3BY8A

Crystal structure of the e.coli dcus sensor domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Sensor protein dcuS
total genus 41
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17203 sCache_3_2 Single cache domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by8A00
5J7EA 1EW0A 2PHYA 5IS1A 3E4PA 1TS7A 4HQAA 4BBTA 4HJ4A 1KOUA 3ICYA 3A0SA 5HDSA 5HD3A 5HWWA 2VV6A 5AVFA 3E4OA 5IU1A 5TBMB 1XFQA 2L4RA 1S4SA 2JN7A 3IS2A 1T1CA 1F98A 2H28A 2ZOHA 4WUJA 4XT2B 4EEPA 2WKRA 2OWHA 3EWKA 3FG8A 3HJIA 3IS2B 3FC7A 4I38A 4L9GA 4R6LA 4EQ1A 1GSVA 1S4RA 5HWTA 3UB8A 3ZQ5A 3KX0X 2D02A 1XJ6A 4GHIB 3C8CA 2VV7A 4GW9A 4R3AA 2WKQA 4PKYG 4WLAA 1XFNA 3H82A 3RH8B 4EW7A 2ZBBA 2Z6DA 3NOUC 3H82B 5I5LA 4DJ2A 4EETB 5HDDA 2INWA 2R78A 2PYPA 3OLOA 2KDKA 2YKFA 5F6AA 3VOLA 5KIZA 1S67L 1P97A 2V9AA 5TBMA 3LIBA 3GECA 2W0NA 1S1ZA 3A0RA 2HV1A 3CLOA 3F1PA 3LIDA 4JGPA 4WN5A 5DJUA 3UB9A 4B9OA 3T50A 5HSQA 1N9OA 1DP6A 1OTAA 4MN5A 4EEUA 2L1MA 4HH2A 1DP9A 2OOLA 2EA9A 1F9IA 5F68A 3UE6A 2I9VA 2CMNA 4R70A 3SW1A 1LL8A 2BASA 1T1BA 1XJ3A 2D01A 3HJKA 1WA9A 3F1PB 3NHQA 3LIEA 4K08A 1GSXA 3UMDA 2KX6A 1UWPX 1VB6A 5HZHA 4XT2A 1DRMA 4H6JA 1S66L 4BBVA 5DKKA 1MZUA 3H7WA 4GCZA 3P7NA 1XJ2A 2L0WA 4I3AA 5G4YA 3BWLA 4I3IA 4L9FA 2VV8A 3MQQA 2PYRA 4GHIA 4HHDA 4PKYA 2QKPA 5DKLA 3UB7A 4H6JB 1T19A 3LICA 2VEAA 4HIAA 2M1CA 3B33A 4L9EA 5A8BA 4LLOB 4EESA 4JGQA 1D06A 3LI8A 1LSVA 4HJ3A 4LRYC 5HWVA 4I39A 2A24B 2PD8A 1G28A 3C2WA 4KUOA 4I3JA 1OJGA 1UGUA 3LI9A 4M4XA 2V1AA 1V9ZA 2PDRA 1TS8A 3PHYA 1N9LA 3PYPA 5G4ZA 1T18A 1BYWA 3BY8A 3G6OA 3MR0A 4HY8A 2V0WA 4NXFA 3LYXA 2PD7A 5DJTA 4NXBA 3F1NB 1ODVA 4HOIA 1GSWA 2OWJA 3LIFA 5F69A 3F1NA 4F3LB 2WKPA 4JGOA 2VLGA 3F1OB 5F5YA 3MJQA 3ULFA 1OT6A 3H7WB 2A24A 2K7SA 1OJ5A 2QJ7A 4WF0A 4EERA 3NOTC 4LRZE 1V9YA 2GJ3A 2QWSA 2W27A 1NWZA 1P0ZA 3A0VA 4HI4A 4HNBA 4NXGA 1LT0A 3BY9A 1LSWA 3LUQA 5EFWA 3MXQA 1D7EA 1UWNX 1N9NA 2QJ5A 2J80A 3VE4A 4KQDA 4NXEA 4YWZA 3CAXA 2QHKA 1XJ4A 1DP8A 4GS9B 4HP9A 4WL9A 5J4EA 1X0OA 2V1BA 4MN6A 3UMEA 2PR6A 5AVEA 3UB6A 1OT9A 3LIAA 1OTDA 3GDIA 3D72A 2ZOIA 4I5SA 3CWFA 3K3CA 3NOPC 3F1OA 2YKHA 3NJAA 2Z6CA 1S1YA 2B02A 4GS9A 1OTIA 5HDCA 1OTEA 2JHEA 5J3WA 4E04A 4DJ3A 3MFXA 2P7JA 3H9WA 4KUKA 3E4QA 1Y28A 4LRXC 1JNUA 4F3LA 4RQ9A 1LSXA 3EEHA 4LPZA 4BBUA 3IBRA 3RTYA 4R38A 3K3DA 4JGRA 4EXOA 2PR5A 4HH3A 1TS0A 1TS6A 5HD5A 2V0UA 3MQOA 4HJ6A 1T1AA 3VE3A 1OTBA 4HP4A
chains in the Genus database with same CATH superfamily
4R0QA 1YSPA 1XKZA 4CPKA 2EFUA 1SHVA 5HD3A 3DTKA 2VV6A 1XFQA 3IS2A 1PW1A 3HJIA 3IS2B 2XH9A 1LI9A 3T4TA 3JYIA 3RH8B 4R3BA 2ZBBA 3OOVA 2INWA 4RX2A 2V1ZA 1D1JA 4X1LA 5FATA 1GA9A 2HV1A 2W3DA 1F5MA 2EXAA 4JF4A 2BASA 2JC7A 3MQ0A 2ZM0A 1DRMA 3G4PA 4Y5FA 1XP4A 5DKLA 5HARA 4HIAA 1FOFA 4S2JA 5HWVA 5L07A 2XROA 3PAGA 4UA9A 3TRCA 1VETB 2O9AA 3A3FA 1MY8A 4X25A 2Y2HA 3IWQA 3U4LP 5CX7A 5DJTA 1ZHHB 4JXVA 3BRMA 3F1NB 4F3LB 4LRZE 1V9YA 2W27A 2QWSA 4GDNA 4Q0JA 3MS6A 2Y2MA 1DP8A 1PZOA 3GDIA 4PHTA 2YKHA 4O0PA 3S7PA 4GZBA 1YLTA 5L09A 3IT9A 3VOYA 1W8YA 1IELA 3EEHA 4WEKA 5HD5A 3TW8A 5EVEA 4Y0UA 4XUZA 2J3TC 3ZDJA 2VGLM 1GA0A 1EW0A 5A90A 3DW0A 4KZ5A 5IHVA 1CEGA 1YAXA 2Y2IA 3C7VA 4WELA 2XFTA 3ZQ5A 1K6SA 2D02A 4OVDA 2ZL1B 1BZAA 3CMZA 1FCMA 5L10A 5FQQA 5F68A 3UDXA 4B9OA 5DJUA 5DTKA 1NLYA 3ULFA 3Q07A 5EECA 2VA0A 2KX6A 1UWPX 4O01A 3MXSA 5HZHA 4N9LA 4DE0A 1H8ZA 1MZUA 5FI2A 3MQQA 4Q0IA 2Y4AA 3NBLA 3B33A 5L8MA 3N8SA 3LI8A 1P9WA 3IX8A 1OJGA 3A3JA 4CQHA 3GRJA 3G6OA 3VP2A 5JYPA 2JKGA 4P87A 2K31A 3F1OB 2A2LA 2C6WB 3PBSA 4DXBA 2K7SA 5HSQA 3A0VA 3QP4A 1NWZA 3FKVA 3DWZA 1LSWA 1UWNX 5EVID 2J80A 5EOEA 1G6OA 4NXEA 4WL9A 1PIOA 1PWCA 1OTIA 5HDCA 2B18A 5J3WA 2KLIA 3ITAA 2ZC4B 5DF9A 2EXBA 1LL9A 5DFYA 5HAQA 4LCLA 2OAQ1 2Y2LA 3Q81A 4X55A 4LV0A 1S0WA 2ZQ7A 5TFQA 4ME4A 1TS0A 5GHZA 3VP4A 3IXGA 3VP3A 1K6RA 1RGYA 1FILA 3PBTA 2VK3A 1CEFA 3LR5A 3T4JA 1IKGA 3ZG0A 1KOUA 4K91A 4BENA 3N8RA 4K0XA 4R6LA 4PMAA 2GX5A 1H3QA 2PT7A 4P85A 4JF5A 2Y2KA 3W4OA 2ZMFA 4X6TA 1K54A 5CHUA 4S2IA 3E2LA 1O7EA 5CGWA 4R70A 1LL8A 5U47A 3KYZA 2D01A 4PM5A 2JE5A 2O0YA 4XT2A 4ZAMA 3UPOA 5DTTA 4IJGA 4HBTA 2VV8A 4GHIA 2Y55A 4H6JB 1KDSA 2AVXA 4HJ3A 4D60A 1H0MA 4KUOA 3M6HA 1GHMA 2V1AA 4OKPA 3PHYA 2HP5A 3G35A 3DTEA 4R1GA 1PI4A 3PBNA 4MN7A 2V8FA 2OWJA 4KZ7A 1K25A 5F69A 5GHXA 1ZTUA 5F5YA 5CEBA 3LY3A 4OOYA 4WF0A 3BY9A 3QNCA 2Y59A 2E8IA 1HLUP 5J4EA 4U0XA 1OT9A 3UPNA 3D72A 3IXBA 1K4EA 2W3GA 4R3JA 4DJ3A 1TD5A 5CERA 5IT5A 2BTFP 2JKTM 1MWUA 5CXWA 1YSQA 3E2KA 4YOFA 3BLMA 4KQRA 2PBDP 1OMEA 4JBFA 3B47A 4Y0TA 3AGDA 4Y15A 1TEMA 4HEFA 4PKYG 4WLAA 2DCFA 2Z6DA 2R9XA 5HDDA 2EFXA 2WKHA 2V9AA 3NDGA 5FQJA 3A0RA 4FH4A 1SZVA 3VFHA 5E2FA 4GJ4A 3QP6A 1AXBA 4BL2A 3P7NA 4E6WA 3UE3A 2QZ6A 1YMXA 1K0KA 3HREA 4X69A 1T19A 2A49A 3UDFA 2WGIA 4M4XA 4OPZA 2J9OA 1ES2A 1GHIA 1N9LA 1T18A 1I2WA 5DF8A 5HW3A 3DBAA 3HLFA 2QPNA 3BM6A 3WS5A 4Y17A 2G2UA 3O3VA 1KGGA 2GJ3A 4HNBA 3T12B 2PAVP 1P0ZA 1M6KA 4JXGA 4KQDA 3MF0A 4DRTA 4DE1A 4OPYA 4S2PA 3T4QA 2HDSA 3IQAA 4GS9A 4HBUA 4Q8IA 3CUEA 3RFBA 3P09A 1L0DA 4D2OA 3V50A 3ZFZA 4RQ9A 4II7A 5FSRA 4EWFA 