3EOIA

Crystal structure of putative protein pilm from escherichia coli b7a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
LSRTVHHQQTAEITQQAADFIRYMNAINDYLYQHPERRAAGGQLTSAQLGLPATKNVSHLISQQRVFVWAKEKPGLMGALLEQSGDSALLARVENGRLLDTHGRRISITLPAVIPDQVIIWMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilM
publication title Crystal structure of an uncharacterized protein
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.360 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eoiA00
3EOIA
chains in the Genus database with same CATH superfamily
3S7NA 4FSFA 1STZA 3PBTA 2M7UA 4EUVA 5CECA 2OLUA 2A2LA 3E2KA 5I5LA 3W8KA 5F6AA 2XD1A 2OV5A 3V67A 3R4KA 2EFUA 4DXCA 4HESA 2Z6CA 4KZ3A 3UPPA 3HUMA 1FOFA 4EBLA 1K57A 3A0SA 2G2UA 5FQ9A 4X53A 4U0XA 2W3HA 4K0XA 4RYEA 1OTBA 3MZFA 3HL9A 2O9BA 2HJEA 3IBJA 1YLTA 1T1AA 3BFGA 4KQDA 1N4OA 3I7JA 1K55C 1PZOA 1NJ4A 3MJQA 3DTEA 3GRJA 3A3IA 5FDHA 4R4RA 3OCLA 2ZQCA 5EOEA 4DXBA 2VX8A 3G35A 3BEBA 4BMWA 1W7FA 1KE0A 3OPPA 2ZC5B 2B95A 5HARA 4CQHA 2HDUA 2D01A 2KDKA 1K38A 4Q8IA 4I5SA 4Y0UA 5KIZA 1IELA 3M2JA 1OTDA 1ODVA 4HEFA 3E2LA 1NRJA 2XRNA 3PTEA 4LRZE 3T4SA 5EE8A 3KYZA 4I39A 1IKGA 1PNEA 5GLDA 3LI9A 2V0UA 5EV0A 1K25A 4HQAA 1IOUA 2GJ3A 2PU4A 1QMEA 4DJ3A 2QPNA 4GLQA 3IX4A 1WYBA 5EVLA 4DKIA 1K6RA 4E6XA 3LUQA 3H7WB 1G5UA 2EX6A 2WAEA 3G31A 2G2WA 3IX8A 3TE8A 1L0EA 3TSGA 3WRTA 3G2YA 5F83A 2L1MA 3DTKA 1GSXA 5A90A 4YNRA 2VLGA 3UE6A 3Q7ZA 4GDNA 4RX3A 2FZ0A 4FH4A 2W1RA 3RH8B 4P85A 2VV6A 1W8YA 2XQZA 2W3EA 1JWPA 3B47A 1V9ZA 3LCEA 3ZG0A 3EOIA 4PAUA 2GZAA 2R9WA 3U4LP 1DJCA 4XUZA 3FPVA 3H82A 1DP8A 1KDSA 3H82B 1PRQA 2WKPA 1BSGA 3DBAA 5HD3A 2OWJA 1IEMA 1LL8A 5CERA 4I3IA 3VMAA 2P7JA 3GMWA 3IF5A 4OQHA 2Z6DA 3QNCA 4FTXA 2K31A 2XK1A 5A93A 3DW0A 3NIAA 1E3UD 4OH0A 4R0QA 3C4PA 3O87A 5CEBA 1P9RA 4KQQA 4JF6A 4L9FA 1ZTUA 3W4OA 2JN7A 1L0DA 1QMFA 3IH8A 2K2NA 3BWLA 4ZTKA 1YLZA 3F1NA 4GOGA 3F1NB 2IWBA 4GB7A 4EU0A 3P98A 2OAQ1 2Y79A 3BFFA 1Y28A 1D06A 3IBRA 5IU1A 3SOIA 3HUOA 4L0LA 1S0WA 2VGKA 1OTIA 1S66L 5HL1A 1SDEA 5GHYA 1K56A 4C6YA 1IYSA 4B88A 3UMEA 2ZMAA 4WYYA 4PM8A 1K55A 4WELA 4HJ4A 3S22A 2V20A 4A5RA 1GHMA 2R9XA 2HP5A 2WGIA 5KSCA 5TBMA 4YOFA 1TDGA 4BJPA 4H6JA 2PRFA 1N9LA 2HGVA 3UB6A 4H6JB 3H9WA 2XGNA 4MN7A 3VOZA 4Z9QA 5AJGA 4WEJA 4MNRA 1MZUA 3P7NA 3OBFA 4JXGA 1BUEA 5AQ9A 4LRYC 4M3KA 3PHYA 3IXHA 1MWSA 4GDBA 3W2ZA 3CHWP 2XA7M 2PR5A 3RTYA 4KUOA 4EBPA 3O86A 3HLFA 4Y13A 3SZTA 1TS7A 3IXGA 1XFNA 1CI8A 5HWWA 1MXOA 3MMHA 3T12B 4PKYA 2RL3A 2WKHA 1MC0A 4FCFA 4UEYA 1YSQA 2VGLS 2OAP1 4N9LA 1PYYA 2XFTA 1Q2PA 1LSVA 3EGDC 3CJMA 2O99A 5E43A 1I5QA 1SZVA 5E2HA 4O8GA 5KSHA 4PHTA 3MFXA 4I38A 3PBQA 1HZOA 4EEUA 3VOLA 2P9VA 2H0TA 4GD8A 2B02A 2P9VB 5KMWA 3JYIA 3UDIA 5CTMA 3VP3A 4QPRA 4X55A 4XUXA 3B42A 5J4EA 2INWA 2ZJ9A 1AWIA 4S2MA 4S2OA 3S1YA 2M7VA 2DRWA 1I2SA 1ERMA 1DP6A 2ZM0A 4NXEA 5CHMA 5A92A 1YLPA 2R78A 2EWWA 2W3GA 1LSWA 1JNUA 1SKFA 3HLGA 4QY6A 2CC1A 1XJ2A 3MZDA 3CLOA 3B33A 4HIAA 4S2LA 3VSLA 2V1BA 2HDQA 4HNBA 3S7PA 1MKMA 3HLEA 2AVXA 4LRXC 3LIAA 1N9OA 2WK0A 3PAEA 4IBXA 2DMWA 3MQQA 4MLLA 4S2IA 1XJ4A 1KGGA 4JGOA 1L0GA 3E98A 4R23A 3SH8A 1BZAA 3K3DA 3ITBA 1YLJA 2KX6A 4BWIA 1BTLA 2H10A 3QP4A 4KG6A 3ISGA 5AVFA 4ARZA 3HJIA 4FH2A 1DJBA 2ZOHA 4AFIA 4ARZB 3NULA 4KENB 2XF3A 4YFMA 1WYCA 2EX2A 3T4LA 4WZ5A 4CLCD 1KE4A 4JF5A 3RFBA 4JGQA 1YQSA 5AVEA 4OPYA 5DTSA 4JBFA 1OTEA 3N4IA 2ZD8A 5A91A 2HDRA 1MBLA 5L2FA 1WA9A 2QWSA 4IHQA 2OOLA 4O7DA 1TD5A 5GL9A 5HDCA 3D72A 4MCWA 3UO9A 4LV0A 1UGUA 2A24A 2A24B 4RA7A 3N8SA 2QZ6A 3P01A 2UWXA 3T4TA 5DF8A 4DMZA 1NYYA 2JKFA 2WKEA 2ZQ9A 5G4YA 2O0YA 3LFVA 3OOVA 5FQQA 4P0MA 2VZWA 2JKGA 1LL5A 1LLBA 1IKIA 3HLWA 2WGVA 5DKKA 4RVAA 3C30A 4ESPA 5TR7A 5FQJA 2HDSA 3O3VA 2ZL1B 1D7EA 2DNSA 3T1QB 4WLAA 5C5KA 1XP4A 2XFSA 3F1OA 1F9IA 5HFOA 3F1OB 2K7SA 2FH5A 4GZBA 2IWDA 5TFQA 2BLSA 4FOFA 4KZ5A 5TJJA 3CPTA 1LL9A 2Y2QA 1N9NA 4LV1A 3CPTB 1F2KA 3UY6A 4OONA 2GX5A 3LIEA 2OWHA 4ZJ3A 4HHDA 3SS5A 3KO6A 3OZHA 3ZCZA 3C5AA 4LV3A 3LICA 3N7WA 3T4JA 4DN0A 4GCZA 4KZ9A 3NDEA 4OKPA 1YAXA 4N92A 4IUKA 1NXYA 3UE1A 1E3UA 1NYMA 3LR0A 5DTTA 1FIKA 2CMNA 1IFQA 4YWZA 5MC7A 1NWZA 4LV2A 3QP8A 1FCMA 4ZJ1A 3ZG8B 5AQ7A 3QP2A 3AGDA 4WEKA 3BQAA 2PYPA 4CLCE 3DTIA 3N8RA 3LGOA 2PYRA 5EVID 1CK3A 4EXOA 4EERA 1S67L 4GNUA 3TRCA 2Y2IA 1ES5A 1H3QA 2A49A 3T1SA 4HP9A 2ZOIA 4OQIA 4E3KA 1RGYA 5IT5A 4LCMA 1H8MA 2ZQ7A 3FZCA 3D3OA 3CG5A 2KLIA 1Z09A 2VV8A 2JC7A 1VETA 1MWRA 1VETB 3BY9A 5FI7A 