3BY8A

Crystal structure of the e.coli dcus sensor domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein dcuS
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17203 sCache_3_2 Single cache domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by8A00
4HP4A 2WKQA 4BBVA 2V1AA 2KDKA 5HWTA 5HZHA 3A0VA 3LYXA 1WA9A 3OLOA 4WUJA 2W27A 4MN6A 2A24A 3F1OA 3NOUC 4HIAA 4JGQA 2P7JA 4WL9A 1EW0A 5F68A 1XJ3A 1V9YA 4BBTA 2VEAA 1XJ2A 4YWZA 2OWHA 3CWFA 2V9AA 2B02A 4HH2A 1UWPX 2OOLA 3LI9A 1T18A 3EEHA 4EQ1A 3PYPA 4JGOA 5DKLA 3A0RA 3NJAA 4EXOA 4HJ6A 2D02A 3H7WB 5F5YA 4F3LA 5IS1A 1P0ZA 4R3AA 2Z6DA 4HY8A 5HD5A 5HWVA 2JHEA 1S1ZA 4LPZA 4WN5A 3UB9A 2L4RA 4MN5A 2V0UA 4R38A 1X0OA 1P97A 2VLGA 3ZQ5A 3P7NA 4HH3A 5EFWA 5J7EA 4DJ3A 3F1NA 4I38A 3UMEA 2R78A 4XT2A 1OJ5A 1XFNA 4PKYA 2OWJA 3VE3A 2J80A 2M1CA 1LT0A 1LSXA 1GSWA 1DP8A 5DJTA 1T1CA 4R6LA 1GSXA 3UB8A 2QWSA 3MFXA 1ODVA 3NHQA 2ZOIA 3MXQA 4PKYG 2L0WA 1DRMA 1TS0A 1S67L 3LI8A 1S1YA 3NOPC 1OTEA 3B33A 1JNUA 2PR6A 3FG8A 2INWA 1TS6A 2W0NA 3T50A 5G4ZA 1F98A 2CMNA 5J4EA 3UB6A 3NOTC 1S4SA 3PHYA 1N9NA 1XJ6A 4F3LB 1TS8A 2PDRA 1N9LA 4LRZE 3UMDA 3KX0X 2QHKA 3EWKA 1UWNX 3BY9A 3E4OA 4RQ9A 4EW7A 2VV8A 2PYPA 4H6JA 4GS9B 1G28A 1LSWA 5TBMB 2ZOHA 3LIDA 1D06A 3SW1A 4EESA 4K08A 3A0SA 5F69A 1V9ZA 1MZUA 3UE6A 3IS2A 1Y28A 2L1MA 4KUKA 4XT2B 3CAXA 1XJ4A 3FC7A 4HQAA 2WKPA 3RH8B 3GECA 2K7SA 4EERA 4NXFA 1OTDA 2JN7A 3K3CA 1DP6A 1OJGA 5DKKA 4L9GA 4M4XA 5AVFA 2PD7A 4BBUA 5HD3A 2A24B 3E4QA 1T19A 3F1OB 5DJUA 4JGRA 2I9VA 3ICYA 1OT6A 3CLOA 4HOIA 4E04A 2HV1A 3BWLA 3LIEA 4I3IA 2KX6A 4I5SA 4I39A 3F1PA 2H28A 3BY8A 4HJ3A 2PYRA 4I3JA 2YKFA 5HWWA 3HJKA 5AVEA 4NXGA 3MR0A 3C2WA 4LRYC 1VB6A 5I5LA 1OTBA 3H82A 5J3WA 2V1BA 4R70A 4EEUA 3G6OA 4GHIA 5G4YA 4H6JB 3MQQA 3VOLA 4I3AA 4NXEA 3LIFA 4HNBA 1F9IA 2GJ3A 1OTIA 4KUOA 1BYWA 4WLAA 3UB7A 3ULFA 1S66L 3MQOA 3IS2B 4LRXC 4HJ4A 5IU1A 2QJ7A 5F6AA 1N9OA 2WKRA 5HDCA 4HI4A 3D72A 1LSVA 3LIBA 2D01A 1TS7A 3K3DA 3VE4A 5HDDA 2VV6A 2V0WA 4EETB 1D7EA 2Z6CA 3MJQA 3F1NB 5HDSA 1OT9A 1GSVA 5KIZA 5A8BA 2VV7A 4HP9A 4JGPA 4GW9A 3E4PA 2QKPA 1KOUA 3LICA 3LUQA 2ZBBA 4B9OA 1NWZA 2PD8A 2PHYA 4LLOB 2YKHA 1XFQA 3F1PB 3GDIA 4GS9A 3HJIA 1UGUA 4NXBA 5TBMA 2EA9A 3H7WA 4GCZA 2PR5A 3H82B 1T1BA 4L9FA 3LIAA 1LL8A 1OTAA 4GHIB 2BASA 1S4RA 4KQDA 5HSQA 1T1AA 4L9EA 3IBRA 4DJ2A 3H9WA 4HHDA 2QJ5A 1DP9A 3RTYA 4WF0A 3C8CA 4EEPA
chains in the Genus database with same CATH superfamily
4HP4A 2Y8HA 2XRNA 2IWDA 3SS4A 1DJBA 5HWTA 5HZHA 4OQIA 3A3EA 4S2JA 4X56A 3LYXA 1YM1A 4KZ8A 1XGJA 5E2EA 1WA9A 1HZOA 1HVBA 4R23A 2GDNA 4MN6A 2XH9A 2FFFB 3NOUC 3MZDA 4KZ7A 4WEJA 1DY6A 5AJGA 2P7JA 3P98A 1CK3A 3E0YA 3UPNA 3SH7A 5EOOA 4FUWA 3ZG5A 2G2UA 3AGEA 1PFLA 1V9YA 2Y91A 3HLBA 1IKIA 4DXBA 3VSLA 1NZUA 1YLJA 1ES2A 2WUQA 4OQHA 1XJ2A 4BQMA 3CWFA 2B02A 3MZFA 4LENA 3KSIA 2VJWA 3BFDA 2ZC5B 2WGWB 2AVXA 4QB8A 3HUMA 3HREA 3EEHA 1PI5A 1G6OA 4EQ1A 2XK1A 4Q0JA 5DKLA 1K0KA 4X1MA 2P9VB 1YLTA 2PBDP 2HDRA 3BJNA 5EVEA 3A3JA 4Z1WA 4HJ6A 3H7WB 5F5YA 4F3LA 4Y0UA 3G2ZA 4CLCB 2HF6A 5EOEA 1K6SA 5EVLA 1BTLA 4S2KA 4IBXA 5DF9A 4OPYA 4G3WA 2IWCA 5BOHA 4X53A 4XXRA 1YLWA 3W4PA 3IHBA 4WN5A 1YT4A 4MN5A 2XD5A 4CLCC 1FCOA 4R38A 1MPLA 3R7WA 4HH3A 5EV0A 4DJ3A 5FQIA 3F1NA 1JWPA 5CEDA 4DN0A 1BLSA 1OJ5A 1BULA 2JKTI 1ERQA 1VHMA 2XDMA 2HP9A 2OWJA 5EECA 1PWGA 2M1CA 1TF1A 1LSXA 1GSWA 4GZBA 5J8XA 4EV4A 5L8MA 1YSQA 1ODVA 4RX3A 4RA7A 2L0WA 2J7VA 1MWUA 4XUXA 3LI8A 3SH8A 1Y54A 3VFFA 1PZOA 2OLUA 5L09A 1NY0A 5KZHA 2EXBA 3UE0A 1OTEA 2PR6A 5DVAA 4E6XA 5G4ZA 1HLUP 3DBAA 4KG6A 4GD8A 4FH2A 3RJUA 4PM8A 3B3XA 3VOYA 5EVIA 1YMXA 3IXGA 1PW1A 1S4SA 4JF5A 1N9NA 3PBSA 4B4ZA 2JC7A 3WS4A 4JXSA 4LRZE 4R0QA 3KX0X 4WMCD 1L0GA 4IUHA 4WZ5C 1RP5A 1M6KA 5L07A 3E4OA 1K25A 4H6JA 1PNEA 3S7PA 1VQQA 1IEMA 3ZGAB 4ZRRA 5FQQA 5E43A 3HUNA 1JTGA 3LIDA 4R4RA 1CJFA 3BYDA 2UWXA 3G32A 3PBQA 3N8SA 1V9ZA 3LCEA 1FOFA 4UQIM 3C38A 3C7VA 4R3JA 4Q0IA 3FKWA 3G34A 1A0KA 3EEAA 4R3BA 5DKKA 4X55A 2ZD8A 2QZ6A 1NRFA 5AVFA 2OAP1 2PD7A 2P9VA 3ISGA 2EX9A 2XD1A 4P85A 3MKEA 3NY4A 4CLCA 4JGRA 2XA7S 3ICYA 2ZMAA 1FCNA 4BL2A 2WGVA 3LIEA 5FI7A 2WZZA 4I3IA 3IXBA 1FSWA 3OPRA 4EU0A 3UN7A 3A3DA 4HJ3A 5FEGA 3PR6A 3FV7A 3MR0A 2ZQ7A 3T1XA 5I5LA 4X6TA 4OQ0A 4MEZA 2VGJA 4OLDA 3WS0A 3WS5A 1ES3A 5C5KA 4RVAA 4GHIA 2KOIA 3UY6A 2ZQDA 3IWQA 1Z09A 3VOLA 1K55A 4DKIA 1L0DA 4Y2FA 3LIFA 1SZVA 3S4XA 4PM7A 1OTIA 5GL9A 1YLYA 1LHYA 1S66L 3IS2B 3GVBA 4LRXC 4Y0OA 3RXWA 4L0LA 5DTTA 2QJ7A 1LL9A 3NBLA 1PYYA 2A2LA 1I2SA 4QHCA 4PM9A 3VOZA 3TJZC 4GD6A 2WZXA 2XSSA 1H3QA 3VE4A 2E8IA 5HDDA 3NDGA 2JKFA 1W63M 4ZJ3A 3TRCA 4MCWA 3VP3A 3MJQA 1OT9A 4QJGA 1GSVA 3G31A 3BFEA 1K56D 4JGPA 4GW9A 2ZMVA 1ALQA 4DDSA 3BQAA 1VEUB 3HL9A 2PU2A 2ZBBA 3OCLA 5M18A 3VP1A 3W2ZA 2Y55A 5HL1A 3VP4A 3N7WA 2PHYA 2LB9A 5I94A 3AGFA 3JPUA 3UE1A 3BEBA 5HAQA 3Q7VB 3UE3A 2EA9A 4WEKA 2W3HA 5FEFA 1TEMA 2A49A 3T4LA 4S2PA 4BENA 1KVLA 1LL8A 5U47A 4QD4A 1YAXA 5TGFA 3GR2A 4OP8A 3HLDA 3LO7A 4WZ4A 5F1FA 4A5RA 2ACGA 5HPFA 1GHIA 3C8CA 3L9KA 2ZL1B 2WKQA 2NUPC 4BBVA 2ZC4B 3GV9A 5L2FA 5GLCA 1M40A 1SDNA 2J8YA 5AQ9A 3ZVWA 