5AVEA

The ligand binding domain of mlp37 with serine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
SVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRSTLIHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
total genus 82
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5aveA02
1XJ6A 1P0ZA 1KOUA 1VB6A 4GW9A 2PDRA 2J80A 2PD8A 3LICA 2ZOIA 2QHKA 1OJGA 4WUJA 1F98A 4HJ6A 4L9FA 1LSWA 3NHQA 5J4EA 2HV1A 3NOPC 3KX0X 4NXBA 2H28A 3F1OA 4WF0A 4EQ1A 2R78A 4L9EA 4BBVA 2M1CA 2ZOHA 3T50A 3NOUC 4JGPA 1MZUA 1DP8A 1LL8A 4EXOA 1F9IA 5HD5A 2PHYA 2D01A 3IS2B 4XT2A 4EW7A 4GHIA 4HQAA 3H82B 2W27A 3UB6A 2KX6A 3MQOA 4YWZA 3EEHA 4R38A 5F5YA 3UB9A 4I39A 2VV6A 4EEPA 1T1AA 4R3AA 1N9NA 4GCZA 2W0NA 5G4ZA 5TBMB 1OT6A 4I5SA 3CWFA 2INWA 4PKYA 1TS0A 2PYRA 4RQ9A 4LRYC 1S4RA 2L4RA 1T1CA 2V0UA 5AVEA 1DP9A 4KUKA 3H7WA 1D06A 3UB7A 4HY8A 3RH8B 1WA9A 3F1NA 3ICYA 1UWPX 3H9WA 5J3WA 3VOLA 2YKHA 1GSWA 3LI9A 3MJQA 5J7EA 1OTIA 3OLOA 2VEAA 4NXFA 3E4OA 2V1BA 1V9YA 3F1OB 4HI4A 4NXEA 1P97A 3A0RA 1NWZA 4EETB 3UE6A 5DJTA 1JNUA 4KQDA 3ULFA 5HDCA 4XT2B 4HIAA 4EEUA 1ODVA 4R6LA 2QWSA 4WLAA 2PR6A 2KDKA 1LT0A 1S1YA 3P7NA 2A24A 2PR5A 5DJUA 1V9ZA 4WN5A 4F3LA 5HD3A 5HWWA 4I3AA 1N9OA 2WKQA 2OWJA 3ZQ5A 1S4SA 3F1PA 3LIFA 2V1AA 2WKPA 4EESA 1UGUA 3BY9A 1XFQA 1T19A 3BWLA 3A0SA 2WKRA 3PHYA 2OOLA 1XJ2A 2JHEA 1DRMA 2PD7A 2QJ7A 4HP9A 1TS8A 2D02A 3HJIA 4GS9A 3H7WB 4HHDA 5HWVA 5HSQA 1XJ4A 2VLGA 2I9VA 2QKPA 3F1NB 3B33A 1DP6A 1OTEA 1EW0A 1S1ZA 5IS1A 5HZHA 3VE4A 4BBTA 4MN5A 4BBUA 1S66L 3VE3A 3LIEA 4HJ4A 4LRXC 4EERA 5TBMA 3UMDA 1TS7A 4LRZE 5KIZA 2BASA 3LIAA 1D7EA 3LIBA 3MR0A 4B9OA 2P7JA 5I5LA 2EA9A 3UMEA 2JN7A 4HH3A 2V0WA 5F6AA 2B02A 3MXQA 2VV7A 1X0OA 1Y28A 4LLOB 3D72A 5DKKA 2A24B 4HP4A 4H6JA 3G6OA 5F69A 4HJ3A 5HWTA 2Z6CA 3NOTC 3E4QA 4GHIB 2YKFA 1OTAA 5HDDA 1LSVA 4LPZA 1T1BA 5F68A 3F1PB 3LIDA 3A0VA 3FC7A 4WL9A 2Z6DA 3C8CA 3EWKA 2VV8A 3RTYA 4I3IA 3E4PA 5G4YA 4K08A 3LI8A 4KUOA 4MN6A 4DJ3A 4HOIA 4GS9B 2K7SA 2L1MA 3LUQA 1G28A 1TS6A 3MFXA 1OTBA 1OTDA 3K3CA 1XJ3A 4F3LB 3NJAA 3C2WA 3IBRA 5DKLA 3GECA 1XFNA 3MQQA 5A8BA 2QJ5A 3IS2A 2ZBBA 4JGOA 1N9LA 3CAXA 3H82A 3SW1A 1T18A 2OWHA 2V9AA 5EFWA 3PYPA 3FG8A 1S67L 1LSXA 2CMNA 4L9GA 3GDIA 4JGRA 3UB8A 4M4XA 1OT9A 4I38A 4R70A 5HDSA 4JGQA 4HNBA 3K3DA 4DJ2A 3LYXA 4H6JB 3BY8A 4PKYG 4HH2A 2L0WA 3HJKA 3CLOA 4NXGA 2GJ3A 4I3JA 1OJ5A 1GSVA 1GSXA 1BYWA 2PYPA 5AVFA 5IU1A 4E04A 1UWNX
chains in the Genus database with same CATH superfamily
4PMAA 1K56D 1XJ6A 1SKOA 2PDRA 2J80A 3S7PA 1OMEA 1K55A 3FKWA 2X01A 2WKIA 4HJ6A 4O01A 5CX7A 1HTZA 3UDXA 3BFFA 1TDLA 3NHQA 1IEMA 3R7WA 1FSWA 1BULA 4EBLA 4P6ZM 4NXBA 3F1OA 4WF0A 4EQ1A 2R78A 3C38A 4L9EA 3ITBA 3GSGA 2XFSA 3JVVA 5FI2A 4ZTKA 2PHYA 1FIKA 4PM8A 2D01A 3MZDA 3PAGA 4GHIA 4HQAA 4X55A 2K31A 1N9BA 3NI9A 2W27A 4P87A 3IF5A 3SH9A 3T1SA 3MQOA 1MBLA 5IHVA 3W4QA 5F5YA 2H0TA 2IWCA 4BD1A 4X1MA 3OPRA 4ETZA 4X25A 2O0YA 1K54C 3NDGA 1PWDA 2WYXA 2JKTI 1K25A 2W1TB 3W2ZA 4OP5A 4RQ9A 4OQHA 1ONGA 3T1XA 2XD5A 4P6ZS 4GDBA 4MCWA 1S4RA 2V2FF 1MKIA 5EPHA 3A3FA 1KDSA 2L4RA 1F5MA 2EXAA 3OCNA 5L09A 5GLAA 4WZ4A 4JPMA 1K6SA 3BJNA 4WMCD 5DTTA 1D06A 3RH8B 5CEBA 3BW6A 1CJFA 2WZZA 3K2NA 3ZG9B 1SKOB 2HDSA 3BM6A 1G6OA 3MJQA 2VEAA 2GZAA 3NC8A 3KO6A 1MC0A 3BRMA 1STZA 1ZTUA 2C5WB 3R7WB 3A3EA 1BSGA 5HPIA 4LCMA 3F1OB 4BMWA 2EX6A 1NYYA 1XP4A 3UE6A 3PBOA 4MBFA 3ZNTA 4PAUA 1JNUA 1SDEA 3VSKA 2ZC5B 1XX2A 5CECA 4X6TA 5HDCA 1H8YA 2R9WA 4EEUA 4LV1A 4R6LA 4UEYA 1YMXA 3V39A 2JC7A 3MKEA 2QWSA 4WLAA 3T12B 3JVUA 1LT0A 4S2MA 2Y2NA 3T4TA 3G34A 1TDGA 1V9ZA 4WN5A 4F3LA 5HD3A 4IUKA 1AXBA 4I3AA 4KZ4A 2J9OA 3VP2A 1KGFA 2E8IA 1ES5A 2J7VA 1NRJA 3CJMA 3IWOA 4X53A 3F1PA 2V1AA 2HF6A 1A0KA 2WKPA 4IVKA 1UGUA 5JYOA 1XFQA 1JWPA 2WKRA 3PHYA 5KSHA 3BFGA 2EX8A 2JKGA 2OOLA 3DTEA 1BTLA 3TSGA 3MQ0A 2PD7A 1YSPA 2D02A 1MXOA 1JTDA 2Y91A 2WZXA 4IJGA 1VHMA 3AGFA 3LO7A 3C7VA 3C5AA 1DP6A 2HZ5A 3LR0A 3MXSA 2ZC4B 3FYZA 1S1ZA 2QZ6A 5HZHA 4RYEA 2Y2GA 1BUEA 4QPRA 5EVID 4KENB 1NJ4A 3S7NA 3LFVA 3VE3A 2A49A 4R4RA 4LRXC 3UMDA 1M40A 3I7JA 2BASA 1ES3A 1SCWA 3O86A 4O0PA 4Q8IA 4OKPA 1D7EA 3LIBA 2HP5A 5I5LA 3BECA 3UMEA 3SZTA 5EE8A 4O8GA 1W79A 4Y0UA 4UA6A 4GOGA 1X0OA 1EI5A 2O99A 3D72A 2V8FA 5M1AA 1BLCA 4H6JA 2J8YA 5F69A 5D3OA 4E3NA 3E4QA 1W63Q 3E2LA 4GB7A 3KSGA 4MBHA 2H5SA 3UPPA 3WS1A 3F1PB 3A0VA 2WGWA 1IYSA 3QP1A 2Z6DA 5BOHA 3RTYA 4DMZA 3QP6A 4JXSA 4WEKA 3W4OA 3LI8A 2RL3A 2G2WA 2ZL1A 4ZJ2A 2Y55A 1FILA 1DY6A 1G28A 2A3UA 2KLIA 3IX8A 3K3CA 4H8RA 1LHYA 2ZQAA 1XJ3A 3Q1FA 4KZ3A 3IF6A 3C2WA 4B4ZA 1DJBA 1DJAA 2V20A 1Q2QA 1CEFA 1XFNA 2J3WA 3IS2A 3ZG7B 2JKTM 4JGOA 3KSIA 4JF4A 1CQAA 1BZAA 3KYQA 3T4LA 4KZ5A 4QHCA 1S67L 3IHAA 3DBAA 1S6RA 2K2NA 4RA7A 5HL6A 3VP4A 2O9BA 4MN7A 5L2FA 2OAQ1 4JF5A 2P9VA 4I38A 1GHIA 3E2KA 2OAP1 5EV0A 4HBTA 1H0MA 2OV5A 4LV2A 3HL9A 3LYXA 4H6JB 4ZBEA 4PKYG 3LR4A 2ZQCA 2XK1A 2XQZA 2ZM2A 2XSSA 1GSVA 5E2HA 1GSXA 1BYWA 4E3JA 1WYBA 1IYPA 2VK3A 5AVFA 3HLGA 4WM9A 4GDNA 1IOUA 1S0WA 2WGWB 2XFTA 3ZVTA 2LB9A 3ZHHA 4LCLA 1YLYA 4NG2A 3RFBA 4BLMA 1Z09A 2Z2LB 1TVFA 4NEED 1E3UD 4OOMA 4WUJA 4L9FA 