5AVEA

The ligand binding domain of mlp37 with serine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
SVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRSTLIHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 82
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5aveA02
1GSXA 3RH8B 4EEPA 1XFNA 4WN5A 3MR0A 4KUKA 3LICA 4I3JA 1DP8A 1OTIA 2GJ3A 2A24B 5DKKA 1XFQA 4RQ9A 4HI4A 4GHIA 2D01A 5IU1A 2VV7A 1UWPX 4NXBA 5A8BA 2ZBBA 3LIFA 2I9VA 1EW0A 3VE4A 2ZOIA 3LI8A 3FC7A 2EA9A 3F1NA 3PHYA 5TBMA 1UGUA 4F3LA 3EWKA 3P7NA 4NXGA 4WLAA 5HZHA 4WF0A 3UMDA 3H7WA 3LIEA 4JGOA 3MFXA 1VB6A 2D02A 5HWTA 4GHIB 4H6JA 1DRMA 2P7JA 1TS0A 3E4QA 2PD7A 2PR6A 4HJ3A 2PYPA 3C8CA 4NXEA 1LSWA 4HIAA 4I39A 2YKHA 4HH3A 3F1NB 5TBMB 4K08A 4F3LB 3B33A 4JGPA 1T18A 3NOUC 1GSWA 1TS8A 3A0RA 2V9AA 3H7WB 3GECA 3IS2A 5DKLA 1S4RA 2VEAA 3LIDA 4EW7A 4H6JB 2V1AA 3MQOA 2JHEA 1N9LA 3A0SA 4LRXC 1ODVA 4B9OA 5HSQA 4I38A 3T50A 4WUJA 3BY8A 4MN5A 4HH2A 4M4XA 3G6OA 1WA9A 4GCZA 3MQQA 1D06A 4HHDA 5AVFA 3UMEA 5AVEA 2OOLA 3IS2B 3C2WA 3E4OA 1X0OA 2L1MA 3K3DA 4LPZA 1DP6A 4YWZA 1LSVA 3MJQA 3SW1A 3EEHA 3ZQ5A 3UB7A 4MN6A 1LL8A 5HDSA 1OT6A 3H9WA 4E04A 2VLGA 1OTDA 4DJ2A 1P97A 1XJ3A 2OWHA 5HD5A 5HWWA 4JGQA 5F6AA 3PYPA 5EFWA 3UB6A 2WKQA 3CLOA 2V0WA 5G4YA 3H82A 2QJ7A 4HP4A 1MZUA 1OTEA 2KX6A 2QWSA 4HP9A 4JGRA 1T19A 4XT2B 4EEUA 2W27A 5IS1A 1S1YA 4GW9A 2B02A 5DJUA 3BY9A 4PKYG 3RTYA 2Z6DA 2M1CA 4BBTA 3ULFA 2OWJA 5I5LA 2JN7A 1S67L 2ZOHA 1S1ZA 3NHQA 4BBVA 1F98A 2PDRA 5G4ZA 3UB8A 4EERA 2CMNA 2WKPA 2KDKA 4HJ6A 5HWVA 3LIAA 4KQDA 3H82B 1V9YA 2H28A 2V0UA 1XJ4A 3HJKA 2INWA 2L0WA 1S4SA 4LLOB 2PHYA 2PR5A 3NOTC 4EXOA 1V9ZA 1F9IA 4HY8A 2QHKA 5HDDA 5F5YA 2VV6A 4R70A 2W0NA 4GS9A 3CWFA 4WL9A 2PYRA 2QKPA 1P0ZA 3HJIA 2Z6CA 1TS6A 4L9EA 3E4PA 1N9NA 1N9OA 3D72A 3F1OA 3VE3A 2K7SA 4HOIA 1LT0A 1NWZA 1BYWA 1DP9A 1Y28A 1S66L 2BASA 4XT2A 4GS9B 4NXFA 4LRYC 4I5SA 5HDCA 2R78A 4EETB 1GSVA 4R38A 3LIBA 1T1BA 2L4RA 3F1OB 3UB9A 5F69A 1T1CA 1T1AA 4I3AA 4EQ1A 1TS7A 3OLOA 3K3CA 2V1BA 5J4EA 3VOLA 4PKYA 4BBUA 3BWLA 4R6LA 2QJ5A 3LYXA 4L9GA 5DJTA 3LUQA 5J7EA 4I3IA 4L9FA 4DJ3A 3NOPC 4HJ4A 4EESA 3FG8A 3A0VA 4KUOA 3CAXA 4LRZE 1JNUA 4R3AA 1OJGA 3F1PA 1G28A 1XJ6A 2HV1A 2YKFA 2WKRA 3KX0X 1UWNX 1XJ2A 1LSXA 5KIZA 1OTBA 1KOUA 2A24A 1OTAA 1OJ5A 3ICYA 1D7EA 1OT9A 3IBRA 3MXQA 3UE6A 3GDIA 3F1PB 3NJAA 2VV8A 5F68A 4HNBA 2PD8A 5HD3A 5J3WA 4HQAA 3LI9A 2J80A
chains in the Genus database with same CATH superfamily
3HLDA 1GHMA 2JKFA 5L10A 4FD8A 4EEPA 4FH4A 4R4RA 5KSHA 4WN5A 1ZG6A 4KUKA 5DKKA 4RQ9A 3G34A 4GHIA 1ES5A 2HP6A 3BFDA 3G31A 3U4LP 5DF7A 4DE0A 3T4KA 4JF4A 2H5SA 1UWPX 3FV7A 4K91A 1NJ4A 5A8BA 4GNUA 3C7VA 2ZLYA 2WADA 3LI8A 5EOEA 3F1NA 4P6ZS 4KZBA 1UGUA 4OPRA 3R4KA 2XFTA 2V2FF 4II7A 1MY8A 3EGXC 3IBJA 4NXGA 5HZHA 4WF0A 1MWSA 3AGFA 1N4OA 3LIEA 2JE5A 2XDMA 3OPHA 3MFXA 3VSLA 2JKTM 2O9AA 1Y4OA 1XA7A 4X1LA 1SDNA 2HZ5A 2DRWA 3HUOA 3TG9A 1TVFA 1ES4A 1ESIA 3ZGAB 2PR6A 3HLCA 4YOFA 3GTCA 2HJEA 3BRMA 4IJGA 4S2LA 5DTTA 2YKHA 3LY3A 3MKEA 1K57A 2HF6A 4JGPA 1BLSA 4OQHA 1K56A 1RP5A 2Y2GA 1C3BA 3SZTA 3H7WB 2MJ6A 5DKLA 1RGYA 1S4RA 4WZ5C 5DF8A 3G30A 4D60A 4EW7A 3T12B 4H6JB 1L0EA 4KZ3A 4ZBEA 3CG5A 1N9LA 3KO6A 5MC7A 3VFFA 4X68A 4F94A 3MFDA 3QP8A 4KZ9A 3V5MA 4C3QA 4WUJA 4M4XA 4GCZA 2J8YA 3LR4A 3TJZC 1D06A 5AVFA 2ZQDA 1NYMA 3IS2B 3QP6A 1HVBA 2PBYA 1K4FA 1ONHA 5CTMA 2Y2HA 2L1MA 4OPQA 5CECA 4OP5A 4BMWA 1JWPA 3UDXA 3WRTA 3ZDJA 3O86A 2BLSA 3LR3A 5DFYA 1LSVA 2XQZA 1LLBA 1M40A 5F82A 1ZG4A 2UWXA 5AJGA 2W3FA 1OT6A 4S2NA 4GJ4A 1OTDA 4CLCC 4DJ2A 3JYIA 1XJ3A 4EBLA 4KQOA 2WYXA 3GQZA 3UB6A 4NK3A 2PU2A 1LI0A 5E2GA 4JKTA 1KE4A 1F5MA 2ACGA 4UQIM 4X53A 5HFOA 4Q0IA 4G3KA 1G6AA 1H3QA 1KGGA 2ZC7A 2M1CA 2VKSA 5J8XA 4NEED 5FDSA 3ULFA 4HBUA 2JN7A 5TGFA 1MWUA 3SH8A 2XFSA 2ZOHA 5I94A 3PBSA 1CI9A 1PWCA 5HX9A 5G4ZA 3HUMA 5FA7A 5CHJA 3S4XA 3ZG9B 3MZDA 5FI2A 1S6RA 5FQJA 4KQDA 1K54A 3A3IA 1H8YA 3H82B 1V9YA 5E2EA 1XJ4A 1YMSA 4MLLA 2OLUA 2E8IA 2PHYA 4LV0A 2ZM2A 3ZNTA 1IYPA 3HREA 4WL9A 4FTXA 4HBTA 4WM9A 4JLFA 4QY5A 4WEKA 1LL5A 4L9EA 3E4PA 4E6XA 1N9NA 4ARZA 5GLAA 4JXWA 3F1OA 4S2IA 2A49A 4LV3A 1YLWA 4L0LA 1JVJA 5FEGA 4HOIA 5CGWA 1WE4A 1YKDA 4O0PA 3MF0A 1LT0A 5CXWA 1Q2PA 3K2NA 4Y13A 5FSRA 1QMFA 1CJFA 1JTDA 3SS3A 4NXFA 4LRYC 3LCEA 1CQAA 4U0TA 3RXWA 1SDEA 2KLIA 1SKFA 4JXSA 4R38A 3LIBA 2J7VA 1H0MA 5GLCA 2ZC4B 5F1GA 2ZMVA 5FQ9A 4BD0A 1FSWA 2WAEA 1T1CA 4GDBA 2E8JA 4I3AA 1IYSA 1MBLA 4EQ1A 1L3LA 4XUXA 2OAP1 4JXVA 4GN2A 4EWFA 2V1BA 4EBPA 1ES2A 4PKYA 3LEQA 1K55A 4R6LA 1JTGA 3O87A 1Q2QA 3IF6A 4I3IA 5L09A 3PAGA 3GRJA 4X55A 5KZHA 2EFXA 2RL3A 3FG8A 4S2JA 1IKGA 3PBTA 4CPKA 4UEYA 3D3OA 4LRZE 1JNUA 4R3AA 1G28A 4NKPA 1ERQA 3IX8A 1J3WA 2ZM0A 2JCHA 4IVKA 3KX0X 3KYEA 3VSKA 2EWWA 1YLJA 1LSXA 4EUVA 2FZ0A 5EVID 1MXOA 3S7OA 2Y2PA 3MBZA 5IHVA 3D4FA 1OTBA 2HJ9C 3SH7A 1XP4A 2Y91A 3HLWA 2WK0A 4B88A 1OTAA 5F1FA 4PM6A 1K56D 3ICYA 4LV2A 3TRCA 3MXQA 1FIKA 5HL1A 3F1PB 5K5BA 2R9WA 3T4LA 5HARA 2ZMAA 3QP2A 3DTKA 3EEAA 4ETXA 2PD8A 3GV9A 1W63M 2FH5A 3OZHA 4Y17A 3IXDA 5CTNA 2GDNA 1XFNA 2XSSA 2H10A 4BWIA 3LICA 1K25A 