2VX8A 5D3OA 1VETB 3U4LP 4JGQA 5HPIA 4LFUA 3GTCA 5LBRA 2VK3A 3ZVTA 4BMWA 1EW0A 2WK0A 5TR7A 3OPLA 3HLWA 4MLLA 2WAFA 4BBTA 3M2KA 3TSGA 2V9AA 4R1GA 2Y2NA 1FILA 3MQ0A 1UWPX 3SH9A 2OOLA 4YOFA 4BD0A 4NG2A 3VP2A 1JWVA 1SKOB 2XGNA 3ZCZA 1KGEA 3A0RA 1LI9A 4NETA 3WS1A 1STZA 4E3OA 1KDWA 4Y3IA 1PWDA 1J3WA 2WKEA 3C7UA 1QMEA 3E2LA 5HW3A 5IS1A 3BFGA 4QY6A 1P0ZA 3EGDC 4E3JA 3N8LA 4HY8A 5HWVA 3LR4A 1K38A 3V50A 4OPZA 4UA9A 4LPZA 3UPPA 3OC2A 1GHMA 4PPRA 4OOLA 4QY5A 5FAOA 4DE0A 1YPRA 3QHYA 2X71A 2V0UA 3UPOA 1U60A 4JPMA 1X0OA 1P97A 1K54A 5EM1A 5EFWA 5J7EA 1XA1A 4XT2A 3HBRA 2Y79A 5CHMA 3VE3A 3BRMA 1ZC2A 3T1QB 1PWCA 4OLGA 1VEUA 4MMNA 1GSXA 3UB8A 1JVJA 4JXWA 3BM6A 4NK3A 1DRMA 1TS0A 3UDXA 2XFSA 1YSPA 3NOPC 1HTZA 2V1ZA 4GN2A 3FG8A 1VM1A 2INWA 4JKTA 1TS6A 3O5YA 4OQGA 3D4FA 1F98A 4DE3A 1Z6FA 3CG5A 4N9KA 5J4EA 2RCXA 5CGWA 1XJ6A 3CPTA 3VMAA 1TS8A 2DMWA 3FPVA 2KLIA 3UMDA 2OSUA 3EWKA 4F94A 4BJPA 1TDLA 5A93A 2V8FA 1MBLA 3JYIA 3KYZA 3OZHA 3SOIA 4EW7A 3R4KA 5CERA 4EQIA 1ZG6A 2XF3A 5CXWA 3IX4A 3V67A 3FYZA 3MZEA 4Y0TA 3HLCA 5MC7A 4IVIA 3T4KA 4EESA 2HZ5A 3V3RA 3UE6A 1LI0A 3O87A 1MKMA 4LGWA 4U3TA 3PAEA 4DRTA 4DE2A 4EWFA 5IT5A 1KVMA 4HQAA 2WKPA 3V5MA 2HDUA 1OTDA 3K3CA 2IWBA 1OJGA 4IVKA 1ERMA 5TJJA 1SKOA 1FSYA 4P6BA 3GMWA 1XKZA 4S2NC 4BBUA 2H0TA 2JE5A 4UAAA 3P01A 1G6AA 3DW0A 3E4QA 1KGFA 3OPHA 3QNCA 2QPNA 2VGLS 3SS5A 3CLOA 4HOIA 2ZQ9A 2HV1A 1HD8A 3S7NA 2KX6A 4I5SA 4PM6A 3SZTA 4I39A 1BT5A 3F1PA 4LV1A 4N9LA 4FOFA 2OV5A 1ONGA 3M6BA 4RX2A 5AVEA 4LRYC 5DFYA 2PAVP 4PMAA 4O01A 4B4XA 2WAEA 5FI2A 4Y17A 2HJEA 5IHVA 4O8GA 3T4QA 3WS2A 5DTKA 3G6OA 2HP6A 3TG9A 4O7DA 1ES5A 5EUAA 3HLFA 3ZHHA 3BQ8A 3MQQA 4I3AA 5A91A 3W4OA 1YLPA 4P6ZS 4OOMA 3LY3A 2GJ3A 3NDEA 3DTKA 4PM5A 2HPBA 2ZQAA 5FL3A 3S7OA 3TOIA 3D3OA 3UB7A 2Z2MB 1IFQA 3G35A 3MQOA 4S2IA 3LY4A 4FTXA 4OPRA 1CEFA 4YNRA 1IYSA 5IU1A 5FI6A 3IWOA 2ZM0A 3D72A 3HCYA 2HDQA 2PU4A 3VSKA 3K3DA 1E4DA 2BLSA 5CECA 2VV6A 3Q81A 1D7EA 3VV4A 1YMSA 4FD8A 3O86A 1NZOA 3W8KA 3BLMA 5HDSA 3K2NA 3IF5A 5KIZA 1ONHA 5DF7A 3IBJA 3UB5P 3DTMA 2CC1A 4HP9A 4N1XA 3E4PA 1KOUA 4HBTA 3I7JA 3IT9A 2WGWA 3BW6A 1NWZA 2PD8A 2WKIA 1XA7A 5JYOA 1W79A 4B88A 1UGUA 3GSGA 4D60A 1WYBA 3H7WA 2M7UA 3MMHA 1IYQA 3LR5A 4JXVA 3H82B 1IYPA 1T1BA 3OPPA 3T4TA 4MN7A 3NI9A 3HVFA 1OTAA 4GJ4A 4B93A 3PBOA 1S4RA 3T1SA 2JBFA 4FSFA 4MNRA 4DJ2A 5M19A 1FQGA 3H9WA 4HHDA 2DNSA 3DWKA 2QJ5A 5AQAA 3V3SA 1K57C 3RTYA 4GB7A 2J9OA 1H5XA 2Y2KA 4XUZA 2V1AA 2RL3A 3KSGA 3LEZA 3CI6A 5G18A 1CI9A 2WGIA 3CMZA 3CITA 2ZQCA 4YFMA 3Q7ZA 2MJ6A 3IH8A 4WL9A 1AWIA 5EVID 4LV3A 1PRQA 3MF0A 2LB5A 2XROA 5CRFA 5HFOA 2OWHA 1L2SA 2K31A 3MKFA 3E2KA 4HH2A 2Y2HA 4WZ5A 4WYYA 1I2WA 2V8CA 4KG2A 3LI9A 1Y4OA 3CJMA 3QNBA 1K6RA 1YLZA 3BFCA 1O7EA 3D9YA 3NJAA 2OLVA 4MBHA 4D2OA 3MS6A 1TD5A 4ID4A 4II7A 2D02A 4CLCE 4IHQA 1NYYA 2Z2LB 3L7HA 1FCMA 2Z6DA 2WKHA 4ZJ2A 4P0MA 3MFDA 1W7FA 1G68A 1MWTA 2X01A 2Y2LA 1AXBA 1G5UA 2XA7M 3S7QA 3IX8A 3TE8A 1BZAA 2L4RA 3V39A 1DJAA 1E25A 4O0PA 5FAQA 3ZQ5A 3EQVA 5EE8A 1SKFA 3LR0A 1SHVA 3RXXA 5FQKA 2R78A 4KZBA 3UNWA 1L3LA 1XFNA 2PRFA 2R9WA 3KSFA 4KZ5A 5HAPA 1J9MA 2BG1A 5DJTA 4R6LA 4ESPA 3VFHA 1S6RA 2QWSA 3NHQA 3MXQA 1SDEA 1GCEA 4DF6A 2B18A 4OKPA 1S1YA 2J3WA 1MWRA 1H8MA 5GLAA 5A92A 2X02A 4KZAA 5HAIA 1JNUA 2ZC6B 1K4FA 4ZJ1A 2WADA 4KZ6A 4CJNA 2W0NA 5FAPA 4K0WA 4IBRA 2C5WB 1NLYA 5GLDA 1JTDA 4UA7A 1S0WA 4G3KA 2CMNA 4KQRA 3UB6A 3EOIA 3U2AA 1ZG4A 1NXYA 3PHYA 3UO9A 1MXOA 4F3LB 1RGZA 3IQAA 3HUOA 3CUEC 2PDRA 1N9LA 1PIOA 4LCMA 1KE3A 4E6WA 1XPBA 1NLZA 4ARZB 2PT7A 3ZG9B 3T4SA 4Y5FA 5TBMB 3DTIA 5HL6A 1I5QA 4UHUA 4KQOA 3WRZA 3SW1A 5F69A 1MZUA 3N6IA 1W5DA 3QP5A 3IS2A 5FQ9A 2L1MA 3CAXA 3RH8B 4EBPA 4NEED 3GECA 4NXFA 1GA0A 2H10A 4C3QA 3PAGA 3PBNA 4DMZA 4M4XA 4PHTA 4OONA 4FCFA 4RYEA 1IOUA 2A24B 4E3NA 3ZDJA 1PZPA 3F1OB 5DJUA 2P08A 4DDYA 1C3BA 3A3IA 4LV2A 2O99A 1OT6A 1RCJA 4H8RA 3BWLA 3T12B 4OVDA 5CTNA 5EVIB 1MY8A 3DTEA 2YKFA 3HJKA 4GOGA 4FH4A 4Q8IA 5GLBA 3Q7VA 3C2WA 1IKGA 3QP2A 3ZG7B 2V1BA 4R70A 1D1JA 1LLBA 5GHYA 5FASA 1PI4A 4WBGA 3ZFZA 4H6JB 1NRJA 1SCWA 4ZAMA 2B95A 4NXEA 1KE0A 3O3VA 1CEGA 5EVIC 1F9IA 1N4OA 1RGYA 4KUOA 4WELA 5AQ7A 2ZL1A 5CHUA 4JF4A 4WLAA 3ULFA 5DF8A 4AFIA 1E3UD 2Q0OA 4WMCA 1FIKA 5F6AA 3JVUA 4DE1A 2WKRA 2HGVA 3LR3A 1GA9A 3CUEA 5HDCA 4ETXA 1VETA 1LSVA 4C6YA 3KSHA 1TS7A 3CHWP 2JKRM 3Q1FA 5GHZA 2EX2A 3HLEA 1OMEA 2Z6CA 1JWZA 1CF0A 1EWZA 2ZLYA 3S1YA 5A8BA 3UDFA 4GDNA 4BD1A 5FATA 2BTFP 4UA6A 5F1GA 2QKPA 3A3FA 5CTMA 3PXPA 4B9OA 5KSHA 2Y2OA 2HP5A 3SS3A 4X68A 1XX2A 2YKHA 4KZ4A 1XFQA 4IJGA 4ARZA 2GZAA 3IX3A 4UQIS 4NXBA 1ESUA 1L0EA 3IH9A 5TBMA 4KQQA 1LL5A 1Q2PA 2Q9MA 1EROA 2PR5A 2V2FF 4OH0A 3NIAA 4ZDXA 3IXHA 3LIAA 4JLFA 5DFXA 1MC0A 4GHIB 2BASA 1W8YA 5FQMA 3PTEA 3T1RA 4U0XA 3LGOA 4S2OA 5L10A 4KENB 1GHPA 4BLMA 1DP9A 4EEPA 4HEFA 1NYMA 2EFUA 2KDKA 1WYCA 3A0VA 2ZQ8A 4EUZA 3OLOA 4WUJA 2W27A 2A24A 2Y2QA 1MKIA 3F1OA 4GLQA 1K55C 3NCKA 4HIAA 3M2JA 3T4JA 2O9BA 4MDZA 2ZC7A 1XP4A 5CHJA 4IEDA 5F68A 1XJ3A 5E2GA 2G2WA 4MBFA 2VEAA 3C5AA 1FR6A 4EUVA 1P9WA 4YWZA 4YINA 4IUKA 3WWXA 2XR0A 3ZG8B 2FFYA 1ESIA 1BLPA 4UEYA 