4FCFA 4JKTA 4GB7A 3UN7A 4LENA 1ZG4A 3IWOA 3KYQA 1SKOB 3GTCA 3NC8A 5FAPA 4XUXA 5AVFA 3RJUA 3WRZA 2P74A 1CJFA 2HDUA 2XD5A 1YMSA 1NZUA 1Z09A 3UB8A 1J3WA 2WADA 2G7UA 5F1FA 4E6XA 2XQZA 3VP1A 1SKOA 4KG6A 4RX3A 2ZM2A 2ZLYA 1S1ZA 4ETXA 3UB9A 4L0LA 4HH2A 4N9KA 1GHPA 4NETA 4BBVA 2J3TD 2WZXA 3IXDA 5FDHA 3NULA 3S7NA 5AQ7A 3NIAA 3FV7A 1HVBA 2ACGA 3BLSA 2HJEA 3QP8A 2PU2A 4PPRA 3PAEA 1Y54A 2XLNA 5I94A 2J3WA 4NXBA 3LIFA 5E2GA 2VLGA 3CZDA 4G3KA 2FH5A 3PBRA 1LT0A 3G30A 3LUQA 1K4FA 1N9NA 1L0FA 1JTGA 1M40A 3SS5A 1XJ4A 1ZG6A 1RGZA 2XSSA 3BFCA 4E3IA 1Z6FA 4LV2A 1CF0A 3TJZC 3D4FA 1E3UD 2P7JA 3O86A 4OQIA 4WMCA 2G2WA 2QMIA 3IH9A 4GDBA 2Z2LB 3ZG5A 3MQOA 3JPUA 5J7EA 4DF6A 3A0SA 3IX3A 3V67A 3LEZA 2HGVA 1PW8A 1XPBA 4EEPA 3EQVA 2ZL1A 4PM9A 1G5UA 3VOZA 1XFNA 2RCXA 1H5XA 2W3EA 2R78A 1XA1A 1P9RA 5KIZA 1P97A 5EV0A 5FAOA 2W1TB 3L7HA 1RP5A 4CLCB 3LR0A 3QNBA 1BLCA 2XA7S 4H6JA 4MBKA 3H7WA 1ZC2A 2DMWA 2DNSA 3UDIA 1LLBA 2QKPA 3VV4A 4JGQA 4FSFA 2A24B 1JVJA 4GD8A 3IF6A 4P6BA 1KGEA 1JTDA 3MXRA 3MZEA 1VEUA 5IS1A 1OJ5A 1A0KA 3EOIA 3GQZA 3M6BA 3R7WA 1IKIA 2QHKA 2OV5A 1Q2PA 5FQ9A 1YLYA 3IX4A 4ZJ2A 4IBRA 5C5KA 3E4QA 4YNRA 3RTYA 2XRNA 4R38A 3K3DA 5FI6A 4ETZA 4HH3A 2RL3A 1MXOA 1TS6A 4LV3A 3LGOA 4IUHA 1ESUA 3E4PA 1ES3A 4N1XA 4UQIM 2L4RA 4F94A 2P04A 2V20A 3KX0X 5F82A 2VV7A 5JYOA 2Q9MA 2WKQA 3FKWA 3NOUC 4BJPA 5HX9A 2YKFA 3M2JA 3CPTA 5EVIC 1S67L 4ESPA 1LL5A 2KOIA 2VKSA 4MMNA 2W0NA 2HP9A 1E4DA 4MBHA 2XF3A 4FUWA 1ONHA 1PNEA 4KQOA 2CMNA 3HJKA 1NRFA 2P08A 1VB6A 4IEDA 4OOMA 2HP6A 3T4SA 2WK0A 3AGFA 4B4ZA 1DJBA 2P9VB 1KVLA 3O88A 4Y0OA 4LRYC 3JVUA 4JPMA 2HJ9C 2V0WA 3WWXA 4UAAA 2FZ0A 2ZC6B 3P98A 1ODVA 1BUEA 3O87A 4EERA 1NLZA 1L0GA 2QJ5A 3T1QB 3VE4A 3CAXA 4P0MA 5CRFA 2Y2QA 3LIAA 4RVAA 3DTMA 4MEZA 1KVMA 3IBJA 1PZPA 5F1GA 3N6IA 3VMAA 2E8JA 1IFQA 2Y2NA 3BECA 2Q0OA 3NOTC 3RXXA 4P6ZS 5CECA 4MCWA 3KSGA 4DE3A 3O5YA 3ICYA 3C38A 1MWSA 1S4SA 4DXCA 3HLEA 1T1CA 4XT2B 1G6AA 2Y91A 4NG2A 4O8GA 1S6RA 4GW9A 1IEMA 3OLOA 4PM7A 4UA6A 3CJMA 3HCYA 4S2NA 3LIDA 3CUEC 2W1TA 5LBRA 4WZ4A 3T50A 1DP6A 3CPTB 3UPPA 2EX6A 2J9PA 3SW1A 4KZ6A 5FQIA 4EQIA 4WMCD 3VSLA 1XJ2A 5EM0A 4LV1A 2FFYA 1VETA 5EVIA 3QP2A 3TSGA 4N1HA 4X53A 1JWVA 3LI9A 2WGWB 1TS8A 3ZVWA 5BOHA 3BY8A 3M2KA 3MZDA 4HY8A 1XXMA 3LYXA 2JKRI 3DTIA 1GSWA 2HZ5A 1L0EA 3SS3A 2JCHA 1ES5A 3ZNTA 3ZYTA 3V3SA 4YWZA 1YPRA 3V5MA 4MN6A 2CC1A 4E3LA 2J8YA 5CHJA 3F1OA 3OPPA 2X71A 3KYEA 4KUKA 3HLCA 3IF6C 3ZG8B 4G3WA 2PR5A 3ZG9B 1EROA 2EX8A 1T1AA 3VE3A 4QB8A 1FQGA 5A91A 4HQAA 4BBTA 4HJ4A 3T4KA 4PM8A 4ZTKA 5HFOA 1IYSA 2ZOHA 4WUJA 2ZJ9A 3FPWA 5HWTA 1BLHA 4ARZB 1XJ6A 5M1AA 2IWCA 5HAPA 1KGFA 5HL6A 2PYPA 4CLCA 4FOFA 3SH8A 4MLLA 4IVIA 1CI9A 1BLSA 3K2NA 2WUQA 4C6YA 1VEUB 1C3BA 2H5SA 2EWWA 4PKYA 3T4LA 4PAUA 2PU4A 3GSGA 1LSVA 2PD8A 1NJ4A 4MNRA 2WAEA 1WYBA 3IF6B 3SZTA 2FFFB 1VM1A 1PWDA 2HDRA 1K57C 1W8QA 3H7WB 4P6ZM 4E3KA 1AWIA 3BFFA 3V3RA 5GLCA 3E98A 4GS9B 1K56A 1X0OA 4B88A 5AVEA 3W8KA 4Y13A 3FPVA 3W2ZA 1L2SA 1OTEA 4X68A 2MJ6A 1TF1A 3B42A 3S22A 4ARZA 5M18A 1LSXA 1KE4A 5TGFA 1MWRA 2BG1A 4OH0A 4HJ6A 2O9CA 4IHQA 3HUMA 2PHYA 5EM1A 4U3TA 5HDSA 5IU1A 4B93A 3A3DA 3EWKA 4ZDXA 3ZG7B 4S2NC 4GHIB 3C8CA 4IBXA 1KDWA 4OP8A 4GKUA 2GDNA 1ESIA 2OOLA 3S7QA 3UE6A 5HPIA 4YINA 4B4XA 1GSXA 3IF5A 5K5BA 5AQ9A 2Z2MB 4LFUA 1MC0A 2O99A 4BLMA 5DFXA 3LICA 5A8BA 3ZCZA 4KZ4A 5TJJA 4FTXA 5AJGA 1NYMA 1RCJA 4WYYA 5FDSA 1FIKA 4LCMA 3EGDC 4ZJ3A 1FSWA 1N9BA 1MWTA 3CG5A 4OP5A 4GLQA 2WGWA 1K55A 3HLDA 2WAFA 4R23A 1FCNA 3S1YA 2W1RA 4DDSA 1O07A 2PRFA 5EVLA 4WZ5C 2IWDA 2OLVA 5GLBA 4KQQA 4RYEA 4LPZA 3ITBA 4EXOA 4OQ0A 2VGLS 2V0UA 4ZBEA 3LR4A 2LB5A 4BD0A 1Y4OA 3NI9A 2JN7A 4C3QA 2WKRA 2OWHA 3OZHA 4Z1WA 4OQHA 3Q7ZA 4WBGA 4UEYA 1MBLA 2HF6A 3PBOA 2WZZA 2O9BA 2KDKA 1XGIA 4YFMA 4FD8A 3SH9A 1IOUA 5A92A 1DP9A 1F9IA 4KG5A 4DDYA 1NY0A 1XJ3A 1SDNA 2Y2GA 3MSHA 1BSGA 3E0YA 3EQUA 1I2SA 5GLAA 4QY6A 4I3IA 1YQSA 2ZQ8A 2UV0E 1G68A 4GOGA 4KZ8A 1PYYA 3C2WA 2UWXA 1GCEA 2ZMAA 3SS4A 3BFEA 4PM6A 1PFLA 2H0TA 1H8MA 3F1NA 2H10A 4CLCC 4EBLA 3B3XA 3ZNYA 2LB9A 3LEQA 2WYXA 2ZC5B 3BW6A 4CJNA 3MKFA 1STZA 4ZRRA 4BMWA 5FAQA 1HD8A 3BFDA 3HUOA 3IHBA 2ZM8A 3K3CA 5FEFA 5TR7A 2M7VA 4NKPA 3Q7VA 3KO6A 3Q7VB 1PRQA 3C4PA 5EOOA 4E04A 3BFGA 3MFXA 1ES4A 4OLGA 2ZC7A 4CLCE 4H8RA 1JNUA 1NZOA 4S2MA 4JXWA 4JF6A 2JKFA 1OTBA 3LO7A 2OAP1 3GR2A 1Q2QA 5TBMB 3CI6A 4L9GA 4C75A 1U60A 4OLDA 3N4IA 4EW7A 3D9YA 1ALQA 4DJ2A 2JKTI 3BJNA 5F6AA 5CGXA 5AQAA 5TBMA 3HLWA 5MC7A 2PBYA 3LR3A 5F83A 1QMFA 2L1MA 2EA9A 1YLWA 3IH8A 4CLCD 3SH7A 4QD4A 4UQIS 2NUTC 5GL9A 3OCLA 2BLSA 4EV4A 3VFFA 4IUKA 1BT5A 3HLGA 2M1CA 4QJGA 2V8CA 2VX8A 1D06A 4I39A 1DJCA 4UA7A 1DJAA 1UGUA 1LI0A 2HDQA 3T1XA 4E3JA 4WM9A 3GMWA 2K2NA 2W3HA 4RA7A 3Q1FA 5FI7A 2V1BA 2PR6A 4I5SA 1VHMA 1NRJA 2Z6CA 3ISGA 4K0WA 1K38A 4X56A 3GV9A 3T1SA 1TDLA 5E43A 5HPFA 3KSIA 4F3LA 2IWBA 4DKIA 2ZQCA 2ZD8A 4JGRA 3HLBA 3MFDA 5FL3A 4KENB 1FCOA 1TS7A 1K57A 4NEED 3E4OA 1F98A 2H28A 4E3MA 4IVKA 1S4RA 1XGJA 3PBQA 4R3AA 4Z9QA 3H82A 1BULA 4EETB 1E3UA 1HTZA 3BEBA 1HZOA 2WGVA 3CHWP 3DAVA 3CLOA 3LFVA 3C7UA 4MDZA 3NHQA 3S4XA 4Y7PA 3UO9A 1ERMA 