3BY8A

Crystal structure of the e.coli dcus sensor domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of C4-Dicarboxylate Ligand Complexes with Sensor Domains of Histidine Kinases DcuS and DctB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Sensor protein dcuS
total genus 41
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17203 sCache_3_2 Single cache domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3by8A00
3EEHA 4HP9A 4EETB 1XFQA 5TBMA 2QHKA 2YKFA 2W0NA 1XJ3A 3ICYA 3LIDA 4NXFA 1BYWA 2PDRA 3F1OA 4I39A 4NXGA 5IU1A 2D01A 2BASA 3BWLA 3GECA 1P97A 4I3IA 4WN5A 5AVEA 4YWZA 3UB7A 4E04A 1T18A 1OT9A 3HJKA 3HJIA 1GSXA 3CAXA 4JGRA 1OTDA 1LT0A 4EW7A 3LIFA 1XJ2A 5J4EA 2H28A 3PYPA 4BBVA 4HJ3A 3F1PA 3G6OA 2VV6A 4HH3A 3F1NA 1ODVA 3VE4A 5HWVA 1P0ZA 2KDKA 3T50A 5F69A 1N9NA 3EWKA 4LPZA 4LRXC 2D02A 2PR5A 3K3CA 1X0OA 4HNBA 4MN5A 1LSXA 1G28A 1KOUA 4KUOA 3IS2B 4GS9A 4WF0A 4XT2B 3H82A 1S4SA 3F1OB 1TS8A 3UB9A 3ULFA 3PHYA 2WKPA 2ZOIA 3LYXA 1S66L 5HDCA 3SW1A 5IS1A 3A0SA 4XT2A 3VE3A 3VOLA 2PD7A 5DKKA 2J80A 2VV7A 2CMNA 3NOUC 4R70A 1EW0A 2A24B 2OOLA 2L0WA 4DJ3A 4R3AA 4GW9A 1N9LA 2V0UA 3F1NB 3LI8A 1GSWA 3H7WA 4H6JB 1OJGA 2P7JA 2A24A 3E4PA 2ZOHA 3NJAA 5HZHA 5HDDA 1MZUA 4EQ1A 3D72A 2PR6A 3MR0A 4PKYG 1XFNA 2QKPA 2GJ3A 1D7EA 2R78A 4WUJA 5HDSA 4EESA 2QJ7A 1S67L 4HI4A 4NXBA 5F6AA 5HWWA 3UB8A 3A0RA 3E4QA 2L1MA 1F98A 1DP8A 5TBMB 2PHYA 4JGQA 4K08A 2JHEA 1UWNX 4HP4A 2PYPA 5F68A 2V1BA 1DP6A 3UE6A 3NOPC 4EEPA 4RQ9A 4LRYC 1XJ6A 3MXQA 1Y28A 4L9GA 1N9OA 5I5LA 2VLGA 1NWZA 1T1CA 5J7EA 2KX6A 2OWHA 1S1ZA 4WLAA 1LL8A 3GDIA 4R6LA 1TS0A 3ZQ5A 5KIZA 4HY8A 1DRMA 5J3WA 2PD8A 2Z6DA 2QJ5A 5G4ZA 2VV8A 2V1AA 3E4OA 3H82B 3B33A 3LIEA 3NHQA 3BY8A 5HD5A 1F9IA 3LICA 5AVFA 4HJ4A 4JGOA 1OTAA 4L9EA 1LSWA 1TS6A 2QWSA 4I5SA 3RTYA 1T19A 2V9AA 4HQAA 5F5YA 2JN7A 2PYRA 1OTBA 4KQDA 4H6JA 1DP9A 3MJQA 3CLOA 4F3LB 4HH2A 3UMEA 3NOTC 1GSVA 2M1CA 4HHDA 4KUKA 2YKHA 2HV1A 3KX0X 5DKLA 2L4RA 4GHIB 5HSQA 4F3LA 5A8BA 1LSVA 1UWPX 2ZBBA 3F1PB 3MQOA 4LRZE 5HWTA 5HD3A 3BY9A 4GCZA 4DJ2A 4EERA 2WKRA 3C2WA 4M4XA 2OWJA 1OT6A 3A0VA 3FG8A 4JGPA 5DJUA 1OTEA 4PKYA 3UMDA 1S4RA 3LUQA 1OTIA 4R38A 2VEAA 2W27A 3MQQA 1WA9A 4I3JA 1OJ5A 3CWFA 3UB6A 1XJ4A 3IBRA 5G4YA 1TS7A 2B02A 4EXOA 2WKQA 3IS2A 4GS9B 2I9VA 1T1BA 3LI9A 1UGUA 3P7NA 1VB6A 2V0WA 3C8CA 3MFXA 5EFWA 4BBTA 1T1AA 3FC7A 1V9ZA 3LIBA 4L9FA 4B9OA 3H9WA 5DJTA 2EA9A 4NXEA 3H7WB 3K3DA 3OLOA 1D06A 2INWA 4GHIA 4I38A 1JNUA 3LIAA 4HOIA 1S1YA 4I3AA 3RH8B 2K7SA 4BBUA 1V9YA 4WL9A 4MN6A 4EEUA 4LLOB 4HJ6A 2Z6CA 4HIAA
chains in the Genus database with same CATH superfamily
3OOVA 1W8YA 1VQQA 5EE8A 2D01A 3WS5A 2CC1A 3V3SA 5CHUA 4KENB 4JGRA 5J4EA 1KE3A 4BWIA 2X02A 2HGVA 3F1NA 3EOIA 1P0ZA 4MDZA 3LGOA 5D3OA 3HLWA 1YQSA 2RCXA 1N4OA 2ZOIA 1YLYA 3PAEA 3R7WA 5IS1A 3E2KA 4XT2A 5FA7A 5L2FA 3ZG9B 4FCFA 2JKRM 2WKHA 1H8ZA 1HVBA 1S0WA 2FH5A 4H8RA 1HD8A 3P01A 2C6WB 4P85A 2G2UA 4WYYA 5F82A 3UE3A 3MR0A 1L0FA 2ZQAA 3C4OA 2XLNA 3SS4A 4ARZB 4KZ5A 4CJNA 1NLZA 5AQ9A 4JGQA 2PYPA 3C30A 4K91A 3E2LA 3PBTA 3PR6A 4UQIS 1YMXA 3QP8A 3MZDA 2KX6A 3PBQA 2OAQ1 3M6BA 4U3TA 4Y17A 4WM9A 3AGEA 1STZA 1FQGA 1PIOA 2OAP1 5CGWA 3VOZA 4X55A 1G6OA 1XKZA 4GLQA 3R4KA 4ZBEA 2HV1A 1JVJA 2Y55A 5HSQA 1BLHA 3UDXA 4B4ZA 3KYQA 2WKRA 3R7WB 2HDSA 4GS9B 2XD5A 4ZJ2A 4KQOA 1LL5A 1KVMA 4N9LA 2ZL1B 3HCYA 3H7WB 3OLOA 2HF6A 4I3AA 4OPQA 3NC8A 4IBRA 2XROA 3HLCA 5TGFA 3IXGA 1YLTA 1SZVA 3DTMA 4LRXC 5E2FA 3O3VA 4D60A 4YNRA 1NZOA 4EUVA 1S66L 4EBPA 4CQHA 2VV7A 3NOUC 2QZ6A 1IOUA 2P04A 2I72A 1IEMA 3WRTA 1K54A 1GSWA 2VGLM 1OJGA 2V8CA 1PWCA 3LR4A 2R78A 4KG6A 4EESA 5EOOA 4DF6A 2OSUA 1NLYA 4GDBA 1S6RA 2ZC5B 5EPHA 1LLBA 4PM6A 2VZWA 1N9OA 3OPHA 2OV5A 4FSFA 2JKFA 4E6XA 5CTMA 3B33A 2ACGA 3N8RA 2Y2OA 3UDIA 3RTYA 5EVEA 5F83A 4KQDA 3MZFA 4HEFA 4F3LB 3KSHA 5CRFA 4ZRRA 5CHMA 3MZEA 2WAEA 3MBZA 5DKLA 1YPRA 1ZG6A 2W1TB 2WZXA 1CK3A 1PI5A 4R23A 3T1RA 3V50A 1OPXA 3IS2A 4OQGA 4NETA 4BJPA 3ZG0A 4GHIA 3QP2A 3SS3A 4LLOB 3HLDA 5TBMA 2QHKA 1SDNA 3FKWA 1BLSA 4CLCC 4WELA 3HJKA 3HLGA 4EBLA 2ZLYA 1NRJA 3WRZA 1X0OA 1JWVA 3S7OA 3V39A 3GVBA 1XA7A 1N9BA 4HESA 4R4SA 1BTLA 4GZBA 2OOLA 3H7WA 1BLCA 3E4PA 3HBRA 1MZUA 2QKPA 4KZ6A 3A3FA 2Y2JA 3BFGA 4LRYC 1CQAA 1MXOA 2XEPA 3BM6A 1KDWA 4Z9QA 5HPFA 4JKTA 4R6LA 3ZQ5A 4IVKA 3L9KA 2MJ6A 4Z1WA 3UPNA 3VP1A 5EVIA 2QJ5A 4E3OA 1SCWA 4F94A 1CF0A 2VGLS 3SH8A 5HAPA 2IWBA 4BD1A 1K4FA 3FKVA 2ZL1A 4O0PA 1PWDA 3MQOA 1XXMA 5HD3A 4GOGA 2VK3A 3W4QA 4CLCB 3GMWA 5FDHA 3KSFA 3FWLA 4GD6A 3D4FA 3LIBA 3IBJA 2WGWB 4KZ3A 4Y0OA 4QU3A 1JNUA 5E2HA 1I2WA 3BJNA 1J9MA 3UMEA 1F2KA 2J3TD 4WN5A 2LB9A 1OTDA 3LIFA 4R3JA 4LENA 3G6OA 5IT5A 5CEBA 1P9RA 4IHQA 5FI7A 2J3TC 4NXGA 1QMFA 2ZD8A 3F1OB 3ZHHA 5CGXA 3LYXA 3S7QA 3V67A 4GW9A 2JE5A 2O0YA 1DJCA 4Y5FA 2Z2LB 2GJ3A 2JC7A 4JXSA 1QMEA 3CITA 3DAVA 2WKIA 5DFXA 4G3WA 1K57C 3I7JA 4RQ9A 1XJ6A 5L07A 1Y28A 5I5LA 4LCLA 4WZ4A 4RVAA 4WLAA 3MS6A 3LO7A 2H0TA 1W8QA 3MMHA 3H82B 3MQ0A 4HJ4A 2HP6A 2J8YA 1OMEA 2PYRA 3M2JA 5L8MA 2EXAA 4UA6A 2XK1A 4OPZA 3P09A 4GHIB 4S2PA 5CGSA 1IYOA 2FFFB 3MXSA 4DJ2A 4EERA 3FG8A 1OTIA 4ARZA 