3BY8A

Crystal structure of the e.coli dcus sensor domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Sensor protein dcuS
total genus 41
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17203 sCache_3_2 Single cache domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by8A00
1T18A 1T1BA 1XJ4A 1F98A 3NOUC 1LT0A 1S1YA 1D7EA 2H28A 3F1PA 3CLOA 1S67L 2PD7A 1D06A 3RTYA 1N9NA 1EW0A 4RQ9A 5HD3A 3B33A 5HSQA 4EEPA 3F1PB 4HHDA 1T19A 2PDRA 4JGQA 4LPZA 5DKKA 5F6AA 2BASA 5F68A 4I38A 1S1ZA 2V1AA 3NOTC 3UB6A 1XFNA 4EXOA 1LSWA 4GCZA 4L9GA 4KUOA 4I3AA 2ZOIA 2JHEA 3BY8A 3H82A 2B02A 4BBVA 1P97A 3F1NB 4HIAA 2QWSA 4HOIA 4HP4A 5HDDA 5HDCA 1OJ5A 5HWTA 2QKPA 1KOUA 4NXGA 3F1NA 1DP9A 1GSXA 4L9EA 4R6LA 1DRMA 1DP6A 3H9WA 4LRZE 2A24B 3VOLA 4KQDA 2V1BA 4XT2A 2I9VA 1T1CA 3FG8A 4JGPA 2Z6CA 1UWNX 1S66L 3UB9A 5HDSA 1Y28A 2VEAA 1GSWA 4XT2B 1OT9A 1S4RA 4HH3A 2V0WA 3G6OA 2PR6A 2EA9A 3GDIA 4EESA 1MZUA 3BY9A 3A0SA 3UB8A 3HJKA 1VB6A 3MXQA 3P7NA 3OLOA 2QJ5A 3MQQA 4YWZA 1DP8A 3CAXA 1LSXA 1LSVA 1V9ZA 2VV7A 3E4PA 3IBRA 3GECA 3LUQA 1UWPX 2INWA 4HI4A 4LLOB 3ULFA 4DJ2A 2L4RA 1OJGA 4EW7A 2Z6DA 1TS6A 4HNBA 2R78A 3D72A 2VLGA 3C8CA 3K3DA 3K3CA 4WL9A 4MN6A 2CMNA 2D02A 4WN5A 3LIDA 1TS8A 2V9AA 5TBMB 3RH8B 3LIFA 2KX6A 2A24A 5DJTA 3LIEA 5TBMA 2WKPA 4HP9A 1UGUA 2OWHA 2KDKA 1XJ2A 2L1MA 3PHYA 5J3WA 3UMDA 5J4EA 3A0VA 3MR0A 4H6JB 4PKYG 4BBTA 4EETB 2PD8A 5IU1A 4R3AA 4EQ1A 5HWWA 3EWKA 3F1OB 4LRXC 3HJIA 4PKYA 4WF0A 5HZHA 3CWFA 5EFWA 4R70A 1GSVA 3EEHA 3IS2B 3MJQA 4HQAA 2QJ7A 5HD5A 2W0NA 3UB7A 3LI8A 5AVEA 3ICYA 1N9LA 4M4XA 2PR5A 4L9FA 1OTEA 2VV8A 3LICA 2M1CA 2OOLA 1N9OA 4I39A 4F3LB 3KX0X 4HY8A 1XJ3A 2WKQA 3BWLA 4BBUA 1LL8A 3VE4A 1BYWA 3UE6A 1S4SA 2JN7A 3LIBA 5G4ZA 3UMEA 2OWJA 1G28A 4I5SA 4HJ4A 4EEUA 1ODVA 4WUJA 4DJ3A 1TS7A 2GJ3A 4GS9A 3ZQ5A 4R38A 3NHQA 4H6JA 4LRYC 4MN5A 1OTAA 2YKHA 2ZBBA 3F1OA 2HV1A 4NXBA 5DJUA 3NOPC 4GHIA 4HH2A 5DKLA 1TS0A 3C2WA 2WKRA 3IS2A 2PYPA 3NJAA 1WA9A 5F69A 2V0UA 4B9OA 1X0OA 3E4QA 4GHIB 1XJ6A 4NXEA 4E04A 3FC7A 3LYXA 2QHKA 2D01A 2K7SA 4KUKA 4NXFA 3LI9A 5F5YA 1JNUA 5IS1A 3PYPA 2PYRA 5I5LA 4F3LA 1XFQA 3H7WA 5AVFA 3LIAA 2PHYA 2W27A 1T1AA 3MFXA 4JGOA 4I3JA 3H7WB 1F9IA 2ZOHA 3A0RA 4HJ3A 1OTBA 1P0ZA 4I3IA 4JGRA 1OT6A 2L0WA 2J80A 5A8BA 2P7JA 2VV6A 4GS9B 5G4YA 1V9YA 3H82B 2YKFA 3E4OA 4WLAA 3T50A 5J7EA 4HJ6A 5KIZA 3SW1A 1OTDA 3VE3A 1OTIA 4EERA 1NWZA 4GW9A 4K08A 3MQOA 5HWVA
chains in the Genus database with same CATH superfamily
2G2WA 3WS0A 3F1PA 3G2ZA 1N9NA 1NRFA 3DAVA 2HP5A 2BG1A 1C3BA 4BL3A 4UA6A 1S1ZA 1XP4A 4L9GA 3H82A 2GNXA 4QY6A 3KO6A 4MBKA 1Z6FA 2AVXA 4QHCA 1UWNX 2HGVA 3BJNA 3CJMA 4XT2B 3CZDA 4HH3A 4AFIA 2EFXA 3C5AA 3DWZA 3QP8A 3CAXA 1BLPA 1IEMA 4L0LA 2OAP1 1TS6A 1MBLA 3K3DA 1K57C 3MBZA 4P85A 1EI5A 5J3WA 5JYPA 2HPBA 3FZCA 5HWWA 4C6YA 3MJQA 3G34A 3SZTA 5HD5A 1FCMA 1OPXA 2VKSA 3MZEA 4HY8A 4EUZA 2WKQA 4GJ4A 1MXOA 4P6ZM 3UMEA 2HP6A 2W3GA 1ODVA 1VEUB 1BTLA 1BUEA 4H6JA 3M6HA 4R38A 2E8IA 1ZG6A 5CERA 2HDRA 3GTCA 2O9BA 2Y2GA 4EQIA 5CRFA 4S2MA 2JCHA 3H7WA 4QD4A 3A3EA 5HFOA 5FI2A 4ARZA 4S2PA 2B18A 5HAIA 4ZJ3A 3MF0A 4K08A 1XJ4A 3IT9A 4GLQA 3PBNA 2WKEA 3CLOA 2QPNA 1I5QA 5HSQA 2Y4AA 2ZQ8A 4LPZA 4E3JA 1CI8A 2QZ6A 4KUOA 3VOZA 1OJ5A 4O01A 5FQQA 1JTGA 4R6LA 3H9WA 4KQDA 4XT2A 3FG8A 3IX3A 4X68A 1Y28A 1W79A 3L9KA 5M1AA 1QMEA 3V67A 2J9OA 3JVUA 2QJ5A 3TRCA 1LSVA 2L4RA 4LV1A 5FAQA 3TG9A 2H10A 2HDQA 4Y0TA 1FIKA 2NUTC 3BFFA 1L0EA 1PFLA 3ZG5A 3MR0A 4OOYA 4BBTA 4R3AA 4MNRA 4WF0A 3MSHA 3UNWA 2PBDP 3LFVA 1IKGA 1HD8A 4Y0OA 5CEBA 4Q0JA 2VX8A 5DF8A 3M6BA 2WGWB 1Q2QA 4Q0IA 4LENA 3IX4A 2WKRA 4KZ3A 4QPRA 4FD8A 5CGWA 3G35A 3PYPA 4BMWA 3ZNYA 2ZMVA 4OLDA 4I3JA 5EE8A 5FQKA 2P9VA 1P0ZA 1MPLA 1Z09A 3VOYA 2WAFA 2P08A 1ERQA 1D06A 1LHYA 4JXVA 4EEPA 3F1PB 1PW8A 3OCNA 4JGQA 4S2KA 1HVBA 3VSKA 4I3AA 4O7DA 2QWSA 4WYYA 1W8QA 1E4DA 3WS4A 4DE3A 5CTNA 3C4OA 3UB9A 2JKFA 3LY3A 3E0YA 2H5SA 5FQIA 3T4JA 2EXBA 3SH7A 3C30A 2Y91A 1DJAA 3T12B 5FQJA 2NUPC 4DDSA 3NCKA 5CEDA 4X1MA 3CWFA 1P9WA 1NZOA 1GSVA 3VP3A 4HQAA 1YLTA 1NYYA 2W0NA 5CGXA 3T1QB 4EV4A 4WZ5C 1U60A 2XH9A 4CLCE 2WAEA 2JE5A 2VA0A 3QHYA 1FCOA 3IX8A 1VETB 3W8KA 2HV1A 4HH2A 1XGIA 4B9OA 1SDEA 4ZTKA 1SZVA 1PWGA 5EECA 4KZ7A 5F5YA 5CX7A 5GHXA 5KSHA 3M2JA 3LIAA 2XQZA 1ERMA 3H7WB 3T1XA 3CPTB 5EVID 3ITBA 3MKFA 5FAOA 2LB5A 2PBYA 3BLSA 1PIOA 1OT6A 3D3OA 4E3NA 1W5DA 2P7JA 4WLAA 4H8RA 3QP6A 3CI6A 5EVIC 1STZA 3BQAA 1T1BA 4CJNA 3N8LA 2R9XA 4JXGA 1K55C 2XROA 1K6SA 2J3TD 3B33A 2KOIA 2V2FF 2ZQDA 4HESA 4MEZA 4GCZA 5E2EA 2P04A 4HP4A 4NXGA 1GSXA 1PW1A 3I7JA 3SS4A 4KZ4A 3C38A 2W3DA 4DKIA 3NIAA 1BLSA 1M6KA 4U0XA 3PXPA 3MXQA 4D2OA 4YWZA 4HBUA 1V9ZA 1ONHA 2VK3A 3ULFA 4WL9A 3CG5A 4WN5A 3U2AA 3VMAA 3BRMA 5DJTA 2J7VA 2OWHA 4P6ZS 3T1RA 4GD8A 3BEBA 2EX2A 2Y2NA 2W1TB 3KSHA 2QJ7A 2ZC7A 3LY4A 3VFFA 1NLYA 1BLCA 4ZAMA 5G4ZA 2RCXA 1CEFA 4HJ4A 1SHVA 4MN5A 1YSPA 1K4EA 4EWFA 4NXBA 4P0MA 1WA9A 1YT4A 1KDWA 4C75A 1GHIA 1XJ6A 2K7SA 4PHTA 3ZYTA 3D4FA 3CPTA 4PM8A 2V8CA 4DDYA 1GHMA 4ETZA 2ZOHA 3A0RA 2UV0E 2B95A 3AGFA 1K25A 2VGLM 2YKFA 3T50A 3OZHA 2ZM0A 4QJGA 4E3LA 3OPRA 