3BY8A

Crystal structure of the e.coli dcus sensor domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
b'DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein dcuS
molecule tags Transferase
source organism Escherichia coli
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
total genus 41
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17203 sCache_3_2 Single cache domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by8A00
3E4PA 3P7NA 4LRZE 3VE3A 5F5YA 1OJ5A 1OTAA 2HV1A 4K08A 1LT0A 1XJ6A 2A24A 3ICYA 4NXFA 3UE6A 4BBUA 2D01A 4RQ9A 1XFNA 3CAXA 4WUJA 5TBMA 2PYPA 4HJ4A 3UMDA 4HJ6A 5HDCA 1T19A 3H7WA 3LYXA 3LICA 4HH2A 5G4YA 3MFXA 1TS6A 3H82B 3H9WA 3MJQA 4I3JA 2VEAA 3A0RA 3NOUC 3UMEA 5DKKA 1VB6A 3HJIA 1DRMA 1OTBA 1UWNX 5F6AA 2KX6A 1LSWA 3IBRA 1UWPX 4JGRA 3IS2A 2OWJA 3KX0X 4HP4A 5TBMB 1XFQA 3LIAA 3IS2B 3B33A 2D02A 1S1YA 4R3AA 2OWHA 1MZUA 4EESA 4LRYC 2VLGA 5DKLA 2A24B 1S67L 2ZOHA 4I38A 5A8BA 3HJKA 3LIFA 4BBTA 5G4ZA 4L9GA 1TS0A 3LUQA 4LLOB 5HZHA 1S4SA 4MN5A 3GECA 4HI4A 3GDIA 1BYWA 1N9OA 3D72A 1OTEA 2QHKA 1WA9A 1T1AA 3UB9A 4GHIA 4HNBA 4M4XA 4KUKA 2QWSA 2I9VA 4HY8A 1F98A 3NJAA 1TS8A 4L9FA 3K3CA 3K3DA 3RH8B 5HWWA 1GSWA 4GW9A 2R78A 1UGUA 2OOLA 3CLOA 4LRXC 4HOIA 4I39A 2W27A 5EFWA 2PYRA 2QKPA 1TS7A 2V0UA 3G6OA 1NWZA 3EWKA 4GHIB 4I5SA 1LL8A 1XJ2A 2INWA 4NXGA 3FC7A 2YKHA 2L0WA 4EW7A 3C2WA 1ODVA 2PD8A 2M1CA 2PHYA 4HIAA 2YKFA 4EEPA 4HJ3A 3LI9A 1EW0A 4JGQA 2VV8A 4R6LA 4BBVA 4H6JB 5IS1A 4PKYA 1V9YA 4HQAA 5DJUA 5J3WA 4XT2A 5AVFA 5HDSA 3RTYA 2PR6A 4NXEA 4KQDA 2B02A 2WKPA 2EA9A 3SW1A 4F3LB 1XJ3A 3CWFA 2VV7A 5F68A 2PDRA 2WKQA 1KOUA 1OTIA 3ZQ5A 2CMNA 4H6JA 4I3IA 4EXOA 1DP9A 4WF0A 3UB8A 1GSXA 1P97A 2VV6A 2J80A 2PD7A 4YWZA 4F3LA 4JGOA 3C8CA 3PHYA 5HD5A 3MR0A 2W0NA 3MXQA 1OTDA 1V9ZA 4WLAA 3UB6A 2JN7A 3EEHA 1X0OA 1Y28A 4HP9A 4MN6A 5F69A 1JNUA 4GS9B 4I3AA 2ZOIA 2QJ7A 3E4OA 3VE4A 4DJ3A 3BY8A 1DP8A 3F1NA 5DJTA 1D06A 4DJ2A 2H28A 4JGPA 4WL9A 3T50A 1OJGA 4R38A 1N9NA 1S66L 1XJ4A 2Z6DA 4HHDA 3VOLA 5AVEA 4EETB 2PR5A 2L4RA 2QJ5A 3F1OA 3F1PA 3LIDA 4PKYG 2BASA 5HWTA 4EEUA 4R70A 3LI8A 1OT9A 5HD3A 1D7EA 3PYPA 1T1CA 1LSXA 3H7WB 4NXBA 2L1MA 3LIBA 4XT2B 5J7EA 2V1AA 2K7SA 1S4RA 4B9OA 3UB7A 4EQ1A 5J4EA 5KIZA 4HH3A 2JHEA 3A0VA 3BWLA 1N9LA 3MQOA 4KUOA 4L9EA 4LPZA 3ULFA 2P7JA 3BY9A 4E04A 1DP6A 4GCZA 1S1ZA 3NOTC 3NOPC 3H82A 2GJ3A 1OT6A 2V1BA 3FG8A 1P0ZA 2ZBBA 3LIEA 4GS9A 3NHQA 5HSQA 1F9IA 1LSVA 4WN5A 1G28A 2V9AA 5I5LA 1T18A 1GSVA 3A0SA 3F1OB 3F1PB 2V0WA 2KDKA 2WKRA 3MQQA 3OLOA 4EERA 5HWVA 5IU1A 2Z6CA 1T1BA 3E4QA 5HDDA 3F1NB
chains in the Genus database with same CATH superfamily
3VE3A 5CTMA 3VP3A 4BD0A 3T4SA 3UMDA 2B5RA 2HP9A 1FCNA 2J3TD 3H82B 5EPHA 1H8ZA 4X56A 2Y79A 2FZ0A 2KX6A 4DKIA 1XFQA 2PBDP 2A2LA 2XR0A 4KZAA 3ZHHA 4QHCA 3VP2A 1EI5A 4OQHA 4DE1A 4I38A 5A8BA 1L0DA 1TDGA 1W5DA 4MN5A 3BFEA 4S2NA 1MPLA 3OBFA 1K57C 1TS7A 4S2MA 1NWZA 2M7VA 1K55C 4LENA 4GHIB 1LL8A 3VP1A 5AQAA 3GV9A 2OV5A 1CI8A 4H6JB 5CHJA 4KZ9A 4OP5A 1BULA 4X53A 4XT2A 1L0EA 4DE2A 2H0YA 1VETB 4P6BA 5JYPA 2CMNA 3C8CA 1YM1A 4MN7A 1XA7A 4MN6A 4OPQA 3HUMA 4JGPA 4G3KA 2Z6DA 3TG9A 3OPRA 1S4RA 4OQIA 3QP6A 4EQ1A 4LCLA 4LPZA 3AGFA 2HDQA 2V1BA 1ESUA 1RGYA 2ZC7A 4ARZB 4GNUA 5FQKA 1T1BA 2ZL1B 1I2SA 3C30A 2JCHA 1K6SA 4WUJA 1NRJA 3LYXA 4MEZA 2ZM0A 4UAAA 3IXDA 5CGWA 3A0RA 3ZNYA 1K54A 1VB6A 4KQOA 3IS2A 5A92A 4LV0A 3G30A 4B4ZA 4X68A 2XK1A 4B4XA 4UA6A 4K0WA 4EUVA 4DMZA 4E3MA 2I72A 1CEFA 1NZOA 2HP6A 4DE0A 4Y7PA 2WKEA 2P04A 3MKEA 1IOUA 1K25A 2Y2KA 4UQIS 1YT4A 3EWKA 4I5SA 3B3XA 5L8MA 4UEYA 2L0WA 3UNWA 3CI6A 3DAVA 4HESA 1EW0A 2ZC3B 2QPNA 3PBNA 1YAXA 5HDSA 5AVFA 3TSGA 1YLYA 4FCFA 4X55A 1XJ3A 2OAQ1 3GRJA 3HBRA 4JLFA 2J3WA 4JXWA 2PD7A 2W0NA 3C7UA 4ZDXA 1BTLA 4S2JA 3NBLA 4LV2A 5DF9A 1XJ4A 3K2NA 2QJ5A 2J3TC 2BASA 2V2FF 1NYYA 3N4IA 3H7WB 4XXRA 3OPLA 4L9EA 4Y0UA 3IWQA 1F9IA 4E3LA 3DTKA 4PHTA 3VOYA 1RGZA 2JKRI 1W63M 1HD8A 4C75A 1DRMA 1UWNX 3E2KA 4GD6A 3CPTA 1K56A 3LIAA 2FFFB 1S1YA 2XH9A 3O3VA 1MZUA 5IHVA 3LIFA 1LL5A 4L9GA 1N9OA 3ZDJA 3T4KA 3SH9A 1F98A 2XDMA 2IA2A 3K3DA 5EVIA 4MBKA 1SKFA 4JF5A 2W27A 2V0UA 3FKVA 2PT7A 3GR2A 4NK3A 2EX9A 3FC7A 3Q7VA 1FSWA 3KO6A 1AWIA 5DJUA 4Z1WA 1YLTA 4IEDA 3IF6A 3UPNA 1Z6FA 2MJ6A 2G2WA 2Y2GA 3ZQ5A 1DP9A 4OOMA 2VV6A 5HAPA 1BLPA 2P08A 1E25A 4GD8A 1V9ZA 5DTTA 3VFFA 4JF4A 4BWIA 3PXPA 3F1NA 5AQ7A 3T50A 2XEPA 3VOLA 5KZHA 1L0GA 1DY6A 5E2GA 4PKYG 5HD3A 4EQIA 2JKTI 4NXBA 3LIBA 5FQQA 4EUZA 3QP8A 1K54C 3BWLA 4G3WA 5L07A 1LI0A 1O7EA 1DP6A 5HPIA 1KGEA 1Q2PA 5DVAA 3WS1A 3C5AA 2KLIA 2V0WA 4RVAA 2ZL1A 4ZBEA 2EXAA 5HWVA 1G6AA 5IU1A 1E3UA 3O88A 3E4PA 3T4LA 4S2NC 4RQ9A 2EXBA 4DF6A 5DFYA 2LB5A 1W8QA 3UB5P 4OLDA 3NOUC 4B93A 1LSWA 4JGRA 2OWJA 4ZJ2A 3PBQA 1C3BA 3MSHA 1YLPA 4Y0OA 3HJKA 3LR4A 4E3KA 2J9PA 1GA0A 3KSFA 4WYYA 3N8RA 3QP2A 5CRFA 4YINA 3ZCZA 2I9VA 3V3SA 1ONGA 3IWIA 4GKUA 4KZ6A 2WK0A 3CLOA 5EFWA 4ZJ1A 3U4LP 5CHUA 2JKFA 3A3EA 3S1YA 1E3UD 4Q0JA 4LFUA 3NDEA 5TFQA 5IT5A 3T12B 2O99A 3UB8A 4EWFA 1IYQA 1SHVA 1VETA 2XD1A 3C38A 2ZOIA 5DJTA 4DJ2A 1D06A 3CZDA 1IEMA 1Y54A 4JKTA 5FI7A 3UPPA 2FFYA 3HLDA 2V1AA 