3EOIA

Crystal structure of putative protein pilm from escherichia coli b7a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
LSRTVHHQQTAEITQQAADFIRYMNAINDYLYQHPERRAAGGQLTSAQLGLPATKNVSHLISQQRVFVWAKEKPGLMGALLEQSGDSALLARVENGRLLDTHGRRISITLPAVIPDQVIIWMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords PilM
publication title Crystal structure of an uncharacterized protein
rcsb
source organism Escherichia coli
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.360 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eoiA00
3EOIA
chains in the Genus database with same CATH superfamily
3CWFA 3BFCA 4LRXC 5EM0A 5EUAA 4I3JA 2CMNA 3HJKA 4HJ3A 3BECA 2XQZA 4OQGA 5CGWA 2OAQ1 4CLCB 3O3VA 3S7QA 1ONHA 3EGDC 3C7VA 1AXBA 1D1JA 2Z6CA 1LT0A 4WUJA 2H0YA 4Y5FA 1YSPA 3ZVTA 5KSHA 2XF3A 1YLZA 2HF6A 3CI6A 5KZHA 3G35A 4H6JB 3T4KA 1YLTA 1Z6FA 2UWXA 4II7A 2XR0A 2JKRI 4EETB 3H7WB 1XFNA 3CG5A 3GDIA 1MWRA 1PNEA 3LYXA 1SKFA 4I39A 5FQIA 3W4QA 1TEMA 3QP2A 5FASA 3LIFA 3S7PA 5EFWA 4EBPA 5HARA 5E43A 4QJGA 3IWQA 2G2WA 4ARZA 3W4OA 1J9MA 2XSSA 4WM9A 3DTEA 4IHQA 4KQRA 2KLIA 1U60A 3FWLA 1H8MA 4LRZE 4R3AA 2A24B 2WKIA 5EPHA 2EWVA 4RYEA 4EWFA 2PBYA 3W4PA 4EQIA 4FD8A 3E0YA 5CTNA 1IYSA 2Y91A 1YPRA 2HDSA 3MQOA 3OCNA 2PU4A 3LIEA 5HPIA 4WF0A 3BQ8A 3C2WA 1YMSA 1MWSA 1MKMA 5DF8A 3EWKA 4R4SA 1ES2A 2WKQA 2WYXA 2Y4AA 5HL6A 3IXGA 3MQ0A 2VV7A 5M19A 2INWA 1DY6A 2ZQAA 3HLGA 3M2JA 3ZG7B 5I94A 1SZVA 1F5MA 1DP6A 5HDCA 4JXSA 4EV4A 2W3FA 2PR5A 3IS2B 1PW8A 3ZNTA 1GHIA 2IWDA 2OSUA 4EBLA 3F1PB 4LCMA 3M6HA 4GDBA 2QHKA 5FSRA 4IUKA 1KOUA 4YFMA 5FEGA 5FI6A 3P7NA 2JKTM 2ZM8A 3VOZA 4HESA 5JYOA 5FAPA 1K4EA 3MJQA 4OQ0A 2Y2HA 2V20A 1H8YA 1K57C 1K4FA 3SS3A 2J9PA 2ACGA 2J9OA 4HJ6A 2Y55A 5J3WA 1CEGA 1IYOA 2WUQA 3QP1A 2V0UA 3GSGA 5FA7A 4LENA 1YMXA 4HQAA 4JGQA 3F1NB 3WRZA 1ZKJA 1XJ6A 4PKYA 5FI2A 2PYRA 2Y59A 2JE5A 3RJUA 1K55C 2ZQ9A 3D72A 1XFQA 4BD0A 4IBXA 4NXFA 5E2GA 3TE8A 1RP5A 4KZ8A 5HW3A 3MZFA 5EECA 3Q07A 4AFIA 4ZTKA 4MMNA 3BEBA 1O7EA 4R3BA 4MEZA 5IU1A 1IYQA 3HREA 3JPUA 1N4OA 3MR0A 2VJWA 3LIAA 2QWSA 2YKHA 2WADA 4QHCA 3HLFA 1VQQA 4X53A 3RFBA 1W63Q 2Q9NA 1DRMA 5HAIA 1L0FA 2XFTA 4R6LA 4XT2B 4PM8A 2WAEA 3UDIA 2XH9A 3B47A 3V67A 1XJ3A 1XX2A 2WGIA 3O88A 4UQIM 2ZC5B 2VGJA 2V8FA 3BWLA 4X6TA 5FQ9A 2PD8A 3SH8A 3FV7A 4G3WA 4DE2A 2EWWA 2XK1A 1RGYA 4R3JA 5J4EA 1N9LA 5C5KA 3VMAA 5AVEA 1ERQA 4PHTA 2JKFA 5CGXA 4KENB 3LO7A 4GD6A 3HLWA 4KZ7A 4ZJ1A 3FKVA 2ZC3B 5FAOA 4R70A 3LCEA 1LL5A 1L2SA 4XXRA 1NRFA 3LY4A 1Y4OA 2WKRA 2I72A 2VGLM 4OPQA 4YNRA 1W8QA 1TS0A 1XGJA 3BJNA 4ZBEA 4Y0OA 3UB9A 5IT5A 3BW6A 4DJ2A 5DKLA 4BWIA 2XEPA 3UN7A 3UPOA 2XD1A 1V9YA 4OH0A 4ARZB 1YM1A 3NJAA 2P9VA 4MLLA 2Y2JA 2ZOHA 1MC0A 5CECA 4X68A 5CHJA 5I5LA 1GHPA 3E2KA 4O01A 4Y15A 1ESIA 3T1QB 4P6BA 5L8MA 3N6IA 1ACFA 2ZC4B 2JC7A 5F1GA 3T4LA 3UB5P 5GHXA 1FCOA 1GA0A 4R4RA 2XLNA 4LLOB 3CAXA 4LRYC 3A3FA 4FH4A 4R38A 5G4YA 1P97A 1DP9A 3T1SA 2JCHA 4X55A 3MXQA 4ZAMA 2JHEA 1STZA 3HUNA 2EX6A 1K6SA 1OJ5A 2P74A 2WZXA 1FOFA 2XA7M 2Y2PA 2HP5A 4EEUA 5CEDA 4KZAA 4OLGA 5AQBA 3UDXA 2O9AA 4OLDA 3QNCA 1KDWA 3GR2A 3CUEC 2RL3A 4BBVA 4ETZA 4BD1A 4DE1A 1ZG4A 2VV8A 3CMZA 4IVKA 4U3TA 1OTDA 2M7VA 1V9ZA 1TDLA 1FSWA 3A3IA 3VP3A 2QKPA 4FTXA 4KQQA 4F94A 4WEKA 3UY6A 1F9IA 2V1AA 2ZL1A 4UHUA 4KZ9A 3IXDA 3C4PA 1JNUA 4FUWA 2MJ6A 5HWWA 5A93A 1XJ2A 3N8RA 4GW9A 1NYYA 1G6AA 2HP9A 4ME4A 5E2HA 4CLCC 4DDSA 2K2NA 4EEPA 1F2KA 3S22A 4HBUA 4P6ZM 3IF5A 3VP4A 1IKIA 3LR4A 4OP8A 2W27A 4K0XA 5AQAA 3HL9A 4B9OA 4YWZA 3KO6A 4OPYA 1LSWA 2ZM2A 1P9WA 4PM9A 1LL9A 2AVXA 2EA9A 1OTBA 1ZHHB 3MXSA 3UO9A 5HSQA 2L1MA 4B4XA 3NOUC 1OPXA 4XUZA 2Y2IA 4O8GA 4KZ5A 2GJ3A 3CJMA 4KG5A 4U0TA 3KX0X 1BT5A 4DE3A 3QP4A 4S2MA 3TJZC 1TF1A 3VP0A 4WZ5C 3GQZA 5CTMA 3WWXA 2ZD8A 1LSVA 2Z6DA 2W1TA 3R7WA 3V5MA 4DDYA 3KYZA 4NG2A 3O87A 2Z2LB 3PTEA 3HUMA 4PM7A 5KIZA 3BYDA 4GHIA 4S2NA 2HPBA 3UMDA 3MKEA 4C75A 1HD8A 1CEFA 4N9KA 2L4RA 4Y17A 1SKOA 3KYEA 4OQHA 2XD5A 3LGOA 3EOIA 4LGWA 1MPLA 1NXYA 4BQMA 5FL3A 3LI9A 1XP4A 2QMIA 1BULA 1ES4A 3UB8A 5FEFA 4S2KA 4EBNA 1W7FA 3MMHA 4KZBA 2KDKA 2K31A 2VKSA 3A0VA 4X69A 3D9YA 4L9GA 2P9VB 4E6XA 1OT6A 4M3KA 1K57A 2G2UA 4LFUA 5HD5A 2PT7A 3B42A 5FATA 1J3WA 1OJGA 4IVIA 3ZG5A 3D3OA 1BZAA 5D3OA 5A91A 2EX8A 2OWJA 4OVDA 4HEFA 3G2YA 1S4SA 3MZEA 1NYMA 5FDSA 3SW1A 5MC7A 5EVIC 4MBKA 2PHYA 2ZLYA 1PZOA 4NXGA 2QZ6A 3V39A 1CJFA 4B93A 3E2LA 1K55A 3ZG0A 2LB5A 3N8SA 4GB7A 3NIAA 3RTYA 3LR5A 5TFQA 5DFYA 3W8KA 1N9BA 3VFHA 