5AVEA

The ligand binding domain of mlp37 with serine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
SVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRSTLIHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 82
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5aveA02
2J80A 3CLOA 3UB9A 4WF0A 1OTAA 5DKKA 4BBUA 3MXQA 3UB6A 2KDKA 3B33A 3SW1A 1OT6A 2W0NA 4EEPA 3CWFA 4L9FA 4HJ3A 4NXGA 5F69A 3UB8A 2V1AA 5IU1A 3F1OB 3RTYA 3EEHA 1XJ3A 3LUQA 1XJ6A 2WKQA 4HI4A 3E4OA 5HDCA 5DJTA 3F1PA 4GS9B 4EW7A 1TS6A 2V9AA 3H82B 4MN5A 5IS1A 3MFXA 1X0OA 1DP6A 2WKPA 4BBTA 4HQAA 2PHYA 2V0WA 4EEUA 4R3AA 3GDIA 3LICA 4I5SA 1OTDA 1UWPX 3HJKA 3MQQA 4R70A 2PYPA 3F1OA 1NWZA 3LIAA 2QJ7A 2L1MA 2VV6A 1F98A 3HJIA 4L9GA 3LIDA 4GS9A 1V9YA 3FC7A 1OTIA 1N9NA 2YKFA 1V9ZA 4L9EA 2OWHA 2CMNA 2EA9A 3RH8B 1XFNA 5I5LA 4R38A 2PD7A 4HHDA 1D7EA 2L4RA 3H9WA 3MQOA 3P7NA 1VB6A 2QHKA 1S4RA 4GCZA 2QWSA 5KIZA 3FG8A 4HJ4A 3NHQA 3A0VA 2OWJA 2VV7A 4E04A 1P97A 4I38A 5HZHA 2PYRA 2V1BA 3LI9A 2OOLA 3A0SA 2PDRA 3T50A 5HWTA 1Y28A 3LIBA 4KUOA 5J3WA 2JHEA 1BYWA 1DRMA 1DP9A 2V0UA 4EERA 1OT9A 1LSVA 2I9VA 2BASA 3C2WA 4B9OA 1T18A 3LI8A 4H6JB 2R78A 1GSWA 3E4QA 2GJ3A 3BY8A 3E4PA 1T1CA 5G4ZA 4HH2A 4MN6A 4LPZA 2KX6A 3UMEA 5HD3A 3NOTC 4HJ6A 4WLAA 2HV1A 2K7SA 2JN7A 5G4YA 2QJ5A 4RQ9A 1GSXA 3IS2B 4WUJA 4NXBA 2INWA 4BBVA 3F1NB 3KX0X 1F9IA 3NOPC 3VOLA 1LL8A 1T1BA 4H6JA 1LSXA 3NJAA 1KOUA 4JGQA 5DKLA 5AVEA 4LRZE 4I39A 1OJGA 3EWKA 1ODVA 3MJQA 2ZOIA 2VLGA 1TS8A 1MZUA 5F5YA 3C8CA 3H7WB 4R6LA 4JGOA 4EETB 3ZQ5A 4LLOB 4GHIB 2L0WA 1OJ5A 4WN5A 1S66L 3UMDA 3IS2A 5F68A 3F1NA 3CAXA 5J7EA 5A8BA 1UWNX 3LIEA 4HH3A 4DJ2A 3ICYA 2Z6DA 3VE3A 1EW0A 4LRYC 3K3CA 5HDDA 4DJ3A 2QKPA 1OTEA 4I3AA 4LRXC 3MR0A 4I3IA 4JGPA 4PKYA 1N9LA 2YKHA 4NXFA 1XJ2A 2ZOHA 3VE4A 4EESA 3H7WA 2PR6A 4HNBA 1LSWA 4GHIA 2D02A 3GECA 1WA9A 1DP8A 2VEAA 4I3JA 1S67L 4HOIA 5F6AA 4F3LB 3OLOA 3A0RA 1UGUA 5TBMB 3IBRA 4HP4A 1T1AA 4KQDA 4XT2B 5HDSA 5AVFA 2PR5A 3LIFA 2P7JA 1TS7A 1JNUA 2ZBBA 5HWVA 2W27A 3LYXA 1LT0A 1XFQA 4NXEA 3NOUC 1OTBA 3BY9A 3PYPA 2M1CA 4KUKA 3ULFA 4GW9A 3G6OA 4F3LA 5TBMA 2B02A 4M4XA 2A24B 2VV8A 5DJUA 4XT2A 4YWZA 4HP9A 1P0ZA 4WL9A 4K08A 1D06A 2D01A 3H82A 5EFWA 2WKRA 5HWWA 2PD8A 4PKYG 3K3DA 5J4EA 5HSQA 3UB7A 1TS0A 1S1ZA 1S1YA 1N9OA 1G28A 1GSVA 1XJ4A 4EQ1A 4HY8A 4HIAA 3D72A 2H28A 1T19A 3F1PB 2Z6CA 4EXOA 3PHYA 1S4SA 5HD5A 2A24A 3UE6A 4JGRA 3BWLA
chains in the Genus database with same CATH superfamily
2J80A 2H10A 2P08A 3CLOA 1YT4A 4P87A 4CLCA 4FCFA 3S7OA 4OQ0A 3MXQA 4BENA 5DTTA 5HFOA 3KSFA 2C5WB 5L10A 3DAVA 1PYYA 3CWFA 3IHBA 4JPMA 4NXGA 1ACFA 4DDSA 3F1OB 3NDEA 2VGJA 4UA6A 1ESIA 5E2FA 3CPTA 3LUQA 1K6RA 3O5YA 1PNEA 2JKRM 2XD5A 2Y2JA 1STZA 3MZEA 3FYZA 2WGVA 5FQMA 1K55A 5DF7A 4KZ5A 1W7FA 3MFDA 5EE8A 3MS6A 1DP6A 1XP4A 4U3TA 1S6RA 2IA2A 2V0WA 4EEUA 1PZPA 3GDIA 2VX8A 3BM6A 3VSKA 4I5SA 1ES5A 1OTDA 3AGDA 4R70A 2ZM8A 3LR5A 4KQOA 1D1JA 3LIAA 3BFCA 2M7UA 2L1MA 3HLDA 1NYYA 1YMXA 5FEFA 3CITA 1V9YA 4WEKA 5F1FA 1K4EA 3R7WB 1VQQA 1GHPA 3CZDA 4JF4A 5K5BA 4MDZA 1OPXA 4Y17A 1Z6FA 1V9ZA 3G2ZA 4KG5A 3FKWA 4Y13A 5F82A 2OWHA 3RH8B 5EVIA 4O8GA 4KQRA 3AGEA 3H9WA 1TF1A 5M19A 3V3SA 2VGLS 1VB6A 4Y0TA 1K38A 2G2WA 1G6OA 1I2WA 2QWSA 3D4FA 2OWJA 3E98A 4E04A 5EOOA 2QPNA 2W1TA 2XD1A 2V1BA 4EBPA 3D3OA 3LI9A 1ES3A 5HWTA 3BJNA 3LIBA 5D3OA 3QNBA 5J3WA 1KGFA 1VETB 3BECA 3QHYA 1KVMA 1DRMA 1DP9A 2V0UA 3M2KA 3RXWA 2GNXA 1RCJA 2A49A 3O86A 1LHYA 5CTNA 3IWOA 2BG1A 3LI8A 1FSYA 2R78A 3OCNA 2QYBA 2EX9A 4MCWA 2GJ3A 1MWTA 1T1CA 2ZC3B 5EVLA 3HL9A 3LR0A 4HH2A 3IX3A 1SKFA 2BTFP 4OOLA 5FASA 4LPZA 1IOUA 3B3XA 1P9RA 3UO9A 3UPPA 2HV1A 3ZG7B 3WS1A 4RQ9A 5JYPA 4G3VA 4EWFA 4ZAMA 2Z2LB 3F1NB 1FOFA 3KX0X 5EM0A 1ONHA 1SDNA 1PZOA 4FH2A 5EOEA 1LL8A 1T1BA 2W3GA 4N1XA 4JGQA 5AVEA 5FDSA 2K2NA 1YQSA 4IBRA 4EU0A 4XXRA 4LRZE 4R4SA 4I39A 4OP5A 2HP9A 1JVJA 2LB5A 3IH8A 2VLGA 5MC7A 3TSGA 4OQHA 4PPRA 1FCNA 3D9YA 4KZBA 4WEJA 5FI2A 4R6LA 1N9BA 4JGOA 3G34A 1GA9A 4WN5A 1S66L 1IYPA 2HDQA 5CRFA 3UMDA 3IS2A 2VKSA 5CTMA 3BEBA 3UY6A 3CAXA 4K91A 4WZ4A 5A8BA 2WAFA 2R9XA 3QP8A 4FTXA 2Z6DA 3VE3A 4E6XA 4LRYC 4WZ5C 5E43A 3KYQA 1E3UA 4I3AA 2ZQDA 1BLHA 3BFGA 2HP6A 3DTIA 2XA7S 1XXMA 5A90A 3T4SA 4JGPA 2HF6A 3MZDA 4NXFA 4EESA 5GLCA 1JWVA 2FFFB 1K54C 3E2KA 2WZZA 4UA7A 2J3TD 4GHIA 5L2FA 3E0YA 3DTKA 3PAEA 2Y79A 3GECA 3ITAA 2VK3A 3PBNA 4KZ3A 2ZL1A 3CMZA 2ZC7A 4F3LB 2R9WA 2ZM2A 5TBMB 4HP4A 3MMHA 5EPHA 4XT2B 4JXSA 1BUEA 1KGEA 3MKEA 2JKFA 1LL9A 4R23A 3HLEA 5AVFA 3TJZC 3NULA 3HLFA 4E3LA 2P7JA 1L0EA 4ZJ3A 5CEDA 2ZBBA 5DF8A 3UE1A 1WYBA 4O7DA 3C30A 3O88A 2W3DA 4KG6A 3EGDC 3C38A 2Y8HA 1KGGA 4LCMA 1EI5A 2ZC4B 3P01A 1BULA 1FCMA 2Y2GA 3BY9A 3PYPA 1NXYA 2ZQ7A 3OZHA 4JBFA 5KSHA 1PI5A 2Y2HA 3MF0A 3B47A 1WE4A 1RGZA 2V8FA 4ZDXA 4EBNA 2VJWA 4HP9A 3BQAA 3IXDA 1IFQA 4WL9A 5HL1A 1D06A 4KZ8A 2D01A 3IF6A 2MJ6A 4M3KA 4X53A 4IVIA 1P9WA 3TRCA 3NECA 4PAUA 4QHCA 1CI8A 1S1YA 1DJBA 1N9OA 4C75A 1Y4OA 2OV5A 3SS5A 4HY8A 3E2LA 3D72A 4UAAA 2H28A 4BWIA 3S22A 3F1PB 1MKIA 1F2KA 4CPKA 3BLMA 2A24A 2PBDP 3UE6A 1Q2QA 2HZ5A 3Q7VB 1ONGA 3OPHA 3UB9A 