1XGJA

Ampc beta-lactamase in complex with 3-(4-carboxy-2-hydroxy-phenylsulfamoyl)-thiophene-2-carboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure-based optimization of a non-beta-lactam lead results in inhibitors that do not up-regulate beta-lactamase expression in cell culture.
pubmed doi rcsb
source organism Escherichia coli
total genus 112
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xgjA00
1XX2A 2X02A 1KVLA 1PZOA 1LHYA 4JKTA 5G18A 4Z9QA 2XLNA 2ZM8A 2WK0A 2ZQ8A 1W8YA 4Y0UA 3ZCZA 5JYOA 5A92A 1FQGA 4S2NC 3GTCA 3V50A 4N9LA 4Y7PA 4N1HA 1NRFA 3NC8A 2HDSA 3VMAA 4DE0A 4S2IA 1PWGA 2Z2LB 3FWLA 4B88A 3G34A 4LV3A 4E3LA 2WKHA 2H5SA 3P98A 1K57A 4A5RA 4QU3A 2I72A 3AGDA 3ZNYA 5FDHA 3N8SA 2VGJA 2HDQA 2ZC3B 1GHIA 4OLDA 5EVID 3CG5A 3BYDA 5AQ7A 3VP0A 1IYSA 3ZG5A 4OOMA 3TSGA 3S22A 1GCEA 2EFUA 1W7FA 2RCXA 1BZAA 2A3UA 1K54A 4DF6A 1SKFA 1TDGA 3O3VA 2HDUA 3ZVTA 2EX8A 1YLPA 3VP1A 1JVJA 4KQQA 4BJPA 4QY5A 2QMIA 4WZ5A 4E3MA 2Y2NA 3AGFA 1BULA 4Y0OA 3HLDA 3FZCA 2C6WB 3GVBA 4KZ9A 1XPBA 1BLHA 2ZLYA 5GHZA 3IQAA 3SH7A 5TFQA 2R9WA 1MWSA 1K56D 5FQ9A 4F94A 2BLSA 4OONA 4MBHA 1IYPA 3WS4A 5HAIA 3ITBA 4H8RA 5DTSA 1CK3A 2JE5A 3UE1A 4DRTA 4KG6A 3PBSA 4OH0A 5E2HA 1FCNA 1K4FA 1SHVA 1L0FA 5FQMA 2EXBA 1PYYA 3C4OA 1C3BA 3FKWA 3UE0A 4JF5A 4DE2A 4OP5A 3IXHA 1I2WA 2ZM2A 3IF5A 4DKIA 2H10A 1PW1A 1GA9A 5A93A 4NK3A 4FH4A 2ZQ7A 4S2JA 5AQ9A 3GRJA 3BFEA 3N8LA 3NDGA 3UDFA 3O87A 3IWOA 3M2JA 3DTMA 4HBUA 5EVIC 2UWXA 5CERA 2Q9MA 5KMWA 4R3BA 4K0XA 3W4OA 2IWDA 1QMEA 1Z6FA 1CEGA 2FFYA 2XDMA 3IHAA 4PPRA 2BG1A 3C5AA 2QPNA 5KSCA 2Y4AA 4CPKA 4KQOA 4EBLA 4OOLA 5FAOA 1G6AA 5EVLA 3E2LA 5EOEA 3W4QA 2XFTA 4KZ7A 3ZFZA 5E2FA 5M18A 3UO9A 1ONHA 3BRMA 3CMZA 5IHVA 4E6XA 3DWZA 1DJAA 1K6SA 1QMFA 4IVIA 3WRZA 4R3JA 3MZEA 2EX9A 4MBFA 5M19A 5CXWA 3C4PA 3IF6C 4NETA 2VGKA 3ZVWA 3CJMA 3UY6A 4C75A 2PBYA 5FQQA 1O7EA 3G4PA 2ZC6B 3MKFA 4GD6A 4GN2A 4X6TA 5CRFA 1JTDA 4X69A 5BOHA 2V2FF 4LCMA 3Q07A 1YLWA 4IVKA 5DTTA 1LI9A 3M6BA 3PAGA 1L0GA 1MPLA 5JYPA 2Y2JA 3IXDA 3UPOA 1WE4A 4UA6A 5FAQA 1NJ4A 3IXBA 5GLCA 4FH2A 3WS2A 4PM9A 4BD0A 3E2KA 4LV0A 3Q7VB 3MBZA 4WM9A 3V3SA 3SS4A 4E3IA 2ZQ9A 3GQZA 3LY4A 3IH9A 3MXSA 3NDEA 4YFMA 4L0LA 4KZ8A 2WGIA 1XA7A 1YLZA 2DCFA 1KE4A 2X71A 2V20A 3LY3A 3Q82A 2P9VB 3Q7VA 4OQIA 5CTNA 1YT4A 3OCLA 3LCEA 4MBKA 4WZ4A 3IT9A 3IWQA 4WELA 4BENA 4R0QA 3I7JA 4WMCD 1XP4A 4ZTKA 3BM6A 2X01A 2P9VA 5GHYA 3UNWA 1YLJA 5CECA 3BLSA 4X56A 2PU2A 4X68A 2OLVA 4E3JA 2XGNA 1DJCA 1VM1A 4OOYA 3PBQA 4S2KA 4BL2A 5KSHA 1XGJA 1FR1A 3ZG7B 4BD1A 1YMXA 1ES2A 4DDYA 3N6IA 3WS1A 2ZQCA 1FCMA 3ISGA 4ID4A 1XXMA 3VSKA 1YQSA 3NCKA 4P0MA 4R1GA 2ZC4B 1NY0A 4PM5A 1FR6A 2V1ZA 2HP9A 2DRWA 4U3TA 4FCFA 3RXWA 2WGWB 2ZMAA 3EQVA 4OQHA 1Q2PA 3HBRA 1MXOA 4D2OA 5A91A 5HL1A 2XR0A 4X53A 3GSGA 1ZKJA 3HVFA 4KZ6A 4GB7A 4EBPA 1K38A 1YLTA 2P74A 2WGWA 3N8RA 1ERQA 4UHUA 1YM1A 2OLUA 3BFCA 3IF6A 3OPRA 1MWRA 2OSUA 3P09A 4HEFA 5CHMA 4BLMA 4DE3A 4JXVA 4C3QA 2XD5A 4E6WA 5EPHA 1DY6A 5A90A 5HAQA 3ZNTA 3DWKA 3M2KA 3IXGA 2J9OA 3V3RA 1ZG4A 3OZHA 1ESIA 1ZC2A 1BT5A 4MEZA 3W4PA 3NY4A 2RL3A 5FATA 2B5RA 4EBNA 3G35A 2HP5A 1FSWA 3HLGA 1WYCA 4PMAA 3PBTA 3CZDA 5KZHA 3G2YA 3TG9A 1E3UA 5DF9A 5HX9A 3UPNA 3ZGAB 4E3OA 5M1AA 5FQIA 3OCNA 3ZG0A 5HARA 4FSFA 2WAFA 4MLLA 3VSLA 1MY8A 1JTGA 2Y59A 2EX6A 5FI2A 4ZJ3A 3ZG9B 4IBXA 3OPLA 4OKPA 5E2EA 3ZHHA 1EI5A 2WKEA 3O88A 5FI7A 5D3OA 1NXYA 3V5MA 1SDNA 2ZM0A 4XUZA 1BLPA 5TGFA 4GDBA 3UDXA 3GMWA 1NZOA 1RP5A 3GR2A 3HLBA 3SS5A 3ZG8B 1IKIA 2Y2KA 4E3NA 5L2FA 2CC1A 4LENA 2ZD8A 1XGIA 2XEPA 4Y0TA 1RGYA 1OMEA 3PAEA 4XXRA 3HLFA 4S2NA 4BL3A 3A3JA 4BQMA 1ALQA 4U0TA 2Y2QA 4OQGA 1S0WA 2XF3A 1HVBA 5HFOA 3VP4A 1GA0A 1ES4A 4OPZA 4KZBA 4S2LA 5GLDA 4EQIA 4JXWA 1BUEA 3A3DA 1YMSA 3OPHA 1FOFA 5TR7A 1WYBA 1FSYA 4UA7A 2OV5A 3NIAA 3IHBA 4RX3A 3Q1FA 4Q8IA 1K57C 3M6HA 2EXAA 3RXXA 3Q81A 3MZDA 2A49A 5DTKA 3HUNA 1KDWA 5HAPA 4HESA 3A3FA 4KZ3A 4QB8A 3S4XA 1O07A 5HW3A 1KGEA 4DXCA 1GHPA 1I2SA 4R23A 4S2PA 1K54C 4O7DA 1LI0A 3IH8A 1SDEA 1JWPA 2HP6A 4JPMA 5EOOA 5GL9A 1MKIA 4P6BA 2JC7A 2QZ6A 2ZQAA 5FA7A 1RGZA 4WZ5C 4JF4A 5EECA 4QHCA 1EROA 1JWVA 5E2GA 1ES5A 1PI4A 2WZZA 4ZJ2A 2H0YA 4RX2A 1VQQA 1ES3A 1ESUA 3HLEA 1N9BA 1FCOA 1H5XA 1XKZA 1PWCA 3IWIA 3WRTA 3VFHA 3AGEA 4GOGA 2WKIA 4GZBA 5GLAA 1KGFA 2Y91A 1PW8A 3HUMA 3PTEA 4DE1A 5EVIB 2WZXA 4OLGA 3S1YA 4WBGA 2HPBA 3G2ZA 3DW0A 5F1FA 4S2OA 5CGWA 1IYOA 3UE3A 4MNRA 3LO7A 3WS0A 5EVIA 4R4RA 1K25A 5F1GA 1H8ZA 1PWDA 4S2MA 3VFFA 3BLMA 2C5WB 4JXSA 1IELA 1AXBA 1KVMA 2Y2LA 3BFGA 3JYIA 3V39A 2JCHA 2WAEA 4C6YA 4OVDA 4ZAMA 4QY6A 1IEMA 1ONGA 3C7VA 4UA9A 4K0WA 5CHJA 2Y2IA 4EV4A 3IF6B 3QNCA 4EWFA 1IKGA 3MKEA 1L0DA 4KZ5A 3SS3A 2XH9A 4WEKA 1K56A 1TDLA 2J7VA 5CGXA 2XFSA 3BECA 3HLCA 5CGSA 5CEDA 3G31A 4ZDXA 1K55C 4KZAA 5FSRA 4CJNA 4RA7A 4OPQA 1LL9A 1ZG6A 4LCLA 3UDIA 1PZPA 4GNUA 4ZBEA 1MWUA 4GKUA 3SH9A 4B4XA 4PM8A 5I94A 2H0TA 1Q2QA 2E8IA 3HL9A 2GDNA 4OPRA 3O86A 4N9KA 5J8XA 4IEDA 5CHUA 1XA1A 4OQ0A 1W79A 4R4SA 5AQAA 3GV9A 2ZC7A 1E25A 2IWBA 3UPPA 3A3IA 3BFDA 3VOZA 1KE0A 1KDSA 3HUOA 4XUXA 1NZUA 3VP3A 4JLFA 4OP8A 4JF6A 1CEFA 2G2WA 1BTLA 4WYYA 5FQKA 1G68A 2EFXA 5U47A 3OC2A 2J8YA 2WGVA 4B4ZA 3LEZA 1DJBA 3C7UA 3QNBA 1M40A 1N4OA 1W8QA 5GHXA 2WADA 4GDNA 1SCWA 3G30A 2IWCA 4OPYA 4P87A 2Y2PA 1HZOA 3WWXA 3W8KA 2Y55A 1L0EA 4KQRA 1CI8A 5E43A 1LL5A 4YINA 4M3KA 3QHYA 5F82A 1MWTA 4PM6A 1BSGA 4N1XA 3WS5A 5DF8A 1M6KA 3NBLA 1K4EA 3MFDA 3RJUA 1EWZA 4KENB 5CTMA 2FFFB 1E3UD 5GLBA 3FKVA 3Q7ZA 3PBRA 2HDRA 1JWZA 3HLWA 2XQZA 3N7WA 2Y2OA 1W5DA 3N4IA 4KG5A 1HD8A 5FAPA 3FYZA 1KE3A 1TVFA 3MZFA 2XK1A 1K6RA 2WYXA 3G32A 1GHMA 1PI5A 1RCJA 4ZJ1A 1L2SA 3VP2A 3OPPA 5AQBA 2ZQDA 2Z2MB 1LLBA 3D4FA 3SOIA 4UAAA 3TOIA 3EQUA 4DXBA 2JBFA 3VOYA 2J9PA 1K55A 4X55A 4KZ4A 1BLCA 2Y2MA 1HTZA 4LV2A 4RVAA 1ERMA 1BLSA 2PU4A 2Q9NA 3PBOA 5FI6A 4E3KA 2ZJ9A 4WMCA 5DF7A 2Y2GA 5F83A 1U60A 3BFFA 3MXRA 1CI9A 1NYYA 1PIOA 4IBRA 4K91A 4JBFA 4RYEA 4KG2A 2WUQA 4QJGA 5FASA 4WEJA 1MBLA 5DVAA 4QD4A 4P85A 5EE8A 4PM7A 1Y54A 2ZC5B 4N92A 2EX2A 4EUZA 1IYQA 2XD1A 3NI9A 2Y2HA 3UN7A 4JXGA 3SH8A 2G2UA 3ZDJA 1S6RA 1H8YA 3BEBA 1I5QA 5EUAA 4U0XA 4FD8A 1KGGA 4GD8A 4DDSA 1TEMA 4LV1A 5CEBA 1J9MA 3B3XA 5FQJA 3FV7A 2DNSA 2R9XA 3HREA 3ITAA 1NYMA 3A3EA 3PBNA 1E4DA 4HBTA 1YLYA
chains in the Genus database with same CATH superfamily
