3BY8A

Crystal structure of the e.coli dcus sensor domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein dcuS
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17203 sCache_3_2 Single cache domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by8A00
3HJKA 3LUQA 3MQQA 4F3LA 1TS0A 2HV1A 4GHIB 4L9GA 3A0VA 4DJ2A 1OTIA 5A8BA 2PDRA 2I9VA 1OTEA 4I5SA 3F1NA 2QWSA 3BY8A 4LRZE 2OWJA 3ULFA 1N9NA 4EW7A 4HH3A 1BYWA 4H6JA 3NJAA 1JNUA 2WKPA 5HDSA 1OTAA 2V0WA 1GSWA 1WA9A 3GDIA 3T50A 1T1AA 4HJ3A 4K08A 4DJ3A 2W0NA 4BBUA 4KUKA 3BY9A 4NXBA 1TS7A 3K3CA 4EQ1A 1G28A 1D06A 3A0RA 4L9FA 2PYRA 4MN5A 5AVFA 4MN6A 3IS2A 4EEPA 5IS1A 4JGOA 3NOTC 3VOLA 1Y28A 3E4PA 2YKHA 1OTBA 2QJ7A 2CMNA 4LPZA 2L1MA 3H7WA 3C8CA 4EXOA 2V1AA 1XJ4A 3CLOA 4PKYG 1LSVA 1T18A 3LIFA 5HDCA 3P7NA 5DKKA 4R70A 2KX6A 5HWWA 2INWA 4GCZA 5IU1A 3EWKA 5J3WA 1N9OA 5HDDA 1S1YA 2ZBBA 3F1OA 1T1CA 2A24A 1XJ3A 2B02A 4HNBA 4M4XA 4KUOA 4KQDA 4GS9A 4BBTA 5F68A 1TS8A 4HJ6A 3UB7A 5HD3A 4NXGA 3D72A 3H82B 4I3IA 1T1BA 1XFQA 3ZQ5A 1XJ2A 4R3AA 1S4SA 1UGUA 5EFWA 2PD7A 4R6LA 3NOPC 5HWVA 4WF0A 3F1PB 2WKRA 1F9IA 2K7SA 5TBMA 3FG8A 2PD8A 4BBVA 4JGQA 3F1NB 1LSWA 5G4YA 4HI4A 3K3DA 2L4RA 3C2WA 3LIAA 1DP8A 3PHYA 4WLAA 3H9WA 2YKFA 2M1CA 4HIAA 4I3JA 2VV8A 4JGRA 5KIZA 4XT2B 1S67L 2VV6A 4JGPA 3UB9A 5DJUA 3UE6A 3SW1A 1S66L 1GSVA 3UB8A 2V9AA 3KX0X 5DKLA 5J7EA 1ODVA 4R38A 5G4ZA 1F98A 3MXQA 2OWHA 4HHDA 1D7EA 1T19A 1V9YA 5I5LA 5HSQA 2ZOHA 1S1ZA 2PR5A 4B9OA 3H7WB 1OTDA 1V9ZA 3MQOA 4E04A 2P7JA 3NOUC 4EETB 1DRMA 1KOUA 2QKPA 3G6OA 4WUJA 5DJTA 4I38A 1MZUA 5AVEA 4HP4A 2BASA 1OJGA 4EEUA 4I39A 3UMDA 5F5YA 2GJ3A 2PHYA 4GHIA 3VE3A 4NXEA 3MFXA 1NWZA 4HQAA 4LLOB 2V1BA 4HP9A 2VEAA 3F1OB 4EESA 2JHEA 3B33A 4RQ9A 2EA9A 2A24B 5J4EA 3E4QA 3OLOA 3LICA 1LL8A 3LYXA 4WN5A 4F3LB 3CWFA 2L0WA 2VLGA 3LI8A 3F1PA 2QJ5A 4GS9B 1N9LA 4EERA 1EW0A 2D01A 2Z6CA 2V0UA 4HOIA 1DP6A 2Z6DA 4I3AA 2JN7A 1P0ZA 3EEHA 1S4RA 1UWNX 1OT6A 3ICYA 4H6JB 3PYPA 1OT9A 5TBMB 3VE4A 3UMEA 2QHKA 4HY8A 4GW9A 2ZOIA 3MJQA 1XFNA 4XT2A 3UB6A 2D02A 1LSXA 4LRXC 1VB6A 2J80A 3LI9A 3GECA 3IS2B 5F6AA 1P97A 1GSXA 1TS6A 2WKQA 3NHQA 3E4OA 1X0OA 3RTYA 1DP9A 1LT0A 4NXFA 2OOLA 3CAXA 4HJ4A 3HJIA 4WL9A 4L9EA 5HWTA 2VV7A 2H28A 3MR0A 3IBRA 2PYPA 5HD5A 1OJ5A 3RH8B 2R78A 2W27A 3LIDA 3A0SA 3LIEA 5HZHA 1UWPX 1XJ6A 4PKYA 3BWLA 4HH2A 2PR6A 3FC7A 5F69A 4YWZA 3LIBA 3H82A 2KDKA 4LRYC
chains in the Genus database with same CATH superfamily
3LUQA 3ZG5A 2HV1A 3DTMA 1NXYA 5L07A 1SZVA 3BYDA 2ZM8A 3IX3A 1OTIA 2XD1A 1BLHA 2JKTI 5HW3A 3F1NA 2ZMVA 2QWSA 3BY8A 4LRZE 4UAAA 4DKIA 5LBRA 4S2IA 1TD5A 2Y2JA 5DTSA 1H3QA 2GNXA 2IWBA 5CEBA 4LFUA 4H6JA 4Q0HA 1JNUA 2WKPA 2XQZA 1ERQA 2JBFA 5KSHA 4IBRA 3S1YA 4MDZA 2XR0A 4ZJ1A 2P08A 4PPRA 5EVIC 1K56A 2H0YA 4LCMA 1JTGA 5CGSA 4OKPA 3CZDA 3U2AA 1G6OA 1K57A 2QPNA 1G28A 1FOFA 2XF3A 4HEFA 2XROA 1ERMA 5EV0A 1RCJA 3MS6A 4WYYA 2PYRA 3O5YA 1VETA 4XUZA 1FR6A 4KZ3A 1FSWA 4C3QA 2J9OA 1QMFA 2ZQ7A 3NOTC 2AVXA 1L2SA 1Y28A 3BFEA 5HX9A 2W3HA 2QJ7A 3L9KA 1WE4A 4LPZA 2DMWA 2GDNA 2Y2LA 1IEMA 2L1MA 3SH9A 5F1FA 3H7WA 3C8CA 1PYYA 3BEBA 1RGZA 3CLOA 4PKYG 2FH5A 3LIFA 1NLZA 3P7NA 4BMWA 2HGVA 3P98A 1ES3A 4G3VA 5CTMA 5IT5A 4IJGA 3LR0A 4GB7A 1XGIA 5CHJA 2M7VA 5HFOA 5A93A 4X25A 3UPOA 2O9CA 2ZBBA 3AGEA 1Y54A 5DVAA 3ZHHA 3CMZA 1XJ3A 4M4XA 4GD6A 4KUOA 3PAEA 3LR5A 2GX5A 1JWPA 3OBFA 1K56D 3O3VA 3DAVA 5EECA 3IXDA 2J7VA 4Q0JA 3D4FA 1YM1A 1SDEA 4L0LA 3D72A 3T1XA 3ZQ5A 1XJ2A 1S4SA 1UGUA 2PD7A 1EI5A 4R6LA 3IWQA 4IBXA 3D9YA 4BL2A 2A3UA 5CX7A 5AQ7A 4KQRA 5M19A 2ACGA 3N4IA 4OQGA 5TBMA 1YLWA 2PD8A 2BG1A 3RJUA 5CGXA 1LSWA 3PBQA 2ZC3B 2P04A 4GN2A 4UQIS 1J3WA 3KO6A 4EU0A 3KSGA 2L4RA 3WRTA 3C2WA 3VOYA 3SS3A 2PT7A 4PM9A 1DJBA 4FOFA 4EBLA 5EM0A 4I3JA 4WZ5C 4M3KA 2C6WB 2EX9A 3TE8A 1JWZA 1XPBA 3T4OA 4RVAA 2JKFA 5KIZA 3CJMA 2J3TC 3CPTA 5U47A 1ZG6A 2P9VA 3EOIA 2HF6A 5EM1A 2Y2GA 1IYQA 3NCKA 4DXCA 4BENA 1KGGA 3UE6A 3VP0A 1BULA 1PWDA 3MZFA 4OP5A 3MXQA 2OWHA 5CHUA 1T19A 1V9YA 2HJEA 1PW8A 4OQHA 1AXBA 2WAFA 3BLMA 4F94A 1IYOA 4B9OA 3NBLA 1BSGA 2MJ6A 3IQAA 4S2MA 1V9ZA 4WEJA 3ZVWA 4R1GA 3B47A 2W1RA 1MKMA 1FR1A 4DE3A 1MZUA 4HP4A 5GHYA 2GJ3A 1NRFA 2OLVA 1CEFA 4CLCB 1IYSA 1L0EA 2WZZA 3GSGA 4S2JA 4LLOB 1SDNA 4HP9A 3F1OB 4EESA 3DTIA 4EQIA 2EA9A 3GV9A 2V8CA 4MN7A 4R4SA 3LYXA 3HUNA 3CWFA 3N8SA 5HAQA 3T1QB 1N9LA 4D60A 4C6YA 3NC8A 3ZGAB 4PAUA 3HLBA 4QD4A 4S2NC 4MBKA 5CGWA 4JBFA 5DF9A 1UWNX 1BZAA 3V3SA 4Y2FA 2WGWB 3WS5A 5MC7A 5J8XA 2WKEA 3HCYA 3QNCA 3E0YA 3L7HA 4LV2A 3VE4A 2A49A 2A2LA 1W8YA 2ZQDA 3GRJA 4HY8A 4JLFA 1ESUA 2WZXA 3UY6A 5HL1A 2Z2MB 2HP5A 1PI4A 4KZ6A 3MJQA 4XT2A 3BQ8A 3ZG7B 2UV0E 1XX2A 3W2ZA 1ES5A 1K57C 4N1XA 4DMZA 4Q0IA 4X55A 1EWZA 1VB6A 2J80A 5F83A 4WEKA 2JKRM 2VX8A 3IX4A 3HLEA 2P74A 4UQIM 1P97A 1TS6A 3HLGA 4BQMA 1DP9A 1LT0A 2Y8HA 3CAXA 2XD5A 3S22A 4HJ4A 3QP1A 5HWTA 3MR0A 1W8QA 3W4OA 4A5RA 4AFIA 1YLZA 5HD5A 3MZDA 2DCFA 4UHUA 5FQIA 1I2SA 3NECA 2Y59A 4HESA 4NEED 3HREA 4PKYA 2O99A 5D3OA 2PR6A 4ZDXA 1SKOA 1K4EA 3SH7A 3VSKA 3WS1A 5GHXA 1P9WA 1L3LA 4ARZA 4RYEA 3E2LA 2NUTC 4F3LA 2WK0A 2B18A 2W1TA 3BFCA 