3EQUA 4GNUA 3C4PA 2J3TD 2W1RA 1T18A 3JVVA 3PYPA 2FZ0A 2EWVA 1BLHA 5F82A 4JGOA 3ITAA 4X1LA 2P74A 2EX8A 1F5MA 3ITBA 3O88A 4LCLA 2W3DA 3PBTA 4EXOA 3FZCA 2EXAA 2HJ9C 1CQAA 1K56A 3C4OA 4PAUA 4R3AA 5JYPA 2ZMFA 1WE4A 5HD5A 1QMFA 4JBFA 2H5SA 4P87A 2JHEA 2IA2A 4HESA 1S1ZA 1BUEA 2O9CA 3GRJA 1PW8A 4ME4A 3UB9A 3FKVA 2Y2JA 2VGLM 1DJCA 3IWIA 4E3KA 3FPWA 1KE4A 1ZKJA 2PBYA 2VLGA 4S2NA 2J9PA 3P7NA 5FA7A 3T4OA 3DWZA 4QU3A 4I38A 3OBFA 3MBZA 5EM0A 1TDGA 4GDBA 5FDHA 5CX7A 3UMEA 4WM9A 4PKYA 3QP6A 3B42A 2J80A 1LT0A 3W4QA 1DP8A 2W3EA 1T1CA 4E3LA 2C6WB 3MFXA 2G7UA 1IELA 5K5BA 2ZOIA 4P6ZM 4PKYG 3IXDA 1KDSA 1S67L 2JKGA 3C30A 5E2HA 4KZ3A 2JKRI 1W8QA 3B33A 4E3IA 4C75A 3HLGA 2ZM2A 2Y59A 3MXRA 3KYEA 4EBLA 3T50A 5CEBA 2K2NA 2Y2IA 4ZTKA 3NC8A 2UV0E 2OAQ1 3QP1A 5KSCA 3PBRA 3NOTC 3BLSA 4N1HA 3NECA 2W1TB 5F83A 4Z9QA 4NKPA 2VGKA 1XGIA 5FQJA 3ZNYA 3G30A 4KG5A 2QHKA 1K4EA 3UDIA 2H0YA 4S2MA 5M1AA 1UWNX 5CGXA 1H8YA 3BY9A 1YKDA 2M7VA 1H8ZA 3Q07A 2NUTC 4RQ9A 2VV8A 2PYPA 5GHXA 4GS9B 4CPKA 4CQHA 1G28A 4JXGA 1LSWA 2ZOHA 3IF6B 1D06A 3S22A 1CI8A 4G3VA 3BFFA 4K08A 3A0SA 1H0MA 2I72A 1Y28A 3WRTA 2XEPA 4KUKA 4XT2B 3Q82A 1XJ4A 3OCNA 3RFBA 5A90A 3FC7A 4KZ9A 4ETZA 2ZJ9A 2JCHA 3DAVA 2K7SA 4EERA 1L0FA 2JN7A 2WYXA 2ZC3B 1DP6A 3NULA 3IF6C 4L9GA 5AQBA 5HARA 1BLCA 3N8RA 5TFQA 1K54C 4QWOA 3MXSA 5HD3A 4CLCD 3ZG0A 1F2KA 4Y15A 1T19A 4BL3A 2B5RA 4MBKA 2I9VA 3KYQA 3G2YA 1OPXA 4R4SA 4E04A 4EBNA 3QP4A 1ACFA 2VKSA 5HX9A 4DXCA 2EWWA 3LEQA 2H28A 3BY8A 2PYRA 1KGGA 4I3JA 5HWWA 2DRWA 4GKUA 3CPTB 1K57A 4NXGA 4S2LA 1VB6A 4Y13A 1OTBA 1XXMA 3MSHA 3H82A 5J3WA 4OP5A 4EEUA 3AGDA 4HBUA 1EI5A 5G4YA 3G4PA 4OOYA 1IYOA 3FWLA 1N9BA 2V20A 3ZNTA 2JKTM 4HNBA 3N4IA 4OPQA 1O07A 1BYWA 2GNXA 1P9RA 4HJ4A 2HDSA 2Y2PA 3CZDA 3GQZA 1E3UA 2Q9NA 4BWIA 1N9OA 2J3TC 2XFTA 5EPHA 3QP8A 4HI4A 3BECA 2EX6A 5FSRA 2DCFA 2FH5A 2QYBA 3LIBA 2D01A 1YQSA 3OOVA 2A3UA 1ZHHB 2V0WA 4EETB 3R7WB 1TVFA 2GX5A 4JF6A 2EFXA 3F1NB 2O9AA 3KO6A 2QMIA 4ZBEA 4U0TA 2VZWA 2R9XA 3P09A 3M6HA 3TW8A 4LV0A 2VV7A 2W1TA 4M3KA 1ZTUA 3LICA 3LUQA 1FR1A 2Y4AA 2ZM8A 5FDSA 2XLNA 4Q0HA 4LLOB 4K91A 3F1PB 3E98A 3GDIA 4QPRA 4GS9A 2E8JA 2Y2MA 3HJIA 4Y7PA 3LFVA 2XQZA 4N92A 3ZYTA 3IF6A 4GCZA 1W63Q 4X69A 4L9FA 5E2FA 2W3FA 2Y2GA 5KMWA 3B47A 2W3GA 4X25A 5CGSA 4KQDA 5HSQA 1BSGA 1T1AA 3IHAA 2VA0A 4E3MA 4L9EA 3IBRA 2P04A 1ES4A 1NJ4A 3VP0A 5DTSA 4K0XA 1Q2QA 1MWSA 2O0YA 4WF0A 3EGXC
chains in the Genus database with same CATH topology
4HP4A 2WKQA 2NUPC 4BBVA 2Y8HA 2XRNA 2V1AA 2KDKA 3KSGA 5HWTA 5HZHA 3A0VA 3CI6A 3LYXA 1WA9A 3CITA 3OLOA 4WUJA 2W27A 4MN6A 2A24A 2VX8A 3F1OA 4GLQA 2MJ6A 3NOUC 4HIAA 4WEJA 4JGQA 5HPIA 3T4JA 2O9BA 5LBRA 5AJGA 2P7JA 4WL9A 4MDZA 4BMWA 1EW0A 3E0YA 5F68A 1XJ3A 1V9YA 4BBTA 2VEAA 3MF0A 2LB5A 4EUVA 1P9WA 2XROA 1XJ2A 4YWZA 2OWHA 3CWFA 4IUKA 2V9AA 2B02A 2K31A 4HH2A 3MQ0A 1UWPX 3KSIA 2VJWA 4UEYA 3EQUA 2OOLA 4YOFA 2J3TD 2W1RA 3LI9A 1T18A 3EEHA 1G6OA 4EQ1A 3JVVA 3PYPA 2FZ0A 2EWVA 4Q0JA 4JGOA 5DKLA 3A0RA 3NJAA 1F5MA 2W3DA 3PBTA 1STZA 4EXOA 3BJNA 4Z1WA 4HJ6A 2HJ9C 4Y3IA 1TD5A 4II7A 2D02A 3H7WB 4IHQA 4CLCE 5F5YA 4F3LA 4CLCB 5IS1A 2HF6A 1P0ZA 4PAUA 3EGDC 4R3AA 2Z6DA 4HY8A 2ZMFA 5HD5A 5HWVA 5DF9A 4G3WA 2JHEA 3LR4A 2IA2A 1S1ZA 2O9CA 4LPZA 3OC2A 4WN5A 2XA7M 4ME4A 3UB9A 4OOLA 2VGLM 3S7QA 3TE8A 2L4RA 4MN5A 3FPWA 2V0UA 4O0PA 4CLCC 4R38A 1X0OA 1P97A 2VLGA 3R7WA 3ZQ5A 3P7NA 3EQVA 3T4OA 4HH3A 5EFWA 5J7EA 4DJ3A 3LR0A 3F1NA 4I38A 3OBFA 5CX7A 3UMEA 2R78A 4XT2A 4DN0A 2Y79A 1OJ5A 2JKTI 1XFNA 4PKYA 1VHMA 3KSFA 2OWJA 3B42A 3VE3A 2J80A 2M1CA 1TF1A 1LT0A 1LSXA 1GSWA 1DP8A 5DJTA 2W3EA 1T1CA 5L8MA 1YSQA 4MMNA 4R6LA 1GSXA 3UB8A 2QWSA 3MFXA 2G7UA 1ODVA 3NHQA 5K5BA 2ZOIA 3MXQA 4P6ZM 4PKYG 2L0WA 1DRMA 1TS0A 1YSPA 2B18A 1S67L 3LI8A 1S1YA 2J3WA 3C30A 3NOPC 1H8MA 1OTEA 2JKRI 3B33A 1JNUA 2PR6A 3FG8A 2INWA 1TS6A 2W0NA 3O5YA 3T50A 5G4ZA 1F98A 1NLYA 3DBAA 2K2NA 4G3KA 2CMNA 5J4EA 2OAQ1 3UB6A 3EOIA 3U2AA 3PBRA 3NOTC 1S4SA 3PHYA 1N9NA 1XJ6A 3PBSA 2W1TB 4F3LB 1TS8A 4NKPA 2DMWA 3FPVA 2KLIA 3CUEC 2PDRA 1N9LA 4LRZE 3UMDA 3KX0X 2QHKA 4IUHA 3EWKA 1UWNX 3BY9A 1YKDA 4BJPA 3KYZA 2M7VA 3E4OA 2NUTC 1NLZA 4RQ9A 4EW7A 2VV8A 2PYPA 4H6JA 3R4KA 3S7PA 4GS9B 2PT7A 4ARZB 4ZRRA 3T4SA 3V67A 4CQHA 1G28A 1LSWA 4Y5FA 5TBMB 5HL6A 5MC7A 2ZOHA 3LIDA 1D06A 3T4KA 4KQOA 3SW1A 4G3VA 4EESA 3PBQA 4K08A 3A0SA 5F69A 1V9ZA 1MZUA 3UE6A 1MKMA 4UQIM 3IS2A 1Y28A 5IT5A 2L1MA 4KUKA 4XT2B 3CAXA 1XJ4A 3OCNA 3C38A 3RFBA 3FC7A 4ETZA 4Q0IA 4HQAA 2WKPA 3RH8B 4NEED 3GECA 2K7SA 4EERA 4NXFA 3EEAA 1OTDA 2JN7A 3K3CA 1DP6A 1OJGA 5TJJA 3PBNA 5DKKA 4L9GA 4DMZA 4M4XA 4PHTA 5AVFA 2OAP1 2PD7A 4BBUA 1IOUA 5HD3A 2A24B 4CLCD 3P01A 3E4QA 1T19A 3F1OB 5DJUA 2P08A 4CLCA 4JGRA 2I9VA 2XA7S 3ICYA 2O99A 1OT6A 2VGLS 3CLOA 4HOIA 3KYQA 4E04A 1OPXA 2HV1A 3BWLA 3LIEA 3S7NA 2VKSA 2KX6A 4I3IA 4I5SA 2EWWA 4I39A 4EU0A 3F1PA 2H28A 3BY8A 4FOFA 4HJ3A 2PYRA 4I3JA 2YKFA 5HWWA 3PR6A 3HJKA 5AVEA 4NXGA 3MR0A 3C2WA 4LRYC 5DFYA 1VB6A 5I5LA 1OTBA 3H82A 5J3WA 2V1BA 4R70A 4O01A 5C5KA 2HJEA 4EEUA 4O8GA 3T4QA 3G6OA 4GHIA 2KOIA 5G4YA 4H6JB 1NRJA 3BQ8A 3MQQA 3VOLA 4I3AA 