2J3TD 2UV0E 2V8CA 1LSWA 5J4EA 2HV1A 3G2YA 1CK3A 4YNRA 3RXXA 1CEGA 3NOPC 3UN7A 3VV4A 2H28A 4GD8A 3M2KA 3IF6B 2P04A 4BBVA 3VP0A 2W3EA 4JGPA 1DP8A 4EXOA 3PAEA 3HREA 4IBRA 1E4DA 1KVMA 1O07A 5C5KA 3N8LA 3OC2A 3IS2B 3VSLA 4OPYA 1YT4A 3OPPA 3PR6A 4FD8A 5DTSA 2EX2A 3WS4A 3HLFA 4M3KA 4GLQA 3EEAA 3UB9A 4N92A 2Y59A 5G18A 2VV6A 1H8ZA 4EWFA 3TW8A 1N9NA 4DE0A 2W0NA 4N1HA 5G4ZA 2EFXA 2KOIA 1K38A 4AFIA 3MZEA 4PKYA 1TS0A 2UWXA 1IKIA 3ZNYA 3V3RA 4KG6A 1XA7A 3MKFA 2Y2QA 3B47A 2EFUA 4C75A 2DNSA 5FQ9A 4NKPA 1T1CA 3UNWA 2ZD8A 4IHQA 2V0UA 1Y54A 5AVEA 5TGFA 1PZOA 4E3IA 4KUKA 4BJPA 2V1ZA 4CLCA 3GV9A 5EVEA 3V5MA 1WA9A 1U60A 3F1NA 2VA0A 4XUXA 1VM1A 3VOLA 1G68A 2XF3A 1MY8A 4ZJ3A 1W5DA 4NXFA 4RX3A 1KGEA 1TD5A 3L7HA 1HZOA 3IX4A 4Y0TA 4GNUA 1VETA 3O5YA 5CEDA 2PRFA 1P97A 3A0RA 3MBZA 3WS0A 1RGZA 4EETB 5DJTA 3SH8A 2FZ0A 1GHMA 2B95A 5TJJA 2DRWA 4R1GA 1J3WA 4HIAA 2XR0A 4JXVA 4MBKA 2Y8HA 3EQVA 3HUMA 2J9PA 4LENA 4OONA 4P0MA 2A24A 2FFYA 2PR5A 4GJ4A 4KG2A 3HBRA 5DJUA 2VZWA 1BLSA 4IEDA 2VGJA 5A92A 2IWBA 2X02A 4OPRA 3GMWA 1N9OA 2W3HA 2OWJA 5CRFA 4OH0A 5CGXA 1XKZA 4YFMA 1YQSA 3ZCZA 4D60A 3M6HA 1PZPA 4EUZA 1PRQA 3A0SA 5LBRA 4YOFA 4KQOA 3PXPA 4PM5A 4JBFA 3FV7A 4HP9A 2VKSA 1PYYA 3UY6A 4GS9A 4HHDA 2IA2A 2ACGA 3SH7A 1XA1A 2HJEA 4CLCB 3VP1A 1VEUA 5AQ9A 5GHXA 5TFQA 4BL2A 2W1RA 2I9VA 2WAEA 4MMNA 3T1RA 3F1NB 3B33A 3NY4A 5U47A 5FI6A 1PI4A 1EW0A 4UQIM 4LV3A 1YSQA 1W63M 5JYPA 4OQGA 4D2OA 1ALQA 4G3WA 4KG5A 3FPVA 4BBTA 3TG9A 2P08A 1XPBA 1NY0A 4HJ4A 4OLGA 1VETB 1XGJA 5M18A 4EERA 5TBMA 3UPOA 3HCYA 4PM9A 4LRZE 2ZM0A 4GZBA 4QJGA 3G30A 3IH8A 5KIZA 2W3DA 3LIAA 1PNEA 4UA9A 1CI8A 4B9OA 2P7JA 4L0LA 4ARZA 1MWUA 1F2KA 5FAQA 5F6AA 3TRCA 3MXQA 2HGVA 5F1GA 3N8RA 2JBFA 2PU2A 1ZKJA 3LY4A 5DKKA 2A24B 3GTCA 4S2KA 2Y2MA 4BWIA 4EQIA 1FR6A 1YKDA 2WKHA 5EUAA 4UQIS 4CLCC 4GHIB 3JPUA 2YKFA 1OTAA 1MWTA 5HDDA 4LPZA 3NCKA 3P98A 3OOVA 1E3UA 3DTKA 2WAFA 3LIDA 3FC7A 2WGIA 4WL9A 5DFXA 2AVXA 3R4KA 3C8CA 1FSYA 5HX9A 5FQMA 3VOZA 4GKUA 4K08A 3BQ8A 4FH4A 1JWZA 4MN6A 4DJ3A 4HOIA 4GS9B 2L1MA 3IXGA 3SOIA 1KE3A 3VP3A 1TS6A 5FQQA 2QYBA 1OTBA 3IBJA 1OTDA 1BT5A 2VGLM 3NJAA 3ZG8B 4E6XA 1LL9A 4K91A 5DKLA 1H5XA 4JF6A 5HAQA 3MQQA 2QJ5A 3EGXC 3CG5A 1RCJA 5EOEA 3H82A 3SW1A 3BLMA 4OPQA 3ZVWA 4R3BA 2OWHA 1IFQA 1KDWA 3ZFZA 2WGVA 3BEBA 2R9XA 2FH5A 5DF7A 2H0YA 5FQJA 5KZHA 1LSXA 1NRFA 4ARZB 4L9GA 4WZ5A 2W3FA 1SKFA 4M4XA 3QP2A 3LGOA 2ZMAA 4HNBA 3G31A 2VJWA 3C4PA 1IYQA 3UO9A 3DAVA 2L0WA 3HJKA 4NXGA 4UAAA 2VGLS 3TJZC 3LY3A 3Q07A 2EXBA 2JKRI 3Q7ZA 2ZC7A 3A3DA 1PW1A 5K5BA 2G7UA 4RVAA 3ZG5A 1YLPA 4JLFA 4B93A 1G6AA 2Y79A 3FWLA 4II7A 4F3LB 1KOUA 1VB6A 4GW9A 5EM1A 4WYYA 3N4IA 1K56A 4EV4A 3LICA 4Z1WA 1KE0A 3BFDA 2ZOIA 1OJGA 2PU4A 4UA7A 1MPLA 4F94A 5DF9A 1SDNA 3OPLA 5GLCA 4OQ0A 3KX0X 3O88A 4DN0A 4DE2A 3PBQA 2ZOHA 3KYZA 5I94A 2VX8A 3UE0A 2JCHA 2G2UA 1FCOA 1IYOA 3UE1A 3M6BA 4EW7A 2WUQA 5KSCA 1CF0A 3H82B 5EM0A 3NBLA 3UB6A 2BTFP 5E43A 3EEHA 4ZRRA 4ZDXA 1NLZA 3IWIA 4I39A 2XD1A 4EEPA 4GN2A 4R3AA 2Y2KA 3B42A 2XDMA 4GCZA 5AQ7A 5MC7A 2J3TC 2OLVA 5GL9A 1CI9A 5CTNA 3LR3A 2INWA 1GA0A 2PYRA 2XH9A 3CHWP 4LRYC 5CGSA 3BYDA 4S2JA 1XXMA 4Y2FA 2ZQDA 5F82A 1FOFA 2NUPC 3VOYA 3CPTA 2H10A 4Y0OA 2M7VA 3H7WA 3MMHA 3MS6A 3UB7A 4HY8A 4WMCA 3LCEA 3LR5A 2B18A 3C7UA 3H9WA 2ZMVA 5J3WA 4B4XA 3G4PA 2YKHA 3HUNA 3M2JA 5FDSA 1ERQA 1O7EA 4S2OA 3QHYA 1P9RA 4FCFA 3OLOA 4WEJA 2IWDA 2GX5A 3QNBA 1VQQA 5EVLA 3V67A 1KE4A 3BFEA 5CHMA 1V9YA 5GLDA 4KZAA 2OLUA 3T4SA 3OBFA 4P85A 4WZ5C 4E6WA 2ZL1B 3D4FA 4QY6A 1HD8A 3HVFA 3E98A 5FL3A 3IQAA 1AWIA 4BENA 2RCXA 4FH2A 1ODVA 2PBDP 5FATA 2QMIA 2C6WB 3B3XA 3CMZA 4RX2A 1QMFA 4Y15A 1S1YA 3P7NA 2EWWA 4XXRA 3SS4A 2HPBA 4S2IA 1WE4A 1I5QA 5HWWA 1LI0A 1SHVA 3HLWA 2WKQA 1BLPA 3ZQ5A 3WS5A 4X1LA 1JVJA 4FOFA 1G5UA 5HARA 2Y4AA 1ZHHB 3WRTA 2ZM8A 5HAIA 3ISGA 3VMAA 3BY9A 4PHTA 1Q2PA 3T4OA 4DKIA 3RJUA 4DXBA 3MXRA 4WELA 2JHEA 2P9VB 1ESIA 3V50A 3H7WB 1K57C 5HWVA 5HSQA 1XJ4A 2VLGA 3CUEC 1K6RA 2QKPA 4ID4A 5CGWA 3EGDC 3AGDA 4CLCE 5HL1A 2Y2IA 1PWCA 3IHBA 1SZVA 3IXDA 3FPWA 3VE4A 3S22A 1EWZA 2HDRA 4N9LA 4MN5A 4BBUA 5EVIA 3BLSA 1NYMA 5FQIA 1S66L 5IT5A 3CITA 1PI5A 2EWVA 1W8YA 4LFUA 5E2GA 1TS7A 2JE5A 3NULA 1IKGA 1Y4OA 1DJCA 2JKRM 2XROA 2EA9A 2PT7A 5L8MA 3Q82A 2JN7A 4KQRA 1E25A 1JWVA 5FASA 2V0WA 2VGKA 1Y28A 4GD6A 4LLOB 3P09A 5AQBA 4EU0A 2Y2OA 3G6OA 4XUZA 3PTEA 5HWTA 3P01A 2Z6CA 3NOTC 1BLHA 2HJ9C 1LSVA 1T1BA 4OQIA 5DF8A 4FUWA 4O7DA 1YLJA 3TE8A 3BFCA 3PBRA 5GLBA 3NECA 3E4PA 4LV0A 5FQKA 3UE3A 1PWGA 1PFLA 5FEFA 1K4EA 5F1FA 1I2WA 3G35A 5CERA 2K7SA 4DRTA 3MFXA 3GR2A 3S1YA 4NK3A 1C3BA 3KSFA 5E2EA 3IBRA 3Q81A 2A2LA 3GECA 2PAVP 5A8BA 2XA7M 3N7WA 5A90A 5EVIB 3HLDA 2XGNA 4PM7A 3CAXA 3T4JA 1GCEA 4ETXA 4U0XA 1FQGA 1T18A 4K0XA 1GHPA 4OOYA 1MWSA 1L2SA 5EFWA 4MEZA 3OPHA 4R0QA 4R3JA 3LEZA 4U3TA 3FG8A 3UDIA 3G2ZA 2CMNA 2ZLYA 4QB8A 5FEGA 5M19A 3SS5A 3UB8A 2Q0OA 3NIAA 4X56A 4Y13A 3K3DA 4Q0IA 3BY8A 4C3QA 4HH2A 3IH9A 2GJ3A 4DF6A 4LGWA 1YLTA 1FCNA 2PYPA 1ZG6A 1TF1A 2ZQ7A 5FSRA 1ESUA 1ONHA 3FZCA 2XA7S 4E04A 2ZMFA 1J9MA 1P0ZA 5CHJA 4R4SA 1H3QA 3JYIA 2Y2JA 1NXYA 2PD8A 