4X69A 4ARZB 3HLCA 3ZVTA 2WKIA 1SKOB 2DMWA 1VEUA 2KDKA 3LCEA 5FAPA 3ZG9B 3T4TA 5A93A 4LFUA 3W4OA 2HDSA 2W0NA 4HJ3A 3PBQA 4CLCC 3UB8A 3IBJA 2EX2A 4Y0UA 4P0MA 5CHJA 1RP5A 1PIOA 1XJ3A 1YLJA 1XJ6A 2WKQA 1SZVA 5HDCA 3LR3A 3T1RA 4OLDA 4X1MA 1K4FA 3SOIA 3OBFA 4Y0OA 4GS9B 4MN7A 5CHUA 4LV1A 4ZJ2A 2V9AA 5I94A 3H82B 4QJGA 5GLDA 5EM1A 1DJCA 3UB5P 5CGSA 1X0OA 4ZBEA 1N4OA 1E3UD 2Y2OA 1HLUP 2UWXA 4HQAA 4R3AA 2DCFA 5AJGA 5FDHA 1NJ4A 3B42A 1ALQA 3VFFA 2OAQ1 4OOYA 4L9GA 3SS4A 1BLCA 4QB8A 2XRNA 2Y59A 1OTIA 1VHMA 2WUQA 2PT7A 1MC0A 1SHVA 1YLTA 1KE3A 4L9EA 1PW1A 3OPLA 2EA9A 3VMAA 4R38A 3LEQA 3IQAA 1MXOA 2PD7A 3G4PA 4HHDA 3T4KA 2L4RA 4GDBA 3ZGAB 3P7NA 3BYDA 2QHKA 3T1XA 5KIZA 2Y2LA 5EVIC 1GHIA 1FR1A 4OPRA 2IWBA 4YFMA 5AQ7A 1H8ZA 4NK3A 1ZC2A 3VP2A 5HZHA 4L0LA 3JVVA 3CUEC 4FD8A 5F1GA 2OOLA 4HBTA 3HLWA 3A0SA 2EWVA 4H8RA 1Y28A 5E2HA 3N7WA 3N4IA 3M2JA 3HUMA 4EERA 3ITBA 2EXAA 3SH7A 3IX4A 1MBLA 3Q7ZA 3NBLA 1K56D 4H6JB 3FPWA 3QNCA 5EV0A 1YKDA 1KVLA 1K25A 3EQUA 3OPRA 1CQAA 2XFSA 3EQVA 3AGFA 3E4PA 5G4ZA 1W63M 2ZC6B 1H8MA 2WKEA 2A2LA 1NRFA 3RJUA 4FUWA 2HGVA 2E8IA 2KX6A 3UMEA 3DBAA 3V67A 4HJ6A 4ZRRA 1KE4A 4R1GA 1W5DA 4OKPA 2QZ6A 2WKHA 2K7SA 2XK1A 5G4YA 1NLYA 2QJ5A 4KZAA 4S2OA 5HPIA 2W3FA 2JE5A 3V5MA 3VOLA 1OMEA 2H5SA 3UN7A 3NDGA 5AQBA 4CJNA 1NYMA 4ESPA 1BTLA 3IHAA 2W3HA 3C7VA 2IWCA 4DN0A 3WS4A 4ETXA 2CC1A 2X71A 1MZUA 3ZFZA 5F5YA 3NIAA 1CF0A 3H7WB 3QP1A 1K0KA 4QY5A 5GHYA 3EOIA 2VGKA 3ZNYA 2UV0E 5FQQA 5J7EA 1UWNX 4LCLA 2EWWA 3LIEA 2ZMVA 3W4QA 4HH3A 1HZOA 4DJ2A 5FI6A 3ICYA 3VOZA 3MBZA 3S7QA 5HDDA 3K3CA 3LFVA 4HESA 4DJ3A 2QKPA 2AVXA 1L0DA 4EUVA 4Y3IA 1M6KA 4GLQA 1N9LA 4EV4A 4DF6A 2YKHA 2Y2PA 3G35A 3FWLA 1XJ2A 4NETA 2O9BA 5CX7A 2V2FF 4JXGA 2XQZA 1IEMA 1LL5A 2D02A 5GL9A 1XGJA 2HDUA 2J9OA 4KQQA 4S2KA 4MNRA 3VP3A 5HX9A 2NUPC 4PM9A 2WGWB 1DP8A 4I3JA 5FQJA 3FV7A 1BSGA 3OLOA 3SZTA 4S2NA 5KZHA 3A0RA 1Q2PA 3IBRA 1T1AA 1PW8A 1SCWA 2ZQ9A 3KYZA 5HDSA 5TJJA 4C3QA 4QD4A 3S7PA 3Q82A 1TS7A 1JNUA 5HWVA 2OLVA 4ARZA 2W27A 4X55A 4N1HA 2XH9A 3LYXA 2JCHA 1S0WA 1ESUA 3HUNA 4N92A 3FZCA 4LV3A 1FSWA 4EBLA 1OTBA 2W3EA 4FOFA 2M1CA 4IBXA 4GW9A 4MMNA 3UPOA 3G6OA 4BQMA 2XROA 2P9VA 2Q9MA 5CGWA 5HAQA 3NY4A 1JWPA 2VV8A 3FPVA 1J3WA 4OH0A 2Y2IA 3Q81A 4LV2A 4CLCB 5TGFA 2PU4A 4S2JA 3H82A 3P09A 2XLNA 4Y7PA 3HBRA 1IYOA 5FAQA 4OPYA 2WKRA 1J9MA 4UA9A 5HSQA 3UB7A 4RX3A 4ME4A 1VM1A 2GDNA 5U47A 1G28A 5TFQA 3CPTB 1XJ4A 4EQ1A 3VV4A 4FH4A 3HUOA 1O07A 2Z6CA 3U2AA 1L0GA 3NCKA 4YINA 4Z1WA 5A92A 3GRJA 2GZAA 4WF0A 1TEMA 1OTAA 4NEED 3W2ZA 4BBUA 4IUKA 3UB6A 3Q1FA 3MXRA 3QP2A 4DKIA 3B33A 3T4OA 2P74A 1JTGA 3GR2A 4JXWA 3SW1A 3EGXC 2HPBA 2PU2A 3IT9A 4EEPA 2Y2QA 4WMCD 5F69A 3VFHA 4BJPA 4YNRA 1I5QA 4E6WA 3E4OA 5DJTA 5AQAA 4EW7A 1YLPA 1TS6A 4ZJ1A 2ZD8A 4MN5A 4S2IA 1W79A 4X25A 3C4PA 2ACGA 4IHQA 1XPBA 3IXGA 1PWDA 4BD1A 2PHYA 5EVIB 5JYOA 4OOMA 5M18A 3O87A 1UWPX 3LO7A 2O99A 3MKFA 3F1OA 3T4QA 4QY6A 1ZHHB 2PBYA 4AFIA 2QJ7A 2EX6A 2VV6A 1F98A 2ZMFA 1MWUA 3HJIA 4X6TA 3LIDA 2JC7A 2V1ZA 3QP6A 3WS2A 2W1TB 4B93A 3G32A 4FSFA 3FC7A 2YKFA 4EUZA 1K56A 4NG2A 4OP8A 5HAIA 3T1SA 5CHMA 1YLZA 5I5LA 4KZ4A 4E3MA 3HVFA 1D7EA 3ZDJA 3V3RA 1YSQA 1K6SA 4MBKA 5FQIA 4WZ5A 1S4RA 4GCZA 2Y2KA 3PAGA 4CQHA 4Y2FA 3FG8A 1AWIA 3IXHA 4HJ4A 3NHQA 3A0VA 3CI6A 4ID4A 4N9KA 3RFBA 2VV7A 1P97A 4CLCE 4DDYA 2XDMA 2HP5A 1G68A 1NZOA 3A3EA 4E3NA 4Q0JA 3HREA 3R7WA 1K54A 2PDRA 1CJFA 5TR7A 3A3FA 4BMWA 3MQ0A 3ZYTA 1BYWA 1L2SA 2Q0OA 2Y2NA 4IVKA 1OT9A 1SDEA 2BASA 1QMFA 1XGIA 1H5XA 1W8YA 5CECA 1BLSA 1DJAA 2ZLYA 1I2SA 4KZ6A 4X56A 3E4QA 4GN2A 3BY8A 4DXBA 1W63Q 4PM8A 3UDXA 2ZC5B 1AXBA 4WLAA 1K55C 4JF5A 1NZUA 1VETA 4R3JA 3T12B 1KDSA 2BLSA 2K31A 2LB9A 3IS2B 4BBVA 3V39A 4R3BA 1F9IA 5L09A 3WRTA 4GZBA 1WYCA 1E4DA 2GX5A 4GD6A 1EWZA 3NJAA 3TG9A 4S2MA 1XA7A 2DRWA 3GMWA 1EROA 1OJGA 1ODVA 2V8CA 3MJQA 4C6YA 1PWGA 2J3TC 3S1YA 3C8CA 1ZG6A 3I7JA 3LEZA 3UDIA 1YLYA 3ZQ5A 4LLOB 4GHIB 2X02A 4DXCA 4S2PA 2L0WA 4NKPA 1NY0A 1KE0A 3LY3A 3F1NA 5LBRA 1XA1A 2WZXA 4R4RA 3O3VA 1U60A 2ZL1B 1EW0A 4IEDA 2J8YA 1MWRA 3NI9A 4OPZA 5DFYA 1OTEA 3N8SA 4O01A 4GKUA 5DF9A 3R4KA 3MR0A 4I3IA 4OLGA 3S4XA 1K57A 3FKVA 4PKYA 1H3QA 3BW6A 2ZOHA 4II7A 1G6AA 1HD8A 3QP4A 4PMAA 4Z9QA 1TDGA 3JYIA 4KENB 1BT5A 3S7NA 5FQ9A 4PM6A 4HEFA 2VEAA 3CJMA 2WADA 5F6AA 2E8JA 3QP5A 4JXVA 2ZQAA 3UNWA 3C7UA 1YSPA 1MWSA 5AQ9A 3KSIA 5HL6A 3CG5A 1YPRA 4MLLA 5L07A 1IKGA 3IF6B 3LIFA 4S2NC 3ZG0A 4O0PA 3PXPA 1BZAA 4GB7A 1RGYA 4U0TA 2VGLM 4OQIA 2XGNA 3BFDA 4U0XA 2Y55A 1XFQA 5GHZA 2KOIA 4D2OA 3W8KA 4WYYA 4LGWA 3NOUC 3IH9A 2B95A 5HAPA 3RXXA 2XSSA 3KO6A 4F3LA 1HVBA 4Y15A 4Q0IA 1L0FA 5TBMA 2B02A 4Q8IA 4WMCA 2A24B 2JKGA 5DJUA 5J8XA 4XT2A 3ZG8B 4Q0HA 1P0ZA 4K08A 1PRQA 1ZTUA 4PHTA 4E3IA 1VEUB 5CEBA 2XF3A 4QPRA 4N9LA 2O9CA 2HJ9C 2W1RA 5DVAA 4PKYG 3K3DA 4UEYA 1CEFA 5J4EA 4WM9A 2ZQCA 1TS0A 2I72A 1S1ZA 2C6WB 5EECA 4B4XA 2DNSA 3WRZA 3LR4A 1IYSA 1ERMA 4IUHA 5M1AA 3L7HA 2EFUA 1MY8A 1T19A 3JPUA 1YAXA 2O0YA 3CUEA 4EXOA 1ERQA 2B5RA 1S4SA 4UQIM 4JGRA 1Y54A 2X01A 3EEAA 4OVDA 3OC2A 5CERA 5FATA 1M40A 5DKKA 1PFLA 4K0XA 2Y4AA 1KDWA 5FAOA 3MXSA 1XX2A 