1T18A 1TF1A 5IHVA 3GRJA 4PMAA 2Q9MA 4GB7A 1KE3A 4E3OA 3UB5P 4UAAA 1IOUA 3HLDA 2ZQ7A 2ZOIA 3BY8A 2JKTI 5GLAA 1OMEA 5FAPA 1YLYA 2IWBA 4MLLA 3VOLA 1ZG4A 5GHZA 2EX8A 1F5MA 1PWCA 4MBHA 1AXBA 1MWUA 1ZC2A 3GECA 3T1SA 2V8FA 5M19A 4PM9A 4S2NC 3IQAA 3U4LP 3S7PA 3LIFA 4R3BA 2WKPA 4PPRA 3QP5A 4KG6A 4N92A 5GLCA 2KDKA 3UMDA 5I94A 3T4TA 1ES4A 4BWIA 4Z1WA 1ES5A 2EXAA 4OQ0A 4KZ8A 4LCLA 2W1RA 2ZD8A 5HL1A 3O87A 5AQ9A 1BLHA 2O0YA 4LCMA 4WUJA 2E8JA 2EWWA 2GX5A 1VETA 3IHBA 2GDNA 2Y2IA 3WRZA 4X56A 4NXEA 5CGSA 1FILA 2FZ0A 3T4KA 1L0FA 2HF6A 4OQGA 1XPBA 5HW3A 2XRNA 3T4QA 2G7UA 4K91A 1CI9A 3E4OA 5E2HA 4EBNA 3KYQA 4WZ5A 4IVKA 3Q81A 1MC0A 1LT0A 3MQ0A 5GLBA 1TEMA 1H8ZA 1VM1A 4UA9A 4A5RA 5FASA 3QP1A 4R4SA 2Q9NA 1YAXA 3L7HA 1FQGA 4RYEA 4HOIA 2EX9A 2QKPA 1KOUA 1MY8A 1DRMA 4KG5A 4OLGA 4KENB 2V1BA 4JGPA 1JWVA 4B88A 3N8SA 5A92A 5FA7A 3FKWA 1MZUA 3MQQA 1G68A 1SDNA 3HLFA 5EVEA 3ZVTA 5AQBA 2JKGA 4S2IA 3K3CA 4S2NA 3N6IA 3ZDJA 2V9AA 4KZ5A 4MDZA 5F83A 4BL2A 3D9YA 1CJFA 4X25A 4N1HA 4RX2A 3WS2A 1HZOA 1G6OA 1PI4A 5CHMA 3LR5A 3P01A 3ZHHA 3NECA 2XLNA 2A49A 3LIBA 3BQ8A 5L09A 5EM0A 1KVMA 2O9AA 5CTMA 3UY6A 2ZBBA 3UE0A 3NDEA 3EGDC 3OOVA 1SCWA 2JKTM 2D01A 5IS1A 2PYRA 4UEYA 2JC7A 2Y2OA 5EPHA 4I3IA 1VEUA 2BTFP 3T4OA 1PZPA 2DCFA 4HBTA 1JVJA 3B3XA 4HJ6A 4WELA 2C6WB 4OPZA 1WYBA 4OOLA 1DJBA 5KZHA 2EFUA 3S7QA 4UQIM 4LFUA 2ZL1B 4FH2A 3S22A 5DF7A 5FATA 3OBFA 1WE4A 3K2NA 1T19A 3O88A 5DKKA 1YKDA 4JXWA 3JPUA 3NOTC 1XFNA 3DBAA 4MCWA 4RA7A 5A93A 1OT9A 4CLCC 1NRJA 5LBRA 5CECA 1BT5A 4KG2A 2INWA 4EBPA 4R23A 5EVLA 2R78A 1ZKJA 3R7WB 3TE8A 3HVFA 4ZDXA 5TBMA 1FOFA 3UDIA 3NI9A 5L07A 5IU1A 4R70A 5DVAA 3BM6A 4NG2A 5AVEA 4X53A 4G3VA 4S2OA 1OTEA 3A3JA 2X02A 3MXRA 4CPKA 3UN7A 1I2SA 4N9LA 4I5SA 1PI5A 4GS9A 1OTAA 2VGLS 4IBRA 4GHIA 1FSWA 3E4QA 3VP4A 3PBOA 2QHKA 3IXHA 2G2UA 3IF6A 1NY0A 4NETA 4II7A 2V1ZA 5FQ9A 1J9MA 2H0YA 4DMZA 4IHQA 1YQSA 1Y4OA 2Y59A 1VHMA 1IYOA 1F98A 2HJEA 3E2LA 3NOUC 2K2NA 1XKZA 2IA2A 2KLIA 4UA7A 4E6XA 4R1GA 1LSWA 2XK1A 2JKRM 5HX9A 4DF6A 1S0WA 3F1NA 1DP9A 4CLCD 4LRZE 3FWLA 2I9VA 2Z6CA 4X6TA 1N4OA 4DRTA 3Q1FA 4GNUA 4KZBA 1DP8A 2XGNA 3IBRA 4LLOB 1XA1A 3LEZA 4E3IA 2Z6DA 3FYZA 2HP9A 5EVIB 5TBMB 5F1FA 3GQZA 5U47A 3PHYA 4EQ1A 2PAVP 3A3IA 4FTXA 3BW6A 1GA9A 3QP2A 3V5MA 1W63M 3DTIA 1CQAA 3ITAA 3KX0X 4RX3A 4OPQA 4EUVA 1XX2A 2ZM8A 1G28A 1YMXA 4EEUA 4IUHA 2HDUA 5A91A 4B93A 3NOPC 3Q7ZA 1LL5A 1K55A 2ZJ9A 4Y5FA 2BLSA 3PBQA 2PYPA 3HL9A 3DW0A 2Q0OA 3KSIA 3OPLA 1H8MA 3W4PA 4FSFA 1W63Q 3M2KA 1KGGA 1ES2A 2HDSA 5KMWA 2EWVA 4WBGA 1NWZA 2ZC4B 1JWZA 3IBJA 3RTYA 3RXXA 4RQ9A 2ZL1A 5IT5A 4IEDA 4NEED 3OCLA 2JHEA 3TJZC 3F1NB 5FSRA 3HLEA 4JF5A 3BFDA 1AWIA 3BFGA 1DP6A 1EROA 3V3RA 3IWOA 2ZMAA 3G6OA 4KQQA 2C5WB 4CLCB 3GDIA 4MN7A 3CHWP 3HJKA 3PBSA 4NK3A 1LSXA 5L10A 2X71A 4OONA 2QYBA 3RH8B 2ZQAA 3QNCA 5G18A 5GHYA 4Y7PA 5DTKA 3DTEA 4H6JB 4GZBA 3RJUA 3BFEA 3EGXC 2WZZA 4ID4A 3LI8A 3ICYA 1N9LA 2M1CA 1K54C 5CHUA 1L3LA 4Y17A 3FV7A 2WK0A 4FH4A 3VP0A 4DE1A 5FL3A 3VP1A 2GJ3A 3ZQ5A 1ZTUA 2Y8HA 3LR3A 2ZC3B 4GHIB 5JYOA 3FC7A 3HCYA 4IBXA 4D60A 5AVFA 3MXSA 3IF6B 3HLGA 5DF9A 4HJ3A 4R0QA 4F94A 2XSSA 2IWCA 4JPMA 3UPOA 2Y2HA 4DE0A 3TOIA 1S1YA 5D3OA 5AQ7A 2PD7A 3SH9A 3RFBA 3ZGAB 4S2LA 4C3QA 1IKIA 2J8YA 4OPYA 2GZAA 3HLWA 2BASA 1YMSA 4ARZB 2Z2MB 3KYEA 1K4FA 3MS6A 4YOFA 1H3QA 2A3UA 1NZUA 1S66L 4E6WA 1GSWA 1S4RA 1BSGA 3IWQA 2EA9A 3GR2A 3QP4A 4LV3A 4IUKA 3IF6C 2W3HA 3NY4A 4OPRA 1LLBA 3C8CA 1E3UD 4FCFA 1LI0A 2FFFB 5EVIA 3LIEA 5CHJA 5FDHA 3IXGA 4LRXC 3PR6A 2LB9A 3IS2B 1PYYA 3UB7A 4R3JA 1ES3A 4F3LB 2FFYA 1S4SA 3BECA 3GVBA 3WS5A 2DRWA 5KSCA 3NULA 5TJJA 1NYMA 2MJ6A 3NJAA 2V0UA 1IFQA 4JXSA 4E04A 1YSQA 4DE2A 1T1AA 2XF3A 4JGOA 2XEPA 3LO7A 3IHAA 1E3UA 3Q82A 4ZJ2A 4Y0UA 5A8BA 3DTKA 4FOFA 4R4RA 4OKPA 3VE3A 1TDGA 2QMIA 4PM5A 3FPVA 4EESA 2O99A 1D7EA 5FEFA 1QMFA 2OLVA 4HHDA 1MWSA 3OPPA 1K56D 3ZG8B 2P9VB 4EU0A 1LI9A 2V1AA 1G5UA 1TDLA 1MKIA 4X69A 5HPFA 1P97A 3G4PA 4MMNA 5HWTA 3JVVA 2A24B 5HAQA 2PR6A 3O5YA 1IYSA 3BY9A 1FCNA 3A0SA 3OLOA 3LCEA 2VV7A 2Y2LA 4OVDA 3S7OA 4BD0A 1UWPX 3UDFA 3MZDA 4Y13A 3ZFZA 1OJGA 4HNBA 4X55A 3VV4A 3WS1A 5E43A 2CMNA 3GMWA 1RGYA 5GL9A 3E2KA 3UDXA 3V39A 1UGUA 1PNEA 1BULA 1XJ2A 4M3KA 4EETB 3F1OB 3HJIA 2K31A 4YINA 5EFWA 4X1LA 5AJGA 4YFMA 4M4XA 5EM1A 2OOLA 1XJ3A 3IH8A 4E3KA 3UE6A 2OWJA 3MZFA 5A90A 3VP2A 3WWXA 2J3WA 2HZ5A 1TS0A 1GA0A 1O07A 1X0OA 3KSGA 2PU4A 1O7EA 4EBLA 3LI9A 3GV9A 4WMCD 4BENA 4IJGA 4QU3A 5TR7A 5EOEA 1ESUA 2JBFA 2OV5A 5DTSA 2DMWA 1XGJA 2X01A 2L0WA 3GSGA 5G4YA 2M7UA 1ZHHB 3H82B 5BOHA 2VGKA 1TVFA 2RL3A 5L8MA 2WUQA 3P7NA 1MWTA 2I72A 4GD6A 1EW0A 4PAUA 1HLUP 1FR6A 5HL6A 1WYCA 4HIAA 2Z2LB 2Y79A 1VQQA 5HDCA 1IYQA 3BLMA 3P09A 1J3WA 3LGOA 4NKPA 1FR1A 1SKOB 3DWKA 5TFQA 1T1CA 2V0WA 3UPNA 1VB6A 4DJ2A 2V20A 4BQMA 1DJCA 1H8YA 1TS8A 3LR4A 4JLFA 3A3FA 1ONGA 4HP9A 3N8RA 3PAEA 3IXDA 3A0VA 1L0GA 4PKYG 4G3WA 4PKYA 3SH8A 3EEHA 1YLPA 4I39A 3LICA 2W3EA 1N9OA 3SS5A 3UO9A 5FQMA 4OQHA 4U0TA 4E3MA 5E2FA 3VE4A 4BBUA 1BYWA 2W3FA 2UWXA 1TS7A 2ACGA 3ZNTA 2OSUA 5MC7A 3HBRA 1EWZA 3C7UA 3LYXA 3JYIA 3O3VA 5I5LA 3ZCZA 1XFQA 3AGDA 