5AVEA

The ligand binding domain of mlp37 with serine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
SVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRSTLIHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
total genus 82
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5aveA02
1XJ6A 3MJQA 4KUOA 1KOUA 3A0SA 1OTBA 4HNBA 4PKYG 3H9WA 3K3CA 2H28A 2W0NA 4JGOA 4EW7A 3H82A 5HDCA 2Z6CA 2J80A 3MQQA 4NXFA 5HZHA 4HJ6A 3LI9A 4RQ9A 4BBTA 5HSQA 4LRXC 2D01A 1DP8A 3LIAA 3VE3A 3D72A 4EEPA 2WKQA 1DP9A 4JGQA 3NHQA 3VOLA 3G6OA 3B33A 4HQAA 5F6AA 4YWZA 2QJ5A 4GS9A 2Z6DA 5IS1A 5TBMB 3A0RA 1OTEA 3BWLA 3EEHA 4PKYA 2ZOIA 3E4OA 1GSVA 1G28A 1VB6A 1F98A 4GCZA 1P0ZA 2VV6A 4LPZA 3UB7A 5DJTA 4MN5A 4H6JB 3F1NB 3LIFA 3F1PB 3LUQA 3GECA 4HIAA 4L9FA 4WF0A 1XFQA 5HD5A 5AVEA 2M1CA 5A8BA 1D06A 3ICYA 2PR5A 4R3AA 5DKKA 3CAXA 3SW1A 5HD3A 4DJ2A 3MR0A 3ULFA 2I9VA 2V1AA 2V0WA 3FC7A 4HJ4A 1DRMA 2PDRA 4L9GA 1UWPX 1MZUA 3EWKA 1LSVA 1TS0A 1UWNX 4F3LB 3C8CA 3LIEA 1OTAA 2K7SA 1LSXA 1T19A 2WKRA 3E4QA 4WN5A 1S1ZA 3BY8A 1JNUA 4HJ3A 3T50A 3UMEA 4F3LA 1S1YA 1T18A 1T1BA 1V9YA 5DKLA 2OWJA 4EETB 2WKPA 3LI8A 4HH3A 5IU1A 2R78A 4NXBA 1OJGA 2PR6A 1WA9A 3IBRA 4R38A 2PD7A 1N9NA 4BBVA 2B02A 2OOLA 5DJUA 4BBUA 2OWHA 3LIBA 3FG8A 4MN6A 5F5YA 2L4RA 3LIDA 5J4EA 3H7WA 4R70A 4EEUA 2A24A 4GHIB 4HP9A 2EA9A 3MFXA 1S4RA 4LLOB 5G4YA 5HDSA 1N9LA 1S67L 1XJ2A 3E4PA 4XT2A 5I5LA 4HY8A 1OJ5A 4K08A 1ODVA 1BYWA 1EW0A 1V9ZA 4GHIA 4WUJA 1T1CA 1T1AA 2VV8A 2W27A 2ZBBA 2D02A 3A0VA 3NOTC 1P97A 2VV7A 4I5SA 4JGPA 4M4XA 1OTDA 5F69A 1F9IA 2HV1A 2QHKA 4LRZE 3UMDA 4WLAA 3VE4A 5HWVA 2VEAA 5HWWA 3NOPC 3F1NA 3NOUC 4HP4A 3RTYA 4HI4A 3PHYA 1Y28A 2QWSA 4I3JA 3HJKA 4I38A 4HHDA 3UB6A 3NJAA 3P7NA 4NXEA 3BY9A 1XFNA 1D7EA 2QKPA 3IS2A 5J3WA 2L1MA 1DP6A 3F1OB 5G4ZA 2JN7A 3H82B 5J7EA 4GS9B 1LT0A 4L9EA 2BASA 4NXGA 3IS2B 4EXOA 4H6JA 2V1BA 1GSXA 3UB8A 2KDKA 4XT2B 2QJ7A 3MQOA 3PYPA 4E04A 2ZOHA 5HDDA 2KX6A 2PYPA 4JGRA 3MXQA 3H7WB 4I3AA 1TS6A 1UGUA 2GJ3A 4KQDA 5TBMA 1XJ4A 4HOIA 4I3IA 3LYXA 3OLOA 2PD8A 1LL8A 1NWZA 2INWA 2P7JA 3F1OA 4KUKA 2PYRA 3CLOA 3F1PA 5EFWA 3RH8B 3UE6A 3GDIA 5HWTA 5F68A 1S66L 1OT9A 2YKFA 4HH2A 5AVFA 2PHYA 4EERA 2L0WA 2V0UA 1OTIA 2YKHA 1GSWA 1S4SA 1TS8A 1N9OA 2A24B 4GW9A 2CMNA 4WL9A 3KX0X 3HJIA 1LSWA 5KIZA 3LICA 2V9AA 3CWFA 3UB9A 3ZQ5A 3C2WA 1TS7A 4DJ3A 4EQ1A 1X0OA 2JHEA 2VLGA 4B9OA 4LRYC 1XJ3A 4EESA 4I39A 4R6LA 3K3DA 1OT6A
chains in the Genus database with same CATH superfamily
3T1QB 4PKYG 3QP2A 2O9CA 4D60A 1XGJA 2WYXA 3C7VA 1EROA 1K57A 4OP5A 1WYCA 2V8FA 3IF6A 3MZFA 1VM1A 2XR0A 4L9FA 2Q9NA 3CHWP 3GTCA 5GLCA 2V0WA 2V1AA 2O9BA 3EGDC 5DFYA 4EV4A 3S7NA 1UWPX 1YKDA 3C8CA 1SKFA 4Y15A 2K7SA 3E4QA 5DFXA 5A93A 4S2OA 1IFQA 4FH4A 2ZQCA 2PR6A 3IBRA 1BZAA 5EVIC 4MLLA 3PTEA 3LIBA 3RFBA 4R70A 4YINA 2KOIA 1K55C 1PI4A 2PBYA 2Y2QA 1JWVA 1W5DA 2VV8A 5E2GA 2HDUA 4PHTA 3UMDA 3VE4A 4CQHA 4ARZA 4QU3A 2ZMAA 1LI0A 5M19A 3UNWA 1FCOA 4I38A 4Q0IA 1W63Q 1G5UA 3LCEA 4Y5FA 4QB8A 1K25A 5HAIA 3HUNA 3T4QA 3PYPA 3IHAA 3MXQA 5AQ7A 2P04A 3S7PA 3RH8B 5EVIA 1W63M 5EOOA 2UV0E 1TS7A 1PWCA 4QHCA 3A0SA 2W0NA 3A3EA 4E6XA 3H82A 2Y2HA 5HZHA 1TD5A 3G6OA 1E25A 1M40A 2O0YA 4MDZA 4Q8IA 1NYYA 3AGFA 3AGDA 3IXHA 4OOLA 4K0XA 3M6BA 2I72A 5HX9A 4H6JB 3F1PB 2Y2MA 1XXMA 4FSFA 4Y0UA 4L9GA 1DRMA 4FOFA 4E6WA 3EWKA 4JPMA 1YAXA 4H8RA 1FILA 1NXYA 5FI2A 3JVUA 3OBFA 1K54A 4PPRA 4BBVA 3CJMA 4JF4A 5HW3A 4R1GA 4LV2A 3Q1FA 1K4EA 3V5MA 1IELA 1V9ZA 2WGWB 2VV7A 5F69A 5GHZA 1OTDA 2WGVA 4GDNA 2ZQDA 1XKZA 4FTXA 3GSGA 4OPYA 4HHDA 3NJAA 3OCLA 3BY9A 5FASA 3LR0A 1XGIA 3WS5A 5FI7A 4WM9A 3GR2A 1ZHHB 3UDIA 4H6JA 3PR6A 3PAGA 2CC1A 1ESUA 1XJ4A 3G2ZA 5F1FA 2PYRA 1Y54A 3CLOA 1BUEA 4A5RA 1GA9A 2RL3A 4D2OA 1KGGA 4BJPA 1GHMA 3T12B 4IVKA 1FSWA 3MS6A 4DRTA 4F94A 2J9OA 3DTEA 4QD4A 1XJ3A 4EESA 4R6LA 2QPNA 3VP4A 4YOFA 4HBTA 3S7OA 2V20A 3HLGA 3LI9A 3Q07A 2D01A 1DP8A 2WKQA 3CI6A 4C3QA 3PBNA 1KGEA 3MMHA 4DXBA 2W3EA 4MN5A 5TJJA 2QYBA 3WRTA 3ZCZA 5EOEA 5HAPA 4DJ2A 2Q0OA 2X02A 1TS0A 1UWNX 3HCYA 4WEJA 1IKGA 1OTAA 2WKRA 4WN5A 3VOYA 5TGFA 3HUMA 3SS5A 3BY8A 3UB5P 1T1BA 1LL5A 1Z6FA 3LI8A 2R78A 4ZRRA 2GNXA 4BQMA 2LB5A 4QY6A 4E3OA 1N9LA 4HY8A 4G3WA 1NY0A 1BLSA 1ODVA 1BYWA 5CHMA 4I5SA 1F9IA 4WBGA 1YLPA 4ZJ3A 3QP8A 3D4FA 4KZ8A 3S7QA 3UB6A 1I2WA 4G3VA 5CECA 3VP0A 3W4QA 3HL9A 2BASA 4XUZA 4JGRA 3H7WB 5AQ9A 4HOIA 3LEZA 2ZMFA 4HESA 1XX2A 4RYEA 4HH2A 3KYQA 3W4OA 1VEUA 1YLTA 3M2JA 3TG9A 1ONGA 3FYZA 3ITBA 1K57C 5HPIA 4JLFA 4JF6A 4JXSA 1M6KA 2ZQ8A 1CJFA 2Z6DA 3V67A 2Y55A 4JXWA 1GSVA 1VB6A 1ES5A 4N1HA 2EFXA 5DJTA 3V50A 2EX2A 5FAOA 5AVEA 5FQMA 3OOVA 3N6IA 3SZTA 3N4IA 2PDRA 5BOHA 4R3BA 1IEMA 3T50A 2O9AA 2OOLA 5EM1A 1XA7A 3ZG8B 2L4RA 1XJ2A 1K0KA 4GHIA 1T1CA 2H10A 3D3OA 2WKHA 3S1YA 1H8YA 3NOPC 3F1NA 5EVEA 5EVLA 2JC7A 2ZL1B 4XT2B 3LO7A 1K55A 4IVIA 5HDDA 4MEZA 5FQIA 5M18A 2KLIA 2VX8A 5DTTA 3OLOA 2JKFA 1NWZA 4R0QA 5EFWA 4ME4A 2VGJA 1VETA 5FAPA 1ESIA 3PBSA 3IWQA 3E0YA 1L0FA 1W8YA 3UB9A 4E3NA 2Y2GA 4X1MA 3K3DA 3K3CA 1S6RA 4EW7A 1L0GA 3O87A 4N92A 3QNBA 1K4FA 1YLZA 3T4LA 1SCWA 3MQ0A 1K6RA 4YWZA 