3BY8A

Crystal structure of the e.coli dcus sensor domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
b'DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein dcuS
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17203 sCache_3_2 Single cache domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by8A00
1OT9A 3UB6A 3GECA 3ICYA 3D72A 1S4RA 1NWZA 2ZBBA 5DJUA 1V9YA 2P7JA 3UB7A 3VE4A 4H6JB 5J4EA 3C8CA 1TS7A 2VV6A 1OTBA 1LSWA 3EEHA 2V0WA 4HJ6A 3H9WA 3CAXA 1VB6A 4EERA 3A0VA 1TS6A 2HV1A 3LI8A 3HJIA 2VV8A 4BBUA 1T1AA 4EQ1A 5HZHA 3MJQA 3P7NA 4HY8A 1LT0A 4HJ4A 2QJ5A 1N9LA 4NXGA 1OTIA 4LPZA 2OWHA 2GJ3A 4EW7A 1N9NA 4EEPA 5F5YA 2W0NA 3H82A 3MQQA 1T1BA 5DKLA 2VLGA 3NOUC 3F1PB 2KX6A 5AVFA 1XJ3A 3E4PA 4XT2B 4JGRA 2PYRA 2Z6DA 2VEAA 2R78A 4R70A 5HSQA 2CMNA 1S1YA 4LLOB 4WUJA 4F3LB 4WLAA 2PR5A 4LRZE 1P0ZA 1OTDA 1BYWA 3T50A 4XT2A 3E4QA 4YWZA 3LIDA 4HH2A 4MN6A 1GSVA 2B02A 1DP6A 4WN5A 1V9ZA 4EEUA 4HIAA 2OOLA 4PKYG 2QKPA 5HDDA 3SW1A 4HNBA 1LL8A 1OJGA 3MQOA 2K7SA 2D02A 4HH3A 4KUOA 3EWKA 1F98A 4JGPA 4RQ9A 3NOTC 1P97A 2V1BA 1TS0A 1OT6A 5F68A 3A0RA 2PR6A 2ZOHA 3BY8A 4H6JA 2W27A 4EETB 5EFWA 1KOUA 3CLOA 3LIFA 5HWVA 5IS1A 4B9OA 4L9GA 2L4RA 4NXEA 5HD3A 2A24B 3E4OA 5IU1A 2V1AA 3K3DA 4BBTA 3LUQA 2M1CA 2L1MA 1GSWA 1Y28A 3BWLA 1OTEA 2BASA 2PHYA 1D7EA 1G28A 4I38A 4DJ2A 4GS9B 5HDSA 3F1NB 1XFQA 3KX0X 4I3JA 5J7EA 3ZQ5A 4HOIA 3VOLA 1OJ5A 5TBMB 4HI4A 2INWA 4EESA 4MN5A 1S1ZA 4BBVA 2YKFA 4GW9A 4HP9A 3IS2B 4I5SA 3UMEA 2QHKA 2JN7A 2I9VA 3C2WA 1T18A 2WKQA 3UMDA 1XJ2A 3F1PA 3F1OB 2H28A 2QJ7A 5HDCA 3NHQA 1UWNX 4DJ3A 4LRXC 3UE6A 5AVEA 4GHIB 4EXOA 5I5LA 3H7WB 3BY9A 3LI9A 3FC7A 5F6AA 2L0WA 1ODVA 3MR0A 3PYPA 4K08A 3PHYA 5HWTA 4F3LA 5HD5A 4KQDA 2V9AA 4JGOA 4NXFA 2J80A 3LICA 3LYXA 3RTYA 2PDRA 2WKPA 4HQAA 4LRYC 1EW0A 4I3AA 1S4SA 2VV7A 3G6OA 4HP4A 2D01A 3FG8A 4R38A 3UB9A 1T1CA 3LIAA 4NXBA 4PKYA 5A8BA 3VE3A 3LIBA 1OTAA 1LSXA 1XFNA 2OWJA 4HJ3A 3ULFA 5HWWA 1F9IA 5KIZA 2PD8A 2Z6CA 1WA9A 3K3CA 5G4YA 1S67L 1T19A 3OLOA 2ZOIA 2QWSA 3IBRA 5G4ZA 4JGQA 3MXQA 5J3WA 2KDKA 4M4XA 1XJ4A 4R3AA 2PYPA 4L9FA 1N9OA 2YKHA 1MZUA 1S66L 4E04A 5DKKA 4HHDA 3H82B 1D06A 4WL9A 3MFXA 2A24A 2V0UA 4WF0A 3LIEA 4R6LA 3B33A 3NJAA 1UGUA 2PD7A 1GSXA 1JNUA 1UWPX 5F69A 3A0SA 4GS9A 1DRMA 3F1NA 1TS8A 1DP9A 3GDIA 5TBMA 1XJ6A 3NOPC 4KUKA 2EA9A 1X0OA 4I3IA 1DP8A 5DJTA 3IS2A 1LSVA 3RH8B 4L9EA 4I39A 3CWFA 3F1OA 3UB8A 3HJKA 2JHEA 4GHIA 3H7WA 4GCZA 2WKRA
chains in the Genus database with same CATH superfamily
2VK3A 1TDGA 3ICYA 3P98A 4E6WA 3N8SA 3N7WA 2Y2KA 4GD8A 1I5QA 5A92A 3VE4A 1BLSA 4F94A 4KQOA 4D2OA 3LR4A 1WE4A 5CEDA 1W8QA 2PU4A 2H10A 3V67A 5F83A 4OPQA 4OP5A 4EERA 5E2EA 3TSGA 1BLCA 1CEGA 2H0YA 1TS6A 2O9AA 3UB5P 1FILA 4BBUA 4K91A 1VEUB 5C5KA 2EFXA 4S2MA 3R7WA 2VGLS 4LFUA 3W4OA 2UV0E 1N9LA 4EUVA 1OTIA 4GN2A 4JKTA 3N4IA 3BFDA 3ZG7B 1FQGA 2EFUA 4R3BA 3IXDA 3HBRA 4KZ5A 1MY8A 2GJ3A 1F5MA 5F5YA 3ZG8B 4EEPA 4N92A 5AQBA 4GD6A 3HUMA 4NKPA 2VZWA 5DKLA 5GHZA 3NOUC 3WWXA 5FL3A 4JGRA 1BLHA 2PYRA 1MWTA 2Z6DA 4Z1WA 3G32A 2ZQCA 4S2LA 2VEAA 5KZHA 2OLVA 2R78A 4FOFA 4R70A 2CMNA 3KSHA 5FQMA 1GCEA 4YOFA 3ITBA 4Y7PA 3IHAA 1TD5A 3E2KA 4WLAA 4GB7A 3G4PA 1XGJA 4LRZE 1NXYA 1P0ZA 1BYWA 5FEGA 3T50A 4MBHA 3G2ZA 1WYCA 2HJ9C 4OPYA 5AQ9A 2HDRA 2VA0A 3GV9A 2Y55A 3IBJA 3S7OA 5FA7A 1NLYA 3AGDA 2X71A 1PWGA 2OOLA 3SW1A 1XP4A 4HNBA 4KUOA 2HJEA 1RGZA 4PHTA 1H5XA 3GMWA 1F98A 3C7VA 3NCKA 3NOTC 2LB5A 2W1TB 3UDFA 2VJWA 1P97A 1TS0A 1OT6A 5EOEA 3DTIA 1IYSA 3WRZA 3ZVTA 4CLCD 3O3VA 3OCLA 4S2OA 3HLGA 3UY6A 5CECA 4LV2A 5EUAA 4FTXA 1KOUA 5HWVA 3T4TA 1AXBA 4U0TA 4XUZA 2W3EA 1A0KA 1NLZA 4E3JA 2A24B 4EV4A 2A49A 1K56A 1L0EA 1XKZA 3QNBA 4K0XA 4P6ZM 2DMWA 2Z2LB 3CG5A 2L1MA 3CUEA 5CERA 1PFLA 2BASA 1H8MA 1FR1A 4GOGA 3IXHA 1G28A 2WGIA 4X1LA 4I38A 2PBYA 2B18A 4DJ2A 3CI6A 3F1NB 1XFQA 4L0LA 3IF5A 4I3JA 4Q0IA 3VP2A 5TBMB 4WMCA 3B42A 4WZ4A 2Y2JA 4QY5A 3G34A 2XA7M 3PBOA 4Q0JA 2YKFA 2ZC3B 4EQIA 4HP9A 3IS2B 4OLDA 5IHVA 3UMEA 1E25A 1T18A 3GR2A 1ZC2A 4OQHA 5EM1A 2JKRM 1XJ2A 2ZC5B 3F1PA 2H28A 4X56A 2QJ7A 1EWZA 4LRXC 4S2NA 5I5LA 3LY4A 3BY9A 5CRFA 4MBFA 1MPLA 3ITAA 3VOZA 3BFGA 5E43A 4F3LA 4KQDA 2V9AA 3GVBA 4JF5A 4JGOA 5TFQA 3HLCA 1SDNA 3LYXA 2JKFA 4HQAA 2J8YA 3UE3A 4I3AA 2VV7A 1MWUA 3G6OA 2XFSA 1U60A 4WYYA 3FG8A 4ETZA 1BT5A 3LIBA 5TGFA 1OTAA 3HUNA 1N9BA 4LV3A 3T1RA 5KIZA 2PD8A 2Z6CA 3QP2A 2KLIA 1DY6A 4RA7A 5DF8A 4R4SA 3E0YA 1WA9A 2QMIA 3K3CA 3V3RA 5HL6A 1T19A 4DXBA 3LO7A 3PBTA 1ERMA 3IBRA 2VGLM 3Q82A 4Y13A 1YLTA 4YINA 1NJ4A 1XJ4A 4P6BA 2WGWA 2JKGA 1N9OA 1S66L 2WKEA 4KG2A 2NUTC 5DKKA 3NECA 3MFXA 4GJ4A 5HPIA 2W3FA 5FQJA 1CF0A 4DE0A 4WF0A 5AQ7A 1K6RA 3MFDA 3NULA 1YSQA 5CGWA 3B33A 3BFEA 5EOOA 1AWIA 1UGUA 2PD7A 1GSXA 5F69A 3A0SA 3IHBA 3HLBA 2ZC6B 4NG2A 1XA7A 2HP5A 3NOPC 4KUKA 2EA9A 2W1RA 1GHMA 2BTFP 3M2KA 4EU0A 1DJCA 3VV4A 2JC7A 3IWQA 1LSVA 3HLWA 3U2AA 4L9EA 1NRJA 1BSGA 4KENB 1SCWA 3KSFA 2GDNA 2JKTM 2Y2HA 1P9RA 3ZDJA 5FDHA 4B4ZA 4GCZA 4GKUA 4ETXA 2Y59A 3W4PA 1OT9A 1VETA 3GECA 1JTGA 2QZ6A 1NWZA 2ZBBA 2WGVA 5DJUA 4BL2A 2J9OA 1V9YA 5FQKA 3BRMA 3UB7A 1KE3A 1W5DA 