5EVIC 1YMSA 4IVIA 1FCMA 2QHKA 1F98A 2W3GA 3HLBA 4OVDA 3PBNA 2LB5A 3A3IA 4X68A 1FR1A 3Q7VA 4CJNA 1W7FA 5F83A 4DXCA 1XGIA 3DW0A 3N6IA 2M1CA 3T50A 3RXWA 3NOUC 4NETA 1MZUA 4OLDA 3IT9A 1LL8A 3PBTA 1F9IA 5HD5A 4ZAMA 4EBNA 3L9KA 1VEUB 4XT2A 5FAPA 3CZDA 5CXWA 1D1JA 2KX6A 3S7OA 4CQHA 3S4XA 4KQQA 4YWZA 1K55C 4R38A 3OZHA 1L0EA 4Y3IA 1T1AA 4S2NA 4JKTA 2JKFA 4EBPA 2P74A 4E3KA 1H8MA 2B5RA 3QNCA 5TBMB 1OT6A 4I5SA 2Q9NA 5L10A 3CWFA 4Q0JA 2E8JA 4PM6A 2CC1A 4Q0HA 1GA9A 1I2SA 5L07A 4CLCD 3A3JA 1DP9A 3IXBA 3QP4A 4MNRA 1WYCA 3ICYA 1Z6FA 4OOLA 1UWPX 1MKMA 2ZC3B 3MSHA 3G32A 1GSWA 4KZ6A 1OPXA 5DTKA 4KZ8A 3LI9A 5J7EA 2PBYA 1OTIA 5HAPA 1QMEA 5CHUA 3E4OA 1L3LA 3Q7VB 1TEMA 3T1QB 1MWRA 5DFYA 2V1BA 4KZBA 4HI4A 3MZFA 4NXEA 3E0YA 1PW8A 4K0WA 1NWZA 2Y2LA 4E3LA 5AQAA 4BL3A 2I72A 3OCLA 4KQDA 3ULFA 2FFFB 2HDUA 4XT2B 3WS2A 3ZG0A 3N8SA 1K57A 3MF0A 3CUEA 2O9CA 4BD0A 2PR6A 4FSFA 2KDKA 3UPNA 5DVAA 4E3OA 1LLBA 1YPRA 2GNXA 4QWOA 2HP6A 3FKVA 3VFFA 1LL5A 4Y5FA 3ZDJA 1K4FA 5FDHA 2OSUA 3DWKA 4MLLA 1S4SA 3LIFA 4Y7PA 3IXHA 4OP8A 4EESA 4ZJ1A 3WWXA 1T19A 3BWLA 4KZ7A 1L0FA 2DCFA 1XJ2A 1P9WA 1DRMA 4Z9QA 4HBUA 3CI6A 1KGGA 2QJ7A 1TS8A 3D3OA 3HJIA 4DDSA 2ZQ9A 4QD4A 3U4LP 4DE1A 2ZJ9A 3VFHA 4IBXA 5EECA 5J8XA 3V3SA 1IELA 3MFDA 4R23A 4S2LA 3HLCA 1OTEA 4G3VA 4JXGA 3QP8A 3UB5P 5IS1A 4N9KA 4G3KA 1L0DA 4BQMA 3KYEA 1N4OA 3KSHA 3AGEA 1ZC2A 3NDEA 2M7UA 4QU3A 3LIEA 3W4PA 4S2NC 3IWQA 2X71A 1HVBA 5FI7A 1HLUP 3MR0A 3T4KA 1ERMA 2Y2PA 4HH3A 3EQUA 4P6BA 2HDQA 2B02A 5HPFA 2QPNA 2HP9A 2VV7A 3ZYTA 1RGYA 3C30A 5GHYA 4HP4A 4FTXA 3DTMA 4HJ3A 4DDYA 4B88A 3PBSA 1NLYA 3GVBA 5CTMA 3ITAA 2Y2HA 1YAXA 2ZC6B 3O87A 4WBGA 2WADA 5F68A 5TR7A 3HLEA 2ZQ8A 3EWKA 3O3VA 1K0KA 3BQAA 4KZ9A 1K54A 2VV8A 1KVLA 4I3IA 2WKEA 5G4YA 4C6YA 1M6KA 5AJGA 1ES4A 4KUOA 4YINA 2BG1A 3SS3A 4JXWA 4X69A 4Y17A 1NZUA 3GQZA 3LUQA 1YLWA 4UHUA 3TOIA 1ZG4A 3IX3A 1YLZA 3CPTB 4QY5A 4ME4A 3UDFA 4E3MA 3QP5A 4PPRA 3T4QA 5HW3A 1RP5A 1ES2A 3C4OA 4A5RA 2Q9MA 2O9AA 3EOIA 4S2PA 2ZBBA 1N9LA 4N1XA 2WK0A 3U2AA 4CPKA 2V9AA 3PYPA 4DE3A 1W8QA 3LEQA 5FA7A 3ZGAB 3DWZA 3HUOA 4IUHA 5A91A 3WRZA 2EX9A 3GDIA 1ACFA 4MDZA 4EUVA 4JGRA 2DMWA 1OT9A 4R70A 5HDSA 4JGQA 2W1TA 2GDNA 2MJ6A 5KMWA 2NUTC 1EROA 3IF6C 1PIOA 5FAOA 2XLNA 3DTIA 4ESPA 4DJ2A 3D9YA 1LI9A 5HFOA 3CLOA 4I3JA 4HEFA 1OJ5A 2Z2MB 2XEPA 1YM1A 3GRJA 4HESA 5EOOA 4U0TA 3S7QA 5A93A 5IU1A 1NZOA 1JTGA 5E2FA 2XRNA 4OPZA 2BLSA 1L0GA 5GHZA 1UWNX 3W8KA
chains in the Genus database with same CATH topology
1XJ6A 1P0ZA 1KOUA 1H3QA 1VB6A 4GW9A 3RFBA 2PDRA 2J80A 3S7PA 2PD8A 4NEED 3LICA 4Z1WA 2ZOIA 4OOMA 2QHKA 1OJGA 4WUJA 1F98A 4HJ6A 4L9FA 2W3GA 4O01A 2J3TD 5CX7A 1LSWA 3PBNA 2LB5A 3NHQA 5DF9A 5J4EA 3R7WA 2HV1A 4YNRA 4P6ZM 3NOPC 3KX0X 4NXBA 3VV4A 2H28A 3F1OA 4WF0A 4DN0A 4EQ1A 3PBQA 2P04A 2R78A 3C38A 4L9EA 4BBVA 2M1CA 2ZOHA 2W3EA 3T50A 3NOUC 4JGPA 1MZUA 1DP8A 1LL8A 3PBTA 3KYZA 4EXOA 1F9IA 2VX8A 5HD5A 3JVVA 2PHYA 2D01A 3OC2A 5C5KA 3IS2B 4XT2A 4EW7A 4GHIA 4HQAA 2K31A 3H82B 2W27A 3UB6A 2KX6A 3PR6A 3S7OA 4CQHA 3MQOA 4YWZA 3EEHA 4R38A 4ZRRA 5F5YA 1NLZA 4GLQA 3EEAA 3UB9A 4I39A 2VV6A 4Y3IA 4EEPA 1T1AA 4R3AA 3B42A 3TW8A 1N9NA 1H8MA 4GCZA 2W0NA 5G4ZA 2J3TC 5MC7A 5TBMB 4ETZA 1OT6A 2KOIA 2O0YA 4I5SA 4AFIA 2JKTI 2W1TB 3CWFA 3LR3A 2INWA 4Q0JA 4PKYA 3W2ZA 1TS0A 2PYRA 4RQ9A 4LRYC 3B47A 4Q0HA 4P6ZS 4MCWA 1S4RA 4Y2FA 2NUPC 2L4RA 1F5MA 4NKPA 3OCNA 1T1CA 4IHQA 2V0UA 3BJNA 5AVEA 2M7VA 4CLCD 1DP9A 4KUKA 4BJPA 3H7WA 3MMHA 1D06A 3UB7A 4CLCA 4HY8A 3RH8B 3BW6A 1WA9A 3LR5A 2B18A 3F1NA 3ICYA 3K2NA 4OOLA 1UWPX 2VA0A 1MKMA 3H9WA 2ZMVA 5J3WA 3VOLA 2YKHA 1GSWA 1OPXA 1G6OA 3LI9A 3MJQA 5J7EA 1P9RA 1OTIA 3OLOA 2VEAA 4NXFA 2GZAA 4WEJA 3KO6A 1MC0A 2GX5A 3E4OA 1STZA 1ZTUA 1TD5A 3V67A 3R7WB 5DFYA 2V1BA 5HPIA 1V9YA 3O5YA 3F1OB 4HI4A 4NXEA 3T4SA 3E0YA 4BMWA 3OBFA 1P97A 3A0RA 1NWZA 4EETB 3UE6A 3PBOA 5DJTA 3E98A 4PAUA 1JNUA 3OCLA 2FZ0A 5TJJA 5FL3A 4KQDA 3ULFA 5HDCA 4XT2B 4HIAA 4EEUA 1ODVA 4R6LA 2Y8HA 3EQVA 4UEYA 3MF0A 2QWSA 3CUEA 2O9CA 4WLAA 2PR6A 4FSFA 2KDKA 3JVUA 1LT0A 1S1YA 3P7NA 3T4TA 2A24A 2EWWA 2PR5A 4GJ4A 5DJUA 1V9ZA 4WN5A 4F3LA 5HD3A 2GNXA 2VZWA 4IUKA 5HWWA 4I3AA 4Y5FA 1N9OA 2W3HA 2WKQA 2OWJA 1NRJA 3ZQ5A 1S4SA 3F1PA 3LIFA 4FOFA 2V1AA 2HF6A 1ZHHB 2WKPA 4EESA 1UGUA 3BY9A 4PHTA 1XFQA 1T19A 3BWLA 3T4OA 3A0SA 2WKRA 5LBRA 3PHYA 4YOFA 5KSHA 2OOLA 4KQOA 4WELA 1XJ2A 3PXPA 2JHEA 1P9WA 1DRMA 3MQ0A 2PD7A 3CI6A 1YSPA 2QJ7A 4HP9A 1TS8A 2D02A 2VKSA 3D3OA 3HJIA 4GS9A 3H7WB 4HHDA 5HWVA 5HSQA 1XJ4A 2IA2A 2HJEA 2VLGA 4CLCB 3CUEC 2W1RA 2I9VA 4MMNA 2QKPA 4IJGA 1VHMA 3F1NB 3B33A 3LR0A 1DP6A 3EGDC 1OTEA 4G3VA 1EW0A 4UQIM 1S1ZA 4CLCE 5IS1A 5HZHA 1YSQA 4G3KA 1W63M 4QPRA 3KSHA 4G3WA 3FPWA 3VE4A 3FPVA 4BBTA 3S7NA 4MN5A 4BBUA 2P08A 1S66L 3LFVA 3VE3A 3CITA 2M7UA 2EWVA 5IT5A 3LIEA 4HJ4A 4LRXC 4EERA 5TBMA 3UMDA 3HCYA 1TS7A 4LRZE 5KIZA 2BASA 2W3DA 3LIAA 4O0PA 2JKRM 2XROA 1D7EA 3LIBA 3MR0A 4B9OA 2P7JA 5I5LA 3T4KA 2EA9A 4L0LA 3UMEA 4ARZA 2PT7A 5L8MA 2JN7A 4O8GA 4HH3A 3EQUA 2V0WA 5F6AA 3TRCA 2B02A 3MXQA 5HPFA 2VV7A 3ZYTA 3C30A 2HGVA 1X0OA 1Y28A 4LLOB 2O99A 3D72A 5DKKA 