3ZFZA 2DRWA 3LY4A 3BWLA 1N9BA 2VV6A 3RJUA 4OOYA 4U3TA 4FCFA 5F83A 1ES3A 3FZCA 3OPLA 3IXDA 1FCMA 3SS3A 3VP3A 4Y3IA 1H0MA 4HJ4A 3FC7A 2NUTC 4OPZA 5CEBA 4GOGA 2VK3A 5HARA 3VOZA 5E2FA 3PAEA 3G2YA 3UE1A 2JCHA 2HP5A 3IF5A 4MNRA 3T1XA 5F1GA 4OQHA 3MFXA 4B4ZA 1YMXA 3E4PA 3VP2A 1L3LA 4QPRA 1EW0A 2W1RA 4OVDA 1JWZA 1P97A 1IYPA 2XA7M 2ZQ7A 4EBPA 5FSRA 3GQZA 3Q7ZA 4NXEA 3ZDJA 1K54C 4IEDA 1YSPA 1FOFA 1MWRA 3ZNYA 3ZNTA 5U47A 3DBAA 4EQIA 4CLCA 1RGYA 3NCKA 2WGIA 2XA7S 2RCXA 3BECA 3M2KA 5CEDA 4DJ3A 3VMAA 4ETZA 3H9WA 2ZQAA 4LCLA 3ZG5A 3WWXA 2J80A 4KZBA 5HSQA 5TR7A 4EEPA 2EX9A 4GD6A 4L0LA 4UA6A 1QMEA 1K6SA 2EX8A 2QJ5A 5EVID 4GS9A 4OH0A 2ZLYA 3O86A 4YNRA 4Z1WA 3FWLA 3E4OA 4EWFA 5EM0A 5CRFA 2VZWA 4P6ZM 4LPZA 4LV3A 3V3RA 1WE4A 4Q0HA 3HREA 2X01A 1G68A 1XFQA 4PMAA 3IWOA 1PWDA 2BTFP 2WGWA 3QP6A 1LL9A 1NZOA 3FKWA 5FQ9A 2G2WA 4UQIS 3ZYTA 3TJZC 5FEFA 2EXBA 4DE1A 4DE2A 3SOIA 5DJUA 2PU2A 1RGZA 4B4XA 5E43A 2V2FF 2VA0A 4GHIB 4S2LA 4E3MA 3ISGA 1IYSA 5I5LA 4RVAA 3RTYA 3A0VA 3HLDA 1E4DA 2B18A 3HLEA 2OSUA 3NI9A 5A91A 2DCFA 1YQSA 3C5AA 3F1OB 1QMFA 3BFGA 1PW1A 1PIOA 2ZMVA 3CPTB 2WK0A 3NDEA 3EEAA 4KZ6A 2W3GA 2HZ5A 2PAVP 1MKMA 1NRFA 4GZBA 4OKPA 2GJ3A 5F68A 3UPOA 4XXRA 3F1OA 3GMWA 3LR3A 1GSWA 3W4PA 3M6HA 4WL9A 2ZC4B 3HJIA 3CWFA 2W1TA 3O5YA 1YLJA 3VSKA 2A3UA 4R4RA 1IYQA 4IHQA 3B3XA 1OTBA 4S2IA 1PZOA 3BW6A 3W2ZA 4NXFA 5J7EA 1LI9A 4MN7A 2E8IA 3Q7VB 5EECA 2HP9A 2OV5A 3B33A 5F6AA 1ERQA 3GVBA 5FAQA 5F82A 3UB7A 2IWDA 3DW0A 3TW8A 2P9VA 1BLHA 3GECA 5CHJA 4LFUA 2W1TB 2ZL1A 5HD3A 5L8MA 4Y0TA 5JYOA 4ARZB 3PBOA 2VGLS 4GNUA 1KVMA 2BLSA 4C75A 5KSCA 2Y4AA 1RCJA 3OC2A 1BLCA 1HLUP 1T18A 3G34A 5DKLA 5CHUA 4R38A 4OP8A 4QY5A 4BBUA 3FG8A 4MN6A 3LIDA 2A24A 3HVFA 4OPRA 4BL2A 3L9KA 4K0WA 5AQBA 4CLCD 3UPNA 1K56A 4K08A 3CITA 4LRZE 2XLNA 2QWSA 3QP4A 1DY6A 1ONHA 3KSHA 5EE8A 1CK3A 5L2FA 3MKEA 2QJ7A 4E04A 4LV0A 4PM7A 1UGUA 2PD8A 3OPPA 1SZVA 4K91A 4BL3A 3GDIA 2NUPC 3T4TA 3E2KA 1JWPA 1OTIA 4JKTA 2EWVA 5JYPA 4I39A 3T4SA 4II7A 4OLDA 3T4KA 4OLGA 3NULA 1H5XA 3UE0A 3WS0A 4E3IA 1OTEA 4PKYA 2ZM0A 2H0YA 2WAEA 2W3DA 5CTNA 2ZQ9A 2DMWA 2Y2LA 2Y79A 2PR5A 4HEFA 1S0WA 2XD5A 4O0PA 4DE3A 5CXWA 1TEMA 4GKUA 4DE0A 2AVXA 1FSYA 3NDGA 3KSFA 4BWIA 4OQGA 4EEUA 1S4RA 5HDSA 1ACFA 5HL1A 2HJ9C 3VOLA 4JGPA 4N1XA 4R4SA 1WYBA 1YPRA 2HV1A 3Q7VA 4RX2A 1L2SA 3IT9A 2VEAA 2Y2PA 5L10A 4Q0JA 2P08A 4I3JA 3VV4A 2QKPA 3EQUA 5A90A 2A2LA 1ZKJA 2WUQA 4L9EA 3E98A 1GSXA 3HLWA 5CTMA 4KG6A 3N8LA 3O88A 5A92A 3A3FA 4X25A 4AFIA 5TBMA 3PBTA 3I7JA 3UDFA 3KSGA 3F1PA 2G7UA 3HLBA 3B42A 2PHYA 1ERMA 5KIZA 1XA1A 2W3HA 3P01A 1LSWA 3LICA 1K38A 3ZQ5A 2HF6A 4LV1A 1YM1A 4WZ5A 5CGSA 2H5SA 2JKGA 1XJ6A 1K56D 2HDQA 2H28A 4ZAMA 1H8ZA 4X55A 1MC0A 3D72A 4OONA 2C6WB 5E2HA 4KQRA 1YSQA 5IS1A 5FQJA 3HLFA 2ZOIA 4EU0A 3MSHA 5A8BA 4WELA 5DKKA 4QJGA 2XSSA 2ACGA 2V1ZA 3MR0A 2IWBA 5GL9A 1LSVA 3MF0A 1IOUA 3MXSA 1V9YA 5FDHA 1TDLA 2J8YA 4UEYA 3UO9A 4NXBA 3WRZA 3BM6A 1N9NA 1NJ4A 3A3JA 4LLOB 5G4YA 2PBDP 3VSLA 1OJ5A 3JYIA 1D1JA 3VFFA 4S2JA 5HWWA 3JPUA 4GLQA 5GLDA 3BEBA 3UY6A 2WKIA 4KQOA 3H82B 1HVBA 4RX3A 2V1BA 2GDNA 1G6OA 2EX6A 1FCNA 2EWWA 2KX6A 5EPHA 1SKOB 4LENA 4HBUA 3K2NA 4KUKA 1CI9A 5AVFA 5EVIB 1N9OA 4Y2FA 1NRJA 3C2WA 2K31A 2OLUA 3MJQA 2PRFA 1MWTA 4HNBA 2IA2A 4NEED 5HDCA 1E3UA 4LRXC 3VE3A 2DNSA 1H3QA 1BSGA 3IF6C 4CLCC 3C4PA 5HFOA 4GCZA 5CGXA 1IKIA 1BULA 4LRYC 4LCMA 3G4PA 4X53A 3LIEA 3EOIA 4EUZA 3N8RA 2VKSA 2JE5A 2ZM8A 4OPQA 4B93A 1CF0A 3GRJA 3BFFA 4JXVA 2XFSA 4ZDXA 1OJGA 4O8GA 1STZA 4BD1A 5IHVA 4OQIA 2M7UA 4CLCB 1T1AA 3ULFA 4X56A 3PBQA 2VJWA 3SH8A 2JBFA 4HI4A 4ESPA 2XQZA 1D7EA 3IX8A 2L1MA 4ETXA 4NXGA 1KGFA 3IS2B 5KSHA 4DDSA 3AGEA 4KQDA 4WMCD 1O07A 1HD8A 2Y2IA 4I3IA 4FD8A 3LYXA 1LL8A 3SS4A 1S66L 1OT9A 2Y8HA 4Y17A 3MKFA 2VLGA 2Y91A 1CEFA 3BLMA 5AJGA 3IXBA 1KOUA 1GHPA 4U0TA 1ZTUA 4Y13A 3BFEA 3TOIA 3R4KA 4KG2A 4PAUA 4DF6A 2ZM2A 4HJ6A 2K2NA 2XH9A 2ZC6B 3CPTA 1FR6A 5EUAA 2HJEA 1MWSA 5CX7A 5GHYA 3LUQA 1PW8A 2H0TA 2UWXA 4PM8A 5FQQA 4BLMA 1SDNA 5HD5A 4WMCA 5DF8A 3TE8A 3A3DA 2JKTI 2WKEA 5E2EA 3FPWA 4KZAA 4F3LB 3OCNA 1N4OA 4HJ3A 2OWJA 3P09A 4M3KA 2WKPA 4EBLA 2GX5A 2Y2NA 5K5BA 2OWHA 5IT5A 2EA9A 1O7EA 2E8JA 1PFLA 3C30A 4M4XA 3IBJA 4IBRA 3U2AA 3HJKA 1YMSA 5KMWA 2XROA 4GS9B 5DF7A 4N9KA 5FL3A 3IX4A 1MKIA 3UB8A 2KDKA 4IBXA 5M1AA 3IQAA 3R7WA 1I2SA 4R23A 1PNEA 1TS8A 4MCWA 4GW9A 1A0KA 4NG2A 3EQVA 2Y59A 3RXXA 5MC7A 4KUOA 4JGOA 1IYOA 4KG5A 2Z6CA 2ZC3B 1GCEA 4ID4A 4JGQA 5L07A 3UN7A 4HQAA 4LGWA 5TBMB 4S2MA 3CMZA 3DTMA 2XD1A 4ZJ2A 4WZ5C 1F98A 1FR1A 1CI8A 1P0ZA 2G2UA 2JKRI 3BQAA 2J3TD 2B95A 5G18A 4UA7A 1P9RA 4KQQA 1MZUA 4NK3A 4WYYA 3DWKA 4CLCE 2XDMA 4GDBA 3UMEA 4ZJ1A 1DJAA 4NETA 5IU1A 4PM6A 4UAAA 1MY8A 2PD7A 4EUVA 1BTLA 4JF5A 3MBZA 3UPPA 5F5YA 4HP9A 4O01A 4MMNA 3LR5A 4KZ3A 5FI6A 1KDWA 2HGVA 4GD8A 1U60A 5L09A 3MXRA 1SHVA 5FEGA 3HLCA 4GB7A 3P7NA 1FIKA 1XFNA 1VHMA 2WADA 2XK1A 3IS2A 2ZJ9A 3LY3A 2C5WB 2WZXA 1KDSA 1PYYA 2ZC5B 3NY4A 3PXPA 3T1RA 2XEPA 3IH8A 3BQ8A 1PRQA 3W8KA 4EERA 3QP5A 2L0WA 3G30A 3HUOA 1AWIA 3NECA 2JKRM 1Y4OA 3FV7A 4JBFA 4CPKA 3NIAA 4BBTA 3LIAA 3S22A 2Z2LB 3G35A 