3MFXA 2XDMA 2J9PA 2PRFA 4WMCA 2J80A 1F2KA 5J7EA 4QB8A 1OTIA 4JF4A 5K5BA 3N4IA 3MQOA 3SS3A 4FUWA 1RGZA 1CF0A 2JKRI 1S67L 1KE0A 2HJ9C 3UE1A 3S1YA 1FSYA 5F68A 3W4QA 2ZC6B 2B5RA 4ZJ1A 3S4XA 1SKOA 3HUOA 4JBFA 2H0TA 1D1JA 1P9RA 3KYZA 4ETXA 3C4PA 4LV0A 4GKUA 3IF5A 2DNSA 3R4KA 4N9KA 3HLCA 2WYXA 1RP5A 4EW7A 4LGWA 3DTMA 1BZAA 4P6BA 4GOGA 2KX6A 2WGWA 4G3KA 1Q2PA 4O8GA 4UQIS 3A3DA 1CK3A 1TD5A 3BYDA 3QNBA 3B47A 1N9BA 3CUEC 2PR5A 4PM6A 2PT7A 3BWLA 2JN7A 1IYPA 1H5XA 3ZVWA 5AQAA 2EX6A 1W8YA 4DXCA 1YPRA 4BD1A 3T4LA 4OH0A 3TSGA 5C5KA 2J3TC 4NXFA 2VJWA 3LR0A 4K0XA 1OTBA 1DY6A 3OPHA 5TGFA 1IELA 3IXBA 4OP5A 5KIZA 4KQRA 1I2WA 4BJPA 1H0MA 2OAQ1 3S7NA 3E98A 3FKVA 1NXYA 5EOOA 5L2FA 5FI6A 2R9WA 2ZQ9A 4QY5A 3CMZA 2Y2KA 1YLZA 1PWDA 4BBVA 5HDDA 3MMHA 2O9CA 3V50A 4Y2FA 2IWDA 4PM7A 2VEAA 2XFTA 1JTDA 1PZOA 4XXRA 2VLGA 4B4ZA 2D02A 3EEAA 4BLMA 2WGVA 2VGJA 2ZM2A 4HEFA 2L1MA 4K0WA 5DTTA 2M7VA 4CLCA 3SW1A 1KGFA 5HZHA 4GN2A 1K54A 1NJ4A 2VZWA 2XD5A 1K56A 3Q7VB 1LL8A 2WKIA 2P74A 1Y54A 3ZG9B 2YKHA 5DJUA 5HAPA 5DFXA 1KDSA 2XA7S 4KUKA 1LL9A 3O86A 3Q07A 3V3SA 4JKTA 2W27A 1ACFA 2ZMFA 3ZG7B 5EUAA 1ESIA 2OLUA 3N7WA 2VV6A 2WKHA 5CXWA 4KZ6A 3UPPA 3EOIA 4Y15A 2XFSA 2PDRA 5F6AA 3NC8A 3W4OA 2WADA 4EXOA 4Q0HA 1MWRA 2B02A 1RCJA 3IH9A 3PAGA 1SKFA 1GHPA 3R7WA 4XUXA 2ZQCA 4WEJA 5J8XA 3W2ZA 2Y2PA 3HUMA 2PU2A 1L0DA 4YNRA 2W1TA 2Y55A 3E4PA 3D72A 3LIDA 5F82A 3VFHA 3AGEA 4ESPA 3HUNA 3IWIA 1ALQA 1E25A 5FDSA 1KGEA 2A2LA 4KQOA 3BFCA 1CEGA 3LEQA 3Q7VA 3ISGA 4L9FA 4XUZA 2VV8A 2WGIA 3PBRA 5F1GA 4UHUA 2Y2QA 4GDNA 3TW8A 2WZXA 4Z9QA 1KVLA 4WM9A 4DJ3A 1YLWA 4LRYC 1KE4A 4N1XA 3VSLA 1JWPA 3IS2A 3C2WA 4OP8A 2Y2MA 1W7FA 1YM1A 1JNUA 4ZBEA 4F3LA 1K6RA 2PHYA 4GDBA 3NDGA 3EQVA 1M40A 3UE3A 1F9IA 4JF6A 5FEGA 4JGRA 4GS9B 1HTZA 1V9YA 4OQIA 3MFDA 4EERA 3P98A 3CUEA 1XXMA 4ME4A 4IVIA 1GCEA 3G2YA 5M18A 2ZLYA 2H28A 5HD3A 4LV2A 3NBLA 3G31A 3CITA 3HREA 3UB6A 4I38A 3PBTA 2XD1A 4QWOA 5GLDA 5FI7A 4DN0A 4L9EA 1XA7A 3KSFA 5HDSA 4DXBA 3FPWA 3UB8A 4RVAA 2XA7M 3MKEA 3C7VA 3LUQA 4HI4A 1PRQA 3SOIA 2ZC5B 3G30A 4KZAA 4U3TA 1K57A 4MBFA 4WEKA 4MN6A 2A24A 4S2JA 2XR0A 4Q8IA 5DFYA 5J4EA 2FH5A 3EQUA 3WRTA 2PD8A 3EWKA 5HARA 1YLJA 1A0KA 1NLZA 2Y2JA 5HPIA 3PTEA 3RXWA 1K0KA 3B42A 4ZRRA 4OOMA 2CC1A 1L2SA 3T4SA 3G32A 3NHQA 1G6AA 4B4XA 3F1OA 1MKMA 5DKLA 4KZ9A 5EV0A 5F69A 3HLBA 5E2GA 4P87A 1K38A 3OC2A 4WZ4A 4O0PA 3ZG0A 1S6RA 4CQHA 1OTDA 4GW9A 4Y3IA 5HWVA
chains in the Genus database with same CATH topology
1T18A 1TF1A 3F1PA 2JKRI 1S67L 3IBJA 3RTYA 1N9NA 4RQ9A 5IT5A 2HJ9C 1IOUA 4NEED 5F68A 1S1ZA 4L9GA 2ZOIA 2JHEA 3BY8A 3H82A 3OCLA 3TJZC 3F1NB 2JKTI 2GNXA 1DP6A 3KO6A 3VOLA 1P9RA 3KYZA 4ETXA 1UWNX 2HGVA 3BJNA 1F5MA 4XT2B 4AFIA 4HH3A 3G6OA 4CLCB 3GDIA 4MN7A 3R4KA 3HJKA 3PBSA 3CAXA 1LSXA 3GECA 4L0LA 2OAP1 4EW7A 1TS6A 3K3DA 2QYBA 3RH8B 3S7PA 3LIFA 2KX6A 4G3KA 4O8GA 2WKPA 4UQIS 2KDKA 5J3WA 3UMDA 4H6JB 5HWWA 3T4TA 4BWIA 1TD5A 3EGXC 4Z1WA 3MJQA 3B47A 5HD5A 3LI8A 3ICYA 1N9LA 2W1RA 3CUEC 2PR5A 1OPXA 2VKSA 2M1CA 2PT7A 4HY8A 2WKQA 3BWLA 4GJ4A 4P6ZM 2O0YA 2JN7A 3UMEA 2W3GA 1ODVA 4WUJA 5FL3A 2GJ3A 3ZQ5A 4R38A 4H6JA 1ZTUA 2EWWA 2Y8HA 3T4LA 3LR3A 2GX5A 5C5KA 2O9BA 4GHIB 4NXEA 3FC7A 3HCYA 2FZ0A 2J3TC 4NXFA 3T4KA 2HF6A 3H7WA 5AVFA 2VJWA 3LR0A 5DF9A 4HJ3A 2XRNA 1OTBA 3T4QA 4ARZA 2XSSA 2G7UA 2B18A 5KIZA 3E4OA 4BJPA 2OAQ1 3MF0A 3KYQA 3S7NA 4K08A 1XJ4A 3E98A 1MC0A 1LT0A 1S1YA 4GLQA 3PBNA 3CLOA 2PD7A 3RFBA 3MQ0A 5HSQA 4LPZA 2GZAA 2BASA 4ARZB 1YAXA 4KUOA 4BBVA 5HDDA 4HOIA 3MMHA 1OJ5A 4O01A 2O9CA 2QKPA 4YOFA 1KOUA 1H3QA 4R6LA 1DRMA 4Y2FA 3H9WA 4KQDA 2V1BA 4XT2A 3FG8A 4JGPA 1S66L 1Y28A 2VEAA 1GSWA 1S4RA 2EA9A 1MZUA 3V67A 4IUKA 3JVUA 2QJ5A 3MQQA 3TRCA 1LSVA 2W3HA 2L4RA 2VLGA 3C8CA 3K3CA 2D02A 2V9AA 3EEAA 4MDZA 2NUTC 3LIEA 2L1MA 2M7VA 3MR0A 4CLCA 4BBTA 3SW1A 4R3AA 4LRXC 3PR6A 4WF0A 5HZHA 2LB9A 1G6OA 3IS2B 3LR5A 3UB7A 3P01A 3LFVA 2VZWA 4F3LB 4Q0JA 2VX8A 1LL8A 1S4SA 3LIBA 3BQ8A 2O9AA 4Q0IA 2YKHA 2ZBBA 5DJUA 5TJJA 2MJ6A 3NJAA 2WKRA 5DFXA 3EGDC 3OOVA 2V0UA 1IFQA 4E04A 2JKTM 2XA7S 4KUKA 2D01A 4QPRA 1YSQA 5IS1A 3PYPA 2PYRA 4BMWA 2ZMVA 2W27A 1T1AA 4JGOA 4UEYA 4I3JA 2ZMFA 1P0ZA 4I3IA 3T4OA 5A8BA 2VV6A 4FOFA 4HJ6A 4WELA 3VE3A 4OOLA 3FPVA 4EESA 2P08A 3S7QA 2O99A 4UQIM 1D7EA 1D06A 3EOIA 4EEPA 3F1PB 3OBFA 4HHDA 3K2NA 3OCNA 1T19A 2PDRA 4JGQA 5DKKA 5F6AA 1YKDA 4EU0A 3NOTC 2V1AA 1XFNA 5HPFA 4EXOA 3DBAA 4I3AA 4Q0HA 2B02A 1P97A 4MCWA 2QWSA 4MMNA 5HWTA 3JVVA 3R7WA 2A24B 4WEJA 3W2ZA 3UB9A 1OT9A 2PR6A 3E0YA 3O5YA 4CLCC 1NRJA 3BY9A 5LBRA 4YNRA 3A0SA 2W1TA 3OLOA 3E4PA 2VV7A 3S7OA 3T4JA 1UWPX 2INWA 1OJGA 4HNBA 3C30A 2R78A 3D72A 3VV4A 2CMNA 3LIDA 3R7WB 2NUPC 3TE8A 5TBMA 1UGUA 1XJ2A 4EETB 5IU1A 3F1OB 3HJIA 2K31A 3CWFA 1P9WA 5EFWA 4R70A 1GSVA 2A2LA 4HQAA 4KQOA 5AJGA 2W0NA 5AVEA 4M4XA 4G3VA 4L9FA 1OTEA 2VV8A 3PBRA 4CLCE 2OOLA 1XJ3A 3UE6A 3TW8A 2OWJA 4I5SA 2VA0A 4DJ3A 4GS9A 4LRYC 1OTAA 2VGLS 2J3WA 2HV1A 4GHIA 4HH2A 1TS0A 3C2WA 3IS2A 4B9OA 1X0OA 3E4QA 3KSGA 3PBOA 2QHKA 5CX7A 5F5YA 5KSHA 3LI9A 1JNUA 4F3LA 3LIAA 2PHYA 4IJGA 3EQVA 3H7WB 3UE3A 1F9IA 4II7A 2LB5A 4JGRA 