1KVLA 5J7EA 5G18A 4HQAA 4R38A 3KSGA 1W8YA 5A8BA 3ZCZA 1VETA 1FQGA 2ZOHA 3GTCA 3NC8A 3T1XA 4S2IA 2OWHA 3FWLA 4YNRA 4JGRA 2B02A 3G34A 1ZHHB 1TS0A 3P98A 4A5RA 2VGJA 4GJ4A 3CG5A 3BYDA 5AQ7A 1IYSA 5TBMA 3S22A 4AFIA 1BZAA 1LSVA 4DF6A 4BWIA 1YLPA 1JVJA 2QMIA 5J3WA 4MN6A 4EXOA 3FZCA 1D1JA 1XPBA 2ZLYA 3SH7A 2QKPA 4I3IA 2R9WA 1K56D 4F94A 2BLSA 3NULA 1IYPA 5IS1A 5HAIA 4H8RA 5DTSA 5HL6A 2IA2A 4OH0A 5EM0A 4HOIA 5E2HA 1FCNA 1L0FA 3MQ0A 3IXHA 3IF5A 5G4YA 1PW1A 5A93A 3GRJA 3BFEA 3N8LA 4HBUA 5EVIC 5CERA 4QPRA 4K0XA 1QMEA 1Z6FA 3A0RA 2XDMA 3IHAA 2J3TD 2MJ6A 3C5AA 4KQOA 4EBLA 4OOLA 3E2LA 3EEHA 5EOEA 2XFTA 2VGLM 4KZ7A 3ZFZA 4E6XA 1QMFA 2VZWA 4R3JA 1EW0A 4IHQA 5L10A 2EX9A 3F1OA 5CXWA 4NETA 2BASA 1T18A 4PHTA 2PBYA 2W1RA 3FC7A 3M6BA 3PAGA 3IXDA 3UPOA 4UA6A 1VEUB 4BD0A 4LV0A 3Q7VB 2VJWA 3MBZA 3V3SA 3GQZA 3NDEA 1TS7A 2WGIA 1YLZA 4UQIS 3LY3A 2P9VB 2ZBBA 3C8CA 3IT9A 4CQHA 3EGDC 4WMCD 3BM6A 3UNWA 4E3JA 3NOTC 2OLVA 3VOLA 2VX8A 2AVXA 1LSXA 3QP5A 1SKOA 4ID4A 2V1ZA 5HPFA 3VE3A 3RXWA 2WGWB 4OQHA 2B18A 5HL1A 4X53A 3GSGA 3HVFA 2ZOIA 1K38A 2P74A 3JVUA 3N8RA 2VA0A 3OPRA 3DTIA 5A90A 3ZNTA 2J9OA 3V3RA 3OZHA 1ZC2A 1BT5A 3W4PA 1CJFA 2RL3A 4I3AA 3G35A 2V1AA 3CZDA 4FUWA 3TG9A 5DF9A 3ULFA 3ZG0A 3VSLA 2Y59A 2NUPC 2EX6A 3ZG9B 3S7NA 2WKPA 2FH5A 1EI5A 2O99A 5FI7A 3V5MA 1IFQA 3UDXA 4GDBA 4HJ3A 2JHEA 1NZOA 2JKGA 3GR2A 3HLBA 2W27A 2Y2KA 4E3NA 2CC1A 5J4EA 1OMEA 3PAEA 5MC7A 4O8GA 2G7UA 1S0WA 3LR4A 3UMDA 4S2LA 1ODVA 2V8CA 4JGOA 2OOLA 1FOFA 5TR7A 1WYBA 1FSYA 1OPXA 3IHBA 4RX3A 3RXXA 2O0YA 2A49A 4HJ4A 3RH8B 3A3FA 3S4XA 4QB8A 1GHPA 4R23A 3IH8A 3CLOA 4JPMA 4ARZA 1MKIA 4P6BA 2QZ6A 5FA7A 3UB8A 1RGZA 3MQOA 5E2GA 4ZJ2A 2H0YA 3D72A 2HZ5A 4R3AA 1ESUA 3HLEA 1N9BA 2HGVA 3VFHA 2KOIA 3AGEA 4GZBA 5GLAA 2Y91A 3T4JA 3PTEA 3S1YA 2HPBA 3G6OA 3H9WA 4O0PA 1G5UA 1K25A 1XJ4A 1D7EA 1PWDA 4S2MA 4YWZA 3VFFA 2C5WB 1AXBA 1KVMA 3BFGA 5LBRA 4D60A 2JCHA 5HD5A 4UA9A 1TD5A 5CHJA 3HJIA 1UWNX 4NEED 4KZ5A 5F69A 2QJ5A 5TJJA 1K56A 1TDLA 1L3LA 5CGSA 3HJKA 4HNBA 4CJNA 4RA7A 4OPQA 1LL9A 4LCLA 4B9OA 1PZPA 1MWUA 4GKUA 4B4XA 4PM8A 4G3KA 1Q2QA 2E8IA 3HCYA 4N9KA 1LSWA 1XA1A 5AQAA 2ZC7A 2LB5A 1KE0A 1XFQA 4G3VA 1NZUA 3VP3A 4OP8A 1CEFA 5HPIA 2PT7A 5U47A 1H3QA 2V1BA 1PRQA 3C7UA 3QNBA 1M40A 5GHXA 4Y3IA 2WADA 4GDNA 1SCWA 3G30A 5EFWA 2IWCA 1F2KA 2Y55A 1OJ5A 5E43A 1MWTA 1T1BA 1BSGA 3WS5A 4P6ZM 1P0ZA 3E4PA 2JKRI 2FFFB 5GLBA 2W3HA 1JWZA 2XQZA 4ZRRA 5F68A 1KE3A 2XK1A 2WYXA 3G32A 4ZJ1A 3CPTA 1L2SA 5L07A 1DP6A 3EQUA 3VOYA 5EM1A 1K55A 5HD3A 2OWJA 4RVAA 3A0VA 4Y15A 4E3KA 3GECA 2ZJ9A 4WMCA 3BFFA 1CI9A 2ZMFA 1J3WA 4FOFA 1NYYA 4KG2A 1MBLA 5EE8A 4PM7A 1Y54A 2XA7S 3ZDJA 1H8YA 2QYBA 3EWKA 1KGGA 4GD8A 3O5YA 3B3XA 3GDIA 3A3EA 1LHYA 2A24A 4Z9QA 2ZM8A 2ZQ8A 4BBTA 4Y0UA 1OT6A 2YKHA 4S2NC 4N9LA 4DE0A 1PWGA 1K57A 2Q0OA 3KYEA 3ZNYA 2HDQA 4MMNA 3KSIA 3ZG5A 2GJ3A 1W7FA 1SKFA 1TDGA 2GNXA 2HDUA 1MZUA 3ZVTA 4BJPA 2Y2NA 3AGFA 2HF6A 4Y0OA 1TF1A 4ESPA 3GVBA 1GSVA 4BBUA 4EEUA 4MBHA 3UE1A 4DRTA 4EETB 3MJQA 4JGPA 1SHVA 3IX4A 5FQMA 3IX8A 2ZM2A 2PR6A 3TE8A 3F1NB 5KMWA 1CEGA 4WN5A 2Y4AA 5FAOA 5EVLA 3W4QA 3TW8A 5E2FA 1S4SA 3T4KA 3MZEA 5M19A 3LIEA 3IS2B 2PYPA 3G4PA 1V9YA 1JTDA 4X69A 2V2FF 3Q07A 1YLWA 5CX7A 5DTTA 4Y13A 1MPLA 2VGLS 2Y2JA 1WE4A 5FAQA 3IXBA 3DTEA 3SW1A 4L0LA 1XA7A 1KE4A 4MN7A 2A24B 2H28A 3Q7VA 3OCLA 3LCEA 4MBKA 1S1YA 4EU0A 3I7JA 1SZVA 2P9VA 2JKFA 5CECA 3BLSA 2PU2A 2XGNA 1DJCA 4L9FA 4KUOA 4S2KA 4BL2A 1FR1A 1YMXA 2ZQCA 1FCMA 3CUEC 1ACFA 2ZC4B 1NY0A 1FR6A 2DRWA 3EQVA 2PDRA 4GB7A 4EBPA 1YLTA 3BJNA 2PD7A 2WGWA 2VV6A 1YM1A 4GS9B 2OSUA 2D01A 4JXVA 2XD5A 3DWKA 3M2KA 3IXGA 2LB9A 3NY4A 4EBNA 1NLZA 2HP5A 3LGOA 1FSWA 3G2YA 5M1AA 2OAP1 3OCNA 3CAXA 1OTBA 4FSFA 5HARA 1MY8A 5FI2A 4ZJ3A 3OPLA 4OKPA 3OOVA 2PBDP 5D3OA 1SDNA 4XUZA 5TGFA 1PFLA 3GMWA 1RP5A 3ZG8B 5L2FA 2V0WA 2ZD8A 1XGIA 2R78A 3HLFA 4BL3A 3A3JA 3BY8A 2Y2QA 5HFOA 1HVBA 3VP4A 1GA0A 4KZBA 5GLDA 4EQIA 3DAVA 1YMSA 4EERA 2OV5A 3LYXA 4Q8IA 2EXAA 3Q81A 3QP1A 4WL9A 3HUNA 2NUTC 1KDWA 5HAPA 5F5YA 5HWTA 4NXFA 3D3OA 2J3WA 2GX5A 1JWPA 2ZQAA 1OTAA 5EECA 5I5LA 5IT5A 1EROA 2M7VA 3QP6A 1XFNA 4RX2A 1H5XA 1VHMA 2V8FA 4Q0JA 2QWSA 3S7OA 5EVIB 3G2ZA 3DW0A 1OTDA 2P7JA 5CGWA 3LO7A 3KSHA 4BMWA 4LRXC 2V9AA 1Z09A 4QY6A 1IEMA 3PHYA 2J80A 4EWFA 1L0DA 2XH9A 5CGXA 4PAUA 2XFSA 3BECA 3HLCA 5CEDA 3G31A 1ZG6A 3UDIA 4HJ6A 4HHDA 5I94A 5DJTA 1OTIA 2GDNA 3O86A 2K31A 2IWBA 1W79A 4L9GA 4QWOA 2EWVA 4WYYA 3JPUA 1G68A 3B33A 3C30A 2WGVA 3OC2A 4B4ZA 1F5MA 5FL3A 1W8QA 2FZ0A 3LR0A 2Y2PA 1HZOA 3WWXA 3W8KA 4KQRA 1CI8A 2WKQA 1ZTUA 4YINA 5F82A 1Y28A 3K2NA 2KLIA 3UB6A 3P7NA 2JKTI 2JKTM 3T12B 4KG5A 1HD8A 1H0MA 3UB7A 3MZFA 4CLCC 2ZQDA 4P6ZS 3TOIA 2JBFA 1UWPX 1BLCA 1YPRA 4WUJA 1ERMA 1BLSA 2Q9NA 3PBOA 5DF7A 5F83A 3MXRA 4GHIA 2ZL1B 5DVAA 5HDDA 3IBJA 3EEAA 4EUZA 2EX2A 2XD1A 2I9VA 2Y2HA 3UN7A 3SH8A 2G2UA 1S6RA 4U0XA 2KX6A 2HV1A 5DKKA 3R7WB 1XJ3A 3BY9A 3HREA 3ITAA 1LT0A 1NYMA 1E4DA 5AVEA 1XX2A 2X02A 4JKTA 2PHYA 4HP9A 5HDSA 3TJZC 5HWVA 5JYOA 5A92A 5EV0A 3V50A 4Y7PA 4N1HA 1NRFA 1YAXA 1T19A 2Z2LB 4CLCB 4E3LA 4QU3A 5FDHA 2ZC3B 1GHIA 5EVID 1D06A 2E8JA 3VP0A 2QHKA 3LICA 1GCEA 4NXBA 2EFUA 1S66L 1K54A 3O3VA 2B95A 3VP1A 4QY5A 4WZ5A 4E3MA 4HH2A 4LGWA 2C6WB 4KZ9A 1BLHA 3IQAA 1WA9A 1CK3A 2JE5A 4KG6A 3PBSA 1K4FA 3C4OA 3S7QA 3FKWA 4JF5A 4OP5A 1I2WA 3PXPA 3LR5A 1GA9A 4FH4A 3QP8A 2ZQ7A 3NDGA 3O87A 3IWOA 3M2JA 4DJ3A 2PR5A 3W4OA 2IWDA 2FFYA 4PPRA 1K0KA 3LIFA 2BG1A 4R70A 3F1NA 3MS6A 3UO9A 3CMZA 3DWZA 3PR6A 1K6SA 4IVIA 4YOFA 4GHIB 4MBFA 3C4PA 3IF6C 3U4LP 1IOUA 3UY6A 1O7EA 2ZC6B 3MKFA 4GD6A 4GN2A 4X6TA 5CRFA 2K7SA 5BOHA 2W1TB 3IS2A 1LI9A 4WF0A 5JYPA 3OLOA 1NJ4A 4FH2A 3WS2A 4PM9A 3E2KA 1A0KA 4WM9A 4F3LB 3SS4A 3LY4A 4YFMA 3MXSA 2DCFA 2X71A 3Q82A 5C5KA 2W3DA 5CTNA 4M4XA 3IWQA 4WELA 4R0QA 1XP4A 4H6JB 1YLJA 4X56A 1S67L 4HH3A 3PBQA 1W63M 3KO6A 1XGJA 4BD1A 4DDYA 4PKYA 3UE6A 3VSKA 1YQSA 4R1GA 4PKYG 2GZAA 4MN5A 2HP9A 4U3TA 5DFXA 3T4SA 4FCFA 2ZMVA 3HBRA 3EOIA 4D2OA 1YKDA 1ZKJA 4KZ6A 1F9IA 4B93A 1GSXA 4BLMA 3P09A 1MWRA 4X1MA 4HEFA 5CHMA 4DE3A 4E6WA 5EPHA 4Y17A 1ZG4A 4GS9A 3T4OA 2UV0E 4KUKA 1UGUA 5HX9A 3UPNA 4CLCD 1NWZA 4ETZA 2WAFA 1JTGA 3T1RA 5E2EA 4ETXA 3DBAA 3K3CA 3O88A 2XSSA 1BLPA 4EESA 1IKIA 2XEPA 1RGYA 2D02A 4BQMA 2JN7A 1PNEA 1ALQA 1DRMA 4OQGA 3LIDA 1S4RA 3NOPC 2HJ9C 4OPZA 4JXWA 1BUEA 4IUHA 3KYQA 3OPHA 4UA7A 1FIKA 3NIAA 2PAVP 1K57C 3M6HA 3A0SA 5DTKA 3C2WA 3NOUC 4KZ3A 1O07A 5HW3A 1OTEA 1I2SA 3MSHA 1LI0A 5GL9A 1SDEA 5EOOA 2Y79A 4XT2A 3BWLA 2JC7A 2ACGA 4QHCA 4LRYC 1JWVA 1PI4A 4RQ9A 1NRJA 2VV8A 4LFUA 5AJGA 3T4QA 3L9KA 1FCOA 1XKZA 1PWCA 4GOGA 2WKIA 1KGFA 3NJAA 5F6AA 4NXEA 3H82A 4HI4A 5F1FA 3UE3A 5EVIA 5F1GA 4R6LA 3U2AA 1H8ZA 3UB5P 1IELA 2Y2LA 4C6YA 4OVDA 1ONGA 3C7VA 2W3EA 2O9CA 4K0WA 2Z6DA 3IX3A 3QNCA 1IKGA 4L9EA 3SS3A 2J7VA 5DJUA 2VEAA 4E04A 4ZDXA 4KZAA 3MXQA 1BYWA 2L1MA 3BQAA 4ZBEA 3SH9A 2H0TA 3F1PB 4OPRA 5L8MA 5J8XA 4IEDA 5CHUA 4OQ0A 3VOZA 3C38A 4XUXA 5G4ZA 1BTLA 5FQKA 2EFXA 4EW7A 1TS8A 1DJBA 3R4KA 4NG2A 3D9YA 4EUVA 4P87A 4II7A 4WLAA 3OBFA 4Z1WA 2O9BA 1LL5A 3QHYA 4PM6A 4N1XA 3W2ZA 5DF8A 2DMWA 3NBLA 1K4EA 3RJUA 1EWZA 1E3UD 3FKVA 3Q7ZA 3PBRA 2HDRA 2Y2OA 2EA9A 3N4IA 2P04A 5FAPA 2QJ7A 3FYZA 1TVFA 4XT2B 1GHMA 3VP2A 5DFYA 2Z2MB 3D4FA 4UAAA 4DXBA 4GW9A 4X55A 3FPVA 2PU4A 3DTKA 1CQAA 1P97A 1PIOA 5FASA 2WUQA 4WEJA 3H82B 3ZQ5A 2XROA 4QD4A 2ZC5B 1XJ2A 4N92A 1IYQA 2ZL1A 3NI9A 5DKLA 4HY8A 3BEBA 3BQ8A 1G28A 4DDSA 4KQDA 4LV1A 2Y8HA 4IJGA 2DNSA 4HIAA 5K5BA 3R7WA 4HBTA 3T4LA 1PZOA 