3EOIA

Crystal structure of putative protein pilm from escherichia coli b7a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'LSRTVHHQQTAEITQQAADFIRYMNAINDYLYQHPERRAAGGQLTSAQLGLPATKNVSHLISQQRVFVWAKEKPGLMGALLEQSGDSALLARVENGRLLDTHGRRISITLPAVIPDQVIIWMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilM
publication title Crystal structure of an uncharacterized protein
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.360 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eoiA00
3EOIA
chains in the Genus database with same CATH superfamily
4KQDA 4QPRA 3E0YA 3P98A 2PBDP 3QP8A 4EESA 3HLWA 3IXGA 3R7WB 2WK0A 5DVAA 2VGJA 4RYEA 4E6WA 1XJ6A 4XXRA 4Z1WA 4Y0TA 1KDWA 4LPZA 3MZDA 3UPPA 1K55A 5AQAA 3G34A 3T1RA 3K3DA 3MXQA 1BLPA 2XQZA 4LV2A 5FQQA 5GHYA 4BMWA 4RX3A 3R4KA 1OMEA 5F82A 1PYYA 1NJ4A 1FIKA 3IF6C 2GZAA 1EWZA 3GTCA 4E3OA 3Q81A 2RL3A 5G4YA 5FQ9A 2ZMFA 4LRXC 3H7WB 3IWIA 3HJIA 2LB9A 3H9WA 2V0UA 1MWRA 1MY8A 5EV0A 4L9GA 4CLCA 2XR0A 3AGDA 4GJ4A 1OTAA 1TD5A 2ZQ9A 3MR0A 4AFIA 3LEQA 3T4OA 5EM0A 4JGQA 3IF6A 2OV5A 5HSQA 1BLCA 4ZBEA 4CPKA 1S1ZA 4EEUA 3HCYA 1ALQA 3PAEA 3BQAA 3HJKA 4JKTA 1H8MA 1ZKJA 2PYRA 3F1PB 2WGWB 4UA9A 3MZFA 2ZM2A 2Y2HA 1YAXA 3FG8A 4P6ZM 5FEGA 2B02A 5IT5A 3RXXA 5AQ7A 3SS5A 4I3JA 3EOIA 1H0MA 1W79A 2OWHA 4LRYC 1TDGA 3A3IA 1O07A 3WRZA 2VKSA 1DRMA 2XEPA 3VOLA 3NDEA 1K56D 3OC2A 1MKIA 4DDSA 4P0MA 1K57A 2W1RA 3FKVA 1XFNA 1OPXA 1WE4A 5FQMA 2WKPA 1E25A 1Q2PA 5HDCA 3E4OA 2NUTC 3MXSA 1ESUA 3GDIA 3BLMA 5F5YA 4HJ3A 1H8YA 3ZVTA 3VE3A 4WZ4A 5FSRA 2OWJA 5CEBA 4NXEA 2W1TA 1GHPA 1FCNA 4KENB 1T1AA 2O9BA 5GLAA 3Q1FA 3EGXC 5FDHA 2V2FF 1RGYA 3FYZA 1G6AA 1PW1A 5KSHA 2A49A 5DKKA 4S2LA 3Q7VB 2Y2IA 3KO6A 2GJ3A 3BQ8A 4GDBA 4O0PA 1N9NA 3ZFZA 4MBFA 2ZM0A 1UWPX 3S22A 3QP4A 2B18A 3CITA 4GD8A 4CLCD 3MSHA 1KGFA 4KZ8A 2W27A 1I5QA 1MXOA 4UHUA 2V8CA 4LV0A 3NBLA 3IX3A 3NHQA 1D1JA 1ZC2A 4DF6A 1GA9A 3TE8A 3W2ZA 3VP4A 1VETB 2HPBA 3BFCA 4BENA 1F2KA 3VSLA 4JF5A 2WKQA 1YKDA 1YSPA 3HLDA 3KSHA 4PM9A 3ZHHA 3S7NA 1YPRA 4UEYA 3P01A 1MWTA 4ZDXA 1L0GA 3PAGA 1GSXA 4UA6A 5FAPA 1A0KA 2ZQ8A 4OOYA 5U47A 1ERMA 2JKFA 3V67A 1VM1A 3EQUA 4GN2A 4WN5A 1H5XA 4BWIA 5FQKA 3U4LP 1J9MA 5G18A 5BOHA 4S2PA 5K5BA 4Q8IA 5HPIA 4FH4A 1XGIA 4H8RA 4R0QA 5AQ9A 3BJNA 4K0WA 4R4RA 1P0ZA 3LI9A 3H82B 4PM7A 2XH9A 4OONA 3UDFA 3T4JA 4NK3A 1MPLA 2IWCA 4IEDA 4JXVA 3N8LA 2BG1A 3L7HA 2VJWA 1XA7A 1YLWA 1D7EA 2DNSA 2ZQAA 4KZ7A 1N9LA 2W3GA 2Q0OA 4L9EA 4HESA 3SZTA 3C4OA 2W3EA 2K31A 4BLMA 3UB7A 2PAVP 2Y2MA 5EVIC 4WMCA 3ITAA 2PRFA 3MXRA 2XLNA 2WAFA 1TVFA 4PKYA 3T4QA 4FH2A 5DF7A 4K08A 4DN0A 3WS1A 4I3AA 1BUEA 2H28A 5EE8A 3QNBA 4HH2A 3M2KA 1LL8A 2QZ6A 1MKMA 2VV6A 2C6WB 1IYSA 1LHYA 1S4RA 3SH8A 5L09A 3ZCZA 5FAQA 3DTEA 4BD1A 4Q0JA 4DRTA 1S6RA 1LL5A 2OAP1 3PXPA 5CGWA 3UNWA 4EERA 2J80A 5IS1A 2QWSA 2PBYA 3UE0A 2XROA 3UPOA 1S4SA 5CEDA 3T1SA 2J9OA 3FC7A 3T1QB 3DAVA 5HD5A 5LBRA 3P09A 1STZA 4EBPA 2ZC4B 5HX9A 3BFGA 1E4DA 3DWKA 2OAQ1 2WKEA 3RFBA 4P6ZS 1T1BA 1FCOA 3A0SA 3TJZC 2ZD8A 3EEHA 3NC8A 1RCJA 2X02A 5FATA 2QMIA 4LGWA 1SZVA 4KQOA 2WKHA 3GSGA 3WS0A 4O7DA 4MN7A 2PHYA 1C3BA 2OSUA 1K4EA 4X55A 3E2KA 1IYOA 2X71A 2EX2A 1L0EA 3IXHA 5HD3A 5DF8A 2VK3A 2VLGA 4D60A 4KZ3A 3F1OA 1XA1A 1Q2QA 1ODVA 5CHMA 3IXDA 4L9FA 3I7JA 3SOIA 3IQAA 4EBLA 4BQMA 2FFYA 5CGSA 1TF1A 4WMCD 3ZYTA 4ID4A 2ZLYA 4YINA 1XP4A 4PM5A 3LI8A 2QJ7A 1ZG4A 3MF0A 3PBOA 4S2OA 4OPZA 4FUWA 1PRQA 2QJ5A 3UE3A 3A3EA 3ITBA 1ZG6A 3K3CA 5J4EA 3IBJA 5FI7A 4Y5FA 1SKOA 2WADA 1GSWA 2HGVA 5JYPA 2EXAA 4ZJ2A 4EQ1A 3ZG5A 5EOOA 3PBSA 3HLGA 3OCNA 1K38A 4EETB 4F94A 5EECA 3LIFA 1OT9A 1I2SA 3OPLA 3DWZA 4GHIA 3G30A 1YLPA 1MBLA 2ZL1B 3C4PA 2J8YA 4DXCA 3KX0X 1MC0A 4OP8A 4QY6A 3GVBA 4FCFA 4KZ9A 4DJ2A 3UB5P 4HHDA 3HUOA 4Y2FA 3BYDA 1GA0A 4EEPA 2VA0A 4OVDA 2BTFP 2XF3A 2PD7A 3S7QA 5DJTA 4OQIA 4X68A 2PD8A 5HPFA 4YNRA 4KZ5A 4HJ6A 5KSCA 4ETZA 2ZBBA 5E2EA 1JWPA 3QP6A 3IF6B 1DJCA 3UMEA 4KG6A 1PW8A 1MWSA 4B88A 3VFHA 3CPTB 4M3KA 3GR2A 1K56A 4UQIM 1OTBA 2JKTI 3N7WA 3SW1A 2Y2LA 4ZAMA 5A93A 1ZHHB 1CK3A 3VP1A 4WUJA 2HDSA 5A8BA 3IH9A 1P9WA 2XGNA 3UE6A 1NYYA 3RJUA 3HLFA 4X6TA 4JXGA 1YLZA 3CG5A 1QMEA 3WWXA 3UE1A 1XKZA 3C8CA 2PT7A 2UV0E 1BT5A 3LR0A 4CLCC 2NUPC 2PYPA 4Y7PA 5HARA 2Q9MA 4R3AA 1CEFA 3CMZA 5E2GA 5FQIA 3V5MA 3C7VA 4LCMA 4BBUA 4S2IA 4IHQA 4GZBA 4Q0HA 1T18A 3HUNA 3EWKA 4OLGA 3NECA 4X53A 1XJ2A 2HP6A 3MS6A 1YMXA 2JCHA 1OJ5A 5F1FA 2ZQCA 1N4OA 4KZ4A 2W3FA 4BJPA 3A3FA 3CJMA 3GECA 3ZNYA 3T4KA 