4G3VA 3UO9A 1RGYA 5G4YA 3NI9A 4ZJ1A 1FILA 4O01A 5CXWA 1XGJA 5HL6A 4WZ5A 1V9ZA 1NY0A 4MN6A 4PPRA 1XFQA 3TW8A 2W1RA 4OKPA 4P6ZM 5TFQA 2VA0A 2WGVA 5FATA 3VFFA 1DJBA 4IJGA 3LR0A 3E98A 4HNBA 4ETXA 4XXRA 4S2MA 3IF6B 3S4XA 3PHYA 2WKPA 4NEED 3BLSA 3U2AA 4P0MA 4N92A 4R70A 4FTXA 4U0XA 2A3UA 3QNBA 4OH0A 4QB8A 3VP0A 2Y2GA 4KG5A 2A24A 3NULA 3VOYA 3D72A 5I94A 5F6AA 3JPUA 3HVFA 1F98A 4FH4A 1DJAA 3MXQA 3GSGA 4DMZA 4S2IA 2RL3A 5J7EA 2PBYA 1ZTUA 5M1AA 2W3FA 3BY8A 3IX8A 1K25A 3IX3A 2QWSA 4P6BA 3Q7VA 3DW0A 3ZG8B 4KG2A 1OTBA 4HHDA 3KYEA 3MKEA 4LFUA 2L4RA 5CHJA 3HLFA 5TJJA 3T4TA 1ZC2A 3UPPA 1FIKA 5DTKA 4JGPA 3O88A 1ERQA 4R38A 2VGJA 4MBKA 1UGUA 3T1XA 5DTTA 4BBTA 3FC7A 3H9WA 2Y2KA 4E3MA 1S1YA 3ZG7B 3ZNYA 1H8MA 2JBFA 5A90A 3NIAA 4ZAMA 5HDCA 3F1OA 1G5UA 3K2NA 4I3IA 5FI2A 4EW7A 1BT5A 4CLCE 3BFFA 2WUQA 4BL2A 5F69A 1VEUB 3K3CA 4GN2A 4KZAA 3H82A 2Y2QA 1TS8A 1YLZA 3G30A 1YLPA 1G68A 3D3OA 2Y59A 1RGZA 4IUHA 5DKKA 2CMNA 1WE4A 4UA7A 2EXBA 4E3NA 3T12B 2ZM0A 1ZHHB 3B3XA 4ESPA 5GLCA 1E25A 4HI4A 5FEGA 3DBAA 3A0RA 4DKIA 1KGGA 2NUPC 4OQIA 4PAUA 1KE4A 3NOPC 4FOFA 4IUKA 1FR6A 2KOIA 1T1CA 4GKUA 1LL8A 1W63Q 4E3JA 4OQ0A 2H5SA 3DTKA 3TRCA 1XX2A 2XR0A 3HUNA 4M3KA 5DF8A 3BFCA 2W3HA 4KZ7A 4O8GA 2M1CA 3FZCA 4QPRA 5E2GA 1MC0A 1SKFA 4CLCD 1WA9A 1MWTA 4DXBA 2W3DA 2GZAA 4NG2A 2LB5A 1CJFA 2EA9A 2Y2MA 1L0GA 4P6ZS 2HDQA 3LIDA 3C38A 4GD8A 4ZJ3A 1M40A 2AVXA 5AVEA 1PNEA 1LT0A 3TOIA 2DMWA 3VE4A 2J9PA 3EGDC 1LHYA 4MLLA 3T1SA 1FCNA 4OOMA 1EI5A 3S7PA 1KOUA 4WF0A 1IYPA 3UB9A 3SW1A 4LCMA 2EWVA 1G6AA 5FQJA 1FR1A 2V0UA 1H0MA 5CECA 2P7JA 3JYIA 3A3EA 1EROA 2QJ7A 4NXBA 2EFXA 3N8SA 3LEZA 3IF5A 1I5QA 3MFDA 4LGWA 4Q0IA 1DP8A 4X68A 3OBFA 3CPTB 2VGKA 3MXRA 2O9CA 1YM1A 2VJWA 2Y2IA 3GDIA 2DCFA 5DFYA 1LI9A 2KLIA 3LICA 4L9EA 2V2FF 4FH2A 1GHMA 1DP9A 4KZ9A 1M6KA 4PM7A 3GV9A 4KUKA 3UE1A 1YT4A 1ERMA 2X01A 1E4DA 2W3EA 5HWTA 1W63M 3IX4A 4CPKA 2UWXA 4JF6A 3OPLA 1YSQA 2PU2A 2B02A 3P7NA 1J3WA 5HARA 2HDRA 4OLDA 4QY6A 2INWA 2K7SA 4P87A 1LI0A 1GSXA 3C7VA 3OPPA 1E3UD 1VHMA 3E0YA 2H28A 5HFOA 2VV6A 1ONGA 2ZC4B 3T4SA 3AGFA 1CI9A 3VE3A 1TVFA 3VOLA 2J80A 1C3BA 4NK3A 3W8KA 3OCNA 1ES3A 3WS2A 1BUEA 5EM0A 4LV3A 3FPVA 3CZDA 5HWWA 1H5XA 1YSPA 3E4QA 1LL9A 4R3BA 2OLUA 5TBMB 5F68A 4GJ4A 1YLWA 1IFQA 3BLMA 1XP4A 3CPTA 1NYYA 4UA9A 1TDGA 1XA1A 3NHQA 3BECA 3VSKA 4JGOA 3O5YA 4WBGA 1O7EA 3MJQA 3Q1FA 3VP4A 4UAAA 4QWOA 4DXCA 4MN7A 4OP8A 5FAQA 1MKIA 4F3LA 1UWPX 5GLAA 4U0TA 2Y2LA 1OT6A 4KZ4A 1OTEA 1VETA 1IKIA 2EFUA 2VEAA 1CEFA 1PI4A 1Z6FA 1TS7A 2ZQDA 1TF1A 4WEKA 3VV4A 2WKEA 2Y8HA 3VP3A 2Z6CA 5DTSA 1Y54A 5IU1A 1PZOA 4UEYA 2BASA 4BD0A 2P9VB 3CAXA 1RCJA 3EEAA 4BBVA 1K6SA 3SS5A 1JTGA 4X1LA 3MF0A 3VFHA 4LPZA 2D02A 2XD1A 2Q9NA 1XGIA 3OZHA 3A3IA 1L3LA 1XPBA 4L0LA 4BENA 3A3DA 3OPRA 4Y7PA 1I2SA 2ZOHA 1K6RA 1SDEA 1L0EA 2HP5A 4ETZA 4GNUA 3DWKA 5MC7A 2PHYA 3G32A 4IVIA 4XUXA 2V1BA 1YMSA 2VX8A 4EEPA 4L9GA 3ZGAB 2WGIA 4NKPA 3HUOA 2GX5A 2WAFA 3BQ8A 2EX9A 2DNSA 3GR2A 3IF6A 1SKOA 3KSIA 2DRWA 1VETB 4X69A 1U60A 4HH2A 3EQVA 4K0XA 1VM1A 3NBLA 3T4KA 3BW6A 5FL3A 4WZ5C 3GRJA 5A8BA 3UMDA 4PM5A 3MQQA 5BOHA 1XJ4A 4K0WA 2WKQA 1ES5A 1MWSA 5FQMA 2NUTC 5CX7A 2XRNA 3SOIA 1V9YA 5FEFA 2ZMFA 4HJ6A 4LRZE 4HP9A 4LV1A 2P9VA 3PBSA 1XJ3A 4B9OA 2XFTA 4YWZA 3HJIA 3ZFZA 3TE8A 4IEDA 2ZC7A 3F1PA 2PAVP 4HH3A 1MY8A 2XA7M 3PBNA 2ZMAA 1AWIA 2XQZA 3OC2A 3ZYTA 3A0SA 5HL1A 2UV0E 4S2KA 1K38A 1FSWA 3F1NB 3JVVA 4JLFA 2J3WA 4DDSA 1XFNA 4Q0JA 5HDSA 4B88A 2Y4AA 5LBRA 2JHEA 2JKRI 4X1MA 1HZOA 3KYZA 4PMAA 2ZM8A 3DTEA 3G35A 2B18A 3IQAA 3RXXA 5AQBA 1NZUA 4X56A 3UY6A 2M7VA 1TS0A 4E3KA 2ZQ7A 4EBNA 3HLEA 4RX3A 1KDSA 1BSGA 1IELA 5AVFA 3T4OA 4XUZA 3N7WA 5CEDA 4QD4A 1ES2A 3CUEA 3DTIA 1TDLA 3QP1A 2WK0A 2C5WB 1F5MA 4JBFA 2G7UA 3A0VA 1IYSA 2V1ZA 5GLDA 4Y15A 4OOLA 4BQMA 3RXWA 1VB6A 1ZKJA 5EOEA 3K3DA 4JF4A 3LIAA 3W2ZA 1KGFA 4OVDA 3G4PA 3Q82A 5FQ9A 2WYXA 3KSGA 5FSRA 3N8LA 3NDEA 1CEGA 3BWLA 2WZZA 3B42A 1BULA 2W1TA 1GCEA 2J9OA 4KZ8A 4II7A 1LSXA 3JVUA 4KUOA 3BQAA 5HAQA 2K31A 2W3GA 1KE0A 4MCWA 4Q8IA 3QP4A 2BLSA 2HDUA 1EW0A 1NJ4A 4DJ3A 4ZDXA 3C4PA 1AXBA 4WMCA 3O87A 4B4XA 3IT9A 5HZHA 5HDDA 3G2ZA 4EQ1A 5KSHA 1FCOA 1D7EA 1MKMA 2L1MA 4S2NA 1MBLA 1ESIA 3ZVTA 3Q07A 4YOFA 2V20A 4Y2FA 1WYBA 1ES4A 4R1GA 2OWHA 1K56D 2EX6A 2PD8A 4DDYA 4R0QA 2VV8A 2V1AA 1OTAA 1FCMA 4MNRA 2EWWA 1K54C 2Z2MB 2H10A 4OLGA 2K2NA 3NOTC 1GSVA 1GA0A 2Q9MA 2YKHA 2ZQ9A 2ZBBA 4OONA 2ZJ9A 2PT7A 3HUMA 5DJUA 4C75A 3IHBA 4GB7A 5GHZA 4EWFA 3UB6A 1HTZA 5TR7A 5F1FA 1E3UA 5DF7A 3MFXA 5EFWA 3U4LP 4I38A 1IYQA 4EV4A 2Y2HA 3Q7VB 5C5KA 4HIAA 4NXFA 2OLVA 3LCEA 4Y0UA 1T18A 5EUAA 3W4OA 4QY5A 5KZHA 1Q2PA 5FAOA 1N9NA 4UQIM 2O9BA 2Q0OA 3SH9A 3TSGA 3LFVA 1H3QA 3BFEA 4E3LA 5FQQA 3SZTA 3MSHA 3G2YA 4E6WA 1K4EA 3UB8A 3V5MA 2J7VA 1UWNX 4AFIA 1ZG4A 4E3IA 1RP5A 3CJMA 4N1HA 3FYZA 5KMWA 3W4PA 3IHAA 5DF9A 1FOFA 1BZAA 2BG1A 1F9IA 2PU4A 2V9AA 5AJGA 1TEMA 1Q2QA 4OOYA 1D1JA 4G3KA 3WWXA 3KX0X 2ZC6B 4S2NC 2OWJA 2XA7S 5A92A 2R9WA 5KIZA 4EXOA 4PM8A 2XDMA 4X6TA 5EVLA 1T1AA 2Y79A 3S7NA 3RH8B 5JYPA 3CI6A 2ZQ8A 1SHVA 2YKFA 3ICYA 4RYEA 3P98A 3UB7A 1W7FA 4JXVA 3T4QA 3HLBA 1K55A 1PWGA 3GTCA 