1VETB 1FILA 2XLNA 3UMEA 1AWIA 3T1QB 2WK0A 3CWFA 3FG8A 2HDSA 4GLQA 3VMAA 1STZA 1F98A 4B88A 4LV3A 2WKHA 2H5SA 5IU1A 4UEYA 2I72A 3AGDA 5TBMB 3N8SA 3IBRA 4OLDA 4CLCA 4OOMA 3TSGA 4K08A 2RCXA 2A3UA 1DP8A 2VKSA 2EX8A 4LLOB 4KQQA 4LPZA 1T1CA 1BULA 3HLDA 5GHZA 5TFQA 1MWSA 5FQ9A 2VK3A 3MFXA 4OONA 4NXGA 3WS4A 3ITBA 2INWA 2EXBA 1PYYA 4GCZA 1C3BA 3UE0A 4DE2A 3MR0A 4DKIA 2H10A 4NK3A 4S2JA 1JNUA 5AQ9A 5L09A 4IUKA 3UDFA 3DTMA 2UWXA 2Q9MA 4R3BA 3T4TA 3E98A 5KSCA 2QPNA 4CPKA 1G6AA 3F1OB 5HSQA 3KSFA 5M18A 1ONHA 3BRMA 3NECA 5IHVA 1DJAA 3WRZA 1S1ZA 4DMZA 3E4QA 2VGKA 3ZVWA 3CJMA 4C75A 4UQIM 5FQQA 4EEPA 4MDZA 4LCMA 4X1LA 1P9WA 4IVKA 1L0GA 3H7WA 3LR3A 3MF0A 5GLCA 2W1TA 3LEQA 3QP2A 3S7PA 3BW6A 4E3IA 2ZQ9A 1GSWA 3IH9A 4KZ8A 2V20A 5FEGA 4F3LA 4OQIA 3FPWA 3MMHA 1YT4A 4EQ1A 4WZ4A 4BENA 3ZYTA 2XRNA 4ZTKA 2X01A 3ICYA 2V0UA 1SKOB 5GHYA 3LI9A 1W63Q 4X68A 1VM1A 3LIBA 4OOYA 3UB9A 5KSHA 3ZG7B 1HLUP 1ES2A 3N6IA 3WS1A 4H6JA 3ISGA 1XXMA 4P0MA 3NCKA 1OJGA 3E4OA 4PM5A 3SZTA 2ZMAA 1Q2PA 1MXOA 2PRFA 5A91A 2VLGA 2XR0A 1X0OA 2W3FA 4BBVA 1ERQA 4G3WA 4UHUA 2OLUA 3BFCA 3IF6A 2O9AA 5HDCA 4C3QA 1DY6A 2A2LA 5HAQA 1ESIA 4MEZA 1XJ6A 4I3JA 5FATA 2B5RA 3MQQA 3HLGA 1WYCA 4PMAA 3PBTA 5KIZA 4MCWA 5KZHA 4Y2FA 3KYZA 4I5SA 3P01A 3RTYA 1E3UA 3ZGAB 4E3OA 1Y4OA 5FQIA 4Y5FA 4X25A 4MLLA 3LFVA 4IBXA 3NHQA 3ZHHA 2WKEA 3LIAA 4HP4A 1NXYA 2ZM0A 3SS5A 4LENA 4Y0TA 2VV7A 4XXRA 4S2NA 4U0TA 2XF3A 2P08A 1ES4A 2PD8A 3RFBA 3TRCA 2JKRM 3A3DA 4I39A 3Q1FA 3H7WB 3MZDA 1LL8A 2WKRA 4HESA 3B42A 4ARZB 1KGEA 1OT9A 4DXCA 4S2PA 1K54C 4O7DA 2HP6A 2HJEA 4WZ5C 4JF4A 1ES5A 1KOUA 2J3TC 2WZZA 3B47A 1MKMA 1VQQA 1ES3A 2YKFA 3IWIA 3E0YA 3WRTA 4JGQA 2L0WA 1PW8A 3HUMA 4DE1A 3QP4A 2WZXA 4OLGA 4WBGA 1TS6A 4S2OA 2W3GA 1IYOA 2W0NA 1V9ZA 4MNRA 3WS0A 3CITA 2OAQ1 4R4RA 1CF0A 3PYPA 5FDSA 3BLMA 4JXSA 3VV4A 3T50A 3V39A 3JYIA 2WAEA 4I38A 4ZAMA 2Y2IA 4EV4A 3IF6B 4Q0IA 3MKEA 1YSQA 3KX0X 5AVFA 4WEKA 2Z6CA 3V67A 2BTFP 4NKPA 1K55C 2KDKA 5FSRA 4GNUA 3HL9A 4R4SA 3UPPA 3GV9A 1E25A 3A3IA 3BFDA 1KDSA 3HUOA 3F1PA 4JLFA 4JF6A 2G2WA 1NLYA 3JVVA 3VE4A 2J8YA 5FEFA 3LEZA 2K2NA 1N9LA 3L7HA 1N4OA 1T1AA 4OPYA 3CHWP 5EVEA 1MC0A 1H8MA 1VB6A 1L0EA 5HWWA 1N9OA 5HZHA 4M3KA 1M6KA 3CUEA 3T1SA 3LI8A 3MFDA 4KENB 5CTMA 2L4RA 1P9RA 3HLWA 4DJ2A 3CPTB 3N7WA 1YSPA 2PYRA 1W5DA 2EWWA 4ME4A 1K6RA 1PI5A 1RCJA 3OPPA 4LRZE 5AQBA 1LLBA 3SOIA 2XA7M 2J9PA 4KZ4A 2Y2MA 2M1CA 1HTZA 4LV2A 5FI6A 1N9NA 2Y2GA 1U60A 4FTXA 3CI6A 4IBRA 4RYEA 4JBFA 4K91A 4QJGA 3EGXC 3LUQA 4O01A 4P85A 1DP9A 2M7UA 4JXGA 1I5QA 5EUAA 4DN0A 4FD8A 4Q0HA 2CMNA 1VEUA 1TEMA 5CEBA 1J9MA 5FQJA 4CLCE 3FV7A 2R9XA 1G6OA 3K3DA 3PBNA 1YLYA
chains in the Genus database with same CATH topology
1XX2A 2X02A 1KVLA 1PZOA 1LHYA 4JKTA 5G18A 4Z9QA 2XLNA 2ZM8A 2WK0A 2ZQ8A 1W8YA 4Y0UA 3ZCZA 5JYOA 5A92A 1FQGA 4S2NC 3GTCA 3V50A 4N9LA 4Y7PA 4N1HA 1NRFA 3NC8A 2HDSA 3VMAA 4DE0A 4S2IA 1PWGA 2Z2LB 3FWLA 4B88A 3G34A 4LV3A 4E3LA 2WKHA 2H5SA 3P98A 1K57A 4A5RA 4QU3A 2I72A 3AGDA 3ZNYA 5FDHA 3N8SA 2VGJA 2HDQA 2ZC3B 1GHIA 4OLDA 5EVID 3CG5A 3BYDA 5AQ7A 3VP0A 1IYSA 3ZG5A 4OOMA 3TSGA 3S22A 1GCEA 2EFUA 1W7FA 2RCXA 1BZAA 2A3UA 1K54A 4DF6A 1SKFA 1TDGA 3O3VA 2HDUA 3ZVTA 2EX8A 1YLPA 3VP1A 1JVJA 4KQQA 4BJPA 4QY5A 2QMIA 4WZ5A 4E3MA 2Y2NA 3AGFA 1BULA 4Y0OA 3HLDA 3FZCA 2C6WB 3GVBA 4KZ9A 1XPBA 1BLHA 2ZLYA 5GHZA 3IQAA 3SH7A 5TFQA 2R9WA 1MWSA 1K56D 5FQ9A 4F94A 2BLSA 4OONA 4MBHA 1IYPA 3WS4A 5HAIA 3ITBA 4H8RA 5DTSA 1CK3A 2JE5A 3UE1A 4DRTA 4KG6A 3PBSA 4OH0A 5E2HA 1FCNA 1K4FA 1SHVA 1L0FA 5FQMA 2EXBA 1PYYA 3C4OA 1C3BA 3FKWA 3UE0A 4JF5A 4DE2A 4OP5A 3IXHA 1I2WA 2ZM2A 3IF5A 4DKIA 2H10A 1PW1A 1GA9A 5A93A 4NK3A 4FH4A 2ZQ7A 4S2JA 5AQ9A 3GRJA 3BFEA 3N8LA 3NDGA 3UDFA 3O87A 3IWOA 3M2JA 3DTMA 4HBUA 5EVIC 2UWXA 5CERA 2Q9MA 5KMWA 4R3BA 4K0XA 3W4OA 2IWDA 1QMEA 1Z6FA 1CEGA 2FFYA 2XDMA 3IHAA 4PPRA 2BG1A 3C5AA 2QPNA 5KSCA 2Y4AA 4CPKA 4KQOA 4EBLA 4OOLA 5FAOA 1G6AA 5EVLA 3E2LA 5EOEA 3W4QA 2XFTA 4KZ7A 3ZFZA 5E2FA 5M18A 3UO9A 1ONHA 3BRMA 3CMZA 5IHVA 4E6XA 3DWZA 1DJAA 1K6SA 1QMFA 4IVIA 3WRZA 4R3JA 3MZEA 2EX9A 4MBFA 5M19A 5CXWA 3C4PA 3IF6C 4NETA 2VGKA 3ZVWA 3CJMA 3UY6A 4C75A 2PBYA 5FQQA 1O7EA 3G4PA 2ZC6B 3MKFA 4GD6A 4GN2A 4X6TA 5CRFA 1JTDA 4X69A 5BOHA 2V2FF 4LCMA 3Q07A 1YLWA 4IVKA 5DTTA 1LI9A 3M6BA 3PAGA 1L0GA 1MPLA 5JYPA 2Y2JA 3IXDA 3UPOA 1WE4A 4UA6A 5FAQA 1NJ4A 3IXBA 5GLCA 4FH2A 3WS2A 4PM9A 4BD0A 3E2KA 4LV0A 3Q7VB 3MBZA 4WM9A 3V3SA 3SS4A 4E3IA 2ZQ9A 3GQZA 3LY4A 3IH9A 3MXSA 3NDEA 4YFMA 4L0LA 4KZ8A 2WGIA 1XA7A 1YLZA 2DCFA 1KE4A 2X71A 2V20A 3LY3A 3Q82A 2P9VB 3Q7VA 4OQIA 5CTNA 1YT4A 3OCLA 3LCEA 4MBKA 4WZ4A 3IT9A 3IWQA 4WELA 4BENA 4R0QA 3I7JA 4WMCD 1XP4A 4ZTKA 3BM6A 2X01A 2P9VA 5GHYA 3UNWA 1YLJA 5CECA 3BLSA 4X56A 2PU2A 4X68A 2OLVA 4E3JA 2XGNA 1DJCA 1VM1A 4OOYA 3PBQA 4S2KA 4BL2A 5KSHA 1XGJA 1FR1A 3ZG7B 4BD1A 1YMXA 1ES2A 4DDYA 3N6IA 3WS1A 2ZQCA 1FCMA 3ISGA 4ID4A 1XXMA 3VSKA 1YQSA 3NCKA 4P0MA 4R1GA 2ZC4B 1NY0A 4PM5A 1FR6A 2V1ZA 2HP9A 2DRWA 4U3TA 4FCFA 3RXWA 2WGWB 2ZMAA 3EQVA 4OQHA 1Q2PA 3HBRA 1MXOA 4D2OA 5A91A 5HL1A 2XR0A 4X53A 3GSGA 1ZKJA 3HVFA 4KZ6A 4GB7A 4EBPA 1K38A 1YLTA 2P74A 2WGWA 3N8RA 1ERQA 4UHUA 1YM1A 2OLUA 3BFCA 3IF6A 3OPRA 1MWRA 2OSUA 3P09A 4HEFA 5CHMA 4BLMA 4DE3A 4JXVA 4C3QA 2XD5A 4E6WA 5EPHA 1DY6A 5A90A 5HAQA 3ZNTA 3DWKA 3M2KA 3IXGA 2J9OA 3V3RA 1ZG4A 3OZHA 1ESIA 1ZC2A 1BT5A 4MEZA 3W4PA 3NY4A 2RL3A 5FATA 2B5RA 4EBNA 3G35A 2HP5A 1FSWA 3HLGA 1WYCA 4PMAA 3PBTA 3CZDA 5KZHA 3G2YA 3TG9A 1E3UA 5DF9A 5HX9A 3UPNA 3ZGAB 4E3OA 5M1AA 5FQIA 3OCNA 3ZG0A 5HARA 4FSFA 2WAFA 4MLLA 3VSLA 1MY8A 1JTGA 2Y59A 2EX6A 5FI2A 4ZJ3A 3ZG9B 4IBXA 3OPLA 4OKPA 5E2EA 3ZHHA 1EI5A 2WKEA 3O88A 5FI7A 5D3OA 1NXYA 3V5MA 1SDNA 2ZM0A 4XUZA 1BLPA 5TGFA 4GDBA 3UDXA 3GMWA 1NZOA 1RP5A 3GR2A 3HLBA 3SS5A 3ZG8B 1IKIA 2Y2KA 4E3NA 5L2FA 2CC1A 4LENA 2ZD8A 1XGIA 2XEPA 4Y0TA 1RGYA 1OMEA 3PAEA 4XXRA 3HLFA 4S2NA 4BL3A 3A3JA 4BQMA 1ALQA 4U0TA 2Y2QA 4OQGA 1S0WA 2XF3A 1HVBA 5HFOA 3VP4A 1GA0A 1ES4A 4OPZA 4KZBA 4S2LA 5GLDA 4EQIA 4JXWA 1BUEA 3A3DA 1YMSA 3OPHA 1FOFA 5TR7A 1WYBA 1FSYA 4UA7A 2OV5A 3NIAA 3IHBA 4RX3A 3Q1FA 4Q8IA 1K57C 3M6HA 2EXAA 3RXXA 3Q81A 3MZDA 2A49A 5DTKA 3HUNA 1KDWA 5HAPA 4HESA 3A3FA 4KZ3A 4QB8A 3S4XA 1O07A 5HW3A 1KGEA 4DXCA 1GHPA 1I2SA 4R23A 4S2PA 1K54C 4O7DA 1LI0A 3IH8A 1SDEA 1JWPA 2HP6A 4JPMA 5EOOA 5GL9A 1MKIA 4P6BA 2JC7A 2QZ6A 2ZQAA 5FA7A 1RGZA 4WZ5C 4JF4A 5EECA 4QHCA 1EROA 1JWVA 5E2GA 1ES5A 1PI4A 2WZZA 4ZJ2A 2H0YA 4RX2A 1VQQA 1ES3A 1ESUA 3HLEA 1N9BA 1FCOA 1H5XA 1XKZA 1PWCA 3IWIA 3WRTA 3VFHA 3AGEA 4GOGA 2WKIA 4GZBA 5GLAA 1KGFA 2Y91A 1PW8A 3HUMA 3PTEA 4DE1A 5EVIB 2WZXA 4OLGA 3S1YA 4WBGA 2HPBA 3G2ZA 3DW0A 5F1FA 4S2OA 5CGWA 1IYOA 3UE3A 4MNRA 3LO7A 3WS0A 5EVIA 4R4RA 1K25A 5F1GA 1H8ZA 1PWDA 4S2MA 3VFFA 3BLMA 2C5WB 4JXSA 1IELA 1AXBA 1KVMA 2Y2LA 3BFGA 3JYIA 3V39A 2JCHA 2WAEA 4C6YA 4OVDA 4ZAMA 4QY6A 1IEMA 1ONGA 3C7VA 4UA9A 4K0WA 5CHJA 2Y2IA 4EV4A 3IF6B 