3NBLA 5EVEA 3TOIA 3VSKA 5BOHA 2Y2LA 3IF6C 1SDNA 4EUVA 2GNXA 4BJPA 1RCJA 2H28A 3VOYA 4OPRA 1KVMA 1SHVA 3UB7A 4WELA 3FKWA 4CQHA 4C6YA 4QU3A 4G3VA 4HY8A 1YSQA 4M4XA 4S2IA 3NDEA 2W3EA 4K0WA 2OLVA 4QD4A 3ZDJA 3IBJA 3PR6A 1BSGA 5EVLA 4N1XA 5HL1A 2JN7A 1XA7A 5A90A 1XGIA 3NC8A 1UGUA 3CLOA 4KQOA 1NZUA 3VFFA 2WK0A 3UE0A 1UWNX 1KGFA 1D7EA 1YLJA 2Q0OA 3IXHA 4LV2A 2W3DA 1GHMA 4JF4A 2ZL1B 2ZQ7A 4N9LA 4MBHA 5HFOA 4UA7A 3MSHA 5KSCA 1HZOA 3LICA 2DCFA 2O99A 3UNWA 5F5YA 4JGPA 3MF0A 3M2KA 2NUPC 3OOVA 3LI8A 5HPFA 4Q0IA 1S1ZA 4S2PA 2HJEA 3ITBA 1S67L 1ERMA 1ES3A 1VETA 3KSFA 3PYPA 1FCMA 1RGZA 4DE0A 1YAXA 2Y2NA 4N1HA 3K2NA 3U2AA 4HJ4A 3E98A 3CHWP 3T1XA 3QP6A 2W3HA 1T1CA 5GL9A 1NLYA 4OP5A 1C3BA 1HVBA 3EQUA 2V1ZA 4PM5A 3IH8A 3GTCA 4OOLA 5TBMA 4FCFA 1CI8A 5AVFA 4L9EA 4GLQA 3LFVA 2FFFB 4E3MA 5AQ9A 4Y3IA 2KOIA 5FQKA 3HJIA 2V8CA 2H10A 2DMWA 3BQAA 4JXGA 4QY5A 1FR1A 2EXAA 2JKGA 4FH2A 1EWZA 2W1TB 3R7WB 3C38A 2CC1A 3AGEA 4OPZA 3GRJA 4X1LA 5U47A 1S4RA 4GHIB 3UE1A 2EX2A 3CPTA 4P87A 1TDGA 2VK3A 3Q82A 3C4OA 2WKHA 1L0DA 3O5YA 1M6KA 4ZDXA 2B18A 4QWOA 3PXPA 1SKOB 5DF7A 2J8YA 1Q2QA 5FQMA 4OKPA 5GLCA 3CUEA 1ODVA 3K3DA 3GVBA 3Q7ZA 4PMAA 3A0SA 3HLBA 2O9BA 2VGLS 2HDQA 4F3LA 3ISGA 4DN0A 4Y7PA 2P04A 2Y79A 1XPBA 3LEQA 1NJ4A 3N7WA 1XKZA 1XXMA 5EOOA 4GZBA 4GOGA 4MN6A 2R78A 3W2ZA 3AGDA 5G4ZA 4BBTA 1FCNA 3BFDA 4FSFA 3PBRA 3KSGA 3KSHA 4DMZA 4IBRA 4UEYA 3NULA 1BLPA 3BLSA 3JVVA 3UB6A 1MWTA 3HUOA 3Q81A 3LUQA 1YLWA 4OOMA 2M7UA 3MBZA 3FC7A 1MWUA 1W8YA 1MXOA 3ZG8B 2GDNA 4JKTA 4UA9A 1T19A 5F6AA 1DJAA 1GSWA 3T4JA 4Y2FA 5G18A 3S7NA 3HLEA 4HP4A 2A3UA 2KX6A 1HTZA 4R23A 1NY0A 1PFLA 2I9VA 3P98A 2VX8A 1JVJA 1Y28A 2X71A 1D06A 3T4TA 1G68A 5E2FA 4DXBA 1H5XA 1GCEA 4OQIA 1O07A 2XA7S 4Q0JA 3UE6A 2W3GA 1NWZA 4WMCD 4NXBA 1LL8A 4WZ5A 1KE0A 4MN7A 2B95A 1OTIA 1XJ4A 3NOTC 1TS7A 3SS4A 5DTSA 2A2LA 1ZTUA 3S4XA 4R1GA 2X02A 3VP2A 4BLMA 2HP6A 2P08A 3DTKA 3VP1A 3BFFA 2VLGA 1IYPA 1DJBA 4R0QA 3OZHA 5HZHA 1LHYA 3FPVA 2Y2GA 4QB8A 4I3AA 3IWOA 1T18A 1PWCA 1YLPA 2DNSA 2GX5A 3SH9A 3ZHHA 1IOUA 4MN5A 1BLCA 2YKFA 1I2SA 2WAFA 3LY3A 1MY8A 2E8JA 3DW0A 3T12B 4EW7A 1VETB 2LB9A 4HP9A 4P6ZS 3ZG9B 2VZWA 1PI4A 1KDSA 1PIOA 1KE4A 4WBGA 3NDGA 4CLCE 4LCLA 5GLBA 1PW1A 3DBAA 3FG8A 5HAQA 5HWTA 1IELA 4JXWA 1G28A 1K38A 4HOIA 3IWIA 2FZ0A 3LIDA 2QJ7A 5TBMB 1ES5A 1JWVA 4JF5A 4GS9A 3NY4A 5CRFA 2XDMA 3GECA 3UDFA 1ONGA 2G7UA 2PAVP 4WYYA 3IBRA 4E3NA 1CQAA 3T50A 5EVIA 4GDNA 2Y2OA 3SH7A 4WLAA 2FH5A 1OTAA 2EFXA 1DP8A 2HZ5A 5TJJA 4E6WA 4DXCA 3G31A 4JPMA 3IT9A 5F68A 1NLZA 4LPZA 1PZPA 4HNBA 4QY6A 3T4SA 2QPNA 4IJGA 4G3KA 3UMEA 4I38A 3CPTB 3IF6A 3K3CA 3SZTA 1K0KA 3BY8A 4N92A 3UE3A 4S2LA 2EX9A 4DJ3A 2ZC7A 2ZM0A 4CLCD 2WGWA 3PAGA 3ULFA 4Y0UA 1OTEA 2H5SA 3GV9A 3QP8A 5L2FA 2OWHA 3S1YA 2WGVA 1HLUP 4RVAA 5EOEA 1K6RA 3NCKA 4F3LB 5GHZA 2J80A 3OPHA 4GKUA 2E8IA 4KG2A 5CHUA 1S66L 5CGSA 3Q1FA 3OPPA 4GN2A 3M6BA 5AQ7A 3P01A 4EXOA 4GD8A 3LIBA 3MKFA 1OT9A 5L10A 5FQQA 5GLDA 3PHYA 2ZQ8A 2V0WA 3I7JA 4Y13A 3FYZA 3F1OA 1PYYA 5AJGA 3QHYA 4MDZA 3VOLA 1FILA 3E4OA 4HH2A 4EESA 1VB6A 1L0GA 3NOPC 2NUTC 2O0YA 3G30A 3VV4A 4PAUA 3E4PA 1KVLA 2PR6A 1UWPX 3FZCA 3R4KA 3E4QA 1Z09A 1FQGA 5HWVA 3OCLA 2V1BA 5K5BA 2HDUA 2DRWA 2OOLA 5F1FA 3HBRA 3TRCA 2XFSA 2HGVA 2B5RA 5FDHA 4LV3A 2BG1A 4D2OA 4XUXA 2Y2MA 4KZ3A 3WRTA 1KE3A 4NETA 4GJ4A 1PRQA 4IEDA 4D60A 1WE4A 1PWGA 1NZOA 4KQDA 2O9CA 2PDRA 3BRMA 5HX9A 1EI5A 1LI0A 2EFUA 3MFDA 1PI5A 2ZOIA 2OLUA 3WS2A 5DJTA 5M18A 5F69A 1QMFA 2B02A 3G34A 3TSGA 3WS5A 3OLOA 2QJ5A 1E3UD 3EEHA 3ZYTA 1K54C 5HAPA 1ZC2A 3IX8A 1S6RA 1KGGA 1H3QA 4EU0A 3IHBA 5EVID 2UV0E 4EERA 3JVUA 5E2EA 1H8ZA 4GCZA 4B4ZA 4P85A 5JYPA 4S2NC 1X0OA 3IXBA 3PBTA 2ZJ9A 2OAP1 4NEED 4E3LA 3BM6A 1FIKA 1BTLA 1H0MA 2R9WA 3SOIA 2FFYA 4U0XA 3L9KA 4X25A 1I2WA 1N9NA 2R9XA 1JWPA 4P0MA 5FQJA 1TS8A 3OPLA 3A3DA 3NI9A 3ZCZA 4JGOA 3DTMA 4GS9B 5GHYA 4WMCA 3C5AA 2HDRA 2ZBBA 3HLCA 4C3QA 1YQSA 4ID4A 3OPRA 4RA7A 1K56D 2WKEA 2X01A 3MS6A 5EVIB 1IFQA 3A3EA 1MKIA 3BY9A 4KG6A 4K91A 1E25A 4RX3A 1AWIA 3G6OA 1MBLA 2W1RA 4ZRRA 2V2FF 4ZJ2A 2VEAA 4Y0TA 3H82A 1BLSA 3ITAA 3TG9A 5KMWA 2ZC6B 3ZVWA 3ZFZA 2P7JA 1Q2PA 4KZ6A 3IF6B 3WS1A 4CPKA 4UAAA 3BFEA 1JTGA 4HHDA 4E3IA 4K08A 3T4OA 1T1AA 1LI9A 3FPWA 1G5UA 5CXWA 3UPNA 4UQIS 2WGWB 4ZJ3A 2A49A 5CERA 4S2JA 3VE4A 2ZMFA 5HDSA 2Z2MB 2XRNA 2PD7A 2PBDP 1YLYA 2HV1A 3ZNYA 1VEUA 3H9WA 2XROA 1GSVA 4HBTA 3B3XA 1F98A 2XGNA 3RXXA 3WS0A 4DKIA 5F83A 5FAQA 3C7UA 3EGXC 4RX2A 5CX7A 3BLMA 3G4PA 3LR3A 