5AVEA

The ligand binding domain of mlp37 with serine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
b'SVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRSTLIHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 82
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5aveA02
1OT6A 4NXEA 3EWKA 2PYRA 2WKQA 1UGUA 4JGOA 5DKKA 4LRXC 5HSQA 5DJUA 4HQAA 2VV7A 4MN5A 4R6LA 2VV8A 3F1NA 2A24B 2ZOIA 3MQOA 5HDCA 2CMNA 3UB9A 2PR6A 4HI4A 5F68A 3IBRA 3LIAA 4M4XA 2PDRA 2EA9A 4HP9A 4HY8A 5HDSA 1TS7A 4MN6A 3RH8B 5DKLA 2PR5A 4HIAA 4EEPA 3MFXA 4I39A 3F1OB 3H7WB 3VOLA 3CAXA 3LI9A 2QJ5A 3MXQA 3LI8A 4L9EA 5HD5A 4NXGA 1LT0A 3F1PA 3UMEA 2Z6CA 1V9YA 3D72A 2L4RA 3CLOA 2I9VA 3KX0X 4HOIA 1G28A 3EEHA 3UB8A 2R78A 3ULFA 4B9OA 2M1CA 3NOPC 3H82B 4EXOA 3MQQA 4YWZA 3HJKA 1DP8A 3UE6A 4LRYC 4HHDA 1N9OA 5IS1A 1UWPX 5I5LA 1LL8A 3LIDA 3LICA 2V0WA 1LSXA 1LSVA 4GHIB 3C2WA 1OTEA 4RQ9A 1T19A 3IS2A 5F69A 3UB7A 3NOTC 3HJIA 1EW0A 5EFWA 1S66L 1OJ5A 4H6JA 2VEAA 4GCZA 2KDKA 4K08A 1JNUA 4KQDA 1S1ZA 5J7EA 4DJ3A 4NXBA 3BWLA 3SW1A 4BBVA 1F9IA 3C8CA 1P97A 1S4RA 3UB6A 3GECA 1OTDA 3ZQ5A 2A24A 2QWSA 1MZUA 4I3AA 2QHKA 2OWHA 4GS9B 2D02A 2YKHA 2B02A 4XT2B 2H28A 5A8BA 4R3AA 4DJ2A 4EEUA 2V1BA 1TS6A 2WKRA 3LIBA 2K7SA 3BY9A 2OOLA 3FC7A 3PHYA 2ZBBA 1OTBA 4LRZE 2ZOHA 2J80A 4E04A 5HWTA 1DP6A 3K3CA 2WKPA 3F1NB 2PYPA 4HJ6A 4F3LA 2L0WA 1D7EA 3LIFA 3BY8A 1DP9A 1S1YA 3G6OA 4KUKA 2JHEA 2Z6DA 5G4ZA 2HV1A 5HDDA 2QKPA 1S67L 4R70A 1OT9A 3F1PB 4KUOA 1GSXA 4WLAA 5TBMB 3A0VA 4L9FA 4WN5A 3VE4A 1T1AA 4I3JA 1TS8A 1OTAA 3GDIA 4EW7A 3LYXA 5J3WA 4EERA 4JGPA 3P7NA 3E4OA 3K3DA 3OLOA 1OJGA 2PD8A 4NXFA 2P7JA 1BYWA 3ICYA 3LUQA 4JGQA 2W0NA 5HWVA 4BBUA 5KIZA 4EETB 1S4SA 2INWA 4GS9A 4XT2A 3RTYA 2L1MA 3NJAA 2BASA 4H6JB 1D06A 