3QNCA 4EWFA 1IKGA 3MKEA 1L0DA 4KZ5A 3SS3A 2XH9A 4WEKA 1K56A 1TDLA 2J7VA 5CGXA 2XFSA 3BECA 3HLCA 5CGSA 5CEDA 3G31A 4ZDXA 1K55C 4KZAA 5FSRA 4CJNA 4RA7A 4OPQA 1LL9A 1ZG6A 4LCLA 3UDIA 1PZPA 4GNUA 4ZBEA 1MWUA 4GKUA 3SH9A 4B4XA 4PM8A 5I94A 2H0TA 1Q2QA 2E8IA 3HL9A 2GDNA 4OPRA 3O86A 4N9KA 5J8XA 4IEDA 5CHUA 1XA1A 4OQ0A 1W79A 4R4SA 5AQAA 3GV9A 2ZC7A 1E25A 2IWBA 3UPPA 3A3IA 3BFDA 3VOZA 1KE0A 1KDSA 3HUOA 4XUXA 1NZUA 3VP3A 4JLFA 4OP8A 4JF6A 1CEFA 2G2WA 1BTLA 4WYYA 5FQKA 1G68A 2EFXA 5U47A 3OC2A 2J8YA 2WGVA 4B4ZA 3LEZA 1DJBA 3C7UA 3QNBA 1M40A 1N4OA 1W8QA 5GHXA 2WADA 4GDNA 1SCWA 3G30A 2IWCA 4OPYA 4P87A 2Y2PA 1HZOA 3WWXA 3W8KA 2Y55A 1L0EA 4KQRA 1CI8A 5E43A 1LL5A 4YINA 4M3KA 3QHYA 5F82A 1MWTA 4PM6A 1BSGA 4N1XA 3WS5A 5DF8A 1M6KA 3NBLA 1K4EA 3MFDA 3RJUA 1EWZA 4KENB 5CTMA 2FFFB 1E3UD 5GLBA 3FKVA 3Q7ZA 3PBRA 2HDRA 1JWZA 3HLWA 2XQZA 3N7WA 2Y2OA 1W5DA 3N4IA 4KG5A 1HD8A 5FAPA 3FYZA 1KE3A 1TVFA 3MZFA 2XK1A 1K6RA 2WYXA 3G32A 1GHMA 1PI5A 1RCJA 4ZJ1A 1L2SA 3VP2A 3OPPA 5AQBA 2ZQDA 2Z2MB 1LLBA 3D4FA 3SOIA 4UAAA 3TOIA 3EQUA 4DXBA 2JBFA 3VOYA 2J9PA 1K55A 4X55A 4KZ4A 1BLCA 2Y2MA 1HTZA 4LV2A 4RVAA 1ERMA 1BLSA 2PU4A 2Q9NA 3PBOA 5FI6A 4E3KA 2ZJ9A 4WMCA 5DF7A 2Y2GA 5F83A 1U60A 3BFFA 3MXRA 1CI9A 1NYYA 1PIOA 4IBRA 4K91A 4JBFA 4RYEA 4KG2A 2WUQA 4QJGA 5FASA 4WEJA 1MBLA 5DVAA 4QD4A 4P85A 5EE8A 4PM7A 1Y54A 2ZC5B 4N92A 2EX2A 4EUZA 1IYQA 2XD1A 3NI9A 2Y2HA 3UN7A 4JXGA 3SH8A 2G2UA 3ZDJA 1S6RA 1H8YA 3BEBA 1I5QA 5EUAA 4U0XA 4FD8A 1KGGA 4GD8A 4DDSA 1TEMA 4LV1A 5CEBA 1J9MA 3B3XA 5FQJA 3FV7A 2DNSA 2R9XA 3HREA 3ITAA 1NYMA 3A3EA 3PBNA 1E4DA 4HBTA 1YLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX2 A;  2X02 A;  1KVL A;  1PZO A;  1LHY A;  4JKT A;  5G18 A;  4Z9Q A;  2XLN A;  2ZM8 A;  2WK0 A;  2ZQ8 A;  1W8Y A;  4Y0U A;  3ZCZ A;  5JYO A;  5A92 A;  1FQG A;  4S2N C;  3GTC A;  3V50 A;  4N9L A;  4Y7P A;  4N1H A;  1NRF A;  3NC8 A;  2HDS A;  3VMA A;  4DE0 A;  4S2I A;  1PWG A;  2Z2L B;  3FWL A;  4B88 A;  3G34 A;  4LV3 A;  4E3L A;  2WKH A;  2H5S A;  3P98 A;  1K57 A;  4A5R A;  4QU3 A;  2I72 A;  3AGD A;  3ZNY A;  5FDH A;  3N8S A;  2VGJ A;  2HDQ A;  2ZC3 B;  1GHI A;  4OLD A;  5EVI D;  3CG5 A;  3BYD A;  5AQ7 A;  3VP0 A;  1IYS A;  3ZG5 A;  4OOM A;  3TSG A;  3S22 A;  1GCE A;  2EFU A;  1W7F A;  2RCX A;  1BZA A;  2A3U A;  1K54 A;  4DF6 A;  1SKF A;  1TDG A;  3O3V A;  2HDU A;  3ZVT A;  2EX8 A;  1YLP A;  3VP1 A;  1JVJ A;  4KQQ A;  4BJP A;  4QY5 A;  2QMI A;  4WZ5 A;  4E3M A;  2Y2N A;  3AGF A;  1BUL A;  4Y0O A;  3HLD A;  3FZC A;  2C6W B;  3GVB A;  4KZ9 A;  1XPB A;  1BLH A;  2ZLY A;  5GHZ A;  3IQA A;  3SH7 A;  5TFQ A;  2R9W A;  1MWS A;  1K56 D;  5FQ9 A;  4F94 A;  2BLS A;  4OON A;  4MBH A;  1IYP A;  3WS4 A;  5HAI A;  3ITB A;  4H8R A;  5DTS A;  1CK3 A;  2JE5 A;  3UE1 A;  4DRT A;  4KG6 A;  3PBS A;  4OH0 A;  5E2H A;  1FCN A;  1K4F A;  1SHV A;  1L0F A;  5FQM A;  2EXB A;  1PYY A;  3C4O A;  1C3B A;  3FKW A;  3UE0 A;  4JF5 A;  4DE2 A;  4OP5 A;  3IXH A;  1I2W A;  2ZM2 A;  3IF5 A;  4DKI A;  2H10 A;  1PW1 A;  1GA9 A;  5A93 A;  4NK3 A;  4FH4 A;  2ZQ7 A;  4S2J A;  5AQ9 A;  3GRJ A;  3BFE A;  3N8L A;  3NDG A;  3UDF A;  3O87 A;  3IWO A;  3M2J A;  3DTM A;  4HBU A;  5EVI C;  2UWX A;  5CER A;  2Q9M A;  5KMW A;  4R3B A;  4K0X A;  3W4O A;  2IWD A;  1QME A;  1Z6F A;  1CEG A;  2FFY A;  2XDM A;  3IHA A;  4PPR A;  2BG1 A;  3C5A A;  2QPN A;  5KSC A;  2Y4A A;  4CPK A;  4KQO A;  4EBL A;  4OOL A;  5FAO A;  1G6A A;  5EVL A;  3E2L A;  5EOE A;  3W4Q A;  2XFT A;  4KZ7 A;  3ZFZ A;  5E2F A;  5M18 A;  3UO9 A;  1ONH A;  3BRM A;  3CMZ A;  5IHV A;  4E6X A;  3DWZ A;  1DJA A;  1K6S A;  1QMF A;  4IVI A;  3WRZ A;  4R3J A;  3MZE A;  2EX9 A;  4MBF A;  5M19 A;  5CXW A;  3C4P A;  3IF6 C;  4NET A;  2VGK A;  3ZVW A;  3CJM A;  3UY6 A;  4C75 A;  2PBY A;  5FQQ A;  1O7E A;  3G4P A;  2ZC6 B;  3MKF A;  4GD6 A;  4GN2 A;  4X6T A;  5CRF A;  1JTD A;  4X69 A;  5BOH A;  2V2F F;  4LCM A;  3Q07 A;  1YLW A;  4IVK A;  5DTT A;  1LI9 A;  3M6B A;  3PAG A;  1L0G A;  1MPL A;  5JYP A;  2Y2J A;  3IXD A;  3UPO A;  1WE4 A;  4UA6 A;  5FAQ A;  1NJ4 A;  3IXB A;  5GLC A;  4FH2 A;  3WS2 A;  4PM9 A;  4BD0 A;  3E2K A;  4LV0 A;  3Q7V B;  3MBZ A;  4WM9 A;  3V3S A;  3SS4 A;  4E3I A;  2ZQ9 A;  3GQZ A;  3LY4 A;  3IH9 A;  3MXS A;  3NDE A;  4YFM A;  4L0L A;  4KZ8 A;  2WGI A;  1XA7 A;  1YLZ A;  2DCF A;  1KE4 A;  2X71 A;  2V20 A;  3LY3 A;  3Q82 A;  2P9V B;  3Q7V A;  4OQI A;  5CTN A;  1YT4 A;  3OCL A;  3LCE A;  4MBK A;  4WZ4 A;  3IT9 A;  3IWQ A;  4WEL A;  4BEN A;  4R0Q A;  3I7J A;  4WMC D;  1XP4 A;  4ZTK A;  3BM6 A;  2X01 A;  2P9V A;  5GHY A;  3UNW A;  1YLJ A;  5CEC A;  3BLS A;  4X56 A;  2PU2 A;  4X68 A;  2OLV A;  4E3J A;  2XGN A;  1DJC A;  1VM1 A;  4OOY A;  3PBQ A;  4S2K A;  4BL2 A;  5KSH A;  1XGJ A;  1FR1 A;  3ZG7 B;  4BD1 A;  1YMX A;  1ES2 A;  4DDY A;  3N6I A;  3WS1 A;  2ZQC A;  1FCM A;  3ISG A;  4ID4 A;  1XXM A;  3VSK A;  1YQS A;  3NCK A;  4P0M A;  4R1G A;  2ZC4 B;  1NY0 A;  4PM5 A;  1FR6 A;  2V1Z A;  2HP9 A;  2DRW A;  4U3T A;  4FCF A;  3RXW A;  2WGW B;  2ZMA A;  3EQV A;  4OQH A;  1Q2P A;  3HBR A;  1MXO A;  4D2O A;  5A91 A;  5HL1 A;  2XR0 A;  4X53 A;  3GSG A;  1ZKJ A;  3HVF A;  4KZ6 A;  4GB7 A;  4EBP A;  1K38 A;  1YLT A;  2P74 A;  2WGW A;  3N8R A;  1ERQ A;  4UHU A;  1YM1 A;  2OLU A;  3BFC A;  3IF6 A;  3OPR A;  1MWR A;  2OSU A;  3P09 A;  4HEF A;  5CHM A;  4BLM A;  4DE3 A;  4JXV A;  4C3Q A;  2XD5 A;  4E6W A;  5EPH A;  1DY6 A;  5A90 A;  5HAQ A;  3ZNT A;  3DWK A;  3M2K A;  3IXG A;  2J9O A;  3V3R A;  1ZG4 A;  3OZH A;  1ESI A;  1ZC2 A;  1BT5 A;  4MEZ A;  3W4P A;  3NY4 A;  2RL3 A;  5FAT A;  2B5R A;  4EBN A;  3G35 A;  2HP5 A;  1FSW A;  3HLG A;  1WYC A;  4PMA A;  3PBT A;  3CZD A;  5KZH A;  3G2Y A;  3TG9 A;  1E3U A;  5DF9 A;  5HX9 A;  3UPN A;  3ZGA B;  4E3O A;  5M1A A;  5FQI A;  3OCN A;  3ZG0 A;  5HAR A;  4FSF A;  2WAF A;  4MLL A;  3VSL A;  1MY8 A;  1JTG A;  2Y59 A;  2EX6 A;  5FI2 A;  4ZJ3 A;  3ZG9 B;  4IBX A;  3OPL A;  4OKP A;  5E2E A;  3ZHH A;  1EI5 A;  2WKE A;  3O88 A;  5FI7 A;  5D3O A;  1NXY A;  3V5M A;  1SDN A;  2ZM0 A;  4XUZ A;  1BLP A;  5TGF A;  4GDB A;  3UDX A;  3GMW A;  1NZO A;  1RP5 A;  3GR2 A;  3HLB A;  3SS5 A;  3ZG8 B;  1IKI A;  2Y2K A;  4E3N A;  5L2F A;  2CC1 A;  4LEN A;  2ZD8 A;  1XGI A;  2XEP A;  4Y0T A;  1RGY A;  1OME A;  3PAE A;  4XXR A;  3HLF A;  4S2N A;  4BL3 A;  3A3J A;  4BQM A;  1ALQ A;  4U0T A;  2Y2Q A;  4OQG A;  1S0W A;  2XF3 A;  1HVB A;  5HFO A;  3VP4 A;  1GA0 A;  1ES4 A;  4OPZ A;  4KZB A;  4S2L A;  5GLD A;  4EQI A;  4JXW A;  1BUE A;  3A3D A;  1YMS A;  3OPH A;  1FOF A;  5TR7 A;  1WYB A;  1FSY A;  4UA7 A;  2OV5 A;  3NIA A;  3IHB A;  4RX3 A;  3Q1F A;  4Q8I A;  1K57 C;  3M6H A;  2EXA A;  3RXX A;  3Q81 A;  3MZD A;  2A49 A;  5DTK A;  3HUN A;  1KDW A;  5HAP A;  4HES A;  3A3F A;  4KZ3 A;  4QB8 A;  