4WZ5C 5FSRA 1MKMA 3QP5A 1JTGA 3BY9A 4QU3A 3OLOA 1SDNA 3FZCA 4IVIA 2C5WB 4WEKA 3LY3A 2PBYA 3P7NA 5F5YA 1OJ5A 1PW8A 1OTAA 4MBFA 3ISGA 3PAEA 3M6BA 2ZQ7A 4BD1A 3Q7ZA 2ACGA 4OOLA 3IX4A 1SKOA 3JVUA 5CXWA 1FR1A 3OCLA 2O0YA 2IWCA 4Y17A 2W3FA 3TOIA 2Y2JA 4WMCA 1CF0A 1NJ4A 4EBPA 2WKIA 3D72A 2QHKA 4B88A 4KUKA 4HY8A 3KYEA 4L9FA 3G32A 1PFLA 3VMAA 2A49A 5CTNA 1IKGA 3CPTB 2JE5A 4NXGA 3C2WA 1ODVA 2PHYA 3IF5A 3KSIA 3UDIA 3ZYTA 1V9YA 1LHYA 3EQUA 3IXHA 2HDSA 5CGXA 1FSYA 3D4FA 2VV7A 1BLCA 3BLSA 4IUHA 4OQGA 4E3IA 3QHYA 3P98A 2HZ5A 3BY8A 4JF6A 4ZRRA 4CLCE 3OCNA 3E2LA 4B9OA 4WBGA 2JHEA 2V1ZA 4F94A 1G28A 1VM1A 4R4SA 2V8CA 3BW6A 4X6TA 3QP1A 1MWRA 2XA7M 5TGFA 1PZOA 3IX3A 5GHYA 3ICYA 2H5SA 2RCXA 2ZQCA 2A3UA 5G4YA 3ZFZA 3BFDA 2XD5A 3VSKA 3N8LA 1YLJA 4Y5FA 5EVIB 1NYMA 3LO7A 2WYXA 1VQQA 1IYOA 1K4FA 1PZPA 3MBZA 1XKZA 1OMEA 3N8SA 4HNBA 1FQGA 2W1TB 3NJAA 5HWWA 3IF6B 4HEFA 3GTCA 4R23A 2JBFA 3CUEA 3WS0A 4O01A 4IJGA 2HP5A 2Y2PA 1S0WA 3SS3A 3V39A 3HVFA 5DF7A 5F68A 3P09A 2EX2A 1WE4A 2Q0OA 3PBOA 2QYBA 4KZ5A 1XXMA 1GHIA 3KYQA 1X0OA 3VE4A 2QJ7A 3BQAA 4Y13A 1KGGA 3JYIA 4QWOA 3MKFA 4XT2B 1A0KA 4N1XA 3L9KA 3UE1A 1DJBA 3R7WA 1N9LA 3IH9A 5CX7A 1RP5A 2WAEA 3ITAA 1N4OA 4C3QA 2EFUA 2Z6CA 3E4QA 5HDDA 2HV1A 2A24A 4BBUA 4HJ4A 4U3TA 4YOFA 1K38A 4WM9A 3UMEA 1PNEA 1OTBA 2GZAA 4OPYA 5TBMB 3T4JA 3LR0A 3S4XA 2VGLS 2OWHA 2EWWA 4CJNA 4CQHA 3U2AA 5JYOA 3ZG8B 1E4DA 4BBTA 5LBRA 1FILA 3HCYA 3GDIA 5FAPA 3OPPA 3UB9A 3LFVA 5FASA 4PAUA 3EQVA 1CI9A 3WWXA 4HOIA 2QKPA 3G6OA 3BECA 4EBNA 4ID4A 2H0TA 3NCKA 4R6LA 2BTFP 1HVBA 2ZQ8A 1GCEA 5AQ9A 5BOHA 1PWGA 5GLBA 2EA9A 5FQMA 3CWFA 1ES5A 1P9WA 1YLZA 4DRTA 1P97A 3BJNA 4K91A 1OTDA 4DN0A 1KDWA 2GDNA 4GS9B 3E4OA 5GHXA 1RCJA 2H28A 4QY5A 2W3DA 4R0QA 3VSLA 1N9NA 4NEED 4QY6A 5FQ9A 2Y2HA 4OOYA 3KYZA 3ZG5A 1LSXA 2FH5A 5FL3A 3NI9A 4Q8IA 2OLUA 2HGVA 1CK3A 4ARZA 5A90A 3OPHA 1OT6A 1AXBA 1P0ZA 3Q07A 2Y59A 4Y0TA 4S2OA 4EU0A 1T18A 1GSVA 3F1OB 3GSGA 4IUKA 4MMNA 4EBLA 5K5BA 1J3WA 5DTSA 2V8FA 2D01A 2X71A 4N1HA 3SS4A 4P87A 3S7PA 4I3JA 2VEAA 5E2EA 4DXBA 1GHMA 2QZ6A 4FD8A 1ES4A 2ZC4B 5HL1A 3LEQA 4NETA 3RFBA 3HLGA 1H0MA 1EWZA 5CECA 1W8YA 1QMFA 1XGIA 3GECA 5FI2A 1G5UA 4M4XA 5I94A 4BJPA 2P9VB 2VZWA 3S7OA 2PAVP 2ZLYA 4M3KA 4LRXC 3IHBA 5EVIC 5L10A 1PI5A 3B42A 4KENB 4BBVA 4QB8A 2Y2IA 3SZTA 1ZG4A 3UO9A 2PDRA 4WF0A 3PHYA 5HD5A 3EGXC 2JN7A 3PTEA 4I3AA 3C4PA 2Y55A 4OONA 2ZD8A 4KQQA 3FKWA 1MWUA 3WS5A 5GL9A 4FH4A 3CJMA 1D7EA 2DMWA 1KVMA 2NUPC 5J4EA 4OVDA 2DRWA 5EOOA 3ULFA 3MZEA 4E3OA 2GJ3A 4GS9A 2JKTM 2KDKA 3WS4A 1K6RA 3F1NB 3P01A 1BZAA 3IQAA 5E2HA 4NXFA 2VJWA 2Y2QA 3SH7A 5EM1A 2WKHA 3G35A 4GDNA 5HDCA 3LICA 1D1JA 4PM5A 1LL9A 5CGSA 1OPXA 5M19A 4LCMA 3IXBA 1YPRA 1TF1A 4FH2A 1IYPA 2VLGA 4FUWA 1MXOA 2VA0A 4Q0HA 5EV0A 1ACFA 4LLOB 4PM6A 1T1AA 5HAIA 1XP4A 1GSWA 3VP0A 3MS6A 3ZVTA 4QJGA 1VEUA 1HTZA 1JVJA 3R7WB 5IS1A 2WGIA 2PR6A 4NXEA 1FR6A 1I5QA 4FSFA 4BLMA 2WADA 2DNSA 1HLUP 4GB7A 3GMWA 1IYSA 3MZFA 3LEZA 2Z2LB 4D2OA 1LLBA 2L4RA 3PBTA 4EEUA 3BRMA 4CPKA 2OSUA 1PRQA 1T1CA 5J7EA 2K7SA 3JVVA 1NRFA 2XQZA 4KUOA 1BSGA 4BL3A 3NOPC 3NHQA 4IBRA 4GLQA 2IWDA 2WKRA 1XPBA 4DE3A 4IHQA 4KG2A 2K2NA 2Y2NA 1ZHHB 5HFOA 3KSGA 4O7DA 4WELA 4MNRA 3HJIA 3IT9A 3IBRA 4ESPA 2J8YA 3IS2B 3T1XA 2Y2OA 3BEBA 5FQJA 5GLAA 1YKDA 5GLCA 4GN2A 2HJ9C 2JC7A 4IVKA 3MXRA 1OTEA 4P6ZM 4OQ0A 3CITA 2ZQ9A 1K55A 5FEGA 1TD5A 4KG5A 4RX3A 4LGWA 3T1RA 2YKHA 1J9MA 4HIAA 4LV3A 2VV8A 5HAQA 3V5MA 3O87A 4PKYA 1IELA 4OLGA 5FDHA 5D3OA 1ES2A 1MY8A 2WKQA 1OTIA 1NXYA 1SKOB 1YMXA 1GSXA 2H10A 3DTIA 4K0XA 4OPZA 3UB6A 1MC0A 4HP9A 3BFFA 5AJGA 5E2FA 5F69A 3O86A 3VV4A 3E0YA 3HLCA 2C6WB 1OJGA 4R38A 4EETB 1NLYA 5AVEA 3UY6A 2EX8A 2M7UA 2L1MA 3M2JA 1WYBA 5HPFA 5KSHA 1S1ZA 5EM0A 3HLWA 3A3IA 5HSQA 4MDZA 3F1PB 5F83A 4RA7A 4GJ4A 3DW0A 3VFHA 2K31A 5TBMA 4HJ6A 1CEGA 3H7WA 3W8KA 5CERA 3W2ZA 3PR6A 4IBXA 3KX0X 3NY4A 3B33A 4BMWA 3SOIA 1K0KA 3ZG0A 1DJAA 1MBLA 3IHAA 4CLCD 4EESA 2A24B 2ZOHA 1ONHA 5KSCA 5DF8A 3UE0A 1MKIA 5L2FA 2QWSA 3T1QB 2B18A 1TS8A 3RH8B 1H5XA 4HBTA 4X25A 4Y2FA 2INWA 2YKFA 4JGQA 1NY0A 4S2KA 2W3HA 4ZJ3A 2VGKA 5F1GA 1YSQA 2EX6A 5CEBA 5TR7A 1KGFA 1FIKA 5CHMA 1JWVA 5EVID 3VP4A 1G68A 3MXQA 3MXSA 1W79A 4DJ3A 5DTKA 4OKPA 1JTDA 3B47A 4R4RA 1FOFA 2PR5A 4FTXA 1FCOA 4GZBA 5HWTA 1OT9A 3FPVA 1ERMA 3TRCA 1H8MA 3ZG7B 2J7VA 3MQOA 2EFXA 4E04A 3TE8A 2PU4A 4R3JA 1VHMA 2XRNA 1LSVA 5I5LA 3ZVWA 3MQQA 3OZHA 2P74A 4PM8A 2ZM2A 2OAP1 4NG2A 1DJCA 3G2ZA 4HBUA 2O9BA 1XJ6A 1SZVA 2R9XA 3G31A 2XROA 3IBJA 4KG6A 3N6IA 4P85A 4U0TA 2DCFA 1ZC2A 2JKRM 4R3AA 3HUOA 1HZOA 2AVXA 3IF6C 4P6ZS 1LI9A 2WUQA 4OH0A 3V50A 4E3NA 3MZDA 2PRFA 3FYZA 2HDUA 1XX2A 3K3CA 4GW9A 2ZQAA 2OOLA 1ALQA 4I39A 3UDXA 3PAGA 1I2WA 5U47A 4H8RA 2Z2MB 3GVBA 1PWCA 1PW1A 4HQAA 3S7NA 1P9RA 1H3QA 4KQDA 2ZMFA 3LGOA 4R1GA 5EOEA 2UWXA 1QMEA 3D3OA 3W4OA 4DDYA 1BLHA 4Y15A 2XSSA 4KZ7A 5EE8A 4OP8A 1DP8A 3V3RA 2XFTA 4WL9A 2WGWA 4HHDA 1M40A 3NC8A 2ZMAA 3V67A 4R70A 3MMHA 5TJJA 3NOTC 2ZM8A 3LIEA 4NKPA 4WN5A 1IFQA 4BL2A 1L3LA 1TDLA 4KQRA 4UHUA 4E6WA 1CJFA 4ME4A 3C7VA 1LT0A 3S22A 3BLMA 2ZC6B 4L0LA 2HF6A 4LV1A 2PYPA 2HDRA 3M6HA 3MFDA 2O9AA 