2DMWA 1OT6A 2L0WA 3D3OA 2P7JA 4GS9B 5G4YA 2M7UA 1ZHHB 4DMZA 1V9YA 3H82B 4WLAA 4IHQA 3CI6A 4EERA 3CUEA 5L8MA 1STZA 3P7NA 3BQAA 1VHMA 1T1BA 2HJEA 1F98A 4ME4A 3NOUC 2H28A 2K2NA 2XROA 1EW0A 2J3TD 5HD3A 3B33A 2IA2A 4PAUA 2KOIA 2KLIA 3CITA 3UB6A 4I38A 3PBTA 5HL6A 1LSWA 4GCZA 2JKRM 4HIAA 4DN0A 2P04A 2Y79A 4HP4A 5HDCA 4NXGA 3F1NA 1DP9A 1GSXA 4L9EA 4CLCD 4LRZE 4NKPA 3C38A 1T1CA 2I9VA 2W3DA 3KSFA 2Z6CA 5HDSA 2V0WA 3FPWA 3PXPA 3UB8A 1VB6A 2XA7M 3MXQA 4YWZA 3LUQA 1DP8A 1V9ZA 3IBRA 4HI4A 4LLOB 3ULFA 4DJ2A 2Z6DA 4WEKA 4WL9A 4MN6A 4WN5A 1TS8A 5TBMB 3U2AA 2A24A 5DJTA 3LR4A 4HP9A 2OWHA 4P6ZS 5DFYA 3PHYA 5J4EA 3A0VA 2FH5A 3EQUA 4G3WA 4PKYG 2PD8A 4EQ1A 3EWKA 4PKYA 1NLZA 2W1TB 3EEHA 3BW6A 3KSHA 2QJ7A 5HPIA 1W63M 4I39A 3LICA 2W3EA 1N9OA 1NLYA 3KX0X 4EUVA 3B42A 4BBUA 3VE4A 4ZRRA 1BYWA 4OOMA 5G4ZA 2W3FA 1G28A 4HJ4A 3T4SA 4EEUA 1TS7A 4IUHA 3NHQA 4MN5A 1YSPA 3F1OA 4NXBA 4B93A 1MKMA 3NOPC 5DKLA 3PBQA 4Y5FA 2PYPA 1WA9A 5F69A 5MC7A 1XJ6A 3LYXA 2K7SA 4PHTA 3KSIA 3ZYTA 5I5LA 3OC2A 1XFQA 3MFXA 1H8MA 4ETZA 2ZOHA 3A0RA 4O0PA 4FSFA 1W63Q 2J80A 2VGLM 2EWVA 2YKFA 3T50A 4CQHA 5J7EA 1OTDA 1OTIA 5K5BA 1NWZA 4GW9A 4Y3IA 3MQOA 5HWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T18 A;  1T1B A;  1XJ4 A;  1F98 A;  3NOU C;  1LT0 A;  1S1Y A;  1D7E A;  2H28 A;  3F1P A;  3CLO A;  1S67 L;  2PD7 A;  1D06 A;  3RTY A;  1N9N A;  1EW0 A;  4RQ9 A;  5HD3 A;  3B33 A;  5HSQ A;  4EEP A;  3F1P B;  4HHD A;  1T19 A;  2PDR A;  4JGQ A;  4LPZ A;  5DKK A;  5F6A A;  2BAS A;  5F68 A;  4I38 A;  1S1Z A;  2V1A A;  3NOT C;  3UB6 A;  1XFN A;  4EXO A;  1LSW A;  4GCZ A;  4L9G A;  4KUO A;  4I3A A;  2ZOI A;  2JHE A;  3BY8 A;  3H82 A;  2B02 A;  4BBV A;  1P97 A;  3F1N B;  4HIA A;  2QWS A;  4HOI A;  4HP4 A;  5HDD A;  5HDC A;  1OJ5 A;  5HWT A;  2QKP A;  1KOU A;  4NXG A;  3F1N A;  1DP9 A;  1GSX A;  4L9E A;  4R6L A;  1DRM A;  1DP6 A;  3H9W A;  4LRZ E;  2A24 B;  3VOL A;  4KQD A;  2V1B A;  4XT2 A;  2I9V A;  1T1C A;  3FG8 A;  4JGP A;  2Z6C A;  1UWN X;  1S66 L;  3UB9 A;  5HDS A;  1Y28 A;  2VEA A;  1GSW A;  4XT2 B;  1OT9 A;  1S4R A;  4HH3 A;  2V0W A;  3G6O A;  2PR6 A;  2EA9 A;  3GDI A;  4EES A;  1MZU A;  3BY9 A;  3A0S A;  3UB8 A;  3HJK A;  1VB6 A;  3MXQ A;  3P7N A;  3OLO A;  2QJ5 A;  3MQQ A;  4YWZ A;  1DP8 A;  3CAX A;  1LSX A;  1LSV A;  1V9Z A;  2VV7 A;  3E4P A;  3IBR A;  3GEC A;  3LUQ A;  1UWP X;  2INW A;  4HI4 A;  4LLO B;  3ULF A;  4DJ2 A;  2L4R A;  1OJG A;  4EW7 A;  2Z6D A;  1TS6 A;  4HNB A;  2R78 A;  3D72 A;  2VLG A;  3C8C A;  3K3D A;  3K3C A;  4WL9 A;  4MN6 A;  2CMN A;  2D02 A;  4WN5 A;  3LID A;  1TS8 A;  2V9A A;  5TBM B;  3RH8 B;  3LIF A;  2KX6 A;  2A24 A;  5DJT A;  3LIE A;  5TBM A;  2WKP A;  4HP9 A;  1UGU A;  2OWH A;  2KDK A;  1XJ2 A;  2L1M A;  3PHY A;  5J3W A;  3UMD A;  5J4E A;  3A0V A;  3MR0 A;  4H6J B;  4PKY G;  4BBT A;  4EET B;  2PD8 A;  5IU1 A;  4R3A A;  4EQ1 A;  5HWW A;  3EWK A;  3F1O B;  4LRX C;  3HJI A;  4PKY A;  4WF0 A;  5HZH A;  3CWF A;  5EFW A;  4R70 A;  1GSV A;  3EEH A;  3IS2 B;  3MJQ A;  4HQA A;  2QJ7 A;  5HD5 A;  2W0N A;  3UB7 A;  3LI8 A;  5AVE A;  3ICY A;  1N9L A;  4M4X A;  2PR5 A;  4L9F A;  1OTE A;  2VV8 A;  3LIC A;  2M1C A;  2OOL A;  1N9O A;  4I39 A;  4F3L B;  3KX0 X;  4HY8 A;  1XJ3 A;  2WKQ A;  3BWL A;  4BBU A;  1LL8 A;  3VE4 A;  1BYW A;  3UE6 A;  1S4S A;  2JN7 A;  3LIB A;  5G4Z A;  3UME A;  2OWJ A;  1G28 A;  4I5S A;  4HJ4 A;  4EEU A;  1ODV A;  4WUJ A;  4DJ3 A;  1TS7 A;  2GJ3 A;  4GS9 A;  3ZQ5 A;  4R38 A;  3NHQ A;  4H6J A;  4LRY C;  4MN5 A;  1OTA A;  2YKH A;  2ZBB A;  3F1O A;  2HV1 A;  4NXB A;  5DJU A;  3NOP C;  4GHI A;  4HH2 A;  5DKL A;  1TS0 A;  3C2W A;  2WKR A;  3IS2 A;  2PYP A;  3NJA A;  1WA9 A;  5F69 A;  2V0U A;  4B9O A;  1X0O A;  3E4Q A;  4GHI B;  1XJ6 A;  4NXE A;  4E04 A;  3FC7 A;  3LYX A;  2QHK A;  2D01 A;  2K7S A;  4KUK A;  4NXF A;  3LI9 A;  5F5Y A;  1JNU A;  5IS1 A;  3PYP A;  2PYR A;  5I5L A;  4F3L A;  1XFQ A;  3H7W A;  5AVF A;  3LIA A;  2PHY A;  2W27 A;  1T1A A;  3MFX A;  4JGO A;  4I3J A;  3H7W B;  1F9I A;  2ZOH A;  3A0R A;  4HJ3 A;  1OTB A;  1P0Z A;  4I3I A;  4JGR A;  1OT6 A;  2L0W A;  2J80 A;  5A8B A;  2P7J A;  2VV6 A;  4GS9 B;  5G4Y A;  1V9Y A;  3H82 B;  2YKF A;  3E4O A;  4WLA A;  3T50 A;  5J7E A;  4HJ6 A;  5KIZ A;  3SW1 A;  1OTD A;  3VE3 A;  1OTI A;  4EER A;  1NWZ A;  4GW9 A;  4K08 A;  3MQO A;  5HWV A; 
#chains in the Genus database with same CATH topology