3S4X A;  1O07 A;  5HW3 A;  1KGE A;  4DXC A;  1GHP A;  1I2S A;  4R23 A;  4S2P A;  1K54 C;  4O7D A;  1LI0 A;  3IH8 A;  1SDE A;  1JWP A;  2HP6 A;  4JPM A;  5EOO A;  5GL9 A;  1MKI A;  4P6B A;  2JC7 A;  2QZ6 A;  2ZQA A;  5FA7 A;  1RGZ A;  4WZ5 C;  4JF4 A;  5EEC A;  4QHC A;  1ERO A;  1JWV A;  5E2G A;  1ES5 A;  1PI4 A;  2WZZ A;  4ZJ2 A;  2H0Y A;  4RX2 A;  1VQQ A;  1ES3 A;  1ESU A;  3HLE A;  1N9B A;  1FCO A;  1H5X A;  1XKZ A;  1PWC A;  3IWI A;  3WRT A;  3VFH A;  3AGE A;  4GOG A;  2WKI A;  4GZB A;  5GLA A;  1KGF A;  2Y91 A;  1PW8 A;  3HUM A;  3PTE A;  4DE1 A;  5EVI B;  2WZX A;  4OLG A;  3S1Y A;  4WBG A;  2HPB A;  3G2Z A;  3DW0 A;  5F1F A;  4S2O A;  5CGW A;  1IYO A;  3UE3 A;  4MNR A;  3LO7 A;  3WS0 A;  5EVI A;  4R4R A;  1K25 A;  5F1G A;  1H8Z A;  1PWD A;  4S2M A;  3VFF A;  3BLM A;  2C5W B;  4JXS A;  1IEL A;  1AXB A;  1KVM A;  2Y2L A;  3BFG A;  3JYI A;  3V39 A;  2JCH A;  2WAE A;  4C6Y A;  4OVD A;  4ZAM A;  4QY6 A;  1IEM A;  1ONG A;  3C7V A;  4UA9 A;  4K0W A;  5CHJ A;  2Y2I A;  4EV4 A;  3IF6 B;  3QNC A;  4EWF A;  1IKG A;  3MKE A;  1L0D A;  4KZ5 A;  3SS3 A;  2XH9 A;  4WEK A;  1K56 A;  1TDL A;  2J7V A;  5CGX A;  2XFS A;  3BEC A;  3HLC A;  5CGS A;  5CED A;  3G31 A;  4ZDX A;  1K55 C;  4KZA A;  5FSR A;  4CJN A;  4RA7 A;  4OPQ A;  1LL9 A;  1ZG6 A;  4LCL A;  3UDI A;  1PZP A;  4GNU A;  4ZBE A;  1MWU A;  4GKU A;  3SH9 A;  4B4X A;  4PM8 A;  5I94 A;  2H0T A;  1Q2Q A;  2E8I A;  3HL9 A;  2GDN A;  4OPR A;  3O86 A;  4N9K A;  5J8X A;  4IED A;  5CHU A;  1XA1 A;  4OQ0 A;  1W79 A;  4R4S A;  5AQA A;  3GV9 A;  2ZC7 A;  1E25 A;  2IWB A;  3UPP A;  3A3I A;  3BFD A;  3VOZ A;  1KE0 A;  1KDS A;  3HUO A;  4XUX A;  1NZU A;  3VP3 A;  4JLF A;  4OP8 A;  4JF6 A;  1CEF A;  2G2W A;  1BTL A;  4WYY A;  5FQK A;  1G68 A;  2EFX A;  5U47 A;  3OC2 A;  2J8Y A;  2WGV A;  4B4Z A;  3LEZ A;  1DJB A;  3C7U A;  3QNB A;  1M40 A;  1N4O A;  1W8Q A;  5GHX A;  2WAD A;  4GDN A;  1SCW A;  3G30 A;  2IWC A;  4OPY A;  4P87 A;  2Y2P A;  1HZO A;  3WWX A;  3W8K A;  2Y55 A;  1L0E A;  4KQR A;  1CI8 A;  5E43 A;  1LL5 A;  4YIN A;  4M3K A;  3QHY A;  5F82 A;  1MWT A;  4PM6 A;  1BSG A;  4N1X A;  3WS5 A;  5DF8 A;  1M6K A;  3NBL A;  1K4E A;  3MFD A;  3RJU A;  1EWZ A;  4KEN B;  5CTM A;  2FFF B;  1E3U D;  5GLB A;  3FKV A;  3Q7Z A;  3PBR A;  2HDR A;  1JWZ A;  3HLW A;  2XQZ A;  3N7W A;  2Y2O A;  1W5D A;  3N4I A;  4KG5 A;  1HD8 A;  5FAP A;  3FYZ A;  1KE3 A;  1TVF A;  3MZF A;  2XK1 A;  1K6R A;  2WYX A;  3G32 A;  1GHM A;  1PI5 A;  1RCJ A;  4ZJ1 A;  1L2S A;  3VP2 A;  3OPP A;  5AQB A;  2ZQD A;  2Z2M B;  1LLB A;  3D4F A;  3SOI A;  4UAA A;  3TOI A;  3EQU A;  4DXB A;  2JBF A;  3VOY A;  2J9P A;  1K55 A;  4X55 A;  4KZ4 A;  1BLC A;  2Y2M A;  1HTZ A;  4LV2 A;  4RVA A;  1ERM A;  1BLS A;  2PU4 A;  2Q9N A;  3PBO A;  5FI6 A;  4E3K A;  2ZJ9 A;  4WMC A;  5DF7 A;  2Y2G A;  5F83 A;  1U60 A;  3BFF A;  3MXR A;  1CI9 A;  1NYY A;  1PIO A;  4IBR A;  4K91 A;  4JBF A;  4RYE A;  4KG2 A;  2WUQ A;  4QJG A;  5FAS A;  4WEJ A;  1MBL A;  5DVA A;  4QD4 A;  4P85 A;  5EE8 A;  4PM7 A;  1Y54 A;  2ZC5 B;  4N92 A;  2EX2 A;  4EUZ A;  1IYQ A;  2XD1 A;  3NI9 A;  2Y2H A;  3UN7 A;  4JXG A;  3SH8 A;  2G2U A;  3ZDJ A;  1S6R A;  1H8Y A;  3BEB A;  1I5Q A;  5EUA A;  4U0X A;  4FD8 A;  1KGG A;  4GD8 A;  4DDS A;  1TEM A;  4LV1 A;  5CEB A;  1J9M A;  3B3X A;  5FQJ A;  3FV7 A;  2DNS A;  2R9X A;  3HRE A;  3ITA A;  1NYM A;  3A3E A;  3PBN A;  1E4D A;  4HBT A;  1YLY A; 
#chains in the Genus database with same CATH topology
 1KVL A;  5J7E A;  5G18 A;  4HQA A;  4R38 A;  3KSG A;  1W8Y A;  5A8B A;  3ZCZ A;  1VET A;  1FQG A;  2ZOH A;  3GTC A;  3NC8 A;  3T1X A;  4S2I A;  2OWH A;  3FWL A;  4YNR A;  4JGR A;  2B02 A;  3G34 A;  1ZHH B;  1TS0 A;  3P98 A;  4A5R A;  2VGJ A;  4GJ4 A;  3CG5 A;  3BYD A;  5AQ7 A;  1IYS A;  5TBM A;  3S22 A;  4AFI A;  1BZA A;  1LSV A;  4DF6 A;  4BWI A;  1YLP A;  1JVJ A;  2QMI A;  5J3W A;  4MN6 A;  4EXO A;  3FZC A;  1D1J A;  1XPB A;  2ZLY A;  3SH7 A;  2QKP A;  4I3I A;  2R9W A;  1K56 D;  4F94 A;  2BLS A;  3NUL A;  1IYP A;  5IS1 A;  5HAI A;  4H8R A;  5DTS A;  5HL6 A;  2IA2 A;  4OH0 A;  5EM0 A;  4HOI A;  5E2H A;  1FCN A;  1L0F A;  3MQ0 A;  3IXH A;  3IF5 A;  5G4Y A;  1PW1 A;  5A93 A;  3GRJ A;  3BFE A;  3N8L A;  4HBU A;  5EVI C;  5CER A;  4QPR A;  4K0X A;  1QME A;  1Z6F A;  3A0R A;  2XDM A;  3IHA A;  2J3T D;  2MJ6 A;  3C5A A;  4KQO A;  4EBL A;  4OOL A;  3E2L A;  3EEH A;  5EOE A;  2XFT A;  2VGL M;  4KZ7 A;  3ZFZ A;  4E6X A;  1QMF A;  2VZW A;  4R3J A;  1EW0 A;  4IHQ A;  5L10 A;  2EX9 A;  3F1O A;  5CXW A;  4NET A;  2BAS A;  1T18 A;  4PHT A;  2PBY A;  2W1R A;  3FC7 A;  3M6B A;  3PAG A;  3IXD A;  3UPO A;  4UA6 A;  1VEU B;  4BD0 A;  4LV0 A;  3Q7V B;  2VJW A;  3MBZ A;  3V3S A;  3GQZ A;  3NDE A;  1TS7 A;  2WGI A;  1YLZ A;  4UQI S;  3LY3 A;  2P9V B;  2ZBB A;  3C8C A;  3IT9 A;  4CQH A;  3EGD C;  4WMC D;  3BM6 A;  3UNW A;  4E3J A;  3NOT C;  2OLV A;  3VOL A;  2VX8 A;  2AVX A;  1LSX A;  3QP5 A;  1SKO A;  4ID4 A;  2V1Z A;  5HPF A;  3VE3 A;  3RXW A;  2WGW B;  4OQH A;  2B18 A;  5HL1 A;  4X53 A;  3GSG A;  3HVF A;  2ZOI A;  1K38 A;  2P74 A;  3JVU A;  3N8R A;  2VA0 A;  3OPR A;  3DTI A;  5A90 A;  3ZNT A;  2J9O A;  3V3R A;  3OZH A;  1ZC2 A;  1BT5 A;  3W4P A;  1CJF A;  2RL3 A;  4I3A A;  3G35 A;  2V1A A;  3CZD A;  4FUW A;  3TG9 A;  5DF9 A;  3ULF A;  3ZG0 A;  3VSL A;  2Y59 A;  2NUP C;  2EX6 A;  3ZG9 B;  3S7N A;  2WKP A;  2FH5 A;  1EI5 A;  2O99 A;  5FI7 A;  3V5M A;  1IFQ A;  3UDX A;  4GDB A;  4HJ3 A;  2JHE A;  1NZO A;  2JKG A;  3GR2 A;  3HLB A;  2W27 A;  2Y2K A;  4E3N A;  2CC1 A;  5J4E A;  1OME A;  3PAE A;  5MC7 A;  4O8G A;  2G7U A;  1S0W A;  3LR4 A;  3UMD A;  4S2L A;  1ODV A;  2V8C A;  4JGO A;  2OOL A;  1FOF A;  5TR7 A;  1WYB A;  1FSY A;  1OPX A;  3IHB A;  4RX3 A;  3RXX A;  2O0Y A;  2A49 A;  4HJ4 A;  3RH8 B;  3A3F A;  3S4X A;  4QB8 A;  1GHP A;  4R23 A;  3IH8 A;  3CLO A;  4JPM A;  4ARZ A;  1MKI A;  4P6B A;  2QZ6 A;  5FA7 A;  3UB8 A;  1RGZ A;  3MQO A;  5E2G A;  4ZJ2 A;  2H0Y A;  3D72 A;  2HZ5 A;  4R3A A;  1ESU A;  3HLE A;  1N9B A;  2HGV A;  3VFH A;  2KOI A;  3AGE A;  4GZB A;  5GLA A;  2Y91 A;  3T4J A;  3PTE A;  3S1Y A;  2HPB A;  3G6O A;  3H9W A;  4O0P A;  1G5U A;  1K25 A;  1XJ4 A;  1D7E A;  1PWD A;  4S2M A;  4YWZ A;  3VFF A;  2C5W B;  1AXB A;  1KVM A;  3BFG A;  5LBR A;  4D60 A;  2JCH A;  5HD5 A;  4UA9 A;  1TD5 A;  5CHJ A;  3HJI A;  1UWN X;  4NEE D;  4KZ5 A;  5F69 A;  2QJ5 A;  5TJJ A;  1K56 A;  1TDL A;  1L3L A;  5CGS A;  3HJK A;  4HNB A;  4CJN A;  4RA7 A;  4OPQ A;  1LL9 A;  4LCL A;  4B9O A;  1PZP A;  1MWU A;  4GKU A;  4B4X A;  4PM8 A;  4G3K A;  1Q2Q A;  2E8I A;  3HCY A;  4N9K A;  1LSW A;  1XA1 A;  5AQA A;  2ZC7 A;  2LB5 A;  1KE0 A;  1XFQ A;  4G3V A;  1NZU A;  3VP3 A;  4OP8 A;  1CEF A;  5HPI A;  2PT7 A;  5U47 A;  