A;  1YSP A;  3H7W B;  3N8R A;  4G3V A;  2Y2P A;  1PWG A;  1N9L A;  2M1C A;  3ZHH A;  4N9L A;  1JVJ A;  5F83 A;  4KZ8 A;  3OOV A;  1JTG A;  4C3Q A;  3A0R A;  1BUE A;  1MWR A;  1S4R A;  3HCY A;  4KG2 A;  1ERO A;  1W8Q A;  2QPN A;  2XDM A;  1GSW A;  4Z9Q A;  3S7P A;  3NCK A;  4RQ9 A;  2XRO A;  1ODV A;  1YM1 A;  3T1Q B;  5DTT A;  1EWZ A;  2C5W B;  4NG2 A;  5DF7 A;  1FCO A;  5KZH A;  3IH8 A;  2QHK A;  2EWV A;  1VET A;  3BM6 A;  4X6T A;  3LR4 A;  4U0T A;  1HTZ A;  4R4S A;  3V5M A;  3RFB A;  4ZJ1 A;  3WS5 A;  1PI4 A;  4Q0H A;  1OME A;  4WN5 A;  4R4R A;  1L3L A;  1N9B A;  3V67 A;  3VOZ A;  3Q81 A;  1KGG A;  3PBN A;  4JXV A;  4QB8 A;  1KDW A;  2ZL1 A;  2HJ9 C;  2Z2M B;  2W1T A;  3OPP A;  1E3U D;  5CGW A;  2LB5 A;  4I3J A;  4Y5F A;  4DXB A;  1XA1 A;  4E04 A;  3A3D A;  1G5U A;  4HNB A;  4LV0 A;  5FI2 A;  3LY4 A;  3F1P A;  3C2W A;  3ZG7 B;  1TVF A;  1S6R A;  1YLZ A;  2O9B A;  3K3C A;  3T4T A;  1SKO B;  3MKF A;  2I9V A;  3TW8 A;  4Y13 A;  3GDI A;  1K4E A;  2OWH A;  5EVI A;  1BLS A;  1G68 A;  5KSC A;  1M6K A;  2H28 A;  4RX2 A;  2J3T D;  1XX2 A;  4MBF A;  2J80 A;  4N9K A;  4KQR A;  1XA7 A;  2JHE A;  2HZ5 A;  4S2P A;  1RP5 A;  2P9V A;  2JKR M;  5F1G A;  2EX9 A;  3WRT A;  5IT5 A;  1JNU A;  3QP2 A;  1W63 Q;  2B02 A;  2BG1 A;  3D9Y A;  1S0W A;  4DRT A;  3AGE A;  4HIA A;  4P85 A;  1OT9 A;  3V3R A;  2Y2H A;  1GSV A;  2JBF A;  3LI9 A;  1CJF A;  3HUN A;  3C5A A;  2X02 A;  3PBO A;  3E0Y A;  5GLD A;  4EUV A;  2QYB A;  4MN7 A;  3CUE A;  3KSF A;  3E2L A;  1OJG A;  2G7U A;  4E3K A;  3EGX C;  3LIF A;  5HWT A;  1CF0 A;  3T4L A;  4X69 A;  3OC2 A;  4WEL A;  5HAP A;  4HOI A;  2XF3 A;  5AQA A;  3P7N A;  1MXO A;  1T1C A;  3W4O A;  4FOF A;  2WKQ A;  3PBS A;  1NJ4 A;  1H3Q A;  3HBR A;  4PPR A;  4GS9 B;  1U60 A;  1IKG A;  1NWZ A;  1YLW A;  3S7Q A;  3S7N A;  3DWK A;  4XUX A;  4C6Y A;  1SDE A;  3PHY A;  1ZG4 A;  2WKI A;  3QP6 A;  2V9A A;  2VA0 A;  4YFM A;  1WE4 A;  2XQZ A;  4DE0 A;  4XT2 B;  1KE4 A;  3ZFZ A;  3QNB A;  4QHC A;  5DTS A;  3U4L P;  2ZQ7 A;  4Y3I A;  3IWI A;  2X71 A;  1YMS A;  3VE3 A;  2ZQ8 A;  5HWW A;  1PI5 A;  3OLO A;  5AQB