4BWIA 3TE8A 5DKKA 4GCZA 4X1MA 1WYCA 2L0WA 3HBRA 4L9FA 3UB7A 3T1RA 3W4PA 2VEAA 4WEJA 4EESA 3D3OA 2C5WB 4Y3IA 4A5RA 1G28A 4I3JA 3IWIA 1V9ZA 1CQAA 2PDRA 1OPXA 4EUVA 3QP5A 3FZCA 1EI5A 4R4RA 1JWZA 2XK1A 4N92A 4DN0A 5HL1A 4S2LA 1TDGA 1J9MA 2WKPA 3A3EA 4JGOA 4OPQA 2QJ7A 4KZAA 2VJWA 3UMDA 5EFWA 5EVIB 3MXQA 1NXYA 2XFSA 2J7VA 1YLPA 5CTNA 4GD6A 3TG9A 3UB6A 5CGSA 2XA7M 2ZQAA 1YKDA 3NOPC 1W63Q 5GLDA 5A93A 3NJAA 5J8XA 2B02A 4FH2A 2JBFA 2JHEA 2Y2JA 3G31A 4S2OA 2Y2OA 1MKIA 3AGEA 2Y8HA 4OQGA 2B95A 3JVVA 4BQMA 1XA7A 2I72A 3OPHA 4G3VA 2QYBA 3FC7A 1ZKJA 1I5QA 2EX9A 3L9KA 3WS4A 5DVAA 3P01A 3VSKA 1YLJA 3R4KA 1MKMA 4LGWA 4HESA 4WZ5A 1F2KA 3HVFA 5E2EA 1BTLA 3G32A 4ZJ1A 1SKFA 1ACFA 2IA2A 4K08A 3F1PB 4EU0A 4E3NA 3Q82A 2VZWA 1DY6A 3QHYA 5G4YA 3G34A 5FQKA 3UE1A 4L9EA 3G2ZA 3MMHA 3T4OA 1QMEA 4EUZA 5G4ZA 1CI8A 3OPRA 4EBNA 3NY4A 5FQMA 4OOLA 4HOIA 4EBPA 3BQAA 1OT6A 4HI4A 2P9VA 1D7EA 4HP9A 1SDEA 5E2HA 2WKIA 3OBFA 3A3IA 3CWFA 3WRTA 3EEAA 3GVBA 3U2AA 1SCWA 3WS0A 1K56D 5KMWA 3VP0A 3IXHA 2A3UA 1VQQA 3C4OA 3PR6A 4BBUA 5AQBA 2OSUA 2B5RA 3FYZA 5KSCA 2XR0A 4HP4A 3OC2A 4GNUA 3NCKA 5KZHA 5KSHA 5FASA 2R9WA 5HWWA 5D3OA 3N8LA 3FG8A 4EQ1A 2OLUA 4I38A 2H0YA 4KZ9A 2W3FA 4QWOA 3H82B 5I5LA 2XDMA 3VOLA 4BD1A 5EPHA 3GECA 4WN5A 3F1PA 4JGPA 1N9OA 2I9VA 3EGXC 3TOIA 4GN2A 3S7OA 1WA9A 3MBZA 2V2FF 1W79A 1ONGA 1JWPA 2NUPC 4I3AA 3SOIA 1YT4A 3R7WB 2HPBA 1CK3A 5G18A 2Y79A 2ZQDA 5CEDA 3V39A 2GNXA 3PYPA 3MR0A 1H8YA 1IYQA 3DWKA 5FEGA 4BL3A 3I7JA 2PD7A 1FR1A 3PTEA 3MJQA 4R4SA 1ERQA 4M3KA 3WS2A 3LCEA 3OPLA 2ZC3B 4QY5A 4Q0HA 4MBFA 2EWVA 3UMEA 1YLZA 1EWZA 3UE0A 3C30A 5EUAA 5FA7A 1S1YA 2VGJA 2Y2PA 4U0TA 1K54C 3H9WA 3UB5P 3QP1A 2XEPA 1W5DA 3IBRA 4XXRA 1KE0A 2VGKA 3KSFA 3NDEA 1NYYA 1MPLA 3FWLA 2DRWA 2ZMVA 1W63M 1FSYA 4DE2A 3MZFA 3OCNA 4QHCA 1XX2A 4NK3A 3KSHA 4KG2A 1GSVA 1L3LA 1PI5A 3G2YA 4E3OA 1FR6A 5DF7A 3LIBA 3IHAA 3W4QA 5HAIA 4MN5A 1OTAA 3PXPA 4EEUA 3NECA 3ZVTA 5CTMA 3CITA 1T1BA 3MKEA 3LIEA 1PWGA 1S66L 2EX2A 3BWLA 2PYRA 4HHDA 2X01A 4UHUA 3ZHHA 4QPRA 4LLOB 1TVFA 5M19A 5L2FA 2WKEA 1IYOA 4JLFA 1K55C 3RXWA 1BYWA 2M7UA 5GHYA 3BYDA 4NXFA 5EE8A 1LHYA 1BLPA 1WE4A 4OPRA 4JXSA 2XD1A 2A24A 4Y2FA 2XGNA 5DTSA 1KE3A 4AFIA 4LRXC 5CHMA 2GZAA 4NXGA 3UY6A 1E25A 3N7WA 4KZ3A 1N4OA 3UNWA 4QU3A 3HL9A 1W7FA 4DMZA 1OTDA 3LY4A 2ZOIA 2ZQ9A 3HUNA 3BQ8A 4KZBA 2JKRM 1Y28A 2Q9NA 4OONA 1IYPA 4O7DA 3WS1A 3C5AA 4ID4A 1YM1A 4S2KA 3ZGAB 2X02A
chains in the Genus database with same CATH topology
3KYQA 1YSPA 1TS7A 4HQAA 4BBTA 4HJ4A 3T4KA 5HD3A 2VV6A 4NEED 3E4OA 5AVFA 1XFQA 3IS2A 1F98A 2H28A 2ZOHA 4WUJA 3HJIA 3IS2B 3FPWA 5HWTA 1S4RA 3UB8A 3T4TA 4ARZB 1XJ6A 2G7UA 3PBQA 4R3AA 3RH8B 3H82A 2ZBBA 4EETB 3OOVA 5HL6A 2INWA 2PYPA 4CLCA 1S1ZA 3CLOA 2HV1A 3LFVA 4ETXA 3UB9A 4FOFA 2W3DA 4L0LA 4MDZA 4HH2A 1F5MA 2BASA 3NHQA 4BWIA 3K2NA 3MQ0A 1DRMA 4BBVA 3TE8A 5DKKA 4GCZA 2J3TD 2L0WA 4Y5FA 2EWWA 4L9FA 4PKYA 5DKLA 3T4LA 3UB7A 4PAUA 3S7NA 2VEAA 4HIAA 4WEJA 4EESA 3D3OA 1LSVA 5HWVA 4Y3IA 2PD8A 1G28A 2XROA 4I3JA 2HJEA 3TRCA 1V9ZA 2PDRA 1OPXA 4EUVA 2O9AA 5CX7A 2J3WA 5DJTA 1ZHHB 4NXBA 3F1NB 4DN0A 3LIFA 4F3LB 2WKPA 4JGOA 2VLGA 3H7WB 4P6ZM 2QJ7A 4G3KA 4LRZE 1V9YA 2FH5A 2QWSA 2VJWA 2W27A 3UMDA 5EFWA 3PBRA 1LT0A 3LUQA 3MXQA 4Q0JA 1N9NA 3E98A 1XJ4A 1DP8A 4GS9B 1X0OA 5AVEA 3UB6A 3GDIA 4PHTA 2XSSA 2XA7M 3NOPC 1YKDA 1W63Q 3FPVA 3W2ZA 2YKHA 3NJAA 4O0PA 3S7PA 2B02A 1OTEA 2JHEA 3TJZC 2MJ6A 1TF1A 2P7JA 3B42A 4ARZA 1LSXA 3EEHA 4WEKA 5HD5A 4HJ6A 2O9CA 3MQOA 2Y8HA 4IHQA 3TW8A 2J3TC 2VGLM 5J7EA 3JVVA 1EW0A 2PHYA 5HDSA 3A0SA 3V67A 5IU1A 2HGVA 4G3VA 4B93A 4EEPA 2QYBA 3EWKA 1YAXA 4WELA 3FC7A 3EQVA 3ZQ5A 2D02A 4GHIB 3C8CA 1XFNA 3VE3A 3P01A 2W3EA 2R78A 1P9RA 5KIZA 1P97A 3R4KA 1MKMA 5F68A 4B9OA 5DJUA 1NLYA 2W1TB 2OOLA 3S7QA 4CLCB 3UE6A 5HPIA 2IA2A 3ULFA 4K08A 3F1PB 4EU0A 3LR0A 1GSXA 2VA0A 2KX6A 1UWPX 4O01A 5K5BA 2XA7S 5HZHA 4H6JA 1MZUA 3H7WA 1MC0A 2DMWA 2O99A 2VZWA 5G4YA 3MQQA 2QKPA 5DFXA 4Q0IA 3VV4A 3LICA 4L9EA 3B33A 5L8MA 5A8BA 4JGQA 3LI8A 1P9WA 4FSFA 2A24B 5TJJA 3MMHA 1OJGA 5AJGA 3T4OA 4CQHA 5G4ZA 3G6OA 3EGDC 4OOLA 4HOIA 2K31A 3BQAA 3F1OB 2A2LA 1OT6A 4GLQA 3PBSA 2K7SA 1OJ5A 5IS1A 3EOIA 5HSQA 3A0VA 1NWZA 4HI4A 1LSWA 3R7WA 1D7EA 1UWNX 2J80A 1G6OA 4NXEA 2QHKA 4HP9A 4WL9A 3OBFA 2W1RA 3CWFA 3EEAA 3U2AA 1OTIA 5HDCA 2B18A 5J3WA 2KLIA 5C5KA 5DF9A 3E4QA 4YNRA 5DFYA 4LPZA 3PR6A 2OAQ1 4BBUA 3RTYA 2XRNA 4R38A 3K3DA 4EXOA 4ETZA 4HH3A 4ME4A 1TS0A 2VGLS 1TS6A 2V0UA 3LR4A 4HP4A 3OC2A 4IUHA 3PBTA 2LB5A 3E4PA 3LR5A 3T4JA 5KSHA 1KOUA 5HWWA 4UQIM 2L4RA 2JN7A 2WKRA 2OWHA 4R6LA 3FG8A 4Z1WA 4EQ1A 4I38A 2GX5A 2P04A 4UEYA 3KX0X 2W3FA 2VV7A 1H3QA 2WKQA 2HF6A 2PT7A 3PBOA 2O9BA 3NOUC 4BJPA 3H82B 5I5LA 2KDKA 2YKFA 2ZMFA 3VOLA 1S67L 2VKSA 2KOIA 4MMNA 3GECA 2W0NA 4WN5A 3F1PA 4JGPA 1N9OA 1IOUA 4KQOA 1DP9A 1F9IA 2I9VA 2CMNA 3EGXC 4R70A 1LL8A 3HJKA 1XJ3A 2D01A 3KYZA 1WA9A 3S7OA 2P08A 2O0YA 1VB6A 3E0YA 3EQUA 4XT2A 2NUPC 4IJGA 4OOMA 4I3AA 4I3IA 2VV8A 3T4SA 4GHIA 3R7WB 4H6JB 4HJ3A 4LRYC 2Y79A 3C2WA 3JVUA 4KUOA 2HJ9C 2V1AA 3PHYA 2GNXA 3PYPA 3MR0A 2V0WA 3PBNA 1H8MA 4MN7A 2FZ0A 