3BQ8A 2GJ3A 4FOFA 3A3DA 2A24B 4GDNA 5A91A 3G2ZA 2PT7A 2WGWB 4Y5FA 2Y8HA 3UDIA 4LCLA 3HVFA 5IU1A 1CF0A 2EX6A 2VV7A 2C6WB 1YT4A 4ZRRA 2I9VA 1W7FA 1EW0A 3VE4A 3P98A 2EA9A 3PHYA 3O5YA 2I72A 1NY0A 1NXYA 4F3LA 3EWKA 4WZ4A 2ZC3B 4N1XA 3IHAA 3DBAA 3D9YA 3B3XA 4GD8A 4WZ5A 1NLYA 2JKGA 1VB6A 1LHYA 2D02A 5HWTA 4GHIB 2J9OA 4PM9A 5DTKA 1MWTA 1DRMA 1TS0A 2PD7A 1WYCA 3W2ZA 4KG2A 2PYPA 2X71A 1LSWA 1FCNA 3OPLA 3UE3A 4HIAA 5FQQA 1SKOB 1IKIA 2OV5A 2Q9MA 4X69A 4I39A 4GB7A 1G68A 4HH3A 3F1NB 4XUZA 2OLVA 4PM8A 3E0YA 1TF1A 4LENA 1T18A 2Y2KA 3C30A 1GSWA 3A0RA 2V9AA 4A5RA 3GECA 3HL9A 3MZEA 2O9BA 3TSGA 4DRTA 3CJMA 2WGWA 3L7HA 3KSHA 3UPOA 3S7QA 1KGEA 2JHEA 1YM1A 3CUEC 4R3JA 3FZCA 1TDGA 2OAQ1 3BLMA 5CGSA 3IWOA 4H8RA 1ODVA 4N1HA 4S2MA 2H0YA 3FWLA 3P09A 4WMCA 3G4PA 2WAFA 3RFBA 3HBRA 1QMEA 4HH2A 4B4XA 2V20A 1PWDA 5AVEA 4OOMA 5JYOA 1W5DA 1O07A 4WELA 3C4PA 1YQSA 1ACFA 2ZQ9A 4YWZA 3MJQA 2ZC6B 1GA9A 1P9WA 4OKPA 3N8LA 1IOUA 1SKOA 1K4EA 3EEHA 3IX3A 4PM7A 5M19A 1S0WA 4KG6A 4MN6A 1LL8A 4BLMA 4EBNA 1OPXA 5FDHA 2Y2OA 3H9WA 1BULA 2VLGA 2XEPA 3KSGA 2H0TA 4B93A 4OVDA 4Q0HA 4Z9QA 2X01A 4O8GA 5G4YA 1PNEA 1G5UA 2W3EA 1KDWA 1OTEA 1T19A 2DNSA 4XT2B 4LGWA 4EEUA 2W27A 5IS1A 4Q0JA 2Y79A 4GW9A 1BSGA 3FYZA 4WYYA 1HLUP 2IWCA 3IHBA 1S67L 2PDRA 3QP5A 3UB8A 4EERA 2CMNA 2WKPA 3MQ0A 3CHWP 3ZYTA 3VP1A 2KDKA 3LIAA 3MXRA 2INWA 1S4SA 1F2KA 1I2SA 2W3GA 2WUQA 1MKIA 4DXBA 3OOVA 5AQAA 5F5YA 4N9KA 4UHUA 2JKRI 5E2FA 2XD5A 2V8FA 4DDSA 2PYRA 1P0ZA 2Z6CA 2Y2JA 4S2OA 5FAQA 5FAPA 4JXGA 4MDZA 2RCXA 1PRQA 1IYOA 4ID4A 3LFVA 4OLGA 1N9OA 1U60A 3A3FA 2VZWA 1W63Q 4YFMA 5GHXA 2FFFB 5FATA 4E3JA 4HESA 1NWZA 2W3DA 3V50A 3G32A 1CI8A 5GLDA 4ETZA 1DP9A 1Y28A 5CHMA 2BASA 1IELA 1FR1A 4XT2A 3CMZA 2WZXA 2ZD8A 2V8CA 2R78A 1VEUA 1GA0A 3KSIA 5F83A 5CEDA 5A92A 1T1BA 4G3WA 1J9MA 5FQMA 2QYBA 4ARZB 3IQAA 2L4RA 3F1OB 1K38A 4E3NA 5GHZA 3OC2A 1T1AA 1XXMA 3O3VA 2HGVA 4GOGA 3WS4A 2O9CA 4ESPA 1YAXA 1BZAA 3ZG8B 4MEZA 3SS5A 1CEGA 1BLCA 3UPNA 4GZBA 4BBUA 3BWLA 1PI5A 5EV0A 3LYXA 4OLDA 4DJ3A 5GL9A 4X6TA 4HJ4A 1N9BA 5FL3A 5TFQA 4LCMA 3C5AA 2HDQA 4NG2A 1BLHA 2HV1A 4QWOA 1FOFA 3QHYA 5EVEA 4MBKA 4OQ0A 1KVLA 3S7NA 4R1GA 1YPRA 3PTEA 4OOLA 3IH8A 1XJ2A 3V3RA 4S2PA 4GKUA 5C5KA 3A3JA 2JKTI 4IVIA 3IF6B 2OSUA 3IT9A 3ZFZA 4U3TA 3SH9A 1OT9A 2XA7M 1FCOA 4MNRA 2ZQ8A 3AGDA 3GDIA 3B42A 4O01A 3BQAA 5EVIC 3LO7A 3NECA 5HD3A 5J3WA 3QP1A 4HQAA 3MMHA 2J80A 1LL9A 3RH8B 4RA7A 2VGLM 1XPBA 4Q8IA 3CI6A 1D1JA 1Z09A 5CHUA 3NULA 2M7VA 2ZMFA 4WMCD 5LBRA 2R9XA 5AQBA 4X1MA 5A90A 4G3VA 4UQIS 4HI4A 1I2WA 4E6WA 1L2SA 2W3HA 1VETA 3V39A 3O88A 5FI7A 2ZBBA 3LIFA 3NDGA 3EOIA 4BD1A 2ZOIA 4KZ5A 3FC7A 4PHTA 5EM1A 5TBMA 2QMIA 4WLAA 3Q7VB 2W1TB 4DDYA 5CERA 4P0MA 4JGOA 3VP2A 2G2WA 3W8KA 5HL6A 4UAAA 1GCEA 1NRFA 3T1QB 4BL3A 3CUEA 1PYYA 4QPRA 3FKVA 4ZJ3A 3BM6A 4NXEA 4N92A 4Z1WA 2Y2NA 3KYZA 1DJCA 5E43A 1YSQA 3RXXA 4K08A 4F3LB 3B33A 5EE8A 2J3WA 2ZL1A 1E25A 1BLPA 2ZQAA 3DTIA 1TS8A 1SZVA 4S2NC 3BFCA 2AVXA 1ZTUA 4P85A 2XK1A 1YLPA 3QNCA 4Y2FA 3WRZA 1DJBA 3MQOA 4CQHA 3M6BA 1VHMA 4OPYA 1E3UA 5HAQA 2Y2LA 3C38A 1YMXA 3A0SA 4LRXC 4B9OA 3IXHA 3T4SA 5DVAA 4GLQA 1PW1A 1KVMA 3BY8A 2VJWA 4HHDA 2OOLA 3N6IA 3Q7VA 1NZOA 2K2NA 2W1TA 5KSCA 3C2WA 3NI9A 5CRFA 3T1RA 2HP5A 4ME4A 3IXBA 4DF6A 2JBFA 4Y0UA 3ITAA 1DP6A 4PMAA 4S2KA 4C75A 1DJAA 1K0KA 2EWVA 4B4ZA 5EPHA 1XA1A 3G2YA 4IUKA 3WS2A 1FSYA 4EUZA 4YINA 1TD5A 5HDSA 3E2LA 1EI5A 3ZG5A 5JYPA 1AWIA 4IBRA 4CLCB 4E3LA 5HAIA 3T1XA 4U0XA 3VV4A 5A93A 2O0YA 4OPZA 2OWHA 3V67A 2Z2MB 2VGKA 4JGQA 4LFUA 3WS1A 3CLOA 2W1RA 2QJ7A 3FPVA 2P74A 2KX6A 4HP9A 4JGRA 5M18A 3ITBA 4JPMA 5EM0A 3BEBA 3BFFA 1W8YA 1S1YA 3QNBA 2B02A 3SS4A 3HLBA 2QZ6A 3RTYA 5FQIA 3EGDC 2OWJA 1LI9A 2VGJA 5I5LA 1S1ZA 4WBGA 1ERMA 3IWIA 2XROA 1F98A 1KE0A 4UA6A 4P6ZM 4C6YA 2XF3A 3NC8A 4DE2A 1FR6A 4HJ6A 3ZNYA 1TDLA 1XGJA 1GHPA 1HD8A 3PBQA 3DWZA 2H28A 3LR5A 2V0UA 1ONGA 3HJKA 3CPTA 5D3OA 4O7DA 4EXOA 1V9ZA 1F9IA 2IWBA 4R70A 2W0NA 3CZDA 1ZKJA 4GS9A 4N9LA 3T4QA 4KQQA 1H8MA 1O7EA 3UNWA 5EUAA 1PWGA 2WKEA 2PRFA 2QKPA 3HJIA 1PZPA 1TS6A 3EQUA 1SHVA 3M2KA 4LV1A 4CLCA 3D72A 2Y2IA 4KG5A 1BUEA 2WKHA 3IH9A 3OCLA 2Y55A 1L0FA 4X56A 2J9PA 1ZC2A 1NZUA 5U47A 3FKWA 3E98A 2J3TD 3UE1A 3LR0A 3TOIA 4I5SA 3QP4A 1CK3A 4ZDXA 4EETB 1GSVA 4PPRA 1EWZA 1XKZA 3V3SA 4ZJ2A 2ZQCA 3IWQA 1K6SA 4E3OA 1TS7A 4IBXA 3K3CA 3PXPA 3L9KA 3IXGA 2G2UA 2HDRA 5J4EA 3T4OA 4K0WA 2PU4A 2QJ5A 4DMZA 5J7EA 3GR2A 3LUQA 3G35A 3NOPC 3PR6A 3UO9A 3UPPA 1VEUB 3IX4A 3A0VA 3M2JA 4FCFA 4KUOA 3CAXA 1AXBA 5EVIA 5DFXA 1YSPA 2FFYA 2YKFA 3Q07A 2WKRA 1PFLA 1UWNX 1I5QA 4KQRA 5TJJA 5CGXA 3R7WA 4IUHA 4FH2A 2XLNA 2HDSA 1BTLA 4UA7A 3OBFA 1IEMA 1KGFA 3UN7A 3VOZA 5EVLA 2NUPC 1DY6A 3HLEA 5GLBA 1OJ5A 3VOYA 1D7EA 1MC0A 2A3UA 3ZHHA 1MWRA 4BENA 2C5WB 5G18A 5F68A 1FQGA 4HNBA 4NETA 3DTMA 3W4PA 5HAPA 3KSFA 1FCMA 1STZA 3DAVA 3LI9A 2XGNA 1E3UD 1GSXA 3HLFA 5FI6A 2ZJ9A 4E3MA 1KE3A 2WZZA 1ZHHB 3MR0A 2B18A 5L07A 5FASA 4I3JA 4ZJ1A 1DP8A 3MXSA 3WS5A 1OTIA 4CJNA 1XFQA 3GVBA 2DMWA 3UY6A 5GHYA 3E2KA 2D01A 5BOHA 3BFGA 5FAOA 1HZOA 4NXBA 2EXBA 1PW8A 4XXRA 3MKFA 3B47A 4PAUA 3DTEA 