4NXEA 4Y2FA 3LIFA 4P6ZS 4OOMA 2JKTM 4HNBA 1F9IA 2GJ3A 1OTIA 4KUOA 4WELA 5FL3A 3S7OA 1BYWA 3D3OA 4WLAA 3UB7A 1IFQA 3ULFA 4AFIA 2GNXA 1S66L 3MQOA 1P9RA 3IS2B 4LRXC 4HJ4A 4L0LA 4YNRA 5IU1A 2QJ7A 5F6AA 4BWIA 1N9OA 3JVUA 2J3TC 2WKRA 2HGVA 3LR3A 3CUEA 5HDCA 4HI4A 2A2LA 3D72A 4ETXA 3TJZC 3HCYA 2FH5A 2QYBA 1LSVA 3LIBA 2D01A 3KSHA 1TS7A 2XSSA 1H3QA 2JKRM 3K3DA 3VE4A 5HDDA 3OOVA 2VV6A 1ZHHB 2V0WA 4EETB 1W63M 3R7WB 3TRCA 2GX5A 4MCWA 1D7EA 3VV4A 2Z6CA 3MJQA 3F1NB 2O9AA 3KO6A 5HDSA 1OT9A 3K2NA 2VZWA 1GSVA 5KIZA 3TW8A 5A8BA 3IBJA 2VV7A 4HP9A 4JGPA 2W1TA 4GW9A 2ZMVA 1ZTUA 3E4PA 2QKPA 1KOUA 3LICA 3BQAA 3LUQA 3OCLA 2ZBBA 3PXPA 3BW6A 4B9OA 5KSHA 3W2ZA 1NWZA 4Q0HA 2PD8A 2PHYA 4LLOB 2YKHA 2LB9A 1XFQA 3E98A 3F1PB 3GDIA 4IJGA 4QPRA 4ARZA 2GZAA 4GS9A 3HJIA 4UQIS 1UGUA 4NXBA 3LFVA 5TBMA 3UE3A 2EA9A 3H7WA 3ZYTA 4GCZA 2M7UA 1W63Q 3MMHA 2PR5A 3LR5A 3H82B 4WEKA 2W3HA 1T1BA 4L9FA 3T4TA 4MN7A 2W3FA 3T4LA 3LIAA 1LL8A 1OTAA 4GJ4A 5DFXA 1MC0A 3B47A 4B93A 4GHIB 2BASA 3PBOA 2W3GA 1S4RA 1YAXA 4KQDA 5HSQA 1T1AA 2VA0A 4FSFA 3IBRA 4L9EA 4DJ2A 2P04A 3H9WA 4HHDA 2QJ5A 1DP9A 5HPFA 3RTYA 2O0YA 4WF0A 3C8CA 4EEPA 3EGXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HP4 A;  2WKQ A;  4BBV A;  2V1A A;  2KDK A;  5HWT A;  5HZH A;  3A0V A;  3LYX A;  1WA9 A;  3OLO A;  4WUJ A;  2W27 A;  4MN6 A;  2A24 A;  3F1O A;  3NOU C;  4HIA A;  4JGQ A;  2P7J A;  4WL9 A;  1EW0 A;  5F68 A;  1XJ3 A;  1V9Y A;  4BBT A;  2VEA A;  1XJ2 A;  4YWZ A;  2OWH A;  3CWF A;  2V9A A;  2B02 A;  4HH2 A;  1UWP X;  2OOL A;  3LI9 A;  1T18 A;  3EEH A;  4EQ1 A;  3PYP A;  4JGO A;  5DKL A;  3A0R A;  3NJA A;  4EXO A;  4HJ6 A;  2D02 A;  3H7W B;  5F5Y A;  4F3L A;  5IS1 A;  1P0Z A;  4R3A A;  2Z6D A;  4HY8 A;  5HD5 A;  5HWV A;  2JHE A;  1S1Z A;  4LPZ A;  4WN5 A;  3UB9 A;  2L4R A;  4MN5 A;  2V0U A;  4R38 A;  1X0O A;  1P97 A;  2VLG A;  3ZQ5 A;  3P7N A;  4HH3 A;  5EFW A;  5J7E A;  4DJ3 A;  3F1N A;  4I38 A;  3UME A;  2R78 A;  4XT2 A;  1OJ5 A;  1XFN A;  4PKY A;  2OWJ A;  3VE3 A;  2J80 A;  2M1C A;  1LT0 A;  1LSX A;  1GSW A;  1DP8 A;  5DJT A;  1T1C A;  4R6L A;  1GSX A;  3UB8 A;  2QWS A;  3MFX A;  1ODV A;  3NHQ A;  2ZOI A;  3MXQ A;  4PKY G;  2L0W A;  1DRM A;  1TS0 A;  1S67 L;  3LI8 A;  1S1Y A;  3NOP C;  1OTE A;  3B33 A;  1JNU A;  2PR6 A;  3FG8 A;  2INW A;  1TS6 A;  2W0N A;  3T50 A;  5G4Z A;  1F98 A;  2CMN A;  5J4E A;  3UB6 A;  3NOT C;  1S4S A;  3PHY A;  1N9N A;  1XJ6 A;  4F3L B;  1TS8 A;  2PDR A;  1N9L A;  4LRZ E;  3UMD A;  3KX0 X;  2QHK A;  3EWK A;  1UWN X;  3BY9 A;  3E4O A;  4RQ9 A;  4EW7 A;  2VV8 A;  2PYP A;  4H6J A;  4GS9 B;  1G28 A;  1LSW A;  5TBM B;  2ZOH A;  3LID A;  1D06 A;  3SW1 A;  4EES A;  4K08 A;  3A0S A;  5F69 A;  1V9Z A;  1MZU A;  3UE6 A;  3IS2 A;  1Y28 A;  2L1M A;  4KUK A;  4XT2 B;  3CAX A;  1XJ4 A;  3FC7 A;  4HQA A;  2WKP A;  3RH8 B;  3GEC A;  2K7S A;  4EER A;  4NXF A;  1OTD A;  2JN7 A;  3K3C A;  1DP6 A;  1OJG A;  5DKK A;  4L9G A;  4M4X A;  5AVF A;  2PD7 A;  4BBU A;  5HD3 A;  2A24 B;  3E4Q A;  1T19 A;  3F1O B;  5DJU A;  4JGR A;  2I9V A;  3ICY A;  1OT6 A;  3CLO A;  4HOI A;  4E04 A;  2HV1 A;  3BWL A;  3LIE A;  4I3I A;  2KX6 A;  4I5S A;  4I39 A;  3F1P A;  2H28 A;  3BY8 A;  4HJ3 A;  2PYR A;  4I3J A;  2YKF A;  5HWW A;  3HJK A;  5AVE A;  4NXG A;  3MR0 A;  3C2W A;  4LRY C;  1VB6 A;  5I5L A;  1OTB A;  3H82 A;  5J3W A;  2V1B A;  4R70 A;  4EEU A;  3G6O A;  4GHI A;  5G4Y A;  4H6J B;  3MQQ A;  3VOL A;  4I3A A;  4NXE A;  3LIF A;  4HNB A;  1F9I A;  2GJ3 A;  1OTI A;  4KUO A;  1BYW A;  4WLA A;  3UB7 A;  3ULF A;  1S66 L;  3MQO A;  3IS2 B;  4LRX C;  4HJ4 A;  5IU1 A;  2QJ7 A;  5F6A A;  1N9O A;  2WKR A;  5HDC A;  4HI4 A;  3D72 A;  1LSV A;  3LIB A;  2D01 A;  1TS7 A;  3K3D A;  3VE4 A;  5HDD A;  2VV6 A;  2V0W A;  4EET B;  1D7E A;  2Z6C A;  3MJQ A;  3F1N B;  5HDS A;  1OT9 A;  1GSV A;  5KIZ A;  5A8B A;  2VV7 A;  4HP9 A;  4JGP A;  4GW9 A;  3E4P A;  2QKP A;  1KOU A;  3LIC A;  3LUQ A;  2ZBB A;  4B9O A;  1NWZ A;  2PD8 A;  2PHY A;  4LLO B;  2YKH A;  1XFQ A;  3F1P B;  3GDI A;  4GS9 A;  3HJI A;  1UGU A;  4NXB A;  5TBM A;  2EA9 A;  3H7W A;  4GCZ A;  2PR5 A;  3H82 B;  1T1B A;  4L9F A;  3LIA A;  1LL8 A;  1OTA A;  4GHI B;  2BAS A;  1S4R A;  4KQD A;  5HSQ A;  1T1A A;  4L9E A;  3IBR A;  4DJ2 A;  3H9W A;  4HHD A;  2QJ5 A;  1DP9 A;  3RTY A;  4WF0 A;  3C8C A;  4EEP A; 
#chains in the Genus database with same CATH topology