2PD7A 1ODVA 2OWJA 5F69A 3F1NA 1ZTUA 5F5YA 4CLCC 3MJQA 4EERA 4WF0A 2LB9A 1NLZA 3BY9A 2QJ5A 3BW6A 3VE4A 4Q0HA 3CAXA 2EWVA 1STZA 4ZRRA 5J4EA 4BMWA 3UMEA 1OT9A 3LIAA 3C30A 3D72A 3K3CA 2M7VA 4NKPA 3KO6A 1S1YA 3IBJA 2W3GA 4E04A 4DJ3A 3MFXA 1TD5A 3H9WA 4CLCE 1JNUA 5IT5A 3IBRA 2JKTM 1IFQA 1YSQA 3KSFA 4YOFA 3NOTC 1OTBA 2ZMVA 1W63M 4P6ZS 2OAP1 4MCWA 3KSGA 3O5YA 3B47A 3ICYA 3C38A 5TBMB 3OCNA 1S4SA 3CI6A 1T1CA 4XT2B 4L9GA 3KSHA 4O8GA 1GSVA 4GW9A 4PKYG 4WLAA 4EW7A 2Z6DA 4DJ2A 2JKTI 5HDDA 3BJNA 3OLOA 5F6AA 2V9AA 5TBMA 3LIBA 3HCYA 3A0RA 3LIDA 5MC7A 3CUEC 2W1TA 5LBRA 3LR3A 3T50A 4MN5A 1DP6A 1OTAA 3PXPA 4EEUA 2L1MA 2EA9A 3CITA 4CLCD 3SW1A 1T1BA 4GJ4A 3LIEA 4UQIS 1S66L 2NUTC 3P7NA 1XJ2A 3UE3A 3BWLA 3OCLA 4IUKA 2PYRA 4HHDA 1T19A 4QPRA 2M1CA 4LLOB 2VX8A 1D06A 4I39A 1UGUA 3LI9A 4M4XA 1TS8A 1N9LA 1T18A 1BYWA 3BY8A 2M7UA 4HY8A 3DBAA 4NXFA 3LYXA 2JKRI 1GSWA 2A24A 4Y2FA 4AFIA 2K2NA 4LRXC 2GJ3A 4HNBA 2GZAA 4NXGA 1P0ZA 2W3HA 3ZYTA 4KQDA 4YWZA 3MF0A 2V1BA 4MN6A 4DMZA 2PR6A 1OTDA 2ZOIA 4I5SA 1VHMA 3T4QA 3F1OA 1NRJA 2Z6CA 4GS9A 3BQ8A 3CUEA 2JKRM 3RFBA 4KUKA 1Y28A 5HPFA 3KSIA 4F3LA 4RQ9A 4II7A 4G3WA 4JGRA 2PR5A 1T1AA 5FL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J7E A;  1EW0 A;  2PHY A;  5IS1 A;  3E4P A;  1TS7 A;  4HQA A;  4BBT A;  4HJ4 A;  1KOU A;  3ICY A;  3A0S A;  5HDS A;  5HD3 A;  5HWW A;  2VV6 A;  5AVF A;  3E4O A;  5IU1 A;  5TBM B;  1XFQ A;  2L4R A;  1S4S A;  2JN7 A;  3IS2 A;  1T1C A;  1F98 A;  2H28 A;  2ZOH A;  4WUJ A;  4XT2 B;  4EEP A;  2WKR A;  2OWH A;  3EWK A;  3FG8 A;  3HJI A;  3IS2 B;  3FC7 A;  4I38 A;  4L9G A;  4R6L A;  4EQ1 A;  1GSV A;  1S4R A;  5HWT A;  3UB8 A;  3ZQ5 A;  3KX0 X;  2D02 A;  1XJ6 A;  4GHI B;  3C8C A;  2VV7 A;  4GW9 A;  4R3A A;  2WKQ A;  4PKY G;  4WLA A;  1XFN A;  3H82 A;  3RH8 B;  4EW7 A;  2ZBB A;  2Z6D A;  3NOU C;  3H82 B;  5I5L A;  4DJ2 A;  4EET B;  5HDD A;  2INW A;  2R78 A;  2PYP A;  3OLO A;  2KDK A;  2YKF A;  5F6A A;  3VOL A;  5KIZ A;  1S67 L;  1P97 A;  2V9A A;  5TBM A;  3LIB A;  3GEC A;  2W0N A;  1S1Z A;  3A0R A;  2HV1 A;  3CLO A;  3F1P A;  3LID A;  4JGP A;  4WN5 A;  5DJU A;  3UB9 A;  4B9O A;  3T50 A;  5HSQ A;  1N9O A;  1DP6 A;  1OTA A;  4MN5 A;  4EEU A;  2L1M A;  4HH2 A;  1DP9 A;  2OOL A;  2EA9 A;  1F9I A;  5F68 A;  3UE6 A;  2I9V A;  2CMN A;  4R70 A;  3SW1 A;  1LL8 A;  2BAS A;  1T1B A;  1XJ3 A;  2D01 A;  3HJK A;  1WA9 A;  3F1P B;  3NHQ A;  3LIE A;  4K08 A;  1GSX A;  3UMD A;  2KX6 A;  1UWP X;  1VB6 A;  5HZH A;  4XT2 A;  1DRM A;  4H6J A;  1S66 L;  4BBV A;  5DKK A;  1MZU A;  3H7W A;  4GCZ A;  3P7N A;  1XJ2 A;  2L0W A;  4I3A A;  5G4Y A;  3BWL A;  4I3I A;  4L9F A;  2VV8 A;  3MQQ A;  2PYR A;  4GHI A;  4HHD A;  4PKY A;  2QKP A;  5DKL A;  3UB7 A;  4H6J B;  1T19 A;  3LIC A;  2VEA A;  4HIA A;  2M1C A;  3B33 A;  4L9E A;  5A8B A;  4LLO B;  4EES A;  4JGQ A;  1D06 A;  3LI8 A;  1LSV A;  4HJ3 A;  4LRY C;  5HWV A;  4I39 A;  2A24 B;  2PD8 A;  1G28 A;  3C2W A;  4KUO A;  4I3J A;  1OJG A;  1UGU A;  3LI9 A;  4M4X A;  2V1A A;  1V9Z A;  2PDR A;  1TS8 A;  3PHY A;  1N9L A;  3PYP A;  5G4Z A;  1T18 A;  1BYW A;  3BY8 A;  3G6O A;  3MR0 A;  4HY8 A;  2V0W A;  4NXF A;  3LYX A;  2PD7 A;  5DJT A;  4NXB A;  3F1N B;  1ODV A;  4HOI A;  1GSW A;  2OWJ A;  3LIF A;  5F69 A;  3F1N A;  4F3L B;  2WKP A;  4JGO A;  2VLG A;  3F1O B;  5F5Y A;  3MJQ A;  3ULF A;  1OT6 A;  3H7W B;  2A24 A;  2K7S A;  1OJ5 A;  2QJ7 A;  4WF0 A;  4EER A;  3NOT C;  4LRZ E;  1V9Y A;  2GJ3 A;  2QWS A;  2W27 A;  1NWZ A;  1P0Z A;  3A0V A;  4HI4 A;  4HNB A;  4NXG A;  1LT0 A;  3BY9 A;  1LSW A;  3LUQ A;  5EFW A;  3MXQ A;  1D7E A;  1UWN X;  1N9N A;  2QJ5 A;  2J80 A;  3VE4 A;  4KQD A;  4NXE A;  4YWZ A;  3CAX A;  2QHK A;  1XJ4 A;  1DP8 A;  4GS9 B;  4HP9 A;  4WL9 A;  5J4E A;  1X0O A;  2V1B A;  4MN6 A;  3UME A;  2PR6 A;  5AVE A;  3UB6 A;  1OT9 A;  3LIA A;  1OTD A;  3GDI A;  3D72 A;  2ZOI A;  4I5S A;  3CWF A;  3K3C A;  3NOP C;  3F1O A;  2YKH A;  3NJA A;  2Z6C A;  1S1Y A;  2B02 A;  4GS9 A;  1OTI A;  5HDC A;  1OTE A;  2JHE A;  5J3W A;  4E04 A;  4DJ3 A;  3MFX A;  2P7J A;  3H9W A;  4KUK A;  3E4Q A;  1Y28 A;  4LRX C;  1JNU A;  4F3L A;  4RQ9 A;  1LSX A;  3EEH A;  4LPZ A;  4BBU A;  3IBR A;  3RTY A;  4R38 A;  3K3D A;  4JGR A;  4EXO A;  2PR5 A;  4HH3 A;  1TS0 A;  1TS6 A;  5HD5 A;  2V0U A;  3MQO A;  4HJ6 A;  1T1A A;  3VE3 A;  1OTB A;  4HP4 A; 
#chains in the Genus database with same CATH topology