4GHIB 4L9GA 3BM6A 4NKPA 3UE3A 3LR4A 5A8BA 2ZC4B 5CEDA 2I9VA 4OOYA 1OTEA 2FFFB 3M2KA 3G30A 2XRNA 1WYCA 1SCWA 4DF6A 2J8YA 1BYWA 4JXGA 4QPRA 4HBUA 5AQ9A 1YPRA 2V0WA 1GSWA 4E6WA 2LB5A 3T50A 4WZ5A 3T4JA 3CITA 4E3KA 1GHIA 4RX3A 4E3JA 4DJ3A 1MWSA 1I5QA 4NXBA 1TS7A 3K3CA 4EQ1A 5HARA 4N9LA 1E4DA 2FFYA 4BD1A 4MN6A 3IS2A 4DE2A 2GZAA 4EEPA 1KVLA 3DTEA 3WS2A 5IS1A 1YT4A 4NG2A 5E43A 4OOMA 3BQAA 4Y15A 2XK1A 1O07A 1OTBA 4B88A 2PBYA 1P9RA 5GLDA 1SKFA 4LV0A 4KZ9A 2WGVA 1LSVA 1T18A 2EFXA 5EOOA 4YOFA 5DKKA 3QHYA 3LEQA 4BD0A 1S0WA 2WAEA 5FI6A 3V5MA 5GLBA 5IU1A 1NYYA 3C7VA 3EWKA 2OAP1 1N9OA 1TEMA 3ZG9B 3DW0A 1IELA 4QWOA 3OPHA 1PWCA 4MNRA 4GNUA 4ETZA 4ME4A 5KMWA 1S1YA 3C30A 4R23A 1T1CA 2ZC7A 5AJGA 3OPLA 2A24A 3TJZC 3S7NA 4DN0A 4HNBA 3IF6B 1ZTUA 3EEAA 3LY3A 4R3JA 3KYEA 2V20A 4CLCC 2J3TD 4GS9A 3ITAA 3G2YA 1CQAA 3T4TA 1E3UA 1TS8A 4HJ6A 2EX6A 4NXGA 2JKTM 4S2NA 4S2OA 3H82B 5GL9A 1KVMA 2V1ZA 1XFQA 3LEZA 2OAQ1 2ZJ9A 3NOPC 4WF0A 3MXRA 1BTLA 5E2GA 3HL9A 3PTEA 4BBVA 2QYBA 4QB8A 1YLJA 3OPPA 3F1NB 3MF0A 5G4YA 3MKEA 3K3DA 1BLPA 4P85A 4H8RA 1ES4A 5M1AA 4FSFA 3IT9A 5BOHA 3UDIA 1L0GA 4WM9A 3A3FA 3HLFA 2VV8A 4JGRA 5FASA 3T4KA 1I2WA 2Q9MA 4CJNA 1S67L 2VV6A 3SS4A 2W3DA 3WS0A 2R9WA 4LV3A 4JGPA 5DJUA 2O9BA 1VETB 3RXXA 1S66L 4DRTA 1E3UD 2V9AA 3T4SA 1A0KA 4KZ5A 5J7EA 1ZG4A 3ZNYA 1F98A 5A92A 4HHDA 4OVDA 1YLPA 2EXAA 2ZC5B 3NULA 2PR5A 4IUKA 1IYPA 3H7WB 2V8FA 1OTDA 2J9PA 3GMWA 4X69A 2RL3A 3V39A 3HLWA 4E04A 4OONA 5FAQA 3N7WA 1DRMA 1KOUA 3ITBA 2HPBA 4Y0TA 3IHAA 3PAGA 1BLCA 1XP4A 5AVEA 2EWWA 1OJGA 3PBRA 4I39A 3UMDA 5F5YA 4NXEA 4QY5A 1IKIA 2ZQCA 3MFXA 5DF8A 1TDLA 2DRWA 2VEAA 2VGJA 2JHEA 3B33A 4RQ9A 3UO9A 2LB9A 3OOVA 3RFBA 3E4QA 4G3KA 3OLOA 3EGDC 1LL8A 1QMEA 4KG5A 2VLGA 1ES2A 2QJ5A 3JYIA 2XH9A 3KSHA 3SS5A 3MFDA 2Y2PA 1LI0A 1NJ4A 4KZ8A 4UA7A 5EVEA 1DP6A 1FIKA 2H5SA 2PAVP 2XA7S 2JN7A 1CF0A 2HDQA 1H8MA 5FQMA 2QZ6A 3BECA 3BW6A 5TBMB 3BLSA 3OCNA 3W4PA 2W3FA 2QHKA 3OPRA 3Q1FA 5F1GA 4JPMA 1XFNA 4KZ7A 3UB6A 3HLDA 4RA7A 3DBAA 1JVJA 1KGFA 1LHYA 3PBNA 4EBNA 2XEPA 4ETXA 3QP5A 4GDNA 3LI9A 2NUPC 1K54C 4WBGA 4PHTA 4JF5A 5F6AA 2J3WA 1WYBA 1GSXA 4Y5FA 2Y79A 1X0OA 1YAXA 2BLSA 4KZBA 2V2FF 4LENA 3HJIA 2P9VB 4WL9A 3IX8A 3IBRA 1K6RA 3M6BA 1VEUA 3IWOA 2X02A 3RH8B 3U4LP 2W27A 4BL3A 4Y13A 3C7UA 3R7WA 3VMAA 3A0SA 3FPWA 5HZHA 3M2JA 3ZCZA 3G2ZA 4CLCA 5FA7A 4YINA 2H0TA 5F69A 4KQQA 3M6HA 4YNRA 2Z2LB 4JKTA 4LRYC 3HJKA 1ZHHB 2K31A 1TS0A 3S7OA 4DDSA 3AGDA 3CG5A 1KGEA 1O7EA 3UDXA 2Q0OA 4Y0UA 3A0VA 4BLMA 4E3MA 2VZWA 3IWIA 2X71A 3CI6A 4QU3A 4R0QA 1PZOA 2ZLYA 1CJFA 1N9NA 1H5XA 1NYMA 2WADA 2Y2IA 3D3OA 5EE8A 2WGWA 3IXBA 3Q07A 5FDHA 1J9MA 3NJAA 1YSQA 3QP8A 1FCNA 4E3LA 1OTAA 4HBTA 1WA9A 3GDIA 3GVBA 5HL6A 1IKGA 4PMAA 3IXHA 1H8YA 5DF7A 4HJ3A 4K08A 3WS4A 5FQQA 4KQOA 3HBRA 4KUKA 1CI9A 3BY9A 4LV1A 5EVIB 3VFFA 4FH4A 2EXBA 1RP5A 3A0RA 4CLCD 4K91A 3B3XA 3OZHA 4L9FA 4MN5A 5AVFA 3BFDA 2XA7M 4S2PA 4EUZA 3NDGA 3VOLA 4E3OA 3GR2A 2ZL1B 3V67A 3VP3A 3P09A 2YKHA 2HJ9C 2Y2QA 3Q7VB 4LGWA 1NLYA 4EXOA 1VM1A 4OQ0A 3T4LA 3FZCA 2BTFP 2I72A 3A3JA 4P6ZS 2M7UA 4R70A 1ONHA 2KX6A 4ZAMA 2WYXA 5HWWA 4GCZA 3IF5A 3UE0A 5IHVA 4GDBA 2VK3A 2B95A 2B5RA 1STZA 1ESIA 3LGOA 3O87A 3FWLA 3T1RA 1YQSA 2Y55A 1ONGA 3SH8A 3W8KA 1W63Q 2E8JA 4CPKA 3G34A 4KQDA 3TG9A 4JXWA 4OPZA 4KENB 5DTKA 3MQ0A 4MLLA 4DE0A 1ACFA 5F68A 4JXSA 3UB7A 3KSFA 1SKOB 5HD3A 1SHVA 1Z6FA 4DE1A 3P01A 1MKIA 1L0FA 3HUOA 1GA0A 3ZG0A 5FATA 3HLCA 2Y91A 4N9KA 5EFWA 1M40A 1MWRA 5FL3A 1MBLA 3DTKA 5HWVA 2W1TB 3NDEA 2PU2A 3F1PB 4PM7A 5CXWA 3VFHA 5FEGA 2OLUA 3FG8A 2RCXA 2CC1A 3T1SA 4Y7PA 5E2EA 1NZUA 1F2KA 4U3TA 4HI4A 1JTDA 2HZ5A 4FH2A 3PBSA 2G2WA 3LCEA 3UN7A 3LIAA 1DP8A 3QNBA 1H0MA 1MWUA 4WMCA 5A90A 4U0TA 4WLAA 5E2HA 4G3WA 5FAPA 2YKFA 1PNEA 3R4KA 4ZTKA 4HIAA 2E8IA 1K54A 1G68A 1XKZA 3BFGA 4MCWA 3LR3A 1PZPA 4C75A 1L0DA 4GKUA 1HZOA 5GLAA 5HAPA 2Q9NA 1FSYA 1E25A 3C4OA 1W7FA 3OCLA 3ZVTA 1BT5A 1GSVA 5C5KA 3UB8A 4IVIA 4P6BA 2HP9A 4E3NA 4OP8A 5DKLA 5GLCA 1YMSA 4R38A 5G4ZA 1D7EA 4KG2A 2HDSA 2JCHA 5HSQA 2ZOHA 2PBDP 5K5BA 1F5MA 3MQOA 3HUMA 2QMIA 4NETA 1YSPA 1ZC2A 4EETB 2QKPA 3G6OA 5EPHA 4WUJA 3LFVA 4EEUA 3TW8A 4WMCD 3VE3A 3CHWP 1DJAA 2W3EA 3S7PA 5FAOA 4HQAA 3O86A 2V1BA 3T12B 2WGIA 4O0PA 4P6ZM 2EWVA 2Y2MA 2ZC6B 3JPUA 3ZDJA 2EFUA 3I7JA 2X01A 4ZRRA 1KDWA 3UNWA 2A24B 2XLNA 4X53A 2O9AA 4WN5A 1DY6A 2L0WA 3GQZA 3LI8A 3E98A 4GS9B 1PFLA 2EX8A 1N9BA 2VGLS 2D01A 2V0UA 3WRZA 1XXMA 4R3BA 3EQVA 4GLQA 3JVVA 2Y2KA 3Q82A 4I3AA 5EUAA 1FCOA 4N92A 1MWTA 4Y3IA 1OT6A 1NRJA 3NIAA 3G31A 4H6JB 4BJPA 2ZQ8A 3UMEA 4OLDA 1ALQA 5TGFA 4WZ4A 3MSHA 3UPPA 1VQQA 4Q8IA 5CERA 2KLIA 4XXRA 1OPXA 4U0XA 5M18A 1KE4A 3Q7ZA 4LRXC 4EUVA 4FUWA 4P0MA 3GECA 4QY6A 3ZNTA 1C3BA 2FZ0A 4OLGA 2XDMA 3NHQA 3E4OA 5KSCA 4ESPA 2ZQ9A 4L9EA 2VV7A 2H28A 5DFXA 2PYPA 4NK3A 3W4QA 3Q81A 1OJ5A 5JYOA 2R78A 2ZMFA 3OC2A 3A3DA 3LIEA 4IUHA 1KDSA 1PRQA 3G35A 4KZ4A 2Y2OA 5EOEA 2KOIA 3MBZA 1YLYA 1RGYA 1Q2QA 2HDRA 3S7QA 3IBJA 4YWZA 4OQIA 1MY8A 2KDKA 5KZHA 1PW1A 4FCFA 2ZM0A 4BWIA 5TR7A 1FILA 5F82A 3MQQA 1NY0A 1K6SA 3UPNA 3KYQA 4DJ2A 1K55C 2Y2HA 2ZD8A 3FKWA 