 4HP4 A;  2Y8H A;  2XRN A;  2IWD A;  3SS4 A;  1DJB A;  5HWT A;  5HZH A;  4OQI A;  3A3E A;  4S2J A;  4X56 A;  3LYX A;  1YM1 A;  4KZ8 A;  1XGJ A;  5E2E A;  1WA9 A;  1HZO A;  1HVB A;  4R23 A;  2GDN A;  4MN6 A;  2XH9 A;  2FFF B;  3NOU C;  3MZD A;  4KZ7 A;  4WEJ A;  1DY6 A;  5AJG A;  2P7J A;  3P98 A;  1CK3 A;  3E0Y A;  3UPN A;  3SH7 A;  5EOO A;  4FUW A;  3ZG5 A;  2G2U A;  3AGE A;  1PFL A;  1V9Y A;  2Y91 A;  3HLB A;  1IKI A;  4DXB A;  3VSL A;  1NZU A;  1YLJ A;  1ES2 A;  2WUQ A;  4OQH A;  1XJ2 A;  4BQM A;  3CWF A;  2B02 A;  3MZF A;  4LEN A;  3KSI A;  2VJW A;  3BFD A;  2ZC5 B;  2WGW B;  2AVX A;  4QB8 A;  3HUM A;  3HRE A;  3EEH A;  1PI5 A;  1G6O A;  4EQ1 A;  2XK1 A;  4Q0J A;  5DKL A;  1K0K A;  4X1M A;  2P9V B;  1YLT A;  2PBD P;  2HDR A;  3BJN A;  5EVE A;  3A3J A;  4Z1W A;  4HJ6 A;  3H7W B;  5F5Y A;  4F3L A;  4Y0U A;  3G2Z A;  4CLC B;  2HF6 A;  5EOE A;  1K6S A;  5EVL A;  1BTL A;  4S2K A;  4IBX A;  5DF9 A;  4OPY A;  4G3W A;  2IWC A;  5BOH A;  4X53 A;  4XXR A;  1YLW A;  3W4P A;  3IHB A;  4WN5 A;  1YT4 A;  4MN5 A;  2XD5 A;  4CLC C;  1FCO A;  4R38 A;  1MPL A;  3R7W A;  4HH3 A;  5EV0 A;  4DJ3 A;  5FQI A;  3F1N A;  1JWP A;  5CED A;  4DN0 A;  1BLS A;  1OJ5 A;  1BUL A;  2JKT I;  1ERQ A;  1VHM A;  2XDM A;  2HP9 A;  2OWJ A;  5EEC A;  1PWG A;  2M1C A;  1TF1 A;  1LSX A;  1GSW A;  4GZB A;  5J8X A;  4EV4 A;  5L8M A;  1YSQ A;  1ODV A;  4RX3 A;  4RA7 A;  2L0W A;  2J7V A;  1MWU A;  4XUX A;  3LI8 A;  3SH8 A;  1Y54 A;  3VFF A;  1PZO A;  2OLU A;  5L09 A;  1NY0 A;  5KZH A;  2EXB A;  3UE0 A;  1OTE A;  2PR6 A;  5DVA A;  4E6X A;  5G4Z A;  1HLU P;  3DBA A;  4KG6 A;  4GD8 A;  4FH2 A;  3RJU A;  4PM8 A;  3B3X A;  3VOY A;  5EVI A;  1YMX A;  3IXG A;  1PW1 A;  1S4S A;  4JF5 A;  1N9N A;  3PBS A;  4B4Z A;  2JC7 A;  3WS4 A;  4JXS A;  4LRZ E;  4R0Q A;  3KX0 X;  4WMC D;  1L0G A;  4IUH A;  4WZ5 C;  1RP5 A;  1M6K A;  5L07 A;  3E4O A;  1K25 A;  4H6J A;  1PNE A;  3S7P A;  1VQQ A;  1IEM A;  3ZGA B;  4ZRR A;  5FQQ A;  5E43 A;  3HUN A;  1JTG A;  3LID A;  4R4R A;  1CJF A;  3BYD A;  2UWX A;  3G32 A;  3PBQ A;  3N8S A;  1V9Z A;  3LCE A;  1FOF A;  4UQI M;  3C38 A;  3C7V A;  4R3J A;  4Q0I A;  3FKW A;  3G34 A;  1A0K A;  3EEA A;  4R3B A;  5DKK A;  4X55 A;  2ZD8 A;  2QZ6 A;  1NRF A;  5AVF A;  2OAP 1;  2PD7 A;  2P9V A;  3ISG A;  2EX9 A;  2XD1 A;  4P85 A;  3MKE A;  3NY4 A;  4CLC A;  4JGR A;  2XA7 S;  3ICY A;  2ZMA A;  1FCN A;  4BL2 A;  2WGV A;  3LIE A;  5FI7 A;  2WZZ A;  4I3I A;  3IXB A;  1FSW A;  3OPR A;  4EU0 A;  3UN7 A;  3A3D A;  4HJ3 A;  5FEG A;  3PR6 A;  3FV7 A;  3MR0 A;  2ZQ7 A;  3T1X A;  5I5L A;  4X6T A;  4OQ0 A;  4MEZ A;  2VGJ A;  4OLD A;  3WS0 A;  3WS5 A;  1ES3 A;  5C5K A;  4RVA A;  4GHI A;  2KOI A;  3UY6 A;  2ZQD A;  3IWQ A;  1Z09 A;  3VOL A;  1K55 A;  4DKI A;  1L0D A;  4Y2F A;  3LIF A;  1SZV A;  3S4X A;  4PM7 A;  1OTI A;  5GL9 A;  1YLY A;  1LHY A;  1S66 L;  3IS2 B;  3GVB A;  4LRX C;  4Y0O A;  3RXW A;  4L0L A;  5DTT A;  2QJ7 A;  1LL9 A;  3NBL A;  1PYY A;  2A2L A;  1I2S A;  4QHC A;  4PM9 A;  3VOZ A;  3TJZ C;  4GD6 A;  2WZX A;  2XSS A;  1H3Q A;  3VE4 A;  2E8I A;  5HDD A;  3NDG A;  2JKF A;  1W63 M;  4ZJ3 A;  3TRC A;  4MCW A;  3VP3 A;  3MJQ A;  1OT9 A;  4QJG A;  1GSV A;  3G31 A;  3BFE A;  1K56 D;  4JGP A;  4GW9 A;  2ZMV A;  1ALQ A;  4DDS A;  3BQA A;  1VEU B;  3HL9 A;  2PU2 A;  2ZBB A;  3OCL A;  5M18 A;  3VP1 A;  3W2Z A;  2Y55 A;  5HL1 A;  3VP4 A;  3N7W A;  2PHY A;  2LB9 A;  5I94 A;  3AGF A;  3JPU A;  3UE1 A;  3BEB A;  5HAQ A;  3Q7V B;  3UE3 A;  2EA9 A;  4WEK A;  2W3H A;  5FEF A;  1TEM A;  2A49 A;  3T4L A;  4S2P A;  4BEN A;  1KVL A;  1LL8 A;  5U47 A;  4QD4 A;  1YAX A;  5TGF A;  3GR2 A;  4OP8 A;  3HLD A;  3LO7 A;  4WZ4 A;  5F1F A;  4A5R A;  2ACG A;  5HPF A;  1GHI A;  3C8C A;  3L9K A;  2ZL1 B;  2WKQ A;  2NUP C;  4BBV A;  2ZC4 B;  3GV9 A;  5L2F A;  5GLC A;  1M40 A;  1SDN A;  2J8Y A;  5AQ9 A;  3ZVW A;  2VX8 A;  5D3O A;  1VET B;  3U4L P;  4JGQ A;  5HPI A;  4LFU A;  3GTC A;  5LBR A;  2VK3 A;  3ZVT A;  4BMW A;  1EW0 A;  2WK0 A;  5TR7 A;  3OPL A;  3HLW A;  4MLL A;  2WAF A;  4BBT A;  3M2K A;  3TSG A;  2V9A A;  4R1G A;  2Y2N A;  1FIL A;  3MQ0 A;  1UWP X;  3SH9 A;  2OOL A;  4YOF A;  4BD0 A;  4NG2 A;  3VP2 A;  1JWV A;  1SKO B;  2XGN A;  3ZCZ A;  1KGE A;  3A0R A;  1LI9 A;  4NET A;  3WS1 A;  1STZ A;  4E3O A;  1KDW A;  4Y3I A;  1PWD A;  1J3W A;  2WKE A;  3C7U A;  1QME A;  3E2L A;  5HW3 A;  5IS1 A;  3BFG A;  4QY6 A;  1P0Z A;  3EGD C;  4E3J A;  3N8L A;  4HY8 A;  5HWV A;  3LR4 A;  1K38 A;  3V50 A;  4OPZ A;  4UA9 A;  4LPZ A;  3UPP A;  3OC2 A;  1GHM A;  4PPR A;  4OOL A;  4QY5 A;  5FAO A;  4DE0 A;  1YPR A;  3QHY A;  2X71 A;  2V0U A;  3UPO A;  1U60 A;  4JPM A;  1X0O A;  1P97 A;  1K54 A;  5EM1 A;  5EFW A;  5J7E A;  1XA1 A;  4XT2 A;  3HBR A;  2Y79 A;  5CHM A;  3VE3 A;  3BRM A;  1ZC2 A;  3T1Q B;  1PWC A;  4OLG A;  1VEU A;  4MMN A;  1GSX A;  3UB8 A;  1JVJ A;  4JXW A;  3BM6 A;  4NK3 A;  1DRM A;  1TS0 A;  3UDX A;  2XFS A;  1YSP A;  3NOP C;  1HTZ A;  2V1Z A;  4GN2 A;  3FG8 A;  1VM1 A;  2INW A;  4JKT A;  1TS6 A;  3O5Y A;  4OQG A;  3D4F A;  1F98 A;  4DE3 A;  1Z6F A;  3CG5 A;  4N9K A;  5J4E A;  2RCX A;  5CGW A;  1XJ6 A;  3CPT A;  3VMA A;  1TS8 A;  2DMW A;  3FPV A;  2KLI A;  3UMD A;  2OSU A;  3EWK A;  4F94 A;  4BJP A;  1TDL A;  5A93 A;  2V8F A;  1MBL A;  3JYI A;  3KYZ A;  3OZH A;  3SOI A;  4EW7 A;  3R4K A;  5CER A;  4EQI A;  1ZG6 A;  2XF3 A;  5CXW A;  3IX4 A;  3V67 A;  3FYZ A;  3MZE A;  4Y0T A;  3HLC A;  5MC7 A;  4IVI A;  3T4K A;  4EES A;  2HZ5 A;  3V3R A;  3UE6 A;  1LI0 A;  3O87 A;  1MKM A;  4LGW A;  4U3T A;  3PAE A;  4DRT A;  4DE2 A;  4EWF A;  5IT5 A;  1KVM A;  4HQA