3OPRA 4WEKA 4KZ9A 1L0EA 1HZOA 1LHYA 3DTKA 4B88A 1ZG4A 3BJNA 5EV0A 3F1NB 4S2NC 3BRMA 1PZPA 2B5RA 2IWCA 3CAXA 3SW1A 1EWZA 2P74A 3BFCA 1MBLA 4MBFA 4Y0OA 4Y7PA 1LSXA 3UE6A 3E2LA 1S1YA 5AQAA 3ZG7B 1NYMA 1XP4A 2B02A 3SH9A 1I5QA 4KZ5A 1OMEA 2FFFB 2OAQ1 4R3JA 3IX3A 1JVJA 3N8SA 4WUJA 3NOTC 2D02A 2HPBA 2QMIA 3JVVA 5GLBA 3CZDA 5GHXA 3KYEA 1OPXA 3G31A 4KZ4A 5HWVA 3GV9A 2J3WA 1Y28A 3WS1A 3DWZA 1PI5A 4P6BA 1NZUA 4S2NA 1KE4A 3BFDA 3L7HA 2QZ6A 1LT0A 2R9WA 2A49A 3V3SA 5HL6A 4GN2A 1RP5A 1LLBA 1SDEA 2EXAA 1F5MA 3KSIA 3CUEA 2FZ0A 1ALQA 2WZZA 2OAP1 4X69A 1VEUB 4U0XA 3V39A 2J9PA 3OPHA 3S4XA 1CQAA 1ES2A 5I94A 1MWUA 4RQ9A 1NLZA 5GLAA 4Z9QA 1DP9A 3C38A 2XGNA 3NHQA 1L0DA 4CJNA 4DMZA 1BLPA 1W79A 3A0RA 3EEHA 1EI5A 1MXOA 2Y2JA 3IHBA 3LIFA 2Y2KA 4G3KA 4S2PA 3RXWA 3ITAA 4OQ0A 3CUEC 3T4OA 3LGOA 4E3LA 1HTZA 2J3TC 2W3FA 1T19A 1S1ZA 1JNUA 4EETB 4KENB 1GA0A 4C6YA 5CERA 4UHUA 3IF6B 5J4EA 5LBRA 3TSGA 1C3BA 1S67L 2PU4A 2XRNA 5DVAA 4O7DA 1VQQA 1YLYA 4WLAA 4X1LA 3NOUC 4DN0A 1Q2PA 4FUWA 3C7UA 2EFUA 4UA9A 4BMWA 3MZDA 4IJGA 4X68A 3WS4A 4EXOA 1JTDA 5KZHA 1CEGA 3MQOA 2ZOHA 3B47A 3QHYA 2P7JA 2INWA 1JTGA 2YKFA 2ZD8A 2V8CA 3LR4A 4MBHA 5FATA 1GHIA 5TFQA 3IH9A 1BT5A 2V9AA 2X71A 1X0OA 1Z09A 2R9XA 3QNCA 1OT6A 5C5KA 3ZG0A 3ZHHA 1TDGA 1G6AA 4PM5A 1ES4A 4BENA 2FH5A 2PT7A 5HPFA 1SKOA 3C4OA 3KYZA 1TF1A 4XUXA 4NKPA 2OLVA 4E3KA 4N9LA 3PBRA 3U4LP 3LFVA 2WAFA 2M1CA 1D06A 3QP1A 4R3AA 3KO6A 2I9VA 3TRCA 1J9MA 2Y2OA 3MZEA 5J8XA 3DTIA 3A3IA 4FH2A 2FFYA 1E3UD 3ZVTA 4HH3A 1W8QA 1VETB 3UE3A 1WA9A 4IUKA 5DF9A 1W7FA 1DJCA 3NC8A 3LEQA 4XT2A 3UDXA 2MJ6A 5CGWA 2ZBBA 4GJ4A 2W27A 3P98A 4IUHA 4RA7A 2GZAA 4HP4A 4DKIA 1J3WA 3Q82A 2BG1A 2Z2MB 1DP6A 2Q9MA 3SH7A 4P87A 3OZHA 2ZC7A 3IWIA 3FPVA 4I3AA 3DAVA 5HWTA 1ZG6A 2V0UA 2YKHA 3T1SA 2A24B 3KX0X 1NLYA 1YLWA 3G32A 4YFMA 3ZG9B 1KE3A 5DTKA 3VP1A 1DJBA 4ZBEA 4KZ7A 3ZVWA 2LB9A 3MQQA 4EBNA 4DDYA 3MFDA 1G28A 2P9VB 2VGKA 1KVLA 3R7WB 4WZ4A 2HDRA 1H8MA 3IXGA 4WF0A 4HIAA 3CG5A 3BYDA 3ICYA 2J7VA 3N7WA 5DTSA 3O3VA 4S2KA 2HDSA 5FA7A 1MPLA 4PM9A 3ZGAB 4F3LA 4P6ZS 4UQIM 4JXGA 1P9WA 1PWGA 5FDSA 1KE0A 3H7WA 4P0MA 1ZC2A 2HP6A 3HBRA 4X6TA 1YT4A 4B9OA 4MBKA 2QHKA 1Q2QA 4DXCA 3WS2A 2XF3A 3PHYA 1F2KA 5J3WA 5G4ZA 1TVFA 2JN7A 2JKTM 1AXBA 3EGXC 2XFTA 2VGLM 3FKVA 4P85A 3T4JA 2PYPA 5HAQA 2O99A 3VFHA 1TS6A 3BLSA 3D9YA 1XPBA 4OOMA 3NBLA 5FQKA 4ZTKA 1S4SA 3Q81A 2CMNA 2M7VA 1FQGA 4BD0A 4EQ1A 2JHEA 4E3JA 5D3OA 4QWOA
chains in the Genus database with same CATH topology
1XJ6A 4PKYG 2JKRM 3K3CA 2H28A 4EW7A 2O9CA 4BBTA 1MC0A 3LIAA 3D72A 3T4LA 3MQ0A 4YWZA 1YSQA 5IS1A 4WEKA 3BWLA 2ZOIA 4EU0A 2VV6A 3BJNA 3F1NB 4L9FA 5A8BA 4Y3IA 4WELA 5DKKA 3CAXA 3SW1A 2XSSA 3MR0A 2V0WA 2V1AA 2O9BA 3EGDC 3FC7A 4HJ4A 5DFYA 3S7NA 1UWPX 1LSVA 1YKDA 2NUTC 3C8CA 3MF0A 2K7SA 3E4QA 1LSXA 3UE6A 5DFXA 1IOUA 1S1YA 1V9YA 1IFQA 4UEYA 4NXBA 2PR6A 3IBRA 1N9NA 2B02A 3LIBA 3RFBA 4R70A 2KOIA 4LLOB 3MFXA 2OAQ1 5G4YA 3E4PA 1OJ5A 4QPRA 1EW0A 4WUJA 2VV8A 3NOTC 2W1RA 2D02A 4PHTA 1P97A 2XA7M 3JVVA 3UMDA 3VE4A 1OPXA 4CQHA 4ARZA 5HWVA 5HWWA 2J3WA 4GLQA 1Y28A 4I38A 4Q0IA 4NXEA 1W63Q 1YSPA 4KQOA 4Y5FA 3H82B 1LT0A 2V1BA 1G6OA 3DBAA 3T4QA 2EWWA 5HL6A 3PYPA 2KX6A 4CLCA 3MXQA 2P04A 1F5MA 3K2NA 4KUKA 3S7PA 2XA7S 3RH8B 3KSIA 3CUEA 1W63M 2FZ0A 5AVFA 2OAP1 1N9OA 4Y2FA 1NRJA 4DJ3A 3C2WA 1TS7A 2K31A 4ETZA 3MJQA 3A0SA 4HNBA 3H9WA 2IA2A 2W0NA 4NEED 3H82A 5HDCA 2J80A 5HZHA 4RQ9A 1NLZA 1TD5A 5HSQA 4LRXC 3VE3A 4EEPA 1H3QA 1DP9A 3C38A 3NHQA 4L0LA 3G6OA 2QJ5A 4CLCC 4DMZA 4GS9A 2O0YA 3A0RA 4MDZA 4YNRA 4Z1WA 3EEHA 3E4OA 4OOLA 2VZWA 4GCZA 4P6ZM 4LPZA 4H6JB 3LIFA 3F1PB 4Q0HA 1XFQA 4FSFA 4G3KA 3CUEC 3T4OA 4LRYC 4L9GA 1DRMA 4FOFA 3EWKA 2J3TC 2W3FA 3LIEA 3EOIA 2VKSA 1YAXA 1T19A 1S1ZA 1JNUA 4UQIS 4B93A 3ZYTA 3TJZC 4EETB 3JVUA 1OJGA 3OBFA 1STZA 4O8GA 4BBVA 5DJUA 5J4EA 5LBRA 2VA0A 4GHIB 1S67L 5I5LA 2XRNA 2M7UA 4CLCB 1V9ZA 1T1AA 3RTYA 3A0VA 2VV7A 5F69A 3ULFA 1OTDA 2B18A 4WLAA 3PBQA 2VJWA 3NOUC 4DN0A 4HI4A 4HHDA 3NJAA 3OCLA 3BY9A 1D7EA 3LR0A 2L1MA 3F1OB 4BMWA 4ETXA 4IJGA 1ZHHB 2ZMVA 4NXGA 3IS2B 4EXOA 4H6JA 5KSHA 3PR6A 3EEAA 2W3GA 3MQOA 2ZOHA 1MKMA 4KQDA 2GJ3A 3B47A 1XJ4A 4I3IA 5F68A 3LYXA 1LL8A 2P7JA 2INWA 3F1OA 2PYRA 3CLOA 1S66L 1OT9A 2YKFA 3LR3A 2Y8HA 3LR4A 4BJPA 1GSWA 4WL9A 3HJIA 2V9AA 3CWFA 2W1TA 3O5YA 1X0OA 2VLGA 4EESA 1XJ3A 4R6LA 5AJGA 4IHQA 1OT6A 5C5KA 1KOUA 1OTBA 4YOFA 3S7OA 1ZTUA 3R4KA 3BW6A 4PAUA 3W2ZA 4NXFA 4HJ6A 3LI9A 5J7EA 4MN7A 2D01A 1DP8A 2K2NA 2WKQA 3CI6A 2FH5A 2PT7A 3B33A 5F6AA 5HPFA 3PBNA 2HJEA 3KYZA 5CX7A 1TF1A 4NKPA 3MMHA 3UB7A 2W3EA 3PBRA 4MN5A 5TJJA 3TW8A 3LUQA 3GECA 3LFVA 2QYBA 2W1TB 5HD5A 2M1CA 1D06A 4R3AA 3KO6A 5HD3A 5L8MA 4DJ2A 3TE8A 3PBOA 4ARZB 2I9VA 2JKTI 3TRCA 2VGLS 3FPWA 1TS0A 1UWNX 3HCYA 4F3LB 4WEJA 1OTAA 2WKRA 4WN5A 3OCNA 3BY8A 3OC2A 4HJ3A 1T1BA 1T18A 5DKLA 2OWJA 2WKPA 3LI8A 4HH3A 2R78A 4ZRRA 1WA9A 4IUKA 4R38A 3UE3A 2GNXA 2GX5A 5DF9A 5K5BA 4BBUA 2OWHA 3FG8A 4MN6A 2LB5A 3LIDA 5IT5A 2A24A 2EA9A 1N9LA 4XT2A 4HY8A 2MJ6A 4G3WA 4CLCD 4K08A 1ODVA 1BYWA 2ZBBA 4GJ4A 2W27A 4IUHA 3C30A 4M4XA 3CITA 4I5SA 3IBJA 1F9IA 