1KOUA 1XFNA 2GJ3A 4I38A 5F6AA 1DRMA 1V9ZA 4EQ1A 3MJQA 1N9NA 3F1OA 3H7WA 4GW9A 5HWWA 5AVEA 2QJ7A 1XJ4A 2VV6A 4HH2A 2KX6A 2OWJA 2V9AA 4HP4A 1F98A 4HH3A 4I3IA 2V1AA 3NHQA 2D01A 2PD7A 4WL9A 1LSWA 1VB6A 2PHYA 4LPZA 4I5SA 3PYPA 4HNBA 2YKFA 1XFQA 5J4EA 3NOUC 3H82A 5G4YA 1WA9A 1TS0A 1XJ2A 4EESA 1P0ZA 4R38A 5HZHA 5TBMA 4F3LB 3E4QA 4GHIA 5F5YA 1N9LA 1T18A 1NWZA 3CWFA 4BBTA 3B33A 4HJ4A 4JGRA 1GSWA 4WF0A 1GSVA 3A0RA 5DJTA 5HD3A 4WUJA 2JN7A 1T1BA 2VLGA 1XJ6A 4HJ3A 3MR0A 5AVFA 2V0UA 3H9WA 4L9GA 4LLOB 3UMDA 4PKYA 2W27A 4PKYG 3T50A 1XJ3A 3LIEA 3VE3A 1UWNX 3IS2B 1X0OA 5IU1A 3A0SA 3FG8A 3E4PA 1OTIA 1ODVA 1T1CA 1Y28A
chains in the Genus database with same CATH superfamily
4E3IA 4YINA 2EFUA 3QP8A 5JYOA 3PAGA 3O3VA 2PYRA 4KZAA 2C6WB 2E8IA 4GKUA 4O7DA 2Y59A 2W1RA 3UE3A 1KE0A 3HLCA 4X6TA 3LR0A 2PT7A 4LENA 1FCOA 3TSGA 2Q9NA 4DE1A 4E3NA 2WGWA 3WRZA 2V1ZA 3HUOA 2VV8A 4E3OA 5F83A 3K2NA 3MBZA 5HDCA 3UB9A 5F68A 4OH0A 3IBRA 1N4OA 5HPFA 4M4XA 2PDRA 5D3OA 2EA9A 4P87A 4WEKA 5HDSA 1TS7A 3IWOA 1FILA 4X55A 3BEBA 3R4KA 4MN7A 1A0KA 3OPPA 4KG2A 4E3JA 4EBLA 2G2UA 1NYMA 5AQ9A 3VOLA 3CAXA 1SKFA 2QJ5A 3GTCA 1K54A 4ZRRA 2ZC5B 3MZFA 3F1PA 3UMEA 2B95A 3RJUA 3HLDA 4ETZA 1YSQA 3CLOA 1D1JA 3Q7VA 3KX0X 3VOYA 5CHJA 1ZTUA 1HTZA 1IELA 2Y2QA 2R78A 2M1CA 3ZYTA 4MNRA 2P74A 3MQQA 4EWFA 5FASA 3HJKA 1DP8A 4QU3A 3LEQA 3GVBA 4PM8A 3TE8A 5IT5A 2ZQ8A 2M7VA 2PU4A 1LSXA 2I72A 3FV7A 1JTDA 1QMFA 4IVKA 1K57A 4MBFA 3BJNA 2ZQDA 3IS2A 1CQAA 5GHYA 1TF1A 3HVFA 3UB7A 3V3RA 4BENA 3HLGA 4C6YA 5EV0A 1S66L 2JKTI 1OJ5A 3S1YA 4GCZA 2KDKA 3HL9A 1YLTA 1JNUA 4KQDA 4R4SA 3V5MA 3C7VA 4CQHA 1K55C 4HBUA 1AXBA 4BBVA 4NK3A 1F9IA 3UY6A 4RX2A 3IX3A 2O9BA 1E3UA 1W8QA 5EE8A 4X25A 2QWSA 4PMAA 4I3AA 2QHKA 4GS9B 2VGJA 3BFDA 4GB7A 