5HWVA 4S2KA 1OJGA 3FC7A 2XLNA 3VV4A 4R3AA 3EQVA 3FV7A 5JYOA 5DJUA 2EX9A 2VKSA 1HTZA 5J8XA 5EOOA 3ZG5A 1JWVA 1DJAA 3NBLA 3WS5A 3TG9A 4U3TA 4X1LA 4LENA 1AXBA 3LR4A 4OPRA 2Y91A 2H5SA 2J3TD 3BYDA 3BFEA 2PD8A 1E4DA 4IEDA 2X01A 1BYWA 3S7OA 1PIOA 3LY3A 4ZAMA 3WWXA 1TS8A 3ZNTA 4DDSA 2ZBBA 3IWOA 3JVVA 2WKQA 3LI8A 3ZHHA 1KVLA 2J7VA 1ZHHB 2EWVA 5CGSA 5KZHA 3LEQA 4E3MA 3IWQA 4EBNA 1FILA 4RX2A 2V8FA 4OLGA 4Y15A 3JPUA 2VGJA 3MQOA 3T1RA 3KYEA 3VE3A 1FCOA 3AGFA 5J7EA 4Z1WA 1MY8A 1YSPA 5HSQA 2Y8HA 2XA7S 5HWTA 4QU3A 3M6BA 3MXRA 1VEUA 1VEUB 4WF0A 3HJKA 4DE0A 2P08A 4R6LA 4ZDXA 4E3NA 2HV1A 1T18A 4UHUA 4WL9A 5M1AA 1ONGA 2YKHA 1GHPA 2VJWA 5A8BA 4DDYA 3OC2A 3E4QA 4MBKA 2H28A 2WGWA 3Q1FA 3HLBA 3VP4A 1KE3A 4JXSA 5HDSA 2C5WB 5E2FA 3PBOA 4NKPA 4I3AA 1YMSA 1CF0A 4PM7A 5G4ZA 3BLSA 4LCLA 3C4OA 2Y2NA 1ERQA 3FPWA 5LBRA 3SH9A 3PBNA 3BRMA 3RJUA 1NY0A 4KQRA 3BFCA 4HJ6A 3K2NA 3BFDA 4B9OA 1N9BA 4UAAA 4GW9A 2Q9MA 3UN7A 1VM1A 2X71A 1XX2A 5FASA 4FD8A 1XFQA 2V9AA 3PAGA 4P6ZM 4WZ5C 5TBMB 4IUHA 4HH3A 2EX8A 5JYPA 2PU2A 3IHAA 4HY8A 1XGJA 4BL2A 5L8MA 2VK3A 4Q0IA 3HVFA 4DJ2A 3V3RA 4BBTA 4X1MA 4N9KA 5FQKA 2PT7A 1PW8A 2M1CA 4ETZA 3PYPA 1K54A 5E2GA 2W1TA 5FAOA 5F82A 1KDWA 3Q07A 4WUJA 2PBDP 2W1TB 2ZM8A 2O9CA 3WS1A 1PFLA 1P0ZA 2XD5A 4NXBA 1G6AA 1ONHA 2L4RA 1HLUP 3OPHA 2J80A 4WM9A 3U2AA 3EGXC 1XXMA 4U0TA 4BLMA 1LHYA 1GA9A 3BM6A 3NOUC 2Y55A 1TS6A 4QD4A 1H8YA 3PXPA 1PWDA 1OMEA 2QKPA 4EQ1A 1PW1A 3CZDA 4Y7PA 5M18A 4CLCA 4WN5A 5FDSA 3FYZA 4P6BA 4CLCB 1BT5A 3WRZA 5U47A 1PZPA 4S2PA 3A3FA 4NEED 4DE3A 4KZAA 5TGFA 1RCJA 5GHXA 3A3JA 3OLOA 4B4XA 1J3WA 3M2KA 3VOYA 4YINA 3S7QA 2JKTI 1G68A 4PMAA 4C75A 4IBRA 2ZQ8A 3LIFA 2EFXA 4BQMA 1RGZA 3WS0A 3HLCA 1IYOA 1FCNA 3BJNA 5EVEA 4II7A 4PKYG 5GLBA 4X69A 3NI9A 2Y59A 3MXQA 4OP5A 4QWOA 2V8CA 3C7VA 3IF6A 3KSFA 2V2FF 3IF6B 2G7UA 4E3OA 4HOIA 4IVIA 2GDNA 4JF4A 4WZ4A 4KZ8A 3UMDA 3RXWA 3DTMA 4KZ4A 3ZVWA 1K4EA 4GN2A 3VFFA 5EUAA 3SH7A 3OPRA 5FL3A 3VE4A 2EXBA 3PBSA 1BLCA 4ID4A 4BBVA 1KOUA 1SCWA 3K3CA 5DKLA 4MN6A 4X56A 3PR6A 2BG1A 2L0WA 4ZRRA 3FG8A 3VP2A 3ZNYA 4D60A 5FQMA 3ZVTA 4BBUA 5FEFA 4LPZA 2ZM2A 3NC8A 3QP1A 3CWFA 1S4RA 5L09A 5EPHA 3BQ8A 2XSSA 1L3LA 1SKOA 3UPOA 1BLPA 1NZOA 1T19A 3NCKA 1KGEA 1T1BA 4HP4A 2Y2MA 1TEMA 4MMNA 1Y54A 3MSHA 5CX7A 5HAQA 4LGWA 4K91A 3HCYA 5BOHA 1FSWA 3Q81A 3ZFZA 1VHMA 2WZXA 4E3JA 3L9KA 4JLFA 3CAXA 1LI0A 1SDNA 4NG2A 4OPZA 3GSGA 1M40A 4L9EA 3HREA 4BL3A 2W0NA 5EVIA 4E3LA 3TOIA 5HL6A 1K0KA 3EWKA 3OPLA 5EVIB 1JVJA 4PM6A 3Q7VA 4UA6A 4S2NA 4PM9A 4MEZA 3Q7VB 2JKTM 3UPNA 1TF1A 3BW6A 4B93A 5FI2A 1G28A 1MWTA 3ZG9B 4ETXA 2XH9A 4HH2A 2J9OA 5L10A 5EM0A 1MKIA 1S6RA 3G30A 3VP1A 1F98A 3WS4A 1GCEA 4JPMA 2J9PA 5I94A 1U60A 2QJ5A 1ZG6A 2Y2OA 1YKDA 3KX0X 1BLHA 3UB7A 4GKUA 2PD7A 1TS0A 1W5DA 3G34A 1XKZA 1CQAA 3KSGA 5E2EA 1YPRA 2KOIA 2MJ6A 3B3XA 1NRFA 4CPKA 3FWLA 3O5YA 5HAPA 1ZC2A 2FFYA 2X02A 2HJ9C 3MQ0A 1I2WA 2GNXA 4MDZA 2HPBA 3NOTC 3LO7A 1VQQA 5FQIA 5HAIA 1KVMA 4KZ7A 4NXFA 3O88A 4Y2FA 5F1GA 1ACFA 3A0VA 4WMCD 1ALQA 3V5MA 4EQIA 1RP5A 4MBHA 4HI4A 4F94A 3GVBA 3E4OA 1FSYA 4KQOA 1EI5A 4DRTA 2Y2HA 4G3VA 5CHUA 5GLAA 1TDLA 2J3WA 3SS4A 1ES4A 1VB6A 4H8RA 2W3FA 1K4FA 1EWZA 1W63Q 4KG2A 5DF7A 4S2JA 3UB8A 4GJ4A 4EEPA 1CJFA 4KZ6A 5FEGA 4EUZA 1XJ6A 3LIBA 2IWCA 3G32A 3RXXA 3JVUA 4E3IA 3C8CA 2B18A 4R38A 2NUTC 2A3UA 1T1CA 3LIDA 1Q2QA 2QMIA 3SW1A 1K54C 5DFYA 3V50A 4Q0HA 4X68A 3MF0A 4EETB 2V1ZA 5FAPA 2XEPA 3QP6A 2E8JA 4JKTA 2PDRA 5M19A 4ZBEA 4OP8A 2Z2LB 4GS9A 3E0YA 2Z2MB 1LT0A 4GS9B 3ZG7B 3LEZA 3QP5A 5FI6A 2WAFA 1ES3A 1H0MA 3LYXA 5HD5A 3NHQA 1C3BA 1S4SA 2Y2GA 5CTNA 3H7WA 3L7HA 4OOLA 5J3WA 1PI4A 4CLCC 3NJAA 4JXVA 4JXWA 3S4XA 4BD0A 4C3QA 2ZC3B 2V0WA 1A0KA 3Q82A 1NZUA 3LY4A 1NLZA 4UQIS 1GSVA 5DVAA 4MBFA 2QHKA 1S1YA 1CI9A 3T50A 4P6ZS 1OT6A 3N8LA 1NLYA 1LI9A 3ITAA 2XDMA 4N1XA 3EEHA 1FR1A 3HBRA 4R1GA 2B5RA 2PR6A 2VV7A 1L0FA 3IXBA 3TJZC 3IF6C 4WBGA 3VFHA 4D2OA 3NOPC 3GV9A 1OTAA 3NECA 3F1PA 5HPFA 4OQGA 3MXSA 3F1PB 5CRFA 2QYBA 4F3LA 4F3LB 1XJ3A 5HPIA 2P04A 4XXRA 1H5XA 1S1ZA 4RQ9A 3ZDJA 4DE2A 3GR2A 3UDFA 1PI5A 2JCHA 5CEDA 2PAVP 2WGWB 3CUEA 1O07A 1O7EA 1JTDA 4DE1A 3UB9A 1SHVA 4G3KA 3QNBA 2BTFP 1BULA 3VP0A 4Y0TA 5F5YA 3MKEA 2NUPC 1L2SA 5F69A 3HUNA 4BENA 2Q9NA 3GECA 5HX9A 2HF6A 3W4QA 5EECA 1XGIA 3AGEA 4KZBA 4QJGA 2ZMVA 1HVBA 4NETA 3P09A 4X6TA 4OOMA 3FKVA 3WS2A 2VA0A 4G3WA 2WADA 4UQIM 4EWFA 2EA9A 3C38A 2Q0OA 3FKWA 3IT9A 1YLYA 2VEAA 1ZG4A 3DWZA 5CGXA 1UWPX 1WE4A 2UV0E 2FFFB 3UDXA 