4LRZE 2GZAA 4HP4A 2QWSA 3S7QA 3HJKA 3U2AA 3UB6A 4G3VA 2XROA 1DP6A 3KSHA 4GS9B 2BASA 5FL3A 3UB8A 2KDKA 2QJ7A 4E04A 3FPVA 4JGRA 3H7WB 4I3AA 1UGUA 4HOIA 3R7WA 2PD8A 2ZMFA 3GDIA 5HWTA 4HH2A 2NUPC 3KYQA 3T4TA 2V0UA 1OTIA 2YKHA 1TS8A 4MCWA 2A24B 4GW9A 2EWVA 3KX0X 1NLYA 3EQVA 4I39A 3T4SA 5MC7A 4KUOA 4II7A 4JGOA 3T4KA 5HPIA 2Z6CA 2LB9A 3MQQA 4JGQA 4HQAA 2Z6DA 5TBMB 3V67A 1OTEA 4PKYA 1GSVA 1G28A 1VB6A 1F98A 1P0ZA 2W3DA 5DJTA 3R7WB 1H8MA 2JKRI 2DMWA 3BQAA 4WF0A 2J3TD 4HIAA 5AVEA 2Y79A 3ICYA 2PR5A 3OOVA 1P9RA 2PDRA 1MZUA 4O0PA 4CLCE 3UMEA 3T50A 4F3LA 4P6ZS 4UQIM 5IU1A 2O9AA 2PD7A 2OOLA 4EUVA 3KSFA 4BWIA 1P9WA 5F5YA 2L4RA 3H7WA 4EEUA 4HP9A 1S4RA 5HDSA 4O01A 1XJ2A 3LR5A 4MMNA 2HJ9C 3VOLA 2HGVA 4GHIA 1T1CA 4B9OA 4JGPA 3D3OA 2HV1A 2QHKA 2VEAA 3NOPC 3F1NA 4Q0JA 2P08A 3PHYA 4I3JA 3P7NA 1XFNA 3VV4A 1VHMA 2QKPA 3EQUA 3IS2A 5J3WA 5G4ZA 2JN7A 2JKTM 2A2LA 4L9EA 3E98A 3EGXC 1GSXA 2VGLM 4XT2B 3T4JA 5HDDA 2PYPA 2O99A 1TS6A 2KLIA 2VX8A 4AFIA 3PBTA 5TBMA 3OLOA 1NWZA 5EFWA 3KSGA 3PXPA 3F1PA 2G7UA 4OOMA 4ME4A 3B42A 3BQ8A 2PHYA 4EERA 2L0WA 3PBSA 1S4SA 3E0YA 5KIZA 3P01A 2CMNA 2W3HA 1LSWA 3LICA 3ZQ5A 2M7VA 2HF6A 3UB9A 4EQ1A 2JHEA 3K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  3MJQ A;  4KUO A;  1KOU A;  3A0S A;  1OTB A;  4HNB A;  4PKY G;  3H9W A;  3K3C A;  2H28 A;  2W0N A;  4JGO A;  4EW7 A;  3H82 A;  5HDC A;  2Z6C A;  2J80 A;  3MQQ A;  4NXF A;  5HZH A;  4HJ6 A;  3LI9 A;  4RQ9 A;  4BBT A;  5HSQ A;  4LRX C;  2D01 A;  1DP8 A;  3LIA A;  3VE3 A;  3D72 A;  4EEP A;  2WKQ A;  1DP9 A;  4JGQ A;  3NHQ A;  3VOL A;  3G6O A;  3B33 A;  4HQA A;  5F6A A;  4YWZ A;  2QJ5 A;  4GS9 A;  2Z6D A;  5IS1 A;  5TBM B;  3A0R A;  1OTE A;  3BWL A;  3EEH A;  4PKY A;  2ZOI A;  3E4O A;  1GSV A;  1G28 A;  1VB6 A;  1F98 A;  4GCZ A;  1P0Z A;  2VV6 A;  4LPZ A;  3UB7 A;  5DJT A;  4MN5 A;  4H6J B;  3F1N B;  3LIF A;  3F1P B;  3LUQ A;  3GEC A;  4HIA A;  4L9F A;  4WF0 A;  1XFQ A;  5HD5 A;  5AVE A;  2M1C A;  5A8B A;  1D06 A;  3ICY A;  2PR5 A;  4R3A A;  5DKK A;  3CAX A;  3SW1 A;  5HD3 A;  4DJ2 A;  3MR0 A;  3ULF A;  2I9V A;  2V1A A;  2V0W A;  3FC7 A;  4HJ4 A;  1DRM A;  2PDR A;  4L9G A;  1UWP X;  1MZU A;  3EWK A;  1LSV A;  1TS0 A;  1UWN X;  4F3L B;  3C8C A;  3LIE A;  1OTA A;  2K7S A;  1LSX A;  1T19 A;  2WKR A;  3E4Q A;  4WN5 A;  1S1Z A;  3BY8 A;  1JNU A;  4HJ3 A;  3T50 A;  3UME A;  4F3L A;  1S1Y A;  1T18 A;  1T1B A;  1V9Y A;  5DKL A;  2OWJ A;  4EET B;  2WKP A;  3LI8 A;  4HH3 A;  5IU1 A;  2R78 A;  4NXB A;  1OJG A;  2PR6 A;  1WA9 A;  3IBR A;  4R38 A;  2PD7 A;  1N9N A;  4BBV A;  2B02 A;  2OOL A;  5DJU A;  4BBU A;  2OWH A;  3LIB A;  3FG8 A;  4MN6 A;  5F5Y A;  2L4R A;  3LID A;  5J4E A;  3H7W A;  4R70 A;  4EEU A;  2A24 A;  4GHI B;  4HP9 A;  2EA9 A;  3MFX A;  1S4R A;  4LLO B;  5G4Y A;  5HDS A;  1N9L A;  1S67 L;  1XJ2 A;  3E4P A;  4XT2 A;  5I5L A;  4HY8 A;  1OJ5 A;  4K08 A;  1ODV A;  1BYW A;  1EW0 A;  1V9Z A;  4GHI A;  4WUJ A;  1T1C A;  1T1A A;  2VV8 A;  2W27 A;  2ZBB A;  2D02 A;  3A0V A;  3NOT C;  1P97 A;  2VV7 A;  4I5S A;  4JGP A;  4M4X A;  1OTD A;  5F69 A;  1F9I A;  2HV1 A;  2QHK A;  4LRZ E;  3UMD A;  4WLA A;  3VE4 A;  5HWV A;  2VEA A;  5HWW A;  3NOP C;  3F1N A;  3NOU C;  4HP4 A;  3RTY A;  4HI4 A;  3PHY A;  1Y28 A;  2QWS A;  4I3J A;  3HJK A;  4I38 A;  4HHD A;  3UB6 A;  3NJA A;  3P7N A;  4NXE A;  3BY9 A;  1XFN A;  1D7E A;  2QKP A;  3IS2 A;  5J3W A;  2L1M A;  1DP6 A;  3F1O B;  5G4Z A;  2JN7 A;  3H82 B;  5J7E A;  4GS9 B;  1LT0 A;  4L9E A;  2BAS A;  4NXG A;  3IS2 B;  4EXO A;  4H6J A;  2V1B A;  1GSX A;  3UB8 A;  2KDK A;  4XT2 B;  2QJ7 A;  3MQO A;  3PYP A;  4E04 A;  2ZOH A;  5HDD A;  2KX6 A;  2PYP A;  4JGR A;  3MXQ A;  3H7W B;  4I3A A;  1TS6 A;  1UGU A;  2GJ3 A;  4KQD A;  5TBM A;  1XJ4 A;  4HOI A;  4I3I A;  3LYX A;  3OLO A;  2PD8 A;  1LL8 A;  1NWZ A;  2INW A;  2P7J A;  3F1O A;  4KUK A;  2PYR A;  3CLO A;  3F1P A;  5EFW A;  3RH8 B;  3UE6 A;  3GDI A;  5HWT A;  5F68 A;  1S66 L;  1OT9 A;  2YKF A;  4HH2 A;  5AVF A;  2PHY A;  4EER A;  2L0W A;  2V0U A;  1OTI A;  2YKH A;  1GSW A;  1S4S A;  1TS8 A;  1N9O A;  2A24 B;  4GW9 A;  2CMN A;  4WL9 A;  3KX0 X;  3HJI A;  1LSW A;  5KIZ A;  3LIC A;  2V9A A;  3CWF A;  3UB9 A;  3ZQ5 A;  3C2W A;  1TS7 A;  4DJ3 A;  4EQ1 A;  1X0O A;  2JHE A;  2VLG A;  4B9O A;  4LRY C;  1XJ3 A;  4EES A;  4I39 A;  4R6L A;  3K3D A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 3T1Q B;  4PKY G;  3QP2 A;  2O9C A;  4D60 A;  1XGJ A;  2WYX A;  3C7V A;  1ERO A;  1K57 A;  4OP5 A;  1WYC A;  2V8F A;  3IF6 A;  3MZF A;  1VM1 A;  2XR0 A;  4L9F A;  2Q9N A;  3CHW P;  3GTC A;  5GLC A;  2V0W A;  2V1A A;  2O9B A;  3EGD C;  5DFY A;  4EV4 A;  3S7N A;  1UWP X;  1YKD A;  3C8C A;  1SKF A;  4Y15 A;  2K7S A;  3E4Q A;  5DFX A;  5A93 A;  4S2O A;  1IFQ A;  4FH4 A;  2ZQC A;  2PR6 A;  3IBR A;  1BZA A;  5EVI C;  4MLL A;  3PTE A;  3LIB A;  3RFB A;  4R70 A;  4YIN A;  2KOI A;  1K55 C;  1PI4 A;  2PBY A;  2Y2Q A;  1JWV A;  1W5D A;  2VV8 A;  5E2G A;  2HDU A;  4PHT A;  3UMD A;  3VE4 A;  4CQH