2A24B 4EU0A 4HP4A 4H6JA 3G6OA 5F69A 4HJ3A 4BWIA 5HWTA 3P01A 2Z6CA 1YKDA 4UQIS 3NOTC 3E4QA 3PBSA 4GHIB 4CLCC 1NLYA 1W63Q 2YKFA 1OTAA 2HJ9C 5HDDA 3KSGA 1LSVA 4LPZA 1T1BA 1YAXA 3OOVA 5F68A 3F1PB 3LIDA 3A0VA 3FC7A 4WL9A 5DFXA 3R4KA 3TE8A 2Z6DA 3C8CA 3EWKA 3BQAA 2VV8A 1UWNX 3PBRA 3RTYA 4DMZA 4I3IA 3E4PA 4WEKA 5G4YA 3UE3A 4K08A 3LI8A 5AJGA 3BQ8A 4KUOA 4MN6A 4DJ3A 4HOIA 4GS9B 2K7SA 2L1MA 3LUQA 1G28A 1TS6A 3MFXA 2QYBA 1OTBA 3IBJA 2KLIA 1OTDA 3K3CA 1XJ3A 2VGLM 4F3LB 3NJAA 3C2WA 4ME4A 3T4QA 3KSFA 3IBRA 5DKLA 2A2LA 3GECA 1XFNA 3MQQA 5A8BA 2QJ5A 2J3WA 2O9AA 2XA7M 3EOIA 3EGXC 3IS2A 2JKTM 2ZBBA 4JGOA 1N9LA 3CAXA 3H82A 4ETXA 3KSIA 3SW1A 3KYQA 1T18A 2OWHA 1IFQA 3T4LA 3U2AA 2V9AA 5EFWA 3PYPA 2FH5A 3FG8A 1S67L 4IUHA 1LSXA 3DBAA 2CMNA 4ARZB 2K2NA 4L9GA 3GDIA 5HL6A 4MDZA 2W3FA 4EUVA 2O9BA 4MN7A 4JGRA 3UB8A 4M4XA 2OAQ1 2DMWA 1OT9A 4I38A 4R70A 5HDSA 4JGQA 4HNBA 2W1TA 2OAP1 2MJ6A 2NUTC 2VJWA 3K3DA 4DJ2A 3LYXA 4H6JB 4Q0IA 3BY8A 4PKYG 4HH2A 2L0WA 3HJKA 3LR4A 3CLOA 4NXGA 2GJ3A 4I3JA 1OJ5A 2VGLS 3TJZC 2JKRI 2XSSA 1GSVA 5K5BA 2G7UA 1GSXA 1BYWA 2PYPA 1TF1A 3S7QA 4B93A 2Y79A 5AVFA 5IU1A 2XA7S 1IOUA 4II7A 2XRNA 3T4JA 4E04A 2ZMFA 2LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  1P0Z A;  1KOU A;  1VB6 A;  4GW9 A;  2PDR A;  2J80 A;  2PD8 A;  3LIC A;  2ZOI A;  2QHK A;  1OJG A;  4WUJ A;  1F98 A;  4HJ6 A;  4L9F A;  1LSW A;  3NHQ A;  5J4E A;  2HV1 A;  3NOP C;  3KX0 X;  4NXB A;  2H28 A;  3F1O A;  4WF0 A;  4EQ1 A;  2R78 A;  4L9E A;  4BBV A;  2M1C A;  2ZOH A;  3T50 A;  3NOU C;  4JGP A;  1MZU A;  1DP8 A;  1LL8 A;  4EXO A;  1F9I A;  5HD5 A;  2PHY A;  2D01 A;  3IS2 B;  4XT2 A;  4EW7 A;  4GHI A;  4HQA A;  3H82 B;  2W27 A;  3UB6 A;  2KX6 A;  3MQO A;  4YWZ A;  3EEH A;  4R38 A;  5F5Y A;  3UB9 A;  4I39 A;  2VV6 A;  4EEP A;  1T1A A;  4R3A A;  1N9N A;  4GCZ A;  2W0N A;  5G4Z A;  5TBM B;  1OT6 A;  4I5S A;  3CWF A;  2INW A;  4PKY A;  1TS0 A;  2PYR A;  4RQ9 A;  4LRY C;  1S4R A;  2L4R A;  1T1C A;  2V0U A;  5AVE A;  1DP9 A;  4KUK A;  3H7W A;  1D06 A;  3UB7 A;  4HY8 A;  3RH8 B;  1WA9 A;  3F1N A;  3ICY A;  1UWP X;  3H9W A;  5J3W A;  3VOL A;  2YKH A;  1GSW A;  3LI9 A;  3MJQ A;  5J7E A;  1OTI A;  3OLO A;  2VEA A;  4NXF A;  3E4O A;  2V1B A;  1V9Y A;  3F1O B;  4HI4 A;  4NXE A;  1P97 A;  3A0R A;  1NWZ A;  4EET B;  3UE6 A;  5DJT A;  1JNU A;  4KQD A;  3ULF A;  5HDC A;  4XT2 B;  4HIA A;  4EEU A;  1ODV A;  4R6L A;  2QWS A;  4WLA A;  2PR6 A;  2KDK A;  1LT0 A;  1S1Y A;  3P7N A;  2A24 A;  2PR5 A;  5DJU A;  1V9Z A;  4WN5 A;  4F3L A;  5HD3 A;  5HWW A;  4I3A A;  1N9O A;  2WKQ A;  2OWJ A;  3ZQ5 A;  1S4S A;  3F1P A;  3LIF A;  2V1A A;  2WKP A;  4EES A;  1UGU A;  3BY9 A;  1XFQ A;  1T19 A;  3BWL A;  3A0S A;  2WKR A;  3PHY A;  2OOL A;  1XJ2 A;  2JHE A;  1DRM A;  2PD7 A;  2QJ7 A;  4HP9 A;  1TS8 A;  2D02 A;  3HJI A;  4GS9 A;  3H7W B;  4HHD A;  5HWV A;  5HSQ A;  1XJ4 A;  2VLG A;  2I9V A;  2QKP A;  3F1N B;  3B33 A;  1DP6 A;  1OTE A;  1EW0 A;  1S1Z A;  5IS1 A;  5HZH A;  3VE4 A;  4BBT A;  4MN5 A;  4BBU A;  1S66 L;  3VE3 A;  3LIE A;  4HJ4 A;  4LRX C;  4EER A;  5TBM A;  3UMD A;  1TS7 A;  4LRZ E;  5KIZ A;  2BAS A;  3LIA A;  1D7E A;  3LIB A;  3MR0 A;  4B9O A;  2P7J A;  5I5L A;  2EA9 A;  3UME A;  2JN7 A;  4HH3 A;  2V0W A;  5F6A A;  2B02 A;  3MXQ A;  2VV7 A;  1X0O A;  1Y28 A;  4LLO B;  3D72 A;  5DKK A;  2A24 B;  4HP4 A;  4H6J A;  3G6O A;  5F69 A;  4HJ3 A;  5HWT A;  2Z6C A;  3NOT C;  3E4Q A;  4GHI B;  2YKF A;  1OTA A;  5HDD A;  1LSV A;  4LPZ A;  1T1B A;  5F68 A;  3F1P B;  3LID A;  3A0V A;  3FC7 A;  4WL9 A;  2Z6D A;  3C8C A;  3EWK A;  2VV8 A;  3RTY A;  4I3I A;  3E4P A;  5G4Y A;  4K08 A;  3LI8 A;  4KUO A;  4MN6 A;  4DJ3 A;  4HOI A;  4GS9 B;  2K7S A;  2L1M A;  3LUQ A;  1G28 A;  1TS6 A;  3MFX A;  1OTB A;  1OTD A;  3K3C A;  1XJ3 A;  4F3L B;  3NJA A;  3C2W A;  3IBR A;  5DKL A;  3GEC A;  1XFN A;  3MQQ A;  5A8B A;  2QJ5 A;  3IS2 A;  2ZBB A;  4JGO A;  1N9L A;  3CAX A;  3H82 A;  3SW1 A;  1T18 A;  2OWH A;  2V9A A;  5EFW A;  3PYP A;  3FG8 A;  1S67 L;  1LSX A;  2CMN A;  4L9G A;  3GDI A;  4JGR A;  3UB8 A;  4M4X A;  1OT9 A;  4I38 A;  4R70 A;  5HDS A;  4JGQ A;  4HNB A;  3K3D A;  4DJ2 A;  3LYX A;  4H6J B;  3BY8 A;  4PKY G;  4HH2 A;  2L0W A;  3HJK A;  3CLO A;  4NXG A;  2GJ3 A;  4I3J A;  1OJ5 A;  1GSV A;  1GSX A;  1BYW A;  2PYP A;  5AVF A;  5IU1 A;  4E04 A;  1UWN X; 
#chains in the Genus database with same CATH topology