1PWCA 1OT6A 4KZ9A 4L9FA 2V1AA 5IU1A 2VZWA 3VP1A 2B18A 3RTYA 4BL2A 1JWZA 3DTMA 3EEHA 2OAP1 3BLSA 4HI4A 1TVFA 5E2GA 3F1PA 3PTEA 3A3JA 4RVAA 3PR6A 3NC8A 3KSGA 5G18A 3Q7VA 2EX8A 5IS1A 3MFXA 2WKPA 4DE0A 2XR0A 3MSHA 2G2UA 2J9PA 5FL3A 1SKOA 4BBTA 4MEZA 4P85A 4G3KA 3IWQA 3TOIA 3PBSA 4GJ4A 4UQIS 3LICA 4OONA 5HARA 1TDLA 4PM7A 4G3WA 3HJKA 4GNUA 3MQQA 1GA0A 2PYPA 1NWZA 3GSGA 1LI0A 2Y2MA 3ZCZA 2XA7M 4CLCD 2J7VA 5GLBA 2JKTI 4DRTA 3LGOA 4GS9A 1IKIA 4Y5FA 1N9NA 2P04A 1IELA 2ZJ9A 3BFEA 5HPFA 1C3BA 3UDFA 5FSRA 4BL3A 3UPNA 2CMNA 2HJEA 3C5AA 3K2NA 1XFNA 4X1LA 4ETZA 4XUXA 2EFXA 3IF6C 4B4ZA 3HCYA 3GVBA 3IX8A 3MQOA 1H0MA 5CXWA 4P6BA 5DTKA 4BLMA 4OPQA 4E3OA 2JKRI 4DE1A 4LV0A 4I38A 1CEGA 2PYRA 5CGXA 2ZM0A 4QWOA 3T50A 3GQZA 4P6ZM 3M6HA 4KUOA 5KSCA 3CHWP 2JHEA 3SH8A 5L8MA 3T1QB 2J3WA 2PAVP 1GCEA 5E2EA 3ZHHA 5EVEA 4QU3A 1DY6A 4GOGA 4KZ7A 1LSVA 3OPPA 4K0WA 2I9VA 3BFFA 3C2WA 4B9OA 3OOVA 4LENA 1T18A 4X68A 2RCXA 5KMWA 1JTDA 1MPLA 5C5KA 4DMZA 1ES2A 3KYEA 1GSWA 5DFXA 5IT5A 2VA0A 2XEPA 5IHVA 1YM1A 4JLFA 5EVID 1O7EA 1YMSA 4RA7A 5GHXA 2OLUA 2FZ0A 1CI9A 4MN6A 1CK3A 3V50A 5HD3A 3NOTC 3UE0A 2RL3A 1QMEA 1E25A 3BRMA 2JN7A 1GSXA 3MZFA 4WUJA 4NXBA 3W4PA 3G31A 2INWA 2Z2MB 2WYXA 3NOPC 2ZMAA 4P6ZS 1W8QA 4ZTKA 5BOHA 1H8YA 4H6JA 1LSXA 3HLBA 1KOUA 3LY4A 5DKLA 3GV9A 2M7VA 3EWKA 3PBRA 3ISGA 4IJGA 1ZKJA 5HW3A 3WS5A 1LI9A 1FILA 5F83A 2ZOIA 1TS8A 3GTCA 4D60A 3DW0A 1GHMA 2H0YA 3WS0A 1ZG4A 4EETB 3T4LA 1G5UA 1OJ5A 1FQGA 1Z09A 5F68A 2EXBA 2PRFA 1TD5A 3L9KA 2NUTC 3IF5A 4MBHA 4EQIA 1NLZA 2A3UA 2QMIA 5EUAA 3UE3A 1MKMA 1YLWA 3N8LA 4RX2A 4BD0A 3A3IA 1IYQA 1FIKA 2WK0A 5FI7A 4E3JA 4LRXC 1F5MA 3HLGA 4UHUA 3A3DA 3VE4A 2JBFA 4PM5A 3U4LP 3VP0A 3H7WA 4OQGA 3ZNTA 3ZVWA 2PR6A 4HNBA 4GDNA 5DTSA 3DWZA 1LSWA 3IWIA 1K57C 4MBFA 5A91A 3KSHA 1WA9A 5FEGA 4RYEA 2WGIA 1S67L 3OCLA 3IXBA 4HOIA 3SS3A 2G7UA 2P9VB 1L3LA 4WELA 1UGUA 4KQDA 1HTZA 4DE2A 3VOYA 2FH5A 2PR5A 1XKZA 3WWXA 2Q9NA 4JKTA 3ZG5A 3VSLA 3P98A 2IWDA 4WBGA 3BQ8A 3N6IA 1LT0A 4GD8A 1LLBA 4NXEA 1ES4A 4R0QA 1NRJA 4E3KA 1PI4A 3TW8A 2WGWA 4KUKA 2V20A 1FCOA 4YOFA 3ULFA 2OSUA 3TE8A 2O9AA 3N8RA 4M4XA 5FA7A 3DWKA 1A0KA 4YWZA 5GLAA 5FQKA 4A5RA 4JF6A 3Q07A 3DTEA 2XFTA 5EFWA 3SH9A 3JVUA 5HWWA 4B88A 4HBUA 2PD8A 4XUZA 3PBTA 3G30A 3VP4A 3PBOA 1GSVA 1FR6A 2FFYA 2H0TA 2HDRA 1BLPA 4DE3A 2ZQ8A 4HIAA 4KG2A 3M6BA 2Y91A 2KLIA 3C4OA 3G2YA 4F94A 3PHYA 3T4JA 2JKTM 5HD5A 4S2LA 2WAEA 3BWLA
chains in the Genus database with same CATH topology
2J80A 2P08A 3CLOA 3UB9A 3EEAA 4WF0A 2GZAA 3OC2A 4ARZB 1OTAA 4NEED 4CLCA 5DKKA 3W2ZA 3S7OA 4BBUA 3MXQA 4IUKA 3UB6A 2DMWA 2KDKA 3T4TA 3B33A 3T4OA 3KSFA 3SW1A 1OT6A 3EGXC 2W0NA 4EEPA 3CWFA 4L9FA 4HJ3A 3PBQA 4NXGA 5F69A 3UB8A 4CLCC 2V1AA 4BJPA 3IBJA 5IU1A 2VZWA 4YNRA 2B18A 3F1OB 3RTYA 3EEHA 1XJ3A 3LUQA 1XJ6A 2OAP1 2WKQA 4HI4A 3E4OA 5HDCA 3LR3A 3O5YA 5DJTA 3F1PA 2JKRM 3OBFA 4GS9B 4EW7A 3PR6A 4MN7A 1TS6A 3KSGA 2V9AA 1STZA 3H82B 4MN5A 5IS1A 3MFXA 4IHQA 1X0OA 1DP6A 2WKPA 2IA2A 5FL3A 4BBTA 4HQAA 4G3KA 2PHYA 2V0WA 4EEUA 3PBSA 4GJ4A 4R3AA 3GDIA 4UQIS 2VX8A 3LICA 5AJGA 4I5SA 4OOMA 4G3WA 1OTDA 1UWPX 3HJKA 3MQQA 3B42A 2O99A 4R70A 2PYPA 3F1OA 1NWZA 3T4QA 1ZHHB 3LR5A 4KQOA 4AFIA 3LIAA 2OAQ1 2XA7M 2QJ7A 2M7UA 2L1MA 4CLCD 2VV6A 1F98A 2ZMFA 3HJIA 4L9GA 3LIDA 2JKTI 2W1TB 3CITA 4GS9A 4B93A 1V9YA 2XRNA 4FSFA 4WEKA 4Y5FA 3FC7A 1OTIA 1N9NA 2P04A 1VHMA 2YKFA 3R7WB 2PT7A 5HPFA 5K5BA 4MDZA 1OPXA 1MC0A 1V9ZA 4L9EA 2OWHA 2CMNA 2EA9A 2HJEA 3RH8B 3K2NA 1XFNA 5I5LA 4R38A 4ETZA 2PD7A 4O8GA 4HHDA 3HCYA 1D7EA 2L4RA 3H9WA 1TF1A 3T4KA 3MQOA 2VGLS 3P7NA 1YSQA 1VB6A 2QHKA 1S4RA 4GCZA 1G6OA 4CQHA 4Y2FA 2QWSA 5KIZA 3FG8A 4HJ4A 3NHQA 3A0VA 2OWJA 3CI6A 2JKRI 3E98A 3RFBA 2VV7A 4E04A 1P97A 4I38A 4CLCE 5HZHA 2W1TA 4L0LA 2PYRA 2V1BA 3JVVA 3D3OA 3CUEC 3LI9A 2OOLA 4Q0JA 3R7WA 3A0SA 2PDRA 3T50A 5HWTA 4P6ZM 2EWVA 4BMWA 3BJNA 1Y28A 3LIBA 4KUOA 3MQ0A 5J3WA 2JHEA 5L8MA 3ZYTA 1BYWA 2J3WA 1DRMA 1DP9A 2V0UA 4EERA 1OT9A 1LSVA 2I9VA 2BASA 2GNXA 3C2WA 4B9OA 3OOVA 1T18A 3LI8A 4H6JB 3FPWA 5C5KA 1YKDA 2R78A 3OCNA 4DMZA 2QYBA 3EQUA 1GSWA 5DFXA 4MCWA 5IT5A 2VA0A 3E4QA 3EQVA 2GJ3A 3BY8A 3E4PA 1T1CA 5G4ZA 3LR0A 1W63M 1W63Q 4HH2A 1H8MA 2A2LA 2FZ0A 4OOLA 4MN6A 4LPZA 1IOUA 2HGVA 2KX6A 3UMEA 3DBAA 1P9RA 3V67A 5HD3A 3NOTC 4HJ6A 4ZRRA 4WLAA 2HV1A 2K7SA 2JN7A 5G4YA 1NLYA 2QJ5A 4RQ9A 1GSXA 5HPIA 2W3FA 2K31A 4G3VA 2LB9A 3IS2B 4WUJA 4NXBA 2INWA 4BBVA 3F1NB 3KX0X 1F9IA 3NOPC 3VOLA 4P6ZS 1LL8A 1T1BA 2W3GA 2GX5A 4H6JA 1LSXA 3NJAA 1KOUA 4JGQA 5DKLA 5AVEA 2K2NA 2W3HA 4EU0A 2M7VA 4LRZE 4I39A 1OJGA 3EWKA 1ODVA 4DN0A 4ETXA 3PBRA 4IJGA 3MJQA 2LB5A 2ZOIA 2VLGA 1TS8A 5MC7A 1MZUA 2J3TC 5F5YA 4WEJA 3C8CA 3H7WB 4R6LA 4JGOA 4EETB 3T4LA 3ZQ5A 4LLOB 3EOIA 4GHIB 2L0WA 4NKPA 1OJ5A 4WN5A 1S66L 3UMDA 3IS2A 2VKSA 5F68A 3F1NA 3CAXA 5LBRA 5J7EA 5A8BA 1TD5A 1UWNX 2NUTC 2EWWA 3LIEA 2ZMVA 1NLZA 4HH3A 4DJ2A 3UE3A 1MKMA 3ICYA 2Z6DA 3VE3A 1EW0A 3S7QA 4LRYC 3K3CA 5HDDA 3LFVA 4DJ3A 2QKPA 3KYQA 5DFYA 1OTEA 4I3AA 4O01A 5DF9A 3R4KA 4LRXC 3MR0A 2XA7S 1F5MA 4EUVA 4Y3IA 4I3IA 3T4SA 4JGPA 4GLQA 4PKYA 1N9LA 2HF6A 1H3QA 