A;  4ARZ A;  4QU3 A;  2ZMA A;  1LI0 A;  5M19 A;  3UNW A;  1FCO A;  4I38 A;  4Q0I A;  1W63 Q;  1G5U A;  3LCE A;  4Y5F A;  4QB8 A;  1K25 A;  5HAI A;  3HUN A;  3T4Q A;  3PYP A;  3IHA A;  3MXQ A;  5AQ7 A;  2P04 A;  3S7P A;  3RH8 B;  5EVI A;  1W63 M;  5EOO A;  2UV0 E;  1TS7 A;  1PWC A;  4QHC A;  3A0S A;  2W0N A;  3A3E A;  4E6X A;  3H82 A;  2Y2H A;  5HZH A;  1TD5 A;  3G6O A;  1E25 A;  1M40 A;  2O0Y A;  4MDZ A;  4Q8I A;  1NYY A;  3AGF A;  3AGD A;  3IXH A;  4OOL A;  4K0X A;  3M6B A;  2I72 A;  5HX9 A;  4H6J B;  3F1P B;  2Y2M A;  1XXM A;  4FSF A;  4Y0U A;  4L9G A;  1DRM A;  4FOF A;  4E6W A;  3EWK A;  4JPM A;  1YAX A;  4H8R A;  1FIL A;  1NXY A;  5FI2 A;  3JVU A;  3OBF A;  1K54 A;  4PPR A;  4BBV A;  3CJM A;  4JF4 A;  5HW3 A;  4R1G A;  4LV2 A;  3Q1F A;  1K4E A;  3V5M A;  1IEL A;  1V9Z A;  2WGW B;  2VV7 A;  5F69 A;  5GHZ A;  1OTD A;  2WGV A;  4GDN A;  2ZQD A;  1XKZ A;  4FTX A;  3GSG A;  4OPY A;  4HHD A;  3NJA A;  3OCL A;  3BY9 A;  5FAS A;  3LR0 A;  1XGI A;  3WS5 A;  5FI7 A;  4WM9 A;  3GR2 A;  1ZHH B;  3UDI A;  4H6J A;  3PR6 A;  3PAG A;  2CC1 A;  1ESU A;  1XJ4 A;  3G2Z A;  5F1F A;  2PYR A;  1Y54 A;  3CLO A;  1BUE A;  4A5R A;  1GA9 A;  2RL3 A;  4D2O A;  1KGG A;  4BJP A;  1GHM A;  3T12 B;  4IVK A;  1FSW A;  3MS6 A;  4DRT A;  4F94 A;  2J9O A;  3DTE A;  4QD4 A;  1XJ3 A;  4EES A;  4R6L A;  2QPN A;  3VP4 A;  4YOF A;  4HBT A;  3S7O A;  2V20 A;  3HLG A;  3LI9 A;  3Q07 A;  2D01 A;  1DP8 A;  2WKQ A;  3CI6 A;  4C3Q A;  3PBN A;  1KGE A;  3MMH A;  4DXB A;  2W3E A;  4MN5 A;  5TJJ A;  2QYB A;  3WRT A;  3ZCZ A;  5EOE A;  5HAP A;  4DJ2 A;  2Q0O A;  2X02 A;  1TS0 A;  1UWN X;  3HCY A;  4WEJ A;  1IKG A;  1OTA A;  2WKR A;  4WN5 A;  3VOY A;  5TGF A;  3HUM A;  3SS5 A;  3BY8 A;  3UB5 P;  1T1B A;  1LL5 A;  1Z6F A;  3LI8 A;  2R78 A;  4ZRR A;  2GNX A;  4BQM A;  2LB5 A;  4QY6 A;  4E3O A;  1N9L A;  4HY8 A;  4G3W A;  1NY0 A;  1BLS A;  1ODV A;  1BYW A;  5CHM A;  4I5S A;  1F9I A;  4WBG A;  1YLP A;  4ZJ3 A;  3QP8 A;  3D4F A;  4KZ8 A;  3S7Q A;  3UB6 A;  1I2W A;  4G3V A;  5CEC A;  3VP0 A;  3W4Q A;  3HL9 A;  2BAS A;  4XUZ A;  4JGR A;  3H7W B;  5AQ9 A;  4HOI A;  3LEZ A;  2ZMF A;  4HES A;  1XX2 A;  4RYE A;  4HH2 A;  3KYQ A;  3W4O A;  1VEU A;  1YLT A;  3M2J A;  3TG9 A;  1ONG A;  3FYZ A;  3ITB A;  1K57 C;  5HPI A;  4JLF A;  4JF6 A;  4JXS A;  1M6K A;  2ZQ8 A;  1CJF A;  2Z6D A;  3V67 A;  2Y55 A;  4JXW A;  1GSV A;  1VB6 A;  1ES5 A;  4N1H A;  2EFX A;  5DJT A;  3V50 A;  2EX2 A;  5FAO A;  5AVE A;  5FQM A;  3OOV A;  3N6I A;  3SZT A;  3N4I A;  2PDR A;  5BOH A;  4R3B A;  1IEM A;  3T50 A;  2O9A A;  2OOL A;  5EM1 A;  1XA7 A;  3ZG8 B;  2L4R A;  1XJ2 A;  1K0K A;  4GHI A;  1T1C A;  2H10 A;  3D3O A;  2WKH A;  3S1Y A;  1H8Y A;  3NOP C;  3F1N A;  5EVE A;  5EVL A;  2JC7 A;  2ZL1 B;  4XT2 B;  3LO7 A;  1K55 A;  4IVI A;  5HDD A;  4MEZ A;  5FQI A;  5M18 A;  2KLI A;  2VX8 A;  5DTT A;  3OLO A;  2JKF A;  1NWZ A;  4R0Q A;  5EFW A;  4ME4 A;  2VGJ A;  1VET A;  5FAP A;  1ESI A;  3PBS A;  3IWQ A;  3E0Y A;  1L0F A;  1W8Y A;  3UB9 A;  4E3N A;  2Y2G A;  4X1M A;  3K3D A;  3K3C A;  1S6R A;  4EW7 A;  1L0G A;  3O87 A;  4N92 A;  3QNB A;  1K4F A;  1YLZ A;  3T4L A;  1SCW A;  3MQ0 A;  1K6R A;  4YWZ A;  3ZFZ A;  2DRW A;  3LY4 A;  3BWL A;  1N9B A;  2VV6 A;  3RJU A;  4OOY A;  4U3T A;  4FCF A;  5F83 A;  1ES3 A;  3FZC A;  3OPL A;  3IXD A;  1FCM A;  3SS3 A;  3VP3 A;  4Y3I A;  1H0M A;  4HJ4 A;  3FC7 A;  2NUT C;  4OPZ A;  5CEB A;  4GOG A;  2VK3 A;  5HAR A;  3VOZ A;  5E2F A;  3PAE A;  3G2Y A;  3UE1 A;  2JCH A;  2HP5 A;  3IF5 A;  4MNR A;  3T1X A;  5F1G A;  4OQH A;  3MFX A;  4B4Z A;  1YMX A;  3E4P A;  3VP2 A;  1L3L A;  4QPR A;  1EW0 A;  2W1R A;  4OVD A;  1JWZ A;  1P97 A;  1IYP A;  2XA7 M;  2ZQ7 A;  4EBP A;  5FSR A;  3GQZ A;  3Q7Z A;  4NXE A;  3ZDJ A;  1K54 C;  4IED A;  1YSP A;  1FOF A;  1MWR A;  3ZNY A;  3ZNT A;  5U47 A;  3DBA A;  4EQI A;  4CLC A;  1RGY A;  3NCK A;  2WGI A;  2XA7 S;  2RCX A;  3BEC A;  3M2K A;  5CED A;  4DJ3 A;  3VMA A;  4ETZ A;  3H9W A;  2ZQA A;  4LCL A;  3ZG5 A;  3WWX A;  2J80 A;  4KZB A;  5HSQ A;  5TR7 A;  4EEP A;  2EX9 A;  4GD6 A;  4L0L A;  4UA6 A;  1QME A;  1K6S A;  2EX8 A;  2QJ5 A;  5EVI D;  4GS9 A;  4OH0 A;  2ZLY A;  3O86 A;  4YNR A;  4Z1W A;  3FWL A;  3E4O A;  4EWF A;  5EM0 A;  5CRF A;  2VZW A;  4P6Z M;  4LPZ A;  4LV3 A;  3V3R A;  1WE4 A;  4Q0H A;  3HRE A;  2X01 A;  1G68 A;  1XFQ A;  4PMA A;  3IWO A;  1PWD A;  2BTF P;  2WGW A;  3QP6 A;  1LL9 A;  1NZO A;  3FKW A;  5FQ9 A;  2G2W A;  4UQI S;  3ZYT A;  3TJZ C;  5FEF A;  2EXB A;  4DE1 A;  4DE2 A;  3SOI A;  5DJU A;  2PU2 A;  1RGZ A;  4B4X A;  5E43 A;  2V2F F;  2VA0 A;  4GHI B;  4S2L A;  4E3M A;  3ISG A;  1IYS A;  5I5L A;  4RVA A;  3RTY A;  3A0V A;  3HLD A;  1E4D A;  2B18 A;  3HLE A;  2OSU A;  3NI9 A;  5A91 A;  2DCF A;  1YQS A;  3C5A A;  3F1O B;  1QMF A;  3BFG A;  1PW1 A;  1PIO A;  2ZMV A;  3CPT B;  2WK0 A;  3NDE A;  3EEA A;  4KZ6 A;  2W3G A;  2HZ5 A;  2PAV P;  1MKM A;  1NRF A;  4GZB A;  4OKP A;  2GJ3 A;  5F68 A;  3UPO A;  4XXR