2PDRA 4I5SA 3QP4A 3QP2A 2OWJA 3ULFA 4EW7A 3VOZA 4O7DA 5DFYA 3FV7A 2VKSA 4HH3A 1HLUP 5HDSA 1GHMA 2JKGA 3JVUA 3ISGA 2VGKA 1T1AA 3VP2A 4CQHA 3CUEC 4CLCE 3FKVA 2W0NA 4BBUA 4Y0OA 4UA9A 5FQJA 4LCLA 1D06A 2VGLM 3T4QA 1PI5A 2VA0A 4X56A 1EROA 1ZKJA 1FCMA 3BRMA 3SZTA 2WUQA 1W5DA 5CECA 4JGOA 4O01A 4DDYA 4E6XA 5L09A 4YFMA 3TSGA 3VP1A 3E4PA 2G2UA 2CMNA 4K0WA 3CPTB 3RXWA 2V1AA 1NZOA 3ZFZA 1XJ4A 1PIOA 4ZJ2A 1TDGA 2IWCA 1G5UA 3TOIA 5A91A 5HDCA 3ZG8B 4OPYA 4PM6A 1AWIA 2HDUA 2INWA 4OOLA 3B42A 5TFQA 3VP4A 5J3WA 5EVLA 1Z09A 1GA9A 5HDDA 3TRCA 1HVBA 2PU4A 1VEUB 3F1OA 5FQ9A 3IF6C 4EV4A 3AGFA 2B02A 4GOGA 3R7WB 3N8RA 4Y17A 4XUXA 1OMEA 5L8MA 3BFFA 2K2NA 5L2FA 2O0YA 3C5AA 4BBTA 5HPFA 4MBFA 1CEGA 3PR6A 3IHBA 4D2OA 2WKIA 5GHZA 4PM5A 4I3IA 1CK3A 1T1BA 5L10A 3EQUA 2XGNA 3PBTA 1K38A 4GZBA 4R3AA 3A3IA 1LLBA 4S2LA 2WKRA 1F9IA 3VSLA 2K7SA 3LO7A 1LL9A 5FDSA 1LL5A 3BJNA 4GJ4A 4JGQA 3MMHA 1K4FA 5CRFA 1BLSA 1KE3A 2VJWA 1W79A 5EVIA 3ZYTA 4OH0A 3O88A 1CI8A 3PHYA 1MXOA 1IOUA 1PWGA 4OPRA 3H9WA 2M1CA 2UWXA 3PXPA 3C4PA 4UEYA 2HP6A 4FD8A 1M6KA 2ZL1A 2PRFA 4XT2B 3Q7VA 4MMNA 1LI9A 1YLTA 3KYZA 1GCEA 3IXGA 4N1HA 2JKRI 3MZEA 3UB9A 1K0KA 3SW1A 2IWDA 2WKHA 4GD8A 1TF1A 3VV4A 4IVKA 5I94A 3KX0X 4E3IA 2IA2A 4JXVA 1ODVA 4X1LA 2XFSA 3MXSA 5AQBA 3UE1A 5I5LA 3SOIA 4P87A 1JWVA 1S1ZA 1S6RA 1DJCA 3K2NA 3QP6A 5DTTA 4MEZA 2P7JA 4PM8A 4X68A 3NOUC 1XA7A 2ZMAA 3C38A 5DJTA 4UA6A 4I38A 4QJGA 4OPQA 2BASA 3GTCA 4JF6A 1VHMA 4R4RA 5EVID 5FQKA 2PHYA 3N8LA 4EWFA 4GHIA 1U60A 5FEFA 1NWZA 1K55A 2G7UA 4JF4A 4IEDA 5FSRA 5J4EA 5JYPA 3A3EA 3LICA 4ARZB 5HPIA 2DNSA 4F3LB 4O8GA 2JC7A 5HAIA 1HD8A 1GHPA 3F1PA 4EERA 1EW0A 5TJJA 2Z6CA 4HOIA 4KZAA 4KG6A 4B4XA 3KSIA 2Z6DA 4X1MA 1P0ZA 3EEHA 4WELA 1S4RA 3CUEA 3G4PA 5E2FA 3NY4A 1N4OA 3FPVA 3IH8A 5CTNA 3HVFA 2EX2A 3FYZA 3ICYA 1Q2PA 1IFQA 4DXBA 3PYPA 1OT9A 4MBHA 3NI9A 2R9XA 3V50A 3WWXA 4GW9A 4B93A 2ZQAA 2XFTA 2ZOIA 3MKFA 1K25A 2Y2NA 3E2KA 5G18A 2D02A 5AQAA 1MC0A 1LSXA 3V3RA 2W3GA 2XSSA 1KE0A 1H8ZA 4ZBEA 2H10A 3IS2B 3DWZA 3LY4A 4IHQA 4EBPA 3N6IA 2WKQA 3RTYA 3EGXC 1Y4OA 4NXFA 3PBOA 3UDFA 1XA1A 4ZJ3A 4II7A 2OOLA 3UB5P 1FQGA 1TVFA 1MPLA 4Z9QA 2OSUA 2JE5A 2OV5A 3S4XA 2C5WB 3LIDA 5FI7A 4X6TA 3DWKA 3IF6A 2ZM2A 1XGJA 4Z1WA 1YMXA 3G32A 1BUEA 1HTZA 1UWPX 1XJ6A 4S2KA 5FI2A 3BWLA 4HH2A 4ID4A 4QHCA 1YKDA 5CHMA 3FC7A 1W63M 1D1JA 4FTXA 4RX2A 3LIBA 4K0XA 3H82A 2Y4AA 1G6AA 3IH9A 4B4ZA
chains in the Genus database with same CATH topology
3HJKA 3LUQA 1ZHHB 4ARZA 2K31A 3MQQA 2NUTC 4F3LA 1TS0A 3S7OA 2HV1A 2B18A 2W1TA 4GHIB 4L9GA 4NKPA 3KYQA 3UE3A 3A0VA 3LR4A 4DJ2A 1OTIA 5A8BA 2JKTI 2PDRA 2I9VA 1OTEA 4I5SA 3F1NA 2VZWA 3CI6A 2ZMVA 2QWSA 3BY8A 4LRZE 2XRNA 5LBRA 1TD5A 2OWJA 3ULFA 1N9NA 4EW7A 1H3QA 2GNXA 3D3OA 5DFYA 2VKSA 4HH3A 1BYWA 4H6JA 4Q0HA 3NJAA 1JNUA 4QPRA 1YSQA 2WKPA 5HDSA 1OTAA 2V0WA 1GSWA 1WA9A 5KSHA 3JVUA 3GDIA 2LB5A 3T50A 1T1AA 5HL6A 4MDZA 3T4JA 4CQHA 3CITA 3CUEC 4HJ3A 4K08A 4CLCE 4DJ3A 2W0NA 4KQOA 4BBUA 4KUKA 2P08A 3BY9A 4NXBA 3U2AA 1G6OA 1TS7A 3K3CA 4EQ1A 1G28A 1D06A 2VGLM 3T4QA 3A0RA 4CLCD 2XROA 2VA0A 4L9FA 2PYRA 3O5YA 4MN5A 5AVFA 4MN6A 3IS2A 2XA7M 2GZAA 4EEPA 5IS1A 4JGOA 4O01A 4OOMA 3BQAA 3NOTC 3VOLA 1Y28A 3V67A 2W3HA 3E4PA 2YKHA 1OTBA 2QJ7A 2CMNA 2HJ9C 4LPZA 2DMWA 2L1MA 1NLYA 3H7WA 1P9RA 3C8CA 4EXOA 2V1AA 1XJ4A 3CLOA 4PKYG 2FH5A 3T4LA 1LSVA 1T18A 3LIFA 4YOFA 1NLZA 3P7NA 5DKKA 5HDCA 4BMWA 2HGVA 4P6ZS 2M7UA 4R70A 2KX6A 4G3VA 5HWWA 5IT5A 2INWA 4OOLA 3B42A 4IJGA 3LR0A 4GCZA 5IU1A 3EWKA 2OAP1 5J3WA 1N9OA 2M7VA 1STZA 5HDDA 3TRCA 4ETZA 4ME4A 2O9CA 1S1YA 2ZBBA 3C30A 3F1OA 1T1CA 5AJGA 3TJZC 2A24A 1XJ3A 2B02A 3S7NA 4DN0A 4HNBA 3R7WB 1ZTUA 4M4XA 1W63Q 4KUOA 3EEAA 4KQDA 3LR5A 2GX5A 3OBFA 4CLCC 5L8MA 2K2NA 2J3TD 4GS9A 2O0YA 4BBTA 3MQ0A 3T4TA 5HPFA 4Q0JA 5F68A 1TS8A 4HJ6A 3UB7A 3PR6A 3KSFA 5HD3A 4NXGA 4L0LA 3D72A 2JKTM 3P01A 3H82B 4I3IA 1T1BA 3EQUA 3PBTA 1XFQA 3ZQ5A 1XJ2A 4R3AA 1S4SA 1UGUA 5EFWA 2OAQ1 2PD7A 4R6LA 3NOPC 5FL3A 5HWVA 4WF0A 2W1TB 5CX7A 3F1PB 2WKRA 1F9IA 2K7SA 5TBMA 3FG8A 2PD8A 4BBVA 2QYBA 3BJNA 4GJ4A 4JGQA 3MMHA 3F1NB 1LSWA 3MF0A 3PBQA 5G4YA 2P04A 2VJWA 4HI4A 3K3DA 4UQIS 3PBSA 3KO6A 4EU0A 3KSGA 2L4RA 3ZYTA 3C2WA 3LIAA 1DP8A 4FSFA 3PHYA 1IOUA 4WLAA 4G3WA 2PT7A 3H9WA 2YKFA 4FOFA 3R4KA 2M1CA 4HIAA 3PXPA 4I3JA 2VV8A 4JGRA 4UEYA 3T4KA 3TE8A 3T4OA 5KIZA 4MCWA 3LR3A 4XT2B 1S67L 2VV6A 2J3TC 4MMNA 2W3DA 3KYZA 2JKRI 3EOIA 2HF6A 4JGPA 3UB9A 5DJUA 2O9BA 3UE6A 3OCLA 3SW1A 1S66L 1GSVA 5C5KA 3UB8A 2V9AA 1TF1A 3VV4A 3T4SA 3KX0X 2IA2A 5DKLA 1ODVA 5J7EA 4R38A 5G4ZA 1F98A 3MXQA 2OWHA 4HHDA 1D7EA 1T19A 1V9YA 2HJEA 5I5LA 5HSQA 2ZOHA 1S1ZA 2PR5A 4IUKA 4B9OA 3H7WB 5K5BA 1OTDA 2MJ6A 1F5MA 1V9ZA 3MQOA 3K2NA 4WEJA 4E04A 3B47A 2P7JA 1YSPA 2W1RA 1MKMA 3NOUC 4EETB 1DRMA 1KOUA 2QKPA 3C38A 3G6OA 4WUJA 5DJTA 4I38A 1MZUA 5AVEA 4HP4A 3LFVA 2BASA 2EWWA 1OJGA 4EEUA 3PBRA 4I39A 3UMDA 5F5YA 1VHMA 3TW8A 2GJ3A 2PHYA 4GHIA 3VE3A 4NXEA 4CLCB 2W3EA 3S7PA 3MFXA 1NWZA 4HQAA 4LLOB 2V1BA 4HP9A 2G7UA 2VEAA 3F1OB 4EESA 2JHEA 4O0PA 4P6ZM 2EWVA 3B33A 4RQ9A 2LB9A 4ZRRA 3OOVA 2EA9A 4MN7A 2A24B 5J4EA 