3NIAA 4E6WA 5JYPA 4XT2B 4CJNA 2G2WA 2H5SA 3LIBA 2Y79A 4G3VA 2JKRI 4S2PA 4S2MA 3FC7A 2Y2OA 4DRTA 3D9YA 4LFUA 4IBRA 5DF8A 4C3QA 4RX3A 4LRZE 4E04A 4YFMA 3K3CA 1L0EA 4YOFA 2WKPA 2OV5A 2WGVA 5F1GA 2XR0A 4F3LA 1KDWA 2XFTA 2WYXA 1M40A 3LIFA 3KSHA 1IEMA 4B4XA 2FH5A 4KUKA 2JHEA 2Z6DA 2HV1A 1Y4OA 1SZVA 1S67L 1BSGA 4BD1A 4PM5A 3T1SA 3D3OA 4WLAA 3KSIA 3GSGA 2WZZA 2XGNA 1CF0A 1MWTA 3MXRA 5GLBA 2HDQA 4QB8A 1OTAA 4ZJ1A 1H8MA 1VETB 4E3LA 3UE1A 2J3WA 3HREA 5J3WA 2J9PA 5BOHA 3IWIA 3SS4A 3ZG0A 2DMWA 4FTXA 4NXFA 3G32A 3JPUA 4JF4A 1EROA 2XDMA 4ZJ3A 3VFHA 4K0XA 5HWVA 4BBUA 4PM7A 4Q0IA 1ALQA 3GR2A 4UQIM 5EPHA 1H8ZA 2L1MA 1I5QA 3V67A 3FKWA 2Y2HA 4BWIA 1C3BA 2BASA 1BLSA 4H6JB 4C75A 3AGFA 4DXBA 4I38A 1KE3A 1V9ZA 1N9BA 4BMWA 3ISGA 4JXGA 4JBFA 2OLVA 3N8SA 3H7WA 1J9MA 1NJ4A 5FAPA 1NY0A 3EOIA 4OOYA 5TR7A 2V9AA 3OPLA 1KDSA 4HP4A 5KZHA 3GRJA 3IXDA 3NHQA 3CZDA 4P0MA 4R4RA 2E8JA 3TW8A 1VB6A 4O8GA 3PYPA 5GLAA 4JXWA 5FI2A 1Z09A 3H82A 4CLCC 3CPTA 1YM1A 3ZHHA 3EQVA 3LR5A 4N9KA 1VM1A 1XKZA 1BT5A 1QMEA 2ZQAA 3UPOA 4EESA 1YLYA 4S2IA 3LEZA 3LR4A 5I94A 2DNSA 3E4QA 5E2EA 2DCFA 4UA9A 4F94A 2XD1A 3C30A 4MLLA 3A0RA 5DJTA 5TGFA 1K25A 3UDXA 5E43A 3ITAA 2RL3A 2JN7A 2HZ5A 5CRFA 2VLGA 1XPBA 5L8MA 4HJ3A 4EUZA 4L9GA 1ES3A 2V20A 4LLOB 4IUKA 1VHMA 3AGEA 3C4OA 3VE3A 5FQKA 2XEPA 1UWNX 3T4TA 4KZ8A 3UPNA 1X0OA 5IU1A 3FG8A 1VEUB 2ZC4B 1Y28A 2J9OA 3QP6A 4H8RA 4PM9A 3V39A 5F1FA 4NXEA 2WKQA 3CG5A 2O0YA 5DKKA 4LRXC 5HSQA 3T4LA 5EM1A 2VV7A 3GV9A 5EUAA 2QYBA 4NEED 3TJZC 2FZ0A 4B88A 3BFGA 4BLMA 1I2SA 3F1NA 2A24B 4O0PA 2ZOIA 1HD8A 5L2FA 1IOUA 1RGZA 4Y3IA 3KYQA 2AVXA 4Y7PA 4K0WA 5GHZA 4WELA 4DMZA 3WS4A 5DKLA 2HP9A 2PR5A 1ES2A 1MBLA 1XX2A 4HIAA 3BQ8A 4DDYA 2XRNA 3MFXA 4I39A 1G5UA 3VP1A 3LFVA 4L9EA 4Y0TA 1K56D 