1KGFA 5EVIC 3V39A 1YM1A 4QB8A 3IX3A 5FATA 2Y2KA 4HBTA 5FA7A 1CEFA 3DWKA 3M6HA 4OVDA 3BY8A 3C2WA 3ZYTA 4S2NC 3UE0A 3IQAA 1GSWA 4PM5A 2Y2JA 4XT2A 5EM1A 4XT2B 4ZJ2A 1HD8A 3N6IA 3KSHA 2ZQDA 1JWZA 5DFXA 1OT9A 3CMZA 1JTGA 5FAQA 3ZQ5A 2YKFA 4N1HA 1UWNX 3BLMA 2JKRI 4EV4A 2ZLYA 3NDGA 3T4QA 1XA7A 3HLDA 1P9WA 1W63M 2E8IA 2QJ7A 3BECA 4O0PA 1YT4A 2ZC6B 2J3TC 2ZC7A 3MZEA 3IWIA 5CHJA 1ESIA 2ACGA 3D4FA 4Q0JA 4OPQA 3MBZA 2IA2A 4E6WA 4Y5FA 5CGWA 2OLVA 2XR0A 1MPLA 3LR3A 4IJGA 3T1XA 4Y0OA 1IYQA 3NY4A 4Y3IA 1X0OA 4P87A 3OCNA 4EESA 4B4ZA 1MWUA 1E25A 2Y2PA 4O01A 4DF6A 2JBFA 2WUQA 4IVKA 2JHEA 1H8ZA 1J9MA 2ZQAA 1ES2A 1K57C 2WYXA 5AQBA 3GTCA 4PPRA 5CXWA 2V1AA 2WZZA 4QHCA 3MS6A 4GHIA 2OSUA 3ZGAB 4GHIB 1CEGA 2I72A 1W8QA 1K56D 1XA1A 2W3DA 1GHIA 2ZMFA 5DF9A 3C7UA 5FSRA 1DP9A 2LB5A 5EFWA 4GD6A 2HZ5A 2LB9A 5G18A 1OPXA 3GQZA 2WKIA 3T4KA 2ZC4B 5HDDA 4K0WA 2Y4AA 2DCFA 3IXDA 2WKRA 1YMXA 1LSXA 4BD1A 4WMCA 1EW0A 4FUWA 3UB5P 2C6WB 3G6OA 4CJNA 3MKFA 3MR0A 2EXAA 2PHYA 3IHBA 3E4PA 4R70A 1SKOB 4R4SA 5AQAA 3ICYA 2H0YA 1P97A 3V3SA 2J8YA 3T4OA 3R7WA 3W4PA 3EEAA 4JGRA 3A3EA 1PWCA 1FR6A 2O9AA 3R7WB 5D3OA 2JKRM 2HP9A 2I9VA 5L07A 4QY5A 3TW8A 3MFDA 5DJTA 4LLOB 2W27A 4K08A 3A3DA 2VGLM 5F1FA 1W79A 1EROA 4L9GA 5HZHA 1OJ5A 1Z6FA 2PBYA 1D1JA 2BASA 4NK3A 5HW3A 4HBUA 4R3JA 1FQGA 3EQUA 4HJ3A 2Y2LA 4MN5A 5F68A 1TVFA 5IS1A 5K5BA 1G6OA 3ULFA 4JGPA 4KG5A 4I3JA 1DRMA 3CI6A 4OOYA 3LR5A 4E04A 1K6SA 3IS2A 4M4XA 4UA9A 4LFUA 3IS2B 4OLDA 3G2ZA 5GHZA 3DAVA 1M6KA 4Y17A 1XPBA 3SS3A 2P74A 1F5MA 4ME4A 3KYQA 2XROA 4NXGA 4UA7A 3PBRA 1ZKJA 1IYPA 3IH9A 5DTKA 1ESUA 3G4PA 3A0RA 3UNWA 3CITA 1Y4OA 3GDIA 4EW7A 3KSIA 1DY6A 1GA0A 4KUKA 1YLWA 2D02A 3VSKA 1PWGA 4R3BA 4X25A 2HP6A 3UE3A 3D9YA 2JE5A 1V9YA 2RCXA 2ZL1A 1BLSA 3CUEC 3QHYA 5GLCA 5IHVA 4OQ0A
chains in the Genus database with same CATH topology
3S7NA 4FSFA 1NLZA 1STZA 2R78A 2EWWA 2W3GA 4UQIS 4HY8A 1LSWA 1GSVA 5L8MA 1JNUA 3PBTA 2M7UA 2QHKA 1S1YA 4EUVA 4Q0IA 3T50A 2A2LA 1OT6A 4P6ZS 4DJ2A 1NLYA 5I5LA 4BBTA 1XJ2A 5F6AA 2PT7A 3V67A 3CLOA 2M1CA 3B33A 3R4KA 4HIAA 4ETZA 3PYPA 2V1BA 2W1TA 2Z6CA 3EEHA 4WUJA 2W1TB 4HNBA 3S7PA 2O9CA 1MKMA 4LRXC 3LIAA 1P0ZA 1N9OA 4NXBA 2PR6A 2VV7A 2DMWA 3TJZC 3A0SA 3MQQA 2L4RA 2J80A 1XJ4A 4JGOA 3U2AA 3E98A 3EGXC 3NOPC 1OTAA 2W3HA 3K3DA 3F1PA 5HPFA 3NOUC 2KX6A 1TS6A 3F1PB 4BWIA 1OTBA 3PXPA 2O9BA 5AVFA 4ARZA 3HJIA 2HJEA 2ZOHA 2QYBA 3IBJA 4AFIA 4ARZB 4F3LA 1T1AA 4KQDA 4F3LB 1XJ3A 5HPIA 2P04A 2QKPA 4EQ1A 3MJQA 1S1ZA 4CLCA 4WN5A 4RQ9A 4CLCB 3T4LA 3OCLA 4CLCD 3RFBA 4JGQA 5AVEA 3CUEA 2VX8A 4NEED 4BMWA 1OTEA 3OLOA 3UB9A 1WA9A 4CQHA 4G3KA 2QWSA 4IHQA 2OOLA 2D01A 3S7QA 2JKTI 2KDKA 1TD5A 5F5YA 5HDCA 3D72A 4I5SA 4MCWA 5KIZA 1UGUA 2NUPC 1OTDA 3LIFA 2A24A 5F69A 1ODVA 2A24B 1NRJA 2XRNA 3BJNA 3GECA 4II7A 4PKYG 2HF6A 3P01A 4LRZE 3T4SA 3MXQA 3T4TA 4DMZA 3KYZA 4I39A 2ZMVA 3LI9A 2V0UA 3KSFA 4HQAA 5G4YA 2GJ3A 1IOUA 4DJ3A 4GLQA 2G7UA 2O0YA 4OOMA 3LFVA 2VA0A 4HOIA 3OOVA 4G3WA 4UQIM 2EA9A 3LUQA 3UMDA 3H7WB 3C38A 2VZWA 2VEAA 3TE8A 1UWPX 5DKKA 3C30A 2L1MA 1GSXA 4YNRA 2VLGA 1D7EA 3UE6A 5FL3A 3VE4A 3PBSA 4BBVA 2FZ0A 3BY8A 1KOUA 3K3CA 3C2WA 3ZYTA 5DKLA 4MN6A 2W1RA 4WLAA 3RH8B 5C5KA 3F1OA 2VV6A 1F9IA 1GSWA 3PR6A 3F1OB 2L0WA 2W3EA 2K7SA 3B47A 2FH5A 4ZRRA 1V9ZA 3FG8A 3EOIA 4XT2A 4BBUA 4XT2B 4LPZA 4PAUA 2GZAA 4FOFA 3KSHA 3CWFA 5TJJA 1S4RA 3FPVA 3H82A 1N9NA 1DP8A 3BQ8A 2XSSA 3H82B 5DFXA 1OT9A 2WKPA 3DBAA 5HD3A 2GX5A 1T19A 3LIEA 2OWHA 2OWJA 3ZQ5A 2YKFA 1T1BA 4HP4A 4HHDA 3KO6A 1UWNX 1LL8A 2JKRI 4I3IA 4MMNA 3LICA 3T4JA 2P7JA 4GCZA 4DN0A 3T4QA 5CX7A 1YAXA 2Z6DA 4IUKA 2K31A 3LR0A 3HCYA 1P9WA 2CMNA 1IFQA 4YWZA 5MC7A 1W63M 1NWZA 2QJ7A 1VHMA 4O0PA 2J3TC 1P9RA 3CAXA 4WEKA 4L9FA 4L9EA 2W0NA 3BQAA 2PYPA 1ZTUA 4Q0JA 5HL6A 4CLCE 3EWKA 2JN7A 2IA2A 4Y5FA 2PYRA 2K2NA 3BWLA 4EXOA 4EERA 1S67L 3F1NA 3TRCA 1H3QA 3F1NB 2JKTM 3LR3A 4IJGA 4HP9A 2ZOIA 1TF1A 3BW6A 4B93A 4Y3IA 1X0OA 3OCNA 5IT5A 4EESA 1G28A 4EU0A 4ETXA 1H8MA 4HH2A 4O01A 3D3OA 2JHEA 2OAQ1 2KLIA 2Y79A 2VV8A 1Y28A 1D06A 3IBRA 1F98A 5IU1A 2V1AA 2QJ5A 3BY9A 4L0LA 5HWVA 1YKDA 3KX0X 1OTIA 1S66L 1OJGA 3UB7A 3FC7A 4GHIA 3VV4A 4R3AA 2PD7A 1TS0A 3EQVA 4GHIB 5DJUA 3UMEA 2VKSA 2W3DA 2ZMFA 5DF9A 3KSGA 1DP9A 4WELA 2LB5A 4HJ4A 5EFWA 2LB9A 2KOIA 1OPXA 2MJ6A 3T4KA 5HDDA 5TBMA 4YOFA 3O5YA 2HJ9C 2WKRA 3MQ0A 3LR4A 4BJPA 2J3TD 2GNXA 4H6JA 4MDZA 1LSXA 3NOTC 1N9LA 2HGVA 2PD8A 4H6JB 3UB6A 3H9WA 1EW0A 4NXFA 4MN7A 4Y2FA 3A0VA 1BYWA 3G6OA 