2GZAA 4H6JB 3A3JA 3MMHA 2ZQ9A 4ARZA 3IX8A 2XFTA 1LSWA 2DCFA 1W63M 2WZXA 3SZTA 1K54A 3MZDA 2HP9A 4JBFA 3FPWA 1ONGA 3TG9A 1JVJA 2ZMAA 3HUOA 3MXRA 3LI8A 5CGSA 3HJIA 4OQIA 2VV8A 4G3WA 4RX3A 2O9BA 1N4OA 5A91A 4ZJ3A 4HY8A 4MLLA 3ZNTA 1NYMA 4IJGA 4BQMA 2XSSA 2QJ5A 4NXGA 3WS1A 2Z2MB 2V1ZA 1Q2PA 3ZCZA 2ACGA 4JXVA 2OWHA 1ALQA 2J3TD 3E2LA 2K31A 4WEJA 1YSPA 1FR6A 4E3IA 5F1GA 2XH9A 5HARA 2W0NA 4DE2A 1HZOA 3H82A 1G6AA 2XROA 1T1BA 2VLGA 1GA9A 1JWPA 4LCLA 1L3LA 2RCXA 3WS4A 3NC8A 3MZFA 3VMAA 1Y4OA 1G6OA 4XT2B 3WS0A 3GTCA 3SH8A 3OOVA 3C7UA 3C4PA 5HSQA 1RP5A 4IEDA 4KZ9A 5CXWA 1S1YA 2H0TA 2EWVA 3Q1FA 4X25A 2XQZA 1E3UA 3GSGA 1SKOA 3EQVA 2EXBA 2OAQ1 3DBAA 3FV7A 3ZFZA 4ZJ1A 5CTNA 4XT2A 4YWZA 2ZQ7A 4HH2A 1GSVA 4GDNA 2NUPC 1SHVA 3NBLA 5A90A 2Y2QA 4GNUA 3W4QA 4WN5A 2Y4AA 3IH9A 3Q7VA 1V9ZA 1KE4A 3T1QB 5L8MA 4N1HA 2JKRI 3S4XA 3IT9A 3CPTB 2ZM2A 2C5WB 4PKYG 2QKPA 1K55A 3PBRA 4R3JA 4WMCD 2K7SA 1PNEA 5KMWA 2FFFB 5L07A 4UAAA 1MWRA 5EVIA 5HAIA 5F1FA 4JGPA 4C6YA 4RQ9A 1PWCA 3QP5A 2VKSA 2V1BA 5DTKA 5TJJA 1KDSA 4NK3A 5HL1A 4LV0A 4OQGA 3PTEA 5HPFA 1I2SA 5DVAA 5FQ9A 4FSFA 2X02A 2OV5A 3BW6A 3BEBA 5D3OA 1XPBA 1CQAA 4PM7A 1MBLA 3GRJA 3S7NA 2Y2PA 2W3GA 3E4OA 4RX2A 1YAXA 5FATA 2MJ6A 3K3DA 4E3LA 4BBTA 2M1CA 2PRFA 3JVUA 1GSWA 1OMEA 3QHYA 1I2WA 3BWLA 1VEUA 4UEYA 3AGFA 1D7EA 3UE0A 5JYOA 1TDLA 4CLCE 2M7VA 3ZQ5A 3MSHA 1H3QA 5GL9A 3VOLA 3V5MA 4N9KA 3KYQA 4QU3A 2Y79A 4FD8A 2A2LA 4ZTKA 4Q0HA 2J3TC 2PU2A 4I5SA 1CJFA 2QHKA 1YLPA 2BLSA 2JN7A 3C2WA 2Q0OA 1FIKA 3UMDA 1MKMA 3F1OB 1M40A 1KE0A 1UWNX 1KGFA 4DJ3A 1MXOA 2J3WA 5AVEA 4GHIB 3PBSA 1FCMA 4EXOA 4E3MA 3PBQA 3FC7A 4S2PA 1MKIA 4R4RA 3IX4A 3UDXA 2V8CA 3LEQA 4OQ0A 2Q9MA 2QYBA 4WBGA 4DE3A 5M18A 4LRYC 3LY3A 1S4SA 2WK0A 4MCWA 3E98A 2WKHA 3ZGAB 4KQRA 3UB9A 5HAPA 4S2KA 3DW0A 2JKTI 4WELA 4ZJ2A 2P08A 1ZHHB 3M2JA 4R23A 1RCJA 3VE3A 4X68A 3KSGA 2HDQA 4HJ3A 3ULFA 1W8YA 3QP6A 4JXSA 3ZVWA 3HCYA 1TEMA 2WADA 3MKEA 1L0FA 1BULA 5EE8A 5G4YA 2W1TA 3TRCA 3OLOA 4UA9A 3UPNA 3BM6A 2ZOIA 2QWSA 4O8GA 5G4ZA 4BL3A 1PZPA 2EX9A 2EWWA 2WKIA 3EQUA 3VFHA 3RJUA 2PYPA 3WRTA 4L9FA 2YKHA 4E04A 1D06A 3DTMA 4FUWA 4KZ3A 5JYPA 2IWCA 2A24A 2Y2OA 3FPVA 4MN7A 5FSRA 1K6SA 2V0UA 3NIAA 4JPMA 2Q9NA 3LIEA 3C30A 3IX3A 4KZ4A 2P9VB 3NJAA 4C3QA 3MZEA 3HL9A 4PPRA 3F1NA 1TS8A 3LEZA 3P09A 3PR6A 5TBMA 1XJ6A 4Y3IA 3ZYTA 3SS5A 2M7UA 1BZAA 3NI9A 2ZQAA 1FSWA 5FDSA 3IS2A 1Y54A 5EECA 1PI4A 3NY4A 2R9XA 2PT7A 2ZC4B 1C3BA 4BJPA 3UB8A 4IVKA 5CHUA 4BD0A 5CHMA 4E3KA 4RVAA 2WYXA 3UE1A 4B93A 4QY6A 3RXWA 3LR0A 5L2FA 3OCNA 4QHCA 4BLMA 1TF1A 1ES2A 3DAVA 3B47A 4BD1A 2P7JA 5J4EA 4OKPA 3C8CA 4PM6A 2VV6A 3IH8A 3EEHA 4FCFA 1H0MA 5AJGA 2V0WA 4HJ6A 4II7A 3UN7A 4C75A 2ZL1B 3CAXA 1E3UD 5E2HA 1VB6A 1ZKJA 3VSKA 4G3KA 5J8XA 1YKDA 4ZRRA 5FEFA 5GLBA 4YFMA 3A0VA 3CZDA 3BYDA 3NDEA 2HV1A 2UWXA 2HZ5A 2XR0A 4CLCC 1K57C 2B95A 4KZ6A 5HZHA 3N8LA 2FFYA 3MJQA 4N1XA 1K0KA 5FQQA 1RGYA 4HJ4A 4Y0OA 2XD1A 2ZMFA 1J3WA 1GA0A 4Y5FA 1EROA 4LPZA 1W7FA 3HLDA 1XA1A 1FOFA 4BMWA 2Y91A 5EVID 3Q7ZA 5GLCA 2ZLYA 1ESUA 1KGEA 4NEED 4R0QA 3Q07A 4ZBEA 1HTZA 3JVVA 4CLCB 2P74A 2IWDA 2WZZA 3V50A 5CX7A 2KX6A 5AVFA 1G68A 2V20A 3C4OA 1XJ3A 1K4EA 3E4PA 4WM9A 1P9WA 3FKVA 1CK3A 1ES3A 2V2FF 4KG6A 4B4XA 4HESA 4LLOB 4DDYA 3JPUA 4WUJA 1KGGA 2K2NA 2PR5A 3OZHA 1PI5A 3SOIA 3IF6C 4MN6A 3VP3A 1DP6A 1IELA 5AQAA 1YPRA 3T12B 2XDMA 3MKFA 4EEUA 4QWOA 3KYEA 4HIAA 1LL8A 4OOLA 4A5RA 1OJGA 3MQOA 4X1MA 3EOIA 1BLPA 4HH3A 5GLAA 3HREA 4ZAMA 2Y2IA 2Y2LA 3TJZC 2GNXA 3LR3A 5DFYA 1NZUA 1ONHA 4G3VA 1JWVA 1QMFA 3O88A 2G2WA 3A3EA 3A3IA 5U47A 3IF6B 1CI9A 4DN0A 3O86A 3UPOA 4H6JA 5DF9A 4E3OA 2O99A 2W27A 5GHXA 4EETB 5HFOA 3CLOA 5KSHA 2O0YA 1GHIA 5IS1A 4B9OA 1K4FA 4NXEA 3QP1A 3OPHA 1ESIA 4IVIA 3DTEA 3CJMA 3OPLA 2V1AA 3LUQA 4OP8A 3A3DA 1HLUP 4UQIS 1Y28A 3V3SA 3UNWA 2PHYA 2XEPA 3ZG9B 1M6KA 4JXGA 3CITA 4GS9B 5HDSA 4P6ZS 5TR7A 5J7EA 1OJ5A 4HI4A 2INWA 4QD4A 2ZQDA 2Y8HA 1W79A 4KZAA 1S1ZA 4U0XA 4O01A 4GW9A 1IEMA 2HGVA 3HLEA 4IBRA 1EI5A 3N6IA 2XLNA 4X6TA 3ISGA 1K56D 1Z6FA 5HDCA 4OOMA 2R9WA 3JYIA 3NHQA 4WZ5C 1KDWA 3OPPA 3H7WB 2FH5A 3LI9A 1YLJA 5A93A 4O0PA 4EUZA 5HWTA 4U3TA 5GLDA 5FAPA 2PBDP 5HD5A 3MBZA 3RTYA 2WAFA 1YMSA 2PDRA 2WKPA 5HW3A 1IYQA 5CEBA 4EWFA 4ME4A 4Y15A 3BFFA 5EM0A 5LBRA 4JXWA 1S6RA 3CPTA 4LCMA 2HDSA 4GDBA 4JLFA 4NXBA 4PKYA 1TVFA 5A8BA 4YNRA 2OAP1 2XGNA 1IYOA 1LSXA 1S0WA 1XFNA 4H8RA 2OWJA 3EGXC 4PM9A 1QMEA 4CPKA 1H8YA 3M6HA 5HWWA 2IWBA 4DE1A 2I72A 3R7WB 4D60A 4QB8A 1VQQA 1F2KA 3HVFA 1S67L 5L10A 4WZ5A 3S7PA 4X55A 3PAGA 3MXQA 2KDKA 4OONA 1CI8A 4R3AA 1OPXA 3LCEA 4GLQA 1MZUA 4HHDA 1PW1A 4KZ8A 1LI0A 2A3UA 3CHWP 2P04A 4IUHA 3BECA 3G35A 5IT5A 4R6LA 3IQAA 1NZOA 4B88A 1JNUA 1UWPX 4E3NA 3BLSA 3B3XA 2JBFA 3GDIA 1J9MA 1STZA 3L9KA 4LGWA 3DWZA 4I3IA 4P85A 4DRTA 2JE5A 1DP8A 4MDZA 5DJTA 1PYYA 1ES4A 1FCNA 3LFVA 3RH8B 4IUKA 4Y17A 4I39A 3D3OA 4DXCA 3CWFA 5EVEA 5MC7A 3F1OA 3BFCA 4JF4A 3HJKA 1D1JA 4RYEA 4GHIA 2WUQA 2VGKA 4HBUA 5G18A 3C38A 1NYYA 5M1AA 4CJNA 1BUEA 3CUEC 3UB6A 4ZDXA 3D72A 1S4RA 4PM8A 3ZNYA 3M6BA 2X01A 4X53A 3N8RA 5DFXA 1G5UA 2QPNA 3T4SA 1L0GA 1IYPA 4MBKA 1TS7A 