4EQ1A 1SDEA 1BYWA 1W5DA 1GSXA 3Q7VA 1T1BA 1SCWA 2D02A 3V3SA 4E3KA 1BUEA 3F1OB 4HH3A 1NRJA 3PAEA 2W0NA 4PM6A 2M1CA 3HVFA 4X56A 2GZAA 3ZQ5A 2ZQCA 2Q9MA 4NKPA 4E04A 4JBFA 2PYPA 4BBUA 3N8LA 2ZQDA 3TW8A 4S2OA 2RCXA 2BLSA 3PBSA 3KSIA 4BENA 4YOFA 3C8CA 4KUKA 1VM1A 1ESUA 3U4LP 2PU2A 1CI9A 1L0EA 5DF9A 5M1AA 1N9OA 4CLCA 3A3JA 1S0WA 4NK3A 4FOFA 3PBQA 4H8RA 1QMEA 2EXBA 3A0RA 3CITA 4ETXA 5CEBA 3BFGA 5TR7A 5DTKA 3QNBA 1IEMA 2C5WB 3EQVA 4RQ9A 3PBNA 1TS6A 3JYIA 5IS1A 1MZUA 5DTTA 2D01A 3HCYA 4Z1WA 2Y2KA 4H6JA 1OMEA 4I3IA 4WN5A 3KYQA 3SS5A 4PPRA 5TGFA 5F82A 5EM1A 2J7VA 3IX3A 3H7WA 2BTFP 2ZMAA 2JKRM 1ALQA 4DRTA 1IKGA 4BL2A 1TD5A 3NECA 3NHQA 5DJUA 5DKKA 2BASA 1BLHA 3MQQA 3DTIA 2IA2A 2VA0A 1LSXA 1L3LA 3DWKA 3RXWA 4BMWA 3HLDA 2IWCA 5DVAA 3MXRA 4L0LA 1I5QA 3ZGAB 3DWZA 4Z9QA 2A24A 1WA9A 2PRFA 3IH9A 1XA1A 1CF0A 3VE3A 3QP5A 4IUHA 4E3JA 2OV5A 3L7HA 5A92A 1FR6A 1ZG6A 1WYBA 1EW0A 1A0KA 3RH8B 4NXEA 5L09A 1GA9A 4QPRA 3WS4A 5IHVA 2WKPA 1JWZA 4HI4A 2C6WB 4E3OA 4PKYG 3ICYA 2VGKA 3DAVA 3IX4A 3P09A 3GMWA 5J7EA 2JKTI 4OONA 1DJCA 3MFXA 5HD3A 3VSLA 1WYCA 4JLFA 4LV0A 2Y8HA 1JTDA 1W79A 1VHMA 1G6OA 5FI7A 3IS2A 2J3TC 5GLAA 2ZMVA 5LBRA 3H82B 4O7DA 2K7SA 3F1PA 1E3UA 3MZDA 4OOYA 1YKDA 3V3RA 3PBOA 1M40A 4MBFA 3N4IA 4ESPA 2V9AA 2L0WA 4B88A 4CJNA 2HJ9C 4BL3A 3G32A 3B33A 1S1YA 4I5SA 3OBFA 2JBFA 2J3WA 3CZDA 4WZ4A 5HDDA 3OC2A 4L9FA 1YT4A 3G2ZA 1FSYA 1VEUB 3EEAA 4MNRA 4LV1A 3LEZA 3LR0A 1Y54A 4WEJA 1PWDA 4O0PA 1TVFA 3V50A 4X1MA 3F1NA 4KUOA 3IHAA 5EV0A 4DF6A 4UA6A 4WL9A 4GNUA 3T4QA 4EUZA 4JF6A 1P9RA 5J8XA 3AGFA 5EE8A 5A8BA 2J3TD 1K56A 4KZ4A 1CK3A 1K25A 1KGEA 3S7OA 1E4DA 1EROA 4A5RA 3Q7VB 4YINA 4Q8IA 1K54A 1LLBA 1W63M 1P0ZA 4JXVA 5L07A 4MCWA 3D4FA 2H0TA 2QYBA 2IWBA 3T1RA 4Q0HA 3C30A 4JGRA 3IQAA 5CHMA 5DFXA 2Y2QA 2VV6A 2WZZA 4XT2A 3UPPA 4HIAA 3O86A
chains in the Genus database with same CATH topology
3CWFA 2OAP1 4F3LA 4BBVA 4ETZA 4LRXC 2VV8A 4NEED 4DN0A 4I3JA 2CMNA 3HJKA 2P04A 4HJ3A 1OTDA 2M7VA 1V9ZA 2Y79A 2OAQ1 4CLCB 2QKPA 4MN6A 3S7QA 2R78A 4WEKA 3W2ZA 3EGDC 5G4ZA 4BBTA 1N9NA 1TS8A 4FSFA 3PBRA 3KSGA 2Z6CA 3KSHA 1F9IA 4DMZA 4UEYA 4JGOA 2V1AA 1LT0A 4GS9B 4WUJA 2ZBBA 3JVVA 1JNUA 2MJ6A 4Y5FA 3UB6A 5HWWA 1YSPA 1XJ2A 4GW9A 5KSHA 3LUQA 1IFQA 4ME4A 4OOMA 4CLCC 2M7UA 2K2NA 2HF6A 3CI6A 4EEPA 3BY9A 3FC7A 4H6JB 3T4KA 4P6ZM 3G6OA 2W1RA 4II7A 4ZRRA 1T19A 2JKRI 2VEAA 3H7WB 5F6AA 4EETB 1XFNA 3GDIA 3H82A 1GSWA 3LYXA 3T4JA 4I39A 3LR4A 4Y2FA 3S7NA 2W27A 4HP4A 2P7JA 4YWZA 2KX6A 4B9OA 3KO6A 3LIFA 3S7PA 1LSWA 5EFWA 1P9WA 4HHDA 2I9VA 4K08A 2VX8A 3T4OA 4ARZA 1Y28A 1T1AA 2XSSA 2EA9A 1OTBA 1ZHHB 1D06A 3T4TA 5HSQA 2L1MA 3FPWA 3NOUC 2XA7S 4IHQA 4UQIS 1OPXA 2KLIA 4Q0JA 1H8MA 3VE4A 2ZMFA 4LRZE 4R3AA 4O8GA 2A24B 5HDSA 2XRNA 2GJ3A 2PD7A 3UE6A 2HV1A 2W3GA 2EWVA 3KX0X 3TJZC 3H9WA 1NWZA 2XROA 1TF1A 1GSVA 4NXBA 1LL8A 1F98A 4MN7A 3E0YA 1OTIA 1XJ4A 3NOTC 1TS7A 1LSVA 2Z6DA 3MQOA 3OCNA 2A2LA 2W1TA 3LIEA 3EGXC 1ZTUA 5HPIA 3R7WA 4WF0A 3BQ8A 3C2WA 3KYZA 5CX7A 3LR3A 1MKMA 2P08A 4EQ1A 5KIZA 2VLGA 4GHIA 3EWKA 1BYWA 2WKQA 5HZHA 3UMDA 5HL6A 1GSXA 3FPVA 1T1BA 3MQ0A 2D02A 4I3AA 2VV7A 2INWA 2L4RA 1T18A 3F1OB 4HH3A 1NRJA 2W0NA 1F5MA 2M1CA 2GX5A 1DP6A 2GZAA 3EOIA 3ZQ5A 5HDCA 1IOUA 2W3FA 4NKPA 4E04A 2PR5A 3IS2B 5FL3A 4MN5A 2PYPA 2YKFA 3LI9A 4BBUA 3TW8A 4EW7A 3F1PB 2LB9A 4HP9A 3PBSA 3KSIA 4P6ZS 4YOFA 2VZWA 3C8CA 2QHKA 4KUKA 3UB8A 4IUKA 1KOUA 3MMHA 2KDKA 2K31A 3P7NA 2VKSA 4CLCE 2JKTM 3A0VA 5DF9A 3DBAA 3FG8A 1N9OA 4CLCA 4L9GA 5HWTA 1G28A 3MJQA 4HOIA 4FOFA 1OT6A 2FZ0A 3LIDA 3PBQA 2QJ7A 5TBMB 5HD5A 2PT7A 3B42A 3A0RA 1OJGA 3CITA 3D3OA 4GS9A 4ETXA 2OWJA 1S4SA 3GECA 4HJ6A 5J3WA 2G7UA 3EQVA 4RQ9A 3PBNA 3IBRA 1TS6A 3SW1A 5IS1A 2V0UA 5MC7A 3T50A 2PHYA 1MZUA 4HQAA 2D01A 3HCYA 4Z1WA 4JGQA 3F1NB 4NXGA 4H6JA 1XJ6A 4I3IA 4WN5A 3KYQA 4PKYA 2PYRA 4WLAA 4B93A 2FH5A 1OTAA 2LB5A 1DP8A 3H7WA 5TJJA 3D72A 2JKRM 1TD5A 1XFQA 3RTYA 5F68A 3NHQA 5DJUA 4NXFA 1NLZA 3LR5A 4LPZA 3TE8A 5DFYA 4HNBA 3T4SA 5DKKA 4IJGA 4G3KA 3UMEA 4I38A 2BASA 3K3CA 4AFIA 4EUVA 4MMNA 2GNXA 3MQQA 2IA2A 3BY8A 3UE3A 4BJPA 5IU1A 2VA0A 1LSXA 2H28A 3MR0A 4DJ3A 3UB7A 2VJWA 3LIAA 4WELA 4BMWA 2QWSA 4CLCD 2YKHA 4CQHA 4L0LA 3ULFA 4G3VA 3RFBA 1W63Q 4HY8A 1DRMA 1OTEA 1YSQA 4M4XA 2A24A 2OWHA 1WA9A 4R6LA 2W3EA 4XT2B 3VE3A 3IBJA 3B47A 4IUHA 4F3LB 3PR6A 3V67A 1XJ3A 2J80A 4UQIM 2JN7A 1EW0A 3RH8B 3BWLA 1S66L 4NXEA 2PD8A 1UGUA 3CLOA 4KQOA 4QPRA 4G3WA 2EWWA 2WKPA 3P01A 5J4EA 1N9LA 5C5KA 1UWNX 4HI4A 