3H9WA 3MJQA 4O8GA 5DKKA 3LY4A 4PMAA 1JWPA 5F6AA 2GX5A 3HLFA 1U60A 3MQ0A 4YFMA 1SCWA 2Q9NA 4QD4A 1BUEA 2XGNA 4S2LA 4FOFA 3LCEA 2HPBA 3EGDC 4YNRA 1W7FA 1N9BA 2Y4AA 5FQIA 3WRZA 4DXCA 1WA9A 3IWOA 1PIOA 3LR3A 3UE3A 2LB9A 2IWBA 5FAOA 1MWSA 2ZMVA 3QP4A 3G2YA 5F82A 4E6XA 4EW7A 2PD8A 3DTEA 3WRTA 3OOVA 3Q81A 5HL6A 2G7UA 3HLBA 1KE4A 2B02A 2X02A 2WKPA 4JXVA 3T4TA 1JWZA 1L2SA 3Q82A 3T4OA 1KOUA 4H6JA 4R3BA 1VEUB 4F3LA 2W1RA 4S2PA 2E8JA 3MR0A 4WLAA 3EEHA 5CEDA 1Y28A 2Q9MA 2B95A 1S66L 3F1PA 1ES3A 1H8YA 2CC1A 3LI8A 4KZ8A 4X1LA 3PYPA 3UPOA 1TVFA 3HUNA 4II7A 2E8IA 4P0MA 2GNXA 3NIAA 3D9YA 5C5KA 2XLNA 4D60A 4JXSA 4XUZA 2KOIA 4A5RA 4N92A 2QMIA 4K08A 5FAQA 5M18A 3UE6A 1K4EA 1XFNA 2XF3A 5M1AA 1T19A 1K56D 5FEFA 3CG5A 2XA7S 5GHZA 3CMZA 4ETZA 4X1MA 2W3EA 5DFXA 2WAFA 3T4QA 1KDSA 1S67L 5A93A 3L7HA 2VGLM 3R4KA 1S4SA 4HI4A 1W63Q 1Y4OA 1XA1A 4GHIA 1MWTA 2W1TA 2VGJA 2PYRA 4O0PA 1ERQA 2BG1A 5HW3A 3LI9A 3OC2A 2BLSA 1WYCA 1IKIA 4PPRA 3Q1FA 2Y2MA 3A3FA 2VK3A 4ZAMA 3SW1A 4BQMA 3SH8A 5EVEA 3VOZA 5MC7A 4JGOA 3UN7A 3T1SA 1JNUA 4GDBA 3BQ8A 3IXGA 3C4OA 5G18A 4Q0IA 2P7JA 4GCZA 3AGEA 4PM9A 4AFIA 4C6YA 5FA7A 2ZJ9A 2V9AA 5L09A 1YLWA 1YMSA 4U0XA 3E98A 4GOGA 1STZA 1O07A 4CLCC 1XGJA 4X69A 4JBFA 3NULA 4ZTKA 1YSPA 3ZNTA 2ZQDA 4HH2A 1KE0A 3MFXA 3ZGAB 1S6RA 1ESIA 3PBSA 3W4QA 3PBRA 3BYDA 5DKLA 1PYYA 5F1FA 4KZ3A 4G3VA 4MCWA 4KZ4A 2O9CA 2EWVA 1Z09A 3HL9A 4JXGA 1NZUA 1CQAA 4PM7A 5AQBA 1XJ2A 3HREA 3GQZA 1F2KA 2M1CA 3QNBA 4HJ3A 3TJZC 5E43A 5FI6A 3KSHA 4XUXA 5A91A 5EUAA 1KVLA 4EV4A 3FWLA 1KE3A 1ZTUA 3IX8A 5EVLA 5J8XA 3CHWP 4WZ4A 2Y8HA 2Y2LA 2OLVA 5EECA 1SDEA 2NUTC 1BLSA 4EERA 4E3JA 4S2IA 3SS5A 3WS2A 3O5YA 2WZXA 2PU2A 3HLEA 1BT5A 1FCMA 2WGVA 3NDGA 3RXWA 3JPUA 3AGDA 3W4PA 5FDSA 3RJUA 5KIZA 3N7WA 4HH3A 3DTMA 2WGWB 3H82A 2ZBBA 3G4PA 2UV0E 1TEMA 1GHPA 2XFSA 2ZC5B 5HARA 2HJEA 3ZG9B 2V20A 1ZKJA 3EEAA 4LRZE 1EROA 4OPRA 1G6OA 3CAXA 4UA7A 4UQIM 2JKGA 1PI4A 3TW8A 4MLLA 1TS6A 1PWDA 3LR5A 4MBHA 4WEJA 4WMCD 1UWPX 1K57A 4HP4A 3BFGA 3G34A 3QNCA 3UDFA 2D02A 3FPWA 4LRYC 4RYEA 5G4ZA 1GA9A 1TS0A 3LUQA 5HZHA 3S7QA 3A3DA 1BYWA 3DWZA 3FV7A 4CLCA 1YQSA 5KMWA 4RX2A 2R78A 1UGUA 4ETXA 2RL3A 4Z9QA 2VKSA 4EEPA 3I7JA 4QPRA 3M2KA 5HX9A 5GLDA 4N9KA 5J3WA 3BM6A 3RTYA 4N9LA 3IH8A 2G2UA 2Y91A 4F3LB 4DDSA 4EXOA 4Y3IA 4I3IA 2P9VA 2J80A 4YWZA 1M6KA 3DBAA 2R9WA 4KZBA 3MF0A 4CLCB 3A3JA 2VX8A 1NLZA 1F5MA 2J9OA 3NECA 3F1OA 3DWKA 3LIDA 3RXXA 3ITBA 2X01A 3UB7A 3Q7VB 3A0VA 2WZZA 1ZG6A 3BFCA 4JPMA 3CUEC 2W3GA 3FG8A 4UA9A 5FATA 4BENA 3A0SA 3EOIA 4WZ5A 1Q2QA 1L0FA
chains in the Genus database with same CATH topology
3P7NA 3VE3A 5F5YA 1OJ5A 1OTAA 1LT0A 4NXFA 2VJWA 4L0LA 2HF6A 3T4SA 2PYPA 3UMDA 5HDCA 3LICA 2J3TD 2O9AA 3H82B 3H9WA 3MJQA 1OPXA 2Y79A 2FZ0A 4O8GA 5DKKA 4OOLA 5F6AA 2GX5A 2KX6A 3JVUA 3OCLA 1TF1A 1XFQA 2O0YA 3MQ0A 2A2LA 2W3FA 2VLGA 4I38A 2VA0A 4FOFA 4Q0HA 5A8BA 4LLOB 3EGDC 4YNRA 4MN5A 3D72A 2QHKA 1WA9A 1T1AA 4KUKA 4HY8A 3OBFA 3LR3A 4L9FA 3UE3A 1GSWA 2LB9A 1TS7A 2ZMVA 2M7VA 1NWZA 4GHIB 1LL8A 4NXGA 4EW7A 3C2WA 1ODVA 2PD8A 2PHYA 3KSIA 3R7WB 3OOVA 4H6JB 5IS1A 5HL6A 3ZYTA 2G7UA 1V9YA 4XT2A 2PR6A 4NXEA 2B02A 3T4TA 2WKPA 3EQUA 2VV7A 3T4OA 1KOUA 4IUHA 2CMNA 4H6JA 4FSFA 4F3LA 2W1RA 3C8CA 3MR0A 4WLAA 4MN7A 3EEHA 1Y28A 4MN6A 3BY8A 4JGPA 1S66L 4G3KA 2Z6DA 4ZRRA 4CLCE 3F1PA 2L4RA 3OCNA 3PBTA 4EEUA 3LI8A 3PYPA 1T1CA 5J7EA 4II7A 2K7SA 1S4RA 3JVVA 4B9OA 4EQ1A 2JHEA 4LPZA 2GNXA 4KUOA 3NOPC 2V1BA 3NHQA 5C5KA 1G28A 4GLQA 2WKRA 4ARZB 4IHQA 3BW6A 2KOIA 1T1BA 2XA7M 3C30A 2K2NA 4K08A 3ICYA 3UE6A 1XFNA 4WUJA 1NRJA 1ZHHB 1T19A 3LYXA 3KSGA 5G4YA 2XA7S 4WELA 3A0RA 4ETZA 1VB6A 4KQOA 3HJIA 3IBRA 2W3EA 3IS2A 5DFXA 4Y5FA 3IS2B 3T4QA 1S67L 1YKDA 2HJ9C 2VGLM 3R4KA 4EUVA 1S4SA 4DMZA 4HI4A 1W63Q 1OTEA 4P6ZM 4GHIA 4HNBA 3CITA 2W1TB 3NJAA 2W1TA 1TD5A 5HWWA 2P04A 1IOUA 2PYRA 4UQIS 4O0PA 3EWKA 4I5SA 3CUEA 5L8MA 4UEYA 2YKHA 2L0WA 3CI6A 4HIAA 3LI9A 1EW0A 4O01A 2VV8A 3OC2A 4IJGA 3PBNA 4PKYA 1YAXA 5HDSA 5AVFA 3SW1A 1XJ3A 2OAQ1 5F68A 2WKQA 1OTIA 5MC7A 2J3WA 1GSXA 2PD7A 3PBOA 2QYBA 4JGOA 2W0NA 3UB6A 3KYQA 1MC0A 1X0OA 4HP9A 5AJGA 5F69A 1JNUA 3VE4A 2QJ7A 3VV4A 3E0YA 3BQAA 5DF9A 1OJGA 4R38A 1XJ4A 3BQ8A 4EETB 3K2NA 1NLYA 5AVEA 2QJ5A 2J3TC 2BASA 2M7UA 4XT2B 3H7WB 2L1MA 4Q0IA 3R7WA 1N9LA 5HPFA 4L9EA 5CX7A 5KSHA 2P7JA 4GCZA 1S1ZA 4AFIA 5HSQA 1F9IA 4MDZA 2V9AA 3F1PB 4PHTA 3E98A 2Z6CA 3E4QA 5HDDA 4GJ4A 1STZA 2JKRI 2HV1A 1W63M 2K31A 2A24A 4BBUA 4CLCC 5TBMA 4HJ4A 4HJ6A 1YSPA 3H7WA 4HH2A 4YOFA 3MFXA 3UMEA 1DRMA 1OTBA 1UWNX 2GZAA 3W2ZA 3PR6A 3KX0X 5TBMB 3PBSA 3LIAA 3LR0A 3T4JA 3PBRA 3B33A 2VGLS 4BMWA 1S1YA 2OWHA 1MZUA 4CLCD 4EESA 5DKLA 2A24B 2EWWA 2ZOHA 4CQHA 3U2AA 3LIFA 4BBTA 4G3VA 5LBRA 4L9GA 4MCWA 2O9CA 3HCYA 2EWVA 3GDIA 1N9OA 3T4KA 3UB9A 3LFVA 2QWSA 4PAUA 3EQVA 1F98A 2B18A 1TS8A 2IA2A 3K3DA 3RH8B 4HOIA 2W27A 2QKPA 2V0UA 3G6OA 4Y2FA 2PT7A 1XJ2A 2INWA 3FC7A 2M1CA 2YKFA 4HJ3A 4JGQA 4R6LA 3TJZC 2W3HA 3KO6A 3KSHA 5DJUA 4Z1WA 1YSQA 2EA9A 1ZTUA 3CWFA 2MJ6A 1P9WA 3ZQ5A 1DP9A 4OOMA 1P97A 2VV6A 2Y8HA 2P08A 3BJNA 3MXQA 1OTDA 1V9ZA 2NUTC 4DN0A 4EERA 4BWIA 4GS9B 4DJ3A 3E4OA 