A;  3F1O A;  3GMW A;  3LR3 A;  1GSW A;  3W4P A;  3M6H A;  4WL9 A;  2ZC4 B;  3HJI A;  3CWF A;  2W1T A;  3O5Y A;  1YLJ A;  3VSK A;  2A3U A;  4R4R A;  1IYQ A;  4IHQ A;  3B3X A;  1OTB A;  4S2I A;  1PZO A;  3BW6 A;  3W2Z A;  4NXF A;  5J7E A;  1LI9 A;  4MN7 A;  2E8I A;  3Q7V B;  5EEC A;  2HP9 A;  2OV5 A;  3B33 A;  5F6A A;  1ERQ A;  3GVB A;  5FAQ A;  5F82 A;  3UB7 A;  2IWD A;  3DW0 A;  3TW8 A;  2P9V A;  1BLH A;  3GEC A;  5CHJ A;  4LFU A;  2W1T B;  2ZL1 A;  5HD3 A;  5L8M A;  4Y0T A;  5JYO A;  4ARZ B;  3PBO A;  2VGL S;  4GNU A;  1KVM A;  2BLS A;  4C75 A;  5KSC A;  2Y4A A;  1RCJ A;  3OC2 A;  1BLC A;  1HLU P;  1T18 A;  3G34 A;  5DKL A;  5CHU A;  4R38 A;  4OP8 A;  4QY5 A;  4BBU A;  3FG8 A;  4MN6 A;  3LID A;  2A24 A;  3HVF A;  4OPR A;  4BL2 A;  3L9K A;  4K0W A;  5AQB A;  4CLC D;  3UPN A;  1K56 A;  4K08 A;  3CIT A;  4LRZ E;  2XLN A;  2QWS A;  3QP4 A;  1DY6 A;  1ONH A;  3KSH A;  5EE8 A;  1CK3 A;  5L2F A;  3MKE A;  2QJ7 A;  4E04 A;  4LV0 A;  4PM7 A;  1UGU A;  2PD8 A;  3OPP A;  1SZV A;  4K91 A;  4BL3 A;  3GDI A;  2NUP C;  3T4T A;  3E2K A;  1JWP A;  1OTI A;  4JKT A;  2EWV A;  5JYP A;  4I39 A;  3T4S A;  4II7 A;  4OLD A;  3T4K A;  4OLG A;  3NUL A;  1H5X A;  3UE0 A;  3WS0 A;  4E3I A;  1OTE A;  4PKY A;  2ZM0 A;  2H0Y A;  2WAE A;  2W3D A;  5CTN A;  2ZQ9 A;  2DMW A;  2Y2L A;  2Y79 A;  2PR5 A;  4HEF A;  1S0W A;  2XD5 A;  4O0P A;  4DE3 A;  5CXW A;  1TEM A;  4GKU A;  4DE0 A;  2AVX A;  1FSY A;  3NDG A;  3KSF A;  4BWI A;  4OQG A;  4EEU A;  1S4R A;  5HDS A;  1ACF A;  5HL1 A;  2HJ9 C;  3VOL A;  4JGP A;  4N1X A;  4R4S A;  1WYB A;  1YPR A;  2HV1 A;  3Q7V A;  4RX2 A;  1L2S A;  3IT9 A;  2VEA A;  2Y2P A;  5L10 A;  4Q0J A;  2P08 A;  4I3J A;  3VV4 A;  2QKP A;  3EQU A;  5A90 A;  2A2L A;  1ZKJ A;  2WUQ A;  4L9E A;  3E98 A;  1GSX A;  3HLW A;  5CTM A;  4KG6 A;  3N8L A;  3O88 A;  5A92 A;  3A3F A;  4X25 A;  4AFI A;  5TBM A;  3PBT A;  3I7J A;  3UDF A;  3KSG A;  3F1P A;  2G7U A;  3HLB A;  3B42 A;  2PHY A;  1ERM A;  5KIZ A;  1XA1 A;  2W3H A;  3P01 A;  1LSW A;  3LIC A;  1K38 A;  3ZQ5 A;  2HF6 A;  4LV1 A;  1YM1 A;  4WZ5 A;  5CGS A;  2H5S A;  2JKG A;  1XJ6 A;  1K56 D;  2HDQ A;  2H28 A;  4ZAM A;  1H8Z A;  4X55 A;  1MC0 A;  3D72 A;  4OON A;  2C6W B;  5E2H A;  4KQR A;  1YSQ A;  5IS1 A;  5FQJ A;  3HLF A;  2ZOI A;  4EU0 A;  3MSH A;  5A8B A;  4WEL A;  5DKK A;  4QJG A;  2XSS A;  2ACG A;  2V1Z A;  3MR0 A;  2IWB A;  5GL9 A;  1LSV A;  3MF0 A;  1IOU A;  3MXS A;  1V9Y A;  5FDH A;  1TDL A;  2J8Y A;  4UEY A;  3UO9 A;  4NXB A;  3WRZ A;  3BM6 A;  1N9N A;  1NJ4 A;  3A3J A;  4LLO B;  5G4Y A;  2PBD P;  3VSL A;  1OJ5 A;  3JYI A;  1D1J A;  3VFF A;  4S2J A;  5HWW A;  3JPU A;  4GLQ A;  5GLD A;  3BEB A;  3UY6 A;  2WKI A;  4KQO A;  3H82 B;  1HVB A;  4RX3 A;  2V1B A;  2GDN A;  1G6O A;  2EX6 A;  1FCN A;  2EWW A;  2KX6 A;  5EPH A;  1SKO B;  4LEN A;  4HBU A;  3K2N A;  4KUK A;  1CI9 A;  5AVF A;  5EVI B;  1N9O A;  4Y2F A;  1NRJ A;  3C2W A;  2K31 A;  2OLU A;  3MJQ A;  2PRF A;  1MWT A;  4HNB A;  2IA2 A;  4NEE D;  5HDC A;  1E3U A;  4LRX C;  3VE3 A;  2DNS A;  1H3Q A;  1BSG A;  3IF6 C;  4CLC C;  3C4P A;  5HFO A;  4GCZ A;  5CGX A;  1IKI A;  1BUL A;  4LRY C;  4LCM A;  3G4P A;  4X53 A;  3LIE A;  3EOI A;  4EUZ A;  3N8R A;  2VKS A;  2JE5 A;  2ZM8 A;  4OPQ A;  4B93 A;  1CF0 A;  3GRJ A;  3BFF A;  4JXV A;  2XFS A;  4ZDX A;  1OJG A;  4O8G A;  1STZ A;  4BD1 A;  5IHV A;  4OQI A;  2M7U A;  4CLC B;  1T1A A;  3ULF A;  4X56 A;  3PBQ A;  2VJW A;  3SH8 A;  2JBF A;  4HI4 A;  4ESP A;  2XQZ A;  1D7E A;  3IX8 A;  2L1M A;  4ETX A;  4NXG A;  1KGF A;  3IS2 B;  5KSH A;  4DDS A;  3AGE A;  4KQD A;  4WMC D;  1O07 A;  1HD8 A;  2Y2I A;  4I3I A;  4FD8 A;  3LYX A;  1LL8 A;  3SS4 A;  1S66 L;  1OT9 A;  2Y8H A;  4Y17 A;  3MKF A;  2VLG A;  2Y91 A;  1CEF A;  3BLM A;  5AJG A;  3IXB A;  1KOU A;  1GHP A;  4U0T A;  1ZTU A;  4Y13 A;  3BFE A;  3TOI A;  3R4K A;  4KG2 A;  4PAU A;  4DF6 A;  2ZM2 A;  4HJ6 A;  2K2N A;  2XH9 A;  2ZC6 B;  3CPT A;  1FR6 A;  5EUA A;  2HJE A;  1MWS A;  5CX7 A;  5GHY A;  3LUQ A;  1PW8 A;  2H0T A;  2UWX A;  4PM8 A;  5FQQ A;  4BLM A;  1SDN A;  5HD5 A;  4WMC A;  5DF8 A;  3TE8 A;  3A3D A;  2JKT I;  2WKE A;  5E2E A;  3FPW A;  4KZA A;  4F3L B;  3OCN A;  1N4O A;  4HJ3 A;  2OWJ A;  3P09 A;  4M3K A;  2WKP A;  4EBL A;  2GX5 A;  2Y2N A;  5K5B A;  2OWH A;  5IT5 A;  2EA9 A;  1O7E A;  2E8J A;  1PFL A;  3C30 A;  4M4X A;  3IBJ A;  4IBR A;  3U2A A;  3HJK A;  1YMS A;  5KMW A;  2XRO A;  4GS9 B;  5DF7 A;  4N9K A;  5FL3 A;  3IX4 A;  1MKI A;  3UB8 A;  2KDK A;  4IBX A;  5M1A A;  3IQA A;  3R7W A;  1I2S A;  4R23 A;  1PNE A;  1TS8 A;  4MCW A;  4GW9 A;  1A0K A;  4NG2 A;  3EQV A;  2Y59 A;  3RXX A;  5MC7 A;  4KUO A;  4JGO A;  1IYO A;  4KG5 A;  2Z6C A;  2ZC3 B;  1GCE A;  4ID4 A;  4JGQ A;  5L07 A;  3UN7 A;  4HQA A;  4LGW A;  5TBM B;  4S2M A;  3CMZ A;  3DTM A;  2XD1 A;  4ZJ2 A;  4WZ5 C;  1F98 A;  1FR1 A;  1CI8 A;  1P0Z A;  2G2U A;  2JKR I;  3BQA A;  2J3T D;  2B95 A;  5G18 A;  4UA7 A;  1P9R A;  4KQQ A;  1MZU A;  4NK3 A;  4WYY