3FPVA 3S7PA 3FZCA 4WL9A 3MQOA 3BM6A 4L0LA 4S2NA 3HLEA 3WS4A 1SDEA 1K57C 4DE3A 3L9KA 4G3WA 5F1GA 4Z9QA 3RTYA 2HDQA 5I94A 3W4QA 4D2OA 2Y2QA 3N8RA 4BBTA 4EBNA 4MDZA 3OBFA 4IBXA 4I3IA 1KGEA 3CLOA 4H6JB 3BFFA 5L07A 1RGZA 1KE3A 4MN6A 3PBRA 1YM1A 3WS2A 3OPPA 5F69A 3S7OA 2IWDA 3G6OA 1OT6A 2EX8A 2FZ0A 3NCKA 4GB7A 5AQBA 1D06A 1NYMA 4GKUA 4HOIA 1WYCA 3NJAA 4YFMA 1PWDA 1ESIA 3SS4A 3UMDA 4HBUA 2HDUA 5FA7A 1BSGA 4MMNA 5TGFA 1SKFA 4E3JA 2YKFA 4QU3A 4IVIA 1BTLA 3F1NA 1ES3A 1Y4OA 1GHIA 3VOYA 2Y2OA 3N4IA 3GV9A 4KZAA 2I9VA 1JWZA 3EEAA 3S4XA 3PHYA 2JBFA 1YMSA 2E8JA 4F3LB 4R1GA 3D9YA 3IHBA 3QP2A 1PIOA 3E2LA 2L0WA 4ZRRA 4KQQA 3QNCA 3IH8A 2GNXA 2P7JA 3SH7A 3MBZA 2Y79A 3F1PA 2OLVA 2WGWA 1T1CA 1VEUB 2XRNA 2BASA 3PBQA 5DFYA 3D4FA 3K2NA 4C6YA 2M1CA 5EM1A 3JPUA 2DMWA 4R38A 2OOLA 1K54A 4QY5A 1M6KA 4E3NA 2H10A 3A3JA 4JBFA 3PYPA 5EVIB 2ZC3B 1AWIA 1TS7A 4GD6A 2G2UA 2XA7S 2H5SA 4NXGA 5HAPA 3ZG8B 5TFQA 4HBTA 4R4SA 4NG2A 3KYEA 4UQIS 1F5MA 3ISGA 3UDXA 3UN7A 5I5LA 1AXBA 1G68A 2HV1A 5MC7A 3W8KA 3PBNA 1LLBA 2QHKA 1L0DA 4G3KA 3LY3A 2V8FA 3FKWA 5CXWA 5KMWA 4LRZE 2B95A 1ES4A 4HP9A 3S1YA 1WA9A 3CZDA 4HY8A 3LGOA 4YOFA 2ZOHA 3DBAA 3MQ0A 1K4FA 4N9KA 4KZ6A 4MBKA 4HJ4A 2GDNA 3QP5A 3OOVA 2DCFA 2VGKA 2ZMAA 4ESPA 5EOEA 4YWZA 4X56A 3IBRA 1LSXA 1NZOA 2XDMA 3KYZA 1HTZA 2P9VB 3B47A 1K6RA 4GCZA 3UB6A 2XK1A 3G4PA 1PWCA 2VV7A 4OQGA 3B33A 4LENA 3LIEA 4XUZA 4KG2A 5HDDA 3P7NA 3LY4A 5FL3A 1CI8A 3IXBA 2X01A 1VQQA 3ZG7B 5DKLA 2VV8A 2Y2KA 1S67L 4DDYA 4UA7A 3WS5A 4DE0A 4OH0A 3BY9A 4R70A 2Y2NA 3NIAA 3T1XA 4HEFA 1L2SA 3NOUC 4EWFA 2R9XA 4ZTKA 4S2KA 2Y55A 3RXWA 1DP8A 1YSQA 3G35A 2O0YA 3QHYA 3TOIA 5G4ZA 2XD5A 4Q0IA 2EX6A 3IS2B 3TW8A 1SKOB 4G3VA 3UO9A 4JGRA 5HAIA 2MJ6A 3H82A 5HFOA 2LB5A 3BLSA 5DTTA 5L2FA 3OCLA 3HREA 2ZQ7A 4PM8A 1HLUP 2HJEA 1FSWA 4MBHA 4PKYG 1O7EA 3UY6A 2H0TA 4I5SA 1HZOA 3Q07A 4QD4A 4ZJ1A 4E3KA 3VP0A 3ZG9B 1DP6A 5J8XA 3O86A 1NRJA 5HW3A 3LCEA 2ZOIA 4WEKA 4R6LA 5FI6A 4XT2B 2JKRI 2V0WA 3MKFA 1F98A 3O5YA 5TBMB 4I38A 3NULA 3A0VA 4MNRA 4X1LA 4N9LA 3V3RA 3ZNTA 3LR5A 3VP3A 3PR6A 1TEMA 1F9IA 1H3QA 2A2LA 3PTEA 1S66L 3M6HA 1EW0A 1PZOA 2L1MA 2BLSA 4FOFA 3UPNA 3FPWA 1J3WA 4FD8A 2V9AA 4WEJA 5HL1A 4MLLA 4LV3A 3KYQA 3ZGAB 3MQQA 2VGLM 4N92A 2EX9A 3CUEA 2K7SA 2HP9A 2W3HA 1KE0A 2JKGA 4DXBA 4Y13A 1W5DA 5TR7A 1G5UA 4EV4A 3DW0A 3LIAA 1IFQA 3HBRA 5AVEA 4PMAA 5CRFA 3MFDA 1E3UA 2INWA 5J7EA 2WKIA 5EVEA 3DTMA 4RQ9A 1HVBA 2UWXA 1Z09A 1MWUA 3EGDC 4S2MA 5F68A 4BL2A 1PI5A 2Y59A 2Y91A 4E3MA 4DE2A 3BWLA 1ERQA 2QYBA 1HD8A 5GHZA 4RVAA 2KX6A 5M1AA 3HLBA 1LI0A 4CLCB 1CJFA 4R3BA 4ETXA 4MCWA 1P97A 3D3OA 3IHAA 3TRCA 1PWGA 2ZC5B 2G2WA 4NXFA 3RH8B 4N1XA 3TSGA 2V1BA 5FAOA 2O99A 3VSKA 2XSSA 1XXMA 1LI9A 4KG5A 4M4XA 3VFFA 3C2WA 2YKHA 5KZHA 1VB6A 5EFWA 1DP9A 3ZVWA 2ZM8A 2PU2A 2HDRA 4PPRA 2JC7A 5EPHA 4ME4A 3MMHA 1UWNX 3V39A 4OKPA 4WBGA 4OLDA 3T4SA 1L3LA 4PHTA 5HAQA 2XFSA 4UAAA 2O9CA 4IUHA 4JGOA 4Y0OA 1OJGA 4I39A 1CI9A 4QB8A 2HZ5A 5JYOA 4EQIA 3E4QA 2Q9NA 5A91A 2PDRA 2IWBA 5HZHA 1NY0A 4K91A 2E8IA 2P08A 2G7UA 3PBTA 4EUVA 4DKIA 3MKEA 1U60A 3JVUA 3IWQA 1NWZA 1FCMA 5A90A 4BBVA 2R78A 4GLQA 1FQGA 4OPRA 2ZL1A 2B5RA 4E3LA 5DF9A 5E43A 4S2NC 1NZUA 4E04A 2H0YA 1E3UD 3Q82A 1K0KA 1IYPA 3CHWP 1SCWA 2W1TB 3DTIA 3F1NB 4GNUA 1SHVA 2Y2JA 1LSVA 1SDNA 3C38A 4LLOB 2ZQDA 2PU4A 4O01A 4DE1A 2EA9A 3WRTA 4IJGA 4ARZA 2O9AA 1CEGA 4GS9A 3MJQA 1V9ZA 4NXBA 5L10A 3A0RA 4PAUA 5DTKA 4Y17A 2A24A 1XPBA 4DMZA 2ACGA 3CPTA 4WLAA 2JHEA 1XJ4A 1DY6A 3BFDA 1UGUA 4WF0A 5CGXA 4HIAA 2FFFB 5A92A 3ZDJA 4E3IA 3R7WA 5HWTA 1W8YA 3A3DA 3LIBA 1W63Q 2EWVA 2KDKA 3NOPC 1DJAA 3ZG0A 1JVJA 4OPQA 1H8ZA 4P85A 2D01A 4EU0A 5E2FA 4E6XA 5C5KA 2Y4AA 3SH9A 4KQRA 2ZJ9A 1BZAA 1CQAA 1YLTA 1KDSA 1VHMA 3BEBA 1ONHA 5L8MA 3T4TA 1BLHA 2VGLS 4WELA 1P9RA 5HL6A 1ES2A 2VEAA 3H7WA 4P6BA 4CQHA 3NY4A 5CX7A 3IX4A 1TDLA 1Y54A 1IYQA 4HQAA 4JXWA 2J3TD 2PR5A 2WUQA 5CTMA 4ZJ3A 1JNUA 4XUXA 3BRMA 1NLZA 3VMAA 3O87A 1YQSA 5AVFA 1PZPA 3NOTC 2JN7A 3EQVA 1K54C 4WYYA 1Y28A 4FTXA 1GHMA 3HUMA 3LR4A 2J7VA 3KSGA 4B93A 5FASA 2KLIA 5KIZA 4CLCE 2IA2A 1N9BA 4B9OA 5GL9A 1PI4A 1S1YA 1WYBA 5GLCA 3UB8A 3BY8A 3IWOA 5DJUA 4HP4A 1JWVA 1K25A 1TS8A 2Y2PA 2W3DA 2KOIA 2V1AA 3UDIA 4WM9A 1JTGA 2XFTA 3N8SA 4X1MA 1W7FA 3C30A 1GCEA 2DRWA 2HP5A 1YT4A 4JF4A 3LYXA 2Z6CA 4H6JA 4JPMA 2M7VA 5FI2A 2EWWA 4II7A 4C75A 4NEED 3QP1A 3M6BA 3VP2A 4EUZA 1TS6A 5IU1A 4GOGA 1NRFA 4NETA 5DTSA 1FSYA 1W8QA 3D72A 4OQHA 4GDNA 1IEMA 5FQJA 3IX8A 1X0OA 3KSIA 