 4R0Q A;  1YSP A;  1XKZ A;  4CPK A;  2EFU A;  1SHV A;  5HD3 A;  3DTK A;  2VV6 A;  1XFQ A;  3IS2 A;  1PW1 A;  3HJI A;  3IS2 B;  2XH9 A;  1LI9 A;  3T4T A;  3JYI A;  3RH8 B;  4R3B A;  2ZBB A;  3OOV A;  2INW A;  4RX2 A;  2V1Z A;  1D1J A;  4X1L A;  5FAT A;  1GA9 A;  2HV1 A;  2W3D A;  1F5M A;  2EXA A;  4JF4 A;  2BAS A;  2JC7 A;  3MQ0 A;  2ZM0 A;  1DRM A;  3G4P A;  4Y5F A;  1XP4 A;  5DKL A;  5HAR A;  4HIA A;  1FOF A;  4S2J A;  5HWV A;  5L07 A;  2XRO A;  3PAG A;  4UA9 A;  3TRC A;  1VET B;  2O9A A;  3A3F A;  1MY8 A;  4X25 A;  2Y2H A;  3IWQ A;  3U4L P;  5CX7 A;  5DJT A;  1ZHH B;  4JXV A;  3BRM A;  3F1N B;  4F3L B;  4LRZ E;  1V9Y A;  2W27 A;  2QWS A;  4GDN A;  4Q0J A;  3MS6 A;  2Y2M A;  1DP8 A;  1PZO A;  3GDI A;  4PHT A;  2YKH A;  4O0P A;  3S7P A;  4GZB A;  1YLT A;  5L09 A;  3IT9 A;  3VOY A;  1W8Y A;  1IEL A;  3EEH A;  4WEK A;  5HD5 A;  3TW8 A;  5EVE A;  4Y0U A;  4XUZ A;  2J3T C;  3ZDJ A;  2VGL M;  1GA0 A;  1EW0 A;  5A90 A;  3DW0 A;  4KZ5 A;  5IHV A;  1CEG A;  1YAX A;  2Y2I A;  3C7V A;  4WEL A;  2XFT A;  3ZQ5 A;  1K6S A;  2D02 A;  4OVD A;  2ZL1 B;  1BZA A;  3CMZ A;  1FCM A;  5L10 A;  5FQQ A;  5F68 A;  3UDX A;  4B9O A;  5DJU A;  5DTK A;  1NLY A;  3ULF A;  3Q07 A;  5EEC A;  2VA0 A;  2KX6 A;  1UWP X;  4O01 A;  3MXS A;  5HZH A;  4N9L A;  4DE0 A;  1H8Z A;  1MZU A;  5FI2 A;  3MQQ A;  4Q0I A;  2Y4A A;  3NBL A;  3B33 A;  5L8M A;  3N8S A;  3LI8 A;  1P9W A;  3IX8 A;  1OJG A;  3A3J A;  4CQH A;  3GRJ A;  3G6O A;  3VP2 A;  5JYP A;  2JKG A;  4P87 A;  2K31 A;  3F1O B;  2A2L A;  2C6W B;  3PBS A;  4DXB A;  2K7S A;  5HSQ A;  3A0V A;  3QP4 A;  1NWZ A;  3FKV A;  3DWZ A;  1LSW A;  1UWN X;  5EVI D;  2J80 A;  5EOE A;  1G6O A;  4NXE A;  4WL9 A;  1PIO A;  1PWC A;  1OTI A;  5HDC A;  2B18 A;  5J3W A;  2KLI A;  3ITA A;  2ZC4 B;  5DF9 A;  2EXB A;  1LL9 A;  5DFY A;  5HAQ A;  4LCL A;  2OAQ 1;  2Y2L A;  3Q81 A;  4X55 A;  4LV0 A;  1S0W A;  2ZQ7 A;  5TFQ A;  4ME4 A;  1TS0 A;  5GHZ A;  3VP4 A;  3IXG A;  3VP3 A;  1K6R A;  1RGY A;  1FIL A;  3PBT A;  2VK3 A;  1CEF A;  3LR5 A;  3T4J A;  1IKG A;  3ZG0 A;  1KOU A;  4K91 A;  4BEN A;  3N8R A;  4K0X A;  4R6L A;  4PMA A;  2GX5 A;  1H3Q A;  2PT7 A;  4P85 A;  4JF5 A;  2Y2K A;  3W4O A;  2ZMF A;  4X6T A;  1K54 A;  5CHU A;  4S2I A;  3E2L A;  1O7E A;  5CGW A;  4R70 A;  1LL8 A;  5U47 A;  3KYZ A;  2D01 A;  4PM5 A;  2JE5 A;  2O0Y A;  4XT2 A;  4ZAM A;  3UPO A;  5DTT A;  4IJG A;  4HBT A;  2VV8 A;  4GHI A;  2Y55 A;  4H6J B;  1KDS A;  2AVX A;  4HJ3 A;  4D60 A;  1H0M A;  4KUO A;  3M6H A;  1GHM A;  2V1A A;  4OKP A;  3PHY A;  2HP5 A;  3G35 A;  3DTE A;  4R1G A;  1PI4 A;  3PBN A;  4MN7 A;  2V8F A;  2OWJ A;  4KZ7 A;  1K25 A;  5F69 A;  5GHX A;  1ZTU A;  5F5Y A;  5CEB A;  3LY3 A;  4OOY A;  4WF0 A;  3BY9 A;  3QNC A;  2Y59 A;  2E8I A;  1HLU P;  5J4E A;  4U0X A;  1OT9 A;  3UPN A;  3D72 A;  3IXB A;  1K4E A;  2W3G A;  4R3J A;  4DJ3 A;  1TD5 A;  5CER A;  5IT5 A;  2BTF P;  2JKT M;  1MWU A;  5CXW A;  1YSQ A;  3E2K A;  4YOF A;  3BLM A;  4KQR A;  2PBD P;  1OME A;  4JBF A;  3B47 A;  4Y0T A;  3AGD A;  4Y15 A;  1TEM A;  4HEF A;  4PKY G;  4WLA A;  2DCF A;  2Z6D A;  2R9X A;  5HDD A;  2EFX A;  2WKH A;  2V9A A;  3NDG A;  5FQJ A;  3A0R A;  4FH4 A;  1SZV A;  3VFH A;  5E2F A;  4GJ4 A;  3QP6 A;  1AXB A;  4BL2 A;  3P7N A;  4E6W A;  3UE3 A;  2QZ6 A;  1YMX A;  1K0K A;  3HRE A;  4X69 A;  1T19 A;  2A49 A;  3UDF A;  2WGI A;  4M4X A;  4OPZ A;  2J9O A;  1ES2 A;  1GHI A;  1N9L A;  1T18 A;  1I2W A;  5DF8 A;  5HW3 A;  3DBA A;  3HLF A;  2QPN A;  3BM6 A;  3WS5 A;  4Y17 A;  2G2U A;  3O3V A;  1KGG A;  2GJ3 A;  4HNB A;  3T12 B;  2PAV P;  1P0Z A;  1M6K A;  4JXG A;  4KQD A;  3MF0 A;  4DRT A;  4DE1 A;  4OPY A;  4S2P A;  3T4Q A;  2HDS A;  3IQA A;  4GS9 A;  4HBU A;  4Q8I A;  3CUE A;  3RFB A;  3P09 A;  1L0D A;  4D2O A;  3V50 A;  3ZFZ A;  4RQ9 A;  4II7 A;  5FSR A;  4EWF A;  4FCF A;  4JKT A;  4GB7 A;  3UN7 A;  4LEN A;  1ZG4 A;  3IWO A;  3KYQ A;  1SKO B;  3GTC A;  3NC8 A;  5FAP A;  4XUX A;  5AVF A;  3RJU A;  3WRZ A;  2P74 A;  1CJF A;  2HDU A;  2XD5 A;  1YMS A;  1NZU A;  1Z09 A;  3UB8 A;  1J3W A;  2WAD A;  2G7U A;  5F1F A;  4E6X A;  2XQZ A;  3VP1 A;  1SKO A;  4KG6 A;  4RX3 A;  2ZM2 A;  2ZLY A;  1S1Z A;  4ETX A;  3UB9 A;  4L0L A;  4HH2 A;  4N9K A;  1GHP A;  4NET A;  4BBV A;  2J3T D;  2WZX A;  3IXD A;  5FDH A;  3NUL A;  3S7N A;  5AQ7 A;  3NIA A;  3FV7 A;  1HVB A;  2ACG A;  3BLS A;  2HJE A;  3QP8 A;  2PU2 A;  4PPR A;  3PAE A;  1Y54 A;  2XLN A;  5I94 A;  2J3W A;  4NXB A;  3LIF A;  5E2G A;  2VLG A;  3CZD A;  4G3K A;  2FH5 A;  3PBR A;  1LT0 A;  3G30 A;  3LUQ A;  1K4F A;  1N9N A;  1L0F A;  1JTG A;  1M40 A;  3SS5 A;  1XJ4 A;  1ZG6 A;  1RGZ A;  2XSS A;  3BFC A;  4E3I A;  1Z6F A;  4LV2 A;  1CF0 A;  3TJZ C;  3D4F A;  1E3U D;  2P7J A;  3O86 A;  4OQI A;  4WMC A;  2G2W A;  2QMI A;  3IH9 A;  4GDB A;  2Z2L B;  3ZG5 A;  3MQO A;  3JPU A;  5J7E A;  4DF6 A;  3A0S A;  3IX3 A;  3V67 A;  3LEZ A;  2HGV A;  1PW8 A;  1XPB A;  4EEP A;  3EQV A;  2ZL1 A;  4PM9 A;  1G5U A;  3VOZ A;  1XFN A;  2RCX A;  1H5X A;  2W3E A;  2R78 A;  1XA1 A;  1P9R A;  5KIZ A;  1P97 A;  5EV0 A;  5FAO A;  2W1T B;  3L7H A;  1RP5 A;  4CLC B;  3LR0 A;  3QNB A;  1BLC A;  2XA7 S;  4H6J A;  4MBK A;  3H7W A;  1ZC2 A;  2DMW A;  2DNS A;  3UDI A;  1LLB A;  2QKP A;  3VV4 A;  4JGQ A;  4FSF A;  2A24 B;  1JVJ A;  4GD8 A;  3IF6 A;  4P6B A;  1KGE A;  1JTD A;  3MXR A;  3MZE A;  1VEU A;  5IS1 A;  1OJ5 A;  1A0K A;  3EOI A;  3GQZ A;  3M6B A;  3R7W A;  1IKI A;  2QHK A;  2OV5 A;  1Q2P A;  5FQ9 A;  1YLY A;  3IX4 A;  4ZJ2 A;  4IBR A;  5C5K A;  3E4Q A;  4YNR A;  3RTY A;  2XRN A;  4R38 A;  3K3D A;  5FI6 A;  4ETZ A;  4HH3 