3HCYA 3C4OA 2X02A 3WWXA 3HUNA 4QJGA 4D2OA 3IF5A 3P7NA 3UMDA 2EX2A 3MSHA 1M6KA 3H7WA 5AQ9A 4CLCE 3S1YA 4RX2A 3BYDA 4BL2A 2DCFA 1OMEA 4H6JA 2XD1A 1NRJA 3TE8A 2P7JA 4MMNA 3E4QA 5DTSA 4EU0A 1VETB 4KZ4A 4HJ3A 1ESUA 3C8CA 3OPPA 3DWKA 2EX8A 3ISGA 5FQKA 3U2AA 1CEFA 4OP8A 5HPIA 3A3EA 5TBMB 2Y2MA 1W79A 4FUWA 3FPWA 3NOUC 3BJNA 3Q82A 4R3BA 3PBNA 5CX7A 1PZOA 3IS2A 2VEAA 4P6BA 3LIDA 3NBLA 2WKIA 4OONA 2V1AA 3N4IA 1ES3A 2VA0A 3ZVTA 2HDUA 3T4TA 3BFEA 3VP4A 4Y7PA 4R4SA 2PAVP 4RYEA 4M3KA 2WGVA 5L8MA 1ALQA 4QD4A 4IHQA 5HSQA 4I38A 4KZAA 4WEJA 2IA2A 4IEDA 1VQQA 1Y54A 2B5RA 1K57C 2A2LA 3T50A 4MN5A 3G6OA 1WA9A 2Y4AA 2ZL1B 3MQQA 4Y0TA 3UE0A 3UMEA 2CC1A 3JVVA 4GD6A 3AGEA 3E4OA 4R23A 4BJPA 1X0OA 1RGZA 3NIAA 4KZ7A 1MPLA 3MZFA 5KMWA 1JWVA 3K3DA 3C7UA 4LPZA 3UB5P 1PI4A 2K31A 4CLCD 3BLSA 3TW8A 2IWDA 4MBHA 3SW1A 3N7WA 3ZQ5A 3UB7A 2Y2QA 3EQVA 2M7UA 2V1ZA 5IT5A 2BG1A 3Q7ZA 1MKMA 2QPNA 1YLYA 2Z2LB 3HLGA 2WGIA 3N8RA 4E04A 3LEZA 1P97A 1G6OA 4DKIA 5HD5A 3WS0A 5HWWA 4DE3A 5F6AA 3PYPA 5EFWA 2WKQA 2XA7S 4EV4A 2V0WA 2P9VB 3H82A 2ZC5B 3DW0A 4JBFA 3ZG7B 4HP4A 4QHCA 1MZUA 3VMAA 5CEBA 2QWSA 1RCJA 5M1AA 4X25A 4RVAA 4QB8A 5DJUA 3BY9A 1GHIA 4YNRA 4PKYG 1H8ZA 2Z6DA 4PM5A 2G7UA 4Y0OA 1HTZA 4BBTA 4DE1A 2VGLS 4HEFA 2B95A 3NHQA 4BBVA 4OOYA 1FILA 3PBRA 3ZG0A 1K6RA 5HWVA 3S22A 3N8SA 4EQIA 1SCWA 3NY4A 2L0WA 3Q81A 4RX3A 4LLOB 3CITA 2PR5A 3NOTC 5E2HA 4HY8A 2QHKA 5HDDA 1L0DA 2VV6A 4P87A 4OQGA 5EOOA 4FSFA 3CWFA 4KZ6A 2VK3A 4DN0A 3ZVWA 2EX9A 2JC7A 3JPUA 2ZQ7A 1E4DA 3JVUA 1Z6FA 1H5XA 2XH9A 4DXCA 3GMWA 2P08A 3RJUA 3VE3A 5AQ7A 1W8QA 1PIOA 2O99A 2LB9A 2K7SA 2ZM8A 2EFUA 3LGOA 1K54C 3CPTB 1EROA 2P9VA 3Q1FA 4MCWA 2GNXA 2HP9A 1BYWA 1S66L 2HPBA 2GX5A 4OH0A 3OPRA 4GS9B 4K0XA 1YLTA 3T4JA 2EXAA 5HDCA 1NLZA 3T1SA 4MN7A 2NUTC 2Q0OA 5FEFA 2LB5A 3UB9A 5F69A 4Y3IA 4UA9A 3KYQA 3VP0A 5HW3A 2J3TC 4BQMA 1XGIA 2Q9NA 3OLOA 5HPFA 3SOIA 3ZCZA 1A0KA 3I7JA 3W4OA 3VOLA 4AFIA 3GSGA 2VX8A 3W4QA 4R0QA 4L9GA 5DJTA 1IYQA 3VFHA 4L9FA 4E3KA 3NDEA 2JKRM 4EESA 4Y15A 1BT5A 3OCNA 5L2FA 4ZAMA 1L0GA 5TR7A 1OJGA 3F1PA 1XJ6A 5EECA 3S7PA 3M6HA 4E3IA 1NYYA 2Y59A 2KOIA 3BECA 3NCKA 2P04A 3PAEA 4ZTKA 5KIZA 4QU3A 1IFQA 5DF9A 4JF5A 4KZ8A 1WYBA 2BTFP 1K55C 1P9RA 4JF6A 1KOUA 2A24A 2XR0A 3IF6C 4QY6A 3LY4A 2XRNA 1YLZA 3IBRA 3PBOA 4MBFA 3UE6A 3BW6A 3MS6A 1KDSA 3NJAA 1VM1A 5EVIB 2VV8A 1JWZA 2UV0E 4KENB 2GZAA 3P01A 3UDFA 2PBDP 1TEMA 3VP3A 1XX2A 3R7WB 4OQIA
chains in the Genus database with same CATH topology
1GSXA 3RH8B 2VGLM 4EEPA 3CI6A 1XFNA 2XSSA 5KSHA 4WN5A 1ZHHB 3MR0A 4KUKA 2B18A 2M7VA 2ZMFA 4BWIA 5LBRA 3LICA 4I3JA 1DP8A 3BQ8A 1OTIA 2GJ3A 4FOFA 2A24B 5DKKA 2PT7A 1XFQA 4G3VA 2DMWA 4RQ9A 4UQIS 4HI4A 4Y5FA 2Y8HA 4GHIA 2D01A 5IU1A 2W3HA 3T4KA 2VV7A 1UWPX 4NXBA 4ZRRA 5A8BA 2ZBBA 3LIFA 3B47A 2I9VA 4PAUA 1EW0A 3VE4A 3EOIA 2ZOIA 3HCYA 3LI8A 3FC7A 2EA9A 3F1NA 4PHTA 3PHYA 3O5YA 4P6ZS 5TBMA 1UGUA 3R4KA 4F3LA 3EWKA 4II7A 3P7NA 3EGXC 3IBJA 4NXGA 4WLAA 5HZHA 4WF0A 3UMDA 2W1TB 3DBAA 3H7WA 3LIEA 4JGOA 3MFXA 1NLYA 2JKTM 4CLCE 1VB6A 2O9AA 5HL6A 2D02A 5HWTA 4GHIB 4H6JA 1NRJA 3TE8A 1DRMA 2P7JA 4MMNA 1TS0A 3CUEA 3E4QA 2PD7A 2PR6A 4QPRA 4EU0A 4YOFA 2HJEA 3W2ZA 4HJ3A 2PYPA 3C8CA 4NXEA 4Z1WA 1LSWA 3UE3A 3KYZA 4HIAA 4IJGA 3U2AA 1YSQA 4I39A 2YKHA 5HPIA 4HH3A 3F1NB 5TBMB 4K08A 2HF6A 4F3LB 3B33A 4JGPA 3E0YA 1TF1A 2J3WA 3FPWA 1T18A 3C30A 3NOUC 1GSWA 3BJNA 1TS8A 3A0RA 3PBNA 3H7WB 2V9AA 2MJ6A 5CX7A 3GECA 3IS2A 5DKLA 1S4RA 2VEAA 2O9BA 3LIDA 1ZTUA 4EW7A 4H6JB 4Y2FA 2V1AA 3MQOA 3KSHA 4CQHA 2VA0A 1VHMA 3S7QA 2JHEA 3CUEC 3T4TA 1N9LA 3KO6A 5MC7A 3C38A 3A0SA 2OAQ1 4LRXC 5L8MA 1ODVA 4B9OA 4IHQA 5HSQA 3T4SA 4I38A 4WEJA 2IA2A 4GLQA 2A2LA 3T50A 3RFBA 4WUJA 3BY8A 4MN5A 4HH2A 4M4XA 3G6OA 2VJWA 1WA9A 4GCZA 3MQQA 3LR4A 3TJZC 1D06A 4HHDA 5AVFA 3UMEA 5AVEA 2OOLA 3JVVA 4OOMA 2K2NA 2W1TA 3IS2B 3C2WA 3E4OA 4ME4A 4BJPA 1X0OA 2L1MA 4BMWA 4WELA 3K3DA 4LPZA 1DP6A 2K31A 3LR3A 5DFYA 4YWZA 4CLCD 1LSVA 2EWVA 3MJQA 3TW8A 1P9WA 4IUKA 1IOUA 3SW1A 3EEHA 3ZQ5A 3UB7A 3EQVA 2M7UA 5IT5A 5AJGA 1MKMA 4MN6A 2W3FA 1LL8A 1TD5A 5HDSA 1OPXA 4CLCB 1OT6A 3H9WA 4GJ4A 3VV4A 4E04A 2VLGA 1OTDA 4CLCC 1P97A 4DJ2A 1G6OA 1XJ3A 2O0YA 2OWHA 5HD5A 3V67A 4KQOA 3KSGA 5HWWA 4JGQA 5F6AA 3PYPA 4B93A 4Q0HA 5EFWA 3UB6A 2WKQA 3CLOA 2XA7S 2W1RA 2V0WA 4O8GA 3H82A 2QJ7A 3FPVA 5G4YA 2W3EA 4HP4A 1MZUA 1OTEA 2KX6A 2QWSA 4HP9A 4JGRA 1T19A 4XT2B 4EEUA 2W27A 5IS1A 4Q0JA 2Y79A 1S1YA 1F5MA 4GW9A 4UQIM 2B02A 4Q0IA 3BY9A 5DJUA 4G3KA 4YNRA 4PKYG 1H3QA 3RTYA 3EGDC 2Z6DA 2M1CA 2G7UA 2VKSA 4NEED 4BBTA 3ULFA 2OWJA 2VGLS 5I5LA 2JN7A 1S67L 2ZOHA 1S1ZA 3PBSA 3NHQA 4BBVA 2XROA 1F98A 2PDRA 5G4ZA 3UB8A 4EERA 2CMNA 2WKPA 4P6ZM 3MQ0A 3ZYTA 3PBRA 2KDKA 4HJ6A 5HWVA 3LIAA 4KQDA 3H82B 3PBQA 1V9YA 2H28A 2V0UA 3LR5A 1XJ4A 3HJKA 2INWA 2L0WA 1S4SA 4LLOB 2W3GA 3CITA 2PHYA 2PR5A 3NOTC 4EXOA 1V9ZA 1F9IA 3OOVA 4HY8A 2QHKA 5HDDA 5F5YA 2VV6A 4R70A 2W0NA 4GS9A 2JKRI 3T4QA 4FSFA 3CWFA 1H8MA 4WL9A 2PYRA 4WEKA 2QKPA 1P0ZA 3HJIA 2Z6CA 1TS6A 3EQUA 4DN0A 4L9EA 3E4PA 4MDZA 3LFVA 3JVUA 1N9NA 1N9OA 4CLCA 4ARZA 3D72A 2VZWA 3F1OA 1W63Q 2P08A 3VE3A 