A;  3QP8 A;  4Q0I A;  2XD5 A;  2J7V A;  1H8M A;  1VEU A;  2HP9 A;  1NYM A;  2XK1 A;  4WYY A;  4QY6 A;  2C6W B;  1IEM A;  4GD8 A;  4GOG A;  4JXW A;  5CTN A;  2AVX A;  1DJA A;  1SKF A;  4B4X A;  3LEQ A;  2Z6D A;  3E4Q A;  5AJG A;  3NC8 A;  1YLT A;  2H5S A;  5DVA A;  4MN6 A;  2PBY A;  4NXF A;  5CTM A;  2OAP 1;  4ZRR A;  3ZDJ A;  4N1X A;  4H6J A;  4KZ6 A;  5FQK A;  1IYO A;  1FCM A;  4HBU A;  2DRW A;  3M2K A;  5EEC A;  1GHI A;  4X25 A;  3B33 A;  1D7E A;  1OTI A;  5HAI A;  4B88 A;  4Q0J A;  3W4Q A;  2E8I A;  2VGL S;  3MJQ A;  4FH2 A;  1K57 C;  3GVB A;  3C7U A;  2XFT A;  5EM0 A;  2WZX A;  1TF1 A;  1KE3 A;  1ES5 A;  5I5L A;  2HJE A;  5IS1 A;  2EX8 A;  1MWS A;  3IS2 A;  4PHT A;  5HD5 A;  2O99 A;  4LLO B;  4OKP A;  4EES A;  1Y4O A;  4E3J A;  1PWC A;  3DTE A;  5EM1 A;  4P6B A;  3M6B A;  3IWQ A;  1GA9 A;  4S2J A;  2ZC5 B;  1K38 A;  4BD1 A;  4R23 A;  2K7S A;  2Y2M A;  3O5Y A;  2HGV A;  3MQQ A;  4JLF A;  3SH9 A;  1BLP A;  5AQ9 A;  5DF9 A;  4R0Q A;  3T50 A;  4NXB A;  5E2F A;  2HDU A;  3HLC A;  1CI8 A;  4LV2 A;  4K0W A;  2R9W A;  4EEU A;  2XA7 S;  2G2W A;  3IHB A;  1G6A A;  2Z2L B;  5EVI D;  3V3S A;  3OPL A;  4IVI A;  5KIZ A;  1H8Y A;  3LYX A;  5GHY A;  1K56 A;  5FDH A;  3SZT A;  2YKF A;  3BFC A;  2EWW A;  3NDG A;  5C5K A;  2VGK A;  2VK3 A;  5GLC A;  3H82 A;  1IYQ A;  4OLG A;  4EV4 A;  4Y2F A;  4FH4 A;  3NDE A;  5LBR A;  4OPR A;  3G6O A;  3ZNT A;  1VB6 A;  5A93 A;  3HLG A;  3UPP A;  1C3B A;  3TOI A;  1X0O A;  2FFY A;  4EUZ A;  5E2E A;  2Y2N A;  2QKP A;  3MR0 A;  4KZB A;  1L0D A;  3KYE A;  4MN5 A;  1LL5 A;  1XJ3 A;  3F1N A;  5TGF A;  3HVF A;  3IXH A;  3V50 A;  1NZU A;  1Z6F A;  1I2W A;  5G4Y A;  4QPR A;  4IUH A;  3C4O A;  5J7E A;  3M2J A;  4I39 A;  3RXX A;  3ZVW A;  1E4D A;  3HLF A;  2XLN A;  2ZM0 A;  3SH7 A;  3CMZ A;  5CEB A;  4OON A;  4YIN A;  5GHX A;  4KUK A;  3MFX A;  1ES4 A;  4R6L A;  3CPT B;  1GHP A;  4HBT A;  2VGJ A;  3QP4 A;  3IXD A;  2W0N A;  1K25 A;  5EUA A;  4LCM A; 
#chains in the Genus database with same CATH homology