4EXOA 1D7EA 4PKYG 5AVEA 4PHTA 3LIBA 2W3DA 3ICYA 1OT9A 5J7EA 4R70A 2JKTI 3PHYA 3MFXA 2V0WA 5HD3A 3F1OA 3LICA 2O99A 5AJGA 5F5YA 4MDZA 4JGPA 3MF0A 3VOLA 2WKRA 2NUPC 3OOVA 3LI8A 2Y8HA 3E4OA 2VGLM 4HH2A 4EESA 1VB6A 1VHMA 5HPFA 1G6OA 4YNRA 4Q0IA 1S1ZA 3IS2A 2J3TC 1TS0A 2HJEA 3NOPC 2NUTC 1S67L 3BJNA 2ZMVA 2O0YA 5LBRA 5IT5A 3UB9A 3H82B 2K7SA 3KSFA 3F1PA 3VV4A 1YKDA 3PYPA 3BW6A 3PBOA 4PAUA 3E4PA 1YAXA 5DKLA 4DJ2A 3K2NA 4BWIA 2V9AA 2L0WA 2PR6A 4HJ4A 3U2AA 3E98A 1UWPX 2HJ9C 2W3HA 3R4KA 3E4QA 1V9YA 5HWVA 3OCLA 2V1BA 3B33A 1T1CA 1S1YA 5K5BA 4ARZB 4I5SA 1NLYA 3OBFA 2OOLA 3NJAA 3EQUA 3TRCA 2ZOHA 1MC0A 2J3WA 2HGVA 4OOLA 5TBMA 5HDDA 5AVFA 5I5LA 3OC2A 4L9EA 4GLQA 4O01A 3LFVA 4L9FA 5L8MA 4Y3IA 3EEAA 4GJ4A 2KOIA 3LR0A 4WEJA 3HJIA 4KQDA 4O0PA 3T4LA 2O9CA 2PDRA 2DMWA 3BQAA 3F1NA 4KUOA 2ZOIA 2W1TB 4WL9A 5DJTA 3R7WB 3T4QA 3C38A 4LLOB 5F69A 3CAXA 4LRYC 1P9RA 2B02A 5A8BA 4R38A 5G4YA 1P97A 2J3TD 1DP9A 3MXQA 1S4RA 4GHIB 2JHEA 3OLOA 1STZA 3S7OA 2QJ5A 3EEHA 1OJ5A 3ZYTA 3O5YA 2XA7M 1W63M 2B18A 4EEUA 1P0ZA 3PXPA 4MCWA 1H3QA 4EU0A 2QYBA 4EERA 3JVUA 4Q0HA 3C30A 4JGRA 2O9AA 4GCZA 3CUEA 1ODVA 3CUEC 5DFXA 3K3DA 2VV6A 4XT2A 1X0OA 3A0SA 2O9BA 4HIAA 2VGLS 3PBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOI A; 
#chains in the Genus database with same CATH topology
 3CWF A;  3BFC A;  4LRX C;  5EM0 A;  5EUA A;  4I3J A;  2CMN A;  3HJK A;  4HJ3 A;  3BEC A;  2XQZ A;  4OQG A;  5CGW A;  2OAQ 1;  4CLC B;  3O3V A;  3S7Q A;  1ONH A;  3EGD C;  3C7V A;  1AXB A;  1D1J A;  2Z6C A;  1LT0 A;  4WUJ A;  2H0Y A;  4Y5F A;  1YSP A;  3ZVT A;  5KSH A;  2XF3 A;  1YLZ A;  2HF6 A;  3CI6 A;  5KZH A;  3G35 A;  4H6J B;  3T4K A;  1YLT A;  1Z6F A;  2UWX A;  4II7 A;  2XR0 A;  2JKR I;  4EET B;  3H7W B;  1XFN A;  3CG5 A;  3GDI A;  1MWR A;  1PNE A;  3LYX A;  1SKF A;  4I39 A;  5FQI A;  3W4Q A;  1TEM A;  3QP2 A;  5FAS A;  3LIF A;  3S7P A;  5EFW A;  4EBP A;  5HAR A;  5E43 A;  4QJG A;  3IWQ A;  2G2W A;  4ARZ A;  3W4O A;  1J9M A;  2XSS A;  4WM9 A;  3DTE A;  4IHQ A;  4KQR A;  2KLI A;  1U60 A;  3FWL A;  1H8M A;  4LRZ E;  4R3A A;  2A24 B;  2WKI A;  5EPH A;  2EWV A;  4RYE A;  4EWF A;  2PBY A;  3W4P A;  4EQI A;  4FD8 A;  3E0Y A;  5CTN A;  1IYS A;  2Y91 A;  1YPR A;  2HDS A;  3MQO A;  3OCN A;  2PU4 A;  3LIE A;  5HPI A;  4WF0 A;  3BQ8 A;  3C2W A;  1YMS A;  1MWS A;  1MKM A;  5DF8 A;  3EWK A;  4R4S A;  1ES2 A;  2WKQ A;  2WYX A;  2Y4A A;  5HL6 A;  3IXG A;  3MQ0 A;  2VV7 A;  5M19 A;  2INW A;  1DY6 A;  2ZQA A;  3HLG A;  3M2J A;  3ZG7 B;  5I94 A;  1SZV A;  1F5M A;  1DP6 A;  5HDC A;  4JXS A;  4EV4 A;  2W3F A;  2PR5 A;  3IS2 B;  1PW8 A;  3ZNT A;  1GHI A;  2IWD A;  2OSU A;  4EBL A;  3F1P B;  4LCM A;  3M6H A;  4GDB A;  2QHK A;  5FSR A;  4IUK A;  1KOU A;  4YFM A;  5FEG A;  5FI6 A;  3P7N A;  2JKT M;  2ZM8 A;  3VOZ A;  4HES A;  5JYO A;  5FAP A;  1K4E A;  3MJQ A;  4OQ0 A;  2Y2H A;  2V20 A;  1H8Y A;  1K57 C;  1K4F A;  3SS3 A;  2J9P A;  2ACG A;  2J9O A;  4HJ6 A;  2Y55 A;  5J3W A;  1CEG A;  1IYO A;  2WUQ A;  3QP1 A;  2V0U A;  3GSG A;  5FA7 A;  4LEN A;  1YMX A;  4HQA A;  4JGQ A;  3F1N B;  3WRZ A;  1ZKJ A;  1XJ6 A;  4PKY A;  5FI2 A;  2PYR A;  2Y59 A;  2JE5 A;  3RJU A;  1K55 C;  2ZQ9 A;  3D72 A;  1XFQ A;  4BD0 A;  4IBX A;  4NXF A;  5E2G A;  3TE8 A;  1RP5 A;  4KZ8 A;  5HW3 A;  3MZF A;  5EEC A;  3Q07 A;  4AFI A;  4ZTK A;  4MMN A;  3BEB A;  1O7E A;  4R3B A;  4MEZ A;  5IU1 A;  1IYQ A;  3HRE A;  3JPU A;  1N4O A;  3MR0 A;  2VJW A;  3LIA A;  2QWS A;  2YKH A;  2WAD A;  4QHC A;  3HLF A;  1VQQ A;  4X53 A;  3RFB A;  1W63 Q;  2Q9N A;  1DRM A;  5HAI A;  1L0F A;  2XFT A;  4R6L A;  4XT2 B;  4PM8 A;  2WAE A;  3UDI A;  2XH9 A;  3B47 A;  3V67 A;  1XJ3 A;  1XX2 A;  2WGI A;  3O88 A;  4UQI M;  2ZC5 B;  2VGJ A;  2V8F A;  3BWL A;  4X6T A;  5FQ9 A;  2PD8 A;  3SH8 A;  3FV7 A;  4G3W A;  4DE2 A;  2EWW A;  2XK1 A;  1RGY A;  4R3J A;  5J4E A;  1N9L A;  5C5K A;  3VMA A;  5AVE A;  1ERQ A;  4PHT A;  2JKF A;  5CGX A;  4KEN B;  3LO7 A;  4GD6 A;  3HLW A;  4KZ7 A;  4ZJ1 A;  3FKV A;  2ZC3 B;  5FAO A;  4R70 A;  3LCE A;  1LL5 A;  1L2S A;  4XXR A;  1NRF A;  3LY4 A;  1Y4O A;  2WKR A;  2I72 A;  2VGL M;  4OPQ A;  4YNR A;  1W8Q A;  1TS0 A;  1XGJ A;  3BJN A;  4ZBE A;  4Y0O A;  3UB9 A;  5IT5 A;  3BW6 A;  4DJ2 A;  5DKL A;  4BWI A;  2XEP A;  3UN7 A;  3UPO A;  2XD1 A;  1V9Y A;  4OH0 A;  4ARZ B;  1YM1 A;  3NJA A;  2P9V A;  4MLL A;  2Y2J A;  2ZOH A;  1MC0 A;  5CEC