3RFBA 3E4QA 4G3KA 3OLOA 2O9AA 3LICA 3EGDC 1LL8A 3LYXA 4ARZB 5HPIA 4WN5A 4F3LB 3CWFA 2L0WA 4O8GA 2VLGA 3LI8A 3F1PA 3E98A 2QJ5A 4GS9B 1N9LA 3KSHA 4EERA 1EW0A 2VGLS 5TJJA 2D01A 2Z6CA 2V0UA 4PAUA 4HOIA 1DP6A 3KSIA 3EQVA 4GLQA 2Z6DA 3JVVA 2XA7S 4I3AA 2JN7A 5DF9A 1P0ZA 3EEHA 4WELA 3CUEA 1S4RA 1UWNX 4Y3IA 3FPVA 4Y2FA 1OT6A 1H8MA 1NRJA 3ICYA 5MC7A 4H6JB 1IFQA 3HCYA 3BW6A 4BJPA 3E0YA 3PYPA 1OT9A 5TBMB 3OCNA 3VE4A 2W3FA 3UMEA 2A2LA 2QHKA 4HY8A 4GW9A 4B93A 2ZOIA 3MJQA 1XFNA 4XT2A 3BQ8A 3UB6A 2KLIA 3DBAA 3W2ZA 2D02A 4DMZA 1OPXA 3PBNA 1MC0A 4Q0IA 1LSXA 4LRXC 4EUVA 1VB6A 2J80A 2W3GA 4WEKA 2XSSA 4ETXA 2JKRM 2VX8A 3LI9A 2NUPC 3GECA 4PHTA 2FZ0A 3IS2B 4UQIM 4IHQA 2J3WA 5F6AA 1P97A 1GSXA 1TS6A 4Y5FA 2WKQA 3NHQA 3E4OA 2Y79A 1X0OA 3RTYA 1DP9A 3EGXC 1LT0A 4NXFA 3PBOA 2Y8HA 1YAXA 4II7A 2OOLA 3CAXA 4HJ4A 3HJIA 4WL9A 4L9EA 5HWTA 2VV7A 2H28A 3MR0A 3IBRA 4AFIA 5DFXA 2PYPA 5HD5A 1OJ5A 3RH8B 2R78A 2W27A 3LIDA 2ZMFA 3OC2A 3R7WA 4Z1WA 3A0SA 3FPWA 3LIEA 5HZHA 1UWPX 4IUHA 4NEED 1XJ6A 4PKYA 4CLCA 2KOIA 3BWLA 2O99A 4HH2A 2PR6A 1YKDA 3FC7A 1W63M 5F69A 3S7QA 3IBJA 4YWZA 3LIBA 3H82A 4YNRA 2KDKA 4BWIA 1P9WA 4LRYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJK A;  3LUQ A;  3MQQ A;  4F3L A;  1TS0 A;  2HV1 A;  4GHI B;  4L9G A;  3A0V A;  4DJ2 A;  1OTI A;  5A8B A;  2PDR A;  2I9V A;  1OTE A;  4I5S A;  3F1N A;  2QWS A;  3BY8 A;  4LRZ E;  2OWJ A;  3ULF A;  1N9N A;  4EW7 A;  4HH3 A;  1BYW A;  4H6J A;  3NJA A;  1JNU A;  2WKP A;  5HDS A;  1OTA A;  2V0W A;  1GSW A;  1WA9 A;  3GDI A;  3T50 A;  1T1A A;  4HJ3 A;  4K08 A;  4DJ3 A;  2W0N A;  4BBU A;  4KUK A;  3BY9 A;  4NXB A;  1TS7 A;  3K3C A;  4EQ1 A;  1G28 A;  1D06 A;  3A0R A;  4L9F A;  2PYR A;  4MN5 A;  5AVF A;  4MN6 A;  3IS2 A;  4EEP A;  5IS1 A;  4JGO A;  3NOT C;  3VOL A;  1Y28 A;  3E4P A;  2YKH A;  1OTB A;  2QJ7 A;  2CMN A;  4LPZ A;  2L1M A;  3H7W A;  3C8C A;  4EXO A;  2V1A A;  1XJ4 A;  3CLO A;  4PKY G;  1LSV A;  1T18 A;  3LIF A;  5HDC A;  3P7N A;  5DKK A;  4R70 A;  2KX6 A;  5HWW A;  2INW A;  4GCZ A;  5IU1 A;  3EWK A;  5J3W A;  1N9O A;  5HDD A;  1S1Y A;  2ZBB A;  3F1O A;  1T1C A;  2A24 A;  1XJ3 A;  2B02 A;  4HNB A;  4M4X A;  4KUO A;  4KQD A;  4GS9 A;  4BBT A;  5F68 A;  1TS8 A;  4HJ6 A;  3UB7 A;  5HD3 A;  4NXG A;  3D72 A;  3H82 B;  4I3I A;  1T1B A;  1XFQ A;  3ZQ5 A;  1XJ2 A;  4R3A A;  1S4S A;  1UGU A;  5EFW A;  2PD7 A;  4R6L A;  3NOP C;  5HWV A;  4WF0 A;  3F1P B;  2WKR A;  1F9I A;  2K7S A;  5TBM A;  3FG8 A;  2PD8 A;  4BBV A;  4JGQ A;  3F1N B;  1LSW A;  5G4Y A;  4HI4 A;  3K3D A;  2L4R A;  3C2W A;  3LIA A;  1DP8 A;  3PHY A;  4WLA A;  3H9W A;  2YKF A;  2M1C A;  4HIA A;  4I3J A;  2VV8 A;  4JGR A;  5KIZ A;  4XT2 B;  1S67 L;  2VV6 A;  4JGP A;  3UB9 A;  5DJU A;  3UE6 A;  3SW1 A;  1S66 L;  1GSV A;  3UB8 A;  2V9A A;  3KX0 X;  5DKL A;  5J7E A;  1ODV A;  4R38 A;  5G4Z A;  1F98 A;  3MXQ A;  2OWH A;  4HHD A;  1D7E A;  1T19 A;  1V9Y A;  5I5L A;  5HSQ A;  2ZOH A;  1S1Z A;  2PR5 A;  4B9O A;  3H7W B;  1OTD A;  1V9Z A;  3MQO A;  4E04 A;  2P7J A;  3NOU C;  4EET B;  1DRM A;  1KOU A;  2QKP A;  3G6O A;  4WUJ A;  5DJT A;  4I38 A;  1MZU A;  5AVE A;  4HP4 A;  2BAS A;  1OJG A;  4EEU A;  4I39 A;  3UMD A;  5F5Y A;  2GJ3 A;  2PHY A;  4GHI A;  3VE3 A;  4NXE A;  3MFX A;  1NWZ A;  4HQA A;  4LLO B;  2V1B A;  4HP9 A;  2VEA A;  3F1O B;  4EES A;  2JHE A;  3B33 A;  4RQ9 A;  2EA9 A;  2A24 B;  5J4E A;  3E4Q A;  3OLO A;  3LIC A;  1LL8 A;  3LYX A;  4WN5 A;  4F3L B;  3CWF A;  2L0W A;  2VLG A;  3LI8 A;  3F1P A;  2QJ5 A;  4GS9 B;  1N9L A;  4EER A;  1EW0 A;  2D01 A;  2Z6C A;  2V0U A;  4HOI A;  1DP6 A;  2Z6D A;  4I3A A;  2JN7 A;  1P0Z A;  3EEH A;  1S4R A;  1UWN X;  1OT6 A;  3ICY A;  4H6J B;  3PYP A;  1OT9 A;  5TBM B;  3VE4 A;  3UME A;  2QHK A;  4HY8 A;  4GW9 A;  2ZOI A;  3MJQ A;  1XFN A;  4XT2 A;  3UB6 A;  2D02 A;  1LSX A;  4LRX C;  1VB6 A;  2J80 A;  3LI9 A;  3GEC A;  3IS2 B;  5F6A A;  1P97 A;  1GSX A;  1TS6 A;  2WKQ A;  3NHQ A;  3E4O A;  1X0O A;  3RTY A;  1DP9 A;  1LT0 A;  4NXF A;  2OOL A;  3CAX A;  4HJ4 A;  3HJI A;  4WL9 A;  4L9E A;  5HWT A;  2VV7 A;  2H28 A;  3MR0 A;  3IBR A;  2PYP A;  5HD5 A;  1OJ5 A;  3RH8 B;  2R78 A;  2W27 A;  3LID A;  3A0S A;  3LIE A;  5HZH A;  1UWP X;  1XJ6 A;  4PKY A;  3BWL A;  4HH2 A;  2PR6 A;  3FC7 A;  5F69 A;  4YWZ A;  3LIB A;  3H82 A;  2KDK A;  4LRY C; 
#chains in the Genus database with same CATH topology