3O5YA 3PXPA 3F1NA 2H28A 3T50A 2W3DA 3F1NB 1N9NA 3B47A 3VOLA 4NEED 2PR5A 3KYZA 4PKYG 5HWTA 1OT9A 3FPVA 5HD3A 2JKTI 1LSXA 4NXBA 3LIBA 3TRCA 1H8MA 2FH5A 5FL3A 5KIZA 4HH3A 3BWLA 3MQOA 4G3WA 4E04A 3TE8A 1DP6A 2HGVA 5HPIA 4ARZA 3H82A 1OT6A 1P0ZA 2ZBBA 1VHMA 2XRNA 1LSVA 4EU0A 5I5LA 3MQQA 1T18A 1GSVA 3F1OB 2KLIA 2V0WA 2HJEA 5HWVA 2OAP1 5IU1A 3EEAA 4IUKA 3E4PA 4MMNA 4LRZE 5K5BA 2O9BA 3T4LA 1XJ6A 2D01A 4RQ9A 1G6OA 2XROA 3CAXA 3IBJA 4UQIM 5DFYA 2LB5A 3TW8A 3S7PA 1TS6A 4I3JA 2VEAA 3NOUC 4B93A 3LR5A 4WEJA 1LSWA 1UWPX 4JGRA 2OWJA 4HP4A 2JKRM 2D02A 4R3AA 3FPWA 3RFBA 3PBQA 4LRYC 4P6ZS 3HJKA 3LR4A 5G4ZA 1TS0A 3LUQA 5HZHA 3KSFA 3GECA 3S7QA 1BYWA 4CLCA 4M4XA 2I9VA 4BJPA 2VZWA 3K3CA 4GW9A 2R78A 3S7OA 1UGUA 2OOLA 3CLOA 4LRXC 4ETXA 4I39A 5EFWA 3B42A 4Q0JA 2VKSA 4EEPA 4QPRA 4BBVA 4HQAA 5J3WA 3S7NA 1P9RA 1H3QA 3RTYA 4KQDA 2ZMFA 5IT5A 4F3LB 2PDRA 4EXOA 4Y3IA 4I3IA 4WF0A 2O99A 3UB8A 2J80A 4YWZA 3DBAA 3PHYA 3D3OA 5HD5A 3EGXC 3MF0A 4CLCB 2JN7A 2XSSA 3C38A 2VX8A 2ZOIA 4I3AA 1DP8A 1NLZA 5DJTA 1D06A 1F5MA 4DJ2A 4WL9A 4HHDA 3F1OA 3LIDA 3V67A 4R70A 1D7EA 3MMHA 2DMWA 5TJJA 2NUPC 2V1AA 5J4EA 3UB7A 3A0VA 1MKMA 3ULFA 3BY9A 3NOTC 3CUEC 2W3GA 2GJ3A 3FG8A 3LIEA 4GS9A 4NKPA 4WN5A 1IFQA 2JKTM 3A0SA 3OLOA 2KDKA 3EOIA 4WEKA 4ME4A 3P01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4P A;  3P7N A;  4LRZ E;  3VE3 A;  5F5Y A;  1OJ5 A;  1OTA A;  2HV1 A;  4K08 A;  1LT0 A;  1XJ6 A;  2A24 A;  3ICY A;  4NXF A;  3UE6 A;  4BBU A;  2D01 A;  4RQ9 A;  1XFN A;  3CAX A;  4WUJ A;  5TBM A;  2PYP A;  4HJ4 A;  3UMD A;  4HJ6 A;  5HDC A;  1T19 A;  3H7W A;  3LYX A;  3LIC A;  4HH2 A;  5G4Y A;  3MFX A;  1TS6 A;  3H82 B;  3H9W A;  3MJQ A;  4I3J A;  2VEA A;  3A0R A;  3NOU C;  3UME A;  5DKK A;  1VB6 A;  3HJI A;  1DRM A;  1OTB A;  1UWN X;  5F6A A;  2KX6 A;  1LSW A;  3IBR A;  1UWP X;  4JGR A;  3IS2 A;  2OWJ A;  3KX0 X;  4HP4 A;  5TBM B;  1XFQ A;  3LIA A;  3IS2 B;  3B33 A;  2D02 A;  1S1Y A;  4R3A A;  2OWH A;  1MZU A;  4EES A;  4LRY C;  2VLG A;  5DKL A;  2A24 B;  1S67 L;  2ZOH A;  4I38 A;  5A8B A;  3HJK A;  3LIF A;  4BBT A;  5G4Z A;  4L9G A;  1TS0 A;  3LUQ A;  4LLO B;  5HZH A;  1S4S A;  4MN5 A;  3GEC A;  4HI4 A;  3GDI A;  1BYW A;  1N9O A;  3D72 A;  1OTE A;  2QHK A;  1WA9 A;  1T1A A;  3UB9 A;  4GHI A;  4HNB A;  4M4X A;  4KUK A;  2QWS A;  2I9V A;  4HY8 A;  1F98 A;  3NJA A;  1TS8 A;  4L9F A;  3K3C A;  3K3D A;  3RH8 B;  5HWW A;  1GSW A;  4GW9 A;  2R78 A;  1UGU A;  2OOL A;  3CLO A;  4LRX C;  4HOI A;  4I39 A;  2W27 A;  5EFW A;  2PYR A;  2QKP A;  1TS7 A;  2V0U A;  3G6O A;  1NWZ A;  3EWK A;  4GHI B;  4I5S A;  1LL8 A;  1XJ2 A;  2INW A;  4NXG A;  3FC7 A;  2YKH A;  2L0W A;  4EW7 A;  3C2W A;  1ODV A;  2PD8 A;  2M1C A;  2PHY A;  4HIA A;  2YKF A;  4EEP A;  4HJ3 A;  3LI9 A;  1EW0 A;  4JGQ A;  2VV8 A;  4R6L A;  4BBV A;  4H6J B;  5IS1 A;  4PKY A;  1V9Y A;  4HQA A;  5DJU A;  5J3W A;  4XT2 A;  5AVF A;  5HDS A;  3RTY A;  2PR6 A;  4NXE A;  4KQD A;  2B02 A;  2WKP A;  2EA9 A;  3SW1 A;  4F3L B;  1XJ3 A;  3CWF A;  2VV7 A;  5F68 A;  2PDR A;  2WKQ A;  1KOU A;  1OTI A;  3ZQ5 A;  2CMN A;  4H6J A;  4I3I A;  4EXO A;  1DP9 A;  4WF0 A;  3UB8 A;  1GSX A;  1P97 A;  2VV6 A;  2J80 A;  2PD7 A;  4YWZ A;  4F3L A;  4JGO A;  3C8C A;  3PHY A;  5HD5 A;  3MR0 A;  2W0N A;  3MXQ A;  1OTD A;  1V9Z A;  4WLA A;  3UB6 A;  2JN7 A;  3EEH A;  1X0O A;  1Y28 A;  4HP9 A;  4MN6 A;  5F69 A;  1JNU A;  4GS9 B;  4I3A A;  2ZOI A;  2QJ7 A;  3E4O A;  3VE4 A;  4DJ3 A;  3BY8 A;  1DP8 A;  3F1N A;  5DJT A;  1D06 A;  4DJ2 A;  2H28 A;  4JGP A;  4WL9 A;  3T50 A;  1OJG A;  4R38 A;  1N9N A;  1S66 L;  1XJ4 A;  2Z6D A;  4HHD A;  3VOL A;  5AVE A;  4EET B;  2PR5 A;  2L4R A;  2QJ5 A;  3F1O A;  3F1P A;  3LID A;  4PKY G;  2BAS A;  5HWT A;  4EEU A;  4R70 A;  3LI8 A;  1OT9 A;  5HD3 A;  1D7E A;  3PYP A;  1T1C A;  1LSX A;  3H7W B;  4NXB A;  2L1M A;  3LIB A;  4XT2 B;  5J7E A;  2V1A A;  2K7S A;  1S4R A;  4B9O A;  3UB7 A;  4EQ1 A;  5J4E A;  5KIZ A;  4HH3 A;  2JHE A;  3A0V A;  3BWL A;  1N9L A;  3MQO A;  4KUO A;  4L9E A;  4LPZ A;  3ULF A;  2P7J A;  3BY9 A;  4E04 A;  1DP6 A;  4GCZ A;  1S1Z A;  3NOT C;  3NOP C;  3H82 A;  2GJ3 A;  1OT6 A;  2V1B A;  3FG8 A;  1P0Z A;  2ZBB A;  3LIE A;  4GS9 A;  3NHQ A;  5HSQ A;  1F9I A;  1LSV A;  4WN5 A;  1G28 A;  2V9A A;  5I5L A;  1T18 A;  1GSV A;  3A0S A;  3F1O B;  3F1P B;  2V0W A;  2KDK A;  2WKR A;  3MQQ A;  3OLO A;  4EER A;  5HWV A;  5IU1 A;  2Z6C A;  1T1B A;  3E4Q A;  5HDD A;  3F1N B; 
#chains in the Genus database with same CATH topology