A;  4X68 A;  5CHJ A;  5I5L A;  1GHP A;  3E2K A;  4O01 A;  4Y15 A;  1ESI A;  3T1Q B;  4P6B A;  5L8M A;  3N6I A;  1ACF A;  2ZC4 B;  2JC7 A;  5F1G A;  3T4L A;  3UB5 P;  5GHX A;  1FCO A;  1GA0 A;  4R4R A;  2XLN A;  4LLO B;  3CAX A;  4LRY C;  3A3F A;  4FH4 A;  4R38 A;  5G4Y A;  1P97 A;  1DP9 A;  3T1S A;  2JCH A;  4X55 A;  3MXQ A;  4ZAM A;  2JHE A;  1STZ A;  3HUN A;  2EX6 A;  1K6S A;  1OJ5 A;  2P74 A;  2WZX A;  1FOF A;  2XA7 M;  2Y2P A;  2HP5 A;  4EEU A;  5CED A;  4KZA A;  4OLG A;  5AQB A;  3UDX A;  2O9A A;  4OLD A;  3QNC A;  1KDW A;  3GR2 A;  3CUE C;  2RL3 A;  4BBV A;  4ETZ A;  4BD1 A;  4DE1 A;  1ZG4 A;  2VV8 A;  3CMZ A;  4IVK A;  4U3T A;  1OTD A;  2M7V A;  1V9Z A;  1TDL A;  1FSW A;  3A3I A;  3VP3 A;  2QKP A;  4FTX A;  4KQQ A;  4F94 A;  4WEK A;  3UY6 A;  1F9I A;  2V1A A;  2ZL1 A;  4UHU A;  4KZ9 A;  3IXD A;  3C4P A;  1JNU A;  4FUW A;  2MJ6 A;  5HWW A;  5A93 A;  1XJ2 A;  3N8R A;  4GW9 A;  1NYY A;  1G6A A;  2HP9 A;  4ME4 A;  5E2H A;  4CLC C;  4DDS A;  2K2N A;  4EEP A;  1F2K A;  3S22 A;  4HBU A;  4P6Z M;  3IF5 A;  3VP4 A;  1IKI A;  3LR4 A;  4OP8 A;  2W27 A;  4K0X A;  5AQA A;  3HL9 A;  4B9O A;  4YWZ A;  3KO6 A;  4OPY A;  1LSW A;  2ZM2 A;  1P9W A;  4PM9 A;  1LL9 A;  2AVX A;  2EA9 A;  1OTB A;  1ZHH B;  3MXS A;  3UO9 A;  5HSQ A;  2L1M A;  4B4X A;  3NOU C;  1OPX A;  4XUZ A;  2Y2I A;  4O8G A;  4KZ5 A;  2GJ3 A;  3CJM A;  4KG5 A;  4U0T A;  3KX0 X;  1BT5 A;  4DE3 A;  3QP4 A;  4S2M A;  3TJZ C;  1TF1 A;  3VP0 A;  4WZ5 C;  3GQZ A;  5CTM A;  3WWX A;  2ZD8 A;  1LSV A;  2Z6D A;  2W1T A;  3R7W A;  3V5M A;  4DDY A;  3KYZ A;  4NG2 A;  3O87 A;  2Z2L B;  3PTE A;  3HUM A;  4PM7 A;  5KIZ A;  3BYD A;  4GHI A;  4S2N A;  2HPB A;  3UMD A;  3MKE A;  4C75 A;  1HD8 A;  1CEF A;  4N9K A;  2L4R A;  4Y17 A;  1SKO A;  3KYE A;  4OQH A;  2XD5 A;  3LGO A;  3EOI A;  4LGW A;  1MPL A;  1NXY A;  4BQM A;  5FL3 A;  3LI9 A;  1XP4 A;  2QMI A;  1BUL A;  1ES4 A;  3UB8 A;  5FEF A;  4S2K A;  4EBN A;  1W7F A;  3MMH A;  4KZB A;  2KDK A;  2K31 A;  2VKS A;  3A0V A;  4X69 A;  3D9Y A;  4L9G A;  2P9V B;  4E6X A;  1OT6 A;  4M3K A;  1K57 A;  2G2U A;  4LFU A;  5HD5 A;  2PT7 A;  3B42 A;  5FAT A;  1J3W A;  1OJG A;  4IVI A;  3ZG5 A;  3D3O A;  1BZA A;  5D3O A;  5A91 A;  2EX8 A;  2OWJ A;  4OVD A;  4HEF A;  3G2Y A;  1S4S A;  3MZE A;  1NYM A;  5FDS A;  3SW1 A;  5MC7 A;  5EVI C;  4MBK A;  2PHY A;  2ZLY A;  1PZO A;  4NXG A;  2QZ6 A;  3V39 A;  1CJF A;  4B93 A;  3E2L A;  1K55 A;  3ZG0 A;  2LB5 A;  3N8S A;  4GB7 A;  3NIA A;  3RTY A;  3LR5 A;  5TFQ A;  5DFY A;  3W8K A;  1N9B A;  3VFH A;  3NBL A;  5EVE A;  3TOI A;  3VSK A;  5BOH A;  2Y2L A;  3IF6 C;  1SDN A;  4EUV A;  2GNX A;  4BJP A;  1RCJ A;  2H28 A;  3VOY A;  4OPR A;  1KVM A;  1SHV A;  3UB7 A;  4WEL A;  3FKW A;  4CQH A;  4C6Y A;  4QU3 A;  4G3V A;  4HY8 A;  1YSQ A;  4M4X A;  4S2I A;  3NDE A;  2W3E A;  4K0W A;  2OLV A;  4QD4 A;  3ZDJ A;  3IBJ A;  3PR6 A;  1BSG A;  5EVL A;  4N1X A;  5HL1 A;  2JN7 A;  1XA7 A;  5A90 A;  1XGI A;  3NC8 A;  1UGU A;  3CLO A;  4KQO A;  1NZU A;  3VFF A;  2WK0 A;  3UE0 A;  1UWN X;  1KGF A;  1D7E A;  1YLJ A;  2Q0O A;  3IXH A;  4LV2 A;  2W3D A;  1GHM A;  4JF4 A;  2ZL1 B;  2ZQ7 A;  4N9L A;  4MBH A;  5HFO A;  4UA7 A;  3MSH A;  5KSC A;  1HZO A;  3LIC A;  2DCF A;  2O99 A;  3UNW A;  5F5Y A;  4JGP A;  3MF0 A;  3M2K A;  2NUP C;  3OOV A;  3LI8 A;  5HPF A;  4Q0I A;  1S1Z A;  4S2P A;  2HJE A;  3ITB A;  1S67 L;  1ERM A;  1ES3 A;  1VET A;  3KSF A;  3PYP A;  1FCM A;  1RGZ A;  4DE0 A;  1YAX A;  2Y2N A;  4N1H A;  3K2N A;  3U2A A;  4HJ4 A;  3E98 A;  3CHW P;  3T1X A;  3QP6 A;  2W3H A;  1T1C A;  5GL9 A;  1NLY A;  4OP5 A;  1C3B A;  1HVB A;  3EQU A;  2V1Z A;  4PM5 A;  3IH8 A;  3GTC A;  4OOL A;  5TBM A;  4FCF A;  1CI8 A;  5AVF A;  4L9E A;  4GLQ A;  3LFV A;  2FFF B;  4E3M A;  5AQ9 A;  4Y3I A;  2KOI A;  5FQK A;  3HJI A;  2V8C A;  2H10 A;  2DMW A;  3BQA A;  4JXG A;  4QY5 A;  1FR1 A;  2EXA A;  2JKG A;  4FH2 A;  1EWZ A;  2W1T B;  3R7W B;  3C38 A;  2CC1 A;  3AGE A;  4OPZ A;  3GRJ A;  4X1L A;  5U47 A;  1S4R A;  4GHI B;  3UE1 A;  2EX2 A;  3CPT A;  4P87 A;  1TDG A;  2VK3 A;  3Q82 A;  3C4O A;  2WKH A;  1L0D A;  3O5Y A;  1M6K A;  4ZDX A;  2B18 A;  4QWO A;  3PXP A;  1SKO B;  5DF7 A;  2J8Y A;  1Q2Q A;  5FQM A;  4OKP A;  5GLC A;  3CUE A;  1ODV A;  3K3D A;  3GVB A;  3Q7Z A;  4PMA A;  3A0S A;  3HLB A;  2O9B A;  2VGL S;  2HDQ A;  4F3L A;  3ISG A;  4DN0 A;  