A;  2RL3 A;  1MXO A;  1TS6 A;  4LV3 A;  3LGO A;  4IUH A;  1ESU A;  3E4P A;  1ES3 A;  4N1X A;  4UQI M;  2L4R A;  4F94 A;  2P04 A;  2V20 A;  3KX0 X;  5F82 A;  2VV7 A;  5JYO A;  2Q9M A;  2WKQ A;  3FKW A;  3NOU C;  4BJP A;  5HX9 A;  2YKF A;  3M2J A;  3CPT A;  5EVI C;  1S67 L;  4ESP A;  1LL5 A;  2KOI A;  2VKS A;  4MMN A;  2W0N A;  2HP9 A;  1E4D A;  4MBH A;  2XF3 A;  4FUW A;  1ONH A;  1PNE A;  4KQO A;  2CMN A;  3HJK A;  1NRF A;  2P08 A;  1VB6 A;  4IED A;  4OOM A;  2HP6 A;  3T4S A;  2WK0 A;  3AGF A;  4B4Z A;  1DJB A;  2P9V B;  1KVL A;  3O88 A;  4Y0O A;  4LRY C;  3JVU A;  4JPM A;  2HJ9 C;  2V0W A;  3WWX A;  4UAA A;  2FZ0 A;  2ZC6 B;  3P98 A;  1ODV A;  1BUE A;  3O87 A;  4EER A;  1NLZ A;  1L0G A;  2QJ5 A;  3T1Q B;  3VE4 A;  3CAX A;  4P0M A;  5CRF A;  2Y2Q A;  3LIA A;  4RVA A;  3DTM A;  4MEZ A;  1KVM A;  3IBJ A;  1PZP A;  5F1G A;  3N6I A;  3VMA A;  2E8J A;  1IFQ A;  2Y2N A;  3BEC A;  2Q0O A;  3NOT C;  3RXX A;  4P6Z S;  5CEC A;  4MCW A;  3KSG A;  4DE3 A;  3O5Y A;  3ICY A;  3C38 A;  1MWS A;  1S4S A;  4DXC A;  3HLE A;  1T1C A;  4XT2 B;  1G6A A;  2Y91 A;  4NG2 A;  4O8G A;  1S6R A;  4GW9 A;  1IEM A;  3OLO A;  4PM7 A;  4UA6 A;  3CJM A;  3HCY A;  4S2N A;  3LID A;  3CUE C;  2W1T A;  5LBR A;  4WZ4 A;  3T50 A;  1DP6 A;  3CPT B;  3UPP A;  2EX6 A;  2J9P A;  3SW1 A;  4KZ6 A;  5FQI A;  4EQI A;  4WMC D;  3VSL A;  1XJ2 A;  5EM0 A;  4LV1 A;  2FFY A;  1VET A;  5EVI A;  3QP2 A;  3TSG A;  4N1H A;  4X53 A;  1JWV A;  3LI9 A;  2WGW B;  1TS8 A;  3ZVW A;  5BOH A;  3BY8 A;  3M2K A;  3MZD A;  4HY8 A;  1XXM A;  3LYX A;  2JKR I;  3DTI A;  1GSW A;  2HZ5 A;  1L0E A;  3SS3 A;  2JCH A;  1ES5 A;  3ZNT A;  3ZYT A;  3V3S A;  4YWZ A;  1YPR A;  3V5M A;  4MN6 A;  2CC1 A;  4E3L A;  2J8Y A;  5CHJ A;  3F1O A;  3OPP A;  2X71 A;  3KYE A;  4KUK A;  3HLC A;  3IF6 C;  3ZG8 B;  4G3W A;  2PR5 A;  3ZG9 B;  1ERO A;  2EX8 A;  1T1A A;  3VE3 A;  4QB8 A;  1FQG A;  5A91 A;  4HQA A;  4BBT A;  4HJ4 A;  3T4K A;  4PM8 A;  4ZTK A;  5HFO A;  1IYS A;  2ZOH A;  4WUJ A;  2ZJ9 A;  3FPW A;  5HWT A;  1BLH A;  4ARZ B;  1XJ6 A;  5M1A A;  2IWC A;  5HAP A;  1KGF A;  5HL6 A;  2PYP A;  4CLC A;  4FOF A;  3SH8 A;  4MLL A;  4IVI A;  1CI9 A;  1BLS A;  3K2N A;  2WUQ A;  4C6Y A;  1VEU B;  1C3B A;  2H5S A;  2EWW A;  4PKY A;  3T4L A;  4PAU A;  2PU4 A;  3GSG A;  1LSV A;  2PD8 A;  1NJ4 A;  4MNR A;  2WAE A;  1WYB A;  3IF6 B;  3SZT A;  2FFF B;  1VM1 A;  1PWD A;  2HDR A;  1K57 C;  1W8Q A;  3H7W B;  4P6Z M;  4E3K A;  1AWI A;  3BFF A;  3V3R A;  5GLC A;  3E98 A;  4GS9 B;  1K56 A;  1X0O A;  4B88 A;  5AVE A;  3W8K A;  4Y13 A;  3FPV A;  3W2Z A;  1L2S A;  1OTE A;  4X68 A;  2MJ6 A;  1TF1 A;  3B42 A;  3S22 A;  4ARZ A;  5M18 A;  1LSX A;  1KE4 A;  5TGF A;  1MWR A;  2BG1 A;  4OH0 A;  4HJ6 A;  2O9C A;  4IHQ A;  3HUM A;  2PHY A;  5EM1 A;  4U3T A;  5HDS A;  5IU1 A;  4B93 A;  3A3D A;  3EWK A;  4ZDX A;  3ZG7 B;  4S2N C;  4GHI B;  3C8C A;  4IBX A;  1KDW A;  4OP8 A;  4GKU A;  2GDN A;  1ESI A;  2OOL A;  3S7Q A;  3UE6 A;  5HPI A;  4YIN A;  4B4X A;  1GSX A;  3IF5 A;  5K5B A;  5AQ9 A;  2Z2M B;  4LFU A;  1MC0 A;  2O99 A;  4BLM A;  5DFX A;  3LIC A;  5A8B A;  3ZCZ A;  4KZ4 A;  5TJJ A;  4FTX A;  5AJG A;  1NYM A;  1RCJ A;  4WYY A;  5FDS A;  1FIK A;  4LCM A;  3EGD C;  4ZJ3 A;  1FSW A;  1N9B A;  1MWT A;  3CG5 A;  4OP5 A;  4GLQ A;  2WGW A;  1K55 A;  3HLD A;  2WAF A;  4R23 A;  1FCN A;  3S1Y A;  2W1R A;  4DDS A;  1O07 A;  2PRF A;  5EVL A;  4WZ5 C;  2IWD A;  2OLV A;  5GLB A;  4KQQ A;  4RYE A;  4LPZ A;  3ITB A;  4EXO A;  4OQ0 A;  2VGL S;  2V0U A;  4ZBE A;  3LR4 A;  2LB5 A;  4BD0 A;  1Y4O A;  3NI9 A;  2JN7 A;  4C3Q A;  2WKR A;  2OWH A;  3OZH A;  4Z1W A;  4OQH A;  3Q7Z A;  4WBG A;  4UEY A;  1MBL A;  2HF6 A;  3PBO A;  2WZZ A;  2O9B A;  2KDK A;  1XGI A;  4YFM A;  4FD8 A;  3SH9 A;  1IOU A;  5A92 A;  1DP9 A;  1F9I A;  4KG5 A;  4DDY A;  1NY0 A;  1XJ3 A;  1SDN A;  2Y2G A;  3MSH A;  1BSG A;  3E0Y A;  3EQU A;  1I2S A;  5GLA A;  4QY6 A;  4I3I A;  1YQS A;  2ZQ8 A;  2UV0 E;  1G68 A;  4GOG A;  4KZ8 A;  1PYY A;  3C2W A;  2UWX A;  1GCE A;  2ZMA A;  3SS4 A;  3BFE A;  4PM6 A;  1PFL A;  2H0T A;  1H8M A;  3F1N A;  2H10 A;  4CLC C;  4EBL A;  3B3X A;  3ZNY A;  2LB9 A;  3LEQ A;  2WYX A;  2ZC5 B;  3BW6 A;  4CJN A;  3MKF A;  1STZ A;  4ZRR A;  4BMW A;  5FAQ A;  1HD8 A;  3BFD A;  3HUO A;  3IHB A;  2ZM8 A;  3K3C A;  5FEF A;  5TR7 A;  2M7V A;  4NKP A;  3Q7V A;  3KO6 A;  3Q7V B;  1PRQ A;  3C4P A;  5EOO A;  4E04 A;  3BFG A;  3MFX A;  1ES4 A;  4OLG A;  2ZC7 A;  4CLC E;  4H8R A;  1JNU A;  1NZO A;  4S2M A;  4JXW A;  4JF6 A;  2JKF A;  1OTB A;  3LO7 A;  2OAP 1;  3GR2 A;  1Q2Q A;  5TBM B;  3CI6 A;  4L9G A;  4C75 A;  1U60 A;  4OLD A;  3N4I A;  4EW7 A;  3D9Y A;  1ALQ A;  4DJ2 A;  2JKT I;  3BJN A;  5F6A A;  5CGX A;  5AQA A;  5TBM A;  3HLW A;  5MC7 A;  2PBY A;  3LR3 A;  5F83 A;  1QMF A;  2L1M A;  2EA9 A;  1YLW A;  3IH8 A;  4CLC D;  3SH7 A;  4QD4 A;  4UQI S;  2NUT C;  5GL9 A;  3OCL A;  2BLS A;  4EV4 A;  3VFF A;  4IUK A;  1BT5 A;  3HLG A;  2M1C A;  4QJG A;  2V8C