4UHUA 2C5WB 5HD5A 4ESPA 4Q0HA 3IH9A 1LT0A 3N4IA 4R1GA 3MQ0A 2ZM2A 3S7OA 3UB5P 1XGJA 1V9YA 3D72A 4OPQA 4WYYA 5HL1A 2I9VA 3MKFA 3C7UA 4DE0A 4HOIA 1G28A 4B9OA 3LR3A 1FIKA 3NOPC 3MF0A 4EXOA 3MSHA 4OPYA 1MY8A 1KVMA 3VFFA 3E0YA 4JKTA 5AJGA 4LRYC 4HHDA 4LCLA 4E3MA 1W7FA 2V8FA 3DWKA 1UWPX 3OZHA 5I5LA 1JVJA 2HPBA 3LICA 3A3JA 3C2WA 5KSHA 3OC2A 2JKTM 5FDSA 3N8RA 3PBRA 1SKOB 2G7UA 3NOTC 3HJIA 1EW0A 5EFWA 3HLWA 3A3EA 1ONHA 4PM6A 3T1QB 3W8KA 2IA2A 2VEAA 3IT9A 5M18A 1MXOA 4KQQA 4U3TA 2IWBA 3FWLA 2ZMAA 5J7EA 4AFIA 1W63M 3O5YA 2BTFP 4HBTA 1AWIA 4ZDXA 4R3JA 3C8CA 3Q82A 1S4RA 1XA7A 5EVIB 3GECA 2R9WA 3T1XA 5HX9A 4WBGA 3O87A 1OTDA 2WGIA 2V8CA 2PRFA 1ONGA 1HZOA 3D4FA 4Q0JA 4LV0A 2D02A 2JKRM 3MMHA 2HF6A 4N9LA 5G18A 3UN7A 1JWVA 1NXYA 2H28A 5A8BA 5HPIA 3KYZA 4DJ2A 4EEUA 3SH8A 3P01A 5EVID 3BY9A 3NDGA 5FL3A 1YQSA 5AQ7A 5FQIA 4ME4A 4D60A 1MPLA 2ZBBA 2ZOHA 5FATA 5L10A 2Y8HA 5FA7A 3A3FA 3IXGA 1DP6A 1W63Q 2Y2PA 1RCJA 3EGXC 1TD5A 5A92A 2CC1A 2JBFA 3NY4A 1TDLA 3IF6A 1CEFA 4OLDA 3LCEA 3T4OA 1D7EA 3HUMA 2WKIA 3OBFA 2VX8A 4WM9A 1L3LA 3E2LA 4FOFA 5A93A 1SDEA 3BY8A 1YMSA 2XH9A 3G6OA 5CECA 1JTGA 2ZQ7A 5G4ZA 4ZJ2A 1HLUP 3IXBA 2A2LA 4R70A 1XA1A 3F1PB 4KUOA 1JWPA 3G34A 3M2KA 2ZJ9A 1GSXA 5TBMB 3A0VA 5LBRA 4L9FA 4WN5A 1G68A 3KO6A 1ES5A 3G31A 1T1AA 4II7A 3QP1A 1PZOA 5CX7A 3BW6A 4JLFA 4EW7A 4IEDA 5EOOA 4JGPA 3O86A 3P7NA 2ZLYA 3OLOA 1OJGA 2PD8A 5E2HA 1BYWA 3LY3A 2X71A 2PU2A 1GA0A 5EVLA 3DTEA 4JGQA 2W0NA 4KZ3A 3N7WA 4N1XA 1FOFA 1RP5A 4MEZA 3PBNA 2K31A 5KIZA 4EETB 4GD6A 3DTKA 1S4SA 4GS9A 5U47A 2OAP1 2A3UA 4FD8A 4XT2A 5TJJA 4QY6A 2EX2A 1LHYA 3VP2A 1PNEA 1IYOA 1XFNA 1DRMA 1PFLA 5FQMA 2XFSA 1N9NA 2JKGA 3F1OA 1I2WA 1DJCA 2XROA 2HP5A 3WS0A 4WZ5C 3RFBA 4HH2A 5DFXA 2OWJA 4B93A 1W8YA 3T4QA 2EXAA 