4Y7P A;  2P04 A;  2Y79 A;  1XPB A;  3LEQ A;  1NJ4 A;  3N7W A;  1XKZ A;  1XXM A;  5EOO A;  4GZB A;  4GOG A;  4MN6 A;  2R78 A;  3W2Z A;  3AGD A;  5G4Z A;  4BBT A;  1FCN A;  3BFD A;  4FSF A;  3PBR A;  3KSG A;  3KSH A;  4DMZ A;  4IBR A;  4UEY A;  3NUL A;  1BLP A;  3BLS A;  3JVV A;  3UB6 A;  1MWT A;  3HUO A;  3Q81 A;  3LUQ A;  1YLW A;  4OOM A;  2M7U A;  3MBZ A;  3FC7 A;  1MWU A;  1W8Y A;  1MXO A;  3ZG8 B;  2GDN A;  4JKT A;  4UA9 A;  1T19 A;  5F6A A;  1DJA A;  1GSW A;  3T4J A;  4Y2F A;  5G18 A;  3S7N A;  3HLE A;  4HP4 A;  2A3U A;  2KX6 A;  1HTZ A;  4R23 A;  1NY0 A;  1PFL A;  2I9V A;  3P98 A;  2VX8 A;  1JVJ A;  1Y28 A;  2X71 A;  1D06 A;  3T4T A;  1G68 A;  5E2F A;  4DXB A;  1H5X A;  1GCE A;  4OQI A;  1O07 A;  2XA7 S;  4Q0J A;  3UE6 A;  2W3G A;  1NWZ A;  4WMC D;  4NXB A;  1LL8 A;  4WZ5 A;  1KE0 A;  4MN7 A;  2B95 A;  1OTI A;  1XJ4 A;  3NOT C;  1TS7 A;  3SS4 A;  5DTS A;  2A2L A;  1ZTU A;  3S4X A;  4R1G A;  2X02 A;  3VP2 A;  4BLM A;  2HP6 A;  2P08 A;  3DTK A;  3VP1 A;  3BFF A;  2VLG A;  1IYP A;  1DJB A;  4R0Q A;  3OZH A;  5HZH A;  1LHY A;  3FPV A;  2Y2G A;  4QB8 A;  4I3A A;  3IWO A;  1T18 A;  1PWC A;  1YLP A;  2DNS A;  2GX5 A;  3SH9 A;  3ZHH A;  1IOU A;  4MN5 A;  1BLC A;  2YKF A;  1I2S A;  2WAF A;  3LY3 A;  1MY8 A;  2E8J A;  3DW0 A;  3T12 B;  4EW7 A;  1VET B;  2LB9 A;  4HP9 A;  4P6Z S;  3ZG9 B;  2VZW A;  1PI4 A;  1KDS A;  1PIO A;  1KE4 A;  4WBG A;  3NDG A;  4CLC E;  4LCL A;  5GLB A;  1PW1 A;  3DBA A;  3FG8 A;  5HAQ A;  5HWT A;  1IEL A;  4JXW A;  1G28 A;  1K38 A;  4HOI A;  3IWI A;  2FZ0 A;  3LID A;  2QJ7 A;  5TBM B;  1ES5 A;  1JWV A;  4JF5 A;  4GS9 A;  3NY4 A;  5CRF A;  2XDM A;  3GEC A;  3UDF A;  1ONG A;  2G7U A;  2PAV P;  4WYY A;  3IBR A;  4E3N A;  1CQA A;  3T50 A;  5EVI A;  4GDN A;  2Y2O A;  3SH7 A;  4WLA A;  2FH5 A;  1OTA A;  2EFX A;  1DP8 A;  2HZ5 A;  5TJJ A;  4E6W A;  4DXC A;  3G31 A;  4JPM A;  3IT9 A;  5F68 A;  1NLZ A;  4LPZ A;  1PZP A;  4HNB A;  4QY6 A;  3T4S A;  2QPN A;  4IJG A;  4G3K A;  3UME A;  4I38 A;  3CPT B;  3IF6 A;  3K3C A;  3SZT A;  1K0K A;  3BY8 A;  4N92 A;  3UE3 A;  4S2L A;  2EX9 A;  4DJ3 A;  2ZC7 A;  2ZM0 A;  4CLC D;  2WGW A;  3PAG A;  3ULF A;  4Y0U A;  1OTE A;  2H5S A;  3GV9 A;  3QP8 A;  5L2F A;  2OWH A;  3S1Y A;  2WGV A;  1HLU P;  4RVA A;  5EOE A;  1K6R A;  3NCK A;  4F3L B;  5GHZ A;  2J80 A;  3OPH A;  4GKU A;  2E8I A;  4KG2 A;  5CHU A;  1S66 L;  5CGS A;  3Q1F A;  3OPP A;  4GN2 A;  3M6B A;  5AQ7 A;  3P01 A;  4EXO A;  4GD8 A;  3LIB A;  3MKF A;  1OT9 A;  5L10 A;  5FQQ A;  5GLD A;  3PHY A;  2ZQ8 A;  2V0W A;  3I7J A;  4Y13 A;  3FYZ A;  3F1O A;  1PYY A;  5AJG A;  3QHY A;  4MDZ A;  3VOL A;  1FIL A;  3E4O A;  4HH2 A;  4EES A;  1VB6 A;  1L0G A;  3NOP C;  2NUT C;  2O0Y A;  3G30 A;  3VV4 A;  4PAU A;  3E4P A;  1KVL A;  2PR6 A;  1UWP X;  3FZC A;  3R4K A;  3E4Q A;  1Z09 A;  1FQG A;  5HWV A;  3OCL A;  2V1B A;  5K5B A;  2HDU A;  2DRW A;  2OOL A;  5F1F A;  3HBR A;  3TRC A;  2XFS A;  2HGV A;  2B5R A;  5FDH A;  4LV3 A;  2BG1 A;  4D2O A;  4XUX A;  2Y2M A;  4KZ3 A;  3WRT A;  1KE3 A;  4NET A;  4GJ4 A;  1PRQ A;  4IED A;  4D60 A;  1WE4 A;  1PWG A;  1NZO A;  4KQD A;  2O9C A;  2PDR A;  3BRM A;  5HX9 A;  1EI5 A;  1LI0 A;  2EFU A;  3MFD A;  1PI5 A;  2ZOI A;  2OLU A;  3WS2 A;  5DJT A;  5M18 A;  5F69 A;  1QMF A;  2B02 A;  3G34 A;  3TSG A;  3WS5 A;  3OLO A;  2QJ5 A;  1E3U D;  3EEH A;  3ZYT A;  1K54 C;  5HAP A;  1ZC2 A;  3IX8 A;  1S6R A;  1KGG A;  1H3Q A;  4EU0 A;  3IHB A;  5EVI D;  2UV0 E;  4EER A;  3JVU A;  5E2E A;  1H8Z A;  4GCZ A;  4B4Z A;  4P85 A;  5JYP A;  4S2N C;  1X0O A;  3IXB A;  3PBT A;  2ZJ9 A;  2OAP 1;  4NEE D;  4E3L A;  3BM6 A;  1FIK A;  1BTL A;  1H0M A;  2R9W A;  3SOI A;  2FFY A;  4U0X A;  3L9K A;  4X25 A;  1I2W A;  1N9N A;  2R9X A;  1JWP A;  4P0M A;  5FQJ A;  1TS8 A;  3OPL A;  3A3D A;  3NI9 A;  3ZCZ A;  4JGO A;  3DTM A;  4GS9 B;  5GHY A;  4WMC A;  3C5A A;  2HDR A;  2ZBB A;  3HLC A;  4C3Q A;  1YQS A;  4ID4 A;  3OPR A;  4RA7 A;  1K56 D;  2WKE A;  2X01 A;  3MS6 A;  5EVI B;  1IFQ A;  3A3E A;  1MKI A;  3BY9 A;  4KG6 A;  4K91 A;  1E25 A;  4RX3 A;  1AWI A;  3G6O A;  1MBL A;  2W1R A;  4ZRR A;  2V2F F;  4ZJ2 A;  2VEA A;  4Y0T A;  3H82 A;  1BLS A;  3ITA A;  3TG9 A;  5KMW A;  2ZC6 B;  3ZVW A;  3ZFZ A;  2P7J A;  1Q2P A;  4KZ6 A;  3IF6 B;  3WS1 A;  4CPK A;  4UAA A;  3BFE A;  1JTG A;  4HHD A;  4E3I A;  4K08 A;  3T4O A;  1T1A A;  1LI9 A;  