A;  3DWK A;  4CLC E;  2XDM A;  4GDB A;  3UME A;  4ZJ1 A;  1DJA A;  4NET A;  5IU1 A;  4PM6 A;  4UAA A;  1MY8 A;  2PD7 A;  4EUV A;  1BTL A;  4JF5 A;  3MBZ A;  3UPP A;  5F5Y A;  4HP9 A;  4O01 A;  4MMN A;  3LR5 A;  4KZ3 A;  5FI6 A;  1KDW A;  2HGV A;  4GD8 A;  1U60 A;  5L09 A;  3MXR A;  1SHV A;  5FEG A;  3HLC A;  4GB7 A;  3P7N A;  1FIK A;  1XFN A;  1VHM A;  2WAD A;  2XK1 A;  3IS2 A;  2ZJ9 A;  3LY3 A;  2C5W B;  2WZX A;  1KDS A;  1PYY A;  2ZC5 B;  3NY4 A;  3PXP A;  3T1R A;  2XEP A;  3IH8 A;  3BQ8 A;  1PRQ A;  3W8K A;  4EER A;  3QP5 A;  2L0W A;  3G30 A;  3HUO A;  1AWI A;  3NEC A;  2JKR M;  1Y4O A;  3FV7 A;  4JBF A;  4CPK A;  3NIA A;  4BBT A;  3LIA A;  3S22 A;  2Z2L B;  3G35 A;  3OPR A;  4WEK A;  4KZ9 A;  1L0E A;  1HZO A;  1LHY A;  3DTK A;  4B88 A;  1ZG4 A;  3BJN A;  5EV0 A;  3F1N B;  4S2N C;  3BRM A;  1PZP A;  2B5R A;  2IWC A;  3CAX A;  3SW1 A;  1EWZ A;  2P74 A;  3BFC A;  1MBL A;  4MBF A;  4Y0O A;  4Y7P A;  1LSX A;  3UE6 A;  3E2L A;  1S1Y A;  5AQA A;  3ZG7 B;  1NYM A;  1XP4 A;  2B02 A;  3SH9 A;  1I5Q A;  4KZ5 A;  1OME A;  2FFF B;  2OAQ 1;  4R3J A;  3IX3 A;  1JVJ A;  3N8S A;  4WUJ A;  3NOT C;  2D02 A;  2HPB A;  2QMI A;  3JVV A;  5GLB A;  3CZD A;  5GHX A;  3KYE A;  1OPX A;  3G31 A;  4KZ4 A;  5HWV A;  3GV9 A;  2J3W A;  1Y28 A;  3WS1 A;  3DWZ A;  1PI5 A;  4P6B A;  1NZU A;  4S2N A;  1KE4 A;  3BFD A;  3L7H A;  2QZ6 A;  1LT0 A;  2R9W A;  2A49 A;  3V3S A;  5HL6 A;  4GN2 A;  1RP5 A;  1LLB A;  1SDE A;  2EXA A;  1F5M A;  3KSI A;  3CUE A;  2FZ0 A;  1ALQ A;  2WZZ A;  2OAP 1;  4X69 A;  1VEU B;  4U0X A;  3V39 A;  2J9P A;  3OPH A;  3S4X A;  1CQA A;  1ES2 A;  5I94 A;  1MWU A;  4RQ9 A;  1NLZ A;  5GLA A;  4Z9Q A;  1DP9 A;  3C38 A;  2XGN A;  3NHQ A;  1L0D A;  4CJN A;  4DMZ A;  1BLP A;  1W79 A;  3A0R A;  3EEH A;  1EI5 A;  1MXO A;  2Y2J A;  3IHB A;  3LIF A;  2Y2K A;  4G3K A;  4S2P A;  3RXW A;  3ITA A;  4OQ0 A;  3CUE C;  3T4O A;  3LGO A;  4E3L A;  1HTZ A;  2J3T C;  2W3F A;  1T19 A;  1S1Z A;  1JNU A;  4EET B;  4KEN B;  1GA0 A;  4C6Y A;  5CER A;  4UHU A;  3IF6 B;  5J4E A;  5LBR A;  3TSG A;  1C3B A;  1S67 L;  2PU4 A;  2XRN A;  5DVA A;  4O7D A;  1VQQ A;  1YLY A;  4WLA A;  4X1L A;  3NOU C;  4DN0 A;  1Q2P A;  4FUW A;  3C7U A;  2EFU A;  4UA9 A;  4BMW A;  3MZD A;  4IJG A;  4X68 A;  3WS4 A;  4EXO A;  1JTD A;  5KZH A;  1CEG A;  3MQO A;  2ZOH A;  3B47 A;  3QHY A;  2P7J A;  2INW A;  1JTG A;  2YKF A;  2ZD8 A;  2V8C A;  3LR4 A;  4MBH A;  5FAT A;  1GHI A;  5TFQ A;  3IH9 A;  1BT5 A;  2V9A A;  2X71 A;  1X0O A;  1Z09 A;  2R9X A;  3QNC A;  1OT6 A;  5C5K A;  3ZG0 A;  3ZHH A;  1TDG A;  1G6A A;  4PM5 A;  1ES4 A;  4BEN A;  2FH5 A;  2PT7 A;  5HPF A;  1SKO A;  3C4O A;  3KYZ A;  1TF1 A;  4XUX A;  4NKP A;  2OLV A;  4E3K A;  4N9L A;  3PBR A;  3U4L P;  3LFV A;  2WAF A;  2M1C A;  1D06 A;  3QP1 A;  4R3A A;  3KO6 A;  2I9V A;  3TRC A;  1J9M A;  2Y2O A;  3MZE A;  5J8X A;  3DTI A;  3A3I A;  4FH2 A;  2FFY A;  1E3U D;  3ZVT A;  4HH3 A;  1W8Q A;  1VET B;  3UE3 A;  1WA9 A;  4IUK A;  5DF9 A;  1W7F A;  1DJC A;  3NC8 A;  3LEQ A;  4XT2 A;  3UDX A;  2MJ6 A;  5CGW A;  2ZBB A;  4GJ4 A;  2W27 A;  3P98 A;  4IUH A;  4RA7 A;  2GZA A;  4HP4 A;  4DKI A;  1J3W A;  3Q82 A;  2BG1 A;  2Z2M B;  1DP6 A;  2Q9M A;  3SH7 A;  4P87 A;  3OZH A;  2ZC7 A;  3IWI A;  3FPV A;  4I3A A;  3DAV A;  5HWT A;  1ZG6 A;  2V0U A;  2YKH A;  3T1S A;  2A24 B;  3KX0 X;  1NLY A;  1YLW A;  3G32 A;  4YFM A;  3ZG9 B;  1KE3 A;  5DTK A;  3VP1 A;  1DJB A;  4ZBE A;  4KZ7 A;  3ZVW A;  2LB9 A;  3MQQ A;  4EBN A;  4DDY A;  3MFD A;  1G28 A;  2P9V B;  2VGK A;  1KVL A;  3R7W B;  4WZ4 A;  2HDR A;  1H8M A;  3IXG A;  4WF0 A;  4HIA A;  3CG5 A;  3BYD A;  3ICY A;  2J7V A;  3N7W A;  5DTS A;  3O3V A;  4S2K A;  2HDS A;  5FA7 A;  1MPL A;  4PM9 A;  3ZGA B;  4F3L A;  4P6Z S;  4UQI M;  4JXG A;  1P9W A;  1PWG A;  5FDS A;  1KE0 A;  3H7W A;  4P0M A;  1ZC2 A;  2HP6 A;  3HBR A;  4X6T A;  1YT4 A;  4B9O A;  4MBK A;  2QHK A;  1Q2Q A;  4DXC A;  3WS2 A;  2XF3 A;  3PHY A;  1F2K A;  5J3W A;  5G4Z A;  1TVF A;  2JN7 A;  2JKT M;  1AXB A;  3EGX C;  2XFT A;  2VGL M;  3FKV A;  4P85 A;  3T4J A;  2PYP A;  5HAQ A;  2O99 A;  3VFH A;  1TS6 A;  3BLS A;  3D9Y A;  1XPB A;  4OOM A;  3NBL A;  5FQK A;  4ZTK A;  1S4S A;  3Q81 A;  2CMN A;  2M7V A;  1FQG A;  4BD0 A;  4EQ1 A;  2JHE A;  4E3J A;  5D3O A;  4QWO A; 
#chains in the Genus database with same CATH homology