 2G2W A;  3WS0 A;  3F1P A;  3G2Z A;  1N9N A;  1NRF A;  3DAV A;  2HP5 A;  2BG1 A;  1C3B A;  4BL3 A;  4UA6 A;  1S1Z A;  1XP4 A;  4L9G A;  3H82 A;  2GNX A;  4QY6 A;  3KO6 A;  4MBK A;  1Z6F A;  2AVX A;  4QHC A;  1UWN X;  2HGV A;  3BJN A;  3CJM A;  4XT2 B;  3CZD A;  4HH3 A;  4AFI A;  2EFX A;  3C5A A;  3DWZ A;  3QP8 A;  3CAX A;  1BLP A;  1IEM A;  4L0L A;  2OAP 1;  1TS6 A;  1MBL A;  3K3D A;  1K57 C;  3MBZ A;  4P85 A;  1EI5 A;  5J3W A;  5JYP A;  2HPB A;  3FZC A;  5HWW A;  4C6Y A;  3MJQ A;  3G34 A;  3SZT A;  5HD5 A;  1FCM A;  1OPX A;  2VKS A;  3MZE A;  4HY8 A;  4EUZ A;  2WKQ A;  4GJ4 A;  1MXO A;  4P6Z M;  3UME A;  2HP6 A;  2W3G A;  1ODV A;  1VEU B;  1BTL A;  1BUE A;  4H6J A;  3M6H A;  4R38 A;  2E8I A;  1ZG6 A;  5CER A;  2HDR A;  3GTC A;  2O9B A;  2Y2G A;  4EQI A;  5CRF A;  4S2M A;  2JCH A;  3H7W A;  4QD4 A;  3A3E A;  5HFO A;  5FI2 A;  4ARZ A;  4S2P A;  2B18 A;  5HAI A;  4ZJ3 A;  3MF0 A;  4K08 A;  1XJ4 A;  3IT9 A;  4GLQ A;  3PBN A;  2WKE A;  3CLO A;  2QPN A;  1I5Q A;  5HSQ A;  2Y4A A;  2ZQ8 A;  4LPZ A;  4E3J A;  1CI8 A;  2QZ6 A;  4KUO A;  3VOZ A;  1OJ5 A;  4O01 A;  5FQQ A;  1JTG A;  4R6L A;  3H9W A;  4KQD A;  4XT2 A;  3FG8 A;  3IX3 A;  4X68 A;  1Y28 A;  1W79 A;  3L9K A;  5M1A A;  1QME A;  3V67 A;  2J9O A;  3JVU A;  2QJ5 A;  3TRC A;  1LSV A;  2L4R A;  4LV1 A;  5FAQ A;  3TG9 A;  2H10 A;  2HDQ A;  4Y0T A;  1FIK A;  2NUT C;  3BFF A;  1L0E A;  1PFL A;  3ZG5 A;  3MR0 A;  4OOY A;  4BBT A;  4R3A A;  4MNR A;  4WF0 A;  3MSH A;  3UNW A;  2PBD P;  3LFV A;  1IKG A;  1HD8 A;  4Y0O A;  5CEB A;  4Q0J A;  2VX8 A;  5DF8 A;  3M6B A;  2WGW B;  1Q2Q A;  4Q0I A;  4LEN A;  3IX4 A;  2WKR A;  4KZ3 A;  4QPR A;  4FD8 A;  5CGW A;  3G35 A;  3PYP A;  4BMW A;  3ZNY A;  2ZMV A;  4OLD A;  4I3J A;  5EE8 A;  5FQK A;  2P9V A;  1P0Z A;  1MPL A;  1Z09 A;  3VOY A;  2WAF A;  2P08 A;  1ERQ A;  1D06 A;  1LHY A;  4JXV A;  4EEP A;  3F1P B;  1PW8 A;  3OCN A;  4JGQ A;  4S2K A;  1HVB A;  3VSK A;  4I3A A;  4O7D A;  2QWS A;  4WYY A;  1W8Q A;  1E4D A;  3WS4 A;  4DE3 A;  5CTN A;  3C4O A;  3UB9 A;  2JKF A;  3LY3 A;  3E0Y A;  2H5S A;  5FQI A;  3T4J A;  2EXB A;  3SH7 A;  3C30 A;  2Y91 A;  1DJA A;  3T12 B;  5FQJ A;  2NUP C;  4DDS A;  3NCK A;  5CED A;  4X1M A;  3CWF A;  1P9W A;  1NZO A;  1GSV A;  3VP3 A;  4HQA A;  1YLT A;  1NYY A;  2W0N A;  5CGX A;  3T1Q B;  4EV4 A;  4WZ5 C;  1U60 A;  2XH9 A;  4CLC E;  2WAE A;  2JE5 A;  2VA0 A;  3QHY A;  1FCO A;  3IX8 A;  1VET B;  3W8K A;  2HV1 A;  4HH2 A;  1XGI A;  4B9O A;  1SDE A;  4ZTK A;  1SZV A;  1PWG A;  5EEC A;  4KZ7 A;  5F5Y A;  5CX7 A;  5GHX A;  5KSH A;  3M2J A;  3LIA A;  2XQZ A;  1ERM A;  3H7W B;  3T1X A;  3CPT B;  5EVI D;  3ITB A;  3MKF A;  5FAO A;  2LB5 A;  2PBY A;  3BLS A;  1PIO A;  1OT6 A;  3D3O A;  4E3N A;  1W5D A;  2P7J A;  4WLA A;  4H8R A;  3QP6 A;  3CI6 A;  5EVI C;  1STZ A;  3BQA A;  1T1B A;  4CJN A;  3N8L A;  2R9X A;  4JXG A;  1K55 C;  2XRO A;  1K6S A;  2J3T D;  3B33 A;  2KOI A;  2V2F F;  2ZQD A;  4HES A;  4MEZ A;  4GCZ A;  5E2E A;  2P04 A;  4HP4 A;  4NXG A;  1GSX A;  1PW1 A;  3I7J A;  3SS4 A;  4KZ4 A;  3C38 A;  2W3D A;  4DKI A;  3NIA A;  1BLS A;  1M6K A;  4U0X A;  3PXP A;  3MXQ A;  4D2O A;  4YWZ A;  4HBU A;  1V9Z A;  1ONH A;  2VK3 A;  3ULF A;  4WL9 A;  3CG5 A;  4WN5 A;  3U2A A;  3VMA A;  3BRM A;  5DJT A;  2J7V A;  2OWH A;  4P6Z S;  3T1R A;  4GD8 A;  3BEB A;  2EX2 A;  2Y2N A;  2W1T B;  3KSH A;  2QJ7 A;  2ZC7 A;  3LY4 A;  3VFF A;  1NLY A;  1BLC A;  4ZAM A;  5G4Z A;  2RCX A;  1CEF A;  4HJ4 A;  1SHV A;  4MN5 A;  1YSP A;  1K4E A;  4EWF A;  4NXB A;  4P0M A;  1WA9 A;  1YT4 A;  1KDW A;  4C75 A;  1GHI A;  1XJ6 A;  2K7S A;  4PHT A;  3ZYT A;  3D4F A;  3CPT A;  4PM8 A;  2V8C A;  4DDY A;  1GHM A;  4ETZ A;  2ZOH A;  3A0R A;  2UV0 E;  2B95 A;  3AGF A;  1K25 A;  2VGL M;  2YKF A;  3T50 A;  3OZH A;  2ZM0 A;  4QJG A;  4E3L A;  3OPR A;  1T18 A;  1TF1 A;  5IHV A;  3GRJ A;  4PMA A;  2Q9M A;  4GB7 A;  1KE3 A;  4E3O A;  3UB5 P;  4UAA A;  1IOU A;  3HLD A;  2ZQ7 A;  2ZOI A;  3BY8 A;  2JKT I;  5GLA A;  1OME A;  5FAP A;  1YLY A;  2IWB A;  4MLL A;  3VOL A;  1ZG4 A;  5GHZ A;  2EX8 A;  1F5M A;  1PWC A;  4MBH A;  1AXB A;  1MWU A;  1ZC2 A;  3GEC A;  3T1S A;  2V8F A;  5M19 A;  4PM9 A;  4S2N C;  3IQA A;  3U4L P;  3S7P A;  3LIF A;  4R3B A;  2WKP A;  4PPR A;  3QP5 A;  4KG6 A;  4N92 A;  5GLC A;  2KDK A;  3UMD A;  5I94 A;  3T4T A;  1ES4 A;  4BWI A;  4Z1W A;  1ES5 A;  2EXA A;  4OQ0 A;  4KZ8 A;  4LCL A;  2W1R A;  2ZD8 A;  5HL1 A;  3O87 A;  5AQ9 A;  1BLH A;  2O0Y A;  4LCM A;  4WUJ A;  2E8J A;  2EWW A;  2GX5 A;  1VET A;  3IHB A;  2GDN A;  2Y2I A;  3WRZ A;  4X56 A;  4NXE A;  5CGS A;  1FIL A;  2FZ0 A;  3T4K A;  1L0F A;  2HF6 A;  4OQG A;  1XPB A;  5HW3 A;  2XRN A;  3T4Q A;  2G7U A;  4K91 A;  1CI9 A;  3E4O A;  5E2H A;  4EBN A;  3KYQ A;  4WZ5 A;  4IVK A;  3Q81 A;  1MC0 A;  1LT0 A;  3MQ0 A;  5GLB A;  1TEM A;  1H8Z A;  1VM1 A;  4UA9 A;  4A5R A;  5FAS A;  3QP1 A;  4R4S A;  2Q9N A;  1YAX A;  3L7H A;  1FQG A;  4RYE A;  4HOI A;  2EX9 A;  2QKP A;  1KOU A;  1MY8 A;  1DRM A;  4KG5 A;  4OLG A;  4KEN B;  2V1B A;  4JGP A;  1JWV A;  4B88 A;  3N8S A;  5A92 A;  5FA7 A;  3FKW A;  1MZU A;  3MQQ A;  1G68 A;  1SDN A;  3HLF A;  5EVE A;  3ZVT A;  5AQB A;  2JKG A;  4S2I A;  3K3C A;  4S2N A;  3N6I A;  3ZDJ A;  2V9A A;  4KZ5 A;  4MDZ A;  5F83 A;  4BL2 A;  3D9Y A;  1CJF A;  4X25 A;  4N1H A;  4RX2 A;  3WS2 A;  1HZO A;  1G6O A;  1PI4 A;  5CHM A;  3LR5 A;  3P01 A;  3ZHH A;  3NEC A;  2XLN A;  2A49 A;  3LIB A;  3BQ8 A;  5L09 A;  5EM0 A;  1KVM A;  2O9A A;  5CTM A;  3UY6 A;  2ZBB A;  3UE0 A;  3NDE A;  3EGD C;  3OOV A;  1SCW A;  2JKT M;  2D01 A;  5IS1 A;  2PYR