4KZBA 3W8KA 1OTBA 3BQ8A 3IWIA 3H9WA 3O5YA 2WAEA 4ID4A 2DRWA 3S7QA 3BQAA 3AGEA 3T4KA 4KQQA 3D4FA 5FI7A 4X69A 1T1AA 4EQ1A 3NDGA 1LL5A 3P7NA 1LT0A 4S2NC 4DDSA 2Y2NA 5FQIA 4UQIM 3ZHHA 1DJBA 2GX5A 5I94A 3VOYA 1FSYA 1YMXA 4O7DA 2XF3A 2J9PA 1SZVA 3VSLA 3IXGA 1O07A 5HX9A 3KO6A 4EW7A 1N9NA 3QP8A 1LI9A 1CEFA 1ACFA 2E8IA 3OBFA 3MQQA 2G7UA 1PZOA 3F1PB 5E2FA 4XUXA 4N9LA 1PW8A 3WS2A 3K2NA 1YM1A 1XX2A 1IKIA 2P9VA 5E2GA 4R1GA 4CQHA 2ZM0A 2HDUA 1IOUA 3SS4A 4F3LB 4MMNA 5EVLA 1ERQA 5CGXA 1OTDA 2KOIA 3G31A 3VFFA 3VP4A 3E4QA 3LIDA 4WEKA 1YLYA 2B02A 2HF6A 4UHUA 3T4OA 3D9YA 3OC2A 4MNRA 3PBNA 1K38A 3U4LP 2E8JA 4Y0TA 1LLBA 5HDDA 1JTDA 4P87A 2XD5A 3G2YA 3HLFA 2D02A 3T4LA 3EWKA 3KYZA 2W3HA 4LV1A 5F82A 3MXSA 2HP6A 1ZTUA 1W63Q 3GQZA 5F68A 3A0RA 1HD8A 4DF6A 3FZCA 3G30A 1WYBA 2PR6A 1MC0A 2VX8A 4GZBA 2ZOHA 3BY8A 1H8ZA 5EFWA 2PAVP 3RXXA 2XK1A 3LIFA 2WGWB 5DF7A 2B5RA 2DNSA 3I7JA 4L9GA 4OOYA 3ZG0A 2L4RA 3S22A 3R4KA 3TW8A 3ZG5A 3BJNA 2ZL1A 5HD3A 4LENA 5IU1A 3PAEA 2AVXA 1JWZA 2VGJA 4QPRA 5DTTA 4HBTA 4UA6A 3MQ0A 1VM1A 4PMAA 4OLGA 3IXBA 2ZC7A 2G2UA 1NRFA 1OTEA 1YT4A 5GHYA 4P0MA 1NY0A 2XRNA 1LHYA 3OPRA 1VHMA 1PWDA 3KX0X 4BWIA 4MEZA 4HOIA 1SKFA 4FH4A 2CC1A 4KZ7A 4EESA 4MN5A 3TOIA 4DKIA 2EXAA 5M19A 1ZG6A 4BBVA 4PAUA 3EGDC 5K5BA 1YLWA 3WS5A 2OSUA 2Y2MA 1DJAA 3BLMA 2O9CA 2I9VA 3A3FA 2WKQA 4CLCA 1K57A 4OVDA 3MF0A 4K0WA 2ZD8A 1K54C 2IA2A 4NETA 5HAQA 4Q8IA 1IFQA 3UE6A 1XXMA 3FYZA 3S1YA 5F6AA 2L0WA 1ODVA 2HPBA 3MR0A 3PYPA 4K08A 3PHYA 4E6XA 2OLUA 1VETB 1KVMA 2LB9A 2J7VA 5KSCA 4EBPA 3MS6A 3SS3A 3SH7A 4NXFA 2J80A 5EPHA 1MWSA 3LICA 4ARZB 1EW0A 3QNCA 5FAOA 4HP4A 2D01A 2V8FA 3O87A 1E4DA 1IKGA 4AFIA 4R38A 4OPRA 3DWKA 1T1CA 3LIAA 5FI6A 3V39A 5FASA 1Z09A 3CMZA 3LGOA 1HVBA 1BTLA 4BENA 1F9IA 5BOHA 3TE8A 4IHQA 1KVLA 2C6WB 3P01A 3IF6A 1O7EA 2Y2GA 1ZG4A 4XXRA 2ZQ8A 3Q81A 5CHJA 5FI2A 4JGQA 5J3WA 4Y0UA 4M4XA 5DTSA 1Q2QA 3VP1A 2ZJ9A 3QP4A 1L0DA 3KSIA 1YLZA 3T4QA 4OPZA 3T1SA 1FCOA 4Z9QA 3L7HA 3H82B 2BG1A 4S2IA 4WL9A 3IWOA 3UDIA 1YQSA 4EBLA 3EEAA 3W2ZA 3PXPA 1K25A 1K55C 1PRQA 3VP0A 2ZMVA 2EX2A 4S2JA 4OH0A 1XGIA 1SKOB 2JCHA 5L09A 3T1XA 1GHPA 5EVIC 4GS9A 1DRMA 4EBNA 2EX8A 1DP9A 2XA7S 4UA7A 4FH2A 3DTKA 2FZ0A 2EX6A 4IBXA 3FKWA 4KG5A 1X0OA 4M3KA 1PIOA 1SDEA 2RL3A 3SH9A 3Q7VB 5EV0A 3RFBA 3C5AA 1L2SA 2ZM8A 4DMZA 4ESPA 4HEFA 2W3DA 4Y2FA 3LR5A 5CTMA 3UO9A 1LL9A 1ES5A 3T4JA 2H5SA 4QJGA 3FWLA 4PM5A 4JF6A 5FAQA 2JHEA 5EVIB 3H7WA 3UPPA 2WKRA
chains in the Genus database with same CATH topology
3C38A 1OT9A 3CUEC 3OCNA 3UB6A 3GECA 3ICYA 1TF1A 3D72A 1S4RA 1NWZA 2ZBBA 3B47A 5DJUA 1V9YA 2P7JA 3UB7A 5DFXA 3VE4A 2GZAA 4H6JB 5J4EA 3T4SA 3MMHA 4KQOA 3C8CA 3LR4A 4ARZA 1TS7A 2VV6A 1OTBA 3BQ8A 1LSWA 1W63M 3EEHA 5AJGA 2V0WA 4HJ6A 4II7A 3H9WA 3CAXA 3O5YA 3V67A 1VB6A 4G3KA 4EERA 1YKDA 4ZRRA 3A0VA 3S7QA 3BQAA 3FPWA 1TS6A 3T4KA 2O9AA 2HV1A 3LI8A 4CLCC 3HJIA 2VV8A 4BBUA 4G3WA 1T1AA 4EQ1A 2O9BA 5HZHA 5C5KA 3MJQA 3P7NA 4HY8A 3R7WA 2VGLS 1LT0A 4IJGA 4HJ4A 2XSSA 2ZMFA 4UQIM 2QJ5A 1N9LA 4NXGA 1OTIA 4EUVA 2GX5A 4Y5FA 4LPZA 2OWHA 2J3TD 2K31A 4BMWA 4WEJA 1YSPA 2GJ3A 3KO6A 4EW7A 1N9NA 1F5MA 5F5YA 4NEED 4EEPA 2W0NA 3H82A 2XROA 3OBFA 4NKPA 3MQQA 2G7UA 3JVVA 4CLCB 1T1BA 2VZWA 5DKLA 2VLGA 3NOUC 3F1PB 5CX7A 5FL3A 2KX6A 5AVFA 1XJ3A 1G6OA 3E4PA 3K2NA 4XT2B 4JGRA 2PYRA 2Z6DA 4Z1WA 2VEAA 3OOVA 2R78A 4FOFA 1P9WA 4R70A 5HSQA 2CMNA 3KSHA 1S1YA 4LLOB 2EWVA 4YOFA 4WUJA 4CQHA 2K2NA 1IOUA 1TD5A 4F3LB 4MMNA 4WLAA 2PR5A 3EQVA 4LRZE 1P0ZA 1OTDA 2OAQ1 3DBAA 1BYWA 2KOIA 3T50A 4XT2A 3E4QA 4YWZA 3LIDA 4WEKA 2HJ9C 4HH2A 4MN6A 1GSVA 2B02A 2VA0A 1DP6A 2NUPC 2HF6A 3IBJA 4WN5A 3T4OA 3OC2A 1V9ZA 3PBNA 3S7OA 5L8MA 2JKRI 1NLYA 4EEUA 4HIAA 2OOLA 4PKYG 2QKPA 5HDDA 3SW1A 4HNBA 1LL8A 3PBRA 4OOLA 1OJGA 3MQOA 3EOIA 2K7SA 2D02A 4HH3A 3T4LA 4KUOA 2HJEA 4PHTA 3EWKA 3KYZA 2W3HA 3TJZC 1F98A 2GNXA 4JGPA 4RQ9A 3LR3A 5DFYA 3NOTC 4G3VA 2LB5A 2W1TB 2VJWA 1P97A 2VKSA 1ZTUA 1W63Q 2V1BA 1TS0A 5TJJA 1OT6A 5F68A 3A0RA 4DN0A 4CLCD 3OCLA 2PR6A 1MC0A 2VX8A 2ZOHA 3BY8A 4H6JA 5DF9A 5HPFA 2O99A 2W27A 4EETB 5EFWA 1KOUA 3CLOA 3LIFA 5KSHA 5HWVA 4FSFA 2O0YA 5IS1A 3T4TA 4B9OA 4L9GA 3BW6A 2L4RA 4NXEA 2W3EA 3R4KA 3TW8A 3BJNA 3S7NA 1NLZA 5HD3A 2A24B 2W3GA 3E4OA 1YAXA 5IU1A 2MJ6A 2V1AA 4QPRA 3K3DA 4BBTA 3LUQA 3MQ0A 2M1CA 3JVUA 4P6ZM 2DMWA 3CUEA 2L1MA 1GSWA 4UQIS 1Y28A 3BWLA 4UEYA 1OTEA 2BASA 2PHYA 1H8MA 1D7EA 1G28A 3CITA 2XRNA 4I38A 4DJ2A 2B18A 1VHMA 3CI6A 3KX0X 1XFQA 3F1NB 4GS9B 4L0LA 4P6ZS 5HDSA 2M7VA 4BWIA 4CLCE 4I3JA 5J7EA 3ZQ5A 4HOIA 1H3QA 4Q0IA 3VOLA 1OJ5A 5TBMB 4HI4A 2INWA 3KYQA 4EESA 4MN5A 2Y8HA 3B42A 2Y79A 2A2LA 4Q0HA 2XA7M 1S1ZA 4BBVA 4PAUA 2J3TC 3EGDC 3PBOA 2YKFA 4Q0JA 5K5BA 4O01A 4GW9A 4HP9A 3IS2B 2HGVA 4I5SA 3UMEA 2QHKA 2JN7A 2O9CA 2I9VA 3C2WA 1T18A 2WKQA 4CLCA 3UMDA 2JKRM 1MKMA 3MF0A 1XJ2A 3F1PA 3F1OB 2H28A 2IA2A 2QJ7A 5HDCA 4OOMA 3NHQA 1UWNX 4DJ3A 2J3WA 1IFQA 4LRXC 3UE6A 5AVEA 4GHIB 3PBSA 4EXOA 5I5LA 3H7WB 2FH5A 3BY9A 3LI9A 3PBQA 3FC7A 5F6AA 2L0WA 1ODVA 3MR0A 3PYPA 4K08A 3PHYA 4O0PA 5HWTA 2LB9A 4F3LA 5HD5A 4KQDA 2V9AA 4JGOA 2QYBA 4NXFA 2J80A 3LICA 4ARZB 