2YKHA 3BW6A 4NXFA 1XJ2A 2ZOHA 3VE4A 4II7A 2O9BA 5CX7A 4EESA 3H7WA 2PR6A 4HNBA 1LSWA 2J3TD 4GHIA 2D02A 3E0YA 3S7NA 2Y79A 3KSHA 3GECA 1WA9A 2NUPC 1DP8A 2VEAA 3PBNA 4I3JA 1S67L 3OCLA 4HOIA 5F6AA 2G7UA 4F3LB 3OLOA 4WELA 3A0RA 1UGUA 5TBMB 3IBRA 4HP4A 1T1AA 3MMHA 1YSPA 4KQDA 4XT2B 3KSIA 5HL6A 3KYZA 5HDSA 5TJJA 5AVFA 3TJZC 2FH5A 2PR5A 3LIFA 2P7JA 3S7PA 4O0PA 1TS7A 1JNUA 3PXPA 4Z1WA 2ZBBA 5HWVA 2VGLM 4ARZA 2W27A 3C30A 3LYXA 3BQ8A 2W3DA 1LT0A 1XFQA 3EGDC 2KOIA 3C38A 4NXEA 2Y8HA 1NRJA 3P01A 3NOUC 1OTBA 2W3EA 3BY9A 3PYPA 4FOFA 3TW8A 2M1CA 4KUKA 5KSHA 3MF0A 4YOFA 3ULFA 4GW9A 3B47A 2XSSA 3G6OA 4MMNA 3KO6A 2XROA 4F3LA 4Q0IA 5TBMA 2B02A 3TE8A 2O9AA 2A24B 4M4XA 2VV8A 5DJUA 3FPVA 4XT2A 2VJWA 4Q0HA 4HP9A 4YWZA 1P0ZA 3BQAA 1IFQA 4K08A 4WL9A 4CLCB 1D06A 1ZTUA 2D01A 4PHTA 3H82A 2MJ6A 4QPRA 5EFWA 1P9WA 2O9CA 2HJ9C 3TRCA 2W1RA 3JVUA 2WKRA 5HWWA 2PD8A 4PKYG 3K3DA 4PAUA 4UEYA 5J4EA 5HSQA 3UB7A 4ME4A 1TS0A 3PBTA 1S1ZA 1S1YA 3PBOA 1N9OA 1G28A 3LR4A 1GSVA 1XJ4A 4EQ1A 4IUHA 4HY8A 4HIAA 3D72A 3VV4A 2H28A 4BWIA 1T19A 1YAXA 3F1PB 2O0YA 3CUEA 2KLIA 2Z6CA 4EXOA 3PHYA 3U2AA 3T4JA 1S4SA 2JKTM 5HD5A 4UQIM 2A24A 3UE6A 4JGRA 3BWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J80 A;  3CLO A;  3UB9 A;  4WF0 A;  1OTA A;  5DKK A;  4BBU A;  3MXQ A;  3UB6 A;  2KDK A;  3B33 A;  3SW1 A;  1OT6 A;  2W0N A;  4EEP A;  3CWF A;  4L9F A;  4HJ3 A;  4NXG A;  5F69 A;  3UB8 A;  2V1A A;  5IU1 A;  3F1O B;  3RTY A;  3EEH A;  1XJ3 A;  3LUQ A;  1XJ6 A;  2WKQ A;  4HI4 A;  3E4O A;  5HDC A;  5DJT A;  3F1P A;  4GS9 B;  4EW7 A;  1TS6 A;  2V9A A;  3H82 B;  4MN5 A;  5IS1 A;  3MFX A;  1X0O A;  1DP6 A;  2WKP A;  4BBT A;  4HQA A;  2PHY A;  2V0W A;  4EEU A;  4R3A A;  3GDI A;  3LIC A;  4I5S A;  1OTD A;  1UWP X;  3HJK A;  3MQQ A;  4R70 A;  2PYP A;  3F1O A;  1NWZ A;  3LIA A;  2QJ7 A;  2L1M A;  2VV6 A;  1F98 A;  3HJI A;  4L9G A;  3LID A;  4GS9 A;  1V9Y A;  3FC7 A;  1OTI A;  1N9N A;  2YKF A;  1V9Z A;  4L9E A;  2OWH A;  2CMN A;  2EA9 A;  3RH8 B;  1XFN A;  5I5L A;  4R38 A;  2PD7 A;  4HHD A;  1D7E A;  2L4R A;  3H9W A;  3MQO A;  3P7N A;  1VB6 A;  2QHK A;  1S4R A;  4GCZ A;  2QWS A;  5KIZ A;  3FG8 A;  4HJ4 A;  3NHQ A;  3A0V A;  2OWJ A;  2VV7 A;  4E04 A;  1P97 A;  4I38 A;  5HZH A;  2PYR A;  2V1B A;  3LI9 A;  2OOL A;  3A0S A;  2PDR A;  3T50 A;  5HWT A;  1Y28 A;  3LIB A;  4KUO A;  5J3W A;  2JHE A;  1BYW A;  1DRM A;  1DP9 A;  2V0U A;  4EER A;  1OT9 A;  1LSV A;  2I9V A;  2BAS A;  3C2W A;  4B9O A;  1T18 A;  3LI8 A;  4H6J B;  2R78 A;  1GSW A;  3E4Q A;  2GJ3 A;  3BY8 A;  3E4P A;  1T1C A;  5G4Z A;  4HH2 A;  4MN6 A;  4LPZ A;  2KX6 A;  3UME A;  5HD3 A;  3NOT C;  4HJ6 A;  4WLA A;  2HV1 A;  2K7S A;  2JN7 A;  5G4Y A;  2QJ5 A;  4RQ9 A;  1GSX A;  3IS2 B;  4WUJ A;  4NXB A;  2INW A;  4BBV A;  3F1N B;  3KX0 X;  1F9I A;  3NOP C;  3VOL A;  1LL8 A;  1T1B A;  4H6J A;  1LSX A;  3NJA A;  1KOU A;  4JGQ A;  5DKL A;  5AVE A;  4LRZ E;  4I39 A;  1OJG A;  3EWK A;  1ODV A;  3MJQ A;  2ZOI A;  2VLG A;  1TS8 A;  1MZU A;  5F5Y A;  3C8C A;  3H7W B;  4R6L A;  4JGO A;  4EET B;  3ZQ5 A;  4LLO B;  4GHI B;  2L0W A;  1OJ5 A;  4WN5 A;  1S66 L;  3UMD A;  3IS2 A;  5F68 A;  3F1N A;  3CAX A;  5J7E A;  5A8B A;  1UWN X;  3LIE A;  4HH3 A;  4DJ2 A;  3ICY A;  2Z6D A;  3VE3 A;  1EW0 A;  4LRY C;  3K3C A;  5HDD A;  4DJ3 A;  2QKP A;  1OTE A;  4I3A A;  4LRX C;  3MR0 A;  4I3I A;  4JGP A;  4PKY A;  1N9L A;  2YKH A;  4NXF A;  1XJ2 A;  2ZOH A;  3VE4 A;  4EES A;  3H7W A;  2PR6 A;  4HNB A;  1LSW A;  4GHI A;  2D02 A;  3GEC A;  1WA9 A;  1DP8 A;  2VEA A;  4I3J A;  1S67 L;  4HOI A;  5F6A A;  4F3L B;  3OLO A;  3A0R A;  1UGU A;  5TBM B;  3IBR A;  4HP4 A;  1T1A A;  4KQD A;  4XT2 B;  5HDS A;  5AVF A;  2PR5 A;  3LIF A;  2P7J A;  1TS7 A;  1JNU A;  2ZBB A;  5HWV A;  2W27 A;  3LYX A;  1LT0 A;  1XFQ A;  4NXE A;  3NOU C;  1OTB A;  3BY9 A;  3PYP A;  2M1C A;  4KUK A;  3ULF A;  4GW9 A;  3G6O A;  4F3L A;  5TBM A;  2B02 A;  4M4X A;  2A24 B;  2VV8 A;  5DJU A;  4XT2 A;  4YWZ A;  4HP9 A;  1P0Z A;  4WL9 A;  4K08 A;  1D06 A;  2D01 A;  3H82 A;  5EFW A;  2WKR A;  5HWW A;  2PD8 A;  4PKY G;  3K3D A;  5J4E A;  5HSQ A;  3UB7 A;  1TS0 A;  1S1Z A;  1S1Y A;  1N9O A;  1G28 A;  1GSV A;  1XJ4 A;  4EQ1 A;  4HY8 A;  4HIA A;  3D72 A;  2H28 A;  1T19 A;  3F1P B;  2Z6C A;  4EXO A;  3PHY A;  1S4S A;  5HD5 A;  2A24 A;  3UE6 A;  4JGR A;  3BWL A; 
#chains in the Genus database with same CATH topology