A;  2VX8 A;  1D06 A;  4I39 A;  1DJC A;  4UA7 A;  1DJA A;  1UGU A;  1LI0 A;  2HDQ A;  3T1X A;  4E3J A;  4WM9 A;  3GMW A;  2K2N A;  2W3H A;  4RA7 A;  3Q1F A;  5FI7 A;  2V1B A;  2PR6 A;  4I5S A;  1VHM A;  1NRJ A;  2Z6C A;  3ISG A;  4K0W A;  1K38 A;  4X56 A;  3GV9 A;  3T1S A;  1TDL A;  5E43 A;  5HPF A;  3KSI A;  4F3L A;  2IWB A;  4DKI A;  2ZQC A;  2ZD8 A;  4JGR A;  3HLB A;  3MFD A;  5FL3 A;  4KEN B;  1FCO A;  1TS7 A;  1K57 A;  4NEE D;  3E4O A;  1F98 A;  2H28 A;  4E3M A;  4IVK A;  1S4R A;  1XGJ A;  3PBQ A;  4R3A A;  4Z9Q A;  3H82 A;  1BUL A;  4EET B;  1E3U A;  1HTZ A;  3BEB A;  1HZO A;  2WGV A;  3CHW P;  3DAV A;  3CLO A;  3LFV A;  3C7U A;  4MDZ A;  3NHQ A;  3S4X A;  4Y7P A;  3UO9 A;  1ERM A;  4BWI A;  3TE8 A;  5DKK A;  4GCZ A;  4X1M A;  1WYC A;  2L0W A;  3HBR A;  4L9F A;  3UB7 A;  3T1R A;  3W4P A;  2VEA A;  4WEJ A;  4EES A;  3D3O A;  2C5W B;  4Y3I A;  4A5R A;  1G28 A;  4I3J A;  3IWI A;  1V9Z A;  1CQA A;  2PDR A;  1OPX A;  4EUV A;  3QP5 A;  3FZC A;  1EI5 A;  4R4R A;  1JWZ A;  2XK1 A;  4N92 A;  4DN0 A;  5HL1 A;  4S2L A;  1TDG A;  1J9M A;  2WKP A;  3A3E A;  4JGO A;  4OPQ A;  2QJ7 A;  4KZA A;  2VJW A;  3UMD A;  5EFW A;  5EVI B;  3MXQ A;  1NXY A;  2XFS A;  2J7V A;  1YLP A;  5CTN A;  4GD6 A;  3TG9 A;  3UB6 A;  5CGS A;  2XA7 M;  2ZQA A;  1YKD A;  3NOP C;  1W63 Q;  5GLD A;  5A93 A;  3NJA A;  5J8X A;  2B02 A;  4FH2 A;  2JBF A;  2JHE A;  2Y2J A;  3G31 A;  4S2O A;  2Y2O A;  1MKI A;  3AGE A;  2Y8H A;  4OQG A;  2B95 A;  3JVV A;  4BQM A;  1XA7 A;  2I72 A;  3OPH A;  4G3V A;  2QYB A;  3FC7 A;  1ZKJ A;  1I5Q A;  2EX9 A;  3L9K A;  3WS4 A;  5DVA A;  3P01 A;  3VSK A;  1YLJ A;  3R4K A;  1MKM A;  4LGW A;  4HES A;  4WZ5 A;  1F2K A;  3HVF A;  5E2E A;  1BTL A;  3G32 A;  4ZJ1 A;  1SKF A;  1ACF A;  2IA2 A;  4K08 A;  3F1P B;  4EU0 A;  4E3N A;  3Q82 A;  2VZW A;  1DY6 A;  3QHY A;  5G4Y A;  3G34 A;  5FQK A;  3UE1 A;  4L9E A;  3G2Z A;  3MMH A;  3T4O A;  1QME A;  4EUZ A;  5G4Z A;  1CI8 A;  3OPR A;  4EBN A;  3NY4 A;  5FQM A;  4OOL A;  4HOI A;  4EBP A;  3BQA A;  1OT6 A;  4HI4 A;  2P9V A;  1D7E A;  4HP9 A;  1SDE A;  5E2H A;  2WKI A;  3OBF A;  3A3I A;  3CWF A;  3WRT A;  3EEA A;  3GVB A;  3U2A A;  1SCW A;  3WS0 A;  1K56 D;  5KMW A;  3VP0 A;  3IXH A;  2A3U A;  1VQQ A;  3C4O A;  3PR6 A;  4BBU A;  5AQB A;  2OSU A;  2B5R A;  3FYZ A;  5KSC A;  2XR0 A;  4HP4 A;  3OC2 A;  4GNU A;  3NCK A;  5KZH A;  5KSH A;  5FAS A;  2R9W A;  5HWW A;  5D3O A;  3N8L A;  3FG8 A;  4EQ1 A;  2OLU A;  4I38 A;  2H0Y A;  4KZ9 A;  2W3F A;  4QWO A;  3H82 B;  5I5L A;  2XDM A;  3VOL A;  4BD1 A;  5EPH A;  3GEC A;  4WN5 A;  3F1P A;  4JGP A;  1N9O A;  2I9V A;  3EGX C;  3TOI A;  4GN2 A;  3S7O A;  1WA9 A;  3MBZ A;  2V2F F;  1W79 A;  1ONG A;  1JWP A;  2NUP C;  4I3A A;  3SOI A;  1YT4 A;  3R7W B;  2HPB A;  1CK3 A;  5G18 A;  2Y79 A;  2ZQD A;  5CED A;  3V39 A;  2GNX A;  3PYP A;  3MR0 A;  1H8Y A;  1IYQ A;  3DWK A;  5FEG A;  4BL3 A;  3I7J A;  2PD7 A;  1FR1 A;  3PTE A;  3MJQ A;  4R4S A;  1ERQ A;  4M3K A;  3WS2 A;  3LCE A;  3OPL A;  2ZC3 B;  4QY5 A;  4Q0H A;  4MBF A;  2EWV A;  3UME A;  1YLZ A;  1EWZ A;  3UE0 A;  3C30 A;  5EUA A;  5FA7 A;  1S1Y A;  2VGJ A;  2Y2P A;  4U0T A;  1K54 C;  3H9W A;  3UB5 P;  3QP1 A;  2XEP A;  1W5D A;  3IBR A;  4XXR A;  1KE0 A;  2VGK A;  3KSF A;  3NDE A;  1NYY A;  1MPL A;  3FWL A;  2DRW A;  2ZMV A;  1W63 M;  1FSY A;  4DE2 A;  3MZF A;  3OCN A;  4QHC A;  1XX2 A;  4NK3 A;  3KSH A;  4KG2 A;  1GSV A;  1L3L A;  1PI5 A;  3G2Y A;  4E3O A;  1FR6 A;  5DF7 A;  3LIB A;  3IHA A;  3W4Q A;  5HAI A;  4MN5 A;  1OTA A;  3PXP A;  4EEU A;  3NEC A;  3ZVT A;  5CTM A;  3CIT A;  1T1B A;  3MKE A;  3LIE A;  1PWG A;  1S66 L;  2EX2 A;  3BWL A;  2PYR A;  4HHD A;  2X01 A;  4UHU A;  3ZHH A;  4QPR A;  4LLO B;  1TVF A;  5M19 A;  5L2F A;  2WKE A;  1IYO A;  4JLF A;  1K55 C;  3RXW A;  1BYW A;  2M7U A;  5GHY A;  3BYD A;  4NXF A;  5EE8 A;  1LHY A;  1BLP A;  1WE4 A;  4OPR A;  4JXS A;  2XD1 A;  2A24 A;  4Y2F A;  2XGN A;  5DTS A;  1KE3 A;  4AFI A;  4LRX C;  5CHM A;  2GZA A;  4NXG A;  3UY6 A;  1E25 A;  3N7W A;  4KZ3 A;  1N4O A;  3UNW A;  4QU3 A;  3HL9 A;  1W7F A;  4DMZ A;  1OTD A;  3LY4 A;  2ZOI A;  2ZQ9 A;  3HUN A;  3BQ8 A;  4KZB A;  2JKR M;  1Y28 A;  2Q9N A;  4OON A;  1IYP A;  4O7D A;  3WS1 A;  3C5A A;  4ID4 A;  1YM1 A;  4S2K A;  3ZGA B;  2X02 A; 
#chains in the Genus database with same CATH homology