2GX5A 2CMNA 1CF0A 5CERA 3OPRA 2V20A 4K0XA 5GLDA 4LFUA 3B42A 4B4ZA 3T50A 1EI5A 2CC1A 1JTDA 2Y2GA 3Q7VA 1PFLA 1KGGA 3W4OA 3NI9A 2WGIA 4MN5A 4F3LA 3V50A 4X25A 3JVVA 5IHVA 3IT9A 5GLBA 3C5AA 4IVKA 3F1OB 3HLCA 3G2ZA 4OP5A 2WYXA 2M7UA 1VETA 1VEUA 4A5RA 5CHUA 1IOUA 3O88A 3HVFA 4QWOA 5M18A 3B3XA 2WZZA 2WAEA 2HF6A 2L4RA 4QJGA 5HWWA 5HDSA 1IKGA 2Z2MB 1K6SA 1YLJA 1YLYA 1V9YA 4S2JA 4BL3A 2VX8A 1QMFA 1OTEA 1OTDA 3G31A 2PR6A 5GHXA 1ACFA 4LCLA 5EVIA 1PNEA 1Z6FA 1T19A 2WGVA 4R3JA 1KVLA 1KVMA 2FH5A 3GRJA 4QHCA 3NDGA 2QPNA 4B4XA 2W0NA 4KZBA 4IBRA 3UB9A 1EROA 4JF6A 3LR3A 5E2HA 3M2JA 2WKRA 5CECA 2JKRM 2Z2LB 2P74A 3T12B 3G2YA 3E4PA 4JGPA 3ICYA 1NLYA 4OOLA 1FR1A 4JLFA 2K2NA 3LO7A 3ZQ5A 3DTKA 3JYIA 1FR6A 1M40A 2EFUA 2VZWA 3VOZA 4GHIB 2R9WA 4KUOA 4RA7A 5AJGA 2P04A 1KE4A 1DJBA 4KUKA 1GSVA 1XJ3A 4Y15A 4NKPA 1FILA 1ES5A 5J3WA 3TG9A 3G32A 1XX2A 4HI4A 3T4LA 3CWFA 4HNBA 4U3TA 2P9VA 3LFVA 4U0XA 5HWVA 3CUEC 3V3SA 1RP5A 3O3VA 1LL9A 4U0TA 4P87A 3SS3A 2Y8HA 5DFXA 2QKPA 5FEFA 1G6OA 4O8GA 2ZMVA 3AGFA 3C7UA 5F6AA 3N6IA 1W63M 2AVXA 2RCXA 2WZXA 4RX2A 3BECA 3VE4A 1KOUA 4Y3IA 4LV1A 3CAXA 5CHJA 4MEZA 1BYWA 5FDSA 3BW6A 5M19A 3W4PA 4R23A 3OPHA 4HH3A 4CJNA 3OZHA 3IS2A 2OLUA 4C3QA 2JE5A 3FV7A 5TJJA 4DJ3A 1S0WA 5EVID 2ZC7A 1MZUA 4N1HA 1BULA 3KSFA 2Z6DA 3MZEA 2I72A 3U2AA 5D3OA 3IF5A 3FWLA 1XGJA 1NXYA 1ZTUA 4JXSA 5EUAA 1LSWA 1IELA 3VV4A 4FSFA 2J3WA 3Q7ZA 3LEZA 1TS0A 4EXOA 2J9PA 4OOMA 2EFXA 3GMWA 2EXBA 2JKTM 3GQZA 4GW9A 1LT0A 2C5WB 4WZ5C 4OPYA 4IUKA 1L0FA 2A3UA 4XT2A 1G28A 1BLSA 3HL9A 3LIDA 5TBMA 2HJ9C 3CI6A 5EVLA 4BD0A 3ULFA 2XD1A 2ZC6B 5CTNA 3OLOA 1OTIA 4EW7A 1IKIA 3LUQA 2D02A 3MFXA 5F83A 4ARZB 3AGEA 4WZ5A 2XA7M 1ONGA 4GS9B 1N9OA 4Y0UA 4X69A 4PM6A 1XFQA 3BFEA 2A24B 3LICA 1I2WA 2V1ZA 3E98A 1FOFA 2J3TC 1K55C 4OQ0A
chains in the Genus database with same CATH topology
1ODVA 3MQ0A 4KQDA 4L9FA 1VHMA 4QPRA 3E0YA 4HJ4A 4EESA 5L8MA 3OOVA 3R7WB 3T4TA 4YWZA 2VGLS 4WELA 1TF1A 3IBRA 1XJ6A 1LSXA 1P9RA 5HL6A 3KYZA 4Z1WA 2VEAA 3H7WA 4CQHA 3B47A 5CX7A 3ZYTA 4GCZA 2ZOHA 3UB6A 2VV7A 4HQAA 2J3TD 4LPZA 3B33A 2PR5A 3LI8A 2QJ7A 3LIEA 3K3DA 3MXQA 5HDDA 3P7NA 1JNUA 3MF0A 3PBOA 5FL3A 1NLZA 5AVFA 2QJ5A 2JN7A 3NOTC 3UE3A 5DKLA 3EQVA 4BMWA 2VV8A 3R4KA 3K3CA 5J4EA 1S67L 1Y28A 3IBJA 4Y5FA 2GZAA 1GSWA 2HGVA 3LR4A 5G4YA 4EQ1A 3KSGA 4B93A 2ZMFA 5KIZA 2KLIA 3BY9A 4LRXC 4R70A 2IA2A 4CLCE 3PBSA 3H7WB 4B9OA 3HJIA 3OCNA 2LB9A 3NOUC 4EETB 3H9WA 2V0UA 1S1YA 4CLCA 4L9GA 3LIFA 3UB8A 3BY8A 1OT9A 5DJUA 4GJ4A 4HP4A 4GHIA 1TS8A 1OTAA 1TD5A 3MR0A 4AFIA 2W3DA 1DP8A 1YSQA 2KOIA 2V1AA 3T4OA 2O0YA 5G4ZA 4JGQA 3KX0X 1MC0A 3C30A 4Q0IA 3IS2B 5HSQA 3TW8A 1S1ZA 4EEUA 3LYXA 3HCYA 4G3VA 2Z6CA 3BQAA 3HJKA 1H8MA 4DJ2A 4JGRA 4H6JA 2MJ6A 2PYRA 4HHDA 4Y2FA 2M7VA 2EWWA 3F1PB 3H82A 4II7A 4EEPA 4NEED 2LB5A 2VA0A 3OCLA 2PD7A 3S7QA 5DJTA 2HJEA 4PKYG 2PD8A 1TS6A 5IU1A 4I5SA 5HPFA 4YNRA 1YAXA 3FG8A 4P6ZM 2B02A 4HJ6A 5IT5A 4ETZA 1DP6A 2ZBBA 4I3JA 1NRJA 3EOIA 2ZOIA 4WEKA 3D72A 1X0OA 2OWHA 4LRYC 4R6LA 3KSIA 3UMEA 4XT2B 2JKRI 2VKSA 2GX5A 1DRMA 2CMNA 2V0WA 3VOLA 1F98A 3O5YA 4UQIM 5TBMB 3OC2A 4I38A 1OTBA 2JKTI 3A0VA 3SW1A 2W1RA 3B42A 1ZHHB 1XFNA 3LR5A 3T50A 4WUJA 3PR6A 5A8BA 1OPXA 1F9IA 1H3QA 1P9WA 3UE6A 2WKPA 2A2LA 5HDCA 3E4OA 1S66L 2NUTC 1EW0A 4MN5A 4F3LA 2L1MA 3GDIA 3C8CA 3JVVA 5F5YA 4FOFA 3FPWA 2PT7A 4HJ3A 3LR0A 4CLCC 3VE3A 2NUPC 2V9AA 2PYPA 4WEJA 2OWJA 3F1OB 4NXEA 4R3AA 2W1TA 3KYQA 1T1AA 2O9BA 3MQQA 2VGLM 2M7UA 3EGXC 4BBUA 3CUEA 1IOUA 2K7SA 5KSHA 4IHQA 2HF6A 2L4RA 2W3HA 4Q0HA 5HWWA 5HDSA 1T18A 3EWKA 5DKKA 3KO6A 2GJ3A 3BQ8A 4O0PA 1N9NA 3LIAA 1V9YA 1UWPX 1IFQA 2VX8A 5AVEA 2B18A 3CITA 1OTEA 1OTDA 4CLCD 1XJ2A 2PR6A 2INWA 5J7EA 4RQ9A 1T19A 2W27A 3NHQA 1OJ5A 2FH5A 3TE8A 3W2ZA 3EGDC 5F68A 2W0NA 3UB9A 2W3FA 3BWLA 4BJPA 3LR3A 2WKRA 2JKRM 3GECA 2QYBA 2WKQA 3T4KA 1YKDA 1YSPA 3FPVA 3KSHA 3S7PA 4WL9A 3E4PA 2KX6A 3MQOA 4JGPA 3ICYA 3S7NA 1NLYA 4L0LA 4OOLA 4UEYA 2K2NA 3P01A 4CLCB 3ZQ5A 1GSXA 4ETXA 2VZWA 4MCWA 4GHIB 1P97A 4G3WA 4KUOA 3V67A 3RTYA 3D3OA 5AJGA 2P04A 3TRCA 3EQUA 4WN5A 4BWIA 4KUKA 4NXFA 1GSVA 3RH8B 1XJ3A 4NKPA 2V1BA 2O99A 4BBTA 5J3WA 2XSSA 4MDZA 5K5BA 3OBFA 4M4XA 5HPIA 3C2WA 4I3IA 3CLOA 2YKHA 4H6JB 1VB6A 3BJNA 1P0ZA 3LI9A 3H82B 5EFWA 1DP9A 4HI4A 4MN6A 3PBRA 3T4LA 3CWFA 4HNBA 3LFVA 3T4JA 5F69A 3S7OA 5HWVA 3G6OA 3CUEC 1OT6A 2FZ0A 4ME4A 3MMHA 1UWNX 3T4SA 4PHTA 2VJWA 2Y8HA 5DFXA 1D06A 2QKPA 4HOIA 1D7EA 1G6OA 3NJAA 4O8GA 2ZMVA 3UMDA 2O9CA 