 2J80 A;  2H10 A;  2P08 A;  3CLO A;  1YT4 A;  4P87 A;  4CLC A;  4FCF A;  3S7O A;  4OQ0 A;  3MXQ A;  4BEN A;  5DTT A;  5HFO A;  3KSF A;  2C5W B;  5L10 A;  3DAV A;  1PYY A;  3CWF A;  3IHB A;  4JPM A;  4NXG A;  1ACF A;  4DDS A;  3F1O B;  3NDE A;  2VGJ A;  4UA6 A;  1ESI A;  5E2F A;  3CPT A;  3LUQ A;  1K6R A;  3O5Y A;  1PNE A;  2JKR M;  2XD5 A;  2Y2J A;  1STZ A;  3MZE A;  3FYZ A;  2WGV A;  5FQM A;  1K55 A;  5DF7 A;  4KZ5 A;  1W7F A;  3MFD A;  5EE8 A;  3MS6 A;  1DP6 A;  1XP4 A;  4U3T A;  1S6R A;  2IA2 A;  2V0W A;  4EEU A;  1PZP A;  3GDI A;  2VX8 A;  3BM6 A;  3VSK A;  4I5S A;  1ES5 A;  1OTD A;  3AGD A;  4R70 A;  2ZM8 A;  3LR5 A;  4KQO A;  1D1J A;  3LIA A;  3BFC A;  2M7U A;  2L1M A;  3HLD A;  1NYY A;  1YMX A;  5FEF A;  3CIT A;  1V9Y A;  4WEK A;  5F1F A;  1K4E A;  3R7W B;  1VQQ A;  1GHP A;  3CZD A;  4JF4 A;  5K5B A;  4MDZ A;  1OPX A;  4Y17 A;  1Z6F A;  1V9Z A;  3G2Z A;  4KG5 A;  3FKW A;  4Y13 A;  5F82 A;  2OWH A;  3RH8 B;  5EVI A;  4O8G A;  4KQR A;  3AGE A;  3H9W A;  1TF1 A;  5M19 A;  3V3S A;  2VGL S;  1VB6 A;  4Y0T A;  1K38 A;  2G2W A;  1G6O A;  1I2W A;  2QWS A;  3D4F A;  2OWJ A;  3E98 A;  4E04 A;  5EOO A;  2QPN A;  2W1T A;  2XD1 A;  2V1B A;  4EBP A;  3D3O A;  3LI9 A;  1ES3 A;  5HWT A;  3BJN A;  3LIB A;  5D3O A;  3QNB A;  5J3W A;  1KGF A;  1VET B;  3BEC A;  3QHY A;  1KVM A;  1DRM A;  1DP9 A;  2V0U A;  3M2K A;  3RXW A;  2GNX A;  1RCJ A;  2A49 A;  3O86 A;  1LHY A;  5CTN A;  3IWO A;  2BG1 A;  3LI8 A;  1FSY A;  2R78 A;  3OCN A;  2QYB A;  2EX9 A;  4MCW A;  2GJ3 A;  1MWT A;  1T1C A;  2ZC3 B;  5EVL A;  3HL9 A;  3LR0 A;  4HH2 A;  3IX3 A;  1SKF A;  2BTF P;  4OOL A;  5FAS A;  4LPZ A;  1IOU A;  3B3X A;  1P9R A;  3UO9 A;  3UPP A;  2HV1 A;  3ZG7 B;  3WS1 A;  4RQ9 A;  5JYP A;  4G3V A;  4EWF A;  4ZAM A;  2Z2L B;  3F1N B;  1FOF A;  3KX0 X;  5EM0 A;  1ONH A;  1SDN A;  1PZO A;  4FH2 A;  5EOE A;  1LL8 A;  1T1B A;  2W3G A;  4N1X A;  4JGQ A;  5AVE A;  5FDS A;  2K2N A;  1YQS A;  4IBR A;  4EU0 A;  4XXR A;  4LRZ E;  4R4S A;  4I39 A;  4OP5 A;  2HP9 A;  1JVJ A;  2LB5 A;  3IH8 A;  2VLG A;  5MC7 A;  3TSG A;  4OQH A;  4PPR A;  1FCN A;  3D9Y A;  4KZB A;  4WEJ A;  5FI2 A;  4R6L A;  1N9B A;  4JGO A;  3G34 A;  1GA9 A;  4WN5 A;  1S66 L;  1IYP A;  2HDQ A;  5CRF A;  3UMD A;  3IS2 A;  2VKS A;  5CTM A;  3BEB A;  3UY6 A;  3CAX A;  4K91 A;  4WZ4 A;  5A8B A;  2WAF A;  2R9X A;  3QP8 A;  4FTX A;  2Z6D A;  3VE3 A;  4E6X A;  4LRY C;  4WZ5 C;  5E43 A;  3KYQ A;  1E3U A;  4I3A A;  2ZQD A;  1BLH A;  3BFG A;  2HP6 A;  3DTI A;  2XA7 S;  1XXM A;  5A90 A;  3T4S A;  4JGP A;  2HF6 A;  3MZD A;  4NXF A;  4EES A;  5GLC A;  1JWV A;  2FFF B;  1K54 C;  3E2K A;  2WZZ A;  4UA7 A;  2J3T D;  4GHI A;  5L2F A;  3E0Y A;  3DTK A;  3PAE A;  2Y79 A;  3GEC A;  3ITA A;  2VK3 A;  3PBN A;  4KZ3 A;  2ZL1 A;  3CMZ A;  2ZC7 A;  4F3L B;  2R9W A;  2ZM2 A;  5TBM B;  4HP4 A;  3MMH A;  5EPH A;  4XT2 B;  4JXS A;  1BUE A;  1KGE A;  3MKE A;  2JKF A;  1LL9 A;  4R23 A;  3HLE A;  5AVF A;  3TJZ C;  3NUL A;  3HLF A;  4E3L A;  2P7J A;  1L0E A;  4ZJ3 A;  5CED A;  2ZBB A;  5DF8 A;  3UE1 A;  1WYB A;  4O7D A;  3C30 A;  3O88 A;  2W3D A;  4KG6 A;  3EGD C;  3C38 A;  2Y8H A;  1KGG A;  4LCM A;  1EI5 A;  2ZC4 B;  3P01 A;  1BUL A;  1FCM A;  2Y2G A;  3BY9 A;  3PYP A;  1NXY A;  2ZQ7 A;  3OZH A;  4JBF A;  5KSH A;  1PI5 A;  2Y2H A;  3MF0 A;  3B47 A;  1WE4 A;  1RGZ A;  2V8F A;  4ZDX A;  4EBN A;  2VJW A;  4HP9 A;  3BQA A;  3IXD A;  1IFQ A;  4WL9 A;  5HL1 A;  1D06 A;  4KZ8 A;  2D01 A;  3IF6 A;  2MJ6 A;  4M3K A;  4X53 A;  4IVI A;  1P9W A;  3TRC A;  3NEC A;  4PAU A;  4QHC A;  1CI8 A;  1S1Y A;  1DJB A;  1N9O A;  4C75 A;  1Y4O A;  2OV5 A;  3SS5 A;  4HY8 A;  3E2L A;  3D72 A;  4UAA A;  2H28 A;  4BWI A;  3S22 A;  3F1P B;  1MKI A;  1F2K A;  4CPK A;  3BLM A;  2A24 A;  2PBD P;  3UE6 A;  1Q2Q A;  2HZ5 A;  3Q7V B;  1ONG A;  3OPH A;  3UB9 A;  4X69 A;  4ARZ B;  3HLC A;  3ZVT A;  2WKI A;  1SKO B;  2DMW A;  1VEU A;  2KDK A;  3LCE A;  5FAP A;  3ZG9 B;  3T4T A;  5A93 A;  4LFU A;  3W4O A;  2HDS A;  2W0N A;  4HJ3 A;  3PBQ A;  4CLC C;  3UB8 A;  3IBJ A;  2EX2 A;  4Y0U A;  4P0M A;  5CHJ A;  1RP5 A;  1PIO A;  1XJ3 A;  1YLJ A;  1XJ6 A;  2WKQ A;  1SZV A;  5HDC A;  3LR3 A;  3T1R A;  4OLD A;  4X1M A;  1K4F A;  3SOI A;  3OBF A;  4Y0O A;  4GS9 B;  4MN7 A;  5CHU A;  4LV1 A;  4ZJ2 A;  2V9A A;  5I94 A;  3H82 B;  4QJG A;  5GLD A;  5EM1 A;  1DJC A;  3UB5 P;  5CGS A;  1X0O A;  4ZBE A;  1N4O A;  1E3U D;  2Y2O A;  1HLU P;  2UWX A;  4HQA A;  4R3A A;  2DCF A;  5AJG A;  5FDH A;  1NJ4 A;  3B42 A;  1ALQ A;  3VFF A;  2OAQ 1;  4OOY A;  4L9G A;  3SS4 A;  1BLC A;  4QB8 A;  2XRN A;  2Y59 A;  1OTI A;  1VHM A;  2WUQ A;  2PT7 A;  1MC0 A;  1SHV A;  1YLT A;  1KE3 A;  4L9E A;  1PW1 A;  3OPL A;  2EA9 A;  3VMA A;  4R38 A;  3LEQ A;  3IQA A;  1MXO A;  2PD7 A;  3G4P A;  4HHD A;  3T4K A;  2L4R A;  4GDB A;  3ZGA B;  3P7N A;  3BYD A;  2QHK A;  3T1X A;  5KIZ A;  2Y2L A;  5EVI C;  1GHI A;  1FR1 A;  4OPR A;  2IWB A;  4YFM A;  5AQ7 A;  1H8Z A;  4NK3 A;  1ZC2 A;  3VP2 A;  5HZH A;  4L0L A;  3JVV A;  3CUE C;  4FD8 A;  5F1G A;  2OOL A;  4HBT A;  3HLW A;  3A0S A;  2EWV A;  4H8R A;  1Y28 A;  5E2H A;  3N7W A;  3N4I A;  3M2J A;  3HUM A;  4EER A;  3ITB A;  2EXA A;  3SH7 A;  3IX4 A;  1MBL A;  3Q7Z A;  3NBL A;  1K56 D;  4H6J B;  3FPW A;  3QNC A;  5EV0 A;  1YKD A;  1KVL A;  1K25 A;  3EQU A;  3OPR A;  1CQA A;  2XFS A;  3EQV A;  3AGF A;  3E4P A;  5G4Z A;  1W63 M;  2ZC6 B;  1H8M A;  2WKE A;  2A2L A;  1NRF A;  3RJU A;  4FUW A;  2HGV A;  2E8I A;  2KX6 A;  3UME A;  3DBA A;  3V67 A;  4HJ6 A;  4ZRR A;  1KE4 A;  4R1G A;  1W5D A;  4OKP A;  2QZ6 A;  2WKH A;  2K7S A;  2XK1 