A;  2WKP A;  3V5M A;  2HDU A;  1OTD A;  3K3C A;  2IWB A;  1OJG A;  4IVK A;  1ERM A;  5TJJ A;  1SKO A;  1FSY A;  4P6B A;  3GMW A;  1XKZ A;  4S2N C;  4BBU A;  2H0T A;  2JE5 A;  4UAA A;  3P01 A;  1G6A A;  3DW0 A;  3E4Q A;  1KGF A;  3OPH A;  3QNC A;  2QPN A;  2VGL S;  3SS5 A;  3CLO A;  4HOI A;  2ZQ9 A;  2HV1 A;  1HD8 A;  3S7N A;  2KX6 A;  4I5S A;  4PM6 A;  3SZT A;  4I39 A;  1BT5 A;  3F1P A;  4LV1 A;  4N9L A;  4FOF A;  2OV5 A;  1ONG A;  3M6B A;  4RX2 A;  5AVE A;  4LRY C;  5DFY A;  2PAV P;  4PMA A;  4O01 A;  4B4X A;  2WAE A;  5FI2 A;  4Y17 A;  2HJE A;  5IHV A;  4O8G A;  3T4Q A;  3WS2 A;  5DTK A;  3G6O A;  2HP6 A;  3TG9 A;  4O7D A;  1ES5 A;  5EUA A;  3HLF A;  3ZHH A;  3BQ8 A;  3MQQ A;  4I3A A;  5A91 A;  3W4O A;  1YLP A;  4P6Z S;  4OOM A;  3LY3 A;  2GJ3 A;  3NDE A;  3DTK A;  4PM5 A;  2HPB A;  2ZQA A;  5FL3 A;  3S7O A;  3TOI A;  3D3O A;  3UB7 A;  2Z2M B;  1IFQ A;  3G35 A;  3MQO A;  4S2I A;  3LY4 A;  4FTX A;  4OPR A;  1CEF A;  4YNR A;  1IYS A;  5IU1 A;  5FI6 A;  3IWO A;  2ZM0 A;  3D72 A;  3HCY A;  2HDQ A;  2PU4 A;  3VSK A;  3K3D A;  1E4D A;  2BLS A;  5CEC A;  2VV6 A;  3Q81 A;  1D7E A;  3VV4 A;  1YMS A;  4FD8 A;  3O86 A;  1NZO A;  3W8K A;  3BLM A;  5HDS A;  3K2N A;  3IF5 A;  5KIZ A;  1ONH A;  5DF7 A;  3IBJ A;  3UB5 P;  3DTM A;  2CC1 A;  4HP9 A;  4N1X A;  3E4P A;  1KOU A;  4HBT A;  3I7J A;  3IT9 A;  2WGW A;  3BW6 A;  1NWZ A;  2PD8 A;  2WKI A;  1XA7 A;  5JYO A;  1W79 A;  4B88 A;  1UGU A;  3GSG A;  4D60 A;  1WYB A;  3H7W A;  2M7U A;  3MMH A;  1IYQ A;  3LR5 A;  4JXV A;  3H82 B;  1IYP A;  1T1B A;  3OPP A;  3T4T A;  4MN7 A;  3NI9 A;  3HVF A;  1OTA A;  4GJ4 A;  4B93 A;  3PBO A;  1S4R A;  3T1S A;  2JBF A;  4FSF A;  4MNR A;  4DJ2 A;  5M19 A;  1FQG A;  3H9W A;  4HHD A;  2DNS A;  3DWK A;  2QJ5 A;  5AQA A;  3V3S A;  1K57 C;  3RTY A;  4GB7 A;  2J9O A;  1H5X A;  2Y2K A;  4XUZ A;  2V1A A;  2RL3 A;  3KSG A;  3LEZ A;  3CI6 A;  5G18 A;  1CI9 A;  2WGI A;  3CMZ A;  3CIT A;  2ZQC A;  4YFM A;  3Q7Z A;  2MJ6 A;  3IH8 A;  4WL9 A;  1AWI A;  5EVI D;  4LV3 A;  1PRQ A;  3MF0 A;  2LB5 A;  2XRO A;  5CRF A;  5HFO A;  2OWH A;  1L2S A;  2K31 A;  3MKF A;  3E2K A;  4HH2 A;  2Y2H A;  4WZ5 A;  4WYY A;  1I2W A;  2V8C A;  4KG2 A;  3LI9 A;  1Y4O A;  3CJM A;  3QNB A;  1K6R A;  1YLZ A;  3BFC A;  1O7E A;  3D9Y A;  3NJA A;  2OLV A;  4MBH A;  4D2O A;  3MS6 A;  1TD5 A;  4ID4 A;  4II7 A;  2D02 A;  4CLC E;  4IHQ A;  1NYY A;  2Z2L B;  3L7H A;  1FCM A;  2Z6D A;  2WKH A;  4ZJ2 A;  4P0M A;  3MFD A;  1W7F A;  1G68 A;  1MWT A;  2X01 A;  2Y2L A;  1AXB A;  1G5U A;  2XA7 M;  3S7Q A;  3IX8 A;  3TE8 A;  1BZA A;  2L4R A;  3V39 A;  1DJA A;  1E25 A;  4O0P A;  5FAQ A;  3ZQ5 A;  3EQV A;  5EE8 A;  1SKF A;  3LR0 A;  1SHV A;  3RXX A;  5FQK A;  2R78 A;  4KZB A;  3UNW A;  1L3L A;  1XFN A;  2PRF A;  2R9W A;  3KSF A;  4KZ5 A;  5HAP A;  1J9M A;  2BG1 A;  5DJT A;  4R6L A;  4ESP A;  3VFH A;  1S6R A;  2QWS A;  3NHQ A;  3MXQ A;  1SDE A;  1GCE A;  4DF6 A;  2B18 A;  4OKP A;  1S1Y A;  2J3W A;  1MWR A;  1H8M A;  5GLA A;  5A92 A;  2X02 A;  4KZA A;  5HAI A;  1JNU A;  2ZC6 B;  1K4F A;  4ZJ1 A;  2WAD A;  4KZ6 A;  4CJN A;  2W0N A;  5FAP A;  4K0W A;  4IBR A;  2C5W B;  1NLY A;  5GLD A;  1JTD A;  4UA7 A;  1S0W A;  4G3K A;  2CMN A;  4KQR A;  3UB6 A;  3EOI A;  3U2A A;  1ZG4 A;  1NXY A;  3PHY A;  3UO9 A;  1MXO A;  4F3L B;  1RGZ A;  3IQA A;  3HUO A;  3CUE C;  2PDR A;  1N9L A;  1PIO A;  4LCM A;  1KE3 A;  4E6W A;  1XPB A;  1NLZ A;  4ARZ B;  2PT7 A;  3ZG9 B;  3T4S A;  4Y5F A;  5TBM B;  3DTI A;  5HL6 A;  1I5Q A;  4UHU A;  4KQO A;  3WRZ A;  3SW1 A;  5F69 A;  1MZU A;  3N6I A;  1W5D A;  3QP5 A;  3IS2 A;  5FQ9 A;  2L1M A;  3CAX A;  3RH8 B;  4EBP A;  4NEE D;  3GEC A;  4NXF A;  1GA0 A;  2H10 A;  4C3Q A;  3PAG A;  3PBN A;  4DMZ A;  4M4X A;  4PHT A;  4OON A;  4FCF A;  4RYE A;  1IOU A;  2A24 B;  4E3N A;  3ZDJ A;  1PZP A;  3F1O B;  5DJU A;  2P08 A;  4DDY A;  1C3B A;  3A3I A;  4LV2 A;  2O99 A;  1OT6 A;  1RCJ A;  4H8R A;  3BWL A;  3T12 B;  4OVD A;  5CTN A;  5EVI B;  1MY8 A;  3DTE A;  2YKF A;  3HJK A;  4GOG A;  4FH4 A;  4Q8I A;  5GLB A;  3Q7V A;  3C2W A;  1IKG A;  3QP2 A;  3ZG7 B;  2V1B A;  4R70 A;  1D1J A;  1LLB A;  5GHY A;  5FAS A;  1PI4 A;  4WBG A;  3ZFZ A;  4H6J B;  1NRJ A;  1SCW A;  4ZAM A;  2B95 A;  4NXE A;  1KE0 A;  3O3V A;  1CEG A;  5EVI C;  1F9I A;  1N4O A;  1RGY A;  4KUO A;  4WEL A;  5AQ7 A;  2ZL1 A;  5CHU A;  4JF4 A;  4WLA A;  3ULF A;  5DF8 A;  4AFI A;  1E3U D;  2Q0O A;  4WMC A;  1FIK A;  5F6A A;  3JVU A;  4DE1 A;  2WKR A;  2HGV A;  3LR3 A;  1GA9 A;  3CUE A;  5HDC A;  4ETX A;  1VET A;  1LSV A;  4C6Y A;  3KSH A;  1TS7 A;  3CHW P;  2JKR M;  3Q1F A;  5GHZ A;  2EX2 A;  3HLE A;  1OME A;  2Z6C A;  1JWZ A;  1CF0 A;  1EWZ A;  2ZLY A;  3S1Y A;  5A8B A;  3UDF A;  4GDN A;  4BD1 A;  5FAT A;  2BTF P;  4UA6 A;  5F1G A;  2QKP A;  3A3F A;  5CTM A;  3PXP A;  4B9O A;  5KSH A;  2Y2O A;  2HP5 A;  3SS3 A;  4X68 A;  1XX2 A;  2YKH A;  4KZ4 A;  1XFQ A;  4IJG A;  4ARZ A;  2GZA A;  3IX3 A;  4UQI S;  4NXB A;  1ESU A;  