3LY4A 3EWKA 4R3AA 1PW8A 4MMNA 4ID4A 1K56A 3IS2B 4XT2B 4Y3IA 4R4RA 5KSCA 3DWZA 3O86A 2L0WA 4S2OA 3ZCZA 4WEJA 3QNCA 4H6JB 3IH9A 3NJAA 3ISGA 1JTDA 4Y0TA 3KO6A 3CMZA 3A3JA 4EUZA 4DRTA 1S67L 2E8IA 3IWOA 3CHWP 4S2JA 3WS0A 5AQAA 5A93A 1NWZA 2FZ0A 3QP5A 4BLMA 3WS1A 3UN7A 1DRMA 3HREA 3LIEA 4MBHA 5HX9A 3LY3A 2XH9A 1LSWA 4I5SA 1K0KA 1IKGA 3CLOA 3NCKA 5FQKA 3WS4A 5L09A 3FV7A 1BLPA 1LSVA 3N4IA 1ALQA 4YINA 4GCZA 4DE2A 2W27A 2QPNA 3RFBA 1OJ5A 3CWFA 4MEZA 3QP6A 1T1BA 1VEUA 3S1YA 4L9FA 2HJEA 3ZVWA 3C7UA 4OPYA 2A49A 4DE3A 3BYDA 2H0YA 4PM9A 4EETB 1H8YA 1BYWA 3CG5A 4I39A 1YLJA 1JWPA 3Q7ZA 5EVIB 4E04A 1XJ2A 5FAPA 2M7UA 1ONHA 3PYPA 4HJ3A 1ODVA 4ME4A 5GLBA 2KDKA 3UPOA 3LR5A 3PBOA 2PR5A 4GS9A 3GQZA 1PZPA 3VP2A 4OPRA 1O07A 3PBRA 2XSSA 2WADA 3PXPA 5HPIA 1N9LA 4JF5A 1TD5A 3B47A 4RA7A 2XFSA 5E2EA 4A5RA 1K55C 2PRFA 2FFYA 2G2WA 3LR3A 5CTNA 3UE6A 5U47A 1PFLA 2IA2A 4DE0A 1HLUP 1GA9A 3IWIA 3RJUA 2WGWA 1A0KA 4KQRA 3ITAA 4C3QA 2Z6DA 5G4ZA 3NY4A 2A2LA 4BMWA 2IWDA 1T19A 3LEQA 2ZQCA 2HZ5A 1YKDA 4GDNA 4O7DA 4PHTA 4HBTA 5F1GA 3IXDA 3BY9A 3IF6C 3EQUA 5FASA 3LUQA 2IWCA 4I3JA 5AQ7A 2I9VA 3LI9A 4LV0A 1Z09A 4EU0A 3C8CA 1DY6A 3QHYA 5DJTA 2EX2A 1D06A 5GHYA 3TG9A 2R9XA 4FD8A 2QYBA 4YFMA 2PDRA 3VSLA 3GECA 1P97A 1MPLA 1OT9A 1ESUA 2P08A 5GHXA 3C5AA 4N9KA 3HL9A 5HWVA 2Y91A 2BTFP 3T50A 4MN5A 1G28A 1S4SA 3ULFA 3ZNTA 3M6HA 3SH7A 1MWUA 5M19A 5G18A 3UNWA 2A24B 1PW1A 3LI8A 4KZBA 5EM1A 5IHVA 2HPBA 4S2LA 2PR6A 4PKYG 3N6IA 1GHPA 4OQHA 2O99A 2JCHA 5JYOA 2ZC3B 3IWQA 4K08A 3NDGA 4JXWA 2VLGA 5FQIA 5J8XA 2ZM2A 3PTEA 3T1QB 3T4LA 5J3WA 3NECA 1K57A 5L10A 5E43A 4HQAA 3BRMA 4H6JA 1NXYA 3TJZC 3F1PB 3V3RA 3IH8A 4M4XA 3C2WA 1Y4OA 4ZTKA 4PKYA 4UHUA 1L0DA 5GL9A 3IBRA 2X71A 3CUEC 5HAIA 2V0WA 3FPWA 5CERA 4D2OA 5K5BA 4N1XA 3BFDA 2JKTI 4BBUA 1GHIA 4HBUA 5EV0A 2JKTM 1YAXA 3EEHA 3G31A 3L7HA 2W0NA 1KGEA 2E8JA 4JPMA 1PRQA 1CI8A 4C6YA 4WMCD 2B5RA 2Y2PA 3EGXC 3M2KA 4CLCA 3PAGA 1W79A 1ACFA 3BEBA 1L2SA 2O9AA 2PD7A 2HJ9C 2ZMVA 3OCLA 3ZDJA 1MWRA 1JWZA 4QHCA 4QJGA 3IXHA 4WUJA 4KQQA 1KVLA 1FSYA 1P9WA 4HP4A 1DP6A 4X53A 2EX8A 2GNXA 4OP5A 5M18A 2QMIA 5HW3A 4RX2A 4X25A 1S1ZA 1NYMA 3UDFA 4Y13A 4HY8A 5A91A 2XF3A 1WYCA 2JKGA 3E4OA 5HD5A 2HP9A 5EVID 3G34A 3T4JA 4DE1A 4B93A 1TS6A 4EQIA 2P74A 2JN7A 5F5YA 2XGNA 3D9YA 3MKFA 4FUWA 4LV2A 4Q0HA 4BL3A 1W5DA 1EWZA 5FI6A 2V8FA 3VMAA 5EVIC 1PYYA 2B95A 5DVAA 1SKOB 1S4RA 1NRFA 2PBDP 3S22A 5FDSA 3UE0A 3AGDA 3IXBA 4IBXA 3UB5P 5EECA 4NXEA 4DN0A 2GDNA 4HOIA 3Q81A 3ZG5A 4MBFA 3ITBA 2Y2NA 4WL9A 4EEUA 4JXGA 2VKSA
chains in the Genus database with same CATH topology
1XFQA 2YKFA 3ICYA 5IU1A 3OOVA 3TW8A 2W1RA 4UEYA 2D01A 2BASA 3UB7A 4P6ZM 3CAXA 4JGRA 3T4QA 3EEAA 5J4EA 4BBVA 4BWIA 2VA0A 2HGVA 3F1NA 3EOIA 1P0ZA 4MDZA 4IJGA 3LR0A 3MF0A 4LPZA 3EWKA 4R3AA 3E98A 2D02A 4HNBA 4ETXA 4MMNA 3IS2B 4XT2B 4Y3IA 3PHYA 2WKPA 4L0LA 2ZOIA 4NEED 3U2AA 3R7WA 5IS1A 4XT2A 4R70A 2JKRM 2L0WA 2FH5A 4WEJA 4H6JB 3P01A 2A24A 3NJAA 2ZOHA 3KO6A 3D72A 3UE3A 3MR0A 4ETZA 1S67L 5F6AA 4ARZB 5MC7A 1F98A 1NLZA 2PHYA 4JGQA 2PYPA 3C30A 2V1BA 3PBTA 2VX8A 4EEPA 3PR6A 3MXQA 4L9GA 4DMZA 1NWZA 4NKPA 4UQIS 5J7EA 2FZ0A 2KX6A 2GX5A 3PBQA 2OAQ1 1ZTUA 1STZA 1DRMA 3BQ8A 3LIEA 2W3FA 3BY8A 1LSWA 2OAP1 2QWSA 3KSIA 4I5SA 1OTBA 3CLOA 1G6OA 4HH2A 3EQVA 4HHDA 4GLQA 3T4KA 3BW6A 3R4KA 5FL3A 2HV1A 2L4RA 5HSQA 5A8BA 1LSVA 5TJJA 3T4TA 3KYQA 4GCZA 2WKRA 4JGPA 3UMDA 3R7WB 4R38A 2W27A 3MQQA 3RFBA 1OJ5A 3CWFA 1XJ4A 2WKQA 4GS9B 1T1BA 1UGUA 4KQOA 4BBTA 4L9FA 3FC7A 2HJEA 2NUTC 3H9WA 3HCYA 5CX7A 3H7WB 3OLOA 2HF6A 2VKSA 2XRNA 1S1YA 4I3AA 1H8MA 1V9YA 2ZMFA 4HJ6A 4LRZE 4HP9A 4EETB 3PBSA 5HDCA 1XJ3A 4B9OA 1BYWA 3F1OA 4I39A 3K2NA 4I3IA 4YWZA 4E04A 4EW7A 3HJIA 2XROA 3TE8A 1XJ2A 2M7UA 3PYPA 4HJ3A 3F1PA 4HH3A 1ODVA 4CLCE 2XA7M 3PBNA 4ME4A 2KDKA 3LR5A 3PBOA 5F69A 4LRXC 3K3CA 2PR5A 4GS9A 3H82A 1TS8A 4YNRA 4EUVA 3OC2A 1S66L 3D3OA 3ZYTA 3A0SA 4IUHA 5DKKA 4CQHA 2VV7A 2CMNA 3NOUC 3PBRA 2P04A 1IOUA 2XSSA 3PXPA 5HPIA 1N9LA 3F1NB 1GSWA 2VGLM 3JVVA 1OJGA 1TD5A 3B47A 3LR4A 1ZHHB 2J3WA 1XFNA 4Q0JA 2R78A 5HDSA 4EESA 4HI4A 3DBAA 3A0RA 2NUPC 4PAUA 1NLYA 3LR3A 5LBRA 2JHEA 2JKRI 3KYZA 3UE6A 3NOPC 4FOFA 2IA2A 4IUKA 2VZWA 2B18A 1N9OA 2KOIA 1T1CA 2M7VA 1LL8A 1W63Q 1TS0A 4FSFA 2Z6DA 5G4ZA 3TRCA 3B33A 5AVFA 2A2LA 3T4OA 4BMWA 3RTYA 1T19A 2W3HA 4KQDA 4F3LB 3KSHA 1YKDA 3CUEA 2M1CA 4O8GA 4ZRRA 4QPRA 5DKLA 4PHTA 1MC0A 1F5MA 3BY9A 2W1TB 2G7UA 3A0VA 3EQUA 4CLCD 1OPXA 3LUQA 4I3JA 1WA9A 3IS2A 2I9VA 3LI9A 2W3DA 2GZAA 4OOLA 1VB6A 4EU0A 3C8CA 4BJPA 5DJTA 2LB5A 2EA9A 3K3DA 1D06A 4GHIA 3LIAA 3W2ZA 4P6ZS 4LLOB 2QYBA 5TBMA 2QHKA 3KSGA 3LIDA 2PDRA 3C38A 3GECA 3BWLA 1P97A 5AVEA 4CLCC 4WELA 1OT9A 3HJKA 3B42A 1LT0A 2P08A 2W1TA 2DMWA 1NRJA 3VE4A 5HWVA 3EGDC 4II7A 3T50A 4OOMA 1X0OA 4MN5A 3S7OA 1LSXA 1G28A 1KOUA 3JVUA 4KUOA 4WF0A 3S7PA 1S4SA 3BQAA 3UB9A 3ULFA 2K31A 2W3GA 4MCWA 3SW1A 2EWVA 1EW0A 2A24B 2OOLA 4DJ3A 2V0UA 3LI8A 3H7WA 2P7JA 3E4PA 5HZHA 5HDDA 1MZUA 4EQ1A 2PR6A 4PKYG 2QKPA 5KSHA 1D7EA 2QJ7A 4NXBA 2O99A 1MKMA 2L1MA 4Q0IA 1DP8A 4K08A 3OBFA 4YOFA 4LRYC 4Y2FA 2VLGA 2O9CA 2VJWA 2OWHA 3GDIA 5HPFA 