A;  5G4Y A;  1NLY A;  2QJ5 A;  4KZA A;  4S2O A;  5HPI A;  2W3F A;  2JE5 A;  3V5M A;  3VOL A;  1OME A;  2H5S A;  3UN7 A;  3NDG A;  5AQB A;  4CJN A;  1NYM A;  4ESP A;  1BTL A;  3IHA A;  2W3H A;  3C7V A;  2IWC A;  4DN0 A;  3WS4 A;  4ETX A;  2CC1 A;  2X71 A;  1MZU A;  3ZFZ A;  5F5Y A;  3NIA A;  1CF0 A;  3H7W B;  3QP1 A;  1K0K A;  4QY5 A;  5GHY A;  3EOI A;  2VGK A;  3ZNY A;  2UV0 E;  5FQQ A;  5J7E A;  1UWN X;  4LCL A;  2EWW A;  3LIE A;  2ZMV A;  3W4Q A;  4HH3 A;  1HZO A;  4DJ2 A;  5FI6 A;  3ICY A;  3VOZ A;  3MBZ A;  3S7Q A;  5HDD A;  3K3C A;  3LFV A;  4HES A;  4DJ3 A;  2QKP A;  2AVX A;  1L0D A;  4EUV A;  4Y3I A;  1M6K A;  4GLQ A;  1N9L A;  4EV4 A;  4DF6 A;  2YKH A;  2Y2P A;  3G35 A;  3FWL A;  1XJ2 A;  4NET A;  2O9B A;  5CX7 A;  2V2F F;  4JXG A;  2XQZ A;  1IEM A;  1LL5 A;  2D02 A;  5GL9 A;  1XGJ A;  2HDU A;  2J9O A;  4KQQ A;  4S2K A;  4MNR A;  3VP3 A;  5HX9 A;  2NUP C;  4PM9 A;  2WGW B;  1DP8 A;  4I3J A;  5FQJ A;  3FV7 A;  1BSG A;  3OLO A;  3SZT A;  4S2N A;  5KZH A;  3A0R A;  1Q2P A;  3IBR A;  1T1A A;  1PW8 A;  1SCW A;  2ZQ9 A;  3KYZ A;  5HDS A;  5TJJ A;  4C3Q A;  4QD4 A;  3S7P A;  3Q82 A;  1TS7 A;  1JNU A;  5HWV A;  2OLV A;  4ARZ A;  2W27 A;  4X55 A;  4N1H A;  2XH9 A;  3LYX A;  2JCH A;  1S0W A;  1ESU A;  3HUN A;  4N92 A;  3FZC A;  4LV3 A;  1FSW A;  4EBL A;  1OTB A;  2W3E A;  4FOF A;  2M1C A;  4IBX A;  4GW9 A;  4MMN A;  3UPO A;  3G6O A;  4BQM A;  2XRO A;  2P9V A;  2Q9M A;  5CGW A;  5HAQ A;  3NY4 A;  1JWP A;  2VV8 A;  3FPV A;  1J3W A;  4OH0 A;  2Y2I A;  3Q81 A;  4LV2 A;  4CLC B;  5TGF A;  2PU4 A;  4S2J A;  3H82 A;  3P09 A;  2XLN A;  4Y7P A;  3HBR A;  1IYO A;  5FAQ A;  4OPY A;  2WKR A;  1J9M A;  4UA9 A;  5HSQ A;  3UB7 A;  4RX3 A;  4ME4 A;  1VM1 A;  2GDN A;  5U47 A;  1G28 A;  5TFQ A;  3CPT B;  1XJ4 A;  4EQ1 A;  3VV4 A;  4FH4 A;  3HUO A;  1O07 A;  2Z6C A;  3U2A A;  1L0G A;  3NCK A;  4YIN A;  4Z1W A;  5A92 A;  3GRJ A;  2GZA A;  4WF0 A;  1TEM A;  1OTA A;  4NEE D;  3W2Z A;  4BBU A;  4IUK A;  3UB6 A;  3Q1F A;  3MXR A;  3QP2 A;  4DKI A;  3B33 A;  3T4O A;  2P74 A;  1JTG A;  3GR2 A;  4JXW A;  3SW1 A;  3EGX C;  2HPB A;  2PU2 A;  3IT9 A;  4EEP A;  2Y2Q A;  4WMC D;  5F69 A;  3VFH A;  4BJP A;  4YNR A;  1I5Q A;  4E6W A;  3E4O A;  5DJT A;  5AQA A;  4EW7 A;  1YLP A;  1TS6 A;  4ZJ1 A;  2ZD8 A;  4MN5 A;  4S2I A;  1W79 A;  4X25 A;  3C4P A;  2ACG A;  4IHQ A;  1XPB A;  3IXG A;  1PWD A;  4BD1 A;  2PHY A;  5EVI B;  5JYO A;  4OOM A;  5M18 A;  3O87 A;  1UWP X;  3LO7 A;  2O99 A;  3MKF A;  3F1O A;  3T4Q A;  4QY6 A;  1ZHH B;  2PBY A;  4AFI A;  2QJ7 A;  2EX6 A;  2VV6 A;  1F98 A;  2ZMF A;  1MWU A;  3HJI A;  4X6T A;  3LID A;  2JC7 A;  2V1Z A;  3QP6 A;  3WS2 A;  2W1T B;  4B93 A;  3G32 A;  4FSF A;  3FC7 A;  2YKF A;  4EUZ A;  1K56 A;  4NG2 A;  4OP8 A;  5HAI A;  3T1S A;  5CHM A;  1YLZ A;  5I5L A;  4KZ4 A;  4E3M A;  3HVF A;  1D7E A;  3ZDJ A;  3V3R A;  1YSQ A;  1K6S A;  4MBK A;  5FQI A;  4WZ5 A;  1S4R A;  4GCZ A;  2Y2K A;  3PAG A;  4CQH A;  4Y2F A;  3FG8 A;  1AWI A;  3IXH A;  4HJ4 A;  3NHQ A;  3A0V A;  3CI6 A;  4ID4 A;  4N9K A;  3RFB A;  2VV7 A;  1P97 A;  4CLC E;  4DDY A;  2XDM A;  2HP5 A;  1G68 A;  1NZO A;  3A3E A;  4E3N A;  4Q0J A;  3HRE A;  3R7W A;  1K54 A;  2PDR A;  1CJF A;  5TR7 A;  3A3F A;  4BMW A;  3MQ0 A;  3ZYT A;  1BYW A;  1L2S A;  2Q0O A;  2Y2N A;  4IVK A;  1OT9 A;  1SDE A;  2BAS A;  1QMF A;  1XGI A;  1H5X A;  1W8Y A;  5CEC A;  1BLS A;  1DJA A;  2ZLY A;  1I2S A;  4KZ6 A;  4X56 A;  3E4Q A;  4GN2 A;  3BY8 A;  4DXB A;  1W63 Q;  4PM8 A;  3UDX A;  2ZC5 B;  1AXB A;  4WLA A;  1K55 C;  4JF5 A;  1NZU A;  1VET A;  4R3J A;  3T12 B;  1KDS A;  2BLS A;  2K31 A;  2LB9 A;  3IS2 B;  4BBV A;  3V39 A;  4R3B A;  1F9I A;  5L09 A;  3WRT A;  4GZB A;  1WYC A;  1E4D A;  2GX5 A;  4GD6 A;  1EWZ A;  3NJA A;  3TG9 A;  4S2M A;  1XA7 A;  2DRW A;  3GMW A;  1ERO A;  1OJG A;  1ODV A;  2V8C A;  3MJQ A;  4C6Y A;  1PWG A;  2J3T C;  3S1Y A;  3C8C A;  1ZG6 A;  3I7J A;  3LEZ A;  3UDI A;  1YLY A;  3ZQ5 A;  4LLO B;  4GHI B;  2X02 A;  4DXC A;  4S2P A;  2L0W A;  4NKP A;  1NY0 A;  1KE0 A;  3LY3 A;  3F1N A;  5LBR A;  1XA1 A;  2WZX A;  4R4R A;  3O3V A;  1U60 A;  2ZL1 B;  1EW0 A;  4IED A;  2J8Y A;  1MWR A;  3NI9 A;  4OPZ A;  5DFY A;  1OTE A;  3N8S A;  4O01 A;  4GKU A;  5DF9 A;  3R4K A;  3MR0 A;  4I3I A;  4OLG A;  3S4X A;  1K57 A;  3FKV A;  4PKY A;  1H3Q A;  3BW6 A;  2ZOH A;  4II7 A;  1G6A A;  1HD8 A;  3QP4 A;  4PMA A;  4Z9Q A;  1TDG A;  3JYI A;  4KEN B;  1BT5 A;  3S7N A;  5FQ9 A;  4PM6 A;  4HEF A;  2VEA A;  3CJM A;  2WAD A;  5F6A A;  2E8J A;  3QP5 A;  4JXV A;  2ZQA A;  3UNW A;  3C7U A;  1YSP A;  1MWS A;  5AQ9 A;  3KSI A;  5HL6 A;  3CG5 A;  1YPR A;  4MLL A;  5L07 A;  1IKG A;  3IF6 B;  3LIF A;  4S2N C;  3ZG0 A;  4O0P A;  3PXP A;  1BZA A;  4GB7 A;  1RGY A;  4U0T A;  2VGL M;  4OQI A;  2XGN A;  3BFD A;  4U0X A;  2Y55 A;  1XFQ A;  5GHZ A;  2KOI A;  4D2O A;  3W8K A;  4WYY A;  4LGW A;  3NOU C;  3IH9 A;  2B95 A;  5HAP A;  3RXX A;  2XSS A;  3KO6 A;  4F3L A;  1HVB A;  4Y15 A;  4Q0I