4IUHA 4JGOA 1N9LA 2W3GA 1OJGA 4I39A 4L9EA 4MMNA 5F6AA 2W3EA 1W63M 2K31A 3E4QA 2PDRA 2YKFA 3UB7A 3F1NA 5HZHA 2P08A 3VE4A 4PKYA 3T4QA 2G7UA 3PBTA 1KOUA 4EUVA 3JVUA 4Y3IA 4K08A 4DN0A 2I9VA 3EEAA 3CAXA 4I3AA 1NWZA 2H28A 3PHYA 4BBVA 1BYWA 2R78A 4GLQA 4HH2A 3BW6A 1LL8A 4F3LB 1MKMA 5DF9A 2VV6A 4HH3A 1S4RA 3IS2A 4E04A 2L0WA 5TJJA 4ZRRA 4DJ3A 2GNXA 2P7JA 4Q0JA 2W1TB 1MZUA 2OAP1 3F1NB 3KSFA 3PXPA 2Y79A 3F1PA 2Z6DA 1LSVA 4EERA 1T1CA 2J80A 3U2AA 5IS1A 2XRNA 1ZTUA 2BASA 3PBQA 3C38A 2QWSA 5DFYA 3K2NA 4LLOB 2XROA 1LSWA 2M1CA 1S4SA 3VV4A 4FSFA 3FC7A 2J3WA 4O01A 1TS0A 2EA9A 5HD5A 5LBRA 4IJGA 1STZA 4ARZA 4EXOA 2O9AA 2DMWA 2OOLA 4R38A 4OOMA 2JKTM 4GW9A 2OAQ1 1LT0A 4GS9A 3MJQA 1V9ZA 4NXBA 3PYPA 3RFBA 4P6ZS 4IUKA 1T1BA 3A0RA 4PAUA 2A24A 1TS7A 4XT2A 2XA7S 1G28A 4NXGA 3A0SA 3TJZC 4DMZA 3EEHA 4WLAA 2JHEA 3LIDA 5TBMA 1XJ4A 1UGUA 4WF0A 2HJ9C 3CI6A 4HIAA 4KQOA 3ULFA 3R7WA 4UQIS 1F5MA 3OLOA 4MN7A 5HWTA 3LIBA 1OTIA 1W63Q 5I5LA 2PHYA 2HV1A 4EW7A 5MC7A 3LUQA 2D02A 2EWVA 3MFXA 2QHKA 3PBNA 4ARZB 2KDKA 3NOPC 2XA7M 4GS9B 4G3KA 1N9OA 2D01A 4LRZE 1XFQA 4EU0A 3LICA 2A24B 5HD3A 3E98A 2J3TC 5C5KA 2VLGA 4HP9A 3F1OA 1WA9A 4HY8A 4YOFA 3DBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOI A; 
#chains in the Genus database with same CATH topology
 4KQD A;  4QPR A;  3E0Y A;  3P98 A;  2PBD P;  3QP8 A;  4EES A;  3HLW A;  3IXG A;  3R7W B;  2WK0 A;  5DVA A;  2VGJ A;  4RYE A;  4E6W A;  1XJ6 A;  4XXR A;  4Z1W A;  4Y0T A;  1KDW A;  4LPZ A;  3MZD A;  3UPP A;  1K55 A;  5AQA A;  3G34 A;  3T1R A;  3K3D A;  3MXQ A;  1BLP A;  2XQZ A;  4LV2 A;  5FQQ A;  5GHY A;  4BMW A;  4RX3 A;  3R4K A;  1OME A;  5F82 A;  1PYY A;  1NJ4 A;  1FIK A;  3IF6 C;  2GZA A;  1EWZ A;  3GTC A;  4E3O A;  3Q81 A;  2RL3 A;  5G4Y A;  5FQ9 A;  2ZMF A;  4LRX C;  3H7W B;  3IWI A;  3HJI A;  2LB9 A;  3H9W A;  2V0U A;  1MWR A;  1MY8 A;  5EV0 A;  4L9G A;  4CLC A;  2XR0 A;  3AGD A;  4GJ4 A;  1OTA A;  1TD5 A;  2ZQ9 A;  3MR0 A;  4AFI A;  3LEQ A;  3T4O A;  5EM0 A;  4JGQ A;  3IF6 A;  2OV5 A;  5HSQ A;  1BLC A;  4ZBE A;  4CPK A;  1S1Z A;  4EEU A;  3HCY A;  1ALQ A;  3PAE A;  3BQA A;  3HJK A;  4JKT A;  1H8M A;  1ZKJ A;  2PYR A;  3F1P B;  2WGW B;  4UA9 A;  3MZF A;  2ZM2 A;  2Y2H A;  1YAX A;  3FG8 A;  4P6Z M;  5FEG A;  2B02 A;  5IT5 A;  3RXX A;  5AQ7 A;  3SS5 A;  4I3J A;  3EOI A;  1H0M A;  1W79 A;  2OWH A;  4LRY C;  1TDG A;  3A3I A;  1O07 A;  3WRZ A;  2VKS A;  1DRM A;  2XEP A;  3VOL A;  3NDE A;  1K56 D;  3OC2 A;  1MKI A;  4DDS A;  4P0M A;  1K57 A;  2W1R A;  3FKV A;  1XFN A;  1OPX A;  1WE4 A;  5FQM A;  2WKP A;  1E25 A;  1Q2P A;  5HDC A;  3E4O A;  2NUT C;  3MXS A;  1ESU A;  3GDI A;  3BLM A;  5F5Y A;  4HJ3 A;  1H8Y A;  3ZVT A;  3VE3 A;  4WZ4 A;  5FSR A;  2OWJ A;  5CEB A;  4NXE A;  2W1T A;  1GHP A;  1FCN A;  4KEN B;  1T1A A;  2O9B A;  5GLA A;  3Q1F A;  3EGX C;  5FDH A;  2V2F F;  1RGY A;  3FYZ A;  1G6A A;  1PW1 A;  5KSH A;  2A49 A;  5DKK A;  4S2L A;  3Q7V B;  2Y2I A;  3KO6 A;  2GJ3 A;  3BQ8 A;  4GDB A;  4O0P A;  1N9N A;  3ZFZ A;  4MBF A;  2ZM0 A;  1UWP X;  3S22 A;  3QP4 A;  2B18 A;  3CIT A;  4GD8 A;  4CLC D;  3MSH A;  1KGF A;  4KZ8 A;  2W27 A;  1I5Q A;  1MXO A;  4UHU A;  2V8C A;  4LV0 A;  3NBL A;  3IX3 A;  3NHQ A;  1D1J A;  1ZC2 A;  4DF6 A;  1GA9 A;  3TE8 A;  3W2Z A;  3VP4 A;  1VET B;  2HPB A;  3BFC A;  4BEN A;  1F2K A;  3VSL A;  4JF5 A;  2WKQ A;  1YKD A;  1YSP A;  3HLD A;  3KSH A;  4PM9 A;  3ZHH A;  3S7N A;  1YPR A;  4UEY A;  3P01 A;  1MWT A;  4ZDX A;  1L0G A;  3PAG A;  1GSX A;  4UA6 A;  5FAP A;  1A0K A;  2ZQ8 A;  4OOY A;  5U47 A;  1ERM A;  2JKF A;  3V67 A;  1VM1 A;  3EQU A;  4GN2 A;  4WN5 A;  1H5X A;  4BWI A;  5FQK A;  3U4L P;  1J9M A;  5G18 A;  5BOH A;  4S2P A;  5K5B A;  4Q8I A;  5HPI A;  4FH4 A;  1XGI A;  4H8R A;  4R0Q A;  5AQ9 A;  3BJN A;  4K0W A;  4R4R A;  1P0Z A;  3LI9 A;  3H82 B;  4PM7 A;  2XH9 A;  4OON A;  3UDF A;  3T4J A;  4NK3 A;  1MPL A;  2IWC A;  4IED A;  4JXV A;  3N8L A;  2BG1 A;  3L7H A;  2VJW A;  1XA7 A;  1YLW A;  1D7E A;  2DNS A;  2ZQA A;  4KZ7 A;  1N9L A;  2W3G A;  2Q0O A;  4L9E A;  4HES A;  3SZT A;  3C4O A;  2W3E A;  2K31 A;  4BLM A;  3UB7 A;  2PAV P;  2Y2M A;  5EVI C;  4WMC A;  3ITA A;  2PRF A;  3MXR A;  2XLN A;  2WAF A;  1TVF A;  4PKY A;  3T4Q A;  4FH2 A;  5DF7 A;  4K08 A;  4DN0 A;  3WS1 A;  4I3A A;  1BUE A;  2H28 A;  5EE8 A;  3QNB A;  4HH2 A;  3M2K A;  1LL8 A;  2QZ6 A;  1MKM A;  2VV6 A;  2C6W B;  