5AJGA 4WEJA 3MR0A 1MZUA 3P7NA 3S7OA 3OBFA 2PHYA 1TS8A 3E4PA 4HI4A 4R70A 2ZBBA 3JVVA 2WKQA 3E4OA 4LRYC 3LI8A 1ZHHB 2EWVA 3ICYA 4KQOA 1P97A 3PHYA 3T4OA 4G3VA 3R7WA 3EEAA 4JGRA 2O9AA 3R7WB 3W2ZA 2JKRM 2J3WA 2I9VA 2XA7M 3TW8A 3MQOA 5DJTA 1VB6A 2PR5A 3RTYA 4LLOB 3VE3A 4KUOA 2W3FA 2W27A 4K08A 2VGLM 1W63Q 5J7EA 4L9GA 5HZHA 1OJ5A 1TS7A 4Z1WA 1YSPA 5HSQA 1XFNA 5HWWA 2Y8HA 3MMHA 4GJ4A 3UB8A 4EEPA 4PKYA 2XA7S 5HWTA 2BASA 1XJ6A 3LIBA 1MC0A 3EQUA 4UEYA 1YSQA 4HJ3A 4MN5A 5F68A 4WF0A 3HJKA 2VGLS 2P08A 2OAP1 4R6LA 3JVUA 5IS1A 2HV1A 5K5BA 1T18A 3C8CA 4WL9A 2B18A 1G6OA 4R38A 2YKHA 3ULFA 4JGPA 2VJWA 5A8BA 2NUTC 3OC2A 4I3JA 1DRMA 3E4QA 1T1CA 2H28A 3LIDA 3CI6A 3SW1A 3LR5A 1LSVA 4E04A 3EGDC 2O99A 5DFYA 5HDSA 3IS2A 4M4XA 4O8GA 5KSHA 4PHTA 3MFXA 4Q0HA 3IS2B 3PBOA 4NKPA 4I38A 4I3AA 3MF0A 4EETB 3PBQA 4EEUA 5G4ZA 3VOLA 2PDRA 2B02A 1F5MA 3FPWA 4ME4A 5LBRA 3KYQA 3PBNA 2XROA 4NXGA 3PBRA 4HJ6A 4GS9A 3E0YA 3A0RA 1LT0A 3K2NA 3CITA 4GS9B 4QPRA 3GDIA 4EW7A 3KSIA 4B9OA 3B42A 3LYXA 4GW9A 4KUKA 5HD5A 5J4EA 2D02A 3NHQA 1S4SA 2INWA 3H7WA 5J3WA 4OOLA 2M7VA 4CLCC 3NJAA 1DP6A 1XFQA 2V9AA 4P6ZM 3UE3A 5TBMB 4IUHA 4NXEA 2V0WA 4HH3A 1V9YA 3CUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOI A; 
#chains in the Genus database with same CATH topology
 3S7N A;  4FSF A;  1STZ A;  3PBT A;  2M7U A;  4EUV A;  5CEC A;  2OLU A;  2A2L A;  3E2K A;  5I5L A;  3W8K A;  5F6A A;  2XD1 A;  2OV5 A;  3V67 A;  3R4K A;  2EFU A;  4DXC A;  4HES A;  2Z6C A;  4KZ3 A;  3UPP A;  3HUM A;  1FOF A;  4EBL A;  1K57 A;  3A0S A;  2G2U A;  5FQ9 A;  4X53 A;  4U0X A;  2W3H A;  4K0X A;  4RYE A;  1OTB A;  3MZF A;  3HL9 A;  2O9B A;  2HJE A;  3IBJ A;  1YLT A;  1T1A A;  3BFG A;  4KQD A;  1N4O A;  3I7J A;  1K55 C;  1PZO A;  1NJ4 A;  3MJQ A;  3DTE A;  3GRJ A;  3A3I A;  5FDH A;  4R4R A;  3OCL A;  2ZQC A;  5EOE A;  4DXB A;  2VX8 A;  3G35 A;  3BEB A;  4BMW A;  1W7F A;  1KE0 A;  3OPP A;  2ZC5 B;  2B95 A;  5HAR A;  4CQH A;  2HDU A;  2D01 A;  2KDK A;  1K38 A;  4Q8I A;  4I5S A;  4Y0U A;  5KIZ A;  1IEL A;  3M2J A;  1OTD A;  1ODV A;  4HEF A;  3E2L A;  1NRJ A;  2XRN A;  3PTE A;  4LRZ E;  3T4S A;  5EE8 A;  3KYZ A;  4I39 A;  1IKG A;  1PNE A;  5GLD A;  3LI9 A;  2V0U A;  5EV0 A;  1K25 A;  4HQA A;  1IOU A;  2GJ3 A;  2PU4 A;  1QME A;  4DJ3 A;  2QPN A;  4GLQ A;  3IX4 A;  1WYB A;  5EVL A;  4DKI A;  1K6R A;  4E6X A;  3LUQ A;  3H7W B;  1G5U A;  2EX6 A;  2WAE A;  3G31 A;  2G2W A;  3IX8 A;  3TE8 A;  1L0E A;  3TSG A;  3WRT A;  3G2Y A;  5F83 A;  2L1M A;  3DTK A;  1GSX A;  5A90 A;  4YNR A;  2VLG A;  3UE6 A;  3Q7Z A;  4GDN A;  4RX3 A;  2FZ0 A;  4FH4 A;  2W1R A;  3RH8 B;  4P85 A;  2VV6 A;  1W8Y A;  2XQZ A;  2W3E A;  1JWP A;  3B47 A;  1V9Z A;  3LCE A;  3ZG0 A;  3EOI A;  4PAU A;  2GZA A;  2R9W A;  3U4L P;  1DJC A;  4XUZ A;  3FPV A;  3H82 A;  1DP8 A;  1KDS A;  3H82 B;  1PRQ A;  2WKP A;  1BSG A;  3DBA A;  5HD3 A;  2OWJ A;  1IEM A;  1LL8 A;  5CER A;  4I3I A;  3VMA A;  2P7J A;  3GMW A;  3IF5 A;  4OQH A;  2Z6D A;  3QNC A;  4FTX A;  2K31 A;  2XK1 A;  5A93 A;  3DW0 A;  3NIA A;  1E3U D;  4OH0 A;  4R0Q A;  3C4P A;  3O87 A;  5CEB A;  1P9R A;  4KQQ A;  4JF6 A;  4L9F A;  1ZTU A;  3W4O A;  2JN7 A;  1L0D A;  1QMF A;  3IH8 A;  2K2N A;  3BWL A;  4ZTK A;  1YLZ A;  3F1N A;  4GOG A;  3F1N B;  2IWB A;  4GB7 A;  4EU0 A;  3P98 A;  2OAQ 1;  2Y79 A;  3BFF A;  1Y28 A;  1D06 A;  3IBR A;  5IU1 A;  3SOI A;  3HUO A;  4L0L A;  1S0W A;  2VGK A;  1OTI A;  1S66 L;  5HL1 A;  1SDE A;  5GHY A;  1K56 A;  4C6Y A;  1IYS A;  4B88 A;  3UME A;  2ZMA A;  4WYY A;  4PM8 A;  1K55 A;  4WEL A;  4HJ4 A;  3S22 A;  2V20 A;  4A5R A;  1GHM A;  2R9X A;  2HP5 A;  2WGI A;  5KSC A;  5TBM A;  4YOF A;  1TDG A;  4BJP A;  4H6J A;  2PRF A;  1N9L A;  2HGV A;  3UB6 A;  4H6J B;  3H9W A;  2XGN A;  4MN7 A;  3VOZ A;  4Z9Q A;  5AJG A;  4WEJ A;  4MNR A;  1MZU A;  3P7N A;  3OBF A;  4JXG A;  1BUE A;  5AQ9 A;  4LRY C;  4M3K A;  3PHY A;  3IXH A;  1MWS A;  4GDB A;  3W2Z A;  3CHW P;  2XA7 M;  2PR5 A;  3RTY A;  4KUO A;  4EBP A;  3O86 A;  3HLF A;  4Y13 A;  3SZT A;  1TS7 A;  3IXG A;  1XFN A;  1CI8 A;  5HWW A;  1MXO A;  3MMH A;  3T12 B;  4PKY A;  2RL3 A;  2WKH A;  1MC0 A;  4FCF A;  4UEY A;  1YSQ A;  2VGL S;  2OAP 1;  4N9L A;  1PYY A;  2XFT A;  1Q2P A;  1LSV A;  3EGD C;  3CJM A;  2O99 A;  5E43 A;  1I5Q A;  1SZV A;  5E2H A;  4O8G A;  5KSH A;  4PHT A;  3MFX A;  4I38 A;  3PBQ A;  1HZO A;  4EEU A;  3VOL A;  