A;  4UEY A;  2JC7 A;  2Y2O A;  5EPH A;  4I3I A;  1VEU A;  2BTF P;  3T4O A;  1PZP A;  2DCF A;  4HBT A;  1JVJ A;  3B3X A;  4HJ6 A;  4WEL A;  2C6W B;  4OPZ A;  1WYB A;  4OOL A;  1DJB A;  5KZH A;  2EFU A;  3S7Q A;  4UQI M;  4LFU A;  2ZL1 B;  4FH2 A;  3S22 A;  5DF7 A;  5FAT A;  3OBF A;  1WE4 A;  3K2N A;  1T19 A;  3O88 A;  5DKK A;  1YKD A;  4JXW A;  3JPU A;  3NOT C;  1XFN A;  3DBA A;  4MCW A;  4RA7 A;  5A93 A;  1OT9 A;  4CLC C;  1NRJ A;  5LBR A;  5CEC A;  1BT5 A;  4KG2 A;  2INW A;  4EBP A;  4R23 A;  5EVL A;  2R78 A;  1ZKJ A;  3R7W B;  3TE8 A;  3HVF A;  4ZDX A;  5TBM A;  1FOF A;  3UDI A;  3NI9 A;  5L07 A;  5IU1 A;  4R70 A;  5DVA A;  3BM6 A;  4NG2 A;  5AVE A;  4X53 A;  4G3V A;  4S2O A;  1OTE A;  3A3J A;  2X02 A;  3MXR A;  4CPK A;  3UN7 A;  1I2S A;  4N9L A;  4I5S A;  1PI5 A;  4GS9 A;  1OTA A;  2VGL S;  4IBR A;  4GHI A;  1FSW A;  3E4Q A;  3VP4 A;  3PBO A;  2QHK A;  3IXH A;  2G2U A;  3IF6 A;  1NY0 A;  4NET A;  4II7 A;  2V1Z A;  5FQ9 A;  1J9M A;  2H0Y A;  4DMZ A;  4IHQ A;  1YQS A;  1Y4O A;  2Y59 A;  1VHM A;  1IYO A;  1F98 A;  2HJE A;  3E2L A;  3NOU C;  2K2N A;  1XKZ A;  2IA2 A;  2KLI A;  4UA7 A;  4E6X A;  4R1G A;  1LSW A;  2XK1 A;  2JKR M;  5HX9 A;  4DF6 A;  1S0W A;  3F1N A;  1DP9 A;  4CLC D;  4LRZ E;  3FWL A;  2I9V A;  2Z6C A;  4X6T A;  1N4O A;  4DRT A;  3Q1F A;  4GNU A;  4KZB A;  1DP8 A;  2XGN A;  3IBR A;  4LLO B;  1XA1 A;  3LEZ A;  4E3I A;  2Z6D A;  3FYZ A;  2HP9 A;  5EVI B;  5TBM B;  5F1F A;  3GQZ A;  5U47 A;  3PHY A;  4EQ1 A;  2PAV P;  3A3I A;  4FTX A;  3BW6 A;  1GA9 A;  3QP2 A;  3V5M A;  1W63 M;  3DTI A;  1CQA A;  3ITA A;  3KX0 X;  4RX3 A;  4OPQ A;  4EUV A;  1XX2 A;  2ZM8 A;  1G28 A;  1YMX A;  4EEU A;  4IUH A;  2HDU A;  5A91 A;  4B93 A;  3NOP C;  3Q7Z A;  1LL5 A;  1K55 A;  2ZJ9 A;  4Y5F A;  2BLS A;  3PBQ A;  2PYP A;  3HL9 A;  3DW0 A;  2Q0O A;  3KSI A;  3OPL A;  1H8M A;  3W4P A;  4FSF A;  1W63 Q;  3M2K A;  1KGG A;  1ES2 A;  2HDS A;  5KMW A;  2EWV A;  4WBG A;  1NWZ A;  2ZC4 B;  1JWZ A;  3IBJ A;  3RTY A;  3RXX A;  4RQ9 A;  2ZL1 A;  5IT5 A;  4IED A;  4NEE D;  3OCL A;  2JHE A;  3TJZ C;  3F1N B;  5FSR A;  3HLE A;  4JF5 A;  3BFD A;  1AWI A;  3BFG A;  1DP6 A;  1ERO A;  3V3R A;  3IWO A;  2ZMA A;  3G6O A;  4KQQ A;  2C5W B;  4CLC B;  3GDI A;  4MN7 A;  3CHW P;  3HJK A;  3PBS A;  4NK3 A;  1LSX A;  5L10 A;  2X71 A;  4OON A;  2QYB A;  3RH8 B;  2ZQA A;  3QNC A;  5G18 A;  5GHY A;  4Y7P A;  5DTK A;  3DTE A;  4H6J B;  4GZB A;  3RJU A;  3BFE A;  3EGX C;  2WZZ A;  4ID4 A;  3LI8 A;  3ICY A;  1N9L A;  2M1C A;  1K54 C;  5CHU A;  1L3L A;  4Y17 A;  3FV7 A;  2WK0 A;  4FH4 A;  3VP0 A;  4DE1 A;  5FL3 A;  3VP1 A;  2GJ3 A;  3ZQ5 A;  1ZTU A;  2Y8H A;  3LR3 A;  2ZC3 B;  4GHI B;  5JYO A;  3FC7 A;  3HCY A;  4IBX A;  4D60 A;  5AVF A;  3MXS A;  3IF6 B;  3HLG A;  5DF9 A;  4HJ3 A;  4R0Q A;  4F94 A;  2XSS A;  2IWC A;  4JPM A;  3UPO A;  2Y2H A;  4DE0 A;  3TOI A;  1S1Y A;  5D3O A;  5AQ7 A;  2PD7 A;  3SH9 A;  3RFB A;  3ZGA B;  4S2L A;  4C3Q A;  1IKI A;  2J8Y A;  4OPY A;  2GZA A;  3HLW A;  2BAS A;  1YMS A;  4ARZ B;  2Z2M B;  3KYE A;  1K4F A;  3MS6 A;  4YOF A;  1H3Q A;  2A3U A;  1NZU A;  1S66 L;  4E6W A;  1GSW A;  1S4R A;  1BSG A;  3IWQ A;  2EA9 A;  3GR2 A;  3QP4 A;  4LV3 A;  4IUK A;  3IF6 C;  2W3H A;  3NY4 A;  4OPR A;  1LLB A;  3C8C A;  1E3U D;  4FCF A;  1LI0 A;  2FFF B;  5EVI A;  3LIE A;  5CHJ A;  5FDH A;  3IXG A;  4LRX C;  3PR6 A;  2LB9 A;  3IS2 B;  1PYY A;  3UB7 A;  4R3J A;  1ES3 A;  4F3L B;  2FFY A;  1S4S A;  3BEC A;  3GVB A;  3WS5 A;  2DRW A;  5KSC A;  3NUL A;  5TJJ A;  1NYM A;  2MJ6 A;  3NJA A;  2V0U A;  1IFQ A;  4JXS A;  4E04 A;  1YSQ A;  4DE2 A;  1T1A A;  2XF3 A;  4JGO A;  2XEP A;  3LO7 A;  3IHA A;  1E3U A;  3Q82 A;  4ZJ2 A;  4Y0U A;  5A8B A;  3DTK A;  4FOF A;  4R4R A;  4OKP A;  3VE3 A;  1TDG A;  2QMI A;  4PM5 A;  3FPV A;  4EES A;  2O99 A;  1D7E A;  5FEF A;  1QMF A;  2OLV A;  4HHD A;  1MWS A;  3OPP A;  1K56 D;  3ZG8 B;  2P9V B;  4EU0 A;  1LI9 A;  2V1A A;  1G5U A;  1TDL A;  1MKI A;  4X69 A;  5HPF A;  1P97 A;  3G4P A;  4MMN A;  5HWT A;  3JVV A;  2A24 B;  5HAQ A;  2PR6 A;  3O5Y A;  1IYS A;  3BY9 A;  1FCN A;  3A0S A;  3OLO A;  3LCE A;  2VV7 A;  2Y2L A;  4OVD A;  3S7O A;  4BD0 A;  1UWP X;  3UDF A;  3MZD A;  4Y13 A;  3ZFZ A;  1OJG A;  4HNB A;  4X55 A;  3VV4 A;  3WS1 A;  5E43 A;  2CMN A;  3GMW A;  1RGY A;  5GL9 A;  3E2K A;  3UDX A;  3V39 A;  1UGU A;  1PNE A;  1BUL A;  1XJ2 A;  4M3K A;  4EET B;  3F1O B;  3HJI A;  2K31 A;  4YIN A;  5EFW A;  4X1L A;  5AJG A;  4YFM A;  4M4X A;  5EM1 A;  2OOL A;  1XJ3 A;  3IH8 A;  4E3K A;  3UE6 A;  2OWJ A;  3MZF A;  5A90 A;  3VP2 A;  3WWX A;  2J3W A;  2HZ5 A;  1TS0 A;  1GA0 A;  1O07 A;  1X0O A;  3KSG A;  2PU4 A;  1O7E A;  4EBL A;  3LI9 A;  3GV9 A;  4WMC D;  4BEN A;  4IJG A;  4QU3 A;  5TR7 A;  5EOE A;  1ESU A;  2JBF A;  2OV5 A;  5DTS A;  2DMW A;  1XGJ A;  2X01 A;  2L0W A;  3GSG A;  5G4Y A;  2M7U A;  1ZHH B;  3H82 B;  5BOH A;  2VGK A;  1TVF A;  2RL3 A;  5L8M A;  2WUQ A;  3P7N A;  1MWT A;  2I72 A;  4GD6 A;  1EW0 