 3KYQ A;  1YSP A;  1TS7 A;  4HQA A;  4BBT A;  4HJ4 A;  3T4K A;  5HD3 A;  2VV6 A;  4NEE D;  3E4O A;  5AVF A;  1XFQ A;  3IS2 A;  1F98 A;  2H28 A;  2ZOH A;  4WUJ A;  3HJI A;  3IS2 B;  3FPW A;  5HWT A;  1S4R A;  3UB8 A;  3T4T A;  4ARZ B;  1XJ6 A;  2G7U A;  3PBQ A;  4R3A A;  3RH8 B;  3H82 A;  2ZBB A;  4EET B;  3OOV A;  5HL6 A;  2INW A;  2PYP A;  4CLC A;  1S1Z A;  3CLO A;  2HV1 A;  3LFV A;  4ETX A;  3UB9 A;  4FOF A;  2W3D A;  4L0L A;  4MDZ A;  4HH2 A;  1F5M A;  2BAS A;  3NHQ A;  4BWI A;  3K2N A;  3MQ0 A;  1DRM A;  4BBV A;  3TE8 A;  5DKK A;  4GCZ A;  2J3T D;  2L0W A;  4Y5F A;  2EWW A;  4L9F A;  4PKY A;  5DKL A;  3T4L A;  3UB7 A;  4PAU A;  3S7N A;  2VEA A;  4HIA A;  4WEJ A;  4EES A;  3D3O A;  1LSV A;  5HWV A;  4Y3I A;  2PD8 A;  1G28 A;  2XRO A;  4I3J A;  2HJE A;  3TRC A;  1V9Z A;  2PDR A;  1OPX A;  4EUV A;  2O9A A;  5CX7 A;  2J3W A;  5DJT A;  1ZHH B;  4NXB A;  3F1N B;  4DN0 A;  3LIF A;  4F3L B;  2WKP A;  4JGO A;  2VLG A;  3H7W B;  4P6Z M;  2QJ7 A;  4G3K A;  4LRZ E;  1V9Y A;  2FH5 A;  2QWS A;  2VJW A;  2W27 A;  3UMD A;  5EFW A;  3PBR A;  1LT0 A;  3LUQ A;  3MXQ A;  4Q0J A;  1N9N A;  3E98 A;  1XJ4 A;  1DP8 A;  4GS9 B;  1X0O A;  5AVE A;  3UB6 A;  3GDI A;  4PHT A;  2XSS A;  2XA7 M;  3NOP C;  1YKD A;  1W63 Q;  3FPV A;  3W2Z A;  2YKH A;  3NJA A;  4O0P A;  3S7P A;  2B02 A;  1OTE A;  2JHE A;  3TJZ C;  2MJ6 A;  1TF1 A;  2P7J A;  3B42 A;  4ARZ A;  1LSX A;  3EEH A;  4WEK A;  5HD5 A;  4HJ6 A;  2O9C A;  3MQO A;  2Y8H A;  4IHQ A;  3TW8 A;  2J3T C;  2VGL M;  5J7E A;  3JVV A;  1EW0 A;  2PHY A;  5HDS A;  3A0S A;  3V67 A;  5IU1 A;  2HGV A;  4G3V A;  4B93 A;  4EEP A;  2QYB A;  3EWK A;  1YAX A;  4WEL A;  3FC7 A;  3EQV A;  3ZQ5 A;  2D02 A;  4GHI B;  3C8C A;  1XFN A;  3VE3 A;  3P01 A;  2W3E A;  2R78 A;  1P9R A;  5KIZ A;  1P97 A;  3R4K A;  1MKM A;  5F68 A;  4B9O A;  5DJU A;  1NLY A;  2W1T B;  2OOL A;  3S7Q A;  4CLC B;  3UE6 A;  5HPI A;  2IA2 A;  3ULF A;  4K08 A;  3F1P B;  4EU0 A;  3LR0 A;  1GSX A;  2VA0 A;  2KX6 A;  1UWP X;  4O01 A;  5K5B A;  2XA7 S;  5HZH A;  4H6J A;  1MZU A;  3H7W A;  1MC0 A;  2DMW A;  2O99 A;  2VZW A;  5G4Y A;  3MQQ A;  2QKP A;  5DFX A;  4Q0I A;  3VV4 A;  3LIC A;  4L9E A;  3B33 A;  5L8M A;  5A8B A;  4JGQ A;  3LI8 A;  1P9W A;  4FSF A;  2A24 B;  5TJJ A;  3MMH A;  1OJG A;  5AJG A;  3T4O A;  4CQH A;  5G4Z A;  3G6O A;  3EGD C;  4OOL A;  4HOI A;  2K31 A;  3BQA A;  3F1O B;  2A2L A;  1OT6 A;  4GLQ A;  3PBS A;  2K7S A;  1OJ5 A;  5IS1 A;  3EOI A;  5HSQ A;  3A0V A;  1NWZ A;  4HI4 A;  1LSW A;  3R7W A;  1D7E A;  1UWN X;  2J80 A;  1G6O A;  4NXE A;  2QHK A;  4HP9 A;  4WL9 A;  3OBF A;  2W1R A;  3CWF A;  3EEA A;  3U2A A;  1OTI A;  5HDC A;  2B18 A;  5J3W A;  2KLI A;  5C5K A;  5DF9 A;  3E4Q A;  4YNR A;  5DFY A;  4LPZ A;  3PR6 A;  2OAQ 1;  4BBU A;  3RTY A;  2XRN A;  4R38 A;  3K3D A;  4EXO A;  4ETZ A;  4HH3 A;  4ME4 A;  1TS0 A;  2VGL S;  1TS6 A;  2V0U A;  3LR4 A;  4HP4 A;  3OC2 A;  4IUH A;  3PBT A;  2LB5 A;  3E4P A;  3LR5 A;  3T4J A;  5KSH A;  1KOU A;  5HWW A;  4UQI M;  2L4R A;  2JN7 A;  2WKR A;  2OWH A;  4R6L A;  3FG8 A;  4Z1W A;  4EQ1 A;  4I38 A;  2GX5 A;  2P04 A;  4UEY A;  3KX0 X;  2W3F A;  2VV7 A;  1H3Q A;  2WKQ A;  2HF6 A;  2PT7 A;  3PBO A;  2O9B A;  3NOU C;  4BJP A;  3H82 B;  5I5L A;  2KDK A;  2YKF A;  2ZMF A;  3VOL A;  1S67 L;  2VKS A;  2KOI A;  4MMN A;  3GEC A;  2W0N A;  4WN5 A;  3F1P A;  4JGP A;  1N9O A;  1IOU A;  4KQO A;  1DP9 A;  1F9I A;  2I9V A;  2CMN A;  3EGX C;  4R70 A;  1LL8 A;  3HJK A;  1XJ3 A;  2D01 A;  3KYZ A;  1WA9 A;  3S7O A;  2P08 A;  2O0Y A;  1VB6 A;  3E0Y A;  3EQU A;  4XT2 A;  2NUP C;  4IJG A;  4OOM A;  4I3A A;  4I3I A;  2VV8 A;  3T4S A;  4GHI A;  3R7W B;  4H6J B;  4HJ3 A;  4LRY C;  2Y79 A;  3C2W A;  3JVU A;  4KUO A;  2HJ9 C;  2V1A A;  3PHY A;  2GNX A;  3PYP A;  3MR0 A;  2V0W A;  3PBN A;  1H8M A;  4MN7 A;  2FZ0 A;  2PD7 A;  1ODV A;  2OWJ A;  5F69 A;  3F1N A;  1ZTU A;  5F5Y A;  4CLC C;  3MJQ A;  4EER A;  4WF0 A;  2LB9 A;  1NLZ A;  3BY9 A;  2QJ5 A;  3BW6 A;  3VE4 A;  4Q0H A;  3CAX A;  2EWV A;  1STZ A;  4ZRR A;  5J4E A;  4BMW A;  3UME A;  1OT9 A;  3LIA A;  3C30 A;  3D72 A;  3K3C A;  2M7V A;  4NKP A;  3KO6 A;  1S1Y A;  3IBJ A;  2W3G A;  4E04 A;  4DJ3 A;  3MFX A;  1TD5 A;  3H9W A;  4CLC E;  1JNU A;  5IT5 A;  3IBR A;  2JKT M;  1IFQ A;  1YSQ A;  3KSF A;  4YOF A;  3NOT C;  1OTB A;  2ZMV A;  1W63 M;  4P6Z S;  2OAP 1;  4MCW A;  3KSG A;  3O5Y A;  3B47 A;  3ICY A;  3C38 A;  5TBM B;  3OCN A;  1S4S A;  3CI6 A;  1T1C A;  4XT2 B;  4L9G A;  3KSH A;  4O8G A;  1GSV A;  4GW9 A;  4PKY G;  4WLA A;  4EW7 A;  2Z6D A;  4DJ2 A;  2JKT I;  5HDD A;  3BJN A;  3OLO A;  5F6A A;  2V9A A;  5TBM A;  3LIB A;  3HCY A;  3A0R A;  3LID A;  5MC7 A;  3CUE C;  2W1T A;  5LBR A;  3LR3 A;  3T50 A;  4MN5 A;  1DP6 A;  1OTA A;  3PXP A;  4EEU A;  2L1M A;  2EA9 A;  3CIT A;  4CLC D;  3SW1 A;  1T1B A;  4GJ4 A;  3LIE A;  4UQI S;  1S66 L;  2NUT C;  3P7N A;  1XJ2 A;  3UE3 A;  3BWL A;  3OCL A;  4IUK A;  2PYR A;  4HHD A;  1T19 A;  4QPR A;  2M1C A;  4LLO B;  2VX8 A;  1D06 A;  4I39 A;  1UGU A;  3LI9 A;  4M4X A;  1TS8 A;  1N9L A;  1T18 A;  1BYW A;  3BY8 A;  2M7U A;  4HY8 A;  3DBA A;  4NXF A;  3LYX A;  2JKR I;  1GSW A;  2A24 A;  4Y2F A;  4AFI A;  2K2N A;  4LRX C;  2GJ3 A;  4HNB A;  2GZA A;  4NXG A;  1P0Z A;  2W3H A;  3ZYT A;  4KQD A;  4YWZ A;  3MF0 A;  2V1B A;  4MN6 A;  4DMZ A;  2PR6 A;  1OTD A;  2ZOI A;  4I5S A;  1VHM A;  3T4Q A;  3F1O A;  1NRJ A;  2Z6C A;  4GS9 A;  3BQ8 A;  3CUE A;  2JKR M;  3RFB A;  4KUK A;  1Y28 A;  5HPF A;  3KSI A;  4F3L A;  4RQ9 A;  4II7 A;  4G3W A;  4JGR A;  2PR5 A;  1T1A A;  5FL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...