3FPW A;  1G5U A;  5CXW A;  3UPN A;  4UQI S;  2WGW B;  4ZJ3 A;  2A49 A;  5CER A;  4S2J A;  3VE4 A;  2ZMF A;  5HDS A;  2Z2M B;  2XRN A;  2PD7 A;  2PBD P;  1YLY A;  2HV1 A;  3ZNY A;  1VEU A;  3H9W A;  2XRO A;  1GSV A;  4HBT A;  3B3X A;  1F98 A;  2XGN A;  3RXX A;  3WS0 A;  4DKI A;  5F83 A;  5FAQ A;  3C7U A;  3EGX C;  4RX2 A;  5CX7 A;  3BLM A;  3G4P A;  3LR3 A;  4EQ1 A;  1SDE A;  1BYW A;  1W5D A;  1GSX A;  3Q7V A;  1T1B A;  1SCW A;  2D02 A;  3V3S A;  4E3K A;  1BUE A;  3F1O B;  4HH3 A;  1NRJ A;  3PAE A;  2W0N A;  4PM6 A;  2M1C A;  3HVF A;  4X56 A;  2GZA A;  3ZQ5 A;  2ZQC A;  2Q9M A;  4NKP A;  4E04 A;  4JBF A;  2PYP A;  4BBU A;  3N8L A;  2ZQD A;  3TW8 A;  4S2O A;  2RCX A;  2BLS A;  3PBS A;  3KSI A;  4BEN A;  4YOF A;  3C8C A;  4KUK A;  1VM1 A;  1ESU A;  3U4L P;  2PU2 A;  1CI9 A;  1L0E A;  5DF9 A;  5M1A A;  1N9O A;  4CLC A;  3A3J A;  1S0W A;  4NK3 A;  4FOF A;  3PBQ A;  4H8R A;  1QME A;  2EXB A;  3A0R A;  3CIT A;  4ETX A;  5CEB A;  3BFG A;  5TR7 A;  5DTK A;  3QNB A;  1IEM A;  2C5W B;  3EQV A;  4RQ9 A;  3PBN A;  1TS6 A;  3JYI A;  5IS1 A;  1MZU A;  5DTT A;  2D01 A;  3HCY A;  4Z1W A;  2Y2K A;  4H6J A;  1OME A;  4I3I A;  4WN5 A;  3KYQ A;  3SS5 A;  4PPR A;  5TGF A;  5F82 A;  5EM1 A;  2J7V A;  3IX3 A;  3H7W A;  2BTF P;  2ZMA A;  2JKR M;  1ALQ A;  4DRT A;  1IKG A;  4BL2 A;  1TD5 A;  3NEC A;  3NHQ A;  5DJU A;  5DKK A;  2BAS A;  1BLH A;  3MQQ A;  3DTI A;  2IA2 A;  2VA0 A;  1LSX A;  1L3L A;  3DWK A;  3RXW A;  4BMW A;  3HLD A;  2IWC A;  5DVA A;  3MXR A;  4L0L A;  1I5Q A;  3ZGA B;  3DWZ A;  4Z9Q A;  2A24 A;  1WA9 A;  2PRF A;  3IH9 A;  1XA1 A;  1CF0 A;  3VE3 A;  3QP5 A;  4IUH A;  4E3J A;  2OV5 A;  3L7H A;  5A92 A;  1FR6 A;  1ZG6 A;  1WYB A;  1EW0 A;  1A0K A;  3RH8 B;  4NXE A;  5L09 A;  1GA9 A;  4QPR A;  3WS4 A;  5IHV A;  2WKP A;  1JWZ A;  4HI4 A;  2C6W B;  4E3O A;  4PKY G;  3ICY A;  2VGK A;  3DAV A;  3IX4 A;  3P09 A;  3GMW A;  5J7E A;  2JKT I;  4OON A;  1DJC A;  3MFX A;  5HD3 A;  3VSL A;  1WYC A;  4JLF A;  4LV0 A;  2Y8H A;  1JTD A;  1W79 A;  1VHM A;  1G6O A;  5FI7 A;  3IS2 A;  2J3T C;  5GLA A;  2ZMV A;  5LBR A;  3H82 B;  4O7D A;  2K7S A;  3F1P A;  1E3U A;  3MZD A;  4OOY A;  1YKD A;  3V3R A;  3PBO A;  1M40 A;  4MBF A;  3N4I A;  4ESP A;  2V9A A;  2L0W A;  4B88 A;  4CJN A;  2HJ9 C;  4BL3 A;  3G32 A;  3B33 A;  1S1Y A;  4I5S A;  3OBF A;  2JBF A;  2J3W A;  3CZD A;  4WZ4 A;  5HDD A;  3OC2 A;  4L9F A;  1YT4 A;  3G2Z A;  1FSY A;  1VEU B;  3EEA A;  4MNR A;  4LV1 A;  3LEZ A;  3LR0 A;  1Y54 A;  4WEJ A;  1PWD A;  4O0P A;  1TVF A;  3V50 A;  4X1M A;  3F1N A;  4KUO A;  3IHA A;  5EV0 A;  4DF6 A;  4UA6 A;  4WL9 A;  4GNU A;  3T4Q A;  4EUZ A;  4JF6 A;  1P9R A;  5J8X A;  3AGF A;  5EE8 A;  5A8B A;  2J3T D;  1K56 A;  4KZ4 A;  1CK3 A;  1K25 A;  1KGE A;  3S7O A;  1E4D A;  1ERO A;  4A5R A;  3Q7V B;  4YIN A;  4Q8I A;  1K54 A;  1LLB A;  1W63 M;  1P0Z A;  4JXV A;  5L07 A;  4MCW A;  3D4F A;  2H0T A;  2QYB A;  2IWB A;  3T1R A;  4Q0H A;  3C30 A;  4JGR A;  3IQA A;  5CHM A;  5DFX A;  2Y2Q A;  2VV6 A;  2WZZ A;  4XT2 A;  3UPP A;  4HIA A;  3O86 A; 
#chains in the Genus database with same CATH homology
 3CWF A;  2OAP 1;  4F3L A;  4BBV A;  4ETZ A;  4LRX C;  2VV8 A;  4NEE D;  4DN0 A;  4I3J A;  2CMN A;  3HJK A;  2P04 A;  4HJ3 A;  1OTD A;  2M7V A;  1V9Z A;  2Y79 A;  2OAQ 1;  4CLC B;  2QKP A;  4MN6 A;  3S7Q A;  2R78 A;  4WEK A;  3W2Z A;  3EGD C;  5G4Z A;  4BBT A;  1N9N A;  1TS8 A;  4FSF A;  3PBR A;  3KSG A;  2Z6C A;  3KSH A;  1F9I A;  4DMZ A;  4UEY A;  4JGO A;  2V1A A;  1LT0 A;  4GS9 B;  4WUJ A;  2ZBB A;  3JVV A;  1JNU A;  2MJ6 A;  4Y5F A;  3UB6 A;  5HWW A;  1YSP A;  1XJ2 A;  4GW9 A;  5KSH A;  3LUQ A;  1IFQ A;  4ME4 A;  4OOM A;  4CLC C;  2M7U A;  2K2N A;  2HF6 A;  3CI6 A;  4EEP A;  3BY9 A;  3FC7 A;  4H6J B;  3T4K A;  4P6Z M;  3G6O A;  2W1R A;  4II7 A;  4ZRR A;  1T19 A;  2JKR I;  2VEA A;  3H7W B;  5F6A A;  4EET B;  1XFN A;  3GDI A;  3H82 A;  1GSW A;  3LYX A;  3T4J A;  4I39 A;  3LR4 A;  4Y2F A;  3S7N A;  2W27 A;  4HP4 A;  2P7J A;  4YWZ A;  2KX6 A;  4B9O A;  3KO6 A;  3LIF A;  3S7P A;  1LSW A;  5EFW A;  1P9W A;  4HHD A;  2I9V A;  4K08 A;  2VX8 A;  3T4O A;  4ARZ A;  1Y28 A;  1T1A A;  2XSS A;  2EA9 A;  1OTB A;  1ZHH B;  1D06 A;  3T4T A;  5HSQ A;  2L1M A;  3FPW A;  3NOU C;  2XA7 S;  4IHQ A;  4UQI S;  1OPX A;  2KLI A;  4Q0J A;  1H8M A;  3VE4 A;  2ZMF A;  4LRZ E;  4R3A A;  4O8G A;  2A24 