2O99A 2LB9A 3OCLA 4L0LA 2K7SA 4HOIA 1YKDA 4O0PA 1LT0A 3MF0A 1NWZA 4MCWA 2GNXA 2W3DA 3K2NA 4ETZA 1BYWA 1DP9A 1Y28A 1S66L 2BASA 2GX5A 4XT2A 3E98A 2J3TD 4GS9B 3LR0A 3T4JA 4NXFA 4LRYC 4I5SA 5HDCA 2R78A 1NLZA 3KSIA 1GSVA 4EETB 2KLIA 4R38A 3LIBA 1T1BA 4G3WA 4MN7A 2NUTC 2LB5A 2QYBA 2ZMVA 4ARZB 2L4RA 3F1OB 3UB9A 5F69A 1T1CA 4Y3IA 3KYQA 3OC2A 1T1AA 4I3AA 2J3TC 2HGVA 4EQ1A 1TS7A 2OAP1 2O9CA 3OLOA 3K3CA 5HPFA 3PXPA 2V1BA 1YAXA 5J4EA 3VOLA 4AFIA 4PKYA 3T4OA 4BBUA 3BWLA 2VX8A 4R6LA 2QJ5A 4DMZA 3LYXA 4L9GA 5DJTA 3LUQA 5J7EA 4I3IA 4L9FA 4DJ3A 3NOPC 3PR6A 2JKRM 4HJ4A 4EESA 5FL3A 3FG8A 3A0VA 3OCNA 3PBTA 4UEYA 3D3OA 4KUOA 3CAXA 4LRZE 1JNUA 4R3AA 1OJGA 3F1PA 1G28A 4NKPA 5DFXA 1XJ6A 2HV1A 1YSPA 3S7PA 2YKFA 2KOIA 2P04A 2WKRA 3KX0X 1UWNX 5TJJA 2EWWA 3S7NA 4OOLA 3R7WA 1XJ2A 1LSXA 4IUHA 4EUVA 2FZ0A 5KIZA 3S7OA 1IFQA 5DF9A 3OBFA 1OTBA 5C5KA 2HJ9C 2JKTI 1P9RA 1KOUA 2NUPC 2A24A 1OTAA 1OJ5A 3ICYA 2XRNA 1D7EA 1OT9A 3TRCA 2XA7M 3IBRA 3PBOA 3MXQA 3UE6A 1MC0A 3BW6A 3GDIA 3F1PB 3NJAA 5K5BA 2VV8A 3B42A 4O01A 3T4LA 3BQAA 2GZAA 5F68A 4HNBA 3EEAA 4ETXA 3P01A 2PD8A 5HD3A 3KSFA 5J3WA 1W63M 2FH5A 1STZA 4HQAA 3LI9A 3MMHA 3R7WB 2J80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSX A;  3RH8 B;  4EEP A;  1XFN A;  4WN5 A;  3MR0 A;  4KUK A;  3LIC A;  4I3J A;  1DP8 A;  1OTI A;  2GJ3 A;  2A24 B;  5DKK A;  1XFQ A;  4RQ9 A;  4HI4 A;  4GHI A;  2D01 A;  5IU1 A;  2VV7 A;  1UWP X;  4NXB A;  5A8B A;  2ZBB A;  3LIF A;  2I9V A;  1EW0 A;  3VE4 A;  2ZOI A;  3LI8 A;  3FC7 A;  2EA9 A;  3F1N A;  3PHY A;  5TBM A;  1UGU A;  4F3L A;  3EWK A;  3P7N A;  4NXG A;  4WLA A;  5HZH A;  4WF0 A;  3UMD A;  3H7W A;  3LIE A;  4JGO A;  3MFX A;  1VB6 A;  2D02 A;  5HWT A;  4GHI B;  4H6J A;  1DRM A;  2P7J A;  1TS0 A;  3E4Q A;  2PD7 A;  2PR6 A;  4HJ3 A;  2PYP A;  3C8C A;  4NXE A;  1LSW A;  4HIA A;  4I39 A;  2YKH A;  4HH3 A;  3F1N B;  5TBM B;  4K08 A;  4F3L B;  3B33 A;  4JGP A;  1T18 A;  3NOU C;  1GSW A;  1TS8 A;  3A0R A;  2V9A A;  3H7W B;  3GEC A;  3IS2 A;  5DKL A;  1S4R A;  2VEA A;  3LID A;  4EW7 A;  4H6J B;  2V1A A;  3MQO A;  2JHE A;  1N9L A;  3A0S A;  4LRX C;  1ODV A;  4B9O A;  5HSQ A;  4I38 A;  3T50 A;  4WUJ A;  3BY8 A;  4MN5 A;  4HH2 A;  4M4X A;  3G6O A;  1WA9 A;  4GCZ A;  3MQQ A;  1D06 A;  4HHD A;  5AVF A;  3UME A;  5AVE A;  2OOL A;  3IS2 B;  3C2W A;  3E4O A;  1X0O A;  2L1M A;  3K3D A;  4LPZ A;  1DP6 A;  4YWZ A;  1LSV A;  3MJQ A;  3SW1 A;  3EEH A;  3ZQ5 A;  3UB7 A;  4MN6 A;  1LL8 A;  5HDS A;  1OT6 A;  3H9W A;  4E04 A;  2VLG A;  1OTD A;  4DJ2 A;  1P97 A;  1XJ3 A;  2OWH A;  5HD5 A;  5HWW A;  4JGQ A;  5F6A A;  3PYP A;  5EFW A;  3UB6 A;  2WKQ A;  3CLO A;  2V0W A;  5G4Y A;  3H82 A;  2QJ7 A;  4HP4 A;  1MZU A;  1OTE A;  2KX6 A;  2QWS A;  4HP9 A;  4JGR A;  1T19 A;  4XT2 B;  4EEU A;  2W27 A;  5IS1 A;  1S1Y A;  4GW9 A;  2B02 A;  5DJU A;  3BY9 A;  4PKY G;  3RTY A;  2Z6D A;  2M1C A;  4BBT A;  3ULF A;  2OWJ A;  5I5L A;  2JN7 A;  1S67 L;  2ZOH A;  1S1Z A;  3NHQ A;  4BBV A;  1F98 A;  2PDR A;  5G4Z A;  3UB8 A;  4EER A;  2CMN A;  2WKP A;  2KDK A;  4HJ6 A;  5HWV A;  3LIA A;  4KQD A;  3H82 B;  1V9Y A;  2H28 A;  2V0U A;  1XJ4 A;  3HJK A;  2INW A;  2L0W A;  1S4S A;  4LLO B;  2PHY A;  2PR5 A;  3NOT C;  4EXO A;  1V9Z A;  1F9I A;  4HY8 A;  2QHK A;  5HDD A;  5F5Y A;  2VV6 A;  4R70 A;  2W0N A;  4GS9 A;  3CWF A;  4WL9 A;  2PYR A;  2QKP A;  1P0Z A;  3HJI A;  2Z6C A;  1TS6 A;  4L9E A;  3E4P A;  1N9N A;  1N9O A;  3D72 A;  3F1O A;  3VE3 A;  2K7S A;  4HOI A;  1LT0 A;  1NWZ A;  1BYW A;  1DP9 A;  1Y28 A;  1S66 L;  2BAS A;  4XT2 A;  4GS9 B;  4NXF A;  4LRY C;  4I5S A;  5HDC A;  2R78 A;  4EET B;  1GSV A;  4R38 A;  3LIB A;  1T1B A;  2L4R A;  3F1O B;  3UB9 A;  5F69 A;  1T1C A;  1T1A A;  4I3A A;  4EQ1 A;  1TS7 A;  3OLO A;  3K3C A;  2V1B A;  5J4E A;  3VOL A;  4PKY A;  4BBU A;  3BWL A;  4R6L A;  2QJ5 A;  3LYX A;  4L9G A;  5DJT A;  3LUQ A;  5J7E A;  4I3I A;  4L9F A;  4DJ3 A;  3NOP C;  4HJ4 A;  4EES A;  3FG8 A;  3A0V A;  4KUO A;  3CAX A;  4LRZ E;  1JNU A;  4R3A A;  1OJG A;  3F1P A;  1G28 A;  1XJ6 A;  2HV1 A;  2YKF A;  2WKR A;  3KX0 X;  1UWN X;  1XJ2 A;  1LSX A;  5KIZ A;  1OTB A;  1KOU A;  2A24 A;  1OTA A;  1OJ5 A;  3ICY A;  1D7E A;  1OT9 A;  3IBR A;  3MXQ A;  3UE6 A;  3GDI A;  3F1P B;  3NJA A;  2VV8 A;  5F68 A;  4HNB A;  2PD8 A;  5HD3 A;  5J3W A;  4HQA A;  3LI9 A;  2J80 A; 
#chains in the Genus database with same CATH topology