 3LUQ A;  3ZG5 A;  2HV1 A;  3DTM A;  1NXY A;  5L07 A;  1SZV A;  3BYD A;  2ZM8 A;  3IX3 A;  1OTI A;  2XD1 A;  1BLH A;  2JKT I;  5HW3 A;  3F1N A;  2ZMV A;  2QWS A;  3BY8 A;  4LRZ E;  4UAA A;  4DKI A;  5LBR A;  4S2I A;  1TD5 A;  2Y2J A;  5DTS A;  1H3Q A;  2GNX A;  2IWB A;  5CEB A;  4LFU A;  4H6J A;  4Q0H A;  1JNU A;  2WKP A;  2XQZ A;  1ERQ A;  2JBF A;  5KSH A;  4IBR A;  3S1Y A;  4MDZ A;  2XR0 A;  4ZJ1 A;  2P08 A;  4PPR A;  5EVI C;  1K56 A;  2H0Y A;  4LCM A;  1JTG A;  5CGS A;  4OKP A;  3CZD A;  3U2A A;  1G6O A;  1K57 A;  2QPN A;  1G28 A;  1FOF A;  2XF3 A;  4HEF A;  2XRO A;  1ERM A;  5EV0 A;  1RCJ A;  3MS6 A;  4WYY A;  2PYR A;  3O5Y A;  1VET A;  4XUZ A;  1FR6 A;  4KZ3 A;  1FSW A;  4C3Q A;  2J9O A;  1QMF A;  2ZQ7 A;  3NOT C;  2AVX A;  1L2S A;  1Y28 A;  3BFE A;  5HX9 A;  2W3H A;  2QJ7 A;  3L9K A;  1WE4 A;  4LPZ A;  2DMW A;  2GDN A;  2Y2L A;  1IEM A;  2L1M A;  3SH9 A;  5F1F A;  3H7W A;  3C8C A;  1PYY A;  3BEB A;  1RGZ A;  3CLO A;  4PKY G;  2FH5 A;  3LIF A;  1NLZ A;  3P7N A;  4BMW A;  2HGV A;  3P98 A;  1ES3 A;  4G3V A;  5CTM A;  5IT5 A;  4IJG A;  3LR0 A;  4GB7 A;  1XGI A;  5CHJ A;  2M7V A;  5HFO A;  5A93 A;  4X25 A;  3UPO A;  2O9C A;  2ZBB A;  3AGE A;  1Y54 A;  5DVA A;  3ZHH A;  3CMZ A;  1XJ3 A;  4M4X A;  4GD6 A;  4KUO A;  3PAE A;  3LR5 A;  2GX5 A;  1JWP A;  3OBF A;  1K56 D;  3O3V A;  3DAV A;  5EEC A;  3IXD A;  2J7V A;  4Q0J A;  3D4F A;  1YM1 A;  1SDE A;  4L0L A;  3D72 A;  3T1X A;  3ZQ5 A;  1XJ2 A;  1S4S A;  1UGU A;  2PD7 A;  1EI5 A;  4R6L A;  3IWQ A;  4IBX A;  3D9Y A;  4BL2 A;  2A3U A;  5CX7 A;  5AQ7 A;  4KQR A;  5M19 A;  2ACG A;  3N4I A;  4OQG A;  5TBM A;  1YLW A;  2PD8 A;  2BG1 A;  3RJU A;  5CGX A;  1LSW A;  3PBQ A;  2ZC3 B;  2P04 A;  4GN2 A;  4UQI S;  1J3W A;  3KO6 A;  4EU0 A;  3KSG A;  2L4R A;  3WRT A;  3C2W A;  3VOY A;  3SS3 A;  2PT7 A;  4PM9 A;  1DJB A;  4FOF A;  4EBL A;  5EM0 A;  4I3J A;  4WZ5 C;  4M3K A;  2C6W B;  2EX9 A;  3TE8 A;  1JWZ A;  1XPB A;  3T4O A;  4RVA A;  2JKF A;  5KIZ A;  3CJM A;  2J3T C;  3CPT A;  5U47 A;  1ZG6 A;  2P9V A;  3EOI A;  2HF6 A;  5EM1 A;  2Y2G A;  1IYQ A;  3NCK A;  4DXC A;  4BEN A;  1KGG A;  3UE6 A;  3VP0 A;  1BUL A;  1PWD A;  3MZF A;  4OP5 A;  3MXQ A;  2OWH A;  5CHU A;  1T19 A;  1V9Y A;  2HJE A;  1PW8 A;  4OQH A;  1AXB A;  2WAF A;  3BLM A;  4F94 A;  1IYO A;  4B9O A;  3NBL A;  1BSG A;  2MJ6 A;  3IQA A;  4S2M A;  1V9Z A;  4WEJ A;  3ZVW A;  4R1G A;  3B47 A;  2W1R A;  1MKM A;  1FR1 A;  4DE3 A;  1MZU A;  4HP4 A;  5GHY A;  2GJ3 A;  1NRF A;  2OLV A;  1CEF A;  4CLC B;  1IYS A;  1L0E A;  2WZZ A;  3GSG A;  4S2J A;  4LLO B;  1SDN A;  4HP9 A;  3F1O B;  4EES A;  3DTI A;  4EQI A;  2EA9 A;  3GV9 A;  2V8C A;  4MN7 A;  4R4S A;  3LYX A;  3HUN A;  3CWF A;  3N8S A;  5HAQ A;  3T1Q B;  1N9L A;  4D60 A;  4C6Y A;  3NC8 A;  3ZGA B;  4PAU A;  3HLB A;  4QD4 A;  4S2N C;  4MBK A;  5CGW A;  4JBF A;  5DF9 A;  1UWN X;  1BZA A;  3V3S A;  4Y2F A;  2WGW B;  3WS5 A;  5MC7 A;  5J8X A;  2WKE A;  3HCY A;  3QNC A;  3E0Y A;  3L7H A;  4LV2 A;  3VE4 A;  2A49 A;  2A2L A;  1W8Y A;  2ZQD A;  3GRJ A;  4HY8 A;  4JLF A;  1ESU A;  2WZX A;  3UY6 A;  5HL1 A;  2Z2M B;  2HP5 A;  1PI4 A;  4KZ6 A;  3MJQ A;  4XT2 A;  3BQ8 A;  3ZG7 B;  2UV0 E;  1XX2 A;  3W2Z A;  1ES5 A;  1K57 C;  4N1X A;  4DMZ A;  4Q0I A;  4X55 A;  1EWZ A;  1VB6 A;  2J80 A;  5F83 A;  4WEK A;  2JKR M;  2VX8 A;  3IX4 A;  3HLE A;  2P74 A;  4UQI M;  1P97 A;  1TS6 A;  3HLG A;  4BQM A;  1DP9 A;  1LT0 A;  2Y8H A;  3CAX A;  2XD5 A;  3S22 A;  4HJ4 A;  3QP1 A;  5HWT A;  3MR0 A;  1W8Q A;  3W4O A;  4A5R A;  4AFI A;  1YLZ A;  5HD5 A;  3MZD A;  2DCF A;  4UHU A;  5FQI A;  1I2S A;  3NEC A;  2Y59 A;  4HES A;  4NEE D;  3HRE A;  4PKY A;  2O99 A;  5D3O A;  2PR6 A;  4ZDX A;  1SKO A;  1K4E A;  3SH7 A;  3VSK A;  3WS1 A;  5GHX A;  1P9W A;  1L3L A;  4ARZ A;  4RYE A;  3E2L A;  2NUT C;  4F3L A;  2WK0 A;  2B18 A;  2W1T A;  3BFC A;  4GHI B;  4L9G A;  3BM6 A;  4NKP A;  3UE3 A;  3LR4 A;  5A8B A;  2ZC4 B;  5CED A;  2I9V A;  4OOY A;  1OTE A;  2FFF B;  3M2K A;  3G30 A;  2XRN A;  1WYC A;  1SCW A;  4DF6 A;  2J8Y A;  1BYW A;  4JXG A;  4QPR A;  4HBU A;  5AQ9 A;  1YPR A;  2V0W A;  1GSW A;  4E6W A;  2LB5 A;  3T50 A;  4WZ5 A;  3T4J A;  3CIT A;  4E3K A;  1GHI A;  4RX3 A;  4E3J A;  4DJ3 A;  1MWS A;  1I5Q A;  4NXB A;  1TS7 A;  3K3C A;  4EQ1 A;  5HAR A;  4N9L A;  1E4D A;  2FFY A;  4BD1 A;  4MN6 A;  3IS2 A;  4DE2 A;  2GZA A;  4EEP A;  1KVL A;  3DTE A;  3WS2 A;  5IS1 A;  1YT4 A;  4NG2 A;  5E43 A;  4OOM A;  3BQA A;  4Y15 A;  2XK1 A;  1O07 A;  1OTB A;  4B88 A;  2PBY A;  1P9R A;  5GLD A;  1SKF A;  4LV0 A;  4KZ9 A;  2WGV A;  1LSV A;  1T18 A;  2EFX A;  5EOO A;  4YOF A;  5DKK A;  3QHY A;  3LEQ A;  4BD0 A;  1S0W A;  2WAE A;  5FI6 A;  3V5M A;  5GLB A;  5IU1 A;  1NYY A;  3C7V A;  3EWK A;  2OAP 1;  1N9O A;  1TEM A;  3ZG9 B;  3DW0 A;  1IEL A;  4QWO A;  3OPH A;  1PWC A;  4MNR A;  4GNU A;  4ETZ A;  4ME4 A;  5KMW A;  1S1Y A;  3C30 A;  4R23 A;  1T1C A;  2ZC7 A;  5AJG A;  3OPL A;  2A24 A;  3TJZ C;  3S7N A;  4DN0 A;  4HNB A;  3IF6 B;  1ZTU A;  3EEA A;  3LY3 A;  4R3J A;  3KYE A;  2V20 A;  4CLC C;  2J3T D;  4GS9 A;  3ITA A;  3G2Y A;  1CQA A;  3T4T A;  1E3U A;  1TS8 A;  4HJ6 A;  2EX6 A;  4NXG A;  2JKT M;  4S2N A;  4S2O A;  3H82 B;  5GL9 A;  1KVM A;  2V1Z A;  1XFQ A;  3LEZ A;  2OAQ 1;  2ZJ9 A;  3NOP C;  4WF0 A;  3MXR A;  1BTL A;  5E2G A;  3HL9 A;  3PTE A;  4BBV A;  2QYB A;  4QB8 A;  1YLJ A;  3OPP A;  3F1N B;  3MF0 A;  5G4Y A;  3MKE A;  3K3D A;  1BLP A;  4P85 A;  4H8R A;  1ES4 A;  5M1A A;  4FSF A;  3IT9 A;  5BOH A;  3UDI A;  1L0G A;  4WM9 A;  3A3F A;  3HLF A;  2VV8 A;  4JGR A;  5FAS A;  3T4K A;  1I2W A;  2Q9M