3LYXA 3RTYA 2PDRA 2WKPA 4HQAA 4LRYC 1EW0A 3UE3A 4I3AA 4ME4A 1S4SA 2VV7A 3G6OA 4HP4A 4MCWA 2D01A 3FG8A 3E98A 5LBRA 4AFIA 4R38A 3UB9A 1T1CA 4ETZA 2JKTI 3LIAA 4WELA 2P08A 1ZHHB 4NXBA 4PKYA 5A8BA 3VE3A 3LIBA 4YNRA 2OAP1 3KSGA 1OTAA 1LSXA 1XFNA 2OWJA 4HJ3A 3EGXC 3ULFA 5HWWA 1F9IA 5KIZA 2PD8A 3HCYA 2Z6CA 2KLIA 3TE8A 4IHQA 3R7WB 3E0YA 1WA9A 3K3CA 5G4YA 2W1TA 5HL6A 3TRCA 1S67L 1T19A 3OLOA 3P01A 2ZOIA 2QWSA 3PBTA 4O8GA 3IBRA 5G4ZA 2VGLM 3S7PA 2EWWA 3EQUA 4JGQA 3MXQA 5J3WA 2KDKA 4M4XA 1XJ4A 4R3AA 1OPXA 2PYPA 4L9FA 1N9OA 3KSIA 4GLQA 2YKHA 3T4QA 1MZUA 1S66L 4E04A 2NUTC 5DKKA 4HHDA 3H82B 1D06A 4WL9A 3MFXA 4GJ4A 2A24A 3EEAA 3FPVA 3W2ZA 3PXPA 2P04A 5HPIA 4IUHA 4MN7A 2W3FA 2V0UA 4WF0A 5IT5A 3LIEA 3C30A 4R6LA 1YSQA 3B33A 3NJAA 2ZMVA 1UGUA 2PD7A 1GSXA 1JNUA 1UWPX 5F69A 3A0SA 4GS9A 1DRMA 3F1NA 1TS8A 1DP9A 2XA7S 3GDIA 3PR6A 2FZ0A 1STZA 5TBMA 1XJ6A 4Y3IA 3ZYTA 3NOPC 2M7UA 4KUKA 2EA9A 2W1RA 1X0OA 4I3IA 4EU0A 1DP8A 4MDZA 3VV4A 5DJTA 3IS2A 3RFBA 1LSVA 4DMZA 3LFVA 3U2AA 3RH8B 4L9EA 2PT7A 4IUKA 2W3DA 1NRJA 4I39A 4Y2FA 3D3OA 3LR5A 3CWFA 4BJPA 3F1OA 5MC7A 3KSFA 3T4JA 3UB8A 2JKTM 3HJKA 2JHEA 4GHIA 1P9RA 3H7WA 4B93A 4GCZA 3LR0A 4ETXA 2WKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT9 A;  3UB6 A;  3GEC A;  3ICY A;  3D72 A;  1S4R A;  1NWZ A;  2ZBB A;  5DJU A;  1V9Y A;  2P7J A;  3UB7 A;  3VE4 A;  4H6J B;  5J4E A;  3C8C A;  1TS7 A;  2VV6 A;  1OTB A;  1LSW A;  3EEH A;  2V0W A;  4HJ6 A;  3H9W A;  3CAX A;  1VB6 A;  4EER A;  3A0V A;  1TS6 A;  2HV1 A;  3LI8 A;  3HJI A;  2VV8 A;  4BBU A;  1T1A A;  4EQ1 A;  5HZH A;  3MJQ A;  3P7N A;  4HY8 A;  1LT0 A;  4HJ4 A;  2QJ5 A;  1N9L A;  4NXG A;  1OTI A;  4LPZ A;  2OWH A;  2GJ3 A;  4EW7 A;  1N9N A;  4EEP A;  5F5Y A;  2W0N A;  3H82 A;  3MQQ A;  1T1B A;  5DKL A;  2VLG A;  3NOU C;  3F1P B;  2KX6 A;  5AVF A;  1XJ3 A;  3E4P A;  4XT2 B;  4JGR A;  2PYR A;  2Z6D A;  2VEA A;  2R78 A;  4R70 A;  5HSQ A;  2CMN A;  1S1Y A;  4LLO B;  4WUJ A;  4F3L B;  4WLA A;  2PR5 A;  4LRZ E;  1P0Z A;  1OTD A;  1BYW A;  3T50 A;  4XT2 A;  3E4Q A;  4YWZ A;  3LID A;  4HH2 A;  4MN6 A;  1GSV A;  2B02 A;  1DP6 A;  4WN5 A;  1V9Z A;  4EEU A;  4HIA A;  2OOL A;  4PKY G;  2QKP A;  5HDD A;  3SW1 A;  4HNB A;  1LL8 A;  1OJG A;  3MQO A;  2K7S A;  2D02 A;  4HH3 A;  4KUO A;  3EWK A;  1F98 A;  4JGP A;  4RQ9 A;  3NOT C;  1P97 A;  2V1B A;  1TS0 A;  1OT6 A;  5F68 A;  3A0R A;  2PR6 A;  2ZOH A;  3BY8 A;  4H6J A;  2W27 A;  4EET B;  5EFW A;  1KOU A;  3CLO A;  3LIF A;  5HWV A;  5IS1 A;  4B9O A;  4L9G A;  2L4R A;  4NXE A;  5HD3 A;  2A24 B;  3E4O A;  5IU1 A;  2V1A A;  3K3D A;  4BBT A;  3LUQ A;  2M1C A;  2L1M A;  1GSW A;  1Y28 A;  3BWL A;  1OTE A;  2BAS A;  2PHY A;  1D7E A;  1G28 A;  4I38 A;  4DJ2 A;  4GS9 B;  5HDS A;  3F1N B;  1XFQ A;  3KX0 X;  4I3J A;  5J7E A;  3ZQ5 A;  4HOI A;  3VOL A;  1OJ5 A;  5TBM B;  4HI4 A;  2INW A;  4EES A;  4MN5 A;  1S1Z A;  4BBV A;  2YKF A;  4GW9 A;  4HP9 A;  3IS2 B;  4I5S A;  3UME A;  2QHK A;  2JN7 A;  2I9V A;  3C2W A;  1T18 A;  2WKQ A;  3UMD A;  1XJ2 A;  3F1P A;  3F1O B;  2H28 A;  2QJ7 A;  5HDC A;  3NHQ A;  1UWN X;  4DJ3 A;  4LRX C;  3UE6 A;  5AVE A;  4GHI B;  4EXO A;  5I5L A;  3H7W B;  3BY9 A;  3LI9 A;  3FC7 A;  5F6A A;  2L0W A;  1ODV A;  3MR0 A;  3PYP A;  4K08 A;  3PHY A;  5HWT A;  4F3L A;  5HD5 A;  4KQD A;  2V9A A;  4JGO A;  4NXF A;  2J80 A;  3LIC A;  3LYX A;  3RTY A;  2PDR A;  2WKP A;  4HQA A;  4LRY C;  1EW0 A;  4I3A A;  1S4S A;  2VV7 A;  3G6O A;  4HP4 A;  2D01 A;  3FG8 A;  4R38 A;  3UB9 A;  1T1C A;  3LIA A;  4NXB A;  4PKY A;  5A8B A;  3VE3 A;  3LIB A;  1OTA A;  1LSX A;  1XFN A;  2OWJ A;  4HJ3 A;  3ULF A;  5HWW A;  1F9I A;  5KIZ A;  2PD8 A;  2Z6C A;  1WA9 A;  3K3C A;  5G4Y A;  1S67 L;  1T19 A;  3OLO A;  2ZOI A;  2QWS A;  3IBR A;  5G4Z A;  4JGQ A;  3MXQ A;  5J3W A;  2KDK A;  4M4X A;  1XJ4 A;  4R3A A;  2PYP A;  4L9F A;  1N9O A;  2YKH A;  1MZU A;  1S66 L;  4E04 A;  5DKK A;  4HHD A;  3H82 B;  1D06 A;  4WL9 A;  3MFX A;  2A24 A;  2V0U A;  4WF0 A;  3LIE A;  4R6L A;  3B33 A;  3NJA A;  1UGU A;  2PD7 A;  1GSX A;  1JNU A;  1UWP X;  5F69 A;  3A0S A;  4GS9 A;  1DRM A;  3F1N A;  1TS8 A;  1DP9 A;  3GDI A;  5TBM A;  1XJ6 A;  3NOP C;  4KUK A;  2EA9 A;  1X0O A;  4I3I A;  1DP8 A;  5DJT A;  3IS2 A;  1LSV A;  3RH8 B;  4L9E A;  4I39 A;  3CWF A;  3F1O A;  3UB8 A;  3HJK A;  2JHE A;  4GHI A;  3H7W A;  4GCZ A;  2WKR A; 
#chains in the Genus database with same CATH topology