1L0E A;  3IH9 A;  5TBM A;  4KQQ A;  1LL5 A;  1Q2P A;  2Q9M A;  1ERO A;  2PR5 A;  2V2F F;  4OH0 A;  3NIA A;  4ZDX A;  3IXH A;  3LIA A;  4JLF A;  5DFX A;  1MC0 A;  4GHI B;  2BAS A;  1W8Y A;  5FQM A;  3PTE A;  3T1R A;  4U0X A;  3LGO A;  4S2O A;  5L10 A;  4KEN B;  1GHP A;  4BLM A;  1DP9 A;  4EEP A;  4HEF A;  1NYM A;  2EFU A;  2KDK A;  1WYC A;  3A0V A;  2ZQ8 A;  4EUZ A;  3OLO A;  4WUJ A;  2W27 A;  2A24 A;  2Y2Q A;  1MKI A;  3F1O A;  4GLQ A;  1K55 C;  3NCK A;  4HIA A;  3M2J A;  3T4J A;  2O9B A;  4MDZ A;  2ZC7 A;  1XP4 A;  5CHJ A;  4IED A;  5F68 A;  1XJ3 A;  5E2G A;  2G2W A;  4MBF A;  2VEA A;  3C5A A;  1FR6 A;  4EUV A;  1P9W A;  4YWZ A;  4YIN A;  4IUK A;  3WWX A;  2XR0 A;  3ZG8 B;  2FFY A;  1ESI A;  1BLP A;  4UEY A;  3EQU A;  4GNU A;  3C4P A;  2J3T D;  2W1R A;  1T18 A;  3JVV A;  3PYP A;  2FZ0 A;  2EWV A;  1BLH A;  5F82 A;  4JGO A;  3ITA A;  4X1L A;  2P74 A;  2EX8 A;  1F5M A;  3ITB A;  3O88 A;  4LCL A;  2W3D A;  3PBT A;  4EXO A;  3FZC A;  2EXA A;  2HJ9 C;  1CQA A;  1K56 A;  3C4O A;  4PAU A;  4R3A A;  5JYP A;  2ZMF A;  1WE4 A;  5HD5 A;  1QMF A;  4JBF A;  2H5S A;  4P87 A;  2JHE A;  2IA2 A;  4HES A;  1S1Z A;  1BUE A;  2O9C A;  3GRJ A;  1PW8 A;  4ME4 A;  3UB9 A;  3FKV A;  2Y2J A;  2VGL M;  1DJC A;  3IWI A;  4E3K A;  3FPW A;  1KE4 A;  1ZKJ A;  2PBY A;  2VLG A;  4S2N A;  2J9P A;  3P7N A;  5FA7 A;  3T4O A;  3DWZ A;  4QU3 A;  4I38 A;  3OBF A;  3MBZ A;  5EM0 A;  1TDG A;  4GDB A;  5FDH A;  5CX7 A;  3UME A;  4WM9 A;  4PKY A;  3QP6 A;  3B42 A;  2J80 A;  1LT0 A;  3W4Q A;  1DP8 A;  2W3E A;  1T1C A;  4E3L A;  2C6W B;  3MFX A;  2G7U A;  1IEL A;  5K5B A;  2ZOI A;  4P6Z M;  4PKY G;  3IXD A;  1KDS A;  1S67 L;  2JKG A;  3C30 A;  5E2H A;  4KZ3 A;  2JKR I;  1W8Q A;  3B33 A;  4E3I A;  4C75 A;  3HLG A;  2ZM2 A;  2Y59 A;  3MXR A;  3KYE A;  4EBL A;  3T50 A;  5CEB A;  2K2N A;  2Y2I A;  4ZTK A;  3NC8 A;  2UV0 E;  2OAQ 1;  3QP1 A;  5KSC A;  3PBR A;  3NOT C;  3BLS A;  4N1H A;  3NEC A;  2W1T B;  5F83 A;  4Z9Q A;  4NKP A;  2VGK A;  1XGI A;  5FQJ A;  3ZNY A;  3G30 A;  4KG5 A;  2QHK A;  1K4E A;  3UDI A;  2H0Y A;  4S2M A;  5M1A A;  1UWN X;  5CGX A;  1H8Y A;  3BY9 A;  1YKD A;  2M7V A;  1H8Z A;  3Q07 A;  2NUT C;  4RQ9 A;  2VV8 A;  2PYP A;  5GHX A;  4GS9 B;  4CPK A;  4CQH A;  1G28 A;  4JXG A;  1LSW A;  2ZOH A;  3IF6 B;  1D06 A;  3S22 A;  1CI8 A;  4G3V A;  3BFF A;  4K08 A;  3A0S A;  1H0M A;  2I72 A;  1Y28 A;  3WRT A;  2XEP A;  4KUK A;  4XT2 B;  3Q82 A;  1XJ4 A;  3OCN A;  3RFB A;  5A90 A;  3FC7 A;  4KZ9 A;  4ETZ A;  2ZJ9 A;  2JCH A;  3DAV A;  2K7S A;  4EER A;  1L0F A;  2JN7 A;  2WYX A;  2ZC3 B;  1DP6 A;  3NUL A;  3IF6 C;  4L9G A;  5AQB A;  5HAR A;  1BLC A;  3N8R A;  5TFQ A;  1K54 C;  4QWO A;  3MXS A;  5HD3 A;  4CLC D;  3ZG0 A;  1F2K A;  4Y15 A;  1T19 A;  4BL3 A;  2B5R A;  4MBK A;  2I9V A;  3KYQ A;  3G2Y A;  1OPX A;  4R4S A;  4E04 A;  4EBN A;  3QP4 A;  1ACF A;  2VKS A;  5HX9 A;  4DXC A;  2EWW A;  3LEQ A;  2H28 A;  3BY8 A;  2PYR A;  1KGG A;  4I3J A;  5HWW A;  2DRW A;  4GKU A;  3CPT B;  1K57 A;  4NXG A;  4S2L A;  1VB6 A;  4Y13 A;  1OTB A;  1XXM A;  3MSH A;  3H82 A;  5J3W A;  4OP5 A;  4EEU A;  3AGD A;  4HBU A;  1EI5 A;  5G4Y A;  3G4P A;  4OOY A;  1IYO A;  3FWL A;  1N9B A;  2V20 A;  3ZNT A;  2JKT M;  4HNB A;  3N4I A;  4OPQ A;  1O07 A;  1BYW A;  2GNX A;  1P9R A;  4HJ4 A;  2HDS A;  2Y2P A;  3CZD A;  3GQZ A;  1E3U A;  2Q9N A;  4BWI A;  1N9O A;  2J3T C;  2XFT A;  5EPH A;  3QP8 A;  4HI4 A;  3BEC A;  2EX6 A;  5FSR A;  2DCF A;  2FH5 A;  2QYB A;  3LIB A;  2D01 A;  1YQS A;  3OOV A;  2A3U A;  1ZHH B;  2V0W A;  4EET B;  3R7W B;  1TVF A;  2GX5 A;  4JF6 A;  2EFX A;  3F1N B;  2O9A A;  3KO6 A;  2QMI A;  4ZBE A;  4U0T A;  2VZW A;  2R9X A;  3P09 A;  3M6H A;  3TW8 A;  4LV0 A;  2VV7 A;  2W1T A;  4M3K A;  1ZTU A;  3LIC A;  3LUQ A;  1FR1 A;  2Y4A A;  2ZM8 A;  5FDS A;  2XLN A;  4Q0H A;  4LLO B;  4K91 A;  3F1P B;  3E98 A;  3GDI A;  4QPR A;  4GS9 A;  2E8J A;  2Y2M A;  3HJI A;  4Y7P A;  3LFV A;  2XQZ A;  4N92 A;  3ZYT A;  3IF6 A;  4GCZ A;  1W63 Q;  4X69 A;  4L9F A;  5E2F A;  2W3F A;  2Y2G A;  5KMW A;  3B47 A;  2W3G A;  4X25 A;  5CGS A;  4KQD A;  5HSQ A;  1BSG A;  1T1A A;  3IHA A;  2VA0 A;  4E3M A;  4L9E A;  3IBR A;  2P04 A;  1ES4 A;  1NJ4 A;  3VP0 A;  5DTS A;  4K0X A;  1Q2Q A;  1MWS A;  2O0Y A;  4WF0 A;  3EGX C; 
#chains in the Genus database with same CATH homology