2P9V A;  2H0T A;  4GD8 A;  2B02 A;  2P9V B;  5KMW A;  3JYI A;  3UDI A;  5CTM A;  3VP3 A;  4QPR A;  4X55 A;  4XUX A;  3B42 A;  5J4E A;  2INW A;  2ZJ9 A;  1AWI A;  4S2M A;  4S2O A;  3S1Y A;  2M7V A;  2DRW A;  1I2S A;  1ERM A;  1DP6 A;  2ZM0 A;  4NXE A;  5CHM A;  5A92 A;  1YLP A;  2R78 A;  2EWW A;  2W3G A;  1LSW A;  1JNU A;  1SKF A;  3HLG A;  4QY6 A;  2CC1 A;  1XJ2 A;  3MZD A;  3CLO A;  3B33 A;  4HIA A;  4S2L A;  3VSL A;  2V1B A;  2HDQ A;  4HNB A;  3S7P A;  1MKM A;  3HLE A;  2AVX A;  4LRX C;  3LIA A;  1N9O A;  2WK0 A;  3PAE A;  4IBX A;  2DMW A;  3MQQ A;  4MLL A;  4S2I A;  1XJ4 A;  1KGG A;  4JGO A;  1L0G A;  3E98 A;  4R23 A;  3SH8 A;  1BZA A;  3K3D A;  3ITB A;  1YLJ A;  2KX6 A;  4BWI A;  1BTL A;  2H10 A;  3QP4 A;  4KG6 A;  3ISG A;  5AVF A;  4ARZ A;  3HJI A;  4FH2 A;  1DJB A;  2ZOH A;  4AFI A;  4ARZ B;  3NUL A;  4KEN B;  2XF3 A;  4YFM A;  1WYC A;  2EX2 A;  3T4L A;  4WZ5 A;  4CLC D;  1KE4 A;  4JF5 A;  3RFB A;  4JGQ A;  1YQS A;  5AVE A;  4OPY A;  5DTS A;  4JBF A;  1OTE A;  3N4I A;  2ZD8 A;  5A91 A;  2HDR A;  1MBL A;  5L2F A;  1WA9 A;  2QWS A;  4IHQ A;  2OOL A;  4O7D A;  1TD5 A;  5GL9 A;  5HDC A;  3D72 A;  4MCW A;  3UO9 A;  4LV0 A;  1UGU A;  2A24 A;  2A24 B;  4RA7 A;  3N8S A;  2QZ6 A;  3P01 A;  2UWX A;  3T4T A;  5DF8 A;  4DMZ A;  1NYY A;  2JKF A;  2WKE A;  2ZQ9 A;  5G4Y A;  2O0Y A;  3LFV A;  3OOV A;  5FQQ A;  4P0M A;  2VZW A;  2JKG A;  1LL5 A;  1LLB A;  1IKI A;  3HLW A;  2WGV A;  5DKK A;  4RVA A;  3C30 A;  4ESP A;  5TR7 A;  5FQJ A;  2HDS A;  3O3V A;  2ZL1 B;  1D7E A;  2DNS A;  3T1Q B;  4WLA A;  5C5K A;  1XP4 A;  2XFS A;  3F1O A;  1F9I A;  5HFO A;  3F1O B;  2K7S A;  2FH5 A;  4GZB A;  2IWD A;  5TFQ A;  2BLS A;  4FOF A;  4KZ5 A;  5TJJ A;  3CPT A;  1LL9 A;  2Y2Q A;  1N9N A;  4LV1 A;  3CPT B;  1F2K A;  3UY6 A;  4OON A;  2GX5 A;  3LIE A;  2OWH A;  4ZJ3 A;  4HHD A;  3SS5 A;  3KO6 A;  3OZH A;  3ZCZ A;  3C5A A;  4LV3 A;  3LIC A;  3N7W A;  3T4J A;  4DN0 A;  4GCZ A;  4KZ9 A;  3NDE A;  4OKP A;  1YAX A;  4N92 A;  4IUK A;  1NXY A;  3UE1 A;  1E3U A;  1NYM A;  3LR0 A;  5DTT A;  1FIK A;  2CMN A;  1IFQ A;  4YWZ A;  5MC7 A;  1NWZ A;  4LV2 A;  3QP8 A;  1FCM A;  4ZJ1 A;  3ZG8 B;  5AQ7 A;  3QP2 A;  3AGD A;  4WEK A;  3BQA A;  2PYP A;  4CLC E;  3DTI A;  3N8R A;  3LGO A;  2PYR A;  5EVI D;  1CK3 A;  4EXO A;  4EER A;  1S67 L;  4GNU A;  3TRC A;  2Y2I A;  1ES5 A;  1H3Q A;  2A49 A;  3T1S A;  4HP9 A;  2ZOI A;  4OQI A;  4E3K A;  1RGY A;  5IT5 A;  4LCM A;  1H8M A;  2ZQ7 A;  3FZC A;  3D3O A;  3CG5 A;  2KLI A;  1Z09 A;  2VV8 A;  2JC7 A;  1VET A;  1MWR A;  1VET B;  3BY9 A;  5FI7 A;  5HWV A;  4S2K A;  1OJG A;  3FC7 A;  2XLN A;  3VV4 A;  4R3A A;  3EQV A;  3FV7 A;  5JYO A;  5DJU A;  2EX9 A;  2VKS A;  1HTZ A;  5J8X A;  5EOO A;  3ZG5 A;  1JWV A;  1DJA A;  3NBL A;  3WS5 A;  3TG9 A;  4U3T A;  4X1L A;  4LEN A;  1AXB A;  3LR4 A;  4OPR A;  2Y91 A;  2H5S A;  2J3T D;  3BYD A;  3BFE A;  2PD8 A;  1E4D A;  4IED A;  2X01 A;  1BYW A;  3S7O A;  1PIO A;  3LY3 A;  4ZAM A;  3WWX A;  1TS8 A;  3ZNT A;  4DDS A;  2ZBB A;  3IWO A;  3JVV A;  2WKQ A;  3LI8 A;  3ZHH A;  1KVL A;  2J7V A;  1ZHH B;  2EWV A;  5CGS A;  5KZH A;  3LEQ A;  4E3M A;  3IWQ A;  4EBN A;  1FIL A;  4RX2 A;  2V8F A;  4OLG A;  4Y15 A;  3JPU A;  2VGJ A;  3MQO A;  3T1R A;  3KYE A;  3VE3 A;  1FCO A;  3AGF A;  5J7E A;  4Z1W A;  1MY8 A;  1YSP A;  5HSQ A;  2Y8H A;  2XA7 S;  5HWT A;  4QU3 A;  3M6B A;  3MXR A;  1VEU A;  1VEU B;  4WF0 A;  3HJK A;  4DE0 A;  2P08 A;  4R6L A;  4ZDX A;  4E3N A;  2HV1 A;  1T18 A;  4UHU A;  4WL9 A;  5M1A A;  1ONG A;  2YKH A;  1GHP A;  2VJW A;  5A8B A;  4DDY A;  3OC2 A;  3E4Q A;  4MBK A;  2H28 A;  2WGW A;  3Q1F A;  3HLB A;  3VP4 A;  1KE3 A;  4JXS A;  5HDS A;  2C5W B;  5E2F A;  3PBO A;  4NKP A;  4I3A A;  1YMS A;  1CF0 A;  4PM7 A;  5G4Z A;  3BLS A;  4LCL A;  3C4O A;  2Y2N A;  1ERQ A;  3FPW A;  5LBR A;  3SH9 A;  3PBN A;  3BRM A;  3RJU A;  1NY0 A;  4KQR A;  3BFC A;  4HJ6 A;  3K2N A;  3BFD A;  4B9O A;  1N9B A;  4UAA A;  4GW9 A;  2Q9M A;  3UN7 A;  1VM1 A;  2X71 A;  1XX2 A;  5FAS A;  4FD8 A;  1XFQ A;  2V9A A;  3PAG A;  4P6Z M;  4WZ5 C;  5TBM B;  4IUH A;  4HH3 A;  2EX8 A;  5JYP A;  2PU2 A;  3IHA A;  4HY8 A;  1XGJ A;  4BL2 A;  5L8M A;  2VK3 A;  4Q0I A;  3HVF A;  4DJ2 A;  3V3R A;  4BBT A;  4X1M A;  4N9K A;  5FQK A;  2PT7 A;  1PW8 A;  2M1C A;  4ETZ A;  3PYP A;  1K54 A;  5E2G A;  2W1T A;  5FAO A;  5F82 A;  