4R6LA 3ZQ5A 2MJ6A 5DFYA 4Z1WA 3T4LA 5J3WA 2PD8A 2QJ5A 2VV8A 2V1AA 2KLIA 3LICA 1OTAA 4L9EA 2EWWA 4HQAA 2VGLS 4H6JA 1DP9A 2K2NA 3NOTC 1GSVA 4KUKA 4O0PA 2YKHA 3TJZC 2W3EA 2ZBBA 3MQOA 5HWTA 3F1PB 1W63M 2PT7A 5HD3A 4M4XA 3C2WA 5DJUA 4PKYA 3UB6A 1YSQA 3IBRA 2B02A 4CLCB 3CUEC 3KSFA 3P7NA 2V0WA 3FPWA 3MFXA 5EFWA 3LIBA 3IBJA 4I38A 5K5BA 2INWA 1JNUA 2JKTI 3BJNA 4BBUA 2K7SA 5C5KA 2JKTM 4HIAA 1YAXA 3EEHA 2W0NA 3UMEA 4NXFA 2J3TD 4WN5A 2LB9A 1T18A 1GSXA 1OTDA 3LIFA 1VHMA 3E0YA 2H28A 3G6OA 2VV6A 5IT5A 1P9RA 4IHQA 3T4SA 2J3TC 1N9NA 4NXGA 3EGXC 4UQIM 2O9BA 4CLCA 3F1OB 3LFVA 3LYXA 3S7QA 2O9AA 3VE3A 3VOLA 1H3QA 2PD7A 2HJ9C 2ZMVA 2J80A 3V67A 3OCLA 4GW9A 2O0YA 3OCNA 4Y5FA 2GJ3A 4WUJA 3FPVA 5HWWA 1YSPA 3CITA 3UB8A 3E4QA 1P9WA 5TBMB 5DFXA 4G3WA 4HP4A 1UWNX 4AFIA 5F68A 4GJ4A 1DP6A 4RQ9A 1XJ6A 1IFQA 1Y28A 5I5LA 2GNXA 1S1ZA 4WLAA 4HY8A 3MMHA 5DF9A 3E4OA 3H82B 5HD5A 3NHQA 1F9IA 3MQ0A 3T4JA 4B93A 4HJ4A 4JGOA 1TS6A 2V9AA 3O5YA 5AJGA 5F5YA 2JN7A 2PYRA 3MJQA 5L8MA 4Q0HA 4G3KA 4MN7A 3KX0X 4GHIB 4F3LA 1UWPX 4DJ2A 4EERA 2OWJA 1OT6A 2XA7S 3FG8A 1OTEA 1S4RA 1OTIA 4ARZA 2VEAA 4G3VA 5KIZA 4EXOA 5G4YA 1TS7A 1TF1A 4O01A 4WEKA 5HL6A 3VV4A 1T1AA 1V9ZA 4NXEA 4DN0A 4HOIA 2Y79A 2Y8HA 3S7NA 3RH8B 4WL9A 4MN6A 4EEUA 3CI6A 2Z6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEH A;  4HP9 A;  4EET B;  1XFQ A;  5TBM A;  2QHK A;  2YKF A;  2W0N A;  1XJ3 A;  3ICY A;  3LID A;  4NXF A;  1BYW A;  2PDR A;  3F1O A;  4I39 A;  4NXG A;  5IU1 A;  2D01 A;  2BAS A;  3BWL A;  3GEC A;  1P97 A;  4I3I A;  4WN5 A;  5AVE A;  4YWZ A;  3UB7 A;  4E04 A;  1T18 A;  1OT9 A;  3HJK A;  3HJI A;  1GSX A;  3CAX A;  4JGR A;  1OTD A;  1LT0 A;  4EW7 A;  3LIF A;  1XJ2 A;  5J4E A;  2H28 A;  3PYP A;  4BBV A;  4HJ3 A;  3F1P A;  3G6O A;  2VV6 A;  4HH3 A;  3F1N A;  1ODV A;  3VE4 A;  5HWV A;  1P0Z A;  2KDK A;  3T50 A;  5F69 A;  1N9N A;  3EWK A;  4LPZ A;  4LRX C;  2D02 A;  2PR5 A;  3K3C A;  1X0O A;  4HNB A;  4MN5 A;  1LSX A;  1G28 A;  1KOU A;  4KUO A;  3IS2 B;  4GS9 A;  4WF0 A;  4XT2 B;  3H82 A;  1S4S A;  3F1O B;  1TS8 A;  3UB9 A;  3ULF A;  3PHY A;  2WKP A;  2ZOI A;  3LYX A;  1S66 L;  5HDC A;  3SW1 A;  5IS1 A;  3A0S A;  4XT2 A;  3VE3 A;  3VOL A;  2PD7 A;  5DKK A;  2J80 A;  2VV7 A;  2CMN A;  3NOU C;  4R70 A;  1EW0 A;  2A24 B;  2OOL A;  2L0W A;  4DJ3 A;  4R3A A;  4GW9 A;  1N9L A;  2V0U A;  3F1N B;  3LI8 A;  1GSW A;  3H7W A;  4H6J B;  1OJG A;  2P7J A;  2A24 A;  3E4P A;  2ZOH A;  3NJA A;  5HZH A;  5HDD A;  1MZU A;  4EQ1 A;  3D72 A;  2PR6 A;  3MR0 A;  4PKY G;  1XFN A;  2QKP A;  2GJ3 A;  1D7E A;  2R78 A;  4WUJ A;  5HDS A;  4EES A;  2QJ7 A;  1S67 L;  4HI4 A;  4NXB A;  5F6A A;  5HWW A;  3UB8 A;  3A0R A;  3E4Q A;  2L1M A;  1F98 A;  1DP8 A;  5TBM B;  2PHY A;  4JGQ A;  4K08 A;  2JHE A;  1UWN X;  4HP4 A;  2PYP A;  5F68 A;  2V1B A;  1DP6 A;  3UE6 A;  3NOP C;  4EEP A;  4RQ9 A;  4LRY C;  1XJ6 A;  3MXQ A;  1Y28 A;  4L9G A;  1N9O A;  5I5L A;  2VLG A;  1NWZ A;  1T1C A;  5J7E A;  2KX6 A;  2OWH A;  1S1Z A;  4WLA A;  1LL8 A;  3GDI A;  4R6L A;  1TS0 A;  3ZQ5 A;  5KIZ A;  4HY8 A;  1DRM A;  5J3W A;  2PD8 A;  2Z6D A;  2QJ5 A;  5G4Z A;  2VV8 A;  2V1A A;  3E4O A;  3H82 B;  3B33 A;  3LIE A;  3NHQ A;  3BY8 A;  5HD5 A;  1F9I A;  3LIC A;  5AVF A;  4HJ4 A;  4JGO A;  1OTA A;  4L9E A;  1LSW A;  1TS6 A;  2QWS A;  4I5S A;  3RTY A;  1T19 A;  2V9A A;  4HQA A;  5F5Y A;  2JN7 A;  2PYR A;  1OTB A;  4KQD A;  4H6J A;  1DP9 A;  3MJQ A;  3CLO A;  4F3L B;  4HH2 A;  3UME A;  3NOT C;  1GSV A;  2M1C A;  4HHD A;  4KUK A;  2YKH A;  2HV1 A;  3KX0 X;  5DKL A;  2L4R A;  4GHI B;  5HSQ A;  4F3L A;  5A8B A;  1LSV A;  1UWP X;  2ZBB A;  3F1P B;  3MQO A;  4LRZ E;  5HWT A;  5HD3 A;  3BY9 A;  4GCZ A;  4DJ2 A;  4EER A;  2WKR A;  3C2W A;  4M4X A;  2OWJ A;  1OT6 A;  3A0V A;  3FG8 A;  4JGP A;  5DJU A;  1OTE A;  4PKY A;  3UMD A;  1S4R A;  3LUQ A;  1OTI A;  4R38 A;  2VEA A;  2W27 A;  3MQQ A;  1WA9 A;  4I3J A;  1OJ5 A;  3CWF A;  3UB6 A;  1XJ4 A;  3IBR A;  5G4Y A;  1TS7 A;  2B02 A;  4EXO A;  2WKQ A;  3IS2 A;  4GS9 B;  2I9V A;  1T1B A;  3LI9 A;  1UGU A;  3P7N A;  1VB6 A;  2V0W A;  3C8C A;  3MFX A;  5EFW A;  4BBT A;  1T1A A;  3FC7 A;  1V9Z A;  3LIB A;  4L9F A;  4B9O A;  3H9W A;  5DJT A;  2EA9 A;  4NXE A;  3H7W B;  3K3D A;  3OLO A;  1D06 A;  2INW A;  4GHI A;  4I38 A;  1JNU A;  3LIA A;  4HOI A;  1S1Y A;  4I3A A;  3RH8 B;  2K7S A;  4BBU A;  1V9Y A;  4WL9 A;  4MN6 A;  4EEU A;  4LLO B;  4HJ6 A;  2Z6C A;  4HIA A; 
#chains in the Genus database with same CATH topology
 3OOV A;  1W8Y A;  1VQQ A;  5EE8 A;  2D01 A;  3WS5 A;  2CC1 A;  3V3S A;  5CHU A;  4KEN B;  4JGR A;  5J4E A;  1KE3 A;  4BWI A;  2X02 A;  2HGV A;  3F1N A;  3EOI A;  1P0Z A;  4MDZ A;  3LGO A;  5D3O A;  3HLW A;  1YQS A;  2RCX A;  1N4O A;  2ZOI A;  1YLY A;  3PAE A;  3R7W A;  5IS1 A;  3E2K A;  4XT2 A;  5FA7 A;  5L2F A;  3ZG9 B;  4FCF A;  2JKR M;  2WKH A;  1H8Z A;  1HVB A;  1S0W A;  2FH5 A;  4H8R A;  1HD8 A;  3P01 A;  2C6W B;  4P85 A;  2G2U A;  4WYY A;  5F82 A;  3UE3 A;  3MR0 A;  1L0F A;  2ZQA A;  3C4O A;  2XLN A;  3SS4 A;  4ARZ B;  4KZ5 A;  4CJN A;  1NLZ A;  5AQ9 A;  4JGQ A;  2PYP A;  3C30 A;  4K91 A;  3E2L A;  3PBT A;  3PR6 A;  4UQI S;  1YMX A;  3QP8 A;  3MZD A;  2KX6 A;  3PBQ A;  2OAQ 1;  3M6B A;  4U3T A;  4Y17 A;  4WM9 A;  3AGE A;  1STZ A;  1FQG A;  1PIO A;  2OAP 1;  5CGW A;  3VOZ A;  4X55 A;  1G6O A;  1XKZ A;  4GLQ A;  3R4K A;  4ZBE A;  2HV1 A;  1JVJ A;  2Y55 A;  5HSQ A;  1BLH A;  3UDX A;  4B4Z A;  3KYQ A;  2WKR A;  3R7W B;  2HDS A;  4GS9 B;  2XD5 A;  4ZJ2 A;  4KQO A;  1LL5 A;  1KVM A;  4N9L A;  2ZL1 B;  3HCY A;  3H7W B;  3OLO A;  2HF6 A;  4I3A A;  4OPQ A;  3NC8 A;  4IBR A;  2XRO A;  3HLC A;  5TGF A;  3IXG A;  1YLT A;  1SZV A;  3DTM A;  4LRX C;  5E2F A;  3O3V A;  4D60 A;  4YNR A;  1NZO A;  4EUV A;  1S66 L;  4EBP A;  4CQH A;  2VV7 A;  3NOU C;  2QZ6 A;  1IOU A;  2P04 A;  2I72 A;  1IEM A;  3WRT A;  1K54 A;  1GSW A;  2VGL M;  1OJG A;  2V8C A;  1PWC A;  3LR4 A;  2R78 A;  4KG6 A;  4EES A;  5EOO A;  4DF6 A;  2OSU A;  1NLY A;  4GDB A;  1S6R A;  2ZC5 B;  5EPH A;  1LLB A;  4PM6 A;  2VZW A;  1N9O A;  3OPH A;  2OV5 A;  4FSF A;  2JKF A;  4E6X A;  5CTM A;  3B33 A;  2ACG A;  3N8R A;  2Y2O A;  3UDI A;  3RTY A;  5EVE A;  5F83 A;  4KQD A;  3MZF A;  4HEF A;  4F3L B;  3KSH A;  5CRF A;  4ZRR A;  5CHM A;  3MZE A;  2WAE A;  3MBZ A;  5DKL A;  1YPR A;  1ZG6 A;  2W1T B;  2WZX A;  1CK3 A;  1PI5 A;  4R23 A;  3T1R A;  3V50 A;  1OPX A;  3IS2 A;  4OQG A;  4NET A;  4BJP A;  3ZG0 A;  4GHI A;  3QP2 A;  3SS3 A;  4LLO B;  3HLD A;  5TBM A;  2QHK A;  1SDN A;  3FKW A;  1BLS A;  4CLC C;  4WEL A;  3HJK A;  3HLG A;  4EBL A;  2ZLY A;  1NRJ A;  3WRZ A;  1X0O A;  1JWV A;  3S7O A;  3V39 A;  3GVB A;  1XA7 A;  1N9B A;  4HES A;  4R4S A;  1BTL A;  4GZB A;  2OOL A;  3H7W A;  1BLC A;  3E4P A;  3HBR A;  1MZU A;  2QKP A;  4KZ6 A;  3A3F A;  2Y2J A;  3BFG A;  4LRY C;  1CQA A;  1MXO A;  2XEP A;  3BM6 A;  1KDW A;  4Z9Q A;  5HPF A;  4JKT A;  4R6L A;  3ZQ5 A;  4IVK A;  3L9K A;  2MJ6 A;  4Z1W A;  3UPN A;  3VP1 A;  5EVI A;  2QJ5 A;  4E3O A;  1SCW A;  4F94 A;  1CF0 A;  2VGL S;  3SH8 A;  5HAP A;  2IWB A;  4BD1 A;  1K4F A;  3FKV A;  2ZL1 A;  4O0P A;  1PWD A;  3MQO A;  1XXM A;  5HD3 A;  4GOG A;  2VK3 A;  3W4Q A;  4CLC B;  3GMW A;  5FDH A;  3KSF A;  3FWL A;  4GD6 A;  3D4F A;  3LIB A;  3IBJ A;  2WGW B;  4KZ3 A;  4Y0O A;  4QU3 A;  1JNU A;  5E2H A;  1I2W A;  3BJN A;  1J9M A;  3UME A;  1F2K A;  2J3T D;  4WN5 A;  2LB9 A;  1OTD A;  3LIF A;  4R3J A;  4LEN A;  3G6O A;  5IT5 A;  5CEB A;  1P9R A;  4IHQ A;  5FI7 A;  2J3T C;  4NXG A;  1QMF A;  2ZD8 A;  3F1O B;  3ZHH A;  5CGX A;  3LYX A;  3S7Q A;  3V67 A;  4GW9 A;  2JE5 A;  2O0Y A;  1DJC A;  4Y5F A;  2Z2L B;  2GJ3 A;  2JC7 A;  4JXS A;  1QME A;  3CIT A;  3DAV A;  2WKI A;  5DFX A;  4G3W A;  1K57 C;  3I7J A;  4RQ9 A;  1XJ6 A;  5L07 A;  1Y28 A;  5I5L A;  4LCL A;  4WZ4 A;  4RVA A;  4WLA A;  3MS6 A;  3LO7 A;  2H0T A;  1W8Q A;  3MMH A;  3H82 B;  3MQ0 A;  4HJ4 A;  2HP6 A;  2J8Y A;  1OME A;  2PYR A;  3M2J A;  5L8M A;  2EXA A;  4UA6 A;  2XK1 A;  4OPZ A;  3P09 A;  4GHI B;  4S2P A;  5CGS A;  1IYO A;  2FFF B;  3MXS A;  4DJ2 A;  4EER A;  3FG8 A;  1OTI A;  4ARZ A;  4G3V A;  3UO9 A;  1RGY A;  5G4Y A;  3NI9 A;  4ZJ1 A;  1FIL A;  4O01 A;  5CXW A;  1XGJ A;  5HL6 A;  4WZ5 A;  1V9Z A;  1NY0 A;  4MN6 A;  4PPR A;  1XFQ A;  3TW8 A;  2W1R A;  4OKP A;  4P6Z M;  5TFQ A;  2VA0 A;  2WGV A;  5FAT A;  3VFF A;  1DJB A;  4IJG A;  3LR0 A;  3E98 A;  4HNB A;  4ETX A;  4XXR A;  4S2M A;  3IF6 B;  3S4X A;  3PHY A;  2WKP A;  4NEE D;  3BLS A;  3U2A A;  4P0M A;  4N92 A;  4R70 A;  4FTX A;  4U0X A;  2A3U A;  3QNB A;  4OH0 A;  4QB8 A;  3VP0 A;  2Y2G A;  4KG5 A;  2A24 A;  3NUL A;  3VOY A;  3D72 A;  5I94 A;  5F6A A;  3JPU A;  3HVF A;  1F98 A;  4FH4 A;  1DJA A;  3MXQ A;  3GSG A;  4DMZ A;  4S2I A;  2RL3 A;  5J7E A;  2PBY A;  1ZTU A;  5M1A A;  2W3F A;  3BY8 A;  3IX8 A;  1K25 A;  3IX3 A;  2QWS A;  4P6B A;  3Q7V A;  3DW0 A;  3ZG8 B;  4KG2 A;  1OTB A;  4HHD A;  3KYE A;  3MKE A;  4LFU A;  2L4R A;  5CHJ A;  3HLF A;  5TJJ A;  3T4T A;  1ZC2 A;  3UPP A;  1FIK A;  5DTK A;  4JGP A;  3O88 A;  1ERQ A;  4R38 A;  2VGJ A;  4MBK A;  1UGU A;  3T1X A;  5DTT A;  4BBT A;  3FC7 A;  3H9W A;  2Y2K A;  4E3M A;  1S1Y A;  3ZG7 B;  3ZNY A;  1H8M A;  2JBF A;  5A90 A;  3NIA A;  4ZAM A;  5HDC A;  3F1O A;  1G5U A;  3K2N A;  4I3I A;  5FI2 A;  4EW7 A;  1BT5 A;  4CLC E;  3BFF A;  2WUQ A;  4BL2 A;  5F69 A;  1VEU B;  3K3C A;  4GN2 A;  4KZA A;  3H82 A;  2Y2Q A;  1TS8 A;  1YLZ A;  3G30 A;  1YLP A;  1G68 A;  3D3O A;  2Y59 A;  1RGZ A;  4IUH A;  5DKK A;  2CMN A;  1WE4 A;  4UA7 A;  2EXB A;  4E3N A;  3T12 B;  2ZM0 A;  1ZHH B;  3B3X A;  4ESP A;  5GLC A;  1E25 A;  4HI4 A;  5FEG A;  3DBA A;  3A0R A;  4DKI A;  1KGG A;  2NUP C;  4OQI A;  4PAU A;  1KE4 A;  3NOP C;  4FOF A;  4IUK A;  1FR6 A;  2KOI A;  1T1C A;  4GKU A;  1LL8 A;  1W63 Q;  4E3J A;  4OQ0 A;  2H5S A;  3DTK A;  3TRC A;  1XX2 A;  2XR0 A;  3HUN A;  4M3K A;  5DF8 A;  3BFC A;  2W3H A;  4KZ7 A;  4O8G A;  2M1C A;  3FZC A;  4QPR A;  5E2G A;  1MC0 A;  1SKF A;  4CLC D;  1WA9 A;  1MWT A;  4DXB