 3HLD A;  1GHM A;  2JKF A;  5L10 A;  4FD8 A;  4EEP A;  4FH4 A;  4R4R A;  5KSH A;  4WN5 A;  1ZG6 A;  4KUK A;  5DKK A;  4RQ9 A;  3G34 A;  4GHI A;  1ES5 A;  2HP6 A;  3BFD A;  3G31 A;  3U4L P;  5DF7 A;  4DE0 A;  3T4K A;  4JF4 A;  2H5S A;  1UWP X;  3FV7 A;  4K91 A;  1NJ4 A;  5A8B A;  4GNU A;  3C7V A;  2ZLY A;  2WAD A;  3LI8 A;  5EOE A;  3F1N A;  4P6Z S;  4KZB A;  1UGU A;  4OPR A;  3R4K A;  2XFT A;  2V2F F;  4II7 A;  1MY8 A;  3EGX C;  3IBJ A;  4NXG A;  5HZH A;  4WF0 A;  1MWS A;  3AGF A;  1N4O A;  3LIE A;  2JE5 A;  2XDM A;  3OPH A;  3MFX A;  3VSL A;  2JKT M;  2O9A A;  1Y4O A;  1XA7 A;  4X1L A;  1SDN A;  2HZ5 A;  2DRW A;  3HUO A;  3TG9 A;  1TVF A;  1ES4 A;  1ESI A;  3ZGA B;  2PR6 A;  3HLC A;  4YOF A;  3GTC A;  2HJE A;  3BRM A;  4IJG A;  4S2L A;  5DTT A;  2YKH A;  3LY3 A;  3MKE A;  1K57 A;  2HF6 A;  4JGP A;  1BLS A;  4OQH A;  1K56 A;  1RP5 A;  2Y2G A;  1C3B A;  3SZT A;  3H7W B;  2MJ6 A;  5DKL A;  1RGY A;  1S4R A;  4WZ5 C;  5DF8 A;  3G30 A;  4D60 A;  4EW7 A;  3T12 B;  4H6J B;  1L0E A;  4KZ3 A;  4ZBE A;  3CG5 A;  1N9L A;  3KO6 A;  5MC7 A;  3VFF A;  4X68 A;  4F94 A;  3MFD A;  3QP8 A;  4KZ9 A;  3V5M A;  4C3Q A;  4WUJ A;  4M4X A;  4GCZ A;  2J8Y A;  3LR4 A;  3TJZ C;  1D06 A;  5AVF A;  2ZQD A;  1NYM A;  3IS2 B;  3QP6 A;  1HVB A;  2PBY A;  1K4F A;  1ONH A;  5CTM A;  2Y2H A;  2L1M A;  4OPQ A;  5CEC A;  4OP5 A;  4BMW A;  1JWP A;  3UDX A;  3WRT A;  3ZDJ A;  3O86 A;  2BLS A;  3LR3 A;  5DFY A;  1LSV A;  2XQZ A;  1LLB A;  1M40 A;  5F82 A;  1ZG4 A;  2UWX A;  5AJG A;  2W3F A;  1OT6 A;  4S2N A;  4GJ4 A;  1OTD A;  4CLC C;  4DJ2 A;  3JYI A;  1XJ3 A;  4EBL A;  4KQO A;  2WYX A;  3GQZ A;  3UB6 A;  4NK3 A;  2PU2 A;  1LI0 A;  5E2G A;  4JKT A;  1KE4 A;  1F5M A;  2ACG A;  4UQI M;  4X53 A;  5HFO A;  4Q0I A;  4G3K A;  1G6A A;  1H3Q A;  1KGG A;  2ZC7 A;  2M1C A;  2VKS A;  5J8X A;  4NEE D;  5FDS A;  3ULF A;  4HBU A;  2JN7 A;  5TGF A;  1MWU A;  3SH8 A;  2XFS A;  2ZOH A;  5I94 A;  3PBS A;  1CI9 A;  1PWC A;  5HX9 A;  5G4Z A;  3HUM A;  5FA7 A;  5CHJ A;  3S4X A;  3ZG9 B;  3MZD A;  5FI2 A;  1S6R A;  5FQJ A;  4KQD A;  1K54 A;  3A3I A;  1H8Y A;  3H82 B;  1V9Y A;  5E2E A;  1XJ4 A;  1YMS A;  4MLL A;  2OLU A;  2E8I A;  2PHY A;  4LV0 A;  2ZM2 A;  3ZNT A;  1IYP A;  3HRE A;  4WL9 A;  4FTX A;  4HBT A;  4WM9 A;  4JLF A;  4QY5 A;  4WEK A;  1LL5 A;  4L9E A;  3E4P A;  4E6X A;  1N9N A;  4ARZ A;  5GLA A;  4JXW A;  3F1O A;  4S2I A;  2A49 A;  4LV3 A;  1YLW A;  4L0L A;  1JVJ A;  5FEG A;  4HOI A;  5CGW A;  1WE4 A;  1YKD A;  4O0P A;  3MF0 A;  1LT0 A;  5CXW A;  1Q2P A;  3K2N A;  4Y13 A;  5FSR A;  1QMF A;  1CJF A;  1JTD A;  3SS3 A;  4NXF A;  4LRY C;  3LCE A;  1CQA A;  4U0T A;  3RXW A;  1SDE A;  2KLI A;  1SKF A;  4JXS A;  4R38 A;  3LIB A;  2J7V A;  1H0M A;  5GLC A;  2ZC4 B;  5F1G A;  2ZMV A;  5FQ9 A;  4BD0 A;  1FSW A;  2WAE A;  1T1C A;  4GDB A;  2E8J A;  4I3A A;  1IYS A;  1MBL A;  4EQ1 A;  1L3L A;  4XUX A;  2OAP 1;  4JXV A;  4GN2 A;  4EWF A;  2V1B A;  4EBP A;  1ES2 A;  4PKY A;  3LEQ A;  1K55 A;  4R6L A;  1JTG A;  3O87 A;  1Q2Q A;  3IF6 A;  4I3I A;  5L09 A;  3PAG A;  3GRJ A;  4X55 A;  5KZH A;  2EFX A;  2RL3 A;  3FG8 A;  4S2J A;  1IKG A;  3PBT A;  4CPK A;  4UEY A;  3D3O A;  4LRZ E;  1JNU A;  4R3A A;  1G28 A;  4NKP A;  1ERQ A;  3IX8 A;  1J3W A;  2ZM0 A;  2JCH A;  4IVK A;  3KX0 X;  3KYE A;  3VSK A;  2EWW A;  1YLJ A;  1LSX A;  4EUV A;  2FZ0 A;  5EVI D;  1MXO A;  3S7O A;  2Y2P A;  3MBZ A;  5IHV A;  3D4F A;  1OTB A;  2HJ9 C;  3SH7 A;  1XP4 A;  2Y91 A;  3HLW A;  2WK0 A;  4B88 A;  1OTA A;  5F1F A;  4PM6 A;  1K56 D;  3ICY A;  4LV2 A;  3TRC A;  3MXQ A;  1FIK A;  5HL1 A;  3F1P B;  5K5B A;  2R9W A;  3T4L A;  5HAR A;  2ZMA A;  3QP2 A;  3DTK A;  3EEA A;  4ETX A;  2PD8 A;  3GV9 A;  1W63 M;  2FH5 A;  3OZH A;  4Y17 A;  3IXD A;  5CTN A;  2GDN A;  1XFN A;  2XSS A;  2H10 A;  4BWI A;  3LIC A;  1K25 A;  3BQ8 A;  2GJ3 A;  4FOF A;  3A3D A;  2A24 B;  4GDN A;  5A91 A;  3G2Z A;  2PT7 A;  2WGW B;  4Y5F A;  2Y8H A;  3UDI A;  4LCL A;  3HVF A;  5IU1 A;  1CF0 A;  2EX6 A;  2VV7 A;  2C6W B;  1YT4 A;  4ZRR A;  2I9V A;  1W7F A;  1EW0 A;  3VE4 A;  3P98 A;  2EA9 A;  3PHY A;  3O5Y A;  2I72 A;  1NY0 A;  1NXY A;  4F3L A;  3EWK A;  4WZ4 A;  2ZC3 B;  4N1X A;  3IHA A;  3DBA A;  3D9Y A;  3B3X A;  4GD8 A;  4WZ5 A;  1NLY A;  2JKG A;  1VB6 A;  1LHY A;  2D02 A;  5HWT A;  4GHI B;  2J9O A;  4PM9 A;  5DTK A;  1MWT A;  1DRM A;  1TS0 A;  2PD7 A;  1WYC A;  3W2Z A;  4KG2 A;  2PYP A;  2X71 A;  1LSW A;  1FCN A;  3OPL A;  3UE3 A;  4HIA A;  5FQQ A;  1SKO B;  1IKI A;  2OV5 A;  2Q9M A;  4X69 A;  4I39 A;  4GB7 A;  1G68 A;  4HH3 A;  3F1N B;  4XUZ A;  2OLV A;  4PM8 A;  3E0Y A;  1TF1 A;  4LEN A;  1T18 A;  2Y2K A;  3C30 A;  1GSW A;  3A0R A;  2V9A A;  4A5R A;  3GEC A;  3HL9 A;  3MZE A;  2O9B A;  3TSG A;  4DRT A;  3CJM A;  2WGW A;  3L7H A;  3KSH A;  3UPO A;  3S7Q A;  1KGE A;  2JHE A;  1YM1 A;  3CUE C;  4R3J A;  3FZC A;  1TDG A;  2OAQ 1;  3BLM A;  5CGS A;  3IWO A;  4H8R A;  1ODV A;  4N1H A;  4S2M A;  2H0Y A;  3FWL A;  3P09 A;  4WMC A;  3G4P A;  2WAF A;  3RFB A;  3HBR A;  1QME A;  4HH2 A;  4B4X A;  2V20 A;  1PWD A;  5AVE A;  4OOM A;  5JYO A;  1W5D A;  1O07 A;  4WEL A;  3C4P A;  1YQS A;  1ACF A;  2ZQ9 A;  4YWZ A;  3MJQ A;  2ZC6 B;  1GA9 A;  1P9W A;  4OKP A;  3N8L A;  1IOU A;  1SKO A;  1K4E A;  3EEH A;  3IX3 A;  4PM7 A;  5M19 A;  1S0W A;  4KG6 A;  4MN6 A;  1LL8 A;  4BLM A;  4EBN A;  1OPX A;  5FDH A;  2Y2O A;  3H9W A;  1BUL A;  2VLG A;  2XEP A;  3KSG A;  2H0T A;  4B93 A;  4OVD A;  4Q0H A;  4Z9Q A;  2X01 A;  4O8G A;  5G4Y A;  1PNE A;  1G5U A;  2W3E A;  1KDW A;  1OTE A;  1T19 A;  2DNS A;  4XT2 B;  4LGW A;  4EEU