 3IF6 B;  2WK0 A;  1KGF A;  4S2L A;  3MZF A;  4MBK A;  5EOO A;  2JE5 A;  3FKW A;  2EFX A;  3VOZ A;  3Q81 A;  4E3M A;  1KGG A;  3PBN A;  3UY6 A;  4JXV A;  4QB8 A;  1KDW A;  2QMI A;  3UDI A;  2UWX A;  2WGW B;  4E6W A;  2Z2M B;  3OPH A;  4ID4 A;  2J9P A;  4OQG A;  3OPP A;  1E3U D;  3IXB A;  4A5R A;  4Q8I A;  5CGW A;  4LCL A;  3QNC A;  2XGN A;  4DXB A;  1XA1 A;  1SCW A;  3W8K A;  1YLJ A;  5EVI B;  4UA9 A;  3CJM A;  2P74 A;  1K54 C;  3A3D A;  4WM9 A;  4O7D A;  4GN2 A;  1YLP A;  4LV0 A;  5FI2 A;  3IXG A;  3LY4 A;  2RCX A;  4N1H A;  5CGS A;  4KZ7 A;  3G31 A;  3Q1F A;  2V1Z A;  4E3O A;  1MPL A;  3ZG7 B;  1TVF A;  4XUZ A;  3G35 A;  3M6H A;  2EX6 A;  3Q7V A;  1S6R A;  1YLZ A;  2P9V B;  3IF6 A;  3AGD A;  1QME A;  4KEN B;  3SS4 A;  4QD4 A;  3G2Y A;  4BLM A;  3N8L A;  1YMX A;  3P98 A;  4N92 A;  3MKF A;  1XGI A;  3SH8 A;  2WGV A;  4WEJ A;  1JWV A;  4OLD A;  3IQA A;  2H0Y A;  3OZH A;  5EUA A;  1K4E A;  5EVI A;  4X55 A;  1BLS A;  4JXS A;  4BJP A;  3SS5 A;  3NIA A;  1G68 A;  5KSC A;  3A3I A;  3MKE A;  1ZC2 A;  4BL3 A;  1M6K A;  4BD0 A;  4OP5 A;  4K0X A;  4RX2 A;  1XX2 A;  1K6S A;  4OPY A;  2FFF B;  2Y2G A;  1HZO A;  5EVL A;  2ZC3 B;  1MKI A;  3N8S A;  4MBF A;  4UA7 A;  1NXY A;  2JC7 A;  4HEF A;  4N9K A;  4KQR A;  4RA7 A;  1XA7 A;  3PBQ A;  4JF5 A;  5CRF A;  5CER A;  3P09 A;  3WRZ A;  4S2P A;  2CC1 A;  1RP5 A;  2P9V A;  4WMC A;  5HL1 A;  3Q82 A;  4KZA A;  3EQV A;  2ZC7 A;  4Y7P A;  5F1G A;  1HD8 A;  2EX9 A;  3GV9 A;  4IBX A;  3WRT A;  4GZB A;  4LEN A;  3WS0 A;  2Y55 A;  1W5D A;  3MZD A;  1VQQ A;  3MXS A;  4NK3 A;  4ZJ2 A;  1BT5 A;  1KDS A;  3I7J A;  2BG1 A;  2ZC4 B;  3VSK A;  2XFS A;  1EI5 A;  3CZD A;  2OV5 A;  1S0W A;  4DRT A;  2WZZ A;  3AGE A;  1L0E A;  3HLW A;  1LI0 A;  4H8R A;  3FYZ A;  4P85 A;  3UO9 A;  3LY3 A;  3PAG A;  1ZKJ A;  1FOF A;  1JWP A;  3CG5 A;  4OQ0 A;  5AQ7 A;  3V3R A;  1Q2Q A;  2Y2H A;  2JBF A;  1K55 A;  2G2U A;  3HUN A;  3C5A A;  5EE8 A;  2X02 A;  2J8Y A;  2HPB A;  4Y0O A;  3UPN A;  3PBO A;  1O7E A;  5GLD A;  3WS4 A;  5E43 A;  4JF6 A;  5FI7 A;  2ZC6 B;  4OPZ A;  1NYY A;  3LEZ A;  3NBL A;  4WBG A;  4WZ5 C;  3E2L A;  2EXB A;  3VMA A;  4QU3 A;  1ERM A;  4GB7 A;  4E3K A;  3C4P A;  2HDQ A;  