1IYS A;  1LHY A;  1S4R A;  3SH8 A;  5L09 A;  3ZCZ A;  5FAQ A;  3DTE A;  4BD1 A;  4Q0J A;  4DRT A;  1S6R A;  1LL5 A;  2OAP 1;  3PXP A;  5CGW A;  3UNW A;  4EER A;  2J80 A;  5IS1 A;  2QWS A;  2PBY A;  3UE0 A;  2XRO A;  3UPO A;  1S4S A;  5CED A;  3T1S A;  2J9O A;  3FC7 A;  3T1Q B;  3DAV A;  5HD5 A;  5LBR A;  3P09 A;  1STZ A;  4EBP A;  2ZC4 B;  5HX9 A;  3BFG A;  1E4D A;  3DWK A;  2OAQ 1;  2WKE A;  3RFB A;  4P6Z S;  1T1B A;  1FCO A;  3A0S A;  3TJZ C;  2ZD8 A;  3EEH A;  3NC8 A;  1RCJ A;  2X02 A;  5FAT A;  2QMI A;  4LGW A;  1SZV A;  4KQO A;  2WKH A;  3GSG A;  3WS0 A;  4O7D A;  4MN7 A;  2PHY A;  1C3B A;  2OSU A;  1K4E A;  4X55 A;  3E2K A;  1IYO A;  2X71 A;  2EX2 A;  1L0E A;  3IXH A;  5HD3 A;  5DF8 A;  2VK3 A;  2VLG A;  4D60 A;  4KZ3 A;  3F1O A;  1XA1 A;  1Q2Q A;  1ODV A;  5CHM A;  3IXD A;  4L9F A;  3I7J A;  3SOI A;  3IQA A;  4EBL A;  4BQM A;  2FFY A;  5CGS A;  1TF1 A;  4WMC D;  3ZYT A;  4ID4 A;  2ZLY A;  4YIN A;  1XP4 A;  4PM5 A;  3LI8 A;  2QJ7 A;  1ZG4 A;  3MF0 A;  3PBO A;  4S2O A;  4OPZ A;  4FUW A;  1PRQ A;  2QJ5 A;  3UE3 A;  3A3E A;  3ITB A;  1ZG6 A;  3K3C A;  5J4E A;  3IBJ A;  5FI7 A;  4Y5F A;  1SKO A;  2WAD A;  1GSW A;  2HGV A;  5JYP A;  2EXA A;  4ZJ2 A;  4EQ1 A;  3ZG5 A;  5EOO A;  3PBS A;  3HLG A;  3OCN A;  1K38 A;  4EET B;  4F94 A;  5EEC A;  3LIF A;  1OT9 A;  1I2S A;  3OPL A;  3DWZ A;  4GHI A;  3G30 A;  1YLP A;  1MBL A;  2ZL1 B;  3C4P A;  2J8Y A;  4DXC A;  3KX0 X;  1MC0 A;  4OP8 A;  4QY6 A;  3GVB A;  4FCF A;  4KZ9 A;  4DJ2 A;  3UB5 P;  4HHD A;  3HUO A;  4Y2F A;  3BYD A;  1GA0 A;  4EEP A;  2VA0 A;  4OVD A;  2BTF P;  2XF3 A;  2PD7 A;  3S7Q A;  5DJT A;  4OQI A;  4X68 A;  2PD8 A;  5HPF A;  4YNR A;  4KZ5 A;  4HJ6 A;  5KSC A;  4ETZ A;  2ZBB A;  5E2E A;  1JWP A;  3QP6 A;  3IF6 B;  1DJC A;  3UME A;  4KG6 A;  1PW8 A;  1MWS A;  4B88 A;  3VFH A;  3CPT B;  4M3K A;  3GR2 A;  1K56 A;  4UQI M;  1OTB A;  2JKT I;  3N7W A;  3SW1 A;  2Y2L A;  4ZAM A;  5A93 A;  1ZHH B;  1CK3 A;  3VP1 A;  4WUJ A;  2HDS A;  5A8B A;  3IH9 A;  1P9W A;  2XGN A;  3UE6 A;  1NYY A;  3RJU A;  3HLF A;  4X6T A;  4JXG A;  1YLZ A;  3CG5 A;  1QME A;  3WWX A;  3UE1 A;  1XKZ A;  3C8C A;  2PT7 A;  2UV0 E;  1BT5 A;  3LR0 A;  4CLC C;  2NUP C;  2PYP A;  4Y7P A;  5HAR A;  2Q9M A;  4R3A A;  1CEF A;  3CMZ A;  5E2G A;  5FQI A;  3V5M A;  3C7V A;  4LCM A;  4BBU A;  4S2I A;  4IHQ A;  4GZB A;  4Q0H A;  1T18 A;  3HUN A;  3EWK A;  4OLG A;  3NEC A;  4X53 A;  1XJ2 A;  2HP6 A;  3MS6 A;  1YMX A;  2JCH A;  1OJ5 A;  5F1F A;  2ZQC A;  1N4O A;  4KZ4 A;  2W3F A;  4BJP A;  3A3F A;  3CJM A;  3GEC A;  3ZNY A;  3T4K A;  3FPV A;  3S7P A;  3FZC A;  4WL9 A;  3MQO A;  3BM6 A;  4L0L A;  4S2N A;  3HLE A;  3WS4 A;  1SDE A;  1K57 C;  4DE3 A;  3L9K A;  4G3W A;  5F1G A;  4Z9Q A;  3RTY A;  2HDQ A;  5I94 A;  3W4Q A;  4D2O A;  2Y2Q A;  3N8R A;  4BBT A;  4EBN A;  4MDZ A;  3OBF A;  4IBX A;  4I3I A;  1KGE A;  3CLO A;  4H6J B;  3BFF A;  5L07 A;  1RGZ A;  1KE3 A;  4MN6 A;  3PBR A;  1YM1 A;  3WS2 A;  3OPP A;  5F69 A;  3S7O A;  2IWD A;  3G6O A;  1OT6 A;  2EX8 A;  2FZ0 A;  3NCK A;  4GB7 A;  5AQB A;  1D06 A;  1NYM A;  4GKU A;  4HOI A;  1WYC A;  3NJA A;  4YFM A;  1PWD A;  1ESI A;  3SS4 A;  3UMD A;  4HBU A;  2HDU A;  5FA7 A;  1BSG A;  4MMN A;  5TGF A;  1SKF A;  4E3J A;  2YKF A;  4QU3 A;  4IVI A;  1BTL A;  3F1N A;  1ES3 A;  1Y4O A;  1GHI A;  3VOY A;  2Y2O A;  3N4I A;  3GV9 A;  4KZA A;  2I9V A;  1JWZ A;  3EEA A;  3S4X A;  3PHY A;  2JBF A;  1YMS A;  2E8J A;  4F3L B;  4R1G A;  3D9Y A;  3IHB A;  3QP2 A;  1PIO A;  3E2L A;  2L0W A;  4ZRR A;  4KQQ A;  3QNC A;  3IH8 A;  2GNX A;  2P7J A;  3SH7 A;  3MBZ A;  2Y79 A;  3F1P A;  2OLV A;  2WGW A;  1T1C A;  1VEU B;  2XRN A;  2BAS A;  3PBQ A;  5DFY A;  3D4F A;  3K2N A;  4C6Y A;  2M1C A;  5EM1 A;  3JPU A;  2DMW A;  4R38 A;  2OOL A;  1K54 A;  4QY5 A;  1M6K A;  4E3N A;  2H10 A;  3A3J A;  4JBF A;  3PYP A;  5EVI B;  2ZC3 B;  1AWI A;  1TS7 A;  4GD6 A;  2G2U A;  2XA7 S;  2H5S A;  4NXG A;  5HAP A;  3ZG8 B;  5TFQ A;  4HBT A;  4R4S A;  4NG2 A;  3KYE A;  4UQI S;  1F5M A;  3ISG A;  3UDX A;  3UN7 A;  5I5L A;  1AXB A;  1G68 A;  2HV1 A;  5MC7 A;  3W8K A;  3PBN A;  1LLB A;  2QHK A;  1L0D A;  4G3K A;  3LY3 A;  2V8F A;  3FKW A;  5CXW A;  5KMW A;  4LRZ E;  2B95 A;  1ES4 A;  4HP9 A;  3S1Y A;  1WA9 A;  3CZD A;  4HY8 A;  3LGO A;  4YOF A;  2ZOH A;  3DBA A;  3MQ0 A;  1K4F A;  4N9K A;  4KZ6 A;  4MBK A;  