A;  2W27 A;  5IS1 A;  4Q0J A;  2Y79 A;  4GW9 A;  1BSG A;  3FYZ A;  4WYY A;  1HLU P;  2IWC A;  3IHB A;  1S67 L;  2PDR A;  3QP5 A;  3UB8 A;  4EER A;  2CMN A;  2WKP A;  3MQ0 A;  3CHW P;  3ZYT A;  3VP1 A;  2KDK A;  3LIA A;  3MXR A;  2INW A;  1S4S A;  1F2K A;  1I2S A;  2W3G A;  2WUQ A;  1MKI A;  4DXB A;  3OOV A;  5AQA A;  5F5Y A;  4N9K A;  4UHU A;  2JKR I;  5E2F A;  2XD5 A;  2V8F A;  4DDS A;  2PYR A;  1P0Z A;  2Z6C A;  2Y2J A;  4S2O A;  5FAQ A;  5FAP A;  4JXG A;  4MDZ A;  2RCX A;  1PRQ A;  1IYO A;  4ID4 A;  3LFV A;  4OLG A;  1N9O A;  1U60 A;  3A3F A;  2VZW A;  1W63 Q;  4YFM A;  5GHX A;  2FFF B;  5FAT A;  4E3J A;  4HES A;  1NWZ A;  2W3D A;  3V50 A;  3G32 A;  1CI8 A;  5GLD A;  4ETZ A;  1DP9 A;  1Y28 A;  5CHM A;  2BAS A;  1IEL A;  1FR1 A;  4XT2 A;  3CMZ A;  2WZX A;  2ZD8 A;  2V8C A;  2R78 A;  1VEU A;  1GA0 A;  3KSI A;  5F83 A;  5CED A;  5A92 A;  1T1B A;  4G3W A;  1J9M A;  5FQM A;  2QYB A;  4ARZ B;  3IQA A;  2L4R A;  3F1O B;  1K38 A;  4E3N A;  5GHZ A;  3OC2 A;  1T1A A;  1XXM A;  3O3V A;  2HGV A;  4GOG A;  3WS4 A;  2O9C A;  4ESP A;  1YAX A;  1BZA A;  3ZG8 B;  4MEZ A;  3SS5 A;  1CEG A;  1BLC A;  3UPN A;  4GZB A;  4BBU A;  3BWL A;  1PI5 A;  5EV0 A;  3LYX A;  4OLD A;  4DJ3 A;  5GL9 A;  4X6T A;  4HJ4 A;  1N9B A;  5FL3 A;  5TFQ A;  4LCM A;  3C5A A;  2HDQ A;  4NG2 A;  1BLH A;  2HV1 A;  4QWO A;  1FOF A;  3QHY A;  5EVE A;  4MBK A;  4OQ0 A;  1KVL A;  3S7N A;  4R1G A;  1YPR A;  3PTE A;  4OOL A;  3IH8 A;  1XJ2 A;  3V3R A;  4S2P A;  4GKU A;  5C5K A;  3A3J A;  2JKT I;  4IVI A;  3IF6 B;  2OSU A;  3IT9 A;  3ZFZ A;  4U3T A;  3SH9 A;  1OT9 A;  2XA7 M;  1FCO A;  4MNR A;  2ZQ8 A;  3AGD A;  3GDI A;  3B42 A;  4O01 A;  3BQA A;  5EVI C;  3LO7 A;  3NEC A;  5HD3 A;  5J3W A;  3QP1 A;  4HQA A;  3MMH A;  2J80 A;  1LL9 A;  3RH8 B;  4RA7 A;  2VGL M;  1XPB A;  4Q8I A;  3CI6 A;  1D1J A;  1Z09 A;  5CHU A;  3NUL A;  2M7V A;  2ZMF A;  4WMC D;  5LBR A;  2R9X A;  5AQB A;  4X1M A;  5A90 A;  4G3V A;  4UQI S;  4HI4 A;  1I2W A;  4E6W A;  1L2S A;  2W3H A;  1VET A;  3V39 A;  3O88 A;  5FI7 A;  2ZBB A;  3LIF A;  3NDG A;  3EOI A;  4BD1 A;  2ZOI A;  4KZ5 A;  3FC7 A;  4PHT A;  5EM1 A;  5TBM A;  2QMI A;  4WLA A;  3Q7V B;  2W1T B;  4DDY A;  5CER A;  4P0M A;  4JGO A;  3VP2 A;  2G2W A;  3W8K A;  5HL6 A;  4UAA A;  1GCE A;  1NRF A;  3T1Q B;  4BL3 A;  3CUE A;  1PYY A;  4QPR A;  3FKV A;  4ZJ3 A;  3BM6 A;  4NXE A;  4N92 A;  4Z1W A;  2Y2N A;  3KYZ A;  1DJC A;  5E43 A;  1YSQ A;  3RXX A;  4K08 A;  4F3L B;  3B33 A;  5EE8 A;  2J3W A;  2ZL1 A;  1E25 A;  1BLP A;  2ZQA A;  3DTI A;  1TS8 A;  1SZV A;  4S2N C;  3BFC A;  2AVX A;  1ZTU A;  4P85 A;  2XK1 A;  1YLP A;  3QNC A;  4Y2F A;  3WRZ A;  1DJB A;  3MQO A;  4CQH A;  3M6B A;  1VHM A;  4OPY A;  1E3U A;  5HAQ A;  2Y2L A;  3C38 A;  1YMX A;  3A0S A;  4LRX C;  4B9O A;  3IXH A;  3T4S A;  5DVA A;  4GLQ A;  1PW1 A;  1KVM A;  3BY8 A;  2VJW A;  4HHD A;  2OOL A;  3N6I A;  3Q7V A;  1NZO A;  2K2N A;  2W1T A;  5KSC A;  3C2W A;  3NI9 A;  5CRF A;  3T1R A;  2HP5 A;  4ME4 A;  3IXB A;  4DF6 A;  2JBF A;  4Y0U A;  3ITA A;  1DP6 A;  4PMA A;  4S2K A;  4C75 A;  1DJA A;  1K0K A;  2EWV A;  4B4Z A;  5EPH A;  1XA1 A;  3G2Y A;  4IUK A;  3WS2 A;  1FSY A;  4EUZ A;  4YIN A;  1TD5 A;  5HDS A;  3E2L A;  1EI5 A;  3ZG5 A;  5JYP A;  1AWI A;  4IBR A;  4CLC B;  4E3L A;  5HAI A;  3T1X A;  4U0X A;  3VV4 A;  5A93 A;  2O0Y A;  4OPZ A;  2OWH A;  3V67 A;  2Z2M B;  2VGK A;  4JGQ A;  4LFU A;  3WS1 A;  3CLO A;  2W1R A;  2QJ7 A;  3FPV A;  2P74 A;  2KX6 A;  4HP9 A;  4JGR A;  5M18 A;  3ITB A;  4JPM A;  5EM0 A;  3BEB A;  3BFF A;  1W8Y A;  1S1Y A;  3QNB A;  2B02 A;  3SS4 A;  3HLB A;  2QZ6 A;  3RTY A;  5FQI A;  3EGD C;  2OWJ A;  1LI9 A;  2VGJ A;  5I5L A;  1S1Z A;  4WBG A;  1ERM A;  3IWI A;  2XRO A;  1F98 A;  1KE0 A;  4UA6 A;  4P6Z M;  4C6Y A;  2XF3 A;  3NC8 A;  4DE2 A;  1FR6 A;  4HJ6 A;  3ZNY A;  1TDL A;  1XGJ A;  1GHP A;  1HD8 A;  3PBQ A;  3DWZ A;  2H28 A;  3LR5 A;  2V0U A;  1ONG A;  3HJK A;  3CPT A;  5D3O A;  4O7D A;  4EXO A;  1V9Z A;  1F9I A;  2IWB A;  4R70 A;  2W0N A;  3CZD A;  1ZKJ A;  4GS9 A;  4N9L A;  3T4Q A;  4KQQ A;  1H8M A;  1O7E A;  3UNW A;  5EUA A;  1PWG A;  2WKE A;  2PRF A;  2QKP A;  3HJI A;  1PZP A;  1TS6 A;  3EQU A;  1SHV A;  3M2K A;  4LV1 A;  4CLC A;  3D72 A;  2Y2I A;  4KG5 A;  1BUE A;  2WKH A;  3IH9 A;  3OCL A;  2Y55 A;  1L0F A;  4X56 A;  2J9P A;  1ZC2 A;  1NZU A;  5U47 A;  3FKW A;  3E98 A;  2J3T D;  3UE1 A;  3LR0 A;  3TOI A;  4I5S A;  3QP4 A;  1CK3 A;  4ZDX A;  4EET B;  1GSV A;  4PPR A;  1EWZ A;  1XKZ A;  3V3S A;  4ZJ2 A;  2ZQC A;  3IWQ A;  1K6S A;  4E3O A;  1TS7 A;  4IBX A;  3K3C A;  3PXP A;  3L9K A;  3IXG A;  2G2U A;  2HDR A;  5J4E A;  3T4O A;  4K0W A;  2PU4 A;  2QJ5 A;  4DMZ A;  5J7E A;  3GR2 A;  3LUQ A;  3G35 A;  3NOP C;  3PR6 A;  3UO9 A;  3UPP A;  1VEU B;  3IX4 A;  3A0V A;  3M2J A;  4FCF A;  4KUO A;  3CAX A;  1AXB A;  5EVI A;  5DFX A;  1YSP A;  2FFY A;  2YKF A;  3Q07 A;  2WKR A;  1PFL A;  1UWN X;  1I5Q A;  4KQR A;  5TJJ A;  5CGX A;  3R7W A;  4IUH