1KDW A;  3Q07 A;  4WUJ A;  2PBD P;  2W1T B;  2ZM8 A;  2O9C A;  3WS1 A;  1PFL A;  1P0Z A;  2XD5 A;  4NXB A;  1G6A A;  1ONH A;  2L4R A;  1HLU P;  3OPH A;  2J80 A;  4WM9 A;  3U2A A;  3EGX C;  1XXM A;  4U0T A;  4BLM A;  1LHY A;  1GA9 A;  3BM6 A;  3NOU C;  2Y55 A;  1TS6 A;  4QD4 A;  1H8Y A;  3PXP A;  1PWD A;  1OME A;  2QKP A;  4EQ1 A;  1PW1 A;  3CZD A;  4Y7P A;  5M18 A;  4CLC A;  4WN5 A;  5FDS A;  3FYZ A;  4P6B A;  4CLC B;  1BT5 A;  3WRZ A;  5U47 A;  1PZP A;  4S2P A;  3A3F A;  4NEE D;  4DE3 A;  4KZA A;  5TGF A;  1RCJ A;  5GHX A;  3A3J A;  3OLO A;  4B4X A;  1J3W A;  3M2K A;  3VOY A;  4YIN A;  3S7Q A;  2JKT I;  1G68 A;  4PMA A;  4C75 A;  4IBR A;  2ZQ8 A;  3LIF A;  2EFX A;  4BQM A;  1RGZ A;  3WS0 A;  3HLC A;  1IYO A;  1FCN A;  3BJN A;  5EVE A;  4II7 A;  4PKY G;  5GLB A;  4X69 A;  3NI9 A;  2Y59 A;  3MXQ A;  4OP5 A;  4QWO A;  2V8C A;  3C7V A;  3IF6 A;  3KSF A;  2V2F F;  3IF6 B;  2G7U A;  4E3O A;  4HOI A;  4IVI A;  2GDN A;  4JF4 A;  4WZ4 A;  4KZ8 A;  3UMD A;  3RXW A;  3DTM A;  4KZ4 A;  3ZVW A;  1K4E A;  4GN2 A;  3VFF A;  5EUA A;  3SH7 A;  3OPR A;  5FL3 A;  3VE4 A;  2EXB A;  3PBS A;  1BLC A;  4ID4 A;  4BBV A;  1KOU A;  1SCW A;  3K3C A;  5DKL A;  4MN6 A;  4X56 A;  3PR6 A;  2BG1 A;  2L0W A;  4ZRR A;  3FG8 A;  3VP2 A;  3ZNY A;  4D60 A;  5FQM A;  3ZVT A;  4BBU A;  5FEF A;  4LPZ A;  2ZM2 A;  3NC8 A;  3QP1 A;  3CWF A;  1S4R A;  5L09 A;  5EPH A;  3BQ8 A;  2XSS A;  1L3L A;  1SKO A;  3UPO A;  1BLP A;  1NZO A;  1T19 A;  3NCK A;  1KGE A;  1T1B A;  4HP4 A;  2Y2M A;  1TEM A;  4MMN A;  1Y54 A;  3MSH A;  5CX7 A;  5HAQ A;  4LGW A;  4K91 A;  3HCY A;  5BOH A;  1FSW A;  3Q81 A;  3ZFZ A;  1VHM A;  2WZX A;  4E3J A;  3L9K A;  4JLF A;  3CAX A;  1LI0 A;  1SDN A;  4NG2 A;  4OPZ A;  3GSG A;  1M40 A;  4L9E A;  3HRE A;  4BL3 A;  2W0N A;  5EVI A;  4E3L A;  3TOI A;  5HL6 A;  1K0K A;  3EWK A;  3OPL A;  5EVI B;  1JVJ A;  4PM6 A;  3Q7V A;  4UA6 A;  4S2N A;  4PM9 A;  4MEZ A;  3Q7V B;  2JKT M;  3UPN A;  1TF1 A;  3BW6 A;  4B93 A;  5FI2 A;  1G28 A;  1MWT A;  3ZG9 B;  4ETX A;  2XH9 A;  4HH2 A;  2J9O A;  5L10 A;  5EM0 A;  1MKI A;  1S6R A;  3G30 A;  3VP1 A;  1F98 A;  3WS4 A;  1GCE A;  4JPM A;  2J9P A;  5I94 A;  1U60 A;  2QJ5 A;  1ZG6 A;  2Y2O A;  1YKD A;  3KX0 X;  1BLH A;  3UB7 A;  4GKU A;  2PD7 A;  1TS0 A;  1W5D A;  3G34 A;  1XKZ A;  1CQA A;  3KSG A;  5E2E A;  1YPR A;  2KOI A;  2MJ6 A;  3B3X A;  1NRF A;  4CPK A;  3FWL A;  3O5Y A;  5HAP A;  1ZC2 A;  2FFY A;  2X02 A;  2HJ9 C;  3MQ0 A;  1I2W A;  2GNX A;  4MDZ A;  2HPB A;  3NOT C;  3LO7 A;  1VQQ A;  5FQI A;  5HAI A;  1KVM A;  4KZ7 A;  4NXF A;  3O88 A;  4Y2F A;  5F1G A;  1ACF A;  3A0V A;  4WMC D;  1ALQ A;  3V5M A;  4EQI A;  1RP5 A;  4MBH A;  4HI4 A;  4F94 A;  3GVB A;  3E4O A;  1FSY A;  4KQO A;  1EI5 A;  4DRT A;  2Y2H A;  4G3V A;  5CHU A;  5GLA A;  1TDL A;  2J3W A;  3SS4 A;  1ES4 A;  1VB6 A;  4H8R A;  2W3F A;  1K4F A;  1EWZ A;  1W63 Q;  4KG2 A;  5DF7 A;  4S2J A;  3UB8 A;  4GJ4 A;  4EEP A;  1CJF A;  4KZ6 A;  5FEG A;  4EUZ A;  1XJ6 A;  3LIB A;  2IWC A;  3G32 A;  3RXX A;  3JVU A;  4E3I A;  3C8C A;  2B18 A;  4R38 A;  2NUT C;  2A3U A;  1T1C A;  3LID A;  1Q2Q A;  2QMI A;  3SW1 A;  1K54 C;  5DFY A;  3V50 A;  4Q0H A;  4X68 A;  3MF0 A;  4EET B;  2V1Z A;  5FAP A;  2XEP A;  3QP6 A;  2E8J A;  4JKT A;  2PDR A;  5M19 A;  4ZBE A;  4OP8 A;  2Z2L B;  4GS9 A;  3E0Y A;  2Z2M B;  1LT0 A;  4GS9 B;  3ZG7 B;  3LEZ A;  3QP5 A;  5FI6 A;  2WAF A;  1ES3 A;  1H0M A;  3LYX A;  5HD5 A;  3NHQ A;  1C3B A;  1S4S A;  2Y2G A;  5CTN A;  3H7W A;  3L7H A;  4OOL A;  5J3W A;  1PI4 A;  4CLC C;  3NJA A;  4JXV A;  4JXW A;  3S4X A;  4BD0 A;  4C3Q A;  2ZC3 B;  2V0W A;  1A0K A;  3Q82 A;  1NZU A;  3LY4 A;  1NLZ A;  4UQI S;  1GSV A;  5DVA A;  4MBF A;  2QHK A;  1S1Y A;  1CI9 A;  3T50 A;  4P6Z S;  1OT6 A;  3N8L A;  1NLY A;  1LI9 A;  3ITA A;  2XDM A;  4N1X A;  3EEH A;  1FR1 A;  3HBR A;  4R1G A;  2B5R A;  2PR6 A;  2VV7 A;  1L0F A;  3IXB A;  3TJZ C;  3IF6 C;  4WBG A;  3VFH A;  4D2O A;  3NOP C;  3GV9 A;  1OTA A;  3NEC A;  3F1P A;  5HPF A;  4OQG A;  3MXS A;  3F1P B;  5CRF A;  2QYB A;  4F3L A;  4F3L B;  1XJ3 A;  5HPI A;  2P04 A;  4XXR A;  1H5X A;  1S1Z A;  4RQ9 A;  3ZDJ A;  4DE2 A;  3GR2 A;  3UDF A;  1PI5 A;  2JCH A;  5CED A;  2PAV P;  2WGW B;  3CUE A;  1O07 A;  1O7E A;  1JTD A;  4DE1 A;  3UB9 A;  1SHV A;  4G3K A;  3QNB A;  2BTF P;  1BUL A;  3VP0 A;  4Y0T A;  5F5Y A;  