4HJ4 A;  2GDN A;  3QP5 A;  3OOV A;  2DCF A;  2VGK A;  2ZMA A;  4ESP A;  5EOE A;  4YWZ A;  4X56 A;  3IBR A;  1LSX A;  1NZO A;  2XDM A;  3KYZ A;  1HTZ A;  2P9V B;  3B47 A;  1K6R A;  4GCZ A;  3UB6 A;  2XK1 A;  3G4P A;  1PWC A;  2VV7 A;  4OQG A;  3B33 A;  4LEN A;  3LIE A;  4XUZ A;  4KG2 A;  5HDD A;  3P7N A;  3LY4 A;  5FL3 A;  1CI8 A;  3IXB A;  2X01 A;  1VQQ A;  3ZG7 B;  5DKL A;  2VV8 A;  2Y2K A;  1S67 L;  4DDY A;  4UA7 A;  3WS5 A;  4DE0 A;  4OH0 A;  3BY9 A;  4R70 A;  2Y2N A;  3NIA A;  3T1X A;  4HEF A;  1L2S A;  3NOU C;  4EWF A;  2R9X A;  4ZTK A;  4S2K A;  2Y55 A;  3RXW A;  1DP8 A;  1YSQ A;  3G35 A;  2O0Y A;  3QHY A;  3TOI A;  5G4Z A;  2XD5 A;  4Q0I A;  2EX6 A;  3IS2 B;  3TW8 A;  1SKO B;  4G3V A;  3UO9 A;  4JGR A;  5HAI A;  2MJ6 A;  3H82 A;  5HFO A;  2LB5 A;  3BLS A;  5DTT A;  5L2F A;  3OCL A;  3HRE A;  2ZQ7 A;  4PM8 A;  1HLU P;  2HJE A;  1FSW A;  4MBH A;  4PKY G;  1O7E A;  3UY6 A;  2H0T A;  4I5S A;  1HZO A;  3Q07 A;  4QD4 A;  4ZJ1 A;  4E3K A;  3VP0 A;  3ZG9 B;  1DP6 A;  5J8X A;  3O86 A;  1NRJ A;  5HW3 A;  3LCE A;  2ZOI A;  4WEK A;  4R6L A;  5FI6 A;  4XT2 B;  2JKR I;  2V0W A;  3MKF A;  1F98 A;  3O5Y A;  5TBM B;  4I38 A;  3NUL A;  3A0V A;  4MNR A;  4X1L A;  4N9L A;  3V3R A;  3ZNT A;  3LR5 A;  3VP3 A;  3PR6 A;  1TEM A;  1F9I A;  1H3Q A;  2A2L A;  3PTE A;  1S66 L;  3M6H A;  1EW0 A;  1PZO A;  2L1M A;  2BLS A;  4FOF A;  3UPN A;  3FPW A;  1J3W A;  4FD8 A;  2V9A A;  4WEJ A;  5HL1 A;  4MLL A;  4LV3 A;  3KYQ A;  3ZGA B;  3MQQ A;  2VGL M;  4N92 A;  2EX9 A;  3CUE A;  2K7S A;  2HP9 A;  2W3H A;  1KE0 A;  2JKG A;  4DXB A;  4Y13 A;  1W5D A;  5TR7 A;  1G5U A;  4EV4 A;  3DW0 A;  3LIA A;  1IFQ A;  3HBR A;  5AVE A;  4PMA A;  5CRF A;  3MFD A;  1E3U A;  2INW A;  5J7E A;  2WKI A;  5EVE A;  3DTM A;  4RQ9 A;  1HVB A;  2UWX A;  1Z09 A;  1MWU A;  3EGD C;  4S2M A;  5F68 A;  4BL2 A;  1PI5 A;  2Y59 A;  2Y91 A;  4E3M A;  4DE2 A;  3BWL A;  1ERQ A;  2QYB A;  1HD8 A;  5GHZ A;  4RVA A;  2KX6 A;  5M1A A;  3HLB A;  1LI0 A;  4CLC B;  1CJF A;  4R3B A;  4ETX A;  4MCW A;  1P97 A;  3D3O A;  3IHA A;  3TRC A;  1PWG A;  2ZC5 B;  2G2W A;  4NXF A;  3RH8 B;  4N1X A;  3TSG A;  2V1B A;  5FAO A;  2O99 A;  3VSK A;  2XSS A;  1XXM A;  1LI9 A;  4KG5 A;  4M4X A;  3VFF A;  3C2W A;  2YKH A;  5KZH A;  1VB6 A;  5EFW A;  1DP9 A;  3ZVW A;  2ZM8 A;  2PU2 A;  2HDR A;  4PPR A;  2JC7 A;  5EPH A;  4ME4 A;  3MMH A;  1UWN X;  3V39 A;  4OKP A;  4WBG A;  4OLD A;  3T4S A;  1L3L A;  4PHT A;  5HAQ A;  2XFS A;  4UAA A;  2O9C A;  4IUH A;  4JGO A;  4Y0O A;  1OJG A;  4I39 A;  1CI9 A;  4QB8 A;  2HZ5 A;  5JYO A;  4EQI A;  3E4Q A;  2Q9N A;  5A91 A;  2PDR A;  2IWB A;  5HZH A;  1NY0 A;  4K91 A;  2E8I A;  2P08 A;  2G7U A;  3PBT A;  4EUV A;  4DKI A;  3MKE A;  1U60 A;  3JVU A;  3IWQ A;  1NWZ A;  1FCM A;  5A90 A;  4BBV A;  2R78 A;  4GLQ A;  1FQG A;  4OPR A;  2ZL1 A;  2B5R A;  4E3L A;  5DF9 A;  5E43 A;  4S2N C;  1NZU A;  4E04 A;  2H0Y A;  1E3U D;  3Q82 A;  1K0K A;  1IYP A;  3CHW P;  1SCW A;  2W1T B;  3DTI A;  3F1N B;  4GNU A;  1SHV A;  2Y2J A;  1LSV A;  1SDN A;  3C38 A;  4LLO B;  2ZQD A;  2PU4 A;  4O01 A;  4DE1 A;  2EA9 A;  3WRT A;  4IJG A;  4ARZ A;  2O9A A;  1CEG A;  4GS9 A;  3MJQ A;  1V9Z A;  4NXB A;  5L10 A;  3A0R A;  4PAU A;  5DTK A;  4Y17 A;  2A24 A;  1XPB A;  4DMZ A;  2ACG A;  3CPT A;  4WLA A;  2JHE A;  1XJ4 A;  1DY6 A;  3BFD A;  1UGU A;  4WF0 A;  5CGX A;  4HIA A;  2FFF B;  5A92 A;  3ZDJ A;  4E3I A;  3R7W A;  5HWT A;  1W8Y A;  3A3D A;  3LIB A;  1W63 Q;  2EWV A;  2KDK A;  3NOP C;  1DJA A;  3ZG0 A;  1JVJ A;  4OPQ A;  1H8Z A;  4P85 A;  2D01 A;  4EU0 A;  5E2F A;  4E6X A;  5C5K A;  2Y4A A;  3SH9 A;  4KQR A;  2ZJ9 A;  1BZA A;  1CQA A;  1YLT A;  1KDS A;  1VHM A;  3BEB A;  1ONH A;  5L8M A;  3T4T A;  1BLH A;  2VGL S;  4WEL A;  1P9R A;  5HL6 A;  1ES2 A;  2VEA A;  3H7W A;  4P6B A;  4CQH A;  3NY4 A;  5CX7 A;  3IX4 A;  1TDL A;  1Y54 A;  1IYQ A;  4HQA A;  4JXW A;  2J3T D;  2PR5 A;  2WUQ A;  5CTM A;  4ZJ3 A;  1JNU A;  4XUX A;  3BRM A;  1NLZ A;  3VMA A;  3O87 A;  1YQS A;  5AVF A;  1PZP A;  3NOT C;  2JN7 A;  3EQV A;  1K54 C;  4WYY A;  1Y28 A;  4FTX A;  1GHM A;  3HUM A;  3LR4 A;  2J7V A;  3KSG A;  4B93 A;  5FAS A;  2KLI A;  5KIZ A;  4CLC E;  2IA2 A;  1N9B A;  4B9O A;  5GL9 A;  1PI4 A;  1S1Y A;  1WYB A;  5GLC A;  3UB8 A;  3BY8 A;  3IWO A;  5DJU A;  4HP4 A;  1JWV A;  1K25 A;  1TS8 A;  2Y2P A;  2W3D A;  2KOI A;  