A;  1L0F A;  5TBM A;  2B02 A;  4Q8I A;  4WMC A;  2A24 B;  2JKG A;  5DJU A;  5J8X A;  4XT2 A;  3ZG8 B;  4Q0H A;  1P0Z A;  4K08 A;  1PRQ A;  1ZTU A;  4PHT A;  4E3I A;  1VEU B;  5CEB A;  2XF3 A;  4QPR A;  4N9L A;  2O9C A;  2HJ9 C;  2W1R A;  5DVA A;  4PKY G;  3K3D A;  4UEY A;  1CEF A;  5J4E A;  4WM9 A;  2ZQC A;  1TS0 A;  2I72 A;  1S1Z A;  2C6W B;  5EEC A;  4B4X A;  2DNS A;  3WRZ A;  3LR4 A;  1IYS A;  1ERM A;  4IUH A;  5M1A A;  3L7H A;  2EFU A;  1MY8 A;  1T19 A;  3JPU A;  1YAX A;  2O0Y A;  3CUE A;  4EXO A;  1ERQ A;  2B5R A;  1S4S A;  4UQI M;  4JGR A;  1Y54 A;  2X01 A;  3EEA A;  4OVD A;  3OC2 A;  5CER A;  5FAT A;  1M40 A;  5DKK A;  1PFL A;  4K0X A;  2Y4A A;  1KDW A;  5FAO A;  3MXS A;  1XX2 A;  1PWC A;  1OT6 A;  4KZ9 A;  4L9F A;  2V1A A;  5IU1 A;  2VZW A;  3VP1 A;  2B18 A;  3RTY A;  4BL2 A;  1JWZ A;  3DTM A;  3EEH A;  2OAP 1;  3BLS A;  4HI4 A;  1TVF A;  5E2G A;  3F1P A;  3PTE A;  3A3J A;  4RVA A;  3PR6 A;  3NC8 A;  3KSG A;  5G18 A;  3Q7V A;  2EX8 A;  5IS1 A;  3MFX A;  2WKP A;  4DE0 A;  2XR0 A;  3MSH A;  2G2U A;  2J9P A;  5FL3 A;  1SKO A;  4BBT A;  4MEZ A;  4P85 A;  4G3K A;  3IWQ A;  3TOI A;  3PBS A;  4GJ4 A;  4UQI S;  3LIC A;  4OON A;  5HAR A;  1TDL A;  4PM7 A;  4G3W A;  3HJK A;  4GNU A;  3MQQ A;  1GA0 A;  2PYP A;  1NWZ A;  3GSG A;  1LI0 A;  2Y2M A;  3ZCZ A;  2XA7 M;  4CLC D;  2J7V A;  5GLB A;  2JKT I;  4DRT A;  3LGO A;  4GS9 A;  1IKI A;  4Y5F A;  1N9N A;  2P04 A;  1IEL A;  2ZJ9 A;  3BFE A;  5HPF A;  1C3B A;  3UDF A;  5FSR A;  4BL3 A;  3UPN A;  2CMN A;  2HJE A;  3C5A A;  3K2N A;  1XFN A;  4X1L A;  4ETZ A;  4XUX A;  2EFX A;  3IF6 C;  4B4Z A;  3HCY A;  3GVB A;  3IX8 A;  3MQO A;  1H0M A;  5CXW A;  4P6B A;  5DTK A;  4BLM A;  4OPQ A;  4E3O A;  2JKR I;  4DE1 A;  4LV0 A;  4I38 A;  1CEG A;  2PYR A;  5CGX A;  2ZM0 A;  4QWO A;  3T50 A;  3GQZ A;  4P6Z M;  3M6H A;  4KUO A;  5KSC A;  3CHW P;  2JHE A;  3SH8 A;  5L8M A;  3T1Q B;  2J3W A;  2PAV P;  1GCE A;  5E2E A;  3ZHH A;  5EVE A;  4QU3 A;  1DY6 A;  4GOG A;  4KZ7 A;  1LSV A;  3OPP A;  4K0W A;  2I9V A;  3BFF A;  3C2W A;  4B9O A;  3OOV A;  4LEN A;  1T18 A;  4X68 A;  2RCX A;  5KMW A;  1JTD A;  1MPL A;  5C5K A;  4DMZ A;  1ES2 A;  3KYE A;  1GSW A;  5DFX A;  5IT5 A;  2VA0 A;  2XEP A;  5IHV A;  1YM1 A;  4JLF A;  5EVI D;  1O7E A;  1YMS A;  4RA7 A;  5GHX A;  2OLU A;  2FZ0 A;  1CI9 A;  4MN6 A;  1CK3 A;  3V50 A;  5HD3 A;  3NOT C;  3UE0 A;  2RL3 A;  1QME A;  1E25 A;  3BRM A;  2JN7 A;  1GSX A;  3MZF A;  4WUJ A;  4NXB A;  3W4P A;  3G31 A;  2INW A;  2Z2M B;  2WYX A;  3NOP C;  2ZMA A;  4P6Z S;  1W8Q A;  4ZTK A;  5BOH A;  1H8Y A;  4H6J A;  1LSX A;  3HLB A;  1KOU A;  3LY4 A;  5DKL A;  3GV9 A;  2M7V A;  3EWK A;  3PBR A;  3ISG A;  4IJG A;  1ZKJ A;  5HW3 A;  3WS5 A;  1LI9 A;  1FIL A;  5F83 A;  2ZOI A;  1TS8 A;  3GTC A;  4D60 A;  3DW0 A;  1GHM A;  2H0Y A;  3WS0 A;  1ZG4 A;  4EET B;  3T4L A;  1G5U A;  1OJ5 A;  1FQG A;  1Z09 A;  5F68 A;  2EXB A;  2PRF A;  1TD5 A;  3L9K A;  2NUT C;  3IF5 A;  4MBH A;  4EQI A;  1NLZ A;  2A3U A;  2QMI A;  5EUA A;  3UE3 A;  1MKM A;  1YLW A;  3N8L A;  4RX2 A;  4BD0 A;  3A3I A;  1IYQ A;  1FIK A;  2WK0 A;  5FI7 A;  4E3J A;  4LRX C;  1F5M A;  3HLG A;  4UHU A;  3A3D A;  3VE4 A;  2JBF A;  4PM5 A;  3U4L P;  3VP0 A;  3H7W A;  4OQG A;  3ZNT A;  3ZVW A;  2PR6 A;  4HNB A;  4GDN A;  5DTS A;  3DWZ A;  1LSW A;  3IWI A;  1K57 C;  4MBF A;  5A91 A;  3KSH A;  1WA9 A;  5FEG A;  4RYE A;  2WGI A;  1S67 L;  3OCL A;  3IXB A;  4HOI A;  3SS3 A;  2G7U A;  2P9V B;  1L3L A;  4WEL A;  1UGU A;  4KQD A;  1HTZ A;  4DE2 A;  3VOY A;  2FH5 A;  2PR5 A;  1XKZ A;  3WWX A;  2Q9N A;  4JKT A;  3ZG5 A;  3VSL A;  3P98 A;  2IWD A;  4WBG A;  3BQ8 A;  3N6I A;  1LT0 A;  4GD8 A;  1LLB A;  4NXE A;  1ES4 A;  4R0Q A;  1NRJ A;  4E3K A;  1PI4 A;  3TW8 A;  2WGW A;  4KUK A;  2V20 A;  1FCO A;  4YOF A;  3ULF A;  2OSU A;  3TE8 A;  2O9A A;  3N8R A;  4M4X A;  5FA7 A;  3DWK A;  1A0K A;  4YWZ A;  5GLA A;  5FQK A;  4A5R A;  4JF6 A;  3Q07 A;  3DTE A;  2XFT A;  5EFW A;  3SH9 A;  3JVU A;  5HWW A;  4B88 A;  4HBU A;  2PD8 A;  4XUZ A;  3PBT A;  3G30 A;  3VP4 A;  3PBO A;  1GSV A;  1FR6 A;  2FFY A;  2H0T A;  2HDR A;  1BLP A;  4DE3 A;  2ZQ8 A;  4HIA A;  4KG2 A;  3M6B A;  2Y91 A;  2KLI A;  3C4O A;  3G2Y A;  4F94 A;  3PHY A;  3T4J A;  2JKT M;  5HD5 A;  4S2L A;  2WAE A;  3BWL A; 
#chains in the Genus database with same CATH homology