 4PMA A;  1K56 D;  1XJ6 A;  1SKO A;  2PDR A;  2J80 A;  3S7P A;  1OME A;  1K55 A;  3FKW A;  2X01 A;  2WKI A;  4HJ6 A;  4O01 A;  5CX7 A;  1HTZ A;  3UDX A;  3BFF A;  1TDL A;  3NHQ A;  1IEM A;  3R7W A;  1FSW A;  1BUL A;  4EBL A;  4P6Z M;  4NXB A;  3F1O A;  4WF0 A;  4EQ1 A;  2R78 A;  3C38 A;  4L9E A;  3ITB A;  3GSG A;  2XFS A;  3JVV A;  5FI2 A;  4ZTK A;  2PHY A;  1FIK A;  4PM8 A;  2D01 A;  3MZD A;  3PAG A;  4GHI A;  4HQA A;  4X55 A;  2K31 A;  1N9B A;  3NI9 A;  2W27 A;  4P87 A;  3IF5 A;  3SH9 A;  3T1S A;  3MQO A;  1MBL A;  5IHV A;  3W4Q A;  5F5Y A;  2H0T A;  2IWC A;  4BD1 A;  4X1M A;  3OPR A;  4ETZ A;  4X25 A;  2O0Y A;  1K54 C;  3NDG A;  1PWD A;  2WYX A;  2JKT I;  1K25 A;  2W1T B;  3W2Z A;  4OP5 A;  4RQ9 A;  4OQH A;  1ONG A;  3T1X A;  2XD5 A;  4P6Z S;  4GDB A;  4MCW A;  1S4R A;  2V2F F;  1MKI A;  5EPH A;  3A3F A;  1KDS A;  2L4R A;  1F5M A;  2EXA A;  3OCN A;  5L09 A;  5GLA A;  4WZ4 A;  4JPM A;  1K6S A;  3BJN A;  4WMC D;  5DTT A;  1D06 A;  3RH8 B;  5CEB A;  3BW6 A;  1CJF A;  2WZZ A;  3K2N A;  3ZG9 B;  1SKO B;  2HDS A;  3BM6 A;  1G6O A;  3MJQ A;  2VEA A;  2GZA A;  3NC8 A;  3KO6 A;  1MC0 A;  3BRM A;  1STZ A;  1ZTU A;  2C5W B;  3R7W B;  3A3E A;  1BSG A;  5HPI A;  4LCM A;  3F1O B;  4BMW A;  2EX6 A;  1NYY A;  1XP4 A;  3UE6 A;  3PBO A;  4MBF A;  3ZNT A;  4PAU A;  1JNU A;  1SDE A;  3VSK A;  2ZC5 B;  1XX2 A;  5CEC A;  4X6T A;  5HDC A;  1H8Y A;  2R9W A;  4EEU A;  4LV1 A;  4R6L A;  4UEY A;  1YMX A;  3V39 A;  2JC7 A;  3MKE A;  2QWS A;  4WLA A;  3T12 B;  3JVU A;  1LT0 A;  4S2M A;  2Y2N A;  3T4T A;  3G34 A;  1TDG A;  1V9Z A;  4WN5 A;  4F3L A;  5HD3 A;  4IUK A;  1AXB A;  4I3A A;  4KZ4 A;  2J9O A;  3VP2 A;  1KGF A;  2E8I A;  1ES5 A;  2J7V A;  1NRJ A;  3CJM A;  3IWO A;  4X53 A;  3F1P A;  2V1A A;  2HF6 A;  1A0K A;  2WKP A;  4IVK A;  1UGU A;  5JYO A;  1XFQ A;  1JWP A;  2WKR A;  3PHY A;  5KSH A;  3BFG A;  2EX8 A;  2JKG A;  2OOL A;  3DTE A;  1BTL A;  3TSG A;  3MQ0 A;  2PD7 A;  1YSP A;  2D02 A;  1MXO A;  1JTD A;  2Y91 A;  2WZX A;  4IJG A;  1VHM A;  3AGF A;  3LO7 A;  3C7V A;  3C5A A;  1DP6 A;  2HZ5 A;  3LR0 A;  3MXS A;  2ZC4 B;  3FYZ A;  1S1Z A;  2QZ6 A;  5HZH A;  4RYE A;  2Y2G A;  1BUE A;  4QPR A;  5EVI D;  4KEN B;  1NJ4 A;  3S7N A;  3LFV A;  3VE3 A;  2A49 A;  4R4R A;  4LRX C;  3UMD A;  1M40 A;  3I7J A;  2BAS A;  1ES3 A;  1SCW A;  3O86 A;  4O0P A;  4Q8I A;  4OKP A;  1D7E A;  3LIB A;  2HP5 A;  5I5L A;  3BEC A;  3UME A;  3SZT A;  5EE8 A;  4O8G A;  1W79 A;  4Y0U A;  4UA6 A;  4GOG A;  1X0O A;  1EI5 A;  2O99 A;  3D72 A;  2V8F A;  5M1A A;  1BLC A;  4H6J A;  2J8Y A;  5F69 A;  5D3O A;  4E3N A;  3E4Q A;  1W63 Q;  3E2L A;  4GB7 A;  3KSG A;  4MBH A;  2H5S A;  3UPP A;  3WS1 A;  3F1P B;  3A0V A;  2WGW A;  1IYS A;  3QP1 A;  2Z6D A;  5BOH A;  3RTY A;  4DMZ A;  3QP6 A;  4JXS A;  4WEK A;  3W4O A;  3LI8 A;  2RL3 A;  2G2W A;  2ZL1 A;  4ZJ2 A;  2Y55 A;  1FIL A;  1DY6 A;  1G28 A;  2A3U A;  2KLI A;  3IX8 A;  3K3C A;  4H8R A;  1LHY A;  2ZQA A;  1XJ3 A;  3Q1F A;  4KZ3 A;  3IF6 A;  3C2W A;  4B4Z A;  1DJB A;  1DJA A;  2V20 A;  1Q2Q A;  1CEF A;  1XFN A;  2J3W A;  3IS2 A;  3ZG7 B;  2JKT M;  4JGO A;  3KSI A;  4JF4 A;  1CQA A;  1BZA A;  3KYQ A;  3T4L A;  4KZ5 A;  4QHC A;  1S67 L;  3IHA A;  3DBA A;  1S6R A;  2K2N A;  4RA7 A;  5HL6 A;  3VP4 A;  2O9B A;  4MN7 A;  5L2F A;  2OAQ 1;  4JF5 A;  2P9V A;  4I38 A;  1GHI A;  3E2K A;  2OAP 1;  5EV0 A;  4HBT A;  1H0M A;  2OV5 A;  4LV2 A;  3HL9 A;  3LYX A;  4H6J B;  4ZBE A;  4PKY G;  3LR4 A;  2ZQC A;  2XK1 A;  2XQZ A;  2ZM2 A;  2XSS A;  1GSV A;  5E2H A;  1GSX A;  1BYW A;  4E3J A;  1WYB A;  1IYP A;  2VK3 A;  5AVF A;  3HLG A;  4WM9 A;  4GDN A;  1IOU A;  1S0W A;  2WGW B;  2XFT A;  3ZVT A;  2LB9 A;  3ZHH A;  4LCL A;  1YLY A;  4NG2 A;  3RFB A;  4BLM A;  1Z09 A;  2Z2L B;  1TVF A;  4NEE D;  1E3U D;  4OOM A;  4WUJ A;  4L9F A;  2J3T D;  2UV0 E;  2V8C A;  1LSW A;  5J4E A;  2HV1 A;  3G2Y A;  1CK3 A;  4YNR A;  3RXX A;  1CEG A;  3NOP C;  3UN7 A;  3VV4 A;  2H28 A;  4GD8 A;  3M2K A;  3IF6 B;  2P04 A;  4BBV A;  3VP0 A;  2W3E A;  4JGP A;  1DP8 A;  4EXO A;  3PAE A;  3HRE A;  4IBR A;  1E4D A;  1KVM A;  1O07 A;  5C5K A;  3N8L A;  3OC2 A;  3IS2 B;  3VSL A;  4OPY A;  1YT4 A;  3OPP A;  3PR6 A;  4FD8 A;  5DTS A;  2EX2 A;  3WS4 A;  3HLF A;  4M3K A;  4GLQ A;  3EEA A;  3UB9 A;  4N92 A;  2Y59 A;  5G18 A;  2VV6 A;  1H8Z A;  4EWF A;  3TW8 A;  1N9N A;  4DE0 A;  2W0N A;  4N1H A;  5G4Z A;  2EFX A;  2KOI A;  1K38 A;  4AFI A;  3MZE A;  4PKY A;  1TS0 A;  2UWX A;  1IKI A;  3ZNY A;  3V3R A;  4KG6 A;  1XA7 A;  3MKF A;  2Y2Q A;  3B47 A;  2EFU A;  4C75 A;  2DNS A;  5FQ9 A;  4NKP A;  1T1C A;  3UNW A;  2ZD8 A;  4IHQ A;  2V0U A;  1Y54 A;  5AVE A;  5TGF A;  1PZO A;  4E3I A;  4KUK A;  4BJP A;  2V1Z A;  4CLC A;  3GV9 A;  5EVE A;  3V5M A;  1WA9 A;  1U60 A;  3F1N A;  2VA0 A;  4XUX A;  1VM1 A;  3VOL A;  1G68 A;  2XF3 A;  1MY8 A;  4ZJ3 A;  1W5D A;  4NXF A;  4RX3 A;  1KGE A;  1TD5 A;  3L7H A;  1HZO A;  3IX4 A;  4Y0T A;  4GNU A;  1VET A;  3O5Y A;  5CED A;  2PRF A;  1P97 A;  3A0R A;  3MBZ A;  3WS0 A;  1RGZ A;  4EET B;  5DJT A;  3SH8 A;  2FZ0 A;  1GHM A;  2B95 A;  5TJJ A;  2DRW A;  4R1G A;  1J3W A;  4HIA A;  2XR0 A;  4JXV A;  4MBK A;  2Y8H A;  3EQV A;  3HUM A;  2J9P A;  4LEN A;  4OON A;  4P0M A;  2A24 A;  2FFY A;  2PR5 A;  4GJ4 A;  4KG2 A;  3HBR A;  5DJU A;  2VZW A;  1BLS A;  4IED A;  2VGJ A;  5A92 A;  2IWB A;  2X02 A;  4OPR A;  3GMW A;  1N9O A;  2W3H A;  2OWJ A;  5CRF A;  4OH0 A;  5CGX A;  1XKZ A;  4YFM A;  1YQS A;  3ZCZ A;  4D60 A;  3M6H A;  1PZP A;  4EUZ A;  1PRQ A;  3A0S A;  5LBR A;  4YOF A;  4KQO A;  3PXP A;  4PM5 A;  4JBF A;  3FV7 A;  