 3VE3 A;  5CTM A;  3VP3 A;  4BD0 A;  3T4S A;  3UMD A;  2B5R A;  2HP9 A;  1FCN A;  2J3T D;  3H82 B;  5EPH A;  1H8Z A;  4X56 A;  2Y79 A;  2FZ0 A;  2KX6 A;  4DKI A;  1XFQ A;  2PBD P;  2A2L A;  2XR0 A;  4KZA A;  3ZHH A;  4QHC A;  3VP2 A;  1EI5 A;  4OQH A;  4DE1 A;  4I38 A;  5A8B A;  1L0D A;  1TDG A;  1W5D A;  4MN5 A;  3BFE A;  4S2N A;  1MPL A;  3OBF A;  1K57 C;  1TS7 A;  4S2M A;  1NWZ A;  2M7V A;  1K55 C;  4LEN A;  4GHI B;  1LL8 A;  3VP1 A;  5AQA A;  3GV9 A;  2OV5 A;  1CI8 A;  4H6J B;  5CHJ A;  4KZ9 A;  4OP5 A;  1BUL A;  4X53 A;  4XT2 A;  1L0E A;  4DE2 A;  2H0Y A;  1VET B;  4P6B A;  5JYP A;  2CMN A;  3C8C A;  1YM1 A;  4MN7 A;  1XA7 A;  4MN6 A;  4OPQ A;  3HUM A;  4JGP A;  4G3K A;  2Z6D A;  3TG9 A;  3OPR A;  1S4R A;  4OQI A;  3QP6 A;  4EQ1 A;  4LCL A;  4LPZ A;  3AGF A;  2HDQ A;  2V1B A;  1ESU A;  1RGY A;  2ZC7 A;  4ARZ B;  4GNU A;  5FQK A;  1T1B A;  2ZL1 B;  1I2S A;  3C30 A;  2JCH A;  1K6S A;  4WUJ A;  1NRJ A;  3LYX A;  4MEZ A;  2ZM0 A;  4UAA A;  3IXD A;  5CGW A;  3A0R A;  3ZNY A;  1K54 A;  1VB6 A;  4KQO A;  3IS2 A;  5A92 A;  4LV0 A;  3G30 A;  4B4Z A;  4X68 A;  2XK1 A;  4B4X A;  4UA6 A;  4K0W A;  4EUV A;  4DMZ A;  4E3M A;  2I72 A;  1CEF A;  1NZO A;  2HP6 A;  4DE0 A;  4Y7P A;  2WKE A;  2P04 A;  3MKE A;  1IOU A;  1K25 A;  2Y2K A;  4UQI S;  1YT4 A;  3EWK A;  4I5S A;  3B3X A;  5L8M A;  4UEY A;  2L0W A;  3UNW A;  3CI6 A;  3DAV A;  4HES A;  1EW0 A;  2ZC3 B;  2QPN A;  3PBN A;  1YAX A;  5HDS A;  5AVF A;  3TSG A;  1YLY A;  4FCF A;  4X55 A;  1XJ3 A;  2OAQ 1;  3GRJ A;  3HBR A;  4JLF A;  2J3W A;  4JXW A;  2PD7 A;  2W0N A;  3C7U A;  4ZDX A;  1BTL A;  4S2J A;  3NBL A;  4LV2 A;  5DF9 A;  1XJ4 A;  3K2N A;  2QJ5 A;  2J3T C;  2BAS A;  2V2F F;  1NYY A;  3N4I A;  3H7W B;  4XXR A;  3OPL A;  4L9E A;  4Y0U A;  3IWQ A;  1F9I A;  4E3L A;  3DTK A;  4PHT A;  3VOY A;  1RGZ A;  2JKR I;  1W63 M;  1HD8 A;  4C75 A;  1DRM A;  1UWN X;  3E2K A;  4GD6 A;  3CPT A;  1K56 A;  3LIA A;  2FFF B;  1S1Y A;  2XH9 A;  3O3V A;  1MZU A;  5IHV A;  3LIF A;  1LL5 A;  4L9G A;  1N9O A;  3ZDJ A;  3T4K A;  3SH9 A;  1F98 A;  2XDM A;  2IA2 A;  3K3D A;  5EVI A;  4MBK A;  1SKF A;  4JF5 A;  2W27 A;  2V0U A;  3FKV A;  2PT7 A;  3GR2 A;  4NK3 A;  2EX9 A;  3FC7 A;  3Q7V A;  1FSW A;  3KO6 A;  1AWI A;  5DJU A;  4Z1W A;  1YLT A;  4IED A;  3IF6 A;  3UPN A;  1Z6F A;  2MJ6 A;  2G2W A;  2Y2G A;  3ZQ5 A;  1DP9 A;  4OOM A;  2VV6 A;  5HAP A;  1BLP A;  2P08 A;  1E25 A;  4GD8 A;  1V9Z A;  5DTT A;  3VFF A;  4JF4 A;  4BWI A;  3PXP A;  3F1N A;  5AQ7 A;  3T50 A;  2XEP A;  3VOL A;  5KZH A;  1L0G A;  1DY6 A;  5E2G A;  4PKY G;  5HD3 A;  4EQI A;  2JKT I;  4NXB A;  3LIB A;  5FQQ A;  4EUZ A;  3QP8 A;  1K54 C;  3BWL A;  4G3W A;  5L07 A;  1LI0 A;  1O7E A;  1DP6 A;  5HPI A;  1KGE A;  1Q2P A;  5DVA A;  3WS1 A;  3C5A A;  2KLI A;  2V0W A;  4RVA A;  2ZL1 A;  4ZBE A;  2EXA A;  5HWV A;  1G6A A;  5IU1 A;  1E3U A;  3O88 A;  3E4P A;  3T4L A;  4S2N C;  4RQ9 A;  2EXB A;  4DF6 A;  5DFY A;  2LB5 A;  1W8Q A;  3UB5 P;  4OLD A;  3NOU C;  4B93 A;  1LSW A;  4JGR A;  2OWJ A;  4ZJ2 A;  3PBQ A;  1C3B A;  3MSH A;  1YLP A;  4Y0O A;  3HJK A;  3LR4 A;  4E3K A;  2J9P A;  1GA0 A;  3KSF A;  4WYY A;  3N8R A;  3QP2 A;  5CRF A;  4YIN A;  3ZCZ A;  2I9V A;  3V3S A;  1ONG A;  3IWI A;  4GKU A;  4KZ6 A;  2WK0 A;  3CLO A;  5EFW A;  4ZJ1 A;  3U4L P;  5CHU A;  2JKF A;  3A3E A;  3S1Y A;  1E3U D;  4Q0J A;  4LFU A;  3NDE A;  5TFQ A;  5IT5 A;  3T12 B;  2O99 A;  3UB8 A;  4EWF A;  1IYQ A;  1SHV A;  1VET A;  2XD1 A;  3C38 A;  2ZOI A;  5DJT A;  4DJ2 A;  1D06 A;  3CZD A;  1IEM A;  1Y54 A;  4JKT A;  5FI7 A;  3UPP A;  2FFY A;  3HLD A;  2V1A A;  4WZ5 C;  5FSR A;  1MKM A;  3QP5 A;  1JTG A;  3BY9 A;  4QU3 A;  3OLO A;  1SDN A;  3FZC A;  4IVI A;  2C5W B;  4WEK A;  3LY3 A;  2PBY A;  3P7N A;  5F5Y A;  1OJ5 A;  1PW8 A;  1OTA A;  4MBF A;  3ISG A;  3PAE A;  3M6B A;  2ZQ7 A;  4BD1 A;  3Q7Z A;  2ACG A;  4OOL A;  3IX4 A;  1SKO A;  3JVU A;  5CXW A;  1FR1 A;  3OCL A;  2O0Y A;  2IWC A;  4Y17 A;  2W3F A;  3TOI A;  2Y2J A;  4WMC A;  1CF0 A;  1NJ4 A;  4EBP A;  2WKI A;  3D72 A;  2QHK A;  4B88 A;  4KUK A;  4HY8 A;  3KYE A;  4L9F A;  3G32 A;  1PFL A;  3VMA A;  2A49 A;  5CTN A;  1IKG A;  3CPT B;  2JE5 A;  4NXG A;  3C2W A;  1ODV A;  2PHY A;  3IF5 A;  3KSI A;  3UDI A;  3ZYT A;  1V9Y A;  1LHY A;  3EQU A;  3IXH A;  2HDS A;  5CGX A;  1FSY A;  3D4F A;  2VV7 A;  1BLC A;  3BLS A;  4IUH A;  4OQG A;  4E3I A;  3QHY A;  3P98 A;  2HZ5 A;  3BY8 A;  4JF6 A;  4ZRR A;  4CLC E;  3OCN A;  3E2L A;  4B9O A;  4WBG A;  2JHE A;  2V1Z A;  4F94 A;  1G28 A;  1VM1 A;  4R4S A;  2V8C A;  3BW6 A;  4X6T A;  3QP1 A;  1MWR A;  2XA7 M;  5TGF A;  1PZO A;  3IX3 A;  5GHY A;  3ICY A;  2H5S A;  2RCX A;  2ZQC A;  2A3U A;  5G4Y A;  3ZFZ A;  3BFD A;  2XD5 A;  3VSK A;  3N8L A;  1YLJ A;  4Y5F A;  5EVI B;  1NYM A;  3LO7 A;  2WYX A;  1VQQ A;  1IYO A;  1K4F A;  1PZP A;  3MBZ A;  1XKZ A;  1OME A;  3N8S A;  4HNB A;  1FQG A;  2W1T B;  3NJA A;  5HWW A;  3IF6 B;  4HEF A;  3GTC A;  4R23 A;  2JBF A;  3CUE A;  3WS0 A;  4O01 A;  4IJG A;  2HP5 A;  2Y2P A;  1S0W A;  3SS3 A;  3V39 A;  3HVF A;  5DF7 A;  5F68 A;  3P09 A;  2EX2 A;  1WE4 A;  2Q0O A;  3PBO A;  2QYB A;  4KZ5 A;  1XXM A;  1GHI A;  3KYQ A;  1X0O A;  3VE4 A;  2QJ7 A;  3BQA A;  4Y13 A;  1KGG A;  3JYI A;  4QWO A;  3MKF A;  4XT2 B;  1A0K A;  4N1X A;  3L9K A;  3UE1 A;  1DJB A;  3R7W A;  1N9L A;  3IH9 A;  5CX7 A;  1RP5 A;  2WAE A;  3ITA A;  1N4O A;  4C3Q A;  2EFU A;  2Z6C A;  3E4Q A;  5HDD A;  2HV1 A;  2A24 A;  4BBU A;  4HJ4 A;  4U3T A;  4YOF A;  1K38 A;  4WM9 A;  3UME A;  1PNE