A;  4FH2 A;  2XLN A;  2HDS A;  1BTL A;  4UA7 A;  3OBF A;  1IEM A;  1KGF A;  3UN7 A;  3VOZ A;  5EVL A;  2NUP C;  1DY6 A;  3HLE A;  5GLB A;  1OJ5 A;  3VOY A;  1D7E A;  1MC0 A;  2A3U A;  3ZHH A;  1MWR A;  4BEN A;  2C5W B;  5G18 A;  5F68 A;  1FQG A;  4HNB A;  4NET A;  3DTM A;  3W4P A;  5HAP A;  3KSF A;  1FCM A;  1STZ A;  3DAV A;  3LI9 A;  2XGN A;  1E3U D;  1GSX A;  3HLF A;  5FI6 A;  2ZJ9 A;  4E3M A;  1KE3 A;  2WZZ A;  1ZHH B;  3MR0 A;  2B18 A;  5L07 A;  5FAS A;  4I3J A;  4ZJ1 A;  1DP8 A;  3MXS A;  3WS5 A;  1OTI A;  4CJN A;  1XFQ A;  3GVB A;  2DMW A;  3UY6 A;  5GHY A;  3E2K A;  2D01 A;  5BOH A;  3BFG A;  5FAO A;  1HZO A;  4NXB A;  2EXB A;  1PW8 A;  4XXR A;  3MKF A;  3B47 A;  4PAU A;  3DTE A;  3HCY A;  3C4O A;  2X02 A;  3WWX A;  3HUN A;  4QJG A;  4D2O A;  3IF5 A;  3P7N A;  3UMD A;  2EX2 A;  3MSH A;  1M6K A;  3H7W A;  5AQ9 A;  4CLC E;  3S1Y A;  4RX2 A;  3BYD A;  4BL2 A;  2DCF A;  1OME A;  4H6J A;  2XD1 A;  1NRJ A;  3TE8 A;  2P7J A;  4MMN A;  3E4Q A;  5DTS A;  4EU0 A;  1VET B;  4KZ4 A;  4HJ3 A;  1ESU A;  3C8C A;  3OPP A;  3DWK A;  2EX8 A;  3ISG A;  5FQK A;  3U2A A;  1CEF A;  4OP8 A;  5HPI A;  3A3E A;  5TBM B;  2Y2M A;  1W79 A;  4FUW A;  3FPW A;  3NOU C;  3BJN A;  3Q82 A;  4R3B A;  3PBN A;  5CX7 A;  1PZO A;  3IS2 A;  2VEA A;  4P6B A;  3LID A;  3NBL A;  2WKI A;  4OON A;  2V1A A;  3N4I A;  1ES3 A;  2VA0 A;  3ZVT A;  2HDU A;  3T4T A;  3BFE A;  3VP4 A;  4Y7P A;  4R4S A;  2PAV P;  4RYE A;  4M3K A;  2WGV A;  5L8M A;  1ALQ A;  4QD4 A;  4IHQ A;  5HSQ A;  4I38 A;  4KZA A;  4WEJ A;  2IA2 A;  4IED A;  1VQQ A;  1Y54 A;  2B5R A;  1K57 C;  2A2L A;  3T50 A;  4MN5 A;  3G6O A;  1WA9 A;  2Y4A A;  2ZL1 B;  3MQQ A;  4Y0T A;  3UE0 A;  3UME A;  2CC1 A;  3JVV A;  4GD6 A;  3AGE A;  3E4O A;  4R23 A;  4BJP A;  1X0O A;  1RGZ A;  3NIA A;  4KZ7 A;  1MPL A;  3MZF A;  5KMW A;  1JWV A;  3K3D A;  3C7U A;  4LPZ A;  3UB5 P;  1PI4 A;  2K31 A;  4CLC D;  3BLS A;  3TW8 A;  2IWD A;  4MBH A;  3SW1 A;  3N7W A;  3ZQ5 A;  3UB7 A;  2Y2Q A;  3EQV A;  2M7U A;  2V1Z A;  5IT5 A;  2BG1 A;  3Q7Z A;  1MKM A;  2QPN A;  1YLY A;  2Z2L B;  3HLG A;  2WGI A;  3N8R A;  4E04 A;  3LEZ A;  1P97 A;  1G6O A;  4DKI A;  5HD5 A;  3WS0 A;  5HWW A;  4DE3 A;  5F6A A;  3PYP A;  5EFW A;  2WKQ A;  2XA7 S;  4EV4 A;  2V0W A;  2P9V B;  3H82 A;  2ZC5 B;  3DW0 A;  4JBF A;  3ZG7 B;  4HP4 A;  4QHC A;  1MZU A;  3VMA A;  5CEB A;  2QWS A;  1RCJ A;  5M1A A;  4X25 A;  4RVA A;  4QB8 A;  5DJU A;  3BY9 A;  1GHI A;  4YNR A;  4PKY G;  1H8Z A;  2Z6D A;  4PM5 A;  2G7U A;  4Y0O A;  1HTZ A;  4BBT A;  4DE1 A;  2VGL S;  4HEF A;  2B95 A;  3NHQ A;  4BBV A;  4OOY A;  1FIL A;  3PBR A;  3ZG0 A;  1K6R A;  5HWV A;  3S22 A;  3N8S A;  4EQI A;  1SCW A;  3NY4 A;  2L0W A;  3Q81 A;  4RX3 A;  4LLO B;  3CIT A;  2PR5 A;  3NOT C;  5E2H A;  4HY8 A;  2QHK A;  5HDD A;  1L0D A;  2VV6 A;  4P87 A;  4OQG A;  5EOO A;  4FSF A;  3CWF A;  4KZ6 A;  2VK3 A;  4DN0 A;  3ZVW A;  2EX9 A;  2JC7 A;  3JPU A;  2ZQ7 A;  1E4D A;  3JVU A;  1Z6F A;  1H5X A;  2XH9 A;  4DXC A;  3GMW A;  2P08 A;  3RJU A;  3VE3 A;  5AQ7 A;  1W8Q A;  1PIO A;  2O99 A;  2LB9 A;  2K7S A;  2ZM8 A;  2EFU A;  3LGO A;  1K54 C;  3CPT B;  1ERO A;  2P9V A;  3Q1F A;  4MCW A;  2GNX A;  2HP9 A;  1BYW A;  1S66 L;  2HPB A;  2GX5 A;  4OH0 A;  3OPR A;  4GS9 B;  4K0X A;  1YLT A;  3T4J A;  2EXA A;  5HDC A;  1NLZ A;  3T1S A;  4MN7 A;  2NUT C;  2Q0O A;  5FEF A;  2LB5 A;  3UB9 A;  5F69 A;  4Y3I A;  4UA9 A;  3KYQ A;  3VP0 A;  5HW3 A;  2J3T C;  4BQM A;  1XGI A;  2Q9N A;  3OLO A;  5HPF A;  3SOI A;  3ZCZ A;  1A0K A;  3I7J A;  3W4O A;  3VOL A;  4AFI A;  3GSG A;  2VX8 A;  3W4Q A;  4R0Q A;  4L9G A;  5DJT A;  1IYQ A;  3VFH A;  4L9F A;  4E3K A;  3NDE A;  2JKR M;  4EES A;  4Y15 A;  1BT5 A;  3OCN A;  5L2F A;  4ZAM A;  1L0G A;  5TR7 A;  1OJG A;  3F1P A;  1XJ6 A;  5EEC A;  3S7P A;  3M6H A;  4E3I A;  1NYY A;  2Y59 A;  2KOI A;  3BEC A;  3NCK A;  2P04 A;  3PAE A;  4ZTK A;  5KIZ A;  4QU3 A;  1IFQ A;  5DF9 A;  4JF5 A;  4KZ8 A;  1WYB A;  2BTF P;  1K55 C;  1P9R A;  4JF6 A;  1KOU A;  2A24 A;  2XR0 A;  3IF6 C;  4QY6 A;  3LY4 A;  2XRN A;  1YLZ A;  3IBR A;  3PBO A;  4MBF A;  3UE6 A;  3BW6 A;  3MS6 A;  1KDS A;  3NJA A;  1VM1 A;  5EVI B;  2VV8 A;  1JWZ A;  2UV0 E;  4KEN B;  2GZA A;  3P01 A;  3UDF A;  2PBD P;  1TEM A;  3VP3 A;  1XX2 A;  3R7W B;  4OQI A; 
#chains in the Genus database with same CATH homology