4HP9 A;  2VKS A;  1PYY A;  3UY6 A;  4GS9 A;  4HHD A;  2IA2 A;  2ACG A;  3SH7 A;  1XA1 A;  2HJE A;  4CLC B;  3VP1 A;  1VEU A;  5AQ9 A;  5GHX A;  5TFQ A;  4BL2 A;  2W1R A;  2I9V A;  2WAE A;  4MMN A;  3T1R A;  3F1N B;  3B33 A;  3NY4 A;  5U47 A;  5FI6 A;  1PI4 A;  1EW0 A;  4UQI M;  4LV3 A;  1YSQ A;  1W63 M;  5JYP A;  4OQG A;  4D2O A;  1ALQ A;  4G3W A;  4KG5 A;  3FPV A;  4BBT A;  3TG9 A;  2P08 A;  1XPB A;  1NY0 A;  4HJ4 A;  4OLG A;  1VET B;  1XGJ A;  5M18 A;  4EER A;  5TBM A;  3UPO A;  3HCY A;  4PM9 A;  4LRZ E;  2ZM0 A;  4GZB A;  4QJG A;  3G30 A;  3IH8 A;  5KIZ A;  2W3D A;  3LIA A;  1PNE A;  4UA9 A;  1CI8 A;  4B9O A;  2P7J A;  4L0L A;  4ARZ A;  1MWU A;  1F2K A;  5FAQ A;  5F6A A;  3TRC A;  3MXQ A;  2HGV A;  5F1G A;  3N8R A;  2JBF A;  2PU2 A;  1ZKJ A;  3LY4 A;  5DKK A;  2A24 B;  3GTC A;  4S2K A;  2Y2M A;  4BWI A;  4EQI A;  1FR6 A;  1YKD A;  2WKH A;  5EUA A;  4UQI S;  4CLC C;  4GHI B;  3JPU A;  2YKF A;  1OTA A;  1MWT A;  5HDD A;  4LPZ A;  3NCK A;  3P98 A;  3OOV A;  1E3U A;  3DTK A;  2WAF A;  3LID A;  3FC7 A;  2WGI A;  4WL9 A;  5DFX A;  2AVX A;  3R4K A;  3C8C A;  1FSY A;  5HX9 A;  5FQM A;  3VOZ A;  4GKU A;  4K08 A;  3BQ8 A;  4FH4 A;  1JWZ A;  4MN6 A;  4DJ3 A;  4HOI A;  4GS9 B;  2L1M A;  3IXG A;  3SOI A;  1KE3 A;  3VP3 A;  1TS6 A;  5FQQ A;  2QYB A;  1OTB A;  3IBJ A;  1OTD A;  1BT5 A;  2VGL M;  3NJA A;  3ZG8 B;  4E6X A;  1LL9 A;  4K91 A;  5DKL A;  1H5X A;  4JF6 A;  5HAQ A;  3MQQ A;  2QJ5 A;  3EGX C;  3CG5 A;  1RCJ A;  5EOE A;  3H82 A;  3SW1 A;  3BLM A;  4OPQ A;  3ZVW A;  4R3B A;  2OWH A;  1IFQ A;  1KDW A;  3ZFZ A;  2WGV A;  3BEB A;  2R9X A;  2FH5 A;  5DF7 A;  2H0Y A;  5FQJ A;  5KZH A;  1LSX A;  1NRF A;  4ARZ B;  4L9G A;  4WZ5 A;  2W3F A;  1SKF A;  4M4X A;  3QP2 A;  3LGO A;  2ZMA A;  4HNB A;  3G31 A;  2VJW A;  3C4P A;  1IYQ A;  3UO9 A;  3DAV A;  2L0W A;  3HJK A;  4NXG A;  4UAA A;  2VGL S;  3TJZ C;  3LY3 A;  3Q07 A;  2EXB A;  2JKR I;  3Q7Z A;  2ZC7 A;  3A3D A;  1PW1 A;  5K5B A;  2G7U A;  4RVA A;  3ZG5 A;  1YLP A;  4JLF A;  4B93 A;  1G6A A;  2Y79 A;  3FWL A;  4II7 A;  4F3L B;  1KOU A;  1VB6 A;  4GW9 A;  5EM1 A;  4WYY A;  3N4I A;  1K56 A;  4EV4 A;  3LIC A;  4Z1W A;  1KE0 A;  3BFD A;  2ZOI A;  1OJG A;  2PU4 A;  4UA7 A;  1MPL A;  4F94 A;  5DF9 A;  1SDN A;  3OPL A;  5GLC A;  4OQ0 A;  3KX0 X;  3O88 A;  4DN0 A;  4DE2 A;  3PBQ A;  2ZOH A;  3KYZ A;  5I94 A;  2VX8 A;  3UE0 A;  2JCH A;  2G2U A;  1FCO A;  1IYO A;  3UE1 A;  3M6B A;  4EW7 A;  2WUQ A;  5KSC A;  1CF0 A;  3H82 B;  5EM0 A;  3NBL A;  3UB6 A;  2BTF P;  5E43 A;  3EEH A;  4ZRR A;  4ZDX A;  1NLZ A;  3IWI A;  4I39 A;  2XD1 A;  4EEP A;  4GN2 A;  4R3A A;  2Y2K A;  3B42 A;  2XDM A;  4GCZ A;  5AQ7 A;  5MC7 A;  2J3T C;  2OLV A;  5GL9 A;  1CI9 A;  5CTN A;  3LR3 A;  2INW A;  1GA0 A;  2PYR A;  2XH9 A;  3CHW P;  4LRY C;  5CGS A;  3BYD A;  4S2J A;  1XXM A;  4Y2F A;  2ZQD A;  5F82 A;  1FOF A;  2NUP C;  3VOY A;  3CPT A;  2H10 A;  4Y0O A;  2M7V A;  3H7W A;  3MMH A;  3MS6 A;  3UB7 A;  4HY8 A;  4WMC A;  3LCE A;  3LR5 A;  2B18 A;  3C7U A;  3H9W A;  2ZMV A;  5J3W A;  4B4X A;  3G4P A;  2YKH A;  3HUN A;  3M2J A;  5FDS A;  1ERQ A;  1O7E A;  4S2O A;  3QHY A;  1P9R A;  4FCF A;  3OLO A;  4WEJ A;  2IWD A;  2GX5 A;  3QNB A;  1VQQ A;  5EVL A;  3V67 A;  1KE4 A;  3BFE A;  5CHM A;  1V9Y A;  5GLD A;  4KZA A;  2OLU A;  3T4S A;  3OBF A;  4P85 A;  4WZ5 C;  4E6W A;  2ZL1 B;  3D4F A;  4QY6 A;  1HD8 A;  3HVF A;  3E98 A;  5FL3 A;  3IQA A;  1AWI A;  4BEN A;  2RCX A;  4FH2 A;  1ODV A;  2PBD P;  5FAT A;  2QMI A;  2C6W B;  3B3X A;  3CMZ A;  4RX2 A;  1QMF A;  4Y15 A;  1S1Y A;  3P7N A;  2EWW A;  4XXR A;  3SS4 A;  2HPB A;  4S2I A;  1WE4 A;  1I5Q A;  5HWW A;  1LI0 A;  1SHV A;  3HLW A;  2WKQ A;  1BLP A;  3ZQ5 A;  3WS5 A;  4X1L A;  1JVJ A;  4FOF A;  1G5U A;  5HAR A;  2Y4A A;  1ZHH B;  3WRT A;  2ZM8 A;  5HAI A;  3ISG A;  3VMA A;  3BY9 A;  4PHT A;  1Q2P A;  3T4O A;  4DKI A;  3RJU A;  4DXB A;  3MXR A;  4WEL A;  2JHE A;  2P9V B;  1ESI A;  3V50 A;  3H7W B;  1K57 C;  5HWV A;  5HSQ A;  1XJ4 A;  2VLG A;  3CUE C;  1K6R A;  2QKP A;  4ID4 A;  5CGW A;  3EGD C;  3AGD A;  4CLC E;  5HL1 A;  2Y2I A;  1PWC A;  3IHB A;  1SZV A;  3IXD A;  3FPW A;  3VE4 A;  3S22 A;  1EWZ A;  2HDR A;  4N9L A;  4MN5 A;  4BBU A;  5EVI A;  3BLS A;  1NYM A;  5FQI A;  1S66 L;  5IT5 A;  3CIT A;  1PI5 A;  2EWV A;  1W8Y A;  4LFU A;  5E2G A;  1TS7 A;  2JE5 A;  3NUL A;  1IKG A;  1Y4O A;  1DJC A;  2JKR M;  2XRO A;  2EA9 A;  2PT7 A;  5L8M A;  3Q82 A;  2JN7 A;  4KQR A;  1E25 A;  1JWV A;  5FAS A;  2V0W A;  2VGK A;  1Y28 A;  4GD6 A;  4LLO B;  3P09 A;  5AQB A;  4EU0 A;  2Y2O A;  3G6O A;  4XUZ A;  3PTE A;  5HWT A;  3P01 A;  2Z6C A;  3NOT C;  1BLH A;  2HJ9 C;  1LSV A;  1T1B A;  4OQI A;  5DF8 A;  4FUW A;  4O7D A;  1YLJ A;  3TE8 A;  3BFC A;  3PBR A;  5GLB A;  3NEC A;  3E4P A;  4LV0 A;  5FQK A;  3UE3 A;  1PWG A;  1PFL A;  5FEF A;  1K4E A;  5F1F A;  1I2W A;  3G35 A;  5CER A;  2K7S A;  4DRT A;  3MFX A;  3GR2 A;  3S1Y A;  4NK3 A;  1C3B A;  3KSF A;  5E2E A;  3IBR A;  