 2J80 A;  2P08 A;  3CLO A;  3UB9 A;  3EEA A;  4WF0 A;  2GZA A;  3OC2 A;  4ARZ B;  1OTA A;  4NEE D;  4CLC A;  5DKK A;  3W2Z A;  3S7O A;  4BBU A;  3MXQ A;  4IUK A;  3UB6 A;  2DMW A;  2KDK A;  3T4T A;  3B33 A;  3T4O A;  3KSF A;  3SW1 A;  1OT6 A;  3EGX C;  2W0N A;  4EEP A;  3CWF A;  4L9F A;  4HJ3 A;  3PBQ A;  4NXG A;  5F69 A;  3UB8 A;  4CLC C;  2V1A A;  4BJP A;  3IBJ A;  5IU1 A;  2VZW A;  4YNR A;  2B18 A;  3F1O B;  3RTY A;  3EEH A;  1XJ3 A;  3LUQ A;  1XJ6 A;  2OAP 1;  2WKQ A;  4HI4 A;  3E4O A;  5HDC A;  3LR3 A;  3O5Y A;  5DJT A;  3F1P A;  2JKR M;  3OBF A;  4GS9 B;  4EW7 A;  3PR6 A;  4MN7 A;  1TS6 A;  3KSG A;  2V9A A;  1STZ A;  3H82 B;  4MN5 A;  5IS1 A;  3MFX A;  4IHQ A;  1X0O A;  1DP6 A;  2WKP A;  2IA2 A;  5FL3 A;  4BBT A;  4HQA A;  4G3K A;  2PHY A;  2V0W A;  4EEU A;  3PBS A;  4GJ4 A;  4R3A A;  3GDI A;  4UQI S;  2VX8 A;  3LIC A;  5AJG A;  4I5S A;  4OOM A;  4G3W A;  1OTD A;  1UWP X;  3HJK A;  3MQQ A;  3B42 A;  2O99 A;  4R70 A;  2PYP A;  3F1O A;  1NWZ A;  3T4Q A;  1ZHH B;  3LR5 A;  4KQO A;  4AFI A;  3LIA A;  2OAQ 1;  2XA7 M;  2QJ7 A;  2M7U A;  2L1M A;  4CLC D;  2VV6 A;  1F98 A;  2ZMF A;  3HJI A;  4L9G A;  3LID A;  2JKT I;  2W1T B;  3CIT A;  4GS9 A;  4B93 A;  1V9Y A;  2XRN A;  4FSF A;  4WEK A;  4Y5F A;  3FC7 A;  1OTI A;  1N9N A;  2P04 A;  1VHM A;  2YKF A;  3R7W B;  2PT7 A;  5HPF A;  5K5B A;  4MDZ A;  1OPX A;  1MC0 A;  1V9Z A;  4L9E A;  2OWH A;  2CMN A;  2EA9 A;  2HJE A;  3RH8 B;  3K2N A;  1XFN A;  5I5L A;  4R38 A;  4ETZ A;  2PD7 A;  4O8G A;  4HHD A;  3HCY A;  1D7E A;  2L4R A;  3H9W A;  1TF1 A;  3T4K A;  3MQO A;  2VGL S;  3P7N A;  1YSQ A;  1VB6 A;  2QHK A;  1S4R A;  4GCZ A;  1G6O A;  4CQH A;  4Y2F A;  2QWS A;  5KIZ A;  3FG8 A;  4HJ4 A;  3NHQ A;  3A0V A;  2OWJ A;  3CI6 A;  2JKR I;  3E98 A;  3RFB A;  2VV7 A;  4E04 A;  1P97 A;  4I38 A;  4CLC E;  5HZH A;  2W1T A;  4L0L A;  2PYR A;  2V1B A;  3JVV A;  3D3O A;  3CUE C;  3LI9 A;  2OOL A;  4Q0J A;  3R7W A;  3A0S A;  2PDR A;  3T50 A;  5HWT A;  4P6Z M;  2EWV A;  4BMW A;  3BJN A;  1Y28 A;  3LIB A;  4KUO A;  3MQ0 A;  5J3W A;  2JHE A;  5L8M A;  3ZYT A;  1BYW A;  2J3W A;  1DRM A;  1DP9 A;  2V0U A;  4EER A;  1OT9 A;  1LSV A;  2I9V A;  2BAS A;  2GNX A;  3C2W A;  4B9O A;  3OOV A;  1T18 A;  3LI8 A;  4H6J B;  3FPW A;  5C5K A;  1YKD A;  2R78 A;  3OCN A;  4DMZ A;  2QYB A;  3EQU A;  1GSW A;  5DFX A;  4MCW A;  5IT5 A;  2VA0 A;  3E4Q A;  3EQV A;  2GJ3 A;  3BY8 A;  3E4P A;  1T1C A;  5G4Z A;  3LR0 A;  1W63 M;  1W63 Q;  4HH2 A;  1H8M A;  2A2L A;  2FZ0 A;  4OOL A;  4MN6 A;  4LPZ A;  1IOU A;  2HGV A;  2KX6 A;  3UME A;  3DBA A;  1P9R A;  3V67 A;  5HD3 A;  3NOT C;  4HJ6 A;  4ZRR A;  4WLA A;  2HV1 A;  2K7S A;  2JN7 A;  5G4Y A;  1NLY A;  2QJ5 A;  4RQ9 A;  1GSX A;  5HPI A;  2W3F A;  2K31 A;  4G3V A;  2LB9 A;  3IS2 B;  4WUJ A;  4NXB A;  2INW A;  4BBV A;  3F1N B;  3KX0 X;  1F9I A;  3NOP C;  3VOL A;  4P6Z S;  1LL8 A;  1T1B A;  2W3G A;  2GX5 A;  4H6J A;  1LSX A;  3NJA A;  1KOU A;  4JGQ A;  5DKL A;  5AVE A;  2K2N A;  2W3H A;  4EU0 A;  2M7V A;  4LRZ E;  4I39 A;  1OJG A;  3EWK A;  1ODV A;  4DN0 A;  4ETX A;  3PBR A;  4IJG A;  3MJQ A;  2LB5 A;  2ZOI A;  2VLG A;  1TS8 A;  5MC7 A;  1MZU A;  2J3T C;  5F5Y A;  4WEJ A;  3C8C A;  3H7W B;  4R6L A;  4JGO A;  4EET B;  3T4L A;  3ZQ5 A;  4LLO B;  3EOI A;  4GHI B;  2L0W A;  4NKP A;  1OJ5 A;  4WN5 A;  1S66 L;  3UMD A;  3IS2 A;  2VKS A;  5F68 A;  3F1N A;  3CAX A;  5LBR A;  5J7E A;  5A8B A;  1TD5 A;  1UWN X;  2NUT C;  2EWW A;  3LIE A;  2ZMV A;  1NLZ A;  4HH3 A;  4DJ2 A;  3UE3 A;  1MKM A;  3ICY A;  2Z6D A;  3VE3 A;  1EW0 A;  3S7Q A;  4LRY C;  3K3C A;  5HDD A;  3LFV A;  4DJ3 A;  2QKP A;  3KYQ A;  5DFY A;  1OTE A;  4I3A A;  4O01 A;  5DF9 A;  3R4K A;  4LRX C;  3MR0 A;  2XA7 S;  1F5M A;  4EUV A;  4Y3I A;  4I3I A;  3T4S A;  4JGP A;  4GLQ A;  4PKY A;  1N9L A;  2HF6 A;  1H3Q A;  2YKH A;  3BW6 A;  4NXF A;  1XJ2 A;  2ZOH A;  3VE4 A;  4II7 A;  2O9B A;  5CX7 A;  4EES A;  3H7W A;  2PR6 A;  4HNB A;  1LSW A;  2J3T D;  4GHI A;  2D02 A;  3E0Y A;  3S7N A;  2Y79 A;  3KSH A;  3GEC A;  1WA9 A;  2NUP C;  1DP8 A;  2VEA A;  3PBN A;  4I3J A;  1S67 L;  3OCL A;  4HOI A;  5F6A A;  2G7U A;  4F3L B;  3OLO A;  4WEL A;  3A0R A;  1UGU A;  5TBM B;  3IBR A;  4HP4 A;  1T1A A;  3MMH A;  1YSP A;  4KQD A;  4XT2 B;  3KSI A;  5HL6 A;  3KYZ A;  5HDS A;  5TJJ A;  5AVF A;  3TJZ C;  2FH5 A;  2PR5 A;  3LIF A;  2P7J A;  3S7P A;  4O0P A;  1TS7 A;  1JNU A;  3PXP A;  4Z1W A;  2ZBB A;  5HWV A;  2VGL M;  4ARZ A;  2W27 A;  3C30 A;  3LYX A;  3BQ8 A;  2W3D A;  1LT0 A;  1XFQ A;  3EGD C;  2KOI A;  3C38 A;  4NXE A;  2Y8H A;  1NRJ A;  3P01 A;  3NOU C;  1OTB A;  2W3E A;  3BY9 A;  3PYP A;  4FOF A;  3TW8 A;  2M1C A;  4KUK A;  5KSH A;  3MF0 A;  4YOF A;  3ULF A;  4GW9 A;  3B47 A;  2XSS A;  3G6O A;  4MMN A;  3KO6 A;  2XRO A;  4F3L A;  4Q0I A;  5TBM A;  2B02 A;  3TE8 A;  2O9A A;  2A24 B;  4M4X A;  2VV8 A;  5DJU A;  3FPV A;  4XT2 A;  2VJW A;  4Q0H A;  4HP9 A;  4YWZ A;  1P0Z A;  3BQA A;  1IFQ A;  4K08 A;  4WL9 A;  4CLC B;  1D06 A;  1ZTU A;  2D01 A;  4PHT A;  3H82 A;  2MJ6 A;  4QPR A;  5EFW A;  1P9W A;  2O9C A;  2HJ9 C;  3TRC A;  2W1R A;  3JVU A;  2WKR A;  5HWW A;  2PD8 A;  4PKY G;  3K3D A;  4PAU A;  4UEY A;  5J4E A;  5HSQ A;  3UB7 A;  4ME4 A;  1TS0 A;  3PBT A;  1S1Z A;  1S1Y A;  3PBO A;  1N9O A;  1G28 A;  3LR4 A;  1GSV A;  1XJ4 A;  4EQ1 A;  4IUH A;  4HY8 A;  4HIA A;  3D72 A;  3VV4 A;  2H28 A;  4BWI A;  1T19 A;  1YAX A;  3F1P B;  2O0Y A;  3CUE A;  2KLI A;  2Z6C A;  4EXO A;  3PHY A;  3U2A A;  3T4J A;  1S4S A;  2JKT M;  5HD5 A;  4UQI M;  2A24 A;  3UE6 A;  4JGR A;  3BWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...