A;  4CJN A;  1S67 L;  2VV6 A;  3SS4 A;  2W3D A;  3WS0 A;  2R9W A;  4LV3 A;  4JGP A;  5DJU A;  2O9B A;  1VET B;  3RXX A;  1S66 L;  4DRT A;  1E3U D;  2V9A A;  3T4S A;  1A0K A;  4KZ5 A;  5J7E A;  1ZG4 A;  3ZNY A;  1F98 A;  5A92 A;  4HHD A;  4OVD A;  1YLP A;  2EXA A;  2ZC5 B;  3NUL A;  2PR5 A;  4IUK A;  1IYP A;  3H7W B;  2V8F A;  1OTD A;  2J9P A;  3GMW A;  4X69 A;  2RL3 A;  3V39 A;  3HLW A;  4E04 A;  4OON A;  5FAQ A;  3N7W A;  1DRM A;  1KOU A;  3ITB A;  2HPB A;  4Y0T A;  3IHA A;  3PAG A;  1BLC A;  1XP4 A;  5AVE A;  2EWW A;  1OJG A;  3PBR A;  4I39 A;  3UMD A;  5F5Y A;  4NXE A;  4QY5 A;  1IKI A;  2ZQC A;  3MFX A;  5DF8 A;  1TDL A;  2DRW A;  2VEA A;  2VGJ A;  2JHE A;  3B33 A;  4RQ9 A;  3UO9 A;  2LB9 A;  3OOV A;  3RFB A;  3E4Q A;  4G3K A;  3OLO A;  3EGD C;  1LL8 A;  1QME A;  4KG5 A;  2VLG A;  1ES2 A;  2QJ5 A;  3JYI A;  2XH9 A;  3KSH A;  3SS5 A;  3MFD A;  2Y2P A;  1LI0 A;  1NJ4 A;  4KZ8 A;  4UA7 A;  5EVE A;  1DP6 A;  1FIK A;  2H5S A;  2PAV P;  2XA7 S;  2JN7 A;  1CF0 A;  2HDQ A;  1H8M A;  5FQM A;  2QZ6 A;  3BEC A;  3BW6 A;  5TBM B;  3BLS A;  3OCN A;  3W4P A;  2W3F A;  2QHK A;  3OPR A;  3Q1F A;  5F1G A;  4JPM A;  1XFN A;  4KZ7 A;  3UB6 A;  3HLD A;  4RA7 A;  3DBA A;  1JVJ A;  1KGF A;  1LHY A;  3PBN A;  4EBN A;  2XEP A;  4ETX A;  3QP5 A;  4GDN A;  3LI9 A;  2NUP C;  1K54 C;  4WBG A;  4PHT A;  4JF5 A;  5F6A A;  2J3W A;  1WYB A;  1GSX A;  4Y5F A;  2Y79 A;  1X0O A;  1YAX A;  2BLS A;  4KZB A;  2V2F F;  4LEN A;  3HJI A;  2P9V B;  4WL9 A;  3IX8 A;  3IBR A;  1K6R A;  3M6B A;  1VEU A;  3IWO A;  2X02 A;  3RH8 B;  3U4L P;  2W27 A;  4BL3 A;  4Y13 A;  3C7U A;  3R7W A;  3VMA A;  3A0S A;  3FPW A;  5HZH A;  3M2J A;  3ZCZ A;  3G2Z A;  4CLC A;  5FA7 A;  4YIN A;  2H0T A;  5F69 A;  4KQQ A;  3M6H A;  4YNR A;  2Z2L B;  4JKT A;  4LRY C;  3HJK A;  1ZHH B;  2K31 A;  1TS0 A;  3S7O A;  4DDS A;  3AGD A;  3CG5 A;  1KGE A;  1O7E A;  3UDX A;  2Q0O A;  4Y0U A;  3A0V A;  4BLM A;  4E3M A;  2VZW A;  3IWI A;  2X71 A;  3CI6 A;  4QU3 A;  4R0Q A;  1PZO A;  2ZLY A;  1CJF A;  1N9N A;  1H5X A;  1NYM A;  2WAD A;  2Y2I A;  3D3O A;  5EE8 A;  2WGW A;  3IXB A;  3Q07 A;  5FDH A;  1J9M A;  3NJA A;  1YSQ A;  3QP8 A;  1FCN A;  4E3L A;  1OTA A;  4HBT A;  1WA9 A;  3GDI A;  3GVB A;  5HL6 A;  1IKG A;  4PMA A;  3IXH A;  1H8Y A;  5DF7 A;  4HJ3 A;  4K08 A;  3WS4 A;  5FQQ A;  4KQO A;  3HBR A;  4KUK A;  1CI9 A;  3BY9 A;  4LV1 A;  5EVI B;  3VFF A;  4FH4 A;  2EXB A;  1RP5 A;  3A0R A;  4CLC D;  4K91 A;  3B3X A;  3OZH A;  4L9F A;  4MN5 A;  5AVF A;  3BFD A;  2XA7 M;  4S2P A;  4EUZ A;  3NDG A;  3VOL A;  4E3O A;  3GR2 A;  2ZL1 B;  3V67 A;  3VP3 A;  3P09 A;  2YKH A;  2HJ9 C;  2Y2Q A;  3Q7V B;  4LGW A;  1NLY A;  4EXO A;  1VM1 A;  4OQ0 A;  3T4L A;  3FZC A;  2BTF P;  2I72 A;  3A3J A;  4P6Z S;  2M7U A;  4R70 A;  1ONH A;  2KX6 A;  4ZAM A;  2WYX A;  5HWW A;  4GCZ A;  3IF5 A;  3UE0 A;  5IHV A;  4GDB A;  2VK3 A;  2B95 A;  2B5R A;  1STZ A;  1ESI A;  3LGO A;  3O87 A;  3FWL A;  3T1R A;  1YQS A;  2Y55 A;  1ONG A;  3SH8 A;  3W8K A;  1W63 Q;  2E8J A;  4CPK A;  3G34 A;  4KQD A;  3TG9 A;  4JXW A;  4OPZ A;  4KEN B;  5DTK A;  3MQ0 A;  4MLL A;  4DE0 A;  1ACF A;  5F68 A;  4JXS A;  3UB7 A;  3KSF A;  1SKO B;  5HD3 A;  1SHV A;  1Z6F A;  4DE1 A;  3P01 A;  1MKI A;  1L0F A;  3HUO A;  1GA0 A;  3ZG0 A;  5FAT A;  3HLC A;  2Y91 A;  4N9K A;  5EFW A;  1M40 A;  1MWR A;  5FL3 A;  1MBL A;  3DTK A;  5HWV A;  2W1T B;  3NDE A;  2PU2 A;  3F1P B;  4PM7 A;  5CXW A;  3VFH A;  5FEG A;  2OLU A;  3FG8 A;  2RCX A;  2CC1 A;  3T1S A;  4Y7P A;  5E2E A;  1NZU A;  1F2K A;  4U3T A;  4HI4 A;  1JTD A;  2HZ5 A;  4FH2 A;  3PBS A;  2G2W A;  3LCE A;  3UN7 A;  3LIA A;  1DP8 A;  3QNB A;  1H0M A;  1MWU A;  4WMC A;  5A90 A;  4U0T A;  4WLA A;  5E2H A;  4G3W A;  5FAP A;  2YKF A;  1PNE A;  3R4K A;  4ZTK A;  4HIA A;  2E8I A;  1K54 A;  1G68 A;  1XKZ A;  3BFG A;  4MCW A;  3LR3 A;  1PZP A;  4C75 A;  1L0D A;  4GKU A;  1HZO A;  5GLA A;  5HAP A;  2Q9N A;  1FSY A;  1E25 A;  3C4O A;  1W7F A;  3OCL A;  3ZVT A;  1BT5 A;  1GSV A;  5C5K A;  3UB8 A;  4IVI A;  4P6B A;  2HP9 A;  4E3N A;  4OP8 A;  5DKL A;  5GLC A;  1YMS A;  4R38 A;  5G4Z A;  1D7E A;  4KG2 A;  2HDS A;  2JCH A;  5HSQ A;  2ZOH A;  2PBD P;  5K5B A;  1F5M A;  3MQO A;  3HUM A;  2QMI A;  4NET A;  1YSP A;  1ZC2 A;  4EET B;  2QKP A;  3G6O A;  5EPH A;  4WUJ A;  3LFV A;  4EEU A;  3TW8 A;  4WMC D;  3VE3 A;  3CHW P;  1DJA A;  2W3E A;  3S7P A;  5FAO A;  4HQA A;  3O86 A;  2V1B A;  3T12 B;  2WGI A;  4O0P A;  4P6Z M;  2EWV A;  2Y2M A;  2ZC6 B;  3JPU A;  3ZDJ A;  2EFU A;  3I7J A;  2X01 A;  4ZRR A;  1KDW A;  3UNW A;  2A24 B;  2XLN A;  4X53 A;  2O9A A;  4WN5 A;  1DY6 A;  2L0W A;  3GQZ A;  3LI8 A;  3E98 A;  4GS9 B;  1PFL A;  2EX8 A;  1N9B A;  2VGL S;  2D01 A;  2V0U A;  3WRZ A;  1XXM A;  4R3B A;  3EQV A;  4GLQ A;  3JVV A;  2Y2K A;  3Q82 A;  4I3A A;  5EUA A;  1FCO A;  4N92 A;  1MWT A;  4Y3I A;  1OT6 A;  1NRJ A;  3NIA A;  3G31 A;  4H6J B;  4BJP A;  2ZQ8 A;  3UME A;  4OLD A;  1ALQ A;  5TGF A;  4WZ4 A;  