A;  1OTB A;  2GZA A;  4OPY A;  5TBM B;  3T4J A;  3LR0 A;  3S4X A;  2VGL S;  2OWH A;  2EWW A;  4CJN A;  4CQH A;  3U2A A;  5JYO A;  3ZG8 B;  1E4D A;  4BBT A;  5LBR A;  1FIL A;  3HCY A;  3GDI A;  5FAP A;  3OPP A;  3UB9 A;  3LFV A;  5FAS A;  4PAU A;  3EQV A;  1CI9 A;  3WWX A;  4HOI A;  2QKP A;  3G6O A;  3BEC A;  4EBN A;  4ID4 A;  2H0T A;  3NCK A;  4R6L A;  2BTF P;  1HVB A;  2ZQ8 A;  1GCE A;  5AQ9 A;  5BOH A;  1PWG A;  5GLB A;  2EA9 A;  5FQM A;  3CWF A;  1ES5 A;  1P9W A;  1YLZ A;  4DRT A;  1P97 A;  3BJN A;  4K91 A;  1OTD A;  4DN0 A;  1KDW A;  2GDN A;  4GS9 B;  3E4O A;  5GHX A;  1RCJ A;  2H28 A;  4QY5 A;  2W3D A;  4R0Q A;  3VSL A;  1N9N A;  4NEE D;  4QY6 A;  5FQ9 A;  2Y2H A;  4OOY A;  3KYZ A;  3ZG5 A;  1LSX A;  2FH5 A;  5FL3 A;  3NI9 A;  4Q8I A;  2OLU A;  2HGV A;  1CK3 A;  4ARZ A;  5A90 A;  3OPH A;  1OT6 A;  1AXB A;  1P0Z A;  3Q07 A;  2Y59 A;  4Y0T A;  4S2O A;  4EU0 A;  1T18 A;  1GSV A;  3F1O B;  3GSG A;  4IUK A;  4MMN A;  4EBL A;  5K5B A;  1J3W A;  5DTS A;  2V8F A;  2D01 A;  2X71 A;  4N1H A;  3SS4 A;  4P87 A;  3S7P A;  4I3J A;  2VEA A;  5E2E A;  4DXB A;  1GHM A;  2QZ6 A;  4FD8 A;  1ES4 A;  2ZC4 B;  5HL1 A;  3LEQ A;  4NET A;  3RFB A;  3HLG A;  1H0M A;  1EWZ A;  5CEC A;  1W8Y A;  1QMF A;  1XGI A;  3GEC A;  5FI2 A;  1G5U A;  4M4X A;  5I94 A;  4BJP A;  2P9V B;  2VZW A;  3S7O A;  2PAV P;  2ZLY A;  4M3K A;  4LRX C;  3IHB A;  5EVI C;  5L10 A;  1PI5 A;  3B42 A;  4KEN B;  4BBV A;  4QB8 A;  2Y2I A;  3SZT A;  1ZG4 A;  3UO9 A;  2PDR A;  4WF0 A;  3PHY A;  5HD5 A;  3EGX C;  2JN7 A;  3PTE A;  4I3A A;  3C4P A;  2Y55 A;  4OON A;  2ZD8 A;  4KQQ A;  3FKW A;  1MWU A;  3WS5 A;  5GL9 A;  4FH4 A;  3CJM A;  1D7E A;  2DMW A;  1KVM A;  2NUP C;  5J4E A;  4OVD A;  2DRW A;  5EOO A;  3ULF A;  3MZE A;  4E3O A;  2GJ3 A;  4GS9 A;  2JKT M;  2KDK A;  3WS4 A;  1K6R A;  3F1N B;  3P01 A;  1BZA A;  3IQA A;  5E2H A;  4NXF A;  2VJW A;  2Y2Q A;  3SH7 A;  5EM1 A;  2WKH A;  3G35 A;  4GDN A;  5HDC A;  3LIC A;  1D1J A;  4PM5 A;  1LL9 A;  5CGS A;  1OPX A;  5M19 A;  4LCM A;  3IXB A;  1YPR A;  1TF1 A;  4FH2 A;  1IYP A;  2VLG A;  4FUW A;  1MXO A;  2VA0 A;  4Q0H A;  5EV0 A;  1ACF A;  4LLO B;  4PM6 A;  1T1A A;  5HAI A;  1XP4 A;  1GSW A;  3VP0 A;  3MS6 A;  3ZVT A;  4QJG A;  1VEU A;  1HTZ A;  1JVJ A;  3R7W B;  5IS1 A;  2WGI A;  2PR6 A;  4NXE A;  1FR6 A;  1I5Q A;  4FSF A;  4BLM A;  2WAD A;  2DNS A;  1HLU P;  4GB7 A;  3GMW A;  1IYS A;  3MZF A;  3LEZ A;  2Z2L B;  4D2O A;  1LLB A;  2L4R A;  3PBT A;  4EEU A;  3BRM A;  4CPK A;  2OSU A;  1PRQ A;  1T1C A;  5J7E A;  2K7S A;  3JVV A;  1NRF A;  2XQZ A;  4KUO A;  1BSG A;  4BL3 A;  3NOP C;  3NHQ A;  4IBR A;  4GLQ A;  2IWD A;  2WKR A;  1XPB A;  4DE3 A;  4IHQ A;  4KG2 A;  2K2N A;  2Y2N A;  1ZHH B;  5HFO A;  3KSG A;  4O7D A;  4WEL A;  4MNR A;  3HJI A;  3IT9 A;  3IBR A;  4ESP A;  2J8Y A;  3IS2 B;  3T1X A;  2Y2O A;  3BEB A;  5FQJ A;  5GLA A;  1YKD A;  5GLC A;  4GN2 A;  2HJ9 C;  2JC7 A;  4IVK A;  3MXR A;  1OTE A;  4P6Z M;  4OQ0 A;  3CIT A;  2ZQ9 A;  1K55 A;  5FEG A;  1TD5 A;  4KG5 A;  4RX3 A;  4LGW A;  3T1R A;  2YKH A;  1J9M A;  4HIA A;  4LV3 A;  2VV8 A;  5HAQ A;  3V5M A;  3O87 A;  4PKY A;  1IEL A;  4OLG A;  5FDH A;  5D3O A;  1ES2 A;  1MY8 A;  2WKQ A;  1OTI A;  1NXY A;  1SKO B;  1YMX A;  1GSX A;  2H10 A;  3DTI A;  4K0X A;  4OPZ A;  3UB6 A;  1MC0 A;  4HP9 A;  3BFF A;  5AJG A;  5E2F A;  5F69 A;  3O86 A;  3VV4 A;  3E0Y A;  3HLC A;  2C6W B;  1OJG A;  4R38 A;  4EET B;  1NLY A;  5AVE A;  3UY6 A;  2EX8 A;  2M7U A;  2L1M A;  3M2J A;  1WYB A;  5HPF A;  5KSH A;  1S1Z A;  5EM0 A;  3HLW A;  3A3I A;  5HSQ A;  4MDZ A;  3F1P B;  5F83 A;  4RA7 A;  4GJ4 A;  3DW0 A;  3VFH A;  2K31 A;  5TBM A;  4HJ6 A;  1CEG A;  3H7W A;  3W8K A;  5CER A;  3W2Z A;  3PR6 A;  4IBX A;  3KX0 X;  3NY4 A;  3B33 A;  4BMW A;  3SOI A;  1K0K A;  3ZG0 A;  1DJA A;  1MBL A;  3IHA A;  4CLC D;  4EES A;  2A24 B;  2ZOH A;  1ONH A;  5KSC A;  5DF8 A;  3UE0 A;  1MKI A;  5L2F A;  2QWS A;  3T1Q B;  2B18 A;  1TS8 A;  3RH8 B;  1H5X A;  4HBT A;  4X25 A;  4Y2F A;  2INW A;  2YKF A;  4JGQ A;  1NY0 A;  4S2K A;  2W3H A;  4ZJ3 A;  2VGK A;  5F1G A;  1YSQ A;  2EX6 A;  5CEB A;  5TR7 A;  1KGF A;  1FIK A;  5CHM A;  1JWV A;  5EVI D;  3VP4 A;  1G68 A;  3MXQ A;  3MXS A;  1W79 A;  4DJ3 A;  5DTK A;  4OKP A;  1JTD A;  3B47 A;  4R4R A;  1FOF A;  2PR5 A;  4FTX A;  1FCO A;  4GZB A;  5HWT A;  1OT9 A;  3FPV A;  1ERM A;  3TRC A;  1H8M A;  3ZG7 B;  2J7V A;  3MQO A;  2EFX A;  4E04 A;  3TE8 A;  2PU4 A;  4R3J A;  1VHM A;  2XRN A;  1LSV A;  5I5L A;  3ZVW A;  3MQQ A;  3OZH A;  2P74 A;  4PM8 A;  2ZM2 A;  2OAP 1;  4NG2 A;  1DJC A;  3G2Z A;  4HBU A;  2O9B A;  1XJ6 A;  1SZV A;  2R9X A;  3G31 A;  2XRO A;  3IBJ A;  4KG6 A;  3N6I A;  4P85 A;  4U0T A;  2DCF A;  1ZC2 A;  2JKR M;  4R3A A;  3HUO A;  1HZO A;  2AVX A;  3IF6 C;  4P6Z S;  1LI9 A;  2WUQ A;  4OH0 A;  3V50 A;  4E3N A;  3MZD A;  2PRF A;  3FYZ A;  2HDU A;  1XX2 A;  3K3C A;  4GW9 A;  2ZQA A;  2OOL A;  1ALQ A;  4I39 A;  3UDX A;  3PAG A;  1I2W A;  5U47 A;  4H8R A;  2Z2M B;  3GVB A;  