3TG9A 5CTNA 3ZG8B 1G6AA 1NYYA 3C38A 1E3UD 3S7NA 3W2ZA 2Q9MA 3NDEA 2YKFA 5J4EA 5G4YA 2OAQ1 1WA9A 4Y5FA 3FZCA 2GX5A 4IJGA 4QJGA 5K5BA 4P6ZM 3FPVA 2O9AA 2P08A 5CGSA 1WE4A 1P0ZA 4KZ7A 5FEFA 4F3LB 4GHIA 1N9LA 1NWZA 3B33A 1KGGA 2VGKA 4HJ4A 4KENB 3C5AA 4BQMA 1YT4A 3G4PA 4GD8A 1GSVA 3M6BA 3CHWP 5HL6A 1K4FA 2ZM8A 1E25A 3P09A 1IFQA 3ZGAB 3R7WA 5HD3A 4WUJA 1YPRA 5L09A 3S7PA 1WYBA 1XJ6A 2VKSA 5CXWA 2K2NA 5EM0A 2WAEA 3UMDA 4PKYA 2NUTC 2W27A 3LIEA 2MJ6A 3RXWA 2VK3A 3M2JA 1PYYA 2QPNA 2ZQ9A 4BL3A 1OTIA 1ODVA 3CJMA 1MKMA 3SS3A 2PBDP 3EWKA 4NG2A 5CEDA 3GQZA 2Y2IA 4Y15A 2V2FF 1UGUA 4RVAA 5CHUA 3WWXA 3CI6A 2DRWA 4BJPA 1PW1A 5DJUA 3JVVA 4FH2A 1FR6A 4D2OA 1K55A 2ACGA 4ZBEA 3SS5A 3CUEC 3U4LP 2PAVP 1OPXA 3I7JA 4LCMA 2J7VA 4HI4A 5GLCA 3QHYA 2RCXA 4HP9A 4X1LA 3VMAA 4R3BA 4MN6A 2EWVA 4ETXA 3RH8B 3HBRA 4ARZA 2HDSA 3ZVTA 1CK3A 3IXHA 4EEPA 3H7WB 2ZL1A 4S2NC 3LI8A 4DE2A 1BUEA 1Z6FA 4QY5A 3Q1FA 4HEFA 4JPMA 3MS6A 3NBLA 2R9XA 3BRMA 1ZG6A 4WZ5A 1O7EA 4FUWA 1PWDA 3BFCA 1OMEA 1TEMA 3T12B 3M6HA 1FR1A 4GDBA 3HUNA 4N92A 1E4DA 2J3TD 3B3XA 4BL2A 3QP2A 3BECA 4YNRA 3H82B 3ZNTA 3CPTB 3V3SA 4XUZA 3UE6A 5EVIC 1N9OA 3B42A 3LIDA 2X02A 5EVEA 2V0WA 3P98A 3C4PA 1XGIA 4RQ9A 5FDHA 1YKDA 3U2AA 5F69A 1VEUA 1ESUA 3OPRA 4DN0A 4LV1A 3WS2A 2H10A 2WZXA 4WEJA 4K08A 5KMWA 5HAPA 3NULA 1S1ZA 4GOGA 1H5XA 2OLUA 2ZQCA 4DJ3A 5MC7A 3BWLA 1ERMA 3VV4A 5FI6A 2HDRA 1SDNA 4P6ZS 3TOIA 3ZQ5A 2A24A 2EX9A 3SZTA 4IUHA 1MZUA 1O07A 2OWHA 4KG5A 4Y13A 4FCFA 1KGEA 5E2FA 5EECA 2V1BA 3MKEA 1TS6A 2P9VA 5DF9A 4RYEA 4PAUA 2K7SA 2Y4AA 3EQUA 3QP5A 2OOLA 5C5KA 3N6IA 4OPZA 5DFYA 2IWCA 1BULA 2W3HA 5HAQA 2J80A 4ZAMA 2UWXA 4ZTKA 1ZHHB 4S2LA 4K91A 2GDNA 3F1NB 2PYPA 4Y17A 4MBHA 4HJ6A 2L0WA 4P85A 1SCWA 4EBNA 1L0DA 4OQGA 3ZVWA 3IQAA 2W1TB 