2V1A A;  3UDI A;  4WM9 A;  1JTG A;  2XFT A;  3N8S A;  4X1M A;  1W7F A;  3C30 A;  1GCE A;  2DRW A;  2HP5 A;  1YT4 A;  4JF4 A;  3LYX A;  2Z6C A;  4H6J A;  4JPM A;  2M7V A;  5FI2 A;  2EWW A;  4II7 A;  4C75 A;  4NEE D;  3QP1 A;  3M6B A;  3VP2 A;  4EUZ A;  1TS6 A;  5IU1 A;  4GOG A;  1NRF A;  4NET A;  5DTS A;  1FSY A;  1W8Q A;  3D72 A;  4OQH A;  4GDN A;  1IEM A;  5FQJ A;  3IX8 A;  1X0O A;  3KSI A;  2GX5 A;  2CMN A;  1CF0 A;  5CER A;  3OPR A;  2V20 A;  4K0X A;  5GLD A;  4LFU A;  3B42 A;  4B4Z A;  3T50 A;  1EI5 A;  2CC1 A;  1JTD A;  2Y2G A;  3Q7V A;  1PFL A;  1KGG A;  3W4O A;  3NI9 A;  2WGI A;  4MN5 A;  4F3L A;  3V50 A;  4X25 A;  3JVV A;  5IHV A;  3IT9 A;  5GLB A;  3C5A A;  4IVK A;  3F1O B;  3HLC A;  3G2Z A;  4OP5 A;  2WYX A;  2M7U A;  1VET A;  1VEU A;  4A5R A;  5CHU A;  1IOU A;  3O88 A;  3HVF A;  4QWO A;  5M18 A;  3B3X A;  2WZZ A;  2WAE A;  2HF6 A;  2L4R A;  4QJG A;  5HWW A;  5HDS A;  1IKG A;  2Z2M B;  1K6S A;  1YLJ A;  1YLY A;  1V9Y A;  4S2J A;  4BL3 A;  2VX8 A;  1QMF A;  1OTE A;  1OTD A;  3G31 A;  2PR6 A;  5GHX A;  1ACF A;  4LCL A;  5EVI A;  1PNE A;  1Z6F A;  1T19 A;  2WGV A;  4R3J A;  1KVL A;  1KVM A;  2FH5 A;  3GRJ A;  4QHC A;  3NDG A;  2QPN A;  4B4X A;  2W0N A;  4KZB A;  4IBR A;  3UB9 A;  1ERO A;  4JF6 A;  3LR3 A;  5E2H A;  3M2J A;  2WKR A;  5CEC A;  2JKR M;  2Z2L B;  2P74 A;  3T12 B;  3G2Y A;  3E4P A;  4JGP A;  3ICY A;  1NLY A;  4OOL A;  1FR1 A;  4JLF A;  2K2N A;  3LO7 A;  3ZQ5 A;  3DTK A;  3JYI A;  1FR6 A;  1M40 A;  2EFU A;  2VZW A;  3VOZ A;  4GHI B;  2R9W A;  4KUO A;  4RA7 A;  5AJG A;  2P04 A;  1KE4 A;  1DJB A;  4KUK A;  1GSV A;  1XJ3 A;  4Y15 A;  4NKP A;  1FIL A;  1ES5 A;  5J3W A;  3TG9 A;  3G32 A;  1XX2 A;  4HI4 A;  3T4L A;  3CWF A;  4HNB A;  4U3T A;  2P9V A;  3LFV A;  4U0X A;  5HWV A;  3CUE C;  3V3S A;  1RP5 A;  3O3V A;  1LL9 A;  4U0T A;  4P87 A;  3SS3 A;  2Y8H A;  5DFX A;  2QKP A;  5FEF A;  1G6O A;  4O8G A;  2ZMV A;  3AGF A;  3C7U A;  5F6A A;  3N6I A;  1W63 M;  2AVX A;  2RCX A;  2WZX A;  4RX2 A;  3BEC A;  3VE4 A;  1KOU A;  4Y3I A;  4LV1 A;  3CAX A;  5CHJ A;  4MEZ A;  1BYW A;  5FDS A;  3BW6 A;  5M19 A;  3W4P A;  4R23 A;  3OPH A;  4HH3 A;  4CJN A;  3OZH A;  3IS2 A;  2OLU A;  4C3Q A;  2JE5 A;  3FV7 A;  5TJJ A;  4DJ3 A;  1S0W A;  5EVI D;  2ZC7 A;  1MZU A;  4N1H A;  1BUL A;  3KSF A;  2Z6D A;  3MZE A;  2I72 A;  3U2A A;  5D3O A;  3IF5 A;  3FWL A;  1XGJ A;  1NXY A;  1ZTU A;  4JXS A;  5EUA A;  1LSW A;  1IEL A;  3VV4 A;  4FSF A;  2J3W A;  3Q7Z A;  3LEZ A;  1TS0 A;  4EXO A;  2J9P A;  4OOM A;  2EFX A;  3GMW A;  2EXB A;  2JKT M;  3GQZ A;  4GW9 A;  1LT0 A;  2C5W B;  4WZ5 C;  4OPY A;  4IUK A;  1L0F A;  2A3U A;  4XT2 A;  1G28 A;  1BLS A;  3HL9 A;  3LID A;  5TBM A;  2HJ9 C;  3CI6 A;  5EVL A;  4BD0 A;  3ULF A;  2XD1 A;  2ZC6 B;  5CTN A;  3OLO A;  1OTI A;  4EW7 A;  1IKI A;  3LUQ A;  2D02 A;  3MFX A;  5F83 A;  4ARZ B;  3AGE A;  4WZ5 A;  2XA7 M;  1ONG A;  4GS9 B;  1N9O A;  4Y0U A;  4X69 A;  4PM6 A;  1XFQ A;  3BFE A;  2A24 B;  3LIC A;  1I2W A;  2V1Z A;  3E98 A;  1FOF A;  2J3T C;  1K55 C;  4OQ0 A; 
#chains in the Genus database with same CATH homology
 1ODV A;  3MQ0 A;  4KQD A;  4L9F A;  1VHM A;  4QPR A;  3E0Y A;  4HJ4 A;  4EES A;  5L8M A;  3OOV A;  3R7W B;  3T4T A;  4YWZ A;  2VGL S;  4WEL A;  1TF1 A;  3IBR A;  1XJ6 A;  1LSX A;  1P9R A;  5HL6 A;  3KYZ A;  4Z1W A;  2VEA A;  3H7W A;  4CQH A;  3B47 A;  5CX7 A;  3ZYT A;  4GCZ A;  2ZOH A;  3UB6 A;  2VV7 A;  4HQA A;  2J3T D;  4LPZ A;  3B33 A;  2PR5 A;  3LI8 A;  2QJ7 A;  3LIE A;  3K3D A;  3MXQ A;  5HDD A;  3P7N A;  1JNU A;  3MF0 A;  3PBO A;  5FL3 A;  1NLZ A;  5AVF A;  2QJ5 A;  2JN7 A;  3NOT C;  3UE3 A;  5DKL A;  3EQV A;  4BMW A;  2VV8 A;  3R4K A;  3K3C A;  5J4E A;  1S67 L;  1Y28 A;  3IBJ A;  4Y5F A;  2GZA A;  1GSW A;  2HGV A;  3LR4 A;  5G4Y A;  4EQ1 A;  3KSG A;  4B93 A;  2ZMF A;  5KIZ A;  2KLI A;  3BY9 A;  4LRX C;  4R70 A;  2IA2 A;  4CLC E;  3PBS A;  3H7W B;  4B9O A;  3HJI A;  3OCN A;  2LB9 A;  3NOU C;  4EET B;  3H9W A;  2V0U A;  1S1Y A;  4CLC A;  4L9G A;  3LIF A;  3UB8 A;  3BY8 A;  1OT9 A;  5DJU A;  4GJ4 A;  4HP4 A;  4GHI A;  1TS8 A;  1OTA A;  1TD5 A;  3MR0 A;  4AFI A;  2W3D A;  1DP8 A;  1YSQ A;  2KOI A;  2V1A A;  3T4O A;  2O0Y A;  5G4Z A;  4JGQ A;  3KX0 X;  1MC0 A;  3C30 A;  4Q0I A;  3IS2 B;  5HSQ A;  3TW8 A;  1S1Z A;  4EEU A;  3LYX A;  3HCY A;  4G3V A;  2Z6C A;  3BQA A;  3HJK A;  1H8M