A;  2W3D A;  2GZA A;  4NG2 A;  2LB5 A;  1CJF A;  2EA9 A;  2Y2M A;  1L0G A;  4P6Z S;  2HDQ A;  3LID A;  3C38 A;  4GD8 A;  4ZJ3 A;  1M40 A;  2AVX A;  5AVE A;  1PNE A;  1LT0 A;  3TOI A;  2DMW A;  3VE4 A;  2J9P A;  3EGD C;  1LHY A;  4MLL A;  3T1S A;  1FCN A;  4OOM A;  1EI5 A;  3S7P A;  1KOU A;  4WF0 A;  1IYP A;  3UB9 A;  3SW1 A;  4LCM A;  2EWV A;  1G6A A;  5FQJ A;  1FR1 A;  2V0U A;  1H0M A;  5CEC A;  2P7J A;  3JYI A;  3A3E A;  1ERO A;  2QJ7 A;  4NXB A;  2EFX A;  3N8S A;  3LEZ A;  3IF5 A;  1I5Q A;  3MFD A;  4LGW A;  4Q0I A;  1DP8 A;  4X68 A;  3OBF A;  3CPT B;  2VGK A;  3MXR A;  2O9C A;  1YM1 A;  2VJW A;  2Y2I A;  3GDI A;  2DCF A;  5DFY A;  1LI9 A;  2KLI A;  3LIC A;  4L9E A;  2V2F F;  4FH2 A;  1GHM A;  1DP9 A;  4KZ9 A;  1M6K A;  4PM7 A;  3GV9 A;  4KUK A;  3UE1 A;  1YT4 A;  1ERM A;  2X01 A;  1E4D A;  2W3E A;  5HWT A;  1W63 M;  3IX4 A;  4CPK A;  2UWX A;  4JF6 A;  3OPL A;  1YSQ A;  2PU2 A;  2B02 A;  3P7N A;  1J3W A;  5HAR A;  2HDR A;  4OLD A;  4QY6 A;  2INW A;  2K7S A;  4P87 A;  1LI0 A;  1GSX A;  3C7V A;  3OPP A;  1E3U D;  1VHM A;  3E0Y A;  2H28 A;  5HFO A;  2VV6 A;  1ONG A;  2ZC4 B;  3T4S A;  3AGF A;  1CI9 A;  3VE3 A;  1TVF A;  3VOL A;  2J80 A;  1C3B A;  4NK3 A;  3W8K A;  3OCN A;  1ES3 A;  3WS2 A;  1BUE A;  5EM0 A;  4LV3 A;  3FPV A;  3CZD A;  5HWW A;  1H5X A;  1YSP A;  3E4Q A;  1LL9 A;  4R3B A;  2OLU A;  5TBM B;  5F68 A;  4GJ4 A;  1YLW A;  1IFQ A;  3BLM A;  1XP4 A;  3CPT A;  1NYY A;  4UA9 A;  1TDG A;  1XA1 A;  3NHQ A;  3BEC A;  3VSK A;  4JGO A;  3O5Y A;  4WBG A;  1O7E A;  3MJQ A;  3Q1F A;  3VP4 A;  4UAA A;  4QWO A;  4DXC A;  4MN7 A;  4OP8 A;  5FAQ A;  1MKI A;  4F3L A;  1UWP X;  5GLA A;  4U0T A;  2Y2L A;  1OT6 A;  4KZ4 A;  1OTE A;  1VET A;  1IKI A;  2EFU A;  2VEA A;  1CEF A;  1PI4 A;  1Z6F A;  1TS7 A;  2ZQD A;  1TF1 A;  4WEK A;  3VV4 A;  2WKE A;  2Y8H A;  3VP3 A;  2Z6C A;  5DTS A;  1Y54 A;  5IU1 A;  1PZO A;  4UEY A;  2BAS A;  4BD0 A;  2P9V B;  3CAX A;  1RCJ A;  3EEA A;  4BBV A;  1K6S A;  3SS5 A;  1JTG A;  4X1L A;  3MF0 A;  3VFH A;  4LPZ A;  2D02 A;  2XD1 A;  2Q9N A;  1XGI A;  3OZH A;  3A3I A;  1L3L A;  1XPB A;  4L0L A;  4BEN A;  3A3D A;  3OPR A;  4Y7P A;  1I2S A;  2ZOH A;  1K6R A;  1SDE A;  1L0E A;  2HP5 A;  4ETZ A;  4GNU A;  3DWK A;  5MC7 A;  2PHY A;  3G32 A;  4IVI A;  4XUX A;  2V1B A;  1YMS A;  2VX8 A;  4EEP A;  4L9G A;  3ZGA B;  2WGI A;  4NKP A;  3HUO A;  2GX5 A;  2WAF A;  3BQ8 A;  2EX9 A;  2DNS A;  3GR2 A;  3IF6 A;  1SKO A;  3KSI A;  2DRW A;  1VET B;  4X69 A;  1U60 A;  4HH2 A;  3EQV A;  4K0X A;  1VM1 A;  3NBL A;  3T4K A;  3BW6 A;  5FL3 A;  4WZ5 C;  3GRJ A;  5A8B A;  3UMD A;  4PM5 A;  3MQQ A;  5BOH A;  1XJ4 A;  4K0W A;  2WKQ A;  1ES5 A;  1MWS A;  5FQM A;  2NUT C;  5CX7 A;  2XRN A;  3SOI A;  1V9Y A;  5FEF A;  2ZMF A;  4HJ6 A;  4LRZ E;  4HP9 A;  4LV1 A;  2P9V A;  3PBS A;  1XJ3 A;  4B9O A;  2XFT A;  4YWZ A;  3HJI A;  3ZFZ A;  3TE8 A;  4IED A;  2ZC7 A;  3F1P A;  2PAV P;  4HH3 A;  1MY8 A;  2XA7 M;  3PBN A;  2ZMA A;  1AWI A;  2XQZ A;  3OC2 A;  3ZYT A;  3A0S A;  5HL1 A;  2UV0 E;  4S2K A;  1K38 A;  1FSW A;  3F1N B;  3JVV A;  4JLF A;  2J3W A;  4DDS A;  1XFN A;  4Q0J A;  5HDS A;  4B88 A;  2Y4A A;  5LBR A;  2JHE A;  2JKR I;  4X1M A;  1HZO A;  3KYZ A;  4PMA A;  2ZM8 A;  3DTE A;  3G35 A;  2B18 A;  3IQA A;  3RXX A;  5AQB A;  1NZU A;  4X56 A;  3UY6 A;  2M7V A;  1TS0 A;  4E3K A;  2ZQ7 A;  4EBN A;  3HLE A;  4RX3 A;  1KDS A;  1BSG A;  1IEL A;  5AVF A;  3T4O A;  4XUZ A;  3N7W A;  5CED A;  4QD4 A;  1ES2 A;  3CUE A;  3DTI A;  1TDL A;  3QP1 A;  2WK0 A;  2C5W B;  1F5M A;  4JBF A;  2G7U A;  3A0V A;  1IYS A;  2V1Z A;  5GLD A;  4Y15 A;  4OOL A;  4BQM A;  3RXW A;  1VB6 A;  1ZKJ A;  5EOE A;  3K3D A;  4JF4 A;  3LIA A;  3W2Z A;  1KGF A;  4OVD A;  3G4P A;  3Q82 A;  5FQ9 A;  2WYX A;  3KSG A;  5FSR A;  3N8L A;  3NDE A;  1CEG A;  3BWL A;  2WZZ A;  3B42 A;  1BUL A;  2W1T A;  1GCE A;  2J9O A;  4KZ8 A;  4II7 A;  1LSX A;  3JVU A;  4KUO A;  3BQA A;  5HAQ A;  2K31 A;  2W3G A;  1KE0 A;  4MCW A;  4Q8I A;  3QP4 A;  2BLS A;  2HDU A;  1EW0 A;  1NJ4 A;  4DJ3 A;  4ZDX A;  3C4P A;  1AXB A;  4WMC A;  3O87 A;  4B4X A;  3IT9 A;  5HZH A;  5HDD A;  3G2Z A;  4EQ1 A;  5KSH A;  1FCO A;  1D7E A;  1MKM A;  2L1M A;  4S2N A;  1MBL A;  1ESI A;  3ZVT A;  3Q07 A;  4YOF A;  2V20 A;  4Y2F A;  1WYB A;  1ES4 A;  4R1G A;  2OWH A;  1K56 D;  2EX6 A;  2PD8 A;  4DDY A;  4R0Q A;  2VV8 A;  2V1A A;  1OTA A;  1FCM A;  4MNR A;  2EWW A;  1K54 C;  2Z2M B;  2H10 A;  4OLG A;  2K2N A;  3NOT C;  1GSV A;  1GA0 A;  2Q9M A;  2YKH A;  2ZQ9 A;  2ZBB A;  4OON A;  2ZJ9 A;  2PT7 A;  3HUM A;  5DJU A;  4C75 A;  3IHB A;  4GB7 A;  5GHZ A;  4EWF A;  3UB6 A;  1HTZ A;  5TR7 A;  5F1F A;  1E3U A;  5DF7 A;  3MFX A;  5EFW A;  3U4L P;  4I38 A;  1IYQ A;  4EV4 A;  2Y2H A;  3Q7V B;  5C5K A;  4HIA A;  4NXF A;  2OLV A;  3LCE A;  4Y0U A;  1T18 A;  5EUA A;  3W4O A;  4QY5 A;  5KZH A;  1Q2P A;  5FAO A;  1N9N A;  4UQI M;  2O9B A;  2Q0O A;  3SH9 A;  3TSG A;  3LFV A;  1H3Q A;  3BFE A;  4E3L A;  5FQQ A;  3SZT A;  3MSH A;  3G2Y