 1GSX A;  3RH8 B;  2VGL M;  4EEP A;  3CI6 A;  1XFN A;  2XSS A;  5KSH A;  4WN5 A;  1ZHH B;  3MR0 A;  4KUK A;  2B18 A;  2M7V A;  2ZMF A;  4BWI A;  5LBR A;  3LIC A;  4I3J A;  1DP8 A;  3BQ8 A;  1OTI A;  2GJ3 A;  4FOF A;  2A24 B;  5DKK A;  2PT7 A;  1XFQ A;  4G3V A;  2DMW A;  4RQ9 A;  4UQI S;  4HI4 A;  4Y5F A;  2Y8H A;  4GHI A;  2D01 A;  5IU1 A;  2W3H A;  3T4K A;  2VV7 A;  1UWP X;  4NXB A;  4ZRR A;  5A8B A;  2ZBB A;  3LIF A;  3B47 A;  2I9V A;  4PAU A;  1EW0 A;  3VE4 A;  3EOI A;  2ZOI A;  3HCY A;  3LI8 A;  3FC7 A;  2EA9 A;  3F1N A;  4PHT A;  3PHY A;  3O5Y A;  4P6Z S;  5TBM A;  1UGU A;  3R4K A;  4F3L A;  3EWK A;  4II7 A;  3P7N A;  3EGX C;  3IBJ A;  4NXG A;  4WLA A;  5HZH A;  4WF0 A;  3UMD A;  2W1T B;  3DBA A;  3H7W A;  3LIE A;  4JGO A;  3MFX A;  1NLY A;  2JKT M;  4CLC E;  1VB6 A;  2O9A A;  5HL6 A;  2D02 A;  5HWT A;  4GHI B;  4H6J A;  1NRJ A;  3TE8 A;  1DRM A;  2P7J A;  4MMN A;  1TS0 A;  3CUE A;  3E4Q A;  2PD7 A;  2PR6 A;  4QPR A;  4EU0 A;  4YOF A;  2HJE A;  3W2Z A;  4HJ3 A;  2PYP A;  3C8C A;  4NXE A;  4Z1W A;  1LSW A;  3UE3 A;  3KYZ A;  4HIA A;  4IJG A;  3U2A A;  1YSQ A;  4I39 A;  2YKH A;  5HPI A;  4HH3 A;  3F1N B;  5TBM B;  4K08 A;  2HF6 A;  4F3L B;  3B33 A;  4JGP A;  3E0Y A;  1TF1 A;  2J3W A;  3FPW A;  1T18 A;  3C30 A;  3NOU C;  1GSW A;  3BJN A;  1TS8 A;  3A0R A;  3PBN A;  3H7W B;  2V9A A;  2MJ6 A;  5CX7 A;  3GEC A;  3IS2 A;  5DKL A;  1S4R A;  2VEA A;  2O9B A;  3LID A;  1ZTU A;  4EW7 A;  4H6J B;  4Y2F A;  2V1A A;  3MQO A;  3KSH A;  4CQH A;  2VA0 A;  1VHM A;  3S7Q A;  2JHE A;  3CUE C;  3T4T A;  1N9L A;  3KO6 A;  5MC7 A;  3C38 A;  3A0S A;  2OAQ 1;  4LRX C;  5L8M A;  1ODV A;  4B9O A;  4IHQ A;  5HSQ A;  3T4S A;  4I38 A;  4WEJ A;  2IA2 A;  4GLQ A;  2A2L A;  3T50 A;  3RFB A;  4WUJ A;  3BY8 A;  4MN5 A;  4HH2 A;  4M4X A;  3G6O A;  2VJW A;  1WA9 A;  4GCZ A;  3MQQ A;  3LR4 A;  3TJZ C;  1D06 A;  4HHD A;  5AVF A;  3UME A;  5AVE A;  2OOL A;  3JVV A;  4OOM A;  2K2N A;  2W1T A;  3IS2 B;  3C2W A;  3E4O A;  4ME4 A;  4BJP A;  1X0O A;  2L1M A;  4BMW A;  4WEL A;  3K3D A;  4LPZ A;  1DP6 A;  2K31 A;  3LR3 A;  5DFY A;  4YWZ A;  4CLC D;  1LSV A;  2EWV A;  3MJQ A;  3TW8 A;  1P9W A;  4IUK A;  1IOU A;  3SW1 A;  3EEH A;  3ZQ5 A;  3UB7 A;  3EQV A;  2M7U A;  5IT5 A;  5AJG A;  1MKM A;  4MN6 A;  2W3F A;  1LL8 A;  1TD5 A;  5HDS A;  1OPX A;  4CLC B;  1OT6 A;  3H9W A;  4GJ4 A;  3VV4 A;  4E04 A;  2VLG A;  1OTD A;  4CLC C;  1P97 A;  4DJ2 A;  1G6O A;  1XJ3 A;  2O0Y A;  2OWH A;  5HD5 A;  3V67 A;  4KQO A;  3KSG A;  5HWW A;  4JGQ A;  5F6A A;  3PYP A;  4B93 A;  4Q0H A;  5EFW A;  3UB6 A;  2WKQ A;  3CLO A;  2XA7 S;  2W1R A;  2V0W A;  4O8G A;  3H82 A;  2QJ7 A;  3FPV A;  5G4Y A;  2W3E A;  4HP4 A;  1MZU A;  1OTE A;  2KX6 A;  2QWS A;  4HP9 A;  4JGR A;  1T19 A;  4XT2 B;  4EEU A;  2W27 A;  5IS1 A;  4Q0J A;  2Y79 A;  1S1Y A;  1F5M A;  4GW9 A;  4UQI M;  2B02 A;  4Q0I A;  3BY9 A;  5DJU A;  4G3K A;  4YNR A;  4PKY G;  1H3Q A;  3RTY A;  3EGD C;  2Z6D A;  2M1C A;  2G7U A;  2VKS A;  4NEE D;  4BBT A;  3ULF A;  2OWJ A;  2VGL S;  5I5L A;  2JN7 A;  1S67 L;  2ZOH A;  1S1Z A;  3PBS A;  3NHQ A;  4BBV A;  2XRO A;  1F98 A;  2PDR A;  5G4Z A;  3UB8 A;  4EER A;  2CMN A;  2WKP A;  4P6Z M;  3MQ0 A;  3ZYT A;  3PBR A;  2KDK A;  4HJ6 A;  5HWV A;  3LIA A;  4KQD A;  3H82 B;  3PBQ A;  1V9Y A;  2H28 A;  2V0U A;  3LR5 A;  1XJ4 A;  3HJK A;  2INW A;  2L0W A;  1S4S A;  4LLO B;  2W3G A;  3CIT A;  2PHY A;  2PR5 A;  3NOT C;  4EXO A;  1V9Z A;  1F9I A;  3OOV A;  4HY8 A;  2QHK A;  5HDD A;  5F5Y A;  2VV6 A;  4R70 A;  2W0N A;  4GS9 A;  2JKR I;  3T4Q A;  4FSF A;  3CWF A;  1H8M A;  4WL9 A;  2PYR A;  4WEK A;  2QKP A;  1P0Z A;  3HJI A;  2Z6C A;  1TS6 A;  3EQU A;  4DN0 A;  4L9E A;  3E4P A;  4MDZ A;  3LFV A;  3JVU A;  1N9N A;  1N9O A;  4CLC A;  4ARZ A;  3D72 A;  2VZW A;  3F1O A;  1W63 Q;  2P08 A;  3VE3 A;  2O99 A;  2LB9 A;  3OCL A;  4L0L A;  2K7S A;  4HOI A;  1YKD A;  4O0P A;  1LT0 A;  3MF0 A;  1NWZ A;  4MCW A;  2GNX A;  2W3D A;  3K2N A;  4ETZ A;  1BYW A;  1DP9 A;  1Y28 A;  1S66 L;  2BAS A;  2GX5 A;  4XT2 A;  3E98 A;  2J3T D;  4GS9 B;  3LR0 A;  3T4J A;  4NXF A;  4LRY C;  4I5S A;  5HDC A;  2R78 A;  1NLZ A;  3KSI A;  1GSV A;  4EET B;  2KLI A;  4R38 A;  3LIB A;  1T1B A;  4G3W A;  4MN7 A;  2NUT C;  2LB5 A;  2QYB A;  2ZMV A;  4ARZ B;  2L4R A;  3F1O B;  3UB9 A;  5F69 A;  1T1C A;  4Y3I A;  3KYQ A;  3OC2 A;  1T1A A;  4I3A A;  2J3T C;  2HGV A;  4EQ1 A;  1TS7 A;  2OAP 1;  2O9C A;  3OLO A;  3K3C A;  5HPF A;  3PXP A;  2V1B A;  1YAX A;  5J4E A;  3VOL A;  4AFI A;  4PKY A;  3T4O A;  4BBU A;  3BWL A;  2VX8 A;  4R6L A;  2QJ5 A;  4DMZ A;  3LYX A;  4L9G A;  5DJT A;  3LUQ A;  5J7E A;  4I3I A;  4L9F A;  4DJ3 A;  3NOP C;  3PR6 A;  2JKR M;  4HJ4 A;  4EES A;  5FL3 A;  3FG8 A;  3A0V A;  3OCN A;  3PBT A;  4UEY A;  3D3O A;  4KUO A;  3CAX A;  4LRZ E;  1JNU A;  4R3A A;  1OJG A;  3F1P A;  1G28 A;  4NKP A;  5DFX A;  1XJ6 A;  2HV1 A;  1YSP A;  3S7P A;  2YKF A;  2KOI A;  2P04 A;  2WKR A;  3KX0 X;  1UWN X;  5TJJ A;  2EWW A;  3S7N A;  4OOL A;  3R7W A;  1XJ2 A;  1LSX A;  4IUH A;  4EUV A;  2FZ0 A;  5KIZ A;  3S7O A;  1IFQ A;  5DF9 A;  3OBF A;  1OTB A;  5C5K A;  2HJ9 C;  2JKT I;  1P9R A;  1KOU A;  2NUP C;  2A24 A;  1OTA A;  1OJ5 A;  3ICY A;  2XRN A;  1D7E A;  1OT9 A;  3TRC A;  2XA7 M;  3IBR A;  3PBO A;  3MXQ A;  3UE6 A;  1MC0 A;  3BW6 A;  3GDI A;  3F1P B;  3NJA A;  5K5B A;  2VV8 A;  3B42 A;  4O01 A;  3T4L A;  3BQA A;  2GZA A;  5F68 A;  4HNB A;  3EEA A;  4ETX A;  3P01 A;  2PD8 A;  5HD3 A;  3KSF A;  5J3W A;  1W63 M;  2FH5 A;  1STZ A;  4HQA A;  3LI9 A;  3MMH A;  3R7W B;  2J80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...