B;  5HDS A;  2XRN A;  2GJ3 A;  2PD7 A;  3UE6 A;  2HV1 A;  2W3G A;  2EWV A;  3KX0 X;  3TJZ C;  3H9W A;  1NWZ A;  2XRO A;  1TF1 A;  1GSV A;  4NXB A;  1LL8 A;  1F98 A;  4MN7 A;  3E0Y A;  1OTI A;  1XJ4 A;  3NOT C;  1TS7 A;  1LSV A;  2Z6D A;  3MQO A;  3OCN A;  2A2L A;  2W1T A;  3LIE A;  3EGX C;  1ZTU A;  5HPI A;  3R7W A;  4WF0 A;  3BQ8 A;  3C2W A;  3KYZ A;  5CX7 A;  3LR3 A;  1MKM A;  2P08 A;  4EQ1 A;  5KIZ A;  2VLG A;  4GHI A;  3EWK A;  1BYW A;  2WKQ A;  5HZH A;  3UMD A;  5HL6 A;  1GSX A;  3FPV A;  1T1B A;  3MQ0 A;  2D02 A;  4I3A A;  2VV7 A;  2INW A;  2L4R A;  1T18 A;  3F1O B;  4HH3 A;  1NRJ A;  2W0N A;  1F5M A;  2M1C A;  2GX5 A;  1DP6 A;  2GZA A;  3EOI A;  3ZQ5 A;  5HDC A;  1IOU A;  2W3F A;  4NKP A;  4E04 A;  2PR5 A;  3IS2 B;  5FL3 A;  4MN5 A;  2PYP A;  2YKF A;  3LI9 A;  4BBU A;  3TW8 A;  4EW7 A;  3F1P B;  2LB9 A;  4HP9 A;  3PBS A;  3KSI A;  4P6Z S;  4YOF A;  2VZW A;  3C8C A;  2QHK A;  4KUK A;  3UB8 A;  4IUK A;  1KOU A;  3MMH A;  2KDK A;  2K31 A;  3P7N A;  2VKS A;  4CLC E;  2JKT M;  3A0V A;  5DF9 A;  3DBA A;  3FG8 A;  1N9O A;  4CLC A;  4L9G A;  5HWT A;  1G28 A;  3MJQ A;  4HOI A;  4FOF A;  1OT6 A;  2FZ0 A;  3LID A;  3PBQ A;  2QJ7 A;  5TBM B;  5HD5 A;  2PT7 A;  3B42 A;  3A0R A;  1OJG A;  3CIT A;  3D3O A;  4GS9 A;  4ETX A;  2OWJ A;  1S4S A;  3GEC A;  4HJ6 A;  5J3W A;  2G7U A;  3EQV A;  4RQ9 A;  3PBN A;  3IBR A;  1TS6 A;  3SW1 A;  5IS1 A;  2V0U A;  5MC7 A;  3T50 A;  2PHY A;  1MZU A;  4HQA A;  2D01 A;  3HCY A;  4Z1W A;  4JGQ A;  3F1N B;  4NXG A;  4H6J A;  1XJ6 A;  4I3I A;  4WN5 A;  3KYQ A;  4PKY A;  2PYR A;  4WLA A;  4B93 A;  2FH5 A;  1OTA A;  2LB5 A;  1DP8 A;  3H7W A;  5TJJ A;  3D72 A;  2JKR M;  1TD5 A;  1XFQ A;  3RTY A;  5F68 A;  3NHQ A;  5DJU A;  4NXF A;  1NLZ A;  3LR5 A;  4LPZ A;  3TE8 A;  5DFY A;  4HNB A;  3T4S A;  5DKK A;  4IJG A;  4G3K A;  3UME A;  4I38 A;  2BAS A;  3K3C A;  4AFI A;  4EUV A;  4MMN A;  2GNX A;  3MQQ A;  2IA2 A;  3BY8 A;  3UE3 A;  4BJP A;  5IU1 A;  2VA0 A;  1LSX A;  2H28 A;  3MR0 A;  4DJ3 A;  3UB7 A;  2VJW A;  3LIA A;  4WEL A;  4BMW A;  2QWS A;  4CLC D;  2YKH A;  4CQH A;  4L0L A;  3ULF A;  4G3V A;  3RFB A;  1W63 Q;  4HY8 A;  1DRM A;  1OTE A;  1YSQ A;  4M4X A;  2A24 A;  2OWH A;  1WA9 A;  4R6L A;  2W3E A;  4XT2 B;  3VE3 A;  3IBJ A;  3B47 A;  4IUH A;  4F3L B;  3PR6 A;  3V67 A;  1XJ3 A;  2J80 A;  4UQI M;  2JN7 A;  1EW0 A;  3RH8 B;  3BWL A;  1S66 L;  4NXE A;  2PD8 A;  1UGU A;  3CLO A;  4KQO A;  4QPR A;  4G3W A;  2EWW A;  2WKP A;  3P01 A;  5J4E A;  1N9L A;  5C5K A;  1UWN X;  4HI4 A;  4EXO A;  1D7E A;  4PKY G;  5AVE A;  4PHT A;  3LIB A;  2W3D A;  3ICY A;  1OT9 A;  5J7E A;  4R70 A;  2JKT I;  3PHY A;  3MFX A;  2V0W A;  5HD3 A;  3F1O A;  3LIC A;  2O99 A;  5AJG A;  5F5Y A;  4MDZ A;  4JGP A;  3MF0 A;  3VOL A;  2WKR A;  2NUP C;  3OOV A;  3LI8 A;  2Y8H A;  3E4O A;  2VGL M;  4HH2 A;  4EES A;  1VB6 A;  1VHM A;  5HPF A;  1G6O A;  4YNR A;  4Q0I A;  1S1Z A;  3IS2 A;  2J3T C;  1TS0 A;  2HJE A;  3NOP C;  2NUT C;  1S67 L;  3BJN A;  2ZMV A;  2O0Y A;  5LBR A;  5IT5 A;  3UB9 A;  3H82 B;  2K7S A;  3KSF A;  3F1P A;  3VV4 A;  1YKD A;  3PYP A;  3BW6 A;  3PBO A;  4PAU A;  3E4P A;  1YAX A;  5DKL A;  4DJ2 A;  3K2N A;  4BWI A;  2V9A A;  2L0W A;  2PR6 A;  4HJ4 A;  3U2A A;  3E98 A;  1UWP X;  2HJ9 C;  2W3H A;  3R4K A;  3E4Q A;  1V9Y A;  5HWV A;  3OCL A;  2V1B A;  3B33 A;  1T1C A;  1S1Y A;  5K5B A;  4ARZ B;  4I5S A;  1NLY A;  3OBF A;  2OOL A;  3NJA A;  3EQU A;  3TRC A;  2ZOH A;  1MC0 A;  2J3W A;  2HGV A;  4OOL A;  5TBM A;  5HDD A;  5AVF A;  5I5L A;  3OC2 A;  4L9E A;  4GLQ A;  4O01 A;  3LFV A;  4L9F A;  5L8M A;  4Y3I A;  3EEA A;  4GJ4 A;  2KOI A;  3LR0 A;  4WEJ A;  3HJI A;  4KQD A;  4O0P A;  3T4L A;  2O9C A;  2PDR A;  2DMW A;  3BQA A;  3F1N A;  4KUO A;  2ZOI A;  2W1T B;  4WL9 A;  5DJT A;  3R7W B;  3T4Q A;  3C38 A;  4LLO B;  5F69 A;  3CAX A;  4LRY C;  1P9R A;  2B02 A;  5A8B A;  4R38 A;  5G4Y A;  1P97 A;  2J3T D;  1DP9 A;  3MXQ A;  1S4R A;  4GHI B;  2JHE A;  3OLO A;  1STZ A;  3S7O A;  2QJ5 A;  3EEH A;  1OJ5 A;  3ZYT A;  3O5Y A;  2XA7 M;  1W63 M;  2B18 A;  4EEU A;  1P0Z A;  3PXP A;  4MCW A;  1H3Q A;  4EU0 A;  2QYB A;  4EER A;  3JVU A;  4Q0H A;  3C30 A;  4JGR A;  2O9A A;  4GCZ A;  3CUE A;  1ODV A;  3CUE C;  5DFX A;  3K3D A;  2VV6 A;  4XT2 A;  1X0O A;  3A0S A;  2O9B A;  4HIA A;  2VGL S;  3PBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...