A;  4E6W A;  1K4E A;  3UB8 A;  3V5M A;  2J7V A;  1UWN X;  4AFI A;  1ZG4 A;  4E3I A;  1RP5 A;  3CJM A;  4N1H A;  3FYZ A;  5KMW A;  3W4P A;  3IHA A;  5DF9 A;  1FOF A;  1BZA A;  2BG1 A;  1F9I A;  2PU4 A;  2V9A A;  5AJG A;  1TEM A;  1Q2Q A;  4OOY A;  1D1J A;  4G3K A;  3WWX A;  3KX0 X;  2ZC6 B;  4S2N C;  2OWJ A;  2XA7 S;  5A92 A;  2R9W A;  5KIZ A;  4EXO A;  4PM8 A;  2XDM A;  4X6T A;  5EVL A;  1T1A A;  2Y79 A;  3S7N A;  3RH8 B;  5JYP A;  3CI6 A;  2ZQ8 A;  1SHV A;  2YKF A;  3ICY A;  4RYE A;  3P98 A;  3UB7 A;  1W7F A;  4JXV A;  3T4Q A;  3HLB A;  1K55 A;  1PWG A;  3GTC A;  3LY4 A;  3EWK A;  4R3A A;  1PW8 A;  4MMN A;  4ID4 A;  1K56 A;  3IS2 B;  4XT2 B;  4Y3I A;  4R4R A;  5KSC A;  3DWZ A;  3O86 A;  2L0W A;  4S2O A;  3ZCZ A;  4WEJ A;  3QNC A;  4H6J B;  3IH9 A;  3NJA A;  3ISG A;  1JTD A;  4Y0T A;  3KO6 A;  3CMZ A;  3A3J A;  4EUZ A;  4DRT A;  1S67 L;  2E8I A;  3IWO A;  3CHW P;  4S2J A;  3WS0 A;  5AQA A;  5A93 A;  1NWZ A;  2FZ0 A;  3QP5 A;  4BLM A;  3WS1 A;  3UN7 A;  1DRM A;  3HRE A;  3LIE A;  4MBH A;  5HX9 A;  3LY3 A;  2XH9 A;  1LSW A;  4I5S A;  1K0K A;  1IKG A;  3CLO A;  3NCK A;  5FQK A;  3WS4 A;  5L09 A;  3FV7 A;  1BLP A;  1LSV A;  3N4I A;  1ALQ A;  4YIN A;  4GCZ A;  4DE2 A;  2W27 A;  2QPN A;  3RFB A;  1OJ5 A;  3CWF A;  4MEZ A;  3QP6 A;  1T1B A;  1VEU A;  3S1Y A;  4L9F A;  2HJE A;  3ZVW A;  3C7U A;  4OPY A;  2A49 A;  4DE3 A;  3BYD A;  2H0Y A;  4PM9 A;  4EET B;  1H8Y A;  1BYW A;  3CG5 A;  4I39 A;  1YLJ A;  1JWP A;  3Q7Z A;  5EVI B;  4E04 A;  1XJ2 A;  5FAP A;  2M7U A;  1ONH A;  3PYP A;  4HJ3 A;  1ODV A;  4ME4 A;  5GLB A;  2KDK A;  3UPO A;  3LR5 A;  3PBO A;  2PR5 A;  4GS9 A;  3GQZ A;  1PZP A;  3VP2 A;  4OPR A;  1O07 A;  3PBR A;  2XSS A;  2WAD A;  3PXP A;  5HPI A;  1N9L A;  4JF5 A;  1TD5 A;  3B47 A;  4RA7 A;  2XFS A;  5E2E A;  4A5R A;  1K55 C;  2PRF A;  2FFY A;  2G2W A;  3LR3 A;  5CTN A;  3UE6 A;  5U47 A;  1PFL A;  2IA2 A;  4DE0 A;  1HLU P;  1GA9 A;  3IWI A;  3RJU A;  2WGW A;  1A0K A;  4KQR A;  3ITA A;  4C3Q A;  2Z6D A;  5G4Z A;  3NY4 A;  2A2L A;  4BMW A;  2IWD A;  1T19 A;  3LEQ A;  2ZQC A;  2HZ5 A;  1YKD A;  4GDN A;  4O7D A;  4PHT A;  4HBT A;  5F1G A;  3IXD A;  3BY9 A;  3IF6 C;  3EQU A;  5FAS A;  3LUQ A;  2IWC A;  4I3J A;  5AQ7 A;  2I9V A;  3LI9 A;  4LV0 A;  1Z09 A;  4EU0 A;  3C8C A;  1DY6 A;  3QHY A;  5DJT A;  2EX2 A;  1D06 A;  5GHY A;  3TG9 A;  2R9X A;  4FD8 A;  2QYB A;  4YFM A;  2PDR A;  3VSL A;  3GEC A;  1P97 A;  1MPL A;  1OT9 A;  1ESU A;  2P08 A;  5GHX A;  3C5A A;  4N9K A;  3HL9 A;  5HWV A;  2Y91 A;  2BTF P;  3T50 A;  4MN5 A;  1G28 A;  1S4S A;  3ULF A;  3ZNT A;  3M6H A;  3SH7 A;  1MWU A;  5M19 A;  5G18 A;  3UNW A;  2A24 B;  1PW1 A;  3LI8 A;  4KZB A;  5EM1 A;  5IHV A;  2HPB A;  4S2L A;  2PR6 A;  4PKY G;  3N6I A;  1GHP A;  4OQH A;  2O99 A;  2JCH A;  5JYO A;  2ZC3 B;  3IWQ A;  4K08 A;  3NDG A;  4JXW A;  2VLG A;  5FQI A;  5J8X A;  2ZM2 A;  3PTE A;  3T1Q B;  3T4L A;  5J3W A;  3NEC A;  1K57 A;  5L10 A;  5E43 A;  4HQA A;  3BRM A;  4H6J A;  1NXY A;  3TJZ C;  3F1P B;  3V3R A;  3IH8 A;  4M4X A;  3C2W A;  1Y4O A;  4ZTK A;  4PKY A;  4UHU A;  1L0D A;  5GL9 A;  3IBR A;  2X71 A;  3CUE C;  5HAI A;  2V0W A;  3FPW A;  5CER A;  4D2O A;  5K5B A;  4N1X A;  3BFD A;  2JKT I;  4BBU A;  1GHI A;  4HBU A;  5EV0 A;  2JKT M;  1YAX A;  3EEH A;  3G31 A;  3L7H A;  2W0N A;  1KGE A;  2E8J A;  4JPM A;  1PRQ A;  1CI8 A;  4C6Y A;  4WMC D;  2B5R A;  2Y2P A;  3EGX C;  3M2K A;  4CLC A;  3PAG A;  1W79 A;  1ACF A;  3BEB A;  1L2S A;  2O9A A;  2PD7 A;  2HJ9 C;  2ZMV A;  3OCL A;  3ZDJ A;  1MWR A;  1JWZ A;  4QHC A;  4QJG A;  3IXH A;  4WUJ A;  4KQQ A;  1KVL A;  1FSY A;  1P9W A;  4HP4 A;  1DP6 A;  4X53 A;  2EX8 A;  2GNX A;  4OP5 A;  5M18 A;  2QMI A;  5HW3 A;  4RX2 A;  4X25 A;  1S1Z A;  1NYM A;  3UDF A;  4Y13 A;  4HY8 A;  5A91 A;  2XF3 A;  1WYC A;  2JKG A;  3E4O A;  5HD5 A;  2HP9 A;  5EVI D;  3G34 A;  3T4J A;  4DE1 A;  4B93 A;  1TS6 A;  4EQI A;  2P74 A;  2JN7 A;  5F5Y A;  2XGN A;  3D9Y A;  3MKF A;  4FUW A;  4LV2 A;  4Q0H A;  4BL3 A;  1W5D A;  1EWZ A;  5FI6 A;  2V8F A;  3VMA A;  5EVI C;  1PYY A;  2B95 A;  5DVA A;  1SKO B;  1S4R A;  1NRF A;  2PBD P;  3S22 A;  5FDS A;  3UE0 A;  3AGD A;  3IXB A;  4IBX A;  3UB5 P;  5EEC A;  4NXE A;  4DN0 A;  2GDN A;  4HOI A;  3Q81 A;  3ZG5 A;  4MBF A;  3ITB A;  2Y2N A;  4WL9 A;  4EEU A;  4JXG A;  2VKS A; 
#chains in the Genus database with same CATH homology