A;  4PAU A;  1HLU P;  1FR6 A;  5HL6 A;  1WYC A;  4HIA A;  2Z2L B;  2Y79 A;  1VQQ A;  5HDC A;  1IYQ A;  3BLM A;  3P09 A;  1J3W A;  3LGO A;  4NKP A;  1FR1 A;  1SKO B;  3DWK A;  5TFQ A;  1T1C A;  2V0W A;  3UPN A;  1VB6 A;  4DJ2 A;  2V20 A;  4BQM A;  1DJC A;  1H8Y A;  1TS8 A;  3LR4 A;  4JLF A;  3A3F A;  1ONG A;  4HP9 A;  3N8R A;  3PAE A;  3IXD A;  3A0V A;  1L0G A;  4PKY G;  4G3W A;  4PKY A;  3SH8 A;  3EEH A;  1YLP A;  4I39 A;  3LIC A;  2W3E A;  1N9O A;  3SS5 A;  3UO9 A;  5FQM A;  4OQH A;  4U0T A;  4E3M A;  5E2F A;  3VE4 A;  4BBU A;  1BYW A;  2W3F A;  2UWX A;  1TS7 A;  2ACG A;  3ZNT A;  2OSU A;  5MC7 A;  3HBR A;  1EWZ A;  3C7U A;  3LYX A;  3JYI A;  3O3V A;  5I5L A;  3ZCZ A;  1XFQ A;  3AGD A;  3MFX A;  2XDM A;  2J9P A;  2PRF A;  4WMC A;  2J80 A;  1F2K A;  5J7E A;  4QB8 A;  1OTI A;  4JF4 A;  5K5B A;  3N4I A;  3MQO A;  3SS3 A;  4FUW A;  1RGZ A;  1CF0 A;  2JKR I;  1S67 L;  1KE0 A;  2HJ9 C;  3UE1 A;  3S1Y A;  1FSY A;  5F68 A;  3W4Q A;  2ZC6 B;  2B5R A;  4ZJ1 A;  3S4X A;  1SKO A;  3HUO A;  4JBF A;  2H0T A;  1D1J A;  1P9R A;  3KYZ A;  4ETX A;  3C4P A;  4LV0 A;  4GKU A;  3IF5 A;  2DNS A;  3R4K A;  4N9K A;  3HLC A;  2WYX A;  1RP5 A;  4EW7 A;  4LGW A;  3DTM A;  1BZA A;  4P6B A;  4GOG A;  2KX6 A;  2WGW A;  4G3K A;  1Q2P A;  4O8G A;  4UQI S;  3A3D A;  1CK3 A;  1TD5 A;  3BYD A;  3QNB A;  3B47 A;  1N9B A;  3CUE C;  2PR5 A;  4PM6 A;  2PT7 A;  3BWL A;  2JN7 A;  1IYP A;  1H5X A;  3ZVW A;  5AQA A;  2EX6 A;  1W8Y A;  4DXC A;  1YPR A;  4BD1 A;  3T4L A;  4OH0 A;  3TSG A;  5C5K A;  2J3T C;  4NXF A;  2VJW A;  3LR0 A;  4K0X A;  1OTB A;  1DY6 A;  3OPH A;  5TGF A;  1IEL A;  3IXB A;  4OP5 A;  5KIZ A;  4KQR A;  1I2W A;  4BJP A;  1H0M A;  2OAQ 1;  3S7N A;  3E98 A;  3FKV A;  1NXY A;  5EOO A;  5L2F A;  5FI6 A;  2R9W A;  2ZQ9 A;  4QY5 A;  3CMZ A;  2Y2K A;  1YLZ A;  1PWD A;  4BBV A;  5HDD A;  3MMH A;  2O9C A;  3V50 A;  4Y2F A;  2IWD A;  4PM7 A;  2VEA A;  2XFT A;  1JTD A;  1PZO A;  4XXR A;  2VLG A;  4B4Z A;  2D02 A;  3EEA A;  4BLM A;  2WGV A;  2VGJ A;  2ZM2 A;  4HEF A;  2L1M A;  4K0W A;  5DTT A;  2M7V A;  4CLC A;  3SW1 A;  1KGF A;  5HZH A;  4GN2 A;  1K54 A;  1NJ4 A;  2VZW A;  2XD5 A;  1K56 A;  3Q7V B;  1LL8 A;  2WKI A;  2P74 A;  1Y54 A;  3ZG9 B;  2YKH A;  5DJU A;  5HAP A;  5DFX A;  1KDS A;  2XA7 S;  4KUK A;  1LL9 A;  3O86 A;  3Q07 A;  3V3S A;  4JKT A;  2W27 A;  1ACF A;  2ZMF A;  3ZG7 B;  5EUA A;  1ESI A;  2OLU A;  3N7W A;  2VV6 A;  2WKH A;  5CXW A;  4KZ6 A;  3UPP A;  3EOI A;  4Y15 A;  2XFS A;  2PDR A;  5F6A A;  3NC8 A;  3W4O A;  2WAD A;  4EXO A;  4Q0H A;  1MWR A;  2B02 A;  1RCJ A;  3IH9 A;  3PAG A;  1SKF A;  1GHP A;  3R7W A;  4XUX A;  2ZQC A;  4WEJ A;  5J8X A;  3W2Z A;  2Y2P A;  3HUM A;  2PU2 A;  1L0D A;  4YNR A;  2W1T A;  2Y55 A;  3E4P A;  3D72 A;  3LID A;  5F82 A;  3VFH A;  3AGE A;  4ESP A;  3HUN A;  3IWI A;  1ALQ A;  1E25 A;  5FDS A;  1KGE A;  2A2L A;  4KQO A;  3BFC A;  1CEG A;  3LEQ A;  3Q7V A;  3ISG A;  4L9F A;  4XUZ A;  2VV8 A;  2WGI A;  3PBR A;  5F1G A;  4UHU A;  2Y2Q A;  4GDN A;  3TW8 A;  2WZX A;  4Z9Q A;  1KVL A;  4WM9 A;  4DJ3 A;  1YLW A;  4LRY C;  1KE4 A;  4N1X A;  3VSL A;  1JWP A;  3IS2 A;  3C2W A;  4OP8 A;  2Y2M A;  1W7F A;  1YM1 A;  1JNU A;  4ZBE A;  4F3L A;  1K6R A;  2PHY A;  4GDB A;  3NDG A;  3EQV A;  1M40 A;  3UE3 A;  1F9I A;  4JF6 A;  5FEG A;  4JGR A;  4GS9 B;  1HTZ A;  1V9Y A;  4OQI A;  3MFD A;  4EER A;  3P98 A;  3CUE A;  1XXM A;  4ME4 A;  4IVI A;  1GCE A;  3G2Y A;  5M18 A;  2ZLY A;  2H28 A;  5HD3 A;  4LV2 A;  3NBL A;  3G31 A;  3CIT A;  3HRE A;  3UB6 A;  4I38 A;  3PBT A;  2XD1 A;  4QWO A;  5GLD A;  5FI7 A;  4DN0 A;  4L9E A;  1XA7 A;  3KSF A;  5HDS A;  4DXB A;  3FPW A;  3UB8 A;  4RVA A;  2XA7 M;  3MKE A;  3C7V A;  3LUQ A;  4HI4 A;  1PRQ A;  3SOI A;  2ZC5 B;  3G30 A;  4KZA A;  4U3T A;  1K57 A;  4MBF A;  4WEK A;  4MN6 A;  2A24 A;  4S2J A;  2XR0 A;  4Q8I A;  5DFY A;  5J4E A;  2FH5 A;  3EQU A;  3WRT A;  2PD8 A;  3EWK A;  5HAR A;  1YLJ A;  1A0K A;  1NLZ A;  2Y2J A;  5HPI A;  3PTE A;  3RXW A;  1K0K A;  3B42 A;  4ZRR A;  4OOM A;  2CC1 A;  1L2S A;  3T4S A;  3G32 A;  3NHQ A;  1G6A A;  4B4X A;  3F1O A;  1MKM A;  5DKL A;  4KZ9 A;  5EV0 A;  5F69 A;  3HLB A;  5E2G A;  4P87 A;  1K38 A;  3OC2 A;  4WZ4 A;  4O0P A;  3ZG0 A;  1S6R A;  4CQH A;  1OTD A;  4GW9 A;  4Y3I A;  5HWV A; 
#chains in the Genus database with same CATH homology