3MSH A;  3UPP A;  1VQQ A;  4Q8I A;  5CER A;  2KLI A;  4XXR A;  1OPX A;  4U0X A;  5M18 A;  1KE4 A;  3Q7Z A;  4LRX C;  4EUV A;  4FUW A;  4P0M A;  3GEC A;  4QY6 A;  3ZNT A;  1C3B A;  2FZ0 A;  4OLG A;  2XDM A;  3NHQ A;  3E4O A;  5KSC A;  4ESP A;  2ZQ9 A;  4L9E A;  2VV7 A;  2H28 A;  5DFX A;  2PYP A;  4NK3 A;  3W4Q A;  3Q81 A;  1OJ5 A;  5JYO A;  2R78 A;  2ZMF A;  3OC2 A;  3A3D A;  3LIE A;  4IUH A;  1KDS A;  1PRQ A;  3G35 A;  4KZ4 A;  2Y2O A;  5EOE A;  2KOI A;  3MBZ A;  1YLY A;  1RGY A;  1Q2Q A;  2HDR A;  3S7Q A;  3IBJ A;  4YWZ A;  4OQI A;  1MY8 A;  2KDK A;  5KZH A;  1PW1 A;  4FCF A;  2ZM0 A;  4BWI A;  5TR7 A;  1FIL A;  5F82 A;  3MQQ A;  1NY0 A;  1K6S A;  3UPN A;  3KYQ A;  4DJ2 A;  1K55 C;  2Y2H A;  2ZD8 A;  3FKW A;  2PDR A;  4I5S A;  3QP4 A;  3QP2 A;  2OWJ A;  3ULF A;  4EW7 A;  3VOZ A;  4O7D A;  5DFY A;  3FV7 A;  2VKS A;  4HH3 A;  1HLU P;  5HDS A;  1GHM A;  2JKG A;  3JVU A;  3ISG A;  2VGK A;  1T1A A;  3VP2 A;  4CQH A;  3CUE C;  4CLC E;  3FKV A;  2W0N A;  4BBU A;  4Y0O A;  4UA9 A;  5FQJ A;  4LCL A;  1D06 A;  2VGL M;  3T4Q A;  1PI5 A;  2VA0 A;  4X56 A;  1ERO A;  1ZKJ A;  1FCM A;  3BRM A;  3SZT A;  2WUQ A;  1W5D A;  5CEC A;  4JGO A;  4O01 A;  4DDY A;  4E6X A;  5L09 A;  4YFM A;  3TSG A;  3VP1 A;  3E4P A;  2G2U A;  2CMN A;  4K0W A;  3CPT B;  3RXW A;  2V1A A;  1NZO A;  3ZFZ A;  1XJ4 A;  1PIO A;  4ZJ2 A;  1TDG A;  2IWC A;  1G5U A;  3TOI A;  5A91 A;  5HDC A;  3ZG8 B;  4OPY A;  4PM6 A;  1AWI A;  2HDU A;  2INW A;  4OOL A;  3B42 A;  5TFQ A;  3VP4 A;  5J3W A;  5EVL A;  1Z09 A;  1GA9 A;  5HDD A;  3TRC A;  1HVB A;  2PU4 A;  1VEU B;  3F1O A;  5FQ9 A;  3IF6 C;  4EV4 A;  3AGF A;  2B02 A;  4GOG A;  3R7W B;  3N8R A;  4Y17 A;  4XUX A;  1OME A;  5L8M A;  3BFF A;  2K2N A;  5L2F A;  2O0Y A;  3C5A A;  4BBT A;  5HPF A;  4MBF A;  1CEG A;  3PR6 A;  3IHB A;  4D2O A;  2WKI A;  5GHZ A;  4PM5 A;  4I3I A;  1CK3 A;  1T1B A;  5L10 A;  3EQU A;  2XGN A;  3PBT A;  1K38 A;  4GZB A;  4R3A A;  3A3I A;  1LLB A;  4S2L A;  2WKR A;  1F9I A;  3VSL A;  2K7S A;  3LO7 A;  1LL9 A;  5FDS A;  1LL5 A;  3BJN A;  4GJ4 A;  4JGQ A;  3MMH A;  1K4F A;  5CRF A;  1BLS A;  1KE3 A;  2VJW A;  1W79 A;  5EVI A;  3ZYT A;  4OH0 A;  3O88 A;  1CI8 A;  3PHY A;  1MXO A;  1IOU A;  1PWG A;  4OPR A;  3H9W A;  2M1C A;  2UWX A;  3PXP A;  3C4P A;  4UEY A;  2HP6 A;  4FD8 A;  1M6K A;  2ZL1 A;  2PRF A;  4XT2 B;  3Q7V A;  4MMN A;  1LI9 A;  1YLT A;  3KYZ A;  1GCE A;  3IXG A;  4N1H A;  2JKR I;  3MZE A;  3UB9 A;  1K0K A;  3SW1 A;  2IWD A;  2WKH A;  4GD8 A;  1TF1 A;  3VV4 A;  4IVK A;  5I94 A;  3KX0 X;  4E3I A;  2IA2 A;  4JXV A;  1ODV A;  4X1L A;  2XFS A;  3MXS A;  5AQB A;  3UE1 A;  5I5L A;  3SOI A;  4P87 A;  1JWV A;  1S1Z A;  1S6R A;  1DJC A;  3K2N A;  3QP6 A;  5DTT A;  4MEZ A;  2P7J A;  4PM8 A;  4X68 A;  3NOU C;  1XA7 A;  2ZMA A;  3C38 A;  5DJT A;  4UA6 A;  4I38 A;  4QJG A;  4OPQ A;  2BAS A;  3GTC A;  4JF6 A;  1VHM A;  4R4R A;  5EVI D;  5FQK A;  2PHY A;  3N8L A;  4EWF A;  4GHI A;  1U60 A;  5FEF A;  1NWZ A;  1K55 A;  2G7U A;  4JF4 A;  4IED A;  5FSR A;  5J4E A;  5JYP A;  3A3E A;  3LIC A;  4ARZ B;  5HPI A;  2DNS A;  4F3L B;  4O8G A;  2JC7 A;  5HAI A;  1HD8 A;  1GHP A;  3F1P A;  4EER A;  1EW0 A;  5TJJ A;  2Z6C A;  4HOI A;  4KZA A;  4KG6 A;  4B4X A;  3KSI A;  2Z6D A;  4X1M A;  1P0Z A;  3EEH A;  4WEL A;  1S4R A;  3CUE A;  3G4P A;  5E2F A;  3NY4 A;  1N4O A;  3FPV A;  3IH8 A;  5CTN A;  3HVF A;  2EX2 A;  3FYZ A;  3ICY A;  1Q2P A;  1IFQ A;  4DXB A;  3PYP A;  1OT9 A;  4MBH A;  3NI9 A;  2R9X A;  3V50 A;  3WWX A;  4GW9 A;  4B93 A;  2ZQA A;  2XFT A;  2ZOI A;  3MKF A;  1K25 A;  2Y2N A;  3E2K A;  5G18 A;  2D02 A;  5AQA A;  1MC0 A;  1LSX A;  3V3R A;  2W3G A;  2XSS A;  1KE0 A;  1H8Z A;  4ZBE A;  2H10 A;  3IS2 B;  3DWZ A;  3LY4 A;  4IHQ A;  4EBP A;  3N6I A;  2WKQ A;  3RTY A;  3EGX C;  1Y4O A;  4NXF A;  3PBO A;  3UDF A;  1XA1 A;  4ZJ3 A;  4II7 A;  2OOL A;  3UB5 P;  1FQG A;  1TVF A;  1MPL A;  4Z9Q A;  2OSU A;  2JE5 A;  2OV5 A;  3S4X A;  2C5W B;  3LID A;  5FI7 A;  4X6T A;  3DWK A;  3IF6 A;  2ZM2 A;  1XGJ A;  4Z1W A;  1YMX A;  3G32 A;  1BUE A;  1HTZ A;  1UWP X;  1XJ6 A;  4S2K A;  5FI2 A;  3BWL A;  4HH2 A;  4ID4 A;  4QHC A;  1YKD A;  5CHM A;  3FC7 A;  1W63 M;  1D1J A;  4FTX A;  4RX2 A;  3LIB A;  4K0X A;  3H82 A;  2Y4A A;  1G6A A;  3IH9 A;  4B4Z A; 
#chains in the Genus database with same CATH homology