2EFU A;  4OQH A;  4X69 A;  3OC2 A;  4WEL A;  3HUO A;  1AXB A;  4OH0 A;  3NY4 A;  3DWZ A;  4MNR A;  5HAP A;  4PM6 A;  1IYP A;  2ZQD A;  3JYI A;  2XF3 A;  2A49 A;  5AQA A;  3ZNY A;  1ONG A;  2EXA A;  4KG5 A;  1MXO A;  5CGX A;  3O86 A;  3AGF A;  3W4O A;  2Y2L A;  1VM1 A;  4DF6 A;  3PBS A;  5FA7 A;  3A3E A;  1NJ4 A;  1JWZ A;  3Q7V B;  1PIO A;  3A3J A;  1BSG A;  5EOE A;  3OCL A;  4PM9 A;  1GCE A;  1ERQ A;  1L0F A;  4E3I A;  1BLH A;  2JCH A;  5U47 A;  3RXW A;  3HBR A;  1I5Q A;  4PPR A;  5F1F A;  1U60 A;  2H10 A;  1IKG A;  4IVK A;  5HFO A;  1YLW A;  4R3J A;  5FQJ A;  3UE1 A;  4EWF A;  5E2H A;  4DE3 A;  1IYS A;  2V20 A;  1E3U A;  1BLC A;  1TEM A;  3LO7 A;  3BLS A;  3DWK A;  4K91 A;  4OOM A;  4XUX A;  3GSG A;  5IHV A;  2ZQA A;  4C6Y A;  5G18 A;  2Q9M A;  1SDE A;  1FQG A;  1KVL A;  1ZG4 A;  2WKI A;  4JF4 A;  3VSL A;  4ZDX A;  2XR0 A;  2J9O A;  1Q2P A;  5CXW A;  5A90 A;  2Y59 A;  4YFM A;  1MWU A;  5HAR A;  4WZ4 A;  3UN7 A;  1WE4 A;  2Y4A A;  4OPQ A;  3S4X A;  2V2F F;  2XQZ A;  2IWC A;  4KQO A;  4XXR A;  1ZG6 A;  4DE0 A;  1KE4 A;  1FR1 A;  1N4O A;  3OCN A;  4PM8 A;  3ZG9 B;  1MY8 A;  3ZFZ A;  3V39 A;  3QNB A;  4QHC A;  5DTS A;  3GTC A;  2X01 A;  2Y2K A;  2ZQ7 A;  3G34 A;  3BYD A;  3IWI A;  2X71 A;  4JBF A;  1YMS A;  2GDN A;  2ZQ8 A;  3UDX A;  1PI5 A;  3TG9 A;  3VP1 A;  1BZA A;  1MWT A;  5AQB A;  4S2K A;  3BFF A;  4GDN A;  2OLU A;  3VFF A;  1NZO A;  2XD5 A;  3ZG5 A;  3LCE A;  2J7V A;  3N7W A;  1CI9 A;  4UHU A;  1FCN A;  2Y91 A;  5FAT A;  2HP9 A;  1NYM A;  3VP0 A;  5A91 A;  3SS3 A;  4OP8 A;  2XK1 A;  4S2N C;  4GDB A;  4WYY A;  5FAO A;  3UDF A;  2H0T A;  4QY6 A;  2C6W B;  1WYB A;  1IEM A;  3FKV A;  2RL3 A;  2WUQ A;  4Y0T A;  4HES A;  5CHM A;  4GD8 A;  1ES2 A;  1FR6 A;  2WKH A;  1NY0 A;  4GOG A;  1LL9 A;  1IKI A;  4OQI A;  2HP5 A;  4LCM A;  4JXW A;  5CTN A;  1DJA A;  3EQU A;  1SKF A;  5FAS A;  3HLB A;  4WZ5 A;  1K56 D;  1NRF A;  1W7F A;  3PTE A;  4B4X A;  2PU2 A;  2ZD8 A;  1PWD A;  2ZJ9 A;  1KVM A;  1IEL A;  3WS2 A;  3O3V A;  1L2S A;  4KZ5 A;  1XP4 A;  3NC8 A;  3DTM A;  3QHY A;  5J8X A;  5JYP A;  1RCJ A;  1YLT A;  