 1T18 A;  1TF1 A;  3F1P A;  2JKR I;  1S67 L;  3IBJ A;  3RTY A;  1N9N A;  4RQ9 A;  5IT5 A;  2HJ9 C;  1IOU A;  4NEE D;  5F68 A;  1S1Z A;  4L9G A;  2ZOI A;  2JHE A;  3BY8 A;  3H82 A;  3OCL A;  3TJZ C;  3F1N B;  2JKT I;  2GNX A;  1DP6 A;  3KO6 A;  3VOL A;  1P9R A;  3KYZ A;  4ETX A;  1UWN X;  2HGV A;  3BJN A;  1F5M A;  4XT2 B;  4AFI A;  4HH3 A;  3G6O A;  4CLC B;  3GDI A;  4MN7 A;  3R4K A;  3HJK A;  3PBS A;  3CAX A;  1LSX A;  3GEC A;  4L0L A;  2OAP 1;  4EW7 A;  1TS6 A;  3K3D A;  2QYB A;  3RH8 B;  3S7P A;  3LIF A;  2KX6 A;  4G3K A;  4O8G A;  2WKP A;  4UQI S;  2KDK A;  5J3W A;  3UMD A;  4H6J B;  5HWW A;  3T4T A;  4BWI A;  1TD5 A;  3EGX C;  4Z1W A;  3MJQ A;  3B47 A;  5HD5 A;  3LI8 A;  3ICY A;  1N9L A;  2W1R A;  3CUE C;  2PR5 A;  1OPX A;  2VKS A;  2M1C A;  2PT7 A;  4HY8 A;  2WKQ A;  3BWL A;  4GJ4 A;  4P6Z M;  2O0Y A;  2JN7 A;  3UME A;  2W3G A;  1ODV A;  4WUJ A;  5FL3 A;  2GJ3 A;  3ZQ5 A;  4R38 A;  4H6J A;  1ZTU A;  2EWW A;  2Y8H A;  3T4L A;  3LR3 A;  2GX5 A;  5C5K A;  2O9B A;  4GHI B;  4NXE A;  3FC7 A;  3HCY A;  2FZ0 A;  2J3T C;  4NXF A;  3T4K A;  2HF6 A;  3H7W A;  5AVF A;  2VJW A;  3LR0 A;  5DF9 A;  4HJ3 A;  2XRN A;  1OTB A;  3T4Q A;  4ARZ A;  2XSS A;  2G7U A;  2B18 A;  5KIZ A;  3E4O A;  4BJP A;  2OAQ 1;  3MF0 A;  3KYQ A;  3S7N A;  4K08 A;  1XJ4 A;  3E98 A;  1MC0 A;  1LT0 A;  1S1Y A;  4GLQ A;  3PBN A;  3CLO A;  2PD7 A;  3RFB A;  3MQ0 A;  5HSQ A;  4LPZ A;  2GZA A;  2BAS A;  4ARZ B;  1YAX A;  4KUO A;  4BBV A;  5HDD A;  4HOI A;  3MMH A;  1OJ5 A;  4O01 A;  2O9C A;  2QKP A;  4YOF A;  1KOU A;  1H3Q A;  4R6L A;  1DRM A;  4Y2F A;  3H9W A;  4KQD A;  2V1B A;  4XT2 A;  3FG8 A;  4JGP A;  1S66 L;  1Y28 A;  2VEA A;  1GSW A;  1S4R A;  2EA9 A;  1MZU A;  3V67 A;  4IUK A;  3JVU A;  2QJ5 A;  3MQQ A;  3TRC A;  1LSV A;  2W3H A;  2L4R A;  2VLG A;  3C8C A;  3K3C A;  2D02 A;  2V9A A;  3EEA A;  4MDZ A;  2NUT C;  3LIE A;  2L1M A;  2M7V A;  3MR0 A;  4CLC A;  4BBT A;  3SW1 A;  4R3A A;  4LRX C;  3PR6 A;  4WF0 A;  5HZH A;  2LB9 A;  1G6O A;  3IS2 B;  3LR5 A;  3UB7 A;  3P01 A;  3LFV A;  2VZW A;  4F3L B;  4Q0J A;  2VX8 A;  1LL8 A;  1S4S A;  3LIB A;  3BQ8 A;  2O9A A;  4Q0I A;  2YKH A;  2ZBB A;  5DJU A;  5TJJ A;  2MJ6 A;  3NJA A;  2WKR A;  5DFX A;  3EGD C;  3OOV A;  2V0U A;  1IFQ A;  4E04 A;  2JKT M;  2XA7 S;  4KUK A;  2D01 A;  4QPR A;  1YSQ A;  5IS1 A;  3PYP A;  2PYR A;  4BMW A;  2ZMV A;  2W27 A;  1T1A A;  4JGO A;  4UEY A;  4I3J A;  2ZMF A;  1P0Z A;  4I3I A;  3T4O A;  5A8B A;  2VV6 A;  4FOF A;  4HJ6 A;  4WEL A;  3VE3 A;  4OOL A;  3FPV A;  4EES A;  2P08 A;  3S7Q A;  2O99 A;  4UQI M;  1D7E A;  1D06 A;  3EOI A;  4EEP A;  3F1P B;  3OBF A;  4HHD A;  3K2N A;  3OCN A;  1T19 A;  2PDR A;  4JGQ A;  5DKK A;  5F6A A;  1YKD A;  4EU0 A;  3NOT C;  2V1A A;  1XFN A;  5HPF A;  4EXO A;  3DBA A;  4I3A A;  4Q0H A;  2B02 A;  1P97 A;  4MCW A;  2QWS A;  4MMN A;  5HWT A;  3JVV A;  3R7W A;  2A24 B;  4WEJ A;  3W2Z A;  3UB9 A;  1OT9 A;  2PR6 A;  3E0Y A;  3O5Y A;  4CLC C;  1NRJ A;  3BY9 A;  5LBR A;  4YNR A;  3A0S A;  2W1T A;  3OLO A;  3E4P A;  2VV7 A;  3S7O A;  3T4J A;  1UWP X;  2INW A;  1OJG A;  4HNB A;  3C30 A;  2R78 A;  3D72 A;  3VV4 A;  2CMN A;  3LID A;  3R7W B;  2NUP C;  3TE8 A;  5TBM A;  1UGU A;  1XJ2 A;  4EET B;  5IU1 A;  3F1O B;  3HJI A;  2K31 A;  3CWF A;  1P9W A;  5EFW A;  4R70 A;  1GSV A;  2A2L A;  4HQA A;  4KQO A;  5AJG A;  2W0N A;  5AVE A;  4M4X A;  4G3V A;  4L9F A;  1OTE A;  2VV8 A;  3PBR A;  4CLC E;  2OOL A;  1XJ3 A;  3UE6 A;  3TW8 A;  2OWJ A;  4I5S A;  2VA0 A;  4DJ3 A;  4GS9 A;  4LRY C;  1OTA A;  2VGL S;  2J3W A;  2HV1 A;  4GHI A;  4HH2 A;  1TS0 A;  3C2W A;  3IS2 A;  4B9O A;  1X0O A;  3E4Q A;  3KSG A;  3PBO A;  2QHK A;  5CX7 A;  5F5Y A;  5KSH A;  3LI9 A;  1JNU A;  4F3L A;  3LIA A;  2PHY A;  4IJG A;  3EQV A;  3H7W B;  3UE3 A;  1F9I A;  4II7 A;  2LB5 A;  4JGR A;  2DMW A;  1OT6 A;  2L0W A;  3D3O A;  2P7J A;  4GS9 B;  5G4Y A;  2M7U A;  1ZHH B;  4DMZ A;  1V9Y A;  3H82 B;  4WLA A;  4IHQ A;  3CI6 A;  4EER A;  3CUE A;  5L8M A;  1STZ A;  3P7N A;  3BQA A;  1VHM A;  1T1B A;  2HJE A;  1F98 A;  4ME4 A;  3NOU C;  2H28 A;  2K2N A;  2XRO A;  1EW0 A;  2J3T D;  5HD3 A;  3B33 A;  2IA2 A;  4PAU A;  2KOI A;  2KLI A;  3CIT A;  3UB6 A;  4I38 A;  3PBT A;  5HL6 A;  1LSW A;  4GCZ A;  2JKR M;  4HIA A;  4DN0 A;  2P04 A;  2Y79 A;  4HP4 A;  5HDC A;  4NXG A;  3F1N A;  1DP9 A;  1GSX A;  4L9E A;  4CLC D;  4LRZ E;  4NKP A;  3C38 A;  1T1C A;  2I9V A;  2W3D A;  3KSF A;  2Z6C A;  5HDS A;  2V0W A;  3FPW A;  3PXP A;  3UB8 A;  1VB6 A;  2XA7 M;  3MXQ A;  4YWZ A;  3LUQ A;  1DP8 A;  1V9Z A;  3IBR A;  4HI4 A;  4LLO B;  3ULF A;  4DJ2 A;  2Z6D A;  4WEK A;  4WL9 A;  4MN6 A;  4WN5 A;  1TS8 A;  5TBM B;  3U2A A;  2A24 A;  5DJT A;  3LR4 A;  4HP9 A;  2OWH A;  4P6Z S;  5DFY A;  3PHY A;  5J4E A;  3A0V A;  2FH5 A;  3EQU A;  4G3W A;  4PKY G;  2PD8 A;  4EQ1 A;  3EWK A;  4PKY A;  1NLZ A;  2W1T B;  3EEH A;  3BW6 A;  3KSH A;  2QJ7 A;  5HPI A;  1W63 M;  4I39 A;  3LIC A;  2W3E A;  1N9O A;  1NLY A;  3KX0 X;  4EUV A;  3B42 A;  4BBU A;  3VE4 A;  4ZRR A;  1BYW A;  4OOM A;  5G4Z A;  2W3F A;  1G28 A;  4HJ4 A;  3T4S A;  4EEU A;  1TS7 A;  4IUH A;  3NHQ A;  4MN5 A;  1YSP A;  3F1O A;  4NXB A;  4B93 A;  1MKM A;  3NOP C;  5DKL A;  3PBQ A;  4Y5F A;  2PYP A;  1WA9 A;  5F69 A;  5MC7 A;  1XJ6 A;  3LYX A;  2K7S A;  4PHT A;  3KSI A;  3ZYT A;  5I5L A;  3OC2 A;  1XFQ A;  3MFX A;  1H8M A;  4ETZ A;  2ZOH A;  3A0R A;  4O0P A;  4FSF A;  1W63 Q;  2J80 A;  2VGL M;  2EWV A;  2YKF A;  3T50 A;  4CQH A;  5J7E A;  1OTD A;  1OTI A;  5K5B A;  1NWZ A;  4GW9 A;  4Y3I A;  3MQO A;  5HWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...