 2VK3 A;  1TDG A;  3ICY A;  3P98 A;  4E6W A;  3N8S A;  3N7W A;  2Y2K A;  4GD8 A;  1I5Q A;  5A92 A;  3VE4 A;  1BLS A;  4F94 A;  4KQO A;  4D2O A;  3LR4 A;  1WE4 A;  5CED A;  1W8Q A;  2PU4 A;  2H10 A;  3V67 A;  5F83 A;  4OPQ A;  4OP5 A;  4EER A;  5E2E A;  3TSG A;  1BLC A;  1CEG A;  2H0Y A;  1TS6 A;  2O9A A;  3UB5 P;  1FIL A;  4BBU A;  4K91 A;  1VEU B;  5C5K A;  2EFX A;  4S2M A;  3R7W A;  2VGL S;  4LFU A;  3W4O A;  2UV0 E;  1N9L A;  4EUV A;  1OTI A;  4GN2 A;  4JKT A;  3N4I A;  3BFD A;  3ZG7 B;  1FQG A;  2EFU A;  4R3B A;  3IXD A;  3HBR A;  4KZ5 A;  1MY8 A;  2GJ3 A;  1F5M A;  5F5Y A;  3ZG8 B;  4EEP A;  4N92 A;  5AQB A;  4GD6 A;  3HUM A;  4NKP A;  2VZW A;  5DKL A;  5GHZ A;  3NOU C;  3WWX A;  5FL3 A;  4JGR A;  1BLH A;  2PYR A;  1MWT A;  2Z6D A;  4Z1W A;  3G32 A;  2ZQC A;  4S2L A;  2VEA A;  5KZH A;  2OLV A;  2R78 A;  4FOF A;  4R70 A;  2CMN A;  3KSH A;  5FQM A;  1GCE A;  4YOF A;  3ITB A;  4Y7P A;  3IHA A;  1TD5 A;  3E2K A;  4WLA A;  4GB7 A;  3G4P A;  1XGJ A;  4LRZ E;  1NXY A;  1P0Z A;  1BYW A;  5FEG A;  3T50 A;  4MBH A;  3G2Z A;  1WYC A;  2HJ9 C;  4OPY A;  5AQ9 A;  2HDR A;  2VA0 A;  3GV9 A;  2Y55 A;  3IBJ A;  3S7O A;  5FA7 A;  1NLY A;  3AGD A;  2X71 A;  1PWG A;  2OOL A;  3SW1 A;  1XP4 A;  4HNB A;  4KUO A;  2HJE A;  1RGZ A;  4PHT A;  1H5X A;  3GMW A;  1F98 A;  3C7V A;  3NCK A;  3NOT C;  2LB5 A;  2W1T B;  3UDF A;  2VJW A;  1P97 A;  1TS0 A;  1OT6 A;  5EOE A;  3DTI A;  1IYS A;  3WRZ A;  3ZVT A;  4CLC D;  3O3V A;  3OCL A;  4S2O A;  3HLG A;  3UY6 A;  5CEC A;  4LV2 A;  5EUA A;  4FTX A;  1KOU A;  5HWV A;  3T4T A;  1AXB A;  4U0T A;  4XUZ A;  2W3E A;  1A0K A;  1NLZ A;  4E3J A;  2A24 B;  4EV4 A;  2A49 A;  1K56 A;  1L0E A;  1XKZ A;  3QNB A;  4K0X A;  4P6Z M;  2DMW A;  2Z2L B;  3CG5 A;  2L1M A;  3CUE A;  5CER A;  1PFL A;  2BAS A;  1H8M A;  1FR1 A;  4GOG A;  3IXH A;  1G28 A;  2WGI A;  4X1L A;  4I38 A;  2PBY A;  2B18 A;  4DJ2 A;  3CI6 A;  3F1N B;  1XFQ A;  4L0L A;  3IF5 A;  4I3J A;  4Q0I A;  3VP2 A;  5TBM B;  4WMC A;  3B42 A;  4WZ4 A;  2Y2J A;  4QY5 A;  3G34 A;  2XA7 M;  3PBO A;  4Q0J A;  2YKF A;  2ZC3 B;  4EQI A;  4HP9 A;  3IS2 B;  4OLD A;  5IHV A;  3UME A;  1E25 A;  1T18 A;  3GR2 A;  1ZC2 A;  4OQH A;  5EM1 A;  2JKR M;  1XJ2 A;  2ZC5 B;  3F1P A;  2H28 A;  4X56 A;  2QJ7 A;  1EWZ A;  4LRX C;  4S2N A;  5I5L A;  3LY4 A;  3BY9 A;  5CRF A;  4MBF A;  1MPL A;  3ITA A;  3VOZ A;  3BFG A;  5E43 A;  4F3L A;  4KQD A;  2V9A A;  3GVB A;  4JF5 A;  4JGO A;  5TFQ A;  3HLC A;  1SDN A;  3LYX A;  2JKF A;  4HQA A;  2J8Y A;  3UE3 A;  4I3A A;  2VV7 A;  1MWU A;  3G6O A;  2XFS A;  1U60 A;  4WYY A;  3FG8 A;  4ETZ A;  1BT5 A;  3LIB A;  5TGF A;  1OTA A;  3HUN A;  1N9B A;  4LV3 A;  3T1R A;  5KIZ A;  2PD8 A;  2Z6C A;  3QP2 A;  2KLI A;  1DY6 A;  4RA7 A;  5DF8 A;  4R4S A;  3E0Y A;  1WA9 A;  2QMI A;  3K3C A;  3V3R A;  5HL6 A;  1T19 A;  4DXB A;  3LO7 A;  3PBT A;  1ERM A;  3IBR A;  2VGL M;  3Q82 A;  4Y13 A;  1YLT A;  4YIN A;  1NJ4 A;  1XJ4 A;  4P6B A;  2WGW A;  2JKG A;  1N9O A;  1S66 L;  2WKE A;  4KG2 A;  2NUT C;  5DKK A;  3NEC A;  3MFX A;  4GJ4 A;  5HPI A;  2W3F A;  5FQJ A;  1CF0 A;  4DE0 A;  4WF0 A;  5AQ7 A;  1K6R A;  3MFD A;  3NUL A;  1YSQ A;  5CGW A;  3B33 A;  3BFE A;  5EOO A;  1AWI A;  1UGU A;  2PD7 A;  1GSX A;  5F69 A;  3A0S A;  3IHB A;  3HLB A;  2ZC6 B;  4NG2 A;  1XA7 A;  2HP5 A;  3NOP C;  4KUK A;  2EA9 A;  2W1R A;  1GHM A;  2BTF P;  3M2K A;  4EU0 A;  1DJC A;  3VV4 A;  2JC7 A;  3IWQ A;  1LSV A;  3HLW A;  3U2A A;  4L9E A;  1NRJ A;  1BSG A;  4KEN B;  1SCW A;  3KSF A;  2GDN A;  2JKT M;  2Y2H A;  1P9R A;  3ZDJ A;  5FDH A;  4B4Z A;  4GCZ A;  4GKU A;  4ETX A;  2Y59 A;  3W4P A;  1OT9 A;  1VET A;  3GEC A;  1JTG A;  2QZ6 A;  1NWZ A;  2ZBB A;  2WGV A;  5DJU A;  4BL2 A;  2J9O A;  1V9Y A;  5FQK A;  3BRM A;  3UB7 A;  1KE3 A;  1W5D A;  2GZA A;  4H6J B;  3A3J A;  3MMH A;  2ZQ9 A;  4ARZ A;  3IX8 A;  2XFT A;  1LSW A;  2DCF A;  1W63 M;  2WZX A;  3SZT A;  1K54 A;  3MZD A;  2HP9 A;  4JBF A;  3FPW A;  1ONG A;  3TG9 A;  1JVJ A;  2ZMA A;  3HUO A;  3MXR A;  3LI8 A;  5CGS A;  3HJI A;  4OQI A;  2VV8 A;  4G3W A;  4RX3 A;  2O9B A;  1N4O A;  5A91 A;  4ZJ3 A;  4HY8 A;  4MLL A;  3ZNT A;  1NYM A;  4IJG A;  4BQM A;  2XSS A;  2QJ5 A;  4NXG A;  3WS1 A;  2Z2M B;  2V1Z A;  1Q2P A;  3ZCZ A;  2ACG A;  4JXV A;  2OWH A;  1ALQ A;  2J3T D;  3E2L A;  2K31 A;  4WEJ A;  1YSP A;  1FR6 A;  4E3I A;  5F1G A;  2XH9 A;  5HAR A;  2W0N A;  4DE2 A;  1HZO A;  3H82 A;  1G6A A;  2XRO A;  1T1B A;  2VLG A;  1GA9 A;  1JWP A;  4LCL A;  1L3L A;  2RCX A;  3WS4 A;  3NC8 A;  3MZF A;  3VMA A;  1Y4O A;  1G6O A;  4XT2 B;  3WS0 A;  3GTC A;  3SH8 A;  3OOV A;  3C7U A;  3C4P A;  5HSQ A;  1RP5 A;  4IED A;  4KZ9 A;  5CXW A;  1S1Y A;  2H0T A;  2EWV A;  3Q1F A;  4X25 A;  2XQZ A;  1E3U A;  3GSG A;  1SKO A;  3EQV A;  2EXB A;  2OAQ 1;  3DBA A;  3FV7 A;  3ZFZ A;  4ZJ1 A;  5CTN A;  4XT2 A;  4YWZ A;  2ZQ7 A;  4HH2 A;  1GSV A;  4GDN A;  2NUP C;  1SHV A;  3NBL A;  5A90 A;  2Y2Q A;  4GNU A;  3W4Q A;  4WN5 A;  2Y4A A;  3IH9 A;  3Q7V A;  1V9Z A;  1KE4 A;  3T1Q B;  5L8M A;  4N1H A;  2JKR I;  3S4X A;  3IT9 A;  3CPT B;  2ZM2 A;  2C5W B;  4PKY G;  2QKP A;  1K55 A;  3PBR A;  4R3J A;  4WMC D;  2K7S A;  1PNE A;  5KMW A;  2FFF B;  5L07 A;  4UAA A;  1MWR A;  5EVI A;  5HAI A;  5F1F A;  4JGP A;  4C6Y A;  4RQ9 A;  1PWC A;  3QP5 A;  2VKS A;  2V1B A;  5DTK A;  5TJJ A;  1KDS A;  4NK3 A;  5HL1 A;  4LV0 A;  4OQG A;  3PTE A;  5HPF A;  1I2S A;  5DVA A;  5FQ9 A;  4FSF A;  2X02 A;  2OV5 A;  3BW6 A;  3BEB A;  5D3O A;  1XPB A;  1CQA A;  4PM7 A;  1MBL A;  3GRJ A;  3S7N A;  2Y2P A;  2W3G A;  3E4O A;  4RX2 A;  1YAX A;  