1PWC A;  1PW1 A;  4HQA A;  3S7N A;  1P9R A;  1H3Q A;  4KQD A;  2ZMF A;  3LGO A;  4R1G A;  5EOE A;  2UWX A;  1QME A;  3D3O A;  3W4O A;  4DDY A;  1BLH A;  4Y15 A;  2XSS A;  4KZ7 A;  5EE8 A;  4OP8 A;  1DP8 A;  3V3R A;  2XFT A;  4WL9 A;  2WGW A;  4HHD A;  1M40 A;  3NC8 A;  2ZMA A;  3V67 A;  4R70 A;  3MMH A;  5TJJ A;  3NOT C;  2ZM8 A;  3LIE A;  4NKP A;  4WN5 A;  1IFQ A;  4BL2 A;  1L3L A;  1TDL A;  4KQR A;  4UHU A;  4E6W A;  1CJF A;  4ME4 A;  3C7V A;  1LT0 A;  3S22 A;  3BLM A;  2ZC6 B;  4L0L A;  2HF6 A;  4LV1 A;  2PYP A;  2HDR A;  3M6H A;  3MFD A;  2O9A A;  3H9W A;  3MJQ A;  4O8G A;  5DKK A;  3LY4 A;  4PMA A;  1JWP A;  5F6A A;  2GX5 A;  3HLF A;  1U60 A;  3MQ0 A;  4YFM A;  1SCW A;  2Q9N A;  4QD4 A;  1BUE A;  2XGN A;  4S2L A;  4FOF A;  3LCE A;  2HPB A;  3EGD C;  4YNR A;  1W7F A;  1N9B A;  2Y4A A;  5FQI A;  3WRZ A;  4DXC A;  1WA9 A;  3IWO A;  1PIO A;  3LR3 A;  3UE3 A;  2LB9 A;  2IWB A;  5FAO A;  1MWS A;  2ZMV A;  3QP4 A;  3G2Y A;  5F82 A;  4E6X A;  4EW7 A;  2PD8 A;  3DTE A;  3WRT A;  3OOV A;  3Q81 A;  5HL6 A;  2G7U A;  3HLB A;  1KE4 A;  2B02 A;  2X02 A;  2WKP A;  4JXV A;  3T4T A;  1JWZ A;  1L2S A;  3Q82 A;  3T4O A;  1KOU A;  4H6J A;  4R3B A;  1VEU B;  4F3L A;  2W1R A;  4S2P A;  2E8J A;  3MR0 A;  4WLA A;  3EEH A;  5CED A;  1Y28 A;  2Q9M A;  2B95 A;  1S66 L;  3F1P A;  1ES3 A;  1H8Y A;  2CC1 A;  3LI8 A;  4KZ8 A;  4X1L A;  3PYP A;  3UPO A;  1TVF A;  3HUN A;  4II7 A;  2E8I A;  4P0M A;  2GNX A;  3NIA A;  3D9Y A;  5C5K A;  2XLN A;  4D60 A;  4JXS A;  4XUZ A;  2KOI A;  4A5R A;  4N92 A;  2QMI A;  4K08 A;  5FAQ A;  5M18 A;  3UE6 A;  1K4E A;  1XFN A;  2XF3 A;  5M1A A;  1T19 A;  1K56 D;  5FEF A;  3CG5 A;  2XA7 S;  5GHZ A;  3CMZ A;  4ETZ A;  4X1M A;  2W3E A;  5DFX A;  2WAF A;  3T4Q A;  1KDS A;  1S67 L;  5A93 A;  3L7H A;  2VGL M;  3R4K A;  1S4S A;  4HI4 A;  1W63 Q;  1Y4O A;  1XA1 A;  4GHI A;  1MWT A;  2W1T A;  2VGJ A;  2PYR A;  4O0P A;  1ERQ A;  2BG1 A;  5HW3 A;  3LI9 A;  3OC2 A;  2BLS A;  1WYC A;  1IKI A;  4PPR A;  3Q1F A;  2Y2M A;  3A3F A;  2VK3 A;  4ZAM A;  3SW1 A;  4BQM A;  3SH8 A;  5EVE A;  3VOZ A;  5MC7 A;  4JGO A;  3UN7 A;  3T1S A;  1JNU A;  4GDB A;  3BQ8 A;  3IXG A;  3C4O A;  5G18 A;  4Q0I A;  2P7J A;  4GCZ A;  3AGE A;  4PM9 A;  4AFI A;  4C6Y A;  5FA7 A;  2ZJ9 A;  2V9A A;  5L09 A;  1YLW A;  1YMS A;  4U0X A;  3E98 A;  4GOG A;  1STZ A;  1O07 A;  4CLC C;  1XGJ A;  4X69 A;  4JBF A;  3NUL A;  4ZTK A;  1YSP A;  3ZNT A;  2ZQD A;  4HH2 A;  1KE0 A;  3MFX A;  3ZGA B;  1S6R A;  1ESI A;  3PBS A;  3W4Q A;  3PBR A;  3BYD A;  5DKL A;  1PYY A;  5F1F A;  4KZ3 A;  4G3V A;  4MCW A;  4KZ4 A;  2O9C A;  2EWV A;  1Z09 A;  3HL9 A;  4JXG A;  1NZU A;  1CQA A;  4PM7 A;  5AQB A;  1XJ2 A;  3HRE A;  3GQZ A;  1F2K A;  2M1C A;  3QNB A;  4HJ3 A;  3TJZ C;  5E43 A;  5FI6 A;  3KSH A;  4XUX A;  5A91 A;  5EUA A;  1KVL A;  4EV4 A;  3FWL A;  1KE3 A;  1ZTU A;  3IX8 A;  5EVL A;  5J8X A;  3CHW P;  4WZ4 A;  2Y8H A;  2Y2L A;  2OLV A;  5EEC A;  1SDE A;  2NUT C;  1BLS A;  4EER A;  4E3J A;  4S2I A;  3SS5 A;  3WS2 A;  3O5Y A;  2WZX A;  2PU2 A;  3HLE A;  1BT5 A;  1FCM A;  2WGV A;  3NDG A;  3RXW A;  3JPU A;  3AGD A;  3W4P A;  5FDS A;  3RJU A;  5KIZ A;  3N7W A;  4HH3 A;  3DTM A;  2WGW B;  3H82 A;  2ZBB A;  3G4P A;  2UV0 E;  1TEM A;  1GHP A;  2XFS A;  2ZC5 B;  5HAR A;  2HJE A;  3ZG9 B;  2V20 A;  1ZKJ A;  3EEA A;  4LRZ E;  1ERO A;  4OPR A;  1G6O A;  3CAX A;  4UA7 A;  4UQI M;  2JKG A;  1PI4 A;  3TW8 A;  4MLL A;  1TS6 A;  1PWD A;  3LR5 A;  4MBH A;  4WEJ A;  4WMC D;  1UWP X;  1K57 A;  4HP4 A;  3BFG A;  3G34 A;  3QNC A;  3UDF A;  2D02 A;  3FPW A;  4LRY C;  4RYE A;  5G4Z A;  1GA9 A;  1TS0 A;  3LUQ A;  5HZH A;  3S7Q A;  3A3D A;  1BYW A;  3DWZ A;  3FV7 A;  4CLC A;  1YQS A;  5KMW A;  4RX2 A;  2R78 A;  1UGU A;  4ETX A;  2RL3 A;  4Z9Q A;  2VKS A;  4EEP A;  3I7J A;  4QPR A;  3M2K A;  5HX9 A;  5GLD A;  4N9K A;  5J3W A;  3BM6 A;  3RTY A;  4N9L A;  3IH8 A;  2G2U A;  2Y91 A;  4F3L B;  4DDS A;  4EXO A;  4Y3I A;  4I3I A;  2P9V A;  2J80 A;  4YWZ A;  1M6K A;  3DBA A;  2R9W A;  4KZB A;  3MF0 A;  4CLC B;  3A3J A;  2VX8 A;  1NLZ A;  1F5M A;  2J9O A;  3NEC A;  3F1O A;  3DWK A;  3LID A;  3RXX A;  3ITB A;  2X01 A;  3UB7 A;  3Q7V B;  3A0V A;  2WZZ A;  1ZG6 A;  3BFC A;  4JPM A;  3CUE C;  2W3G A;  3FG8 A;  4UA9 A;  5FAT A;  4BEN A;  3A0S A;  3EOI A;  4WZ5 A;  1Q2Q A;  1L0F A; 
#chains in the Genus database with same CATH homology