A;  4DJ2 A;  4JGR A;  4H6J A;  2MJ6 A;  2PYR A;  4HHD A;  4Y2F A;  2M7V A;  2EWW A;  3F1P B;  3H82 A;  4II7 A;  4EEP A;  4NEE D;  2LB5 A;  2VA0 A;  3OCL A;  2PD7 A;  3S7Q A;  5DJT A;  2HJE A;  4PKY G;  2PD8 A;  1TS6 A;  5IU1 A;  4I5S A;  5HPF A;  4YNR A;  1YAX A;  3FG8 A;  4P6Z M;  2B02 A;  4HJ6 A;  5IT5 A;  4ETZ A;  1DP6 A;  2ZBB A;  4I3J A;  1NRJ A;  3EOI A;  2ZOI A;  4WEK A;  3D72 A;  1X0O A;  2OWH A;  4LRY C;  4R6L A;  3KSI A;  3UME A;  4XT2 B;  2JKR I;  2VKS A;  2GX5 A;  1DRM A;  2CMN A;  2V0W A;  3VOL A;  1F98 A;  3O5Y A;  4UQI M;  5TBM B;  3OC2 A;  4I38 A;  1OTB A;  2JKT I;  3A0V A;  3SW1 A;  2W1R A;  3B42 A;  1ZHH B;  1XFN A;  3LR5 A;  3T50 A;  4WUJ A;  3PR6 A;  5A8B A;  1OPX A;  1F9I A;  1H3Q A;  1P9W A;  3UE6 A;  2WKP A;  2A2L A;  5HDC A;  3E4O A;  1S66 L;  2NUT C;  1EW0 A;  4MN5 A;  4F3L A;  2L1M A;  3GDI A;  3C8C A;  3JVV A;  5F5Y A;  4FOF A;  3FPW A;  2PT7 A;  4HJ3 A;  3LR0 A;  4CLC C;  3VE3 A;  2NUP C;  2V9A A;  2PYP A;  4WEJ A;  2OWJ A;  3F1O B;  4NXE A;  4R3A A;  2W1T A;  3KYQ A;  1T1A A;  2O9B A;  3MQQ A;  2VGL M;  2M7U A;  3EGX C;  4BBU A;  3CUE A;  1IOU A;  2K7S A;  5KSH A;  4IHQ A;  2HF6 A;  2L4R A;  2W3H A;  4Q0H A;  5HWW A;  5HDS A;  1T18 A;  3EWK A;  5DKK A;  3KO6 A;  2GJ3 A;  3BQ8 A;  4O0P A;  1N9N A;  3LIA A;  1V9Y A;  1UWP X;  1IFQ A;  2VX8 A;  5AVE A;  2B18 A;  3CIT A;  1OTE A;  1OTD A;  4CLC D;  1XJ2 A;  2PR6 A;  2INW A;  5J7E A;  4RQ9 A;  1T19 A;  2W27 A;  3NHQ A;  1OJ5 A;  2FH5 A;  3TE8 A;  3W2Z A;  3EGD C;  5F68 A;  2W0N A;  3UB9 A;  2W3F A;  3BWL A;  4BJP A;  3LR3 A;  2WKR A;  2JKR M;  3GEC A;  2QYB A;  2WKQ A;  3T4K A;  1YKD A;  1YSP A;  3FPV A;  3KSH A;  3S7P A;  4WL9 A;  3E4P A;  2KX6 A;  3MQO A;  4JGP A;  3ICY A;  3S7N A;  1NLY A;  4L0L A;  4OOL A;  4UEY A;  2K2N A;  3P01 A;  4CLC B;  3ZQ5 A;  1GSX A;  4ETX A;  2VZW A;  4MCW A;  4GHI B;  1P97 A;  4G3W A;  4KUO A;  3V67 A;  3RTY A;  3D3O A;  5AJG A;  2P04 A;  3TRC A;  3EQU A;  4WN5 A;  4BWI A;  4KUK A;  4NXF A;  1GSV A;  3RH8 B;  1XJ3 A;  4NKP A;  2V1B A;  2O99 A;  4BBT A;  5J3W A;  2XSS A;  4MDZ A;  5K5B A;  3OBF A;  4M4X A;  5HPI A;  3C2W A;  4I3I A;  3CLO A;  2YKH A;  4H6J B;  1VB6 A;  3BJN A;  1P0Z A;  3LI9 A;  3H82 B;  5EFW A;  1DP9 A;  4HI4 A;  4MN6 A;  3PBR A;  3T4L A;  3CWF A;  4HNB A;  3LFV A;  3T4J A;  5F69 A;  3S7O A;  5HWV A;  3G6O A;  3CUE C;  1OT6 A;  2FZ0 A;  4ME4 A;  3MMH A;  1UWN X;  3T4S A;  4PHT A;  2VJW A;  2Y8H A;  5DFX A;  1D06 A;  2QKP A;  4HOI A;  1D7E A;  1G6O A;  3NJA A;  4O8G A;  2ZMV A;  3UMD A;  2O9C A;  4IUH A;  4JGO A;  1N9L A;  2W3G A;  1OJG A;  4I39 A;  4L9E A;  4MMN A;  5F6A A;  2W3E A;  1W63 M;  2K31 A;  3E4Q A;  2PDR A;  2YKF A;  3UB7 A;  3F1N A;  5HZH A;  2P08 A;  3VE4 A;  4PKY A;  3T4Q A;  2G7U A;  3PBT A;  1KOU A;  4EUV A;  3JVU A;  4Y3I A;  4K08 A;  4DN0 A;  2I9V A;  3EEA A;  3CAX A;  4I3A A;  1NWZ A;  2H28 A;  3PHY A;  4BBV A;  1BYW A;  2R78 A;  4GLQ A;  4HH2 A;  3BW6 A;  1LL8 A;  4F3L B;  1MKM A;  5DF9 A;  2VV6 A;  4HH3 A;  1S4R A;  3IS2 A;  4E04 A;  2L0W A;  5TJJ A;  4ZRR A;  4DJ3 A;  2GNX A;  2P7J A;  4Q0J A;  2W1T B;  1MZU A;  2OAP 1;  3F1N B;  3KSF A;  3PXP A;  2Y79 A;  3F1P A;  2Z6D A;  1LSV A;  4EER A;  1T1C A;  2J80 A;  3U2A A;  5IS1 A;  2XRN A;  1ZTU A;  2BAS A;  3PBQ A;  3C38 A;  2QWS A;  5DFY A;  3K2N A;  4LLO B;  2XRO A;  1LSW A;  2M1C A;  1S4S A;  3VV4 A;  4FSF A;  3FC7 A;  2J3W A;  4O01 A;  1TS0 A;  2EA9 A;  5HD5 A;  5LBR A;  4IJG A;  1STZ A;  4ARZ A;  4EXO A;  2O9A A;  2DMW A;  2OOL A;  4R38 A;  4OOM A;  2JKT M;  4GW9 A;  2OAQ 1;  1LT0 A;  4GS9 A;  3MJQ A;  1V9Z A;  4NXB A;  3PYP A;  3RFB A;  4P6Z S;  4IUK A;  1T1B A;  3A0R A;  4PAU A;  2A24 A;  1TS7 A;  4XT2 A;  2XA7 S;  1G28 A;  4NXG A;  3A0S A;  3TJZ C;  4DMZ A;  3EEH A;  4WLA A;  2JHE A;  3LID A;  5TBM A;  1XJ4 A;  1UGU A;  4WF0 A;  2HJ9 C;  3CI6 A;  4HIA A;  4KQO A;  3ULF A;  3R7W A;  4UQI S;  1F5M A;  3OLO A;  4MN7 A;  5HWT A;  3LIB A;  1OTI A;  1W63 Q;  5I5L A;  2PHY A;  2HV1 A;  4EW7 A;  5MC7 A;  3LUQ A;  2D02 A;  2EWV A;  3MFX A;  2QHK A;  3PBN A;  4ARZ B;  2KDK A;  3NOP C;  2XA7 M;  4GS9 B;  4G3K A;  1N9O A;  2D01 A;  4LRZ E;  1XFQ A;  4EU0 A;  3LIC A;  2A24 B;  5HD3 A;  3E98 A;  2J3T C;  5C5K A;  2VLG A;  4HP9 A;  3F1O A;  1WA9 A;  4HY8 A;  4YOF A;  3DBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...