5FAT A;  2MJ6 A;  3K3D A;  4E3L A;  4BBT A;  2M1C A;  2PRF A;  3JVU A;  1GSW A;  1OME A;  3QHY A;  1I2W A;  3BWL A;  1VEU A;  4UEY A;  3AGF A;  1D7E A;  3UE0 A;  5JYO A;  1TDL A;  4CLC E;  2M7V A;  3ZQ5 A;  3MSH A;  1H3Q A;  5GL9 A;  3VOL A;  3V5M A;  4N9K A;  3KYQ A;  4QU3 A;  2Y79 A;  4FD8 A;  2A2L A;  4ZTK A;  4Q0H A;  2J3T C;  2PU2 A;  4I5S A;  1CJF A;  2QHK A;  1YLP A;  2BLS A;  2JN7 A;  3C2W A;  2Q0O A;  1FIK A;  3UMD A;  1MKM A;  3F1O B;  1M40 A;  1KE0 A;  1UWN X;  1KGF A;  4DJ3 A;  1MXO A;  2J3W A;  5AVE A;  4GHI B;  3PBS A;  1FCM A;  4EXO A;  4E3M A;  3PBQ A;  3FC7 A;  4S2P A;  1MKI A;  4R4R A;  3IX4 A;  3UDX A;  2V8C A;  3LEQ A;  4OQ0 A;  2Q9M A;  2QYB A;  4WBG A;  4DE3 A;  5M18 A;  4LRY C;  3LY3 A;  1S4S A;  2WK0 A;  4MCW A;  3E98 A;  2WKH A;  3ZGA B;  4KQR A;  3UB9 A;  5HAP A;  4S2K A;  3DW0 A;  2JKT I;  4WEL A;  4ZJ2 A;  2P08 A;  1ZHH B;  3M2J A;  4R23 A;  1RCJ A;  3VE3 A;  4X68 A;  3KSG A;  2HDQ A;  4HJ3 A;  3ULF A;  1W8Y A;  3QP6 A;  4JXS A;  3ZVW A;  3HCY A;  1TEM A;  2WAD A;  3MKE A;  1L0F A;  1BUL A;  5EE8 A;  5G4Y A;  2W1T A;  3TRC A;  3OLO A;  4UA9 A;  3UPN A;  3BM6 A;  2ZOI A;  2QWS A;  4O8G A;  5G4Z A;  4BL3 A;  1PZP A;  2EX9 A;  2EWW A;  2WKI A;  3EQU A;  3VFH A;  3RJU A;  2PYP A;  3WRT A;  4L9F A;  2YKH A;  4E04 A;  1D06 A;  3DTM A;  4FUW A;  4KZ3 A;  5JYP A;  2IWC A;  2A24 A;  2Y2O A;  3FPV A;  4MN7 A;  5FSR A;  1K6S A;  2V0U A;  3NIA A;  4JPM A;  2Q9N A;  3LIE A;  3C30 A;  3IX3 A;  4KZ4 A;  2P9V B;  3NJA A;  4C3Q A;  3MZE A;  3HL9 A;  4PPR A;  3F1N A;  1TS8 A;  3LEZ A;  3P09 A;  3PR6 A;  5TBM A;  1XJ6 A;  4Y3I A;  3ZYT A;  3SS5 A;  2M7U A;  1BZA A;  3NI9 A;  2ZQA A;  1FSW A;  5FDS A;  3IS2 A;  1Y54 A;  5EEC A;  1PI4 A;  3NY4 A;  2R9X A;  2PT7 A;  2ZC4 B;  1C3B A;  4BJP A;  3UB8 A;  4IVK A;  5CHU A;  4BD0 A;  5CHM A;  4E3K A;  4RVA A;  2WYX A;  3UE1 A;  4B93 A;  4QY6 A;  3RXW A;  3LR0 A;  5L2F A;  3OCN A;  4QHC A;  4BLM A;  1TF1 A;  1ES2 A;  3DAV A;  3B47 A;  4BD1 A;  2P7J A;  5J4E A;  4OKP A;  3C8C A;  4PM6 A;  2VV6 A;  3IH8 A;  3EEH A;  4FCF A;  1H0M A;  5AJG A;  2V0W A;  4HJ6 A;  4II7 A;  3UN7 A;  4C75 A;  2ZL1 B;  3CAX A;  1E3U D;  5E2H A;  1VB6 A;  1ZKJ A;  3VSK A;  4G3K A;  5J8X A;  1YKD A;  4ZRR A;  5FEF A;  5GLB A;  4YFM A;  3A0V A;  3CZD A;  3BYD A;  3NDE A;  2HV1 A;  2UWX A;  2HZ5 A;  2XR0 A;  4CLC C;  1K57 C;  2B95 A;  4KZ6 A;  5HZH A;  3N8L A;  2FFY A;  3MJQ A;  4N1X A;  1K0K A;  5FQQ A;  1RGY A;  4HJ4 A;  4Y0O A;  2XD1 A;  2ZMF A;  1J3W A;  1GA0 A;  4Y5F A;  1ERO A;  4LPZ A;  1W7F A;  3HLD A;  1XA1 A;  1FOF A;  4BMW A;  2Y91 A;  5EVI D;  3Q7Z A;  5GLC A;  2ZLY A;  1ESU A;  1KGE A;  4NEE D;  4R0Q A;  3Q07 A;  4ZBE A;  1HTZ A;  3JVV A;  4CLC B;  2P74 A;  2IWD A;  2WZZ A;  3V50 A;  5CX7 A;  2KX6 A;  5AVF A;  1G68 A;  2V20 A;  3C4O A;  1XJ3 A;  1K4E A;  3E4P A;  4WM9 A;  1P9W A;  3FKV A;  1CK3 A;  1ES3 A;  2V2F F;  4KG6 A;  4B4X A;  4HES A;  4LLO B;  4DDY A;  3JPU A;  4WUJ A;  1KGG A;  2K2N A;  2PR5 A;  3OZH A;  1PI5 A;  3SOI A;  3IF6 C;  4MN6 A;  3VP3 A;  1DP6 A;  1IEL A;  5AQA A;  1YPR A;  3T12 B;  2XDM A;  3MKF A;  4EEU A;  4QWO A;  3KYE A;  4HIA A;  1LL8 A;  4OOL A;  4A5R A;  1OJG A;  3MQO A;  4X1M A;  3EOI A;  1BLP A;  4HH3 A;  5GLA A;  3HRE A;  4ZAM A;  2Y2I A;  2Y2L A;  3TJZ C;  2GNX A;  3LR3 A;  5DFY A;  1NZU A;  1ONH A;  4G3V A;  1JWV A;  1QMF A;  3O88 A;  2G2W A;  3A3E A;  3A3I A;  5U47 A;  3IF6 B;  1CI9 A;  4DN0 A;  3O86 A;  3UPO A;  4H6J A;  5DF9 A;  4E3O A;  2O99 A;  2W27 A;  5GHX A;  4EET B;  5HFO A;  3CLO A;  5KSH A;  2O0Y A;  1GHI A;  5IS1 A;  4B9O A;  1K4F A;  4NXE A;  3QP1 A;  3OPH A;  1ESI A;  4IVI A;  3DTE A;  3CJM A;  3OPL A;  2V1A A;  3LUQ A;  4OP8 A;  3A3D A;  1HLU P;  4UQI S;  1Y28 A;  3V3S A;  3UNW A;  2PHY A;  2XEP A;  3ZG9 B;  1M6K A;  4JXG A;  3CIT A;  4GS9 B;  5HDS A;  4P6Z S;  5TR7 A;  5J7E A;  1OJ5 A;  4HI4 A;  2INW A;  4QD4 A;  2ZQD A;  2Y8H A;  1W79 A;  4KZA A;  1S1Z A;  4U0X A;  4O01 A;  4GW9 A;  1IEM A;  2HGV A;  3HLE A;  4IBR A;  1EI5 A;  3N6I A;  2XLN A;  4X6T A;  3ISG A;  1K56 D;  1Z6F A;  5HDC A;  4OOM A;  2R9W A;  3JYI A;  3NHQ A;  4WZ5 C;  1KDW A;  3OPP A;  3H7W B;  2FH5 A;  3LI9 A;  1YLJ A;  5A93 A;  4O0P A;  4EUZ A;  5HWT A;  4U3T A;  5GLD A;  5FAP A;  2PBD P;  5HD5 A;  3MBZ A;  3RTY A;  2WAF A;  1YMS A;  2PDR A;  2WKP A;  5HW3 A;  1IYQ A;  5CEB A;  4EWF A;  4ME4 A;  4Y15 A;  3BFF A;  5EM0 A;  5LBR A;  4JXW A;  1S6R A;  3CPT A;  4LCM A;  2HDS A;  4GDB A;  4JLF A;  4NXB A;  4PKY A;  1TVF A;  5A8B A;  4YNR A;  2OAP 1;  2XGN A;  1IYO A;  1LSX A;  1S0W A;  1XFN A;  4H8R A;  2OWJ A;  3EGX C;  4PM9 A;  1QME A;  4CPK A;  1H8Y A;  3M6H A;  5HWW A;  2IWB A;  4DE1 A;  2I72 A;  3R7W B;  4D60 A;  4QB8 A;  1VQQ A;  1F2K A;  3HVF A;  1S67 L;  5L10 A;  4WZ5 A;  3S7P A;  4X55 A;  3PAG A;  3MXQ A;  2KDK A;  4OON A;  1CI8 A;  4R3A A;  1OPX A;  3LCE A;  4GLQ A;  1MZU A;  4HHD A;  1PW1 A;  4KZ8 A;  1LI0 A;  2A3U A;  3CHW P;  2P04 A;  4IUH A;  3BEC A;  3G35 A;  5IT5 A;  4R6L A;  3IQA A;  1NZO A;  4B88 A;  1JNU A;  1UWP X;  4E3N A;  3BLS A;  3B3X A;  2JBF A;  3GDI A;  1J9M A;  1STZ A;  3L9K A;  4LGW A;  3DWZ A;  4I3I A;  4P85 A;  4DRT A;  2JE5 A;  1DP8 A;  4MDZ A;  5DJT A;  1PYY A;  1ES4 A;  1FCN A;  3LFV A;  3RH8 B;  4IUK A;  4Y17 A;  4I39 A;  3D3O A;  4DXC A;  3CWF A;  5EVE A;  5MC7 A;  3F1O A;  3BFC A;  4JF4 A;  3HJK A;  1D1J A;  4RYE A;  4GHI A;  2WUQ A;  2VGK A;  4HBU A;  5G18 A;  3C38 A;  1NYY A;  5M1A A;  4CJN A;  1BUE A;  3CUE C;  3UB6 A;  4ZDX A;  3D72 A;  1S4R A;  4PM8 A;  3ZNY A;  3M6B A;  2X01 A;  4X53 A;  3N8R A;  5DFX A;  1G5U A;  2QPN A;  3T4S A;  1L0G A;  1IYP A;  4MBK A;  1TS7 A;  4KZB A;  3W8K A;  1OTB A;  3BQ8 A;  3IWI A;  3H9W A;  3O5Y A;  2WAE A;  4ID4 A;  2DRW A;  3S7Q A;  3BQA A;  3AGE A;  3T4K A;  4KQQ A;  3D4F A;  5FI7 A;  4X69 A;  1T1A A;  4EQ1 A;  3NDG A;  1LL5 A;  3P7N A;  1LT0 A;  4S2N C;  4DDS A;  2Y2N A;  5FQI A;  4UQI M;  3ZHH A;  1DJB A;  2GX5 A;  5I94 A;  3VOY A;  1FSY A;  1YMX A;  4O7D A;  2XF3 A;  2J9P A;  1SZV A;  3VSL A;  3IXG A;  1O07 A;  5HX9 A;  3KO6 A;  4EW7 A;  1N9N A;  3QP8 A;  1LI9 A;  1CEF A;  1ACF A;  2E8I A;  3OBF A;  3MQQ A;  2G7U A;  1PZO A;  3F1P B;  5E2F A;  4XUX A;  4N9L A;  1PW8 A;  3WS2 A;  3K2N A;  1YM1 A;  1XX2 A;  1IKI A;  2P9V A;  5E2G A;  4R1G A;  4CQH A;  2ZM0 A;  2HDU A;  1IOU A;  3SS4 A;  4F3L B;  4MMN A;  5EVL A;  1ERQ A;  5CGX A;  1OTD A;  2KOI A;  3G31 A;  3VFF A;  3VP4 A;  3E4Q A;  3LID A;  4WEK A;  1YLY A;  2B02 A;  2HF6 A;  4UHU A;  3T4O A;  3D9Y A;  3OC2 A;  4MNR A;  3PBN A;  1K38 A;  3U4L P;  2E8J A;  4Y0T A;  1LLB A;  5HDD A;  1JTD A;  4P87 A;  2XD5 A;  3G2Y A;  3HLF A;  2D02 A;  3T4L A;  3EWK A;  3KYZ A;  2W3H A;  4LV1 A;  5F82 A;  3MXS A;  2HP6 A;  1ZTU A;  1W63 Q;  3GQZ A;  5F68 A;  3A0R A;  1HD8 A;  4DF6 A;  3FZC A;  3G30 A;  1WYB A;  2PR6 A;  1MC0 A;  2VX8 A;  4GZB A;  2ZOH A;  3BY8 A;  1H8Z A;  5EFW A;  2PAV P;  3RXX A;  2XK1 A;  3LIF A;  2WGW B;  5DF7 A;  2B5R A;  2DNS A;  3I7J A;  4L9G A;  4OOY A;  3ZG0 A;  2L4R A;  3S22 A;  3R4K A;  3TW8 A;  3ZG5 A;  3BJN A;  2ZL1 A;  5HD3 A;  4LEN A;  5IU1 A;  3PAE A;  2AVX A;  1JWZ A;  2VGJ A;  4QPR A;  5DTT A;  4HBT A;  4UA6 A;  3MQ0 A;  1VM1 A;  4PMA A;  4OLG A;  3IXB A;  2ZC7 A;  2G2U A;  1NRF A;  1OTE A;  1YT4 A;  5GHY A;  4P0M A;  1NY0 A;  2XRN A;  1LHY A;  3OPR A;  1VHM A;  1PWD A;  3KX0 X;  4BWI A;  4MEZ A;  4HOI A;  1SKF A;  4FH4 A;  2CC1 A;  4KZ7 A;  4EES A;  4MN5 A;  3TOI A;  4DKI A;  2EXA A;  5M19 A;  1ZG6 A;  4BBV A;  4PAU A;  3EGD C;  5K5B A;  1YLW A;  3WS5 A;  2OSU A;  2Y2M A;  1DJA A;  3BLM A;  2O9C A;  2I9V A;  3A3F A;  2WKQ A;  4CLC A;  1K57 A;  4OVD A;  3MF0 A;  4K0W A;  2ZD8 A;  1K54 C;  2IA2 A;  4NET A;  5HAQ A;  4Q8I A;  1IFQ A;  3UE6 A;  1XXM A;  3FYZ A;  3S1Y A;  5F6A A;  2L0W A;  1ODV A;  2HPB A;  3MR0 A;  3PYP A;  4K08 A;  3PHY A;  4E6X A;  2OLU A;  1VET B;  1KVM A;  2LB9 A;  2J7V A;  5KSC A;  4EBP A;  3MS6 A;  3SS3 A;  3SH7 A;  4NXF A;  2J80 A;  5EPH A;  1MWS A;  3LIC A;  4ARZ B;  1EW0 A;  3QNC A;  5FAO A;  4HP4 A;  2D01 A;  2V8F A;  3O87 A;  1E4D A;  1IKG A;  4AFI A;  4R38 A;  4OPR A;  3DWK A;  1T1C A;  3LIA A;  5FI6 A;  3V39 A;  5FAS A;  1Z09 A;  3CMZ A;  3LGO A;  1HVB A;  1BTL A;  4BEN A;  1F9I A;  5BOH A;  3TE8 A;  4IHQ A;  1KVL A;  2C6W B;  3P01 A;  3IF6 A;  1O7E A;  2Y2G A;  1ZG4 A;  4XXR A;  2ZQ8 A;  3Q81 A;  5CHJ A;  5FI2 A;  4JGQ A;  5J3W A;  4Y0U A;  4M4X A;  5DTS A;  1Q2Q A;  3VP1 A;  2ZJ9 A;  3QP4 A;  1L0D A;  3KSI A;  1YLZ A;  3T4Q A;  4OPZ A;  3T1S A;  1FCO A;  4Z9Q A;  3L7H A;  3H82 B;  2BG1 A;  4S2I A;  4WL9 A;  3IWO A;  3UDI A;  1YQS A;  4EBL A;  3EEA A;  3W2Z A;  3PXP A;  1K25 A;  1K55 C;  1PRQ A;  3VP0 A;  2ZMV A;  2EX2 A;  4S2J A;  4OH0 A;  1XGI A;  1SKO B;  2JCH A;  5L09 A;  3T1X A;  1GHP A;  5EVI C;  4GS9 A;  1DRM A;  4EBN A;  2EX8 A;  1DP9 A;  2XA7 S;  4UA7 A;  4FH2 A;  3DTK A;  2FZ0 A;  2EX6 A;  4IBX A;  3FKW A;  4KG5 A;  1X0O A;  4M3K A;  1PIO A;  1SDE A;  2RL3 A;  3SH9 A;  3Q7V B;  5EV0 A;  3RFB A;  3C5A A;  1L2S A;  2ZM8 A;  4DMZ A;  4ESP A;  4HEF A;  2W3D A;  4Y2F A;  3LR5 A;  5CTM A;  3UO9 A;  1LL9 A;  1ES5 A;  3T4J A;  2H5S A;  4QJG A;  3FWL A;  4PM5 A;  4JF6 A;  5FAQ A;  2JHE A;  5EVI B;  3H7W A;  3UPP A;  2WKR A; 
#chains in the Genus database with same CATH homology