 4HP4 A;  2WKQ A;  2NUP C;  4BBV A;  2Y8H A;  2XRN A;  2V1A A;  2KDK A;  3KSG A;  5HWT A;  5HZH A;  3A0V A;  3CI6 A;  3LYX A;  1WA9 A;  3CIT A;  3OLO A;  4WUJ A;  2W27 A;  4MN6 A;  2A24 A;  2VX8 A;  3F1O A;  4GLQ A;  2MJ6 A;  3NOU C;  4HIA A;  4WEJ A;  4JGQ A;  5HPI A;  3T4J A;  2O9B A;  5LBR A;  5AJG A;  2P7J A;  4WL9 A;  4MDZ A;  4BMW A;  1EW0 A;  3E0Y A;  5F68 A;  1XJ3 A;  1V9Y A;  4BBT A;  2VEA A;  3MF0 A;  2LB5 A;  4EUV A;  1P9W A;  2XRO A;  1XJ2 A;  4YWZ A;  2OWH A;  3CWF A;  4IUK A;  2V9A A;  2B02 A;  2K31 A;  4HH2 A;  3MQ0 A;  1UWP X;  3KSI A;  2VJW A;  4UEY A;  3EQU A;  2OOL A;  4YOF A;  2J3T D;  2W1R A;  3LI9 A;  1T18 A;  3EEH A;  1G6O A;  4EQ1 A;  3JVV A;  3PYP A;  2FZ0 A;  2EWV A;  4Q0J A;  4JGO A;  5DKL A;  3A0R A;  3NJA A;  1F5M A;  2W3D A;  3PBT A;  1STZ A;  4EXO A;  3BJN A;  4Z1W A;  4HJ6 A;  2HJ9 C;  4Y3I A;  1TD5 A;  4II7 A;  2D02 A;  3H7W B;  4IHQ A;  4CLC E;  5F5Y A;  4F3L A;  4CLC B;  5IS1 A;  2HF6 A;  1P0Z A;  4PAU A;  3EGD C;  4R3A A;  2Z6D A;  4HY8 A;  2ZMF A;  5HD5 A;  5HWV A;  5DF9 A;  4G3W A;  2JHE A;  3LR4 A;  2IA2 A;  1S1Z A;  2O9C A;  4LPZ A;  3OC2 A;  4WN5 A;  2XA7 M;  4ME4 A;  3UB9 A;  4OOL A;  2VGL M;  3S7Q A;  3TE8 A;  2L4R A;  4MN5 A;  3FPW A;  2V0U A;  4O0P A;  4CLC C;  4R38 A;  1X0O A;  1P97 A;  2VLG A;  3R7W A;  3ZQ5 A;  3P7N A;  3EQV A;  3T4O A;  4HH3 A;  5EFW A;  5J7E A;  4DJ3 A;  3LR0 A;  3F1N A;  4I38 A;  3OBF A;  5CX7 A;  3UME A;  2R78 A;  4XT2 A;  4DN0 A;  2Y79 A;  1OJ5 A;  2JKT I;  1XFN A;  4PKY A;  1VHM A;  3KSF A;  2OWJ A;  3B42 A;  3VE3 A;  2J80 A;  2M1C A;  1TF1 A;  1LT0 A;  1LSX A;  1GSW A;  1DP8 A;  5DJT A;  2W3E A;  1T1C A;  5L8M A;  1YSQ A;  4MMN A;  4R6L A;  1GSX A;  3UB8 A;  2QWS A;  3MFX A;  2G7U A;  1ODV A;  3NHQ A;  5K5B A;  2ZOI A;  3MXQ A;  4P6Z M;  4PKY G;  2L0W A;  1DRM A;  1TS0 A;  1YSP A;  2B18 A;  1S67 L;  3LI8 A;  1S1Y A;  2J3W A;  3C30 A;  3NOP C;  1H8M A;  1OTE A;  2JKR I;  3B33 A;  1JNU A;  2PR6 A;  3FG8 A;  2INW A;  1TS6 A;  2W0N A;  3O5Y A;  3T50 A;  5G4Z A;  1F98 A;  1NLY A;  3DBA A;  2K2N A;  4G3K A;  2CMN A;  5J4E A;  2OAQ 1;  3UB6 A;  3EOI A;  3U2A A;  3PBR A;  3NOT C;  1S4S A;  3PHY A;  1N9N A;  1XJ6 A;  3PBS A;  2W1T B;  4F3L B;  1TS8 A;  4NKP A;  2DMW A;  3FPV A;  2KLI A;  3CUE C;  2PDR A;  1N9L A;  4LRZ E;  3UMD A;  3KX0 X;  2QHK A;  4IUH A;  3EWK A;  1UWN X;  3BY9 A;  1YKD A;  4BJP A;  3KYZ A;  2M7V A;  3E4O A;  2NUT C;  1NLZ A;  4RQ9 A;  4EW7 A;  2VV8 A;  2PYP A;  4H6J A;  3R4K A;  3S7P A;  4GS9 B;  2PT7 A;  4ARZ B;  4ZRR A;  3T4S A;  3V67 A;  4CQH A;  1G28 A;  1LSW A;  4Y5F A;  5TBM B;  5HL6 A;  5MC7 A;  2ZOH A;  3LID A;  1D06 A;  3T4K A;  4KQO A;  3SW1 A;  4G3V A;  4EES A;  3PBQ A;  4K08 A;  3A0S A;  5F69 A;  1V9Z A;  1MZU A;  3UE6 A;  1MKM A;  4UQI M;  3IS2 A;  1Y28 A;  5IT5 A;  2L1M A;  4KUK A;  4XT2 B;  3CAX A;  1XJ4 A;  3OCN A;  3C38 A;  3RFB A;  3FC7 A;  4ETZ A;  4Q0I A;  4HQA A;  2WKP A;  3RH8 B;  4NEE D;  3GEC A;  2K7S A;  4EER A;  4NXF A;  3EEA A;  1OTD A;  2JN7 A;  3K3C A;  1DP6 A;  1OJG A;  5TJJ A;  3PBN A;  5DKK A;  4L9G A;  4DMZ A;  4M4X A;  4PHT A;  5AVF A;  2OAP 1;  2PD7 A;  4BBU A;  1IOU A;  5HD3 A;  2A24 B;  4CLC D;  3P01 A;  3E4Q A;  1T19 A;  3F1O B;  5DJU A;  2P08 A;  4CLC A;  4JGR A;  2I9V A;  2XA7 S;  3ICY A;  2O99 A;  1OT6 A;  2VGL S;  3CLO A;  4HOI A;  3KYQ A;  4E04 A;  1OPX A;  2HV1 A;  3BWL A;  3LIE A;  3S7N A;  2VKS A;  2KX6 A;  4I3I A;  4I5S A;  2EWW A;  4I39 A;  4EU0 A;  3F1P A;  2H28 A;  3BY8 A;  4FOF A;  4HJ3 A;  2PYR A;  4I3J A;  2YKF A;  5HWW A;  3PR6 A;  3HJK A;  5AVE A;  4NXG A;  3MR0 A;  3C2W A;  4LRY C;  5DFY A;  1VB6 A;  5I5L A;  1OTB A;  3H82 A;  5J3W A;  2V1B A;  4R70 A;  4O01 A;  5C5K A;  2HJE A;  4EEU A;  4O8G A;  3T4Q A;  3G6O A;  4GHI A;  2KOI A;  5G4Y A;  4H6J B;  1NRJ A;  3BQ8 A;  3MQQ A;  3VOL A;  4I3A A;  4NXE A;  4Y2F A;  3LIF A;  4P6Z S;  4OOM A;  2JKT M;  4HNB A;  1F9I A;  2GJ3 A;  1OTI A;  4KUO A;  4WEL A;  5FL3 A;  3S7O A;  1BYW A;  3D3O A;  4WLA A;  3UB7 A;  1IFQ A;  3ULF A;  4AFI A;  2GNX A;  1S66 L;  3MQO A;  1P9R A;  3IS2 B;  4LRX C;  4HJ4 A;  4L0L A;  4YNR A;  5IU1 A;  2QJ7 A;  5F6A A;  4BWI A;  1N9O A;  3JVU A;  2J3T C;  2WKR A;  2HGV A;  3LR3 A;  3CUE A;  5HDC A;  4HI4 A;  2A2L A;  3D72 A;  4ETX A;  3TJZ C;  3HCY A;  2FH5 A;  2QYB A;  1LSV A;  3LIB A;  2D01 A;  3KSH A;  1TS7 A;  2XSS A;  1H3Q A;  2JKR M;  3K3D A;  3VE4 A;  5HDD A;  3OOV A;  2VV6 A;  1ZHH B;  2V0W A;  4EET B;  1W63 M;  3R7W B;  3TRC A;  2GX5 A;  4MCW A;  1D7E A;  3VV4 A;  2Z6C A;  3MJQ A;  3F1N B;  2O9A A;  3KO6 A;  5HDS A;  1OT9 A;  3K2N A;  2VZW A;  1GSV A;  5KIZ A;  3TW8 A;  5A8B A;  3IBJ A;  2VV7 A;  4HP9 A;  4JGP A;  2W1T A;  4GW9 A;  2ZMV A;  1ZTU A;  3E4P A;  2QKP A;  1KOU A;  3LIC A;  3BQA A;  3LUQ A;  3OCL A;  2ZBB A;  3PXP A;  3BW6 A;  4B9O A;  5KSH A;  3W2Z A;  1NWZ A;  4Q0H A;  2PD8 A;  2PHY A;  4LLO B;  2YKH A;  2LB9 A;  1XFQ A;  3E98 A;  3F1P B;  3GDI A;  4IJG A;  4QPR A;  4ARZ A;  2GZA A;  4GS9 A;  3HJI A;  4UQI S;  1UGU A;  4NXB A;  3LFV A;  5TBM A;  3UE3 A;  2EA9 A;  3H7W A;  3ZYT A;  4GCZ A;  2M7U A;  1W63 Q;  3MMH A;  2PR5 A;  3LR5 A;  3H82 B;  4WEK A;  2W3H A;  1T1B A;  4L9F A;  3T4T A;  4MN7 A;  2W3F A;  3T4L A;  3LIA A;  1LL8 A;  1OTA A;  4GJ4 A;  5DFX A;  1MC0 A;  3B47 A;  4B93 A;  4GHI B;  2BAS A;  3PBO A;  2W3G A;  1S4R A;  1YAX A;  4KQD A;  5HSQ A;  1T1A A;  2VA0 A;  4FSF A;  3IBR A;  4L9E A;  4DJ2 A;  2P04 A;  3H9W A;  4HHD A;  2QJ5 A;  1DP9 A;  5HPF A;  3RTY A;  2O0Y A;  4WF0 A;  3C8C A;  4EEP A;  3EGX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...