1H3Q A;  2V1B A;  1PRQ A;  3C7U A;  3QNB A;  1M40 A;  5GHX A;  4Y3I A;  2WAD A;  4GDN A;  1SCW A;  3G30 A;  5EFW A;  2IWC A;  1F2K A;  2Y55 A;  1OJ5 A;  5E43 A;  1MWT A;  1T1B A;  1BSG A;  3WS5 A;  4P6Z M;  1P0Z A;  3E4P A;  2JKR I;  2FFF B;  5GLB A;  2W3H A;  1JWZ A;  2XQZ A;  4ZRR A;  5F68 A;  1KE3 A;  2XK1 A;  2WYX A;  3G32 A;  4ZJ1 A;  3CPT A;  1L2S A;  5L07 A;  1DP6 A;  3EQU A;  3VOY A;  5EM1 A;  1K55 A;  5HD3 A;  2OWJ A;  4RVA A;  3A0V A;  4Y15 A;  4E3K A;  3GEC A;  2ZJ9 A;  4WMC A;  3BFF A;  1CI9 A;  2ZMF A;  1J3W A;  4FOF A;  1NYY A;  4KG2 A;  1MBL A;  5EE8 A;  4PM7 A;  1Y54 A;  2XA7 S;  3ZDJ A;  1H8Y A;  2QYB A;  3EWK A;  1KGG A;  4GD8 A;  3O5Y A;  3B3X A;  3GDI A;  3A3E A;  1LHY A;  2A24 A;  4Z9Q A;  2ZM8 A;  2ZQ8 A;  4BBT A;  4Y0U A;  1OT6 A;  2YKH A;  4S2N C;  4N9L A;  4DE0 A;  1PWG A;  1K57 A;  2Q0O A;  3KYE A;  3ZNY A;  2HDQ A;  4MMN A;  3KSI A;  3ZG5 A;  2GJ3 A;  1W7F A;  1SKF A;  1TDG A;  2GNX A;  2HDU A;  1MZU A;  3ZVT A;  4BJP A;  2Y2N A;  3AGF A;  2HF6 A;  4Y0O A;  1TF1 A;  4ESP A;  3GVB A;  1GSV A;  4BBU A;  4EEU A;  4MBH A;  3UE1 A;  4DRT A;  4EET B;  3MJQ A;  4JGP A;  1SHV A;  3IX4 A;  5FQM A;  3IX8 A;  2ZM2 A;  2PR6 A;  3TE8 A;  3F1N B;  5KMW A;  1CEG A;  4WN5 A;  2Y4A A;  5FAO A;  5EVL A;  3W4Q A;  3TW8 A;  5E2F A;  1S4S A;  3T4K A;  3MZE A;  5M19 A;  3LIE A;  3IS2 B;  2PYP A;  3G4P A;  1V9Y A;  1JTD A;  4X69 A;  2V2F F;  3Q07 A;  1YLW A;  5CX7 A;  5DTT A;  4Y13 A;  1MPL A;  2VGL S;  2Y2J A;  1WE4 A;  5FAQ A;  3IXB A;  3DTE A;  3SW1 A;  4L0L A;  1XA7 A;  1KE4 A;  4MN7 A;  2A24 B;  2H28 A;  3Q7V A;  3OCL A;  3LCE A;  4MBK A;  1S1Y A;  4EU0 A;  3I7J A;  1SZV A;  2P9V A;  2JKF A;  5CEC A;  3BLS A;  2PU2 A;  2XGN A;  1DJC A;  4L9F A;  4KUO A;  4S2K A;  4BL2 A;  1FR1 A;  1YMX A;  2ZQC A;  1FCM A;  3CUE C;  1ACF A;  2ZC4 B;  1NY0 A;  1FR6 A;  2DRW A;  3EQV A;  2PDR A;  4GB7 A;  4EBP A;  1YLT A;  3BJN A;  2PD7 A;  2WGW A;  2VV6 A;  1YM1 A;  4GS9 B;  2OSU A;  2D01 A;  4JXV A;  2XD5 A;  3DWK A;  3M2K A;  3IXG A;  2LB9 A;  3NY4 A;  4EBN A;  1NLZ A;  2HP5 A;  3LGO A;  1FSW A;  3G2Y A;  5M1A A;  2OAP 1;  3OCN A;  3CAX A;  1OTB A;  4FSF A;  5HAR A;  1MY8 A;  5FI2 A;  4ZJ3 A;  3OPL A;  4OKP A;  3OOV A;  2PBD P;  5D3O A;  1SDN A;  4XUZ A;  5TGF A;  1PFL A;  3GMW A;  1RP5 A;  3ZG8 B;  5L2F A;  2V0W A;  2ZD8 A;  1XGI A;  2R78 A;  3HLF A;  4BL3 A;  3A3J A;  3BY8 A;  2Y2Q A;  5HFO A;  1HVB A;  3VP4 A;  1GA0 A;  4KZB A;  5GLD A;  4EQI A;  3DAV A;  1YMS A;  4EER A;  2OV5 A;  3LYX A;  4Q8I A;  2EXA A;  3Q81 A;  3QP1 A;  4WL9 A;  3HUN A;  2NUT C;  1KDW A;  5HAP A;  5F5Y A;  5HWT A;  4NXF A;  3D3O A;  2J3W A;  2GX5 A;  1JWP A;  2ZQA A;  1OTA A;  5EEC A;  5I5L A;  5IT5 A;  1ERO A;  2M7V A;  3QP6 A;  1XFN A;  4RX2 A;  1H5X A;  1VHM A;  2V8F A;  4Q0J A;  2QWS A;  3S7O A;  5EVI B;  3G2Z A;  3DW0 A;  1OTD A;  2P7J A;  5CGW A;  3LO7 A;  3KSH A;  4BMW A;  4LRX C;  2V9A A;  1Z09 A;  4QY6 A;  1IEM A;  3PHY A;  2J80 A;  4EWF A;  1L0D A;  2XH9 A;  5CGX A;  4PAU A;  2XFS A;  3BEC A;  3HLC A;  5CED A;  3G31 A;  1ZG6 A;  3UDI A;  4HJ6 A;  4HHD A;  5I94 A;  5DJT A;  1OTI A;  2GDN A;  3O86 A;  2K31 A;  2IWB A;  1W79 A;  4L9G A;  4QWO A;  2EWV A;  4WYY A;  3JPU A;  1G68 A;  3B33 A;  3C30 A;  2WGV A;  3OC2 A;  4B4Z A;  1F5M A;  5FL3 A;  1W8Q A;  2FZ0 A;  3LR0 A;  2Y2P A;  1HZO A;  3WWX A;  3W8K A;  4KQR A;  1CI8 A;  2WKQ A;  1ZTU A;  4YIN A;  5F82 A;  1Y28 A;  3K2N A;  2KLI A;  3UB6 A;  3P7N A;  2JKT I;  2JKT M;  3T12 B;  4KG5 A;  1HD8 A;  1H0M A;  3UB7 A;  3MZF A;  4CLC C;  2ZQD A;  4P6Z S;  3TOI A;  2JBF A;  1UWP X;  1BLC A;  1YPR A;  4WUJ A;  1ERM A;  1BLS A;  2Q9N A;  3PBO A;  5DF7 A;  5F83 A;  3MXR A;  4GHI A;  2ZL1 B;  5DVA A;  5HDD A;  3IBJ A;  3EEA A;  4EUZ A;  2EX2 A;  2XD1 A;  2I9V A;  2Y2H A;  3UN7 A;  3SH8 A;  2G2U A;  1S6R A;  4U0X A;  2KX6 A;  2HV1 A;  5DKK A;  3R7W B;  1XJ3 A;  3BY9 A;  3HRE A;  3ITA A;  1LT0 A;  1NYM A;  1E4D A;  5AVE A;  1XX2 A;  2X02 A;  4JKT A;  2PHY A;  4HP9 A;  5HDS A;  3TJZ C;  5HWV A;  5JYO A;  5A92 A;  5EV0 A;  3V50 A;  4Y7P A;  4N1H A;  1NRF A;  1YAX A;  1T19 A;  2Z2L B;  4CLC B;  4E3L A;  4QU3 A;  5FDH A;  2ZC3 B;  1GHI A;  5EVI D;  1D06 A;  2E8J A;  3VP0 A;  2QHK A;  3LIC A;  1GCE A;  4NXB A;  2EFU A;  1S66 L;  1K54 A;  3O3V A;  2B95 A;  3VP1 A;  4QY5 A;  4WZ5 A;  4E3M A;  4HH2 A;  4LGW A;  2C6W B;  4KZ9 A;  1BLH A;  3IQA A;  1WA9 A;  1CK3 A;  2JE5 A;  4KG6 A;  3PBS A;  1K4F A;  3C4O A;  3S7Q A;  3FKW A;  4JF5 A;  4OP5 A;  1I2W A;  3PXP A;  3LR5 A;  1GA9 A;  4FH4 A;  3QP8 A;  2ZQ7 A;  3NDG A;  3O87 A;  3IWO A;  3M2J A;  4DJ3 A;  2PR5 A;  3W4O A;  2IWD A;  2FFY A;  4PPR A;  1K0K A;  3LIF A;  2BG1 A;  4R70 A;  3F1N A;  3MS6 A;  3UO9 A;  3CMZ A;  3DWZ A;  3PR6 A;  1K6S A;  4IVI A;  4YOF A;  4GHI B;  4MBF A;  3C4P A;  3IF6 C;  3U4L P;  1IOU A;  3UY6 A;  1O7E A;  2ZC6 B;  3MKF A;  4GD6 A;  4GN2 A;  4X6T A;  5CRF A;  2K7S A;  5BOH A;  2W1T B;  3IS2 A;  1LI9 A;  4WF0 A;  5JYP A;  3OLO A;  1NJ4 A;  4FH2 A;  3WS2 A;  4PM9 A;  3E2K A;  1A0K A;  4WM9 A;  4F3L B;  3SS4 A;  3LY4 A;  4YFM A;  3MXS A;  2DCF A;  2X71 A;  3Q82 A;  5C5K A;  2W3D A;  5CTN A;  4M4X A;  3IWQ A;  4WEL A;  4R0Q A;  1XP4 A;  4H6J B;  1YLJ A;  4X56 A;  1S67 L;  4HH3 A;  3PBQ A;  1W63 M;  3KO6 A;  1XGJ A;  4BD1 A;  4DDY A;  4PKY A;  3UE6 A;  3VSK A;  1YQS A;  4R1G A;  4PKY G;  2GZA A;  4MN5 A;  2HP9 A;  4U3T A;  5DFX A;  3T4S A;  4FCF A;  2ZMV A;  3HBR A;  3EOI A;  4D2O A;  1YKD A;  1ZKJ A;  4KZ6 A;  1F9I A;  4B93 A;  1GSX A;  4BLM A;  3P09 A;  1MWR A;  4X1M A;  4HEF A;  5CHM A;  4DE3 A;  4E6W A;  5EPH A;  4Y17 A;  1ZG4 A;  4GS9 A;  3T4O A;  2UV0 E;  4KUK A;  1UGU A;  5HX9 A;  3UPN A;  4CLC D;  1NWZ A;  4ETZ A;  2WAF A;  1JTG A;  3T1R A;  5E2E A;  4ETX A;  3DBA A;  3K3C A;  3O88 A;  2XSS A;  1BLP A;  4EES A;  1IKI A;  2XEP A;  1RGY A;  2D02 A;  4BQM A;  2JN7 A;  1PNE A;  1ALQ A;  1DRM A;  4OQG A;  3LID A;  1S4R A;  3NOP C;  2HJ9 C;  4OPZ A;  4JXW A;  1BUE A;  4IUH A;  3KYQ A;  3OPH A;  4UA7 A;  1FIK A;  3NIA A;  2PAV P;  1K57 C;  3M6H A;  3A0S A;  5DTK A;  3C2W A;  3NOU C;  4KZ3 A;  1O07 A;  5HW3 A;  1OTE A;  1I2S A;  3MSH A;  1LI0 A;  5GL9 A;  1SDE A;  5EOO A;  2Y79 A;  4XT2 A;  3BWL A;  2JC7 A;  2ACG A;  4QHC A;  4LRY C;  1JWV A;  1PI4 A;  4RQ9 A;  1NRJ A;  2VV8 A;  4LFU A;  5AJG A;  3T4Q A;  3L9K A;  1FCO A;  1XKZ A;  1PWC A;  4GOG A;  2WKI A;  1KGF A;  3NJA A;  5F6A A;  4NXE A;  3H82 A;  4HI4 A;  5F1F A;  3UE3 A;  5EVI A;  5F1G A;  4R6L A;  3U2A A;  1H8Z A;  3UB5 P;  1IEL A;  2Y2L A;  4C6Y A;  4OVD A;  1ONG A;  3C7V A;  2W3E A;  2O9C A;  4K0W A;  2Z6D A;  3IX3 A;  3QNC A;  1IKG A;  4L9E A;  3SS3 A;  2J7V A;  5DJU A;  2VEA A;  4E04 A;  4ZDX A;  4KZA A;  3MXQ A;  1BYW