 3C38 A;  1OT9 A;  3CUE C;  3OCN A;  3UB6 A;  3GEC A;  3ICY A;  1TF1 A;  3D72 A;  1S4R A;  1NWZ A;  2ZBB A;  3B47 A;  5DJU A;  1V9Y A;  2P7J A;  3UB7 A;  5DFX A;  3VE4 A;  2GZA A;  4H6J B;  5J4E A;  3T4S A;  3MMH A;  4KQO A;  3C8C A;  3LR4 A;  4ARZ A;  1TS7 A;  2VV6 A;  1OTB A;  3BQ8 A;  1LSW A;  1W63 M;  3EEH A;  5AJG A;  2V0W A;  4HJ6 A;  4II7 A;  3H9W A;  3CAX A;  3O5Y A;  3V67 A;  1VB6 A;  4G3K A;  4EER A;  1YKD A;  4ZRR A;  3A0V A;  3S7Q A;  3BQA A;  3FPW A;  1TS6 A;  3T4K A;  2O9A A;  2HV1 A;  3LI8 A;  4CLC C;  3HJI A;  2VV8 A;  4BBU A;  4G3W A;  1T1A A;  4EQ1 A;  2O9B A;  5HZH A;  5C5K A;  3MJQ A;  3P7N A;  4HY8 A;  3R7W A;  2VGL S;  1LT0 A;  4IJG A;  4HJ4 A;  2XSS A;  2ZMF A;  4UQI M;  2QJ5 A;  1N9L A;  4NXG A;  1OTI A;  4EUV A;  2GX5 A;  4Y5F A;  4LPZ A;  2OWH A;  2J3T D;  2K31 A;  4BMW A;  4WEJ A;  1YSP A;  2GJ3 A;  3KO6 A;  4EW7 A;  1N9N A;  1F5M A;  5F5Y A;  4NEE D;  4EEP A;  2W0N A;  3H82 A;  2XRO A;  3OBF A;  4NKP A;  3MQQ A;  2G7U A;  3JVV A;  4CLC B;  1T1B A;  2VZW A;  5DKL A;  2VLG A;  3NOU C;  3F1P B;  5CX7 A;  5FL3 A;  2KX6 A;  5AVF A;  1XJ3 A;  1G6O A;  3E4P A;  3K2N A;  4XT2 B;  4JGR A;  2PYR A;  2Z6D A;  4Z1W A;  2VEA A;  3OOV A;  2R78 A;  4FOF A;  1P9W A;  4R70 A;  5HSQ A;  2CMN A;  3KSH A;  1S1Y A;  4LLO B;  2EWV A;  4YOF A;  4WUJ A;  4CQH A;  2K2N A;  1IOU A;  1TD5 A;  4F3L B;  4MMN A;  4WLA A;  2PR5 A;  3EQV A;  4LRZ E;  1P0Z A;  1OTD A;  2OAQ 1;  3DBA A;  1BYW A;  2KOI A;  3T50 A;  4XT2 A;  3E4Q A;  4YWZ A;  3LID A;  4WEK A;  2HJ9 C;  4HH2 A;  4MN6 A;  1GSV A;  2B02 A;  2VA0 A;  1DP6 A;  2NUP C;  2HF6 A;  3IBJ A;  4WN5 A;  3T4O A;  3OC2 A;  1V9Z A;  3PBN A;  3S7O A;  5L8M A;  2JKR I;  1NLY A;  4EEU A;  4HIA A;  2OOL A;  4PKY G;  2QKP A;  5HDD A;  3SW1 A;  4HNB A;  1LL8 A;  3PBR A;  4OOL A;  1OJG A;  3MQO A;  3EOI A;  2K7S A;  2D02 A;  4HH3 A;  3T4L A;  4KUO A;  2HJE A;  4PHT A;  3EWK A;  3KYZ A;  2W3H A;  3TJZ C;  1F98 A;  2GNX A;  4JGP A;  4RQ9 A;  3LR3 A;  5DFY A;  3NOT C;  4G3V A;  2LB5 A;  2W1T B;  2VJW A;  1P97 A;  2VKS A;  1ZTU A;  1W63 Q;  2V1B A;  1TS0 A;  5TJJ A;  1OT6 A;  5F68 A;  3A0R A;  4DN0 A;  4CLC D;  3OCL A;  2PR6 A;  1MC0 A;  2VX8 A;  2ZOH A;  3BY8 A;  4H6J A;  5DF9 A;  5HPF A;  2O99 A;  2W27 A;  4EET B;  5EFW A;  1KOU A;  3CLO A;  3LIF A;  5KSH A;  5HWV A;  4FSF A;  2O0Y A;  5IS1 A;  3T4T A;  4B9O A;  4L9G A;  3BW6 A;  2L4R A;  4NXE A;  2W3E A;  3R4K A;  3TW8 A;  3BJN A;  3S7N A;  1NLZ A;  5HD3 A;  2A24 B;  2W3G A;  3E4O A;  1YAX A;  5IU1 A;  2MJ6 A;  2V1A A;  4QPR A;  3K3D A;  4BBT A;  3LUQ A;  3MQ0 A;  2M1C A;  3JVU A;  4P6Z M;  2DMW A;  3CUE A;  2L1M A;  1GSW A;  4UQI S;  1Y28 A;  3BWL A;  4UEY A;  1OTE A;  2BAS A;  2PHY A;  1H8M A;  1D7E A;  1G28 A;  3CIT A;  2XRN A;  4I38 A;  4DJ2 A;  2B18 A;  1VHM A;  3CI6 A;  3KX0 X;  1XFQ A;  3F1N B;  4GS9 B;  4L0L A;  4P6Z S;  5HDS A;  2M7V A;  4BWI A;  4CLC E;  4I3J A;  5J7E A;  3ZQ5 A;  4HOI A;  1H3Q A;  4Q0I A;  3VOL A;  1OJ5 A;  5TBM B;  4HI4 A;  2INW A;  3KYQ A;  4EES A;  4MN5 A;  2Y8H A;  3B42 A;  2Y79 A;  2A2L A;  4Q0H A;  2XA7 M;  1S1Z A;  4BBV A;  4PAU A;  2J3T C;  3EGD C;  3PBO A;  2YKF A;  4Q0J A;  5K5B A;  4O01 A;  4GW9 A;  4HP9 A;  3IS2 B;  2HGV A;  4I5S A;  3UME A;  2QHK A;  2JN7 A;  2O9C A;  2I9V A;  3C2W A;  1T18 A;  2WKQ A;  4CLC A;  3UMD A;  2JKR M;  1MKM A;  3MF0 A;  1XJ2 A;  3F1P A;  3F1O B;  2H28 A;  2IA2 A;  2QJ7 A;  5HDC A;  4OOM A;  3NHQ A;  1UWN X;  4DJ3 A;  2J3W A;  1IFQ A;  4LRX C;  3UE6 A;  5AVE A;  4GHI B;  3PBS A;  4EXO A;  5I5L A;  3H7W B;  2FH5 A;  3BY9 A;  3LI9 A;  3PBQ A;  3FC7 A;  5F6A A;  2L0W A;  1ODV A;  3MR0 A;  3PYP A;  4K08 A;  3PHY A;  4O0P A;  5HWT A;  2LB9 A;  4F3L A;  5HD5 A;  4KQD A;  2V9A A;  4JGO A;  2QYB A;  4NXF A;  2J80 A;  3LIC A;  4ARZ B;  3LYX A;  3RTY A;  2PDR A;  2WKP A;  4HQA A;  4LRY C;  1EW0 A;  3UE3 A;  4I3A A;  4ME4 A;  1S4S A;  2VV7 A;  3G6O A;  4HP4 A;  4MCW A;  2D01 A;  3FG8 A;  3E98 A;  5LBR A;  4AFI A;  4R38 A;  3UB9 A;  1T1C A;  4ETZ A;  2JKT I;  3LIA A;  4WEL A;  2P08 A;  1ZHH B;  4NXB A;  4PKY A;  5A8B A;  3VE3 A;  3LIB A;  4YNR A;  2OAP 1;  3KSG A;  1OTA A;  1LSX A;  1XFN A;  2OWJ A;  4HJ3 A;  3EGX C;  3ULF A;  5HWW A;  1F9I A;  5KIZ A;  2PD8 A;  3HCY A;  2Z6C A;  2KLI A;  3TE8 A;  4IHQ A;  3R7W B;  3E0Y A;  1WA9 A;  3K3C A;  5G4Y A;  2W1T A;  5HL6 A;  3TRC A;  1S67 L;  1T19 A;  3OLO A;  3P01 A;  2ZOI A;  2QWS A;  3PBT A;  4O8G A;  3IBR A;  5G4Z A;  2VGL M;  3S7P A;  2EWW A;  3EQU A;  4JGQ A;  3MXQ A;  5J3W A;  2KDK A;  4M4X A;  1XJ4 A;  4R3A A;  1OPX A;  2PYP A;  4L9F A;  1N9O A;  3KSI A;  4GLQ A;  2YKH A;  3T4Q A;  1MZU A;  1S66 L;  4E04 A;  2NUT C;  5DKK A;  4HHD A;  3H82 B;  1D06 A;  4WL9 A;  3MFX A;  4GJ4 A;  2A24 A;  3EEA A;  3FPV A;  3W2Z A;  3PXP A;  2P04 A;  5HPI A;  4IUH A;  4MN7 A;  2W3F A;  2V0U A;  4WF0 A;  5IT5 A;  3LIE A;  3C30 A;  4R6L A;  1YSQ A;  3B33 A;  3NJA A;  2ZMV A;  1UGU A;  2PD7 A;  1GSX A;  1JNU A;  1UWP X;  5F69 A;  3A0S A;  4GS9 A;  1DRM A;  3F1N A;  1TS8 A;  1DP9 A;  2XA7 S;  3GDI A;  3PR6 A;  2FZ0 A;  1STZ A;  5TBM A;  1XJ6 A;  4Y3I A;  3ZYT A;  3NOP C;  2M7U A;  4KUK A;  2EA9 A;  2W1R A;  1X0O A;  4I3I A;  4EU0 A;  1DP8 A;  4MDZ A;  3VV4 A;  5DJT A;  3IS2 A;  3RFB A;  1LSV A;  4DMZ A;  3LFV A;  3U2A A;  3RH8 B;  4L9E A;  2PT7 A;  4IUK A;  2W3D A;  1NRJ A;  4I39 A;  4Y2F A;  3D3O A;  3LR5 A;  3CWF A;  4BJP A;  3F1O A;  5MC7 A;  3KSF A;  3T4J A;  3UB8 A;  2JKT M;  3HJK A;  2JHE A;  4GHI A;  1P9R A;  3H7W A;  4B93 A;  4GCZ A;  3LR0 A;  4ETX A;  2WKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...