2H5S A;  5DVA A;  3ZGA B;  2WAD A;  3IF6 C;  2PBY A;  5F82 A;  5CTM A;  2EX2 A;  3ZDJ A;  1XKZ A;  3VP4 A;  4N1X A;  5CED A;  1YLY A;  5HX9 A;  1HVB A;  5GLA A;  4KZ6 A;  3TSG A;  4RVA A;  5E2G A;  5FQK A;  4E3N A;  1IYO A;  1LI9 A;  3RJU A;  3BLM A;  1FCM A;  3Q07 A;  4HBU A;  3G30 A;  4JKT A;  1LLB A;  4UAA A;  2DRW A;  3ZVT A;  3M2K A;  5EEC A;  5EVI C;  1GHI A;  4GKU A;  4KZ3 A;  3ZG8 B;  1ES3 A;  5JYO A;  3N6I A;  1QMF A;  2WAF A;  4DDS A;  4EBP A;  1ESU A;  2Y2O A;  5EPH A;  5HAI A;  3ZCZ A;  2BLS A;  4B88 A;  3MZE A;  4Y0U A;  3A3F A;  1XPB A;  3W4Q A;  3PBT A;  2QZ6 A;  2ZMA A;  2E8I A;  1PW1 A;  4S2M A;  3UE0 A;  3BEC A;  4FH2 A;  4EBN A;  1K57 C;  4PM7 A;  1K54 A;  4ZTK A;  2HDS A;  4IBR A;  1H5X A;  3GVB A;  4JXG A;  3C7U A;  2XFT A;  1J9M A;  3BRM A;  4BL2 A;  4M3K A;  2WZX A;  4KZ4 A;  1XXM A;  1KE3 A;  5D3O A;  1BUL A;  3O87 A;  5CEC A;  5FQI A;  1KGE A;  2XH9 A;  1ES5 A;  1W8Y A;  2WYX A;  3BFG A;  4JPM A;  2EX8 A;  1MBL A;  1MWS A;  3ISG A;  3PAE A;  5M18 A;  4KZ9 A;  5GLB A;  2DNS A;  3G2Z A;  5CHU A;  4OKP A;  1I2S A;  1SHV A;  4WEK A;  5HAQ A;  4U0X A;  1K55 C;  1XGJ A;  3VP3 A;  5TR7 A;  4E3J A;  4FD8 A;  1PWC A;  1JTD A;  1YQS A;  1H8Z A;  2PU4 A;  4P6B A;  3M6B A;  4EBL A;  4DDY A;  4QJG A;  4DE2 A;  4QY5 A;  4E3L A;  3IWQ A;  1GA9 A;  4S2N A;  3BFE A;  5FAQ A;  3HLE A;  4S2J A;  3VP2 A;  1TDG A;  2R9X A;  3OPR A;  4X68 A;  2ZC5 B;  2B5R A;  2IWD A;  1K38 A;  5FQM A;  4BD1 A;  5CHJ A;  4R23 A;  2ZLY A;  2Y2M A;  4JLF A;  4MEZ A;  1BLP A;  3SH9 A;  2WKE A;  1PW8 A;  5AQ9 A;  4DE1 A;  3N4I A;  5DF9 A;  3MBZ A;  3B3X A;  4GD6 A;  4R0Q A;  3ITA A;  4U3T A;  1K4F A;  5FQ9 A;  5E2F A;  2ZM2 A;  3IHA A;  4E6X A;  2HDU A;  3IWO A;  1CK3 A;  1FSY A;  5M1A A;  3HLC A;  2WGI A;  4OOL A;  1CI8 A;  3MXR A;  4S2I A;  4LV2 A;  5A92 A;  4D2O A;  4K0W A;  2R9W A;  4OOY A;  1GA0 A;  3IH9 A;  1KE0 A;  4LV3 A;  1GHM A;  4R1G A;  2G2W A;  3IHB A;  3S1Y A;  4IED A;  1BTL A;  2WGW A;  4BQM A;  1G6A A;  2Z2L B;  4FSF A;  1M40 A;  3DW0 A;  2WAE A;  4EQI A;  2XEP A;  2ZQ9 A;  4B4Z A;  5EVI D;  5KMW A;  5KSH