 1XJ6 A;  4PKY G;  2JKR M;  3K3C A;  2H28 A;  4EW7 A;  2O9C A;  4BBT A;  1MC0 A;  3LIA A;  3D72 A;  3T4L A;  3MQ0 A;  4YWZ A;  1YSQ A;  5IS1 A;  4WEK A;  3BWL A;  2ZOI A;  4EU0 A;  2VV6 A;  3BJN A;  3F1N B;  4L9F A;  5A8B A;  4Y3I A;  4WEL A;  5DKK A;  3CAX A;  3SW1 A;  2XSS A;  3MR0 A;  2V0W A;  2V1A A;  2O9B A;  3EGD C;  3FC7 A;  4HJ4 A;  5DFY A;  3S7N A;  1UWP X;  1LSV A;  1YKD A;  2NUT C;  3C8C A;  3MF0 A;  2K7S A;  3E4Q A;  1LSX A;  3UE6 A;  5DFX A;  1IOU A;  1S1Y A;  1V9Y A;  1IFQ A;  4UEY A;  4NXB A;  2PR6 A;  3IBR A;  1N9N A;  2B02 A;  3LIB A;  3RFB A;  4R70 A;  2KOI A;  4LLO B;  3MFX A;  2OAQ 1;  5G4Y A;  3E4P A;  1OJ5 A;  4QPR A;  1EW0 A;  4WUJ A;  2VV8 A;  3NOT C;  2W1R A;  2D02 A;  4PHT A;  1P97 A;  2XA7 M;  3JVV A;  3UMD A;  3VE4 A;  1OPX A;  4CQH A;  4ARZ A;  5HWV A;  5HWW A;  2J3W A;  4GLQ A;  1Y28 A;  4I38 A;  4Q0I A;  4NXE A;  1W63 Q;  1YSP A;  4KQO A;  4Y5F A;  3H82 B;  1LT0 A;  2V1B A;  1G6O A;  3DBA A;  3T4Q A;  2EWW A;  5HL6 A;  3PYP A;  2KX6 A;  4CLC A;  3MXQ A;  2P04 A;  1F5M A;  3K2N A;  4KUK A;  3S7P A;  2XA7 S;  3RH8 B;  3KSI A;  3CUE A;  1W63 M;  2FZ0 A;  5AVF A;  2OAP 1;  1N9O A;  4Y2F A;  1NRJ A;  4DJ3 A;  3C2W A;  1TS7 A;  2K31 A;  4ETZ A;  3MJQ A;  3A0S A;  4HNB A;  3H9W A;  2IA2 A;  2W0N A;  4NEE D;  3H82 A;  5HDC A;  2J80 A;  5HZH A;  4RQ9 A;  1NLZ A;  1TD5 A;  5HSQ A;  4LRX C;  3VE3 A;  4EEP A;  1H3Q A;  1DP9 A;  3C38 A;  3NHQ A;  4L0L A;  3G6O A;  2QJ5 A;  4CLC C;  4DMZ A;  4GS9 A;  2O0Y A;  3A0R A;  4MDZ A;  4YNR A;  4Z1W A;  3EEH A;  3E4O A;  4OOL A;  2VZW A;  4GCZ A;  4P6Z M;  4LPZ A;  4H6J B;  3LIF A;  3F1P B;  4Q0H A;  1XFQ A;  4FSF A;  4G3K A;  3CUE C;  3T4O A;  4LRY C;  4L9G A;  1DRM A;  4FOF A;  3EWK A;  2J3T C;  2W3F A;  3LIE A;  3EOI A;  2VKS A;  1YAX A;  1T19 A;  1S1Z A;  1JNU A;  4UQI S;  4B93 A;  3ZYT A;  3TJZ C;  4EET B;  3JVU A;  1OJG A;  3OBF A;  1STZ A;  4O8G A;  4BBV A;  5DJU A;  5J4E A;  5LBR A;  2VA0 A;  4GHI B;  1S67 L;  5I5L A;  2XRN A;  2M7U A;  4CLC B;  1V9Z A;  1T1A A;  3RTY A;  3A0V A;  2VV7 A;  5F69 A;  3ULF A;  1OTD A;  2B18 A;  4WLA A;  3PBQ A;  2VJW A;  3NOU C;  4DN0 A;  4HI4 A;  4HHD A;  3NJA A;  3OCL A;  3BY9 A;  1D7E A;  3LR0 A;  2L1M A;  3F1O B;  4BMW A;  4ETX A;  4IJG A;  1ZHH B;  2ZMV A;  4NXG A;  3IS2 B;  4EXO A;  4H6J A;  5KSH A;  3PR6 A;  3EEA A;  2W3G A;  3MQO A;  2ZOH A;  1MKM A;  4KQD A;  2GJ3 A;  3B47 A;  1XJ4 A;  4I3I A;  5F68 A;  3LYX A;  1LL8 A;  2P7J A;  2INW A;  3F1O A;  2PYR A;  3CLO A;  1S66 L;  1OT9 A;  2YKF A;  3LR3 A;  2Y8H A;  3LR4 A;  4BJP A;  1GSW A;  4WL9 A;  3HJI A;  2V9A A;  3CWF A;  2W1T A;  3O5Y A;  1X0O A;  2VLG A;  4EES A;  1XJ3 A;  4R6L A;  5AJG A;  4IHQ A;  1OT6 A;  5C5K A;  1KOU A;  1OTB A;  4YOF A;  3S7O A;  1ZTU A;  3R4K A;  3BW6 A;  4PAU A;  3W2Z A;  4NXF A;  4HJ6 A;  3LI9 A;  5J7E A;  4MN7 A;  2D01 A;  1DP8 A;  2K2N A;  2WKQ A;  3CI6 A;  2FH5 A;  2PT7 A;  3B33 A;  5F6A A;  5HPF A;  3PBN A;  2HJE A;  3KYZ A;  5CX7 A;  1TF1 A;  4NKP A;  3MMH A;  3UB7 A;  2W3E A;  3PBR A;  4MN5 A;  5TJJ A;  3TW8 A;  3LUQ A;  3GEC A;  3LFV A;  2QYB A;  2W1T B;  5HD5 A;  2M1C A;  1D06 A;  4R3A A;  3KO6 A;  5HD3 A;  5L8M A;  4DJ2 A;  3TE8 A;  3PBO A;  4ARZ B;  2I9V A;  2JKT I;  3TRC A;  2VGL S;  3FPW A;  1TS0 A;  1UWN X;  3HCY A;  4F3L B;  4WEJ A;  1OTA A;  2WKR A;  4WN5 A;  3OCN A;  3BY8 A;  3OC2 A;  4HJ3 A;  1T1B A;  1T18 A;  5DKL A;  2OWJ A;  2WKP A;  3LI8 A;  4HH3 A;  2R78 A;  4ZRR A;  1WA9 A;  4IUK A;  4R38 A;  3UE3 A;  2GNX A;  2GX5 A;  5DF9 A;  5K5B A;  4BBU A;  2OWH A;  3FG8 A;  4MN6 A;  2LB5 A;  3LID A;  5IT5 A;  2A24 A;  2EA9 A;  1N9L A;  4XT2 A;  4HY8 A;  2MJ6 A;  4G3W A;  4CLC D;  4K08 A;  1ODV A;  1BYW A;  2ZBB A;  4GJ4 A;  2W27 A;  4IUH A;  3C30 A;  4M4X A;  3CIT A;  4I5S A;  3IBJ A;  1F9I A;  4LRZ E;  2GZA A;  4HP4 A;  2QWS A;  3S7Q A;  3HJK A;  3U2A A;  3UB6 A;  4G3V A;  2XRO A;  1DP6 A;  3KSH A;  4GS9 B;  2BAS A;  5FL3 A;  3UB8 A;  2KDK A;  2QJ7 A;  4E04 A;  3FPV A;  4JGR A;  3H7W B;  4I3A A;  1UGU A;  4HOI A;  3R7W A;  2PD8 A;  2ZMF A;  3GDI A;  5HWT A;  4HH2 A;  2NUP C;  3KYQ A;  3T4T A;  2V0U A;  1OTI A;  2YKH A;  1TS8 A;  4MCW A;  2A24 B;  4GW9 A;  2EWV A;  3KX0 X;  1NLY A;  3EQV A;  4I39 A;  3T4S A;  5MC7 A;  4KUO A;  4II7 A;  4JGO A;  3T4K A;  5HPI A;  2Z6C A;  2LB9 A;  3MQQ A;  4JGQ A;  4HQA A;  2Z6D A;  5TBM B;  3V67 A;  1OTE A;  4PKY A;  1GSV A;  1G28 A;  1VB6 A;  1F98 A;  1P0Z A;  2W3D A;  5DJT A;  3R7W B;  1H8M A;  2JKR I;  2DMW A;  3BQA A;  4WF0 A;  2J3T D;  4HIA A;  5AVE A;  2Y79 A;  3ICY A;  2PR5 A;  3OOV A;  1P9R A;  2PDR A;  1MZU A;  4O0P A;  4CLC E;  3UME A;  3T50 A;  4F3L A;  4P6Z S;  4UQI M;  5IU1 A;  2O9A A;  2PD7 A;  2OOL A;  4EUV A;  3KSF A;  4BWI A;  1P9W A;  5F5Y A;  2L4R A;  3H7W A;  4EEU A;  4HP9 A;  1S4R A;  5HDS A;  4O01 A;  1XJ2 A;  3LR5 A;  4MMN A;  2HJ9 C;  3VOL A;  2HGV A;  4GHI A;  1T1C A;  4B9O A;  4JGP A;  3D3O A;  2HV1 A;  2QHK A;  2VEA A;  3NOP C;  3F1N A;  4Q0J A;  2P08 A;  3PHY A;  4I3J A;  3P7N A;  1XFN A;  3VV4 A;  1VHM A;  2QKP A;  3EQU A;  3IS2 A;  5J3W A;  5G4Z A;  2JN7 A;  2JKT M;  2A2L A;  4L9E A;  3E98 A;  3EGX C;  1GSX A;  2VGL M;  4XT2 B;  3T4J A;  5HDD A;  2PYP A;  2O99 A;  1TS6 A;  2KLI A;  2VX8 A;  4AFI A;  3PBT A;  5TBM A;  3OLO A;  1NWZ A;  5EFW A;  3KSG A;  3PXP A;  3F1P A;  2G7U A;  4OOM A;  4ME4 A;  3B42 A;  3BQ8 A;  2PHY A;  4EER A;  2L0W A;  3PBS A;  1S4S A;  3E0Y A;  5KIZ A;  3P01 A;  2CMN A;  2W3H A;  1LSW A;  3LIC A;  3ZQ5 A;  2M7V A;  2HF6 A;  3UB9 A;  4EQ1 A;  2JHE A;  3K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...