A;  2L1M A;  3BQA A;  4ZBE A;  3SH9 A;  2H0T A;  3F1P B;  4OPR A;  5L8M A;  5J8X A;  4IED A;  5CHU A;  4OQ0 A;  3VOZ A;  3C38 A;  4XUX A;  5G4Z A;  1BTL A;  5FQK A;  2EFX A;  4EW7 A;  1TS8 A;  1DJB A;  3R4K A;  4NG2 A;  3D9Y A;  4EUV A;  4P87 A;  4II7 A;  4WLA A;  3OBF A;  4Z1W A;  2O9B A;  1LL5 A;  3QHY A;  4PM6 A;  4N1X A;  3W2Z A;  5DF8 A;  2DMW A;  3NBL A;  1K4E A;  3RJU A;  1EWZ A;  1E3U D;  3FKV A;  3Q7Z A;  3PBR A;  2HDR A;  2Y2O A;  2EA9 A;  3N4I A;  2P04 A;  5FAP A;  2QJ7 A;  3FYZ A;  1TVF A;  4XT2 B;  1GHM A;  3VP2 A;  5DFY A;  2Z2M B;  3D4F A;  4UAA A;  4DXB A;  4GW9 A;  4X55 A;  3FPV A;  2PU4 A;  3DTK A;  1CQA A;  1P97 A;  1PIO A;  5FAS A;  2WUQ A;  4WEJ A;  3H82 B;  3ZQ5 A;  2XRO A;  4QD4 A;  2ZC5 B;  1XJ2 A;  4N92 A;  1IYQ A;  2ZL1 A;  3NI9 A;  5DKL A;  4HY8 A;  3BEB A;  3BQ8 A;  1G28 A;  4DDS A;  4KQD A;  4LV1 A;  2Y8H A;  4IJG A;  2DNS A;  4HIA A;  5K5B A;  3R7W A;  4HBT A;  3T4L A;  1PZO A;  1VET B;  1FIL A;  2XLN A;  3UME A;  1AWI A;  3T1Q B;  2WK0 A;  3CWF A;  3FG8 A;  2HDS A;  4GLQ A;  3VMA A;  1STZ A;  1F98 A;  4B88 A;  4LV3 A;  2WKH A;  2H5S A;  5IU1 A;  4UEY A;  2I72 A;  3AGD A;  5TBM B;  3N8S A;  3IBR A;  4OLD A;  4CLC A;  4OOM A;  3TSG A;  4K08 A;  2RCX A;  2A3U A;  1DP8 A;  2VKS A;  2EX8 A;  4LLO B;  4KQQ A;  4LPZ A;  1T1C A;  1BUL A;  3HLD A;  5GHZ A;  5TFQ A;  1MWS A;  5FQ9 A;  2VK3 A;  3MFX A;  4OON A;  4NXG A;  3WS4 A;  3ITB A;  2INW A;  2EXB A;  1PYY A;  4GCZ A;  1C3B A;  3UE0 A;  4DE2 A;  3MR0 A;  4DKI A;  2H10 A;  4NK3 A;  4S2J A;  1JNU A;  5AQ9 A;  5L09 A;  4IUK A;  3UDF A;  3DTM A;  2UWX A;  2Q9M A;  4R3B A;  3T4T A;  3E98 A;  5KSC A;  2QPN A;  4CPK A;  1G6A A;  3F1O B;  5HSQ A;  3KSF A;  5M18 A;  1ONH A;  3BRM A;  3NEC A;  5IHV A;  1DJA A;  3WRZ A;  1S1Z A;  4DMZ A;  3E4Q A;  2VGK A;  3ZVW A;  3CJM A;  4C75 A;  4UQI M;  5FQQ A;  4EEP A;  4MDZ A;  4LCM A;  4X1L A;  1P9W A;  4IVK A;  1L0G A;  3H7W A;  3LR3 A;  3MF0 A;  5GLC A;  2W1T A;  3LEQ A;  3QP2 A;  3S7P A;  3BW6 A;  4E3I A;  2ZQ9 A;  1GSW A;  3IH9 A;  4KZ8 A;  2V20 A;  5FEG A;  4F3L A;  4OQI A;  3FPW A;  3MMH A;  1YT4 A;  4EQ1 A;  4WZ4 A;  4BEN A;  3ZYT A;  2XRN A;  4ZTK A;  2X01 A;  3ICY A;  2V0U A;  1SKO B;  5GHY A;  3LI9 A;  1W63 Q;  4X68 A;  1VM1 A;  3LIB A;  4OOY A;  3UB9 A;  5KSH A;  3ZG7 B;  1HLU P;  1ES2 A;  3N6I A;  3WS1 A;  4H6J A;  3ISG A;  1XXM A;  4P0M A;  3NCK A;  1OJG A;  3E4O A;  4PM5 A;  3SZT A;  2ZMA A;  1Q2P A;  1MXO A;  2PRF A;  5A91 A;  2VLG A;  2XR0 A;  1X0O A;  2W3F A;  4BBV A;  1ERQ A;  4G3W A;  4UHU A;  2OLU A;  3BFC A;  3IF6 A;  2O9A A;  5HDC A;  4C3Q A;  1DY6 A;  2A2L A;  5HAQ A;  1ESI A;  4MEZ A;  1XJ6 A;  4I3J A;  5FAT A;  2B5R A;  3MQQ A;  3HLG A;  1WYC A;  4PMA A;  3PBT A;  5KIZ A;  4MCW A;  5KZH A;  4Y2F A;  3KYZ A;  4I5S A;  3P01 A;  3RTY A;  1E3U A;  3ZGA B;  4E3O A;  1Y4O A;  5FQI A;  4Y5F A;  4X25 A;  4MLL A;  3LFV A;  4IBX A;  3NHQ A;  3ZHH A;  2WKE A;  3LIA A;  4HP4 A;  1NXY A;  2ZM0 A;  3SS5 A;  4LEN A;  4Y0T A;  2VV7 A;  4XXR A;  4S2N A;  4U0T A;  2XF3 A;  2P08 A;  1ES4 A;  2PD8 A;  3RFB A;  3TRC A;  2JKR M;  3A3D A;  4I39 A;  3Q1F A;  3H7W B;  3MZD A;  1LL8 A;  2WKR A;  4HES A;  3B42 A;  4ARZ B;  1KGE A;  1OT9 A;  4DXC A;  4S2P A;  1K54 C;  4O7D A;  2HP6 A;  2HJE A;  4WZ5 C;  4JF4 A;  1ES5 A;  1KOU A;  2J3T C;  2WZZ A;  3B47 A;  1MKM A;  1VQQ A;  1ES3 A;  2YKF A;  3IWI A;  3E0Y A;  3WRT A;  4JGQ A;  2L0W A;  1PW8 A;  3HUM A;  4DE1 A;  3QP4 A;  2WZX A;  4OLG A;  4WBG A;  1TS6 A;  4S2O A;  2W3G A;  1IYO A;  2W0N A;  1V9Z A;  4MNR A;  3WS0 A;  3CIT A;  2OAQ 1;  4R4R A;  1CF0 A;  3PYP A;  5FDS A;  3BLM A;  4JXS A;  3VV4 A;  3T50 A;  3V39 A;  3JYI A;  2WAE A;  4I38 A;  4ZAM A;  2Y2I A;  4EV4 A;  3IF6 B;  4Q0I A;  3MKE A;  1YSQ A;  3KX0 X;  5AVF A;  4WEK A;  2Z6C A;  3V67 A;  2BTF P;  4NKP A;  1K55 C;  2KDK A;  5FSR A;  4GNU A;  3HL9 A;  4R4S A;  3UPP A;  3GV9 A;  1E25 A;  3A3I A;  3BFD A;  1KDS A;  3HUO A;  3F1P A;  4JLF A;  4JF6 A;  2G2W A;  1NLY A;  3JVV A;  3VE4 A;  2J8Y A;  5FEF A;  3LEZ A;  2K2N A;  1N9L A;  3L7H A;  1N4O A;  1T1A A;  4OPY A;  3CHW P;  5EVE A;  1MC0 A;  1H8M A;  1VB6 A;  1L0E A;  5HWW A;  1N9O A;  5HZH A;  4M3K A;  1M6K A;  3CUE A;  3T1S A;  3LI8 A;  3MFD A;  4KEN B;  5CTM A;  2L4R A;  1P9R A;  3HLW A;  4DJ2 A;  3CPT B;  3N7W A;  1YSP A;  2PYR A;  1W5D A;  2EWW A;  4ME4 A;  1K6R A;  1PI5 A;  1RCJ A;  3OPP A;  4LRZ E;  5AQB A;  1LLB A;  3SOI A;  2XA7 M;  2J9P A;  4KZ4 A;  2Y2M A;  2M1C A;  1HTZ A;  4LV2 A;  5FI6 A;  1N9N A;  2Y2G A;  1U60 A;  4FTX A;  3CI6 A;  4IBR A;  4RYE A;  4JBF A;  4K91 A;  4QJG A;  3EGX C;  3LUQ A;  4O01 A;  4P85 A;  1DP9 A;  2M7U A;  4JXG A;  1I5Q A;  5EUA A;  4DN0 A;  4FD8 A;  4Q0H A;  2CMN A;  1VEU A;  1TEM A;  5CEB A;  1J9M A;  5FQJ A;  4CLC E;  3FV7 A;  2R9X A;  1G6O A;  3K3D A;  3PBN A;  1YLY A; 
#chains in the Genus database with same CATH homology
 1XX2 A;  2X02 A;  1KVL A;  1PZO A;  1LHY A;  4JKT A;  5G18 A;  4Z9Q A;  2XLN A;  2ZM8 A;  2WK0 A;  2ZQ8 A;  1W8Y A;  4Y0U A;  3ZCZ A;  5JYO A;  5A92 A;  1FQG A;  4S2N C;  3GTC A;  3V50 A;  4N9L A;  4Y7P A;  4N1H A;  1NRF A;  3NC8 A;  2HDS A;  3VMA A;  4DE0 A;  4S2I A;  1PWG A;  2Z2L B;  3FWL A;  4B88 A;  3G34 A;  4LV3 A;  4E3L A;  2WKH A;  2H5S A;  3P98 A;  1K57 A;  4A5R A;  4QU3 A;  2I72 A;  3AGD A;  3ZNY A;  5FDH A;  3N8S A;  2VGJ A;  2HDQ A;  2ZC3 B;  1GHI A;  4OLD A;  5EVI D;  3CG5 A;  3BYD A;  5AQ7 A;  3VP0 A;  1IYS A;  3ZG5 A;  4OOM A;  3TSG A;  3S22 A;  1GCE A;  2EFU A;  1W7F A;  2RCX A;  1BZA A;  2A3U A;  1K54 A;  4DF6 A;  1SKF A;  1TDG A;  3O3V A;  2HDU A;  3ZVT A;  2EX8 A;  1YLP A;  3VP1 A;  1JVJ A;  4KQQ A;  4BJP A;  4QY5 A;  2QMI A;  4WZ5 A;  4E3M A;  2Y2N A;  3AGF A;  1BUL A;  4Y0O A;  3HLD A;  3FZC A;  2C6W B;  3GVB A;  4KZ9 A;  1XPB A;  1BLH A;  2ZLY A;  5GHZ A;  3IQA A;  3SH7 A;  5TFQ A;  2R9W A;  1MWS A;  1K56 D;  5FQ9 A;  4F94 A;  2BLS A;  4OON A;  4MBH A;  1IYP A;  3WS4 A;  5HAI A;  3ITB A;  4H8R A;  5DTS A;  1CK3 A;  2JE5 A;  3UE1 A;  4DRT A;  4KG6 A;  3PBS A;  4OH0 A;  5E2H A;  1FCN A;  1K4F A;  1SHV A;  1L0F A;  5FQM A;  2EXB A;  1PYY A;  3C4O A;  1C3B A;  3FKW A;  3UE0 A;  4JF5 A;  4DE2 A;  4OP5 A;  3IXH A;  1I2W A;  2ZM2 A;  3IF5 A;  4DKI A;  2H10 A;  1PW1 A;  1GA9 A;  5A93 A;  4NK3 A;  4FH4 A;  2ZQ7 A;  4S2J A;  5AQ9 A;  3GRJ A;  3BFE A;  3N8L A;  3NDG A;  3UDF A;  3O87 A;  3IWO A;  3M2J A;  3DTM A;  4HBU A;  5EVI C;  2UWX A;  5CER A;  2Q9M A;  5KMW A;  4R3B A;  4K0X A;  3W4O A;  2IWD A;  1QME A;  1Z6F A;  1CEG A;  2FFY A;  2XDM A;  3IHA A;  4PPR A;  2BG1 A;  3C5A A;  2QPN A;  5KSC A;  2Y4A A;  4CPK A;  4KQO A;  4EBL A;  4OOL A;  5FAO A;  1G6A A;  5EVL A;  3E2L A;  5EOE A;  3W4Q A;  2XFT A;  4KZ7 A;  3ZFZ A;  5E2F A;  5M18 A;  3UO9 A;  1ONH A;  3BRM A;  3CMZ A;  5IHV A;  4E6X A;  3DWZ A;  1DJA A;  1K6S A;  1QMF A;  4IVI A;  3WRZ A;  4R3J A;  3MZE A;  2EX9 A;  4MBF A;  5M19 A;  5CXW A;  3C4P A;  3IF6 C;  4NET A;  2VGK A;  3ZVW A;  3CJM A;  3UY6 A;  4C75 A;  2PBY A;  5FQQ A;  1O7E A;  3G4P A;  2ZC6 B;  3MKF A;  4GD6 A;  4GN2 A;  4X6T A;  5CRF A;  1JTD A;  4X69 A;  5BOH A;  2V2F F;  4LCM A;  3Q07 A;  1YLW A;  4IVK A;  5DTT A;  1LI9 A;  3M6B A;  3PAG A;  1L0G A;  1MPL A;  5JYP A;  2Y2J A;  3IXD A;  3UPO A;  1WE4 A;  4UA6 A;  5FAQ A;  1NJ4 A;  3IXB A;  5GLC A;  4FH2 A;  3WS2 A;  4PM9 A;  4BD0 A;  3E2K A;  4LV0 A;  3Q7V B;  3MBZ A;  4WM9 A;  3V3S A;  3SS4 A;  4E3I A;  2ZQ9 A;  3GQZ A;  3LY4 A;  3IH9 A;  3MXS A;  3NDE A;  4YFM A;  4L0L A;  4KZ8 A;  2WGI A;  1XA7 A;  1YLZ A;  2DCF A;  1KE4 A;  2X71 A;  2V20 A;  3LY3 A;  3Q82 A;  2P9V B;  3Q7V A;  4OQI A;  5CTN A;  1YT4 A;  3OCL A;  3LCE A;  4MBK A;  4WZ4 A;  3IT9 A;  3IWQ A;  4WEL A;  4BEN A;  4R0Q A;  3I7J A;  4WMC D;  1XP4 A;  4ZTK A;  3BM6 A;  2X01 A;  2P9V A;  5GHY A;  3UNW A;  1YLJ A;  5CEC A;  3BLS A;  4X56 A;  2PU2 A;  4X68 A;  2OLV A;  4E3J A;  2XGN A;  1DJC A;  1VM1 A;  4OOY A;  3PBQ A;  4S2K A;  4BL2 A;  5KSH A;  1XGJ A;  1FR1 A;  3ZG7 B;  4BD1 A;  1YMX A;  1ES2 A;  4DDY A;  3N6I A;  3WS1 A;  2ZQC A;  1FCM A;  3ISG A;  4ID4 A;  1XXM A;  3VSK A;  1YQS A;  3NCK A;  4P0M A;  4R1G A;  2ZC4 B;  1NY0 A;  4PM5 A;  1FR6 A;  2V1Z A;  2HP9 A;  2DRW A;  4U3T A;  4FCF A;  3RXW A;  2WGW B;  2ZMA A;  3EQV A;  4OQH A;  1Q2P A;  3HBR A;  1MXO A;  4D2O A;  5A91 A;  5HL1 A;  2XR0 A;  4X53 A;  3GSG A;  1ZKJ A;  3HVF A;  4KZ6 A;  4GB7 A;  4EBP A;  1K38 A;  1YLT A;  2P74 A;  2WGW A;  3N8R A;  1ERQ A;  4UHU A;  1YM1 A;  2OLU A;  3BFC A;  3IF6 A;  3OPR A;  1MWR A;  2OSU A;  3P09 A;  4HEF A;  5CHM A;  4BLM A;  4DE3 A;  4JXV A;  4C3Q A;  2XD5 A;  4E6W A;  5EPH A;  1DY6 A;  5A90 A;  5HAQ A;  3ZNT A;  3DWK A;  3M2K A;  3IXG A;  2J9O A;  3V3R A;  1ZG4 A;  3OZH A;  1ESI A;  1ZC2 A;  1BT5 A;  4MEZ A;  3W4P A;  3NY4 A;  2RL3 A;  5FAT A;  2B5R A;  4EBN A;  3G35 A;  2HP5 A;  1FSW A;  3HLG A;  1WYC A;  4PMA A;  3PBT A;  3CZD A;  5KZH A;  3G2Y A;  3TG9 A;  1E3U A;  5DF9 A;  5HX9 A;  3UPN A;  3ZGA B;  4E3O A;  5M1A A;  5FQI A;  3OCN A;  3ZG0 A;  5HAR A;  4FSF A;  2WAF A;  4MLL A;  3VSL A;  1MY8 A;  1JTG A;  2Y59 A;  2EX6 A;  5FI2 A;  4ZJ3 A;  3ZG9 B;  4IBX A;  3OPL A;  4OKP A;  5E2E A;  3ZHH A;  1EI5 A;  2WKE A;  3O88 A;  5FI7 A;  5D3O A;  1NXY A;  3V5M A;  1SDN A;  2ZM0 A;  4XUZ A;  1BLP A;  5TGF A;  4GDB A;  3UDX A;  3GMW A;  1NZO A;  1RP5 A;  3GR2 A;  3HLB A;  3SS5 A;  3ZG8 B;  1IKI A;  2Y2K A;  4E3N A;  5L2F A;  2CC1 A;  4LEN A;  2ZD8 A;  1XGI A;  2XEP A;  4Y0T A;  1RGY A;  1OME A;  3PAE A;  4XXR A;  3HLF A;  4S2N A;  4BL3 A;  3A3J A;  4BQM A;  1ALQ A;  4U0T A;  2Y2Q A;  4OQG A;  1S0W A;  2XF3 A;  1HVB A;  5HFO A;  3VP4 A;  1GA0 A;  1ES4 A;  4OPZ A;  4KZB A;  4S2L A;  5GLD A;  4EQI A;  4JXW A;  1BUE A;  3A3D A;  1YMS A;  3OPH A;  1FOF A;  5TR7 A;  1WYB A;  1FSY A;  4UA7 A;  2OV5 A;  3NIA A;  3IHB A;  4RX3 A;  3Q1F A;  4Q8I A;  1K57 C;  3M6H A;  2EXA A;  3RXX A;  3Q81 A;  3MZD A;  2A49 A;  5DTK A;  3HUN A;  1KDW A;  5HAP A;  4HES A;  3A3F A;  4KZ3 A;  4QB8 A;  3S4X A;  1O07 A;  5HW3 A;  1KGE A;  4DXC A;  1GHP A;  1I2S A;  4R23 A;  4S2P A;  1K54 C;  4O7D A;  1LI0 A;  3IH8 A;  1SDE A;  1JWP A;  2HP6 A;  4JPM A;  5EOO A;  5GL9 A;  1MKI A;  4P6B A;  2JC7 A;  2QZ6 A;  2ZQA A;  5FA7 A;  1RGZ A;  4WZ5 C;  4JF4 A;  5EEC A;  4QHC A;  1ERO A;  1JWV A;  5E2G A;  1ES5 A;  1PI4 A;  2WZZ A;  4ZJ2 A;  2H0Y A;  4RX2 A;  1VQQ A;  1ES3 A;  1ESU A;  3HLE A;  1N9B A;  1FCO A;  1H5X A;  1XKZ A;  1PWC A;  3IWI A;  3WRT A;  3VFH A;  3AGE A;  4GOG A;  2WKI A;  4GZB A;  5GLA A;  1KGF A;  2Y91 A;  1PW8 A;  3HUM A;  3PTE A;  4DE1 A;  5EVI B;  2WZX A;  4OLG A;  3S1Y A;  4WBG A;  2HPB A;  3G2Z A;  3DW0 A;  5F1F A;  4S2O A;  5CGW A;  1IYO A;  3UE3 A;  4MNR A;  3LO7 A;  3WS0 A;  5EVI A;  4R4R A;  1K25 A;  5F1G A;  1H8Z A;  1PWD A;  4S2M A;  3VFF A;  3BLM A;  2C5W B;  4JXS A;  1IEL A;  1AXB A;  1KVM A;  2Y2L A;  3BFG A;  3JYI A;  3V39 A;  2JCH A;  2WAE A;  4C6Y A;  4OVD A;  4ZAM A;  4QY6 A;  1IEM A;  1ONG A;  3C7V A;  4UA9 A;  4K0W A;  5CHJ A;  2Y2I A;  4EV4 A;  3IF6 B;  3QNC A;  4EWF A;  1IKG A;  3MKE A;  1L0D A;  4KZ5 A;  3SS3 A;  2XH9 A;  4WEK A;  1K56 A;  1TDL A;  2J7V A;  5CGX A;  2XFS A;  3BEC A;  3HLC A;  5CGS A;  5CED A;  3G31 A;  4ZDX A;  1K55 C;  4KZA A;  5FSR A;  4CJN A;  4RA7 A;  4OPQ A;  1LL9 A;  1ZG6 A;  4LCL A;  3UDI A;  1PZP A;  4GNU A;  4ZBE A;  1MWU A;  4GKU A;  3SH9 A;  4B4X A;  4PM8 A;  5I94 A;  2H0T A;  1Q2Q A;  2E8I A;  3HL9 A;  2GDN A;  4OPR A;  3O86 A;  4N9K A;  5J8X A;  4IED A;  5CHU A;  1XA1 A;  4OQ0 A;  1W79 A;  4R4S A;  5AQA A;  3GV9 A;  2ZC7 A;  1E25 A;  2IWB A;  3UPP A;  3A3I A;  3BFD A;  3VOZ A;  1KE0 A;  1KDS A;  3HUO A;  4XUX A;  1NZU A;  3VP3 A;  4JLF A;  4OP8 A;  4JF6 A;  1CEF A;  2G2W A;  1BTL A;  4WYY A;  5FQK A;  1G68 A;  2EFX A;  5U47 A;  3OC2 A;  2J8Y A;  2WGV A;  4B4Z A;  3LEZ A;  1DJB A;  3C7U A;  3QNB A;  1M40 A;  1N4O A;  1W8Q A;  5GHX A;  2WAD A;  4GDN A;  1SCW A;  3G30 A;  2IWC A;  4OPY A;  4P87 A;  2Y2P A;  1HZO A;  3WWX A;  3W8K A;  2Y55 A;  1L0E A;  4KQR A;  1CI8 A;  5E43 A;  1LL5 A;  4YIN A;  4M3K A;  3QHY A;  5F82 A;  1MWT A;  4PM6 A;  1BSG A;  4N1X A;  3WS5 A;  5DF8 A;  1M6K A;  3NBL A;  1K4E A;  3MFD A;  3RJU A;  1EWZ A;  4KEN B;  5CTM A;  2FFF B;  1E3U D;  5GLB A;  3FKV A;  3Q7Z A;  3PBR A;  2HDR A;  1JWZ A;  3HLW A;  2XQZ A;  3N7W A;  2Y2O A;  1W5D A;  3N4I A;  4KG5 A;  1HD8 A;  5FAP A;  3FYZ A;  1KE3 A;  1TVF A;  3MZF A;  2XK1 A;  1K6R A;  2WYX A;  3G32 A;  1GHM A;  1PI5 A;  1RCJ A;  4ZJ1 A;  1L2S A;  3VP2 A;  3OPP A;  5AQB A;  2ZQD A;  2Z2M B;  1LLB A;  3D4F A;  3SOI A;  4UAA A;  3TOI A;  3EQU A;  4DXB A;  2JBF A;  3VOY A;  2J9P A;  1K55 A;  4X55 A;  4KZ4 A;  1BLC A;  2Y2M A;  1HTZ A;  4LV2 A;  4RVA A;  1ERM A;  1BLS A;  2PU4 A;  2Q9N A;  3PBO A;  5FI6 A;  4E3K A;  2ZJ9 A;  4WMC A;  5DF7 A;  2Y2G A;  5F83 A;  1U60 A;  3BFF A;  3MXR A;  1CI9 A;  1NYY A;  1PIO A;  4IBR A;  4K91 A;  4JBF A;  4RYE A;  4KG2 A;  2WUQ A;  4QJG A;  5FAS A;  4WEJ A;  1MBL A;  5DVA A;  4QD4 A;  4P85 A;  5EE8 A;  4PM7 A;  1Y54 A;  2ZC5 B;  4N92 A;  2EX2 A;  4EUZ A;  1IYQ A;  2XD1 A;  3NI9 A;  2Y2H A;  3UN7 A;  4JXG A;  3SH8 A;  2G2U A;  3ZDJ A;  1S6R A;  1H8Y A;  3BEB A;  1I5Q A;  5EUA A;  4U0X A;  4FD8 A;  1KGG A;  4GD8 A;  4DDS A;  1TEM A;  4LV1 A;  5CEB A;  1J9M A;  3B3X A;  5FQJ A;  3FV7 A;  2DNS A;  2R9X A;  3HRE A;  3ITA A;  1NYM A;  3A3E A;  3PBN A;  1E4D A;  4HBT A;  1YLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...