A;  4UA6 A;  3G4P A;  3V3S A;  3OPL A;  3GR2 A;  4IVI A;  4S2O A;  1PYY A;  1H8Y A;  4MBH A;  3HUM A;  5FSR A;  3GMW A;  5GHY A;  1K56 A;  1YT4 A;  3MFD A;  5FDH A;  2Q9N A;  5I94 A;  5FQQ A;  4ZAM A;  1LHY A;  3BFC A;  1CEG A;  3NDG A;  1PZP A;  2VGK A;  3G32 A;  4ZJ3 A;  2XD1 A;  3GRJ A;  1ONH A;  4WMC D;  5GLC A;  4P0M A;  3PBR A;  3WWX A;  1IYQ A;  4OLG A;  1K57 A;  1DJC A;  1PZO A;  2Y2J A;  2HDR A;  4KG6 A;  4EV4 A;  2A3U A;  5DF8 A;  4FH4 A;  4DXC A;  5BOH A;  3NDE A;  4P87 A;  4OPR A;  4C75 A;  4CPK A;  3ZNT A;  3FV7 A;  3C7V A;  5A93 A;  3HLG A;  1L0G A;  3UPP A;  2ZM8 A;  2ZQC A;  4F94 A;  1C3B A;  3TOI A;  5TFQ A;  3N8R A;  4X56 A;  2Y2P A;  1PWG A;  3D4F A;  2FFY A;  4EUZ A;  2Y2Q A;  5E2E A;  5GHZ A;  2IWB A;  3BEB A;  2Y2N A;  3FWL A;  3GQZ A;  3ZHH A;  4N9L A;  1JVJ A;  3HRE A;  4KZB A;  5F83 A;  5FI6 A;  2Y2I A;  4RX3 A;  4KZ8 A;  4ZBE A;  3IT9 A;  1JTG A;  1L0D A;  1RGZ A;  2I72 A;  1BUE A;  2OLV A;  3Q7Z A;  1MWR A;  4C3Q A;  4R3B A;  4KG2 A;  1ERO A;  3IF5 A;  5DTK A;  1LL5 A;  1W8Q A;  2QPN A;  1TDL A;  2OSU A;  2XDM A;  3UE3 A;  4Z9Q A;  4KQQ A;  1W79 A;  4RYE A;  3NCK A;  5M19 A;  5TGF A;  3HVF A;  4PM5 A;  1YM1 A;  3IXH A;  1CEF A;  3V50 A;  4DKI A;  3UPO A;  1FSW A;  1NZU A;  1Z6F A;  1I2W A;  3HL9 A;  4L0L A;  3O88 A;  5DTT A;  4NET A;  1EWZ A;  2C5W B;  3C4O A;  5DF7 A;  1FCO A;  5KZH A;  3M2J A;  3W4P A;  1O07 A;  1K6R A;  3RXX A;  3UNW A;  3IH8 A;  3VOY A;  3HLD A;  3ZVW A;  5HW3 A;  4PMA A;  1E4D A;  3E2K A;  4LV1 A;  3ITB A;  3HLF A;  3BM6 A;  4BEN A;  2XLN A;  1ESI A;  2ZM0 A;  5L2F A;  2HP6 A;  3SH7 A;  3ZG0 A;  5FAP A;  4X6T A;  1Y54 A;  3CMZ A;  5CEB A;  1DY6 A;  4OON A;  4YIN A;  1E25 A;  5GHX A;  4U0T A;  3BFD A;  3FZC A;  1HTZ A;  4R4S A;  1ES4 A;  3V5M A;  3VFH A;  3SOI A;  2DCF A;  3NI9 A;  4FCF A;  4ZJ1 A;  4X53 A;  3WS1 A;  3WS5 A;  1DJB A;  1PI4 A;  1GHP A;  1SDN A;  1OME A;  4HBT A;  1WYC A;  2VGJ A;  4R4R A;  4CJN A;  5GL9 A;  3IXD A;  1RGY A;  1K25 A;  4OVD A;  1N9B A;  1ALQ A;  3S22 A;  4GNU A;  4MLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...