3Q81 A;  2A2L A;  3GEC A;  2PAV P;  5A8B A;  2XA7 M;  3N7W A;  5A90 A;  5EVI B;  3HLD A;  2XGN A;  4PM7 A;  3CAX A;  3T4J A;  1GCE A;  4ETX A;  4U0X A;  1FQG A;  1T18 A;  4K0X A;  1GHP A;  4OOY A;  1MWS A;  1L2S A;  5EFW A;  4MEZ A;  3OPH A;  4R0Q A;  4R3J A;  3LEZ A;  4U3T A;  3FG8 A;  3UDI A;  3G2Z A;  2CMN A;  2ZLY A;  4QB8 A;  5FEG A;  5M19 A;  3SS5 A;  3UB8 A;  2Q0O A;  3NIA A;  4X56 A;  4Y13 A;  3K3D A;  4Q0I A;  3BY8 A;  4C3Q A;  4HH2 A;  3IH9 A;  2GJ3 A;  4DF6 A;  4LGW A;  1YLT A;  1FCN A;  2PYP A;  1ZG6 A;  1TF1 A;  2ZQ7 A;  5FSR A;  1ESU A;  1ONH A;  3FZC A;  2XA7 S;  4E04 A;  2ZMF A;  1J9M A;  1P0Z A;  5CHJ A;  4R4S A;  1H3Q A;  3JYI A;  2Y2J A;  1NXY A;  2PD8 A;  5EVI C;  1YMS A;  4IVI A;  1FCM A;  2QHK A;  1F98 A;  2W3G A;  3HLB A;  4OVD A;  3PBN A;  2LB5 A;  3A3I A;  4X68 A;  1FR1 A;  3Q7V A;  4CJN A;  1W7F A;  5F83 A;  4DXC A;  1XGI A;  3DW0 A;  3N6I A;  2M1C A;  3T50 A;  3RXW A;  3NOU C;  4NET A;  1MZU A;  4OLD A;  3IT9 A;  1LL8 A;  3PBT A;  1F9I A;  5HD5 A;  4ZAM A;  4EBN A;  3L9K A;  1VEU B;  4XT2 A;  5FAP A;  3CZD A;  5CXW A;  1D1J A;  2KX6 A;  3S7O A;  4CQH A;  3S4X A;  4KQQ A;  4YWZ A;  1K55 C;  4R38 A;  3OZH A;  1L0E A;  4Y3I A;  1T1A A;  4S2N A;  4JKT A;  2JKF A;  4EBP A;  2P74 A;  4E3K A;  1H8M A;  2B5R A;  3QNC A;  5TBM B;  1OT6 A;  4I5S A;  2Q9N A;  5L10 A;  3CWF A;  4Q0J A;  2E8J A;  4PM6 A;  2CC1 A;  4Q0H A;  1GA9 A;  1I2S A;  5L07 A;  4CLC D;  3A3J A;  1DP9 A;  3IXB A;  3QP4 A;  4MNR A;  1WYC A;  3ICY A;  1Z6F A;  4OOL A;  1UWP X;  1MKM A;  2ZC3 B;  3MSH A;  3G32 A;  1GSW A;  4KZ6 A;  1OPX A;  5DTK A;  4KZ8 A;  3LI9 A;  5J7E A;  2PBY A;  1OTI A;  5HAP A;  1QME A;  5CHU A;  3E4O A;  1L3L A;  3Q7V B;  1TEM A;  3T1Q B;  1MWR A;  5DFY A;  2V1B A;  4KZB A;  4HI4 A;  3MZF A;  4NXE A;  3E0Y A;  1PW8 A;  4K0W A;  1NWZ A;  2Y2L A;  4E3L A;  5AQA A;  4BL3 A;  2I72 A;  3OCL A;  4KQD A;  3ULF A;  2FFF B;  2HDU A;  4XT2 B;  3WS2 A;  3ZG0 A;  3N8S A;  1K57 A;  3MF0 A;  3CUE A;  2O9C A;  4BD0 A;  2PR6 A;  4FSF A;  2KDK A;  3UPN A;  5DVA A;  4E3O A;  1LLB A;  1YPR A;  2GNX A;  4QWO A;  2HP6 A;  3FKV A;  3VFF A;  1LL5 A;  4Y5F A;  3ZDJ A;  1K4F A;  5FDH A;  2OSU A;  3DWK A;  4MLL A;  1S4S A;  3LIF A;  4Y7P A;  3IXH A;  4OP8 A;  4EES A;  4ZJ1 A;  3WWX A;  1T19 A;  3BWL A;  4KZ7 A;  1L0F A;  2DCF A;  1XJ2 A;  1P9W A;  1DRM A;  4Z9Q A;  4HBU A;  3CI6 A;  1KGG A;  2QJ7 A;  1TS8 A;  3D3O A;  3HJI A;  4DDS A;  2ZQ9 A;  4QD4 A;  3U4L P;  4DE1 A;  2ZJ9 A;  3VFH A;  4IBX A;  5EEC A;  5J8X A;  3V3S A;  1IEL A;  3MFD A;  4R23 A;  4S2L A;  3HLC A;  1OTE A;  4G3V A;  4JXG A;  3QP8 A;  3UB5 P;  5IS1 A;  4N9K A;  4G3K A;  1L0D A;  4BQM A;  3KYE A;  1N4O A;  3KSH A;  3AGE A;  1ZC2 A;  3NDE A;  2M7U A;  4QU3 A;  3LIE A;  3W4P A;  4S2N C;  3IWQ A;  2X71 A;  1HVB A;  5FI7 A;  1HLU P;  3MR0 A;  3T4K A;  1ERM A;  2Y2P A;  4HH3 A;  3EQU A;  4P6B A;  2HDQ A;  2B02 A;  5HPF A;  2QPN A;  2HP9 A;  2VV7 A;  3ZYT A;  1RGY A;  3C30 A;  5GHY A;  4HP4 A;  4FTX A;  3DTM A;  4HJ3 A;  4DDY A;  4B88 A;  3PBS A;  1NLY A;  3GVB A;  5CTM A;  3ITA A;  2Y2H A;  1YAX A;  2ZC6 B;  3O87 A;  4WBG A;  2WAD A;  5F68 A;  5TR7 A;  3HLE A;  2ZQ8 A;  3EWK A;  3O3V A;  1K0K A;  3BQA A;  4KZ9 A;  1K54 A;  2VV8 A;  1KVL A;  4I3I A;  2WKE A;  5G4Y A;  4C6Y A;  1M6K A;  5AJG A;  1ES4 A;  4KUO A;  4YIN A;  2BG1 A;  3SS3 A;  4JXW A;  4X69 A;  4Y17 A;  1NZU A;  3GQZ A;  3LUQ A;  1YLW A;  4UHU A;  3TOI A;  1ZG4 A;  3IX3 A;  1YLZ A;  3CPT B;  4QY5 A;  4ME4 A;  3UDF A;  4E3M A;  3QP5 A;  4PPR A;  3T4Q A;  5HW3 A;  1RP5 A;  1ES2 A;  3C4O A;  4A5R A;  2Q9M A;  2O9A A;  3EOI A;  4S2P A;  2ZBB A;  1N9L A;  4N1X A;  2WK0 A;  3U2A A;  4CPK A;  2V9A A;  3PYP A;  4DE3 A;  1W8Q A;  3LEQ A;  5FA7 A;  3ZGA B;  3DWZ A;  3HUO A;  4IUH A;  5A91 A;  3WRZ A;  2EX9 A;  3GDI A;  1ACF A;  4MDZ A;  4EUV A;  4JGR A;  2DMW A;  1OT9 A;  4R70 A;  5HDS A;  4JGQ A;  2W1T A;  2GDN A;  2MJ6 A;  5KMW A;  2NUT C;  1ERO A;  3IF6 C;  1PIO A;  5FAO A;  2XLN A;  3DTI A;  4ESP A;  4DJ2 A;  3D9Y A;  1LI9 A;  5HFO A;  3CLO A;  4I3J A;  4HEF A;  1OJ5 A;  2Z2M B;  2XEP A;  1YM1 A;  3GRJ A;  4HES A;  5EOO A;  4U0T A;  3S7Q A;  5A93 A;  5IU1 A;  1NZO A;  1JTG A;  5E2F A;  2XRN A;  4OPZ A;  2BLS A;  1L0G A;  5GHZ A;  1UWN X;  3W8K A; 
#chains in the Genus database with same CATH homology