 3HJK A;  3LUQ A;  1ZHH B;  4ARZ A;  2K31 A;  3MQQ A;  2NUT C;  4F3L A;  1TS0 A;  3S7O A;  2HV1 A;  2B18 A;  2W1T A;  4GHI B;  4L9G A;  4NKP A;  3KYQ A;  3UE3 A;  3A0V A;  3LR4 A;  4DJ2 A;  1OTI A;  5A8B A;  2JKT I;  2PDR A;  2I9V A;  1OTE A;  4I5S A;  3F1N A;  2VZW A;  3CI6 A;  2ZMV A;  2QWS A;  3BY8 A;  4LRZ E;  2XRN A;  5LBR A;  1TD5 A;  2OWJ A;  3ULF A;  1N9N A;  4EW7 A;  1H3Q A;  2GNX A;  3D3O A;  5DFY A;  2VKS A;  4HH3 A;  1BYW A;  4H6J A;  4Q0H A;  3NJA A;  1JNU A;  4QPR A;  1YSQ A;  2WKP A;  5HDS A;  1OTA A;  2V0W A;  1GSW A;  1WA9 A;  5KSH A;  3JVU A;  3GDI A;  2LB5 A;  3T50 A;  1T1A A;  5HL6 A;  4MDZ A;  3T4J A;  4CQH A;  3CIT A;  3CUE C;  4HJ3 A;  4K08 A;  4CLC E;  4DJ3 A;  2W0N A;  4KQO A;  4BBU A;  4KUK A;  2P08 A;  3BY9 A;  4NXB A;  3U2A A;  1G6O A;  1TS7 A;  3K3C A;  4EQ1 A;  1G28 A;  1D06 A;  2VGL M;  3T4Q A;  3A0R A;  4CLC D;  2XRO A;  2VA0 A;  4L9F A;  2PYR A;  3O5Y A;  4MN5 A;  5AVF A;  4MN6 A;  3IS2 A;  2XA7 M;  2GZA A;  4EEP A;  5IS1 A;  4JGO A;  4O01 A;  4OOM A;  3BQA A;  3NOT C;  3VOL A;  1Y28 A;  3V67 A;  2W3H A;  3E4P A;  2YKH A;  1OTB A;  2QJ7 A;  2CMN A;  2HJ9 C;  4LPZ A;  2DMW A;  2L1M A;  1NLY A;  3H7W A;  1P9R A;  3C8C A;  4EXO A;  2V1A A;  1XJ4 A;  3CLO A;  4PKY G;  2FH5 A;  3T4L A;  1LSV A;  1T18 A;  3LIF A;  4YOF A;  1NLZ A;  3P7N A;  5DKK A;  5HDC A;  4BMW A;  2HGV A;  4P6Z S;  2M7U A;  4R70 A;  2KX6 A;  4G3V A;  5HWW A;  5IT5 A;  2INW A;  4OOL A;  3B42 A;  4IJG A;  3LR0 A;  4GCZ A;  5IU1 A;  3EWK A;  2OAP 1;  5J3W A;  1N9O A;  2M7V A;  1STZ A;  5HDD A;  3TRC A;  4ETZ A;  4ME4 A;  2O9C A;  1S1Y A;  2ZBB A;  3C30 A;  3F1O A;  1T1C A;  5AJG A;  3TJZ C;  2A24 A;  1XJ3 A;  2B02 A;  3S7N A;  4DN0 A;  4HNB A;  3R7W B;  1ZTU A;  4M4X A;  1W63 Q;  4KUO A;  3EEA A;  4KQD A;  3LR5 A;  2GX5 A;  3OBF A;  4CLC C;  5L8M A;  2K2N A;  2J3T D;  4GS9 A;  2O0Y A;  4BBT A;  3MQ0 A;  3T4T A;  5HPF A;  4Q0J A;  5F68 A;  1TS8 A;  4HJ6 A;  3UB7 A;  3PR6 A;  3KSF A;  5HD3 A;  4NXG A;  4L0L A;  3D72 A;  2JKT M;  3P01 A;  3H82 B;  4I3I A;  1T1B A;  3EQU A;  3PBT A;  1XFQ A;  3ZQ5 A;  1XJ2 A;  4R3A A;  1S4S A;  1UGU A;  5EFW A;  2OAQ 1;  2PD7 A;  4R6L A;  3NOP C;  5FL3 A;  5HWV A;  4WF0 A;  2W1T B;  5CX7 A;  3F1P B;  2WKR A;  1F9I A;  2K7S A;  5TBM A;  3FG8 A;  2PD8 A;  4BBV A;  2QYB A;  3BJN A;  4GJ4 A;  4JGQ A;  3MMH A;  3F1N B;  1LSW A;  3MF0 A;  3PBQ A;  5G4Y A;  2P04 A;  2VJW A;  4HI4 A;  3K3D A;  4UQI S;  3PBS A;  3KO6 A;  4EU0 A;  3KSG A;  2L4R A;  3ZYT A;  3C2W A;  3LIA A;  1DP8 A;  4FSF A;  3PHY A;  1IOU A;  4WLA A;  4G3W A;  2PT7 A;  3H9W A;  2YKF A;  4FOF A;  3R4K A;  2M1C A;  4HIA A;  3PXP A;  4I3J A;  2VV8 A;  4JGR A;  4UEY A;  3T4K A;  3TE8 A;  3T4O A;  5KIZ A;  4MCW A;  3LR3 A;  4XT2 B;  1S67 L;  2VV6 A;  2J3T C;  4MMN A;  2W3D A;  3KYZ A;  2JKR I;  3EOI A;  2HF6 A;  4JGP A;  3UB9 A;  5DJU A;  2O9B A;  3UE6 A;  3OCL A;  3SW1 A;  1S66 L;  1GSV A;  5C5K A;  3UB8 A;  2V9A A;  1TF1 A;  3VV4 A;  3T4S A;  3KX0 X;  2IA2 A;  5DKL A;  1ODV A;  5J7E A;  4R38 A;  5G4Z A;  1F98 A;  3MXQ A;  2OWH A;  4HHD A;  1D7E A;  1T19 A;  1V9Y A;  2HJE A;  5I5L A;  5HSQ A;  2ZOH A;  1S1Z A;  2PR5 A;  4IUK A;  4B9O A;  3H7W B;  5K5B A;  1OTD A;  2MJ6 A;  1F5M A;  1V9Z A;  3MQO A;  3K2N A;  4WEJ A;  4E04 A;  3B47 A;  2P7J A;  1YSP A;  2W1R A;  1MKM A;  3NOU C;  4EET B;  1DRM A;  1KOU A;  2QKP A;  3C38 A;  3G6O A;  4WUJ A;  5DJT A;  4I38 A;  1MZU A;  5AVE A;  4HP4 A;  3LFV A;  2BAS A;  2EWW A;  1OJG A;  4EEU A;  3PBR A;  4I39 A;  3UMD A;  5F5Y A;  1VHM A;  3TW8 A;  2GJ3 A;  2PHY A;  4GHI A;  3VE3 A;  4NXE A;  4CLC B;  2W3E A;  3S7P A;  3MFX A;  1NWZ A;  4HQA A;  4LLO B;  2V1B A;  4HP9 A;  2G7U A;  2VEA A;  3F1O B;  4EES A;  2JHE A;  4O0P A;  4P6Z M;  2EWV A;  3B33 A;  4RQ9 A;  2LB9 A;  4ZRR A;  3OOV A;  2EA9 A;  4MN7 A;  2A24 B;  5J4E A;  3RFB A;  3E4Q A;  4G3K A;  3OLO A;  2O9A A;  3LIC A;  3EGD C;  1LL8 A;  3LYX A;  4ARZ B;  5HPI A;  4WN5 A;  4F3L B;  3CWF A;  2L0W A;  4O8G A;  2VLG A;  3LI8 A;  3F1P A;  3E98 A;  2QJ5 A;  4GS9 B;  1N9L A;  3KSH A;  4EER A;  1EW0 A;  2VGL S;  5TJJ A;  2D01 A;  2Z6C A;  2V0U A;  4PAU A;  4HOI A;  1DP6 A;  3KSI A;  3EQV A;  4GLQ A;  2Z6D A;  3JVV A;  2XA7 S;  4I3A A;  2JN7 A;  5DF9 A;  1P0Z A;  3EEH A;  4WEL A;  3CUE A;  1S4R A;  1UWN X;  4Y3I A;  3FPV A;  4Y2F A;  1OT6 A;  1H8M A;  1NRJ A;  3ICY A;  5MC7 A;  4H6J B;  1IFQ A;  3HCY A;  3BW6 A;  4BJP A;  3E0Y A;  3PYP A;  1OT9 A;  5TBM B;  3OCN A;  3VE4 A;  2W3F A;  3UME A;  2A2L A;  2QHK A;  4HY8 A;  4GW9 A;  4B93 A;  2ZOI A;  3MJQ A;  1XFN A;  4XT2 A;  3BQ8 A;  3UB6 A;  2KLI A;  3DBA A;  3W2Z A;  2D02 A;  4DMZ A;  1OPX A;  3PBN A;  1MC0 A;  4Q0I A;  1LSX A;  4LRX C;  4EUV A;  1VB6 A;  2J80 A;  2W3G A;  4WEK A;  2XSS A;  4ETX A;  2JKR M;  2VX8 A;  3LI9 A;  2NUP C;  3GEC A;  4PHT A;  2FZ0 A;  3IS2 B;  4UQI M;  4IHQ A;  2J3W A;  5F6A A;  1P97 A;  1GSX A;  1TS6 A;  4Y5F A;  2WKQ A;  3NHQ A;  3E4O A;  2Y79 A;  1X0O A;  3RTY A;  1DP9 A;  3EGX C;  1LT0 A;  4NXF A;  3PBO A;  2Y8H A;  1YAX A;  4II7 A;  2OOL A;  3CAX A;  4HJ4 A;  3HJI A;  4WL9 A;  4L9E A;  5HWT A;  2VV7 A;  2H28 A;  3MR0 A;  3IBR A;  4AFI A;  5DFX A;  2PYP A;  5HD5 A;  1OJ5 A;  3RH8 B;  2R78 A;  2W27 A;  3LID A;  2ZMF A;  3OC2 A;  3R7W A;  4Z1W A;  3A0S A;  3FPW A;  3LIE A;  5HZH A;  1UWP X;  4IUH A;  4NEE D;  1XJ6 A;  4PKY A;  4CLC A;  2KOI A;  3BWL A;  2O99 A;  4HH2 A;  2PR6 A;  1YKD A;  3FC7 A;  1W63 M;  5F69 A;  3S7Q A;  3IBJ A;  4YWZ A;  3LIB A;  3H82 A;  4YNR A;  2KDK A;  4BWI A;  1P9W A;  4LRY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...