2WK0A 4QWOA 5L07A 4GZBA 4OKPA 1DP9A 2ZC7A 1LI0A 3JYIA 1L0GA 3DWZA 3BYDA 2QMIA 4DF6A 1NRFA 2QKPA 2VGLS 5J8XA 3NCKA 1NRJA 3VSKA 4KZ9A 3BM6A 2Q0OA 4CLCA 3VOZA 1YLJA 5DTKA 2ZC6B 3W4QA 1RGYA 1SKOA 5DF7A 4IBXA 4OONA 1P9WA 4JXVA 3HLFA 4I3JA 1TS8A 2WKHA 1MKIA 1SHVA 1JWZA 1NLZA 4Y0OA 1S6RA 5HAIA 2Y2NA 3LYXA 5DVAA 3IHBA 4EERA 4DDSA 3DTIA 3IX4A 2H0TA 4N1HA 4XXRA 5HARA 3ZG5A 2P7JA 3VP3A 3DW0A 3ICYA 4R0QA 4EQIA 5TFQA 3ZCZA 4OQ0A 4OP5A 4OLGA 3PBQA 4UEYA 1PRQA 1L2SA 2VA0A 4LV3A 3L7HA 3B47A 3LO7A 3MZEA 2HGVA 1D06A 1GHIA 3IH8A 2Y2GA 4S2JA 3DBAA 2GJ3A 1LI9A 3T4SA 2JCHA 1YSPA 1FQGA 3MJQA 1CEGA 3BLMA 2KLIA 2HJEA 4BD0A 1CJFA 5CGXA 5AVEA 1BZAA 4EU0A 3GMWA 2WADA 1XJ4A 2VV6A 3A3DA 5FQ9A 2WGWB 2KX6A 4HH3A 5E2GA 1W79A 1FSYA 2B18A 2PD7A 3RXXA 2EX6A 4MMNA 2PBYA 3HLBA 4LPZA 4I5SA 2HJ9C 3V50A 3T4JA 2HDUA 2UV0E 4U0XA 1XJ2A 4R38A 1PWGA 4KZBA 5HZHA 3MFDA 5TBMA 3IF6B 1GCEA 2W3DA 3EGDC 4BBTA 3Q7ZA 1XXMA 4X68A 3G35A 3PBOA 3Q7VB 4JGRA 1GSWA 4P6BA 5A90A 1PI4A 1PI5A 2KOIA 3OCLA 1FSWA 5F82A 4GJ4A 1L0FA 2FFFB 1DJAA 4LGWA 1YAXA 2W3GA 2EFXA 2Y91A 2XA7S 3UO9A 1LL9A 4CLCE 2J8YA 1YLPA 3H9WA 4KZ4A 3Q81A 4PKYG 1XJ3A 4OVDA 3IS2B 3T1RA 1WYCA 2Z2LB 3OOVA 2X01A 3HCYA 5HFOA 2BG1A 4B4ZA 2LB9A 3E98A 1T1CA 1F5MA 2LB5A 1LL5A 5HW3A 4PPRA 1OT6A 3LGOA 3WS1A 2FFYA 2JE5A 3BFFA 3UDIA 4JGOA 4OQHA 4MBKA 2J3TC 3QP4A 2H0YA 3NI9A 3PBSA 4HQAA 4MN5A 3N8LA 1MWRA 5CHMA 4GNUA 3CMZA 4Y2FA 4R6LA 4S2OA 3VP0A 4S2KA 3MQOA 2CMNA 5FAQA 5FI7A 2PR6A 1ZG4A 1EWZA 3BLSA 1YMXA 3LIAA 2B5RA 3BQAA 4HY8A 4KZ6A 4LV2A 3DTMA 4PHTA 1MWUA 4G3KA 1EI5A 3F1OB 3LI9A 2JKFA 3MXQA 4X69A 2XSSA 1BLPA 2W3FA 1STZA 3KSFA 4L0LA 4NXGA 1ZC2A 5CTMA 5M1AA 2XK1A 4WZ4A 2Z6CA 2L4RA 3WRTA 4Z9QA 2EXBA 3EEHA 4QD4A 3UB8A 3ULFA 1VETA 1W5DA 1ESIA 2ZMFA 2ZM0A