 1XJ6 A;  1P0Z A;  1KOU A;  1H3Q A;  1VB6 A;  4GW9 A;  3RFB A;  2PDR A;  2J80 A;  3S7P A;  2PD8 A;  4NEE D;  3LIC A;  4Z1W A;  2ZOI A;  4OOM A;  2QHK A;  1OJG A;  4WUJ A;  1F98 A;  4HJ6 A;  4L9F A;  2W3G A;  4O01 A;  2J3T D;  5CX7 A;  1LSW A;  3PBN A;  2LB5 A;  3NHQ A;  5DF9 A;  5J4E A;  3R7W A;  2HV1 A;  4YNR A;  4P6Z M;  3NOP C;  3KX0 X;  4NXB A;  3VV4 A;  2H28 A;  3F1O A;  4WF0 A;  4DN0 A;  4EQ1 A;  3PBQ A;  2P04 A;  2R78 A;  3C38 A;  4L9E A;  4BBV A;  2M1C A;  2ZOH A;  2W3E A;  3T50 A;  3NOU C;  4JGP A;  1MZU A;  1DP8 A;  1LL8 A;  3PBT A;  3KYZ A;  4EXO A;  1F9I A;  2VX8 A;  5HD5 A;  3JVV A;  2PHY A;  2D01 A;  3OC2 A;  5C5K A;  3IS2 B;  4XT2 A;  4EW7 A;  4GHI A;  4HQA A;  2K31 A;  3H82 B;  2W27 A;  3UB6 A;  2KX6 A;  3PR6 A;  3S7O A;  4CQH A;  3MQO A;  4YWZ A;  3EEH A;  4R38 A;  4ZRR A;  5F5Y A;  1NLZ A;  4GLQ A;  3EEA A;  3UB9 A;  4I39 A;  2VV6 A;  4Y3I A;  4EEP A;  1T1A A;  4R3A A;  3B42 A;  3TW8 A;  1N9N A;  1H8M A;  4GCZ A;  2W0N A;  5G4Z A;  2J3T C;  5MC7 A;  5TBM B;  4ETZ A;  1OT6 A;  2KOI A;  2O0Y A;  4I5S A;  4AFI A;  2JKT I;  2W1T B;  3CWF A;  3LR3 A;  2INW A;  4Q0J A;  4PKY A;  3W2Z A;  1TS0 A;  2PYR A;  4RQ9 A;  4LRY C;  3B47 A;  4Q0H A;  4P6Z S;  4MCW A;  1S4R A;  4Y2F A;  2NUP C;  2L4R A;  1F5M A;  4NKP A;  3OCN A;  1T1C A;  4IHQ A;  2V0U A;  3BJN A;  5AVE A;  2M7V A;  4CLC D;  1DP9 A;  4KUK A;  4BJP A;  3H7W A;  3MMH A;  1D06 A;  3UB7 A;  4CLC A;  4HY8 A;  3RH8 B;  3BW6 A;  1WA9 A;  3LR5 A;  2B18 A;  3F1N A;  3ICY A;  3K2N A;  4OOL A;  1UWP X;  2VA0 A;  1MKM A;  3H9W A;  2ZMV A;  5J3W A;  3VOL A;  2YKH A;  1GSW A;  1OPX A;  1G6O A;  3LI9 A;  3MJQ A;  5J7E A;  1P9R A;  1OTI A;  3OLO A;  2VEA A;  4NXF A;  2GZA A;  4WEJ A;  3KO6 A;  1MC0 A;  2GX5 A;  3E4O A;  1STZ A;  1ZTU A;  1TD5 A;  3V67 A;  3R7W B;  5DFY A;  2V1B A;  5HPI A;  1V9Y A;  3O5Y A;  3F1O B;  4HI4 A;  4NXE A;  3T4S A;  3E0Y A;  4BMW A;  3OBF A;  1P97 A;  3A0R A;  1NWZ A;  4EET B;  3UE6 A;  3PBO A;  5DJT A;  3E98 A;  4PAU A;  1JNU A;  3OCL A;  2FZ0 A;  5TJJ A;  5FL3 A;  4KQD A;  3ULF A;  5HDC A;  4XT2 B;  4HIA A;  4EEU A;  1ODV A;  4R6L A;  2Y8H A;  3EQV A;  4UEY A;  3MF0 A;  2QWS A;  3CUE A;  2O9C A;  4WLA A;  2PR6 A;  4FSF A;  2KDK A;  3JVU A;  1LT0 A;  1S1Y A;  3P7N A;  3T4T A;  2A24 A;  2EWW A;  2PR5 A;  4GJ4 A;  5DJU A;  1V9Z A;  4WN5 A;  4F3L A;  5HD3 A;  2GNX A;  2VZW A;  4IUK A;  5HWW A;  4I3A A;  4Y5F A;  1N9O A;  2W3H A;  2WKQ A;  2OWJ A;  1NRJ A;  3ZQ5 A;  1S4S A;  3F1P A;  3LIF A;  4FOF A;  2V1A A;  2HF6 A;  1ZHH B;  2WKP A;  4EES A;  1UGU A;  3BY9 A;  4PHT A;  1XFQ A;  1T19 A;  3BWL A;  3T4O A;  3A0S A;  2WKR A;  5LBR A;  3PHY A;  4YOF A;  5KSH A;  2OOL A;  4KQO A;  4WEL A;  1XJ2 A;  3PXP A;  2JHE A;  1P9W A;  1DRM A;  3MQ0 A;  2PD7 A;  3CI6 A;  1YSP A;  2QJ7 A;  4HP9 A;  1TS8 A;  2D02 A;  2VKS A;  3D3O A;  3HJI A;  4GS9 A;  3H7W B;  4HHD A;  5HWV A;  5HSQ A;  1XJ4 A;  2IA2 A;  2HJE A;  2VLG A;  4CLC B;  3CUE C;  2W1R A;  2I9V A;  4MMN A;  2QKP A;  4IJG A;  1VHM A;  3F1N B;  3B33 A;  3LR0 A;  1DP6 A;  3EGD C;  1OTE A;  4G3V A;  1EW0 A;  4UQI M;  1S1Z A;  4CLC E;  5IS1 A;  5HZH A;  1YSQ A;  4G3K A;  1W63 M;  4QPR A;  3KSH A;  4G3W A;  3FPW A;  3VE4 A;  3FPV A;  4BBT A;  3S7N A;  4MN5 A;  4BBU A;  2P08 A;  1S66 L;  3LFV A;  3VE3 A;  3CIT A;  2M7U A;  2EWV A;  5IT5 A;  3LIE A;  4HJ4 A;  4LRX C;  4EER A;  5TBM A;  3UMD A;  3HCY A;  1TS7 A;  4LRZ E;  5KIZ A;  2BAS A;  2W3D A;  3LIA A;  4O0P A;  2JKR M;  2XRO A;  1D7E A;  3LIB A;  3MR0 A;  4B9O A;  2P7J A;  5I5L A;  3T4K A;  2EA9 A;  4L0L A;  3UME A;  4ARZ A;  2PT7 A;  5L8M A;  2JN7 A;  4O8G A;  4HH3 A;  3EQU A;  2V0W A;  5F6A A;  3TRC A;  2B02 A;  3MXQ A;  5HPF A;  2VV7 A;  3ZYT A;  3C30 A;  2HGV A;  1X0O A;  1Y28 A;  4LLO B;  2O99 A;  3D72 A;  5DKK A;  2A24 B;  4EU0 A;  4HP4 A;  4H6J A;  3G6O A;  5F69 A;  4HJ3 A;  4BWI A;  5HWT A;  3P01 A;  2Z6C A;  1YKD A;  4UQI S;  3NOT C;  3E4Q A;  3PBS A;  4GHI B;  4CLC C;  1NLY A;  1W63 Q;  2YKF A;  1OTA A;  2HJ9 C;  5HDD A;  3KSG A;  1LSV A;  4LPZ A;  1T1B A;  1YAX A;  3OOV A;  5F68 A;  3F1P B;  3LID A;  3A0V A;  3FC7 A;  4WL9 A;  5DFX A;  3R4K A;  3TE8 A;  2Z6D A;  3C8C A;  3EWK A;  3BQA A;  2VV8 A;  1UWN X;  3PBR A;  3RTY A;  4DMZ A;  4I3I A;  3E4P A;  4WEK A;  5G4Y A;  3UE3 A;  4K08 A;  3LI8 A;  5AJG A;  3BQ8 A;  4KUO A;  4MN6 A;  4DJ3 A;  4HOI A;  4GS9 B;  2K7S A;  2L1M A;  3LUQ A;  1G28 A;  1TS6 A;  3MFX A;  2QYB A;  1OTB A;  3IBJ A;  2KLI A;  1OTD A;  3K3C A;  1XJ3 A;  2VGL M;  4F3L B;  3NJA A;  3C2W A;  4ME4 A;  3T4Q A;  3KSF A;  3IBR A;  5DKL A;  2A2L A;  3GEC A;  1XFN A;  3MQQ A;  5A8B A;  2QJ5 A;  2J3W A;  2O9A A;  2XA7 M;  3EOI A;  3EGX C;  3IS2 A;  2JKT M;  2ZBB A;  4JGO A;  1N9L A;  3CAX A;  3H82 A;  4ETX A;  3KSI A;  3SW1 A;  3KYQ A;  1T18 A;  2OWH A;  1IFQ A;  3T4L A;  3U2A A;  2V9A A;  5EFW A;  3PYP A;  2FH5 A;  3FG8 A;  1S67 L;  4IUH A;  1LSX A;  3DBA A;  2CMN A;  4ARZ B;  2K2N A;  4L9G A;  3GDI A;  5HL6 A;  4MDZ A;  2W3F A;  4EUV A;  2O9B A;  4MN7 A;  4JGR A;  3UB8 A;  4M4X A;  2OAQ 1;  2DMW A;  1OT9 A;  4I38 A;  4R70 A;  5HDS A;  4JGQ A;  4HNB A;  2W1T A;  2OAP 1;  2MJ6 A;  2NUT C;  2VJW A;  3K3D A;  4DJ2 A;  3LYX A;  4H6J B;  4Q0I A;  3BY8 A;  4PKY G;  4HH2 A;  2L0W A;  3HJK A;  3LR4 A;  3CLO A;  4NXG A;  2GJ3 A;  4I3J A;  1OJ5 A;  2VGL S;  3TJZ C;  2JKR I;  2XSS A;  1GSV A;  5K5B A;  2G7U A;  1GSX A;  1BYW A;  2PYP A;  1TF1 A;  3S7Q A;  4B93 A;  2Y79 A;  5AVF A;  5IU1 A;  2XA7 S;  1IOU A;  4II7 A;  2XRN A;  3T4J A;  4E04 A;  2ZMF A;  2LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...