 3P7N A;  3VE3 A;  5F5Y A;  1OJ5 A;  1OTA A;  1LT0 A;  4NXF A;  2VJW A;  4L0L A;  2HF6 A;  3T4S A;  2PYP A;  3UMD A;  5HDC A;  3LIC A;  2J3T D;  2O9A A;  3H82 B;  3H9W A;  3MJQ A;  1OPX A;  2Y79 A;  2FZ0 A;  4O8G A;  5DKK A;  4OOL A;  5F6A A;  2GX5 A;  2KX6 A;  3JVU A;  3OCL A;  1TF1 A;  1XFQ A;  2O0Y A;  3MQ0 A;  2A2L A;  2W3F A;  2VLG A;  4I38 A;  2VA0 A;  4FOF A;  4Q0H A;  5A8B A;  4LLO B;  3EGD C;  4YNR A;  4MN5 A;  3D72 A;  2QHK A;  1WA9 A;  1T1A A;  4KUK A;  4HY8 A;  3OBF A;  3LR3 A;  4L9F A;  3UE3 A;  1GSW A;  2LB9 A;  1TS7 A;  2ZMV A;  2M7V A;  1NWZ A;  4GHI B;  1LL8 A;  4NXG A;  4EW7 A;  3C2W A;  1ODV A;  2PD8 A;  2PHY A;  3KSI A;  3R7W B;  3OOV A;  4H6J B;  5IS1 A;  5HL6 A;  3ZYT A;  2G7U A;  1V9Y A;  4XT2 A;  2PR6 A;  4NXE A;  2B02 A;  3T4T A;  2WKP A;  3EQU A;  2VV7 A;  3T4O A;  1KOU A;  4IUH A;  2CMN A;  4H6J A;  4FSF A;  4F3L A;  2W1R A;  3C8C A;  3MR0 A;  4WLA A;  4MN7 A;  3EEH A;  1Y28 A;  4MN6 A;  3BY8 A;  4JGP A;  1S66 L;  4G3K A;  2Z6D A;  4ZRR A;  4CLC E;  3F1P A;  2L4R A;  3OCN A;  3PBT A;  4EEU A;  3LI8 A;  3PYP A;  1T1C A;  5J7E A;  4II7 A;  2K7S A;  1S4R A;  3JVV A;  4B9O A;  4EQ1 A;  2JHE A;  4LPZ A;  2GNX A;  4KUO A;  3NOP C;  2V1B A;  3NHQ A;  5C5K A;  1G28 A;  4GLQ A;  2WKR A;  4ARZ B;  4IHQ A;  3BW6 A;  2KOI A;  1T1B A;  2XA7 M;  3C30 A;  2K2N A;  4K08 A;  3ICY A;  3UE6 A;  1XFN A;  4WUJ A;  1NRJ A;  1ZHH B;  1T19 A;  3LYX A;  3KSG A;  5G4Y A;  2XA7 S;  4WEL A;  3A0R A;  4ETZ A;  1VB6 A;  4KQO A;  3HJI A;  3IBR A;  2W3E A;  3IS2 A;  5DFX A;  4Y5F A;  3IS2 B;  3T4Q A;  1S67 L;  1YKD A;  2HJ9 C;  2VGL M;  3R4K A;  4EUV A;  1S4S A;  4DMZ A;  4HI4 A;  1W63 Q;  1OTE A;  4P6Z M;  4GHI A;  4HNB A;  3CIT A;  2W1T B;  3NJA A;  2W1T A;  1TD5 A;  5HWW A;  2P04 A;  1IOU A;  2PYR A;  4UQI S;  4O0P A;  3EWK A;  4I5S A;  3CUE A;  5L8M A;  4UEY A;  2YKH A;  2L0W A;  3CI6 A;  4HIA A;  3LI9 A;  1EW0 A;  4O01 A;  2VV8 A;  3OC2 A;  4IJG A;  3PBN A;  4PKY A;  1YAX A;  5HDS A;  5AVF A;  3SW1 A;  1XJ3 A;  2OAQ 1;  5F68 A;  2WKQ A;  1OTI A;  5MC7 A;  2J3W A;  1GSX A;  2PD7 A;  3PBO A;  2QYB A;  4JGO A;  2W0N A;  3UB6 A;  3KYQ A;  1MC0 A;  1X0O A;  4HP9 A;  5AJG A;  5F69 A;  1JNU A;  3VE4 A;  2QJ7 A;  3VV4 A;  3E0Y A;  3BQA A;  5DF9 A;  1OJG A;  4R38 A;  1XJ4 A;  3BQ8 A;  4EET B;  3K2N A;  1NLY A;  5AVE A;  2QJ5 A;  2J3T C;  2BAS A;  2M7U A;  4XT2 B;  3H7W B;  2L1M A;  4Q0I A;  3R7W A;  1N9L A;  5HPF A;  4L9E A;  5CX7 A;  5KSH A;  2P7J A;  4GCZ A;  1S1Z A;  4AFI A;  5HSQ A;  1F9I A;  4MDZ A;  2V9A A;  3F1P B;  4PHT A;  3E98 A;  2Z6C A;  3E4Q A;  5HDD A;  4GJ4 A;  1STZ A;  2JKR I;  2HV1 A;  1W63 M;  2K31 A;  2A24 A;  4BBU A;  4CLC C;  5TBM A;  4HJ4 A;  4HJ6 A;  1YSP A;  3H7W A;  4HH2 A;  4YOF A;  3MFX A;  3UME A;  1DRM A;  1OTB A;  1UWN X;  2GZA A;  3W2Z A;  3PR6 A;  3KX0 X;  5TBM B;  3PBS A;  3LIA A;  3LR0 A;  3T4J A;  3PBR A;  3B33 A;  2VGL S;  4BMW A;  1S1Y A;  2OWH A;  1MZU A;  4CLC D;  4EES A;  5DKL A;  2A24 B;  2EWW A;  2ZOH A;  4CQH A;  3U2A A;  3LIF A;  4BBT A;  4G3V A;  5LBR A;  4L9G A;  4MCW A;  2O9C A;  3HCY A;  2EWV A;  3GDI A;  1N9O A;  3T4K A;  3UB9 A;  3LFV A;  2QWS A;  4PAU A;  3EQV A;  1F98 A;  2B18 A;  1TS8 A;  2IA2 A;  3K3D A;  3RH8 B;  4HOI A;  2W27 A;  2QKP A;  2V0U A;  3G6O A;  4Y2F A;  2PT7 A;  1XJ2 A;  2INW A;  3FC7 A;  2M1C A;  2YKF A;  4HJ3 A;  4JGQ A;  4R6L A;  3TJZ C;  2W3H A;  3KO6 A;  3KSH A;  5DJU A;  4Z1W A;  1YSQ A;  2EA9 A;  1ZTU A;  3CWF A;  2MJ6 A;  1P9W A;  3ZQ5 A;  1DP9 A;  4OOM A;  1P97 A;  2VV6 A;  2Y8H A;  2P08 A;  3BJN A;  3MXQ A;  1OTD A;  1V9Z A;  2NUT C;  4DN0 A;  4EER A;  4BWI A;  4GS9 B;  4DJ3 A;  3E4O A;  3O5Y A;  3PXP A;  3F1N A;  2H28 A;  3T50 A;  2W3D A;  3F1N B;  1N9N A;  3B47 A;  3VOL A;  4NEE D;  2PR5 A;  3KYZ A;  4PKY G;  5HWT A;  1OT9 A;  3FPV A;  5HD3 A;  2JKT I;  1LSX A;  4NXB A;  3LIB A;  3TRC A;  1H8M A;  2FH5 A;  5FL3 A;  5KIZ A;  4HH3 A;  3BWL A;  3MQO A;  4G3W A;  4E04 A;  3TE8 A;  1DP6 A;  2HGV A;  5HPI A;  4ARZ A;  3H82 A;  1OT6 A;  1P0Z A;  2ZBB A;  1VHM A;  2XRN A;  1LSV A;  4EU0 A;  5I5L A;  3MQQ A;  1T18 A;  1GSV A;  3F1O B;  2KLI A;  2V0W A;  2HJE A;  5HWV A;  2OAP 1;  5IU1 A;  3EEA A;  4IUK A;  3E4P A;  4MMN A;  4LRZ E;  5K5B A;  2O9B A;  3T4L A;  1XJ6 A;  2D01 A;  4RQ9 A;  1G6O A;  2XRO A;  3CAX A;  3IBJ A;  4UQI M;  5DFY A;  2LB5 A;  3TW8 A;  3S7P A;  1TS6 A;  4I3J A;  2VEA A;  3NOU C;  4B93 A;  3LR5 A;  4WEJ A;  1LSW A;  1UWP X;  4JGR A;  2OWJ A;  4HP4 A;  2JKR M;  2D02 A;  4R3A A;  3FPW A;  3RFB A;  3PBQ A;  4LRY C;  4P6Z S;  3HJK A;  3LR4 A;  5G4Z A;  1TS0 A;  3LUQ A;  5HZH A;  3KSF A;  3GEC A;  3S7Q A;  1BYW A;  4CLC A;  4M4X A;  2I9V A;  4BJP A;  2VZW A;  3K3C A;  4GW9 A;  2R78 A;  3S7O A;  1UGU A;  2OOL A;  3CLO A;  4LRX C;  4ETX A;  4I39 A;  5EFW A;  3B42 A;  4Q0J A;  2VKS A;  4EEP A;  4QPR A;  4BBV A;  4HQA A;  5J3W A;  3S7N A;  1P9R A;  1H3Q A;  3RTY A;  4KQD A;  2ZMF A;  5IT5 A;  4F3L B;  2PDR A;  4EXO A;  4Y3I A;  4I3I A;  4WF0 A;  2O99 A;  3UB8 A;  2J80 A;  4YWZ A;  3DBA A;  3PHY A;  3D3O A;  5HD5 A;  3EGX C;  3MF0 A;  4CLC B;  2JN7 A;  2XSS A;  3C38 A;  2VX8 A;  2ZOI A;  4I3A A;  1DP8 A;  1NLZ A;  5DJT A;  1D06 A;  1F5M A;  4DJ2 A;  4WL9 A;  4HHD A;  3F1O A;  3LID A;  3V67 A;  4R70 A;  1D7E A;  3MMH A;  2DMW A;  5TJJ A;  2NUP C;  2V1A A;  5J4E A;  3UB7 A;  3A0V A;  1MKM A;  3ULF A;  3BY9 A;  3NOT C;  3CUE C;  2W3G A;  2GJ3 A;  3FG8 A;  3LIE A;  4GS9 A;  4NKP A;  4WN5 A;  1IFQ A;  2JKT M;  3A0S A;  3OLO A;  2KDK A;  3EOI A;  4WEK A;  4ME4 A;  3P01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...