 1XFQ A;  2YKF A;  3ICY A;  5IU1 A;  3OOV A;  3TW8 A;  2W1R A;  4UEY A;  2D01 A;  2BAS A;  3UB7 A;  4P6Z M;  3CAX A;  4JGR A;  3T4Q A;  3EEA A;  5J4E A;  4BBV A;  4BWI A;  2VA0 A;  2HGV A;  3F1N A;  3EOI A;  1P0Z A;  4MDZ A;  4IJG A;  3LR0 A;  3MF0 A;  4LPZ A;  3EWK A;  4R3A A;  3E98 A;  2D02 A;  4HNB A;  4ETX A;  4MMN A;  3IS2 B;  4XT2 B;  4Y3I A;  3PHY A;  2WKP A;  4L0L A;  2ZOI A;  4NEE D;  3U2A A;  3R7W A;  5IS1 A;  4XT2 A;  4R70 A;  2JKR M;  2L0W A;  2FH5 A;  4WEJ A;  4H6J B;  3P01 A;  2A24 A;  3NJA A;  2ZOH A;  3KO6 A;  3D72 A;  3UE3 A;  3MR0 A;  4ETZ A;  1S67 L;  5F6A A;  4ARZ B;  5MC7 A;  1F98 A;  1NLZ A;  2PHY A;  4JGQ A;  2PYP A;  3C30 A;  2V1B A;  3PBT A;  2VX8 A;  4EEP A;  3PR6 A;  3MXQ A;  4L9G A;  4DMZ A;  1NWZ A;  4NKP A;  4UQI S;  5J7E A;  2FZ0 A;  2KX6 A;  2GX5 A;  3PBQ A;  2OAQ 1;  1ZTU A;  1STZ A;  1DRM A;  3BQ8 A;  3LIE A;  2W3F A;  3BY8 A;  1LSW A;  2OAP 1;  2QWS A;  3KSI A;  4I5S A;  1OTB A;  3CLO A;  1G6O A;  4HH2 A;  3EQV A;  4HHD A;  4GLQ A;  3T4K A;  3BW6 A;  3R4K A;  5FL3 A;  2HV1 A;  2L4R A;  5HSQ A;  5A8B A;  1LSV A;  5TJJ A;  3T4T A;  3KYQ A;  4GCZ A;  2WKR A;  4JGP A;  3UMD A;  3R7W B;  4R38 A;  2W27 A;  3MQQ A;  3RFB A;  1OJ5 A;  3CWF A;  1XJ4 A;  2WKQ A;  4GS9 B;  1T1B A;  1UGU A;  4KQO A;  4BBT A;  4L9F A;  3FC7 A;  2HJE A;  2NUT C;  3H9W A;  3HCY A;  5CX7 A;  3H7W B;  3OLO A;  2HF6 A;  2VKS A;  2XRN A;  1S1Y A;  4I3A A;  1H8M A;  1V9Y A;  2ZMF A;  4HJ6 A;  4LRZ E;  4HP9 A;  4EET B;  3PBS A;  5HDC A;  1XJ3 A;  4B9O A;  1BYW A;  3F1O A;  4I39 A;  3K2N A;  4I3I A;  4YWZ A;  4E04 A;  4EW7 A;  3HJI A;  2XRO A;  3TE8 A;  1XJ2 A;  2M7U A;  3PYP A;  4HJ3 A;  3F1P A;  4HH3 A;  1ODV A;  4CLC E;  2XA7 M;  3PBN A;  4ME4 A;  2KDK A;  3LR5 A;  3PBO A;  5F69 A;  4LRX C;  3K3C A;  2PR5 A;  4GS9 A;  3H82 A;  1TS8 A;  4YNR A;  4EUV A;  3OC2 A;  1S66 L;  3D3O A;  3ZYT A;  3A0S A;  4IUH A;  5DKK A;  4CQH A;  2VV7 A;  2CMN A;  3NOU C;  3PBR A;  2P04 A;  1IOU A;  2XSS A;  3PXP A;  5HPI A;  1N9L A;  3F1N B;  1GSW A;  2VGL M;  3JVV A;  1OJG A;  1TD5 A;  3B47 A;  3LR4 A;  1ZHH B;  2J3W A;  1XFN A;  4Q0J A;  2R78 A;  5HDS A;  4EES A;  4HI4 A;  3DBA A;  3A0R A;  2NUP C;  4PAU A;  1NLY A;  3LR3 A;  5LBR A;  2JHE A;  2JKR I;  3KYZ A;  3UE6 A;  3NOP C;  4FOF A;  2IA2 A;  4IUK A;  2VZW A;  2B18 A;  1N9O A;  2KOI A;  1T1C A;  2M7V A;  1LL8 A;  1W63 Q;  1TS0 A;  4FSF A;  2Z6D A;  5G4Z A;  3TRC A;  3B33 A;  5AVF A;  2A2L A;  3T4O A;  4BMW A;  3RTY A;  1T19 A;  2W3H A;  4KQD A;  4F3L B;  3KSH A;  1YKD A;  3CUE A;  2M1C A;  4O8G A;  4ZRR A;  4QPR A;  5DKL A;  4PHT A;  1MC0 A;  1F5M A;  3BY9 A;  2W1T B;  2G7U A;  3A0V A;  3EQU A;  4CLC D;  1OPX A;  3LUQ A;  4I3J A;  1WA9 A;  3IS2 A;  2I9V A;  3LI9 A;  2W3D A;  2GZA A;  4OOL A;  1VB6 A;  4EU0 A;  3C8C A;  4BJP A;  5DJT A;  2LB5 A;  2EA9 A;  3K3D A;  1D06 A;  4GHI A;  3LIA A;  3W2Z A;  4P6Z S;  4LLO B;  2QYB A;  5TBM A;  2QHK A;  3KSG A;  3LID A;  2PDR A;  3C38 A;  3GEC A;  3BWL A;  1P97 A;  5AVE A;  4CLC C;  4WEL A;  1OT9 A;  3HJK A;  3B42 A;  1LT0 A;  2P08 A;  2W1T A;  2DMW A;  1NRJ A;  3VE4 A;  5HWV A;  3EGD C;  4II7 A;  3T50 A;  4OOM A;  1X0O A;  4MN5 A;  3S7O A;  1LSX A;  1G28 A;  1KOU A;  3JVU A;  4KUO A;  4WF0 A;  3S7P A;  1S4S A;  3BQA A;  3UB9 A;  3ULF A;  2K31 A;  2W3G A;  4MCW A;  3SW1 A;  2EWV A;  1EW0 A;  2A24 B;  2OOL A;  4DJ3 A;  2V0U A;  3LI8 A;  3H7W A;  2P7J A;  3E4P A;  5HZH A;  5HDD A;  1MZU A;  4EQ1 A;  2PR6 A;  4PKY G;  2QKP A;  5KSH A;  1D7E A;  2QJ7 A;  4NXB A;  2O99 A;  1MKM A;  2L1M A;  4Q0I A;  1DP8 A;  4K08 A;  3OBF A;  4YOF A;  4LRY C;  4Y2F A;  2VLG A;  2O9C A;  2VJW A;  2OWH A;  3GDI A;  5HPF A;  4R6L A;  3ZQ5 A;  2MJ6 A;  5DFY A;  4Z1W A;  3T4L A;  5J3W A;  2PD8 A;  2QJ5 A;  2VV8 A;  2V1A A;  2KLI A;  3LIC A;  1OTA A;  4L9E A;  2EWW A;  4HQA A;  2VGL S;  4H6J A;  1DP9 A;  2K2N A;  3NOT C;  1GSV A;  4KUK A;  4O0P A;  2YKH A;  3TJZ C;  2W3E A;  2ZBB A;  3MQO A;  5HWT A;  3F1P B;  1W63 M;  2PT7 A;  5HD3 A;  4M4X A;  3C2W A;  5DJU A;  4PKY A;  3UB6 A;  1YSQ A;  3IBR A;  2B02 A;  4CLC B;  3CUE C;  3KSF A;  3P7N A;  2V0W A;  3FPW A;  3MFX A;  5EFW A;  3LIB A;  3IBJ A;  4I38 A;  5K5B A;  2INW A;  1JNU A;  2JKT I;  3BJN A;  4BBU A;  2K7S A;  5C5K A;  2JKT M;  4HIA A;  1YAX A;  3EEH A;  2W0N A;  3UME A;  4NXF A;  2J3T D;  4WN5 A;  2LB9 A;  1T18 A;  1GSX A;  1OTD A;  3LIF A;  1VHM A;  3E0Y A;  2H28 A;  3G6O A;  2VV6 A;  5IT5 A;  1P9R A;  4IHQ A;  3T4S A;  2J3T C;  1N9N A;  4NXG A;  3EGX C;  4UQI M;  2O9B A;  4CLC A;  3F1O B;  3LFV A;  3LYX A;  3S7Q A;  2O9A A;  3VE3 A;  3VOL A;  1H3Q A;  2PD7 A;  2HJ9 C;  2ZMV A;  2J80 A;  3V67 A;  3OCL A;  4GW9 A;  2O0Y A;  3OCN A;  4Y5F A;  2GJ3 A;  4WUJ A;  3FPV A;  5HWW A;  1YSP A;  3CIT A;  3UB8 A;  3E4Q A;  1P9W A;  5TBM B;  5DFX A;  4G3W A;  4HP4 A;  1UWN X;  4AFI A;  5F68 A;  4GJ4 A;  1DP6 A;  4RQ9 A;  1XJ6 A;  1IFQ A;  1Y28 A;  5I5L A;  2GNX A;  1S1Z A;  4WLA A;  4HY8 A;  3MMH A;  5DF9 A;  3E4O A;  3H82 B;  5HD5 A;  3NHQ A;  1F9I A;  3MQ0 A;  3T4J A;  4B93 A;  4HJ4 A;  4JGO A;  1TS6 A;  2V9A A;  3O5Y A;  5AJG A;  5F5Y A;  2JN7 A;  2PYR A;  3MJQ A;  5L8M A;  4Q0H A;  4G3K A;  4MN7 A;  3KX0 X;  4GHI B;  4F3L A;  1UWP X;  4DJ2 A;  4EER A;  2OWJ A;  1OT6 A;  2XA7 S;  3FG8 A;  1OTE A;  1S4R A;  1OTI A;  4ARZ A;  2VEA A;  4G3V A;  5KIZ A;  4EXO A;  5G4Y A;  1TS7 A;  1TF1 A;  4O01 A;  4WEK A;  5HL6 A;  3VV4 A;  1T1A A;  1V9Z A;  4NXE A;  4DN0 A;  4HOI A;  2Y79 A;  2Y8H A;  3S7N A;  3RH8 B;  4WL9 A;  4MN6 A;  4EEU A;  3CI6 A;  2Z6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...