3MKE A;  2NUP C;  1L2S A;  5F69 A;  3HUN A;  4BEN A;  2Q9N A;  3GEC A;  5HX9 A;  2HF6 A;  3W4Q A;  5EEC A;  1XGI A;  3AGE A;  4KZB A;  4QJG A;  2ZMV A;  1HVB A;  4NET A;  3P09 A;  4X6T A;  4OOM A;  3FKV A;  3WS2 A;  2VA0 A;  4G3W A;  2WAD A;  4UQI M;  4EWF A;  2EA9 A;  3C38 A;  2Q0O A;  3FKW A;  3IT9 A;  1YLY A;  2VEA A;  1ZG4 A;  3DWZ A;  5CGX A;  1UWP X;  1WE4 A;  2UV0 E;  2FFF B;  3UDX A;  1KGF A;  5EVI C;  3V39 A;  1YM1 A;  4QB8 A;  3IX3 A;  5FAT A;  2Y2K A;  4HBT A;  5FA7 A;  1CEF A;  3DWK A;  3M6H A;  4OVD A;  3BY8 A;  3C2W A;  3ZYT A;  4S2N C;  3UE0 A;  3IQA A;  1GSW A;  4PM5 A;  2Y2J A;  4XT2 A;  5EM1 A;  4XT2 B;  4ZJ2 A;  1HD8 A;  3N6I A;  3KSH A;  2ZQD A;  1JWZ A;  5DFX A;  1OT9 A;  3CMZ A;  1JTG A;  5FAQ A;  3ZQ5 A;  2YKF A;  4N1H A;  1UWN X;  3BLM A;  2JKR I;  4EV4 A;  2ZLY A;  3NDG A;  3T4Q A;  1XA7 A;  3HLD A;  1P9W A;  1W63 M;  2E8I A;  2QJ7 A;  3BEC A;  4O0P A;  1YT4 A;  2ZC6 B;  2J3T C;  2ZC7 A;  3MZE A;  3IWI A;  5CHJ A;  1ESI A;  2ACG A;  3D4F A;  4Q0J A;  4OPQ A;  3MBZ A;  2IA2 A;  4E6W A;  4Y5F A;  5CGW A;  2OLV A;  2XR0 A;  1MPL A;  3LR3 A;  4IJG A;  3T1X A;  4Y0O A;  1IYQ A;  3NY4 A;  4Y3I A;  1X0O A;  4P87 A;  3OCN A;  4EES A;  4B4Z A;  1MWU A;  1E25 A;  2Y2P A;  4O01 A;  4DF6 A;  2JBF A;  2WUQ A;  4IVK A;  2JHE A;  1H8Z A;  1J9M A;  2ZQA A;  1ES2 A;  1K57 C;  2WYX A;  5AQB A;  3GTC A;  4PPR A;  5CXW A;  2V1A A;  2WZZ A;  4QHC A;  3MS6 A;  4GHI A;  2OSU A;  3ZGA B;  4GHI B;  1CEG A;  2I72 A;  1W8Q A;  1K56 D;  1XA1 A;  2W3D A;  1GHI A;  2ZMF A;  5DF9 A;  3C7U A;  5FSR A;  1DP9 A;  2LB5 A;  5EFW A;  4GD6 A;  2HZ5 A;  2LB9 A;  5G18 A;  1OPX A;  3GQZ A;  2WKI A;  3T4K A;  2ZC4 B;  5HDD A;  4K0W A;  2Y4A A;  2DCF A;  3IXD A;  2WKR A;  1YMX A;  1LSX A;  4BD1 A;  4WMC A;  1EW0 A;  4FUW A;  3UB5 P;  2C6W B;  3G6O A;  4CJN A;  3MKF A;  3MR0 A;  2EXA A;  2PHY A;  3IHB A;  3E4P A;  4R70 A;  1SKO B;  4R4S A;  5AQA A;  3ICY A;  2H0Y A;  1P97 A;  3V3S A;  2J8Y A;  3T4O A;  3R7W A;  3W4P A;  3EEA A;  4JGR A;  3A3E A;  1PWC A;  1FR6 A;  2O9A A;  3R7W B;  5D3O A;  2JKR M;  2HP9 A;  2I9V A;  5L07 A;  4QY5 A;  3TW8 A;  3MFD A;  5DJT A;  4LLO B;  2W27 A;  4K08 A;  3A3D A;  2VGL M;  5F1F A;  1W79 A;  1ERO A;  4L9G A;  5HZH A;  1OJ5 A;  1Z6F A;  2PBY A;  1D1J A;  2BAS A;  4NK3 A;  5HW3 A;  4HBU A;  4R3J A;  1FQG A;  3EQU A;  4HJ3 A;  2Y2L A;  4MN5 A;  5F68 A;  1TVF A;  5IS1 A;  5K5B A;  1G6O A;  3ULF A;  4JGP A;  4KG5 A;  4I3J A;  1DRM A;  3CI6 A;  4OOY A;  3LR5 A;  4E04 A;  1K6S A;  3IS2 A;  4M4X A;  4UA9 A;  4LFU A;  3IS2 B;  4OLD A;  3G2Z A;  5GHZ A;  3DAV A;  1M6K A;  4Y17 A;  1XPB A;  3SS3 A;  2P74 A;  1F5M A;  4ME4 A;  3KYQ A;  2XRO A;  4NXG A;  4UA7 A;  3PBR A;  1ZKJ A;  1IYP A;  3IH9 A;  5DTK A;  1ESU A;  3G4P A;  3A0R A;  3UNW A;  3CIT A;  1Y4O A;  3GDI A;  4EW7 A;  3KSI A;  1DY6 A;  1GA0 A;  4KUK A;  1YLW A;  2D02 A;  3VSK A;  1PWG A;  4R3B A;  4X25 A;  2HP6 A;  3UE3 A;  3D9Y A;  2JE5 A;  1V9Y A;  2RCX A;  2ZL1 A;  1BLS A;  3CUE C;  3QHY A;  5GLC A;  5IHV A;  4OQ0 A; 
#chains in the Genus database with same CATH homology
 3S7N A;  4FSF A;  1NLZ A;  1STZ A;  2R78 A;  2EWW A;  2W3G A;  4UQI S;  4HY8 A;  1LSW A;  1GSV A;  5L8M A;  1JNU A;  3PBT A;  2M7U A;  2QHK A;  1S1Y A;  4EUV A;  4Q0I A;  3T50 A;  2A2L A;  1OT6 A;  4P6Z S;  4DJ2 A;  1NLY A;  5I5L A;  4BBT A;  1XJ2 A;  5F6A A;  2PT7 A;  3V67 A;  3CLO A;  2M1C A;  3B33 A;  3R4K A;  4HIA A;  4ETZ A;  3PYP A;  2V1B A;  2W1T A;  2Z6C A;  3EEH A;  4WUJ A;  2W1T B;  4HNB A;  3S7P A;  2O9C A;  1MKM A;  4LRX C;  3LIA A;  1P0Z A;  1N9O A;  4NXB A;  2PR6 A;  2VV7 A;  2DMW A;  3TJZ C;  3A0S A;  3MQQ A;  2L4R A;  2J80 A;  1XJ4 A;  4JGO A;  3U2A A;  3E98 A;  3EGX C;  3NOP C;  1OTA A;  2W3H A;  3K3D A;  3F1P A;  5HPF A;  3NOU C;  2KX6 A;  1TS6 A;  3F1P B;  4BWI A;  1OTB A;  3PXP A;  2O9B A;  5AVF A;  4ARZ A;  3HJI A;  2HJE A;  2ZOH A;  2QYB A;  3IBJ A;  4AFI A;  4ARZ B;  4F3L A;  1T1A A;  4KQD A;  4F3L B;  1XJ3 A;  5HPI A;  2P04 A;  2QKP A;  4EQ1 A;  3MJQ A;  1S1Z A;  4CLC A;  4WN5 A;  4RQ9 A;  4CLC B;  3T4L A;  3OCL A;  4CLC D;  3RFB A;  4JGQ A;  5AVE A;  3CUE A;  2VX8 A;  4NEE D;  4BMW A;  1OTE A;  3OLO A;  3UB9 A;  1WA9 A;  4CQH A;  4G3K A;  2QWS A;  4IHQ A;  2OOL A;  2D01 A;  3S7Q A;  2JKT I;  2KDK A;  1TD5 A;  5F5Y A;  5HDC A;  3D72 A;  4I5S A;  4MCW A;  5KIZ A;  1UGU A;  2NUP C;  1OTD A;  3LIF A;  2A24 A;  5F69 A;  1ODV A;  2A24 B;  1NRJ A;  2XRN A;  3BJN A;  3GEC A;  4II7 A;  4PKY G;  2HF6 A;  3P01 A;  4LRZ E;  3T4S A;  3MXQ A;  3T4T A;  4DMZ A;  3KYZ A;  4I39 A;  2ZMV A;  3LI9 A;  2V0U A;  3KSF A;  4HQA A;  5G4Y A;  2GJ3 A;  1IOU A;  4DJ3 A;  4GLQ A;  2G7U A;  2O0Y A;  4OOM A;  3LFV A;  2VA0 A;  4HOI A;  3OOV A;  4G3W A;  4UQI M;  2EA9 A;  3LUQ A;  3UMD A;  3H7W B;  3C38 A;  2VZW A;  2VEA A;  3TE8 A;  1UWP X;  5DKK A;  3C30 A;  2L1M A;  1GSX A;  4YNR A;  2VLG A;  1D7E A;  3UE6 A;  5FL3 A;  3VE4 A;  3PBS A;  4BBV A;  2FZ0 A;  3BY8 A;  1KOU A;  3K3C A;  3C2W A;  3ZYT A;  5DKL A;  4MN6 A;  2W1R A;  4WLA A;  3RH8 B;  5C5K A;  3F1O A;  2VV6 A;  1F9I A;  1GSW A;  3PR6 A;  3F1O B;  2L0W A;  2W3E A;  2K7S A;  3B47 A;  2FH5 A;  4ZRR A;  1V9Z A;  3FG8 A;  3EOI A;  4XT2 A;  4BBU A;  4XT2 B;  4LPZ A;  4PAU A;  2GZA A;  4FOF A;  3KSH A;  3CWF A;  5TJJ A;  1S4R A;  3FPV A;  3H82 A;  1N9N A;  1DP8 A;  3BQ8 A;  2XSS A;  3H82 B;  5DFX A;  1OT9 A;  2WKP A;  3DBA A;  5HD3 A;  2GX5 A;  1T19 A;  3LIE A;  2OWH A;  2OWJ A;  3ZQ5 A;  2YKF A;  1T1B A;  4HP4 A;  4HHD A;  3KO6 A;  1UWN X;  1LL8 A;  2JKR I;  4I3I A;  4MMN A;  3LIC A;  3T4J A;  2P7J A;  4GCZ A;  4DN0 A;  3T4Q A;  5CX7 A;  1YAX A;  2Z6D A;  4IUK A;  2K31 A;  3LR0 A;  3HCY A;  1P9W A;  2CMN A;  1IFQ A;  4YWZ A;  5MC7 A;  1W63 M;  1NWZ A;  2QJ7 A;  1VHM A;  4O0P A;  2J3T C;  1P9R A;  3CAX A;  4WEK A;  4L9F A;  4L9E A;  2W0N A;  3BQA A;  2PYP A;  1ZTU A;  4Q0J A;  5HL6 A;  4CLC E;  3EWK A;  2JN7 A;  2IA2 A;  4Y5F A;  2PYR A;  2K2N A;  3BWL A;  4EXO A;  4EER A;  1S67 L;  3F1N A;  3TRC A;  1H3Q A;  3F1N B;  2JKT M;  3LR3 A;  4IJG A;  4HP9 A;  2ZOI A;  1TF1 A;  3BW6 A;  4B93 A;  4Y3I A;  1X0O A;  3OCN A;  5IT5 A;  4EES A;  1G28 A;  4EU0 A;  4ETX A;  1H8M A;  4HH2 A;  4O01 A;  3D3O A;  2JHE A;  2OAQ 1;  2KLI A;  2Y79 A;  2VV8 A;  1Y28 A;  1D06 A;  3IBR A;  1F98 A;  5IU1 A;  2V1A A;  2QJ5 A;  3BY9 A;  4L0L A;  5HWV A;  1YKD A;  3KX0 X;  1OTI A;  1S66 L;  1OJG A;  3UB7 A;  3FC7 A;  4GHI A;  3VV4 A;  4R3A A;  2PD7 A;  1TS0 A;  3EQV A;  4GHI B;  5DJU A;  3UME A;  2VKS A;  2W3D A;  2ZMF A;  5DF9 A;  3KSG A;  1DP9 A;  4WEL A;  2LB5 A;  4HJ4 A;  5EFW A;  2LB9 A;  2KOI A;  1OPX A;  2MJ6 A;  3T4K A;  5HDD A;  5TBM A;  4YOF A;  3O5Y A;  2HJ9 C;  2WKR A;  3MQ0 A;  3LR4 A;  4BJP A;  2J3T D;  2GNX A;  4H6J A;  4MDZ A;  1LSX A;  3NOT C;  1N9L A;  2HGV A;  2PD8 A;  4H6J B;  3UB6 A;  3H9W A;  1EW0 A;  4NXF A;  4MN7 A;  4Y2F A;  3A0V A;  1BYW A;  3G6O A;  5AJG A;  4WEJ A;  3MR0 A;  1MZU A;  3P7N A;  3S7O A;  3OBF A;  2PHY A;  1TS8 A;  3E4P A;  4HI4 A;  4R70 A;  2ZBB A;  3JVV A;  2WKQ A;  3E4O A;  4LRY C;  3LI8 A;  1ZHH B;  2EWV A;  3ICY A;  4KQO A;  1P97 A;  3PHY A;  3T4O A;  4G3V A;  3R7W A;  3EEA A;  4JGR A;  2O9A A;  3R7W B;  3W2Z A;  2JKR M;  2J3W A;  2I9V A;  2XA7 M;  3TW8 A;  3MQO A;  5DJT A;  1VB6 A;  2PR5 A;  3RTY A;  4LLO B;  3VE3 A;  4KUO A;  2W3F A;  2W27 A;  4K08 A;  2VGL M;  1W63 Q;  5J7E A;  4L9G A;  5HZH A;  1OJ5 A;  1TS7 A;  4Z1W A;  1YSP A;  5HSQ A;  1XFN A;  5HWW A;  2Y8H A;  3MMH A;  4GJ4 A;  3UB8 A;  4EEP A;  4PKY A;  2XA7 S;  5HWT A;  2BAS A;  1XJ6 A;  3LIB A;  1MC0 A;  3EQU A;  4UEY A;  1YSQ A;  4HJ3 A;  4MN5 A;  5F68 A;  4WF0 A;  3HJK A;  2VGL S;  2P08 A;  2OAP 1;  4R6L A;  3JVU A;  5IS1 A;  2HV1 A;  5K5B A;  1T18 A;  3C8C A;  4WL9 A;  2B18 A;  1G6O A;  4R38 A;  2YKH A;  3ULF A;  4JGP A;  2VJW A;  5A8B A;  2NUT C;  3OC2 A;  4I3J A;  1DRM A;  3E4Q A;  1T1C A;  2H28 A;  3LID A;  3CI6 A;  3SW1 A;  3LR5 A;  1LSV A;  4E04 A;  3EGD C;  2O99 A;  5DFY A;  5HDS A;  3IS2 A;  4M4X A;  4O8G A;  5KSH A;  4PHT A;  3MFX A;  4Q0H A;  3IS2 B;  3PBO A;  4NKP A;  4I38 A;  4I3A A;  3MF0 A;  4EET B;  3PBQ A;  4EEU A;  5G4Z A;  3VOL A;  2PDR A;  2B02 A;  1F5M A;  3FPW A;  4ME4 A;  5LBR A;  3KYQ A;  3PBN A;  2XRO A;  4NXG A;  3PBR A;  4HJ6 A;  4GS9 A;  3E0Y A;  3A0R A;  1LT0 A;  3K2N A;  3CIT A;  4GS9 B;  4QPR A;  3GDI A;  4EW7 A;  3KSI A;  4B9O A;  3B42 A;  3LYX A;  4GW9 A;  4KUK A;  5HD5 A;  5J4E A;  2D02 A;  3NHQ A;  1S4S A;  2INW A;  3H7W A;  5J3W A;  4OOL A;  2M7V A;  4CLC C;  3NJA A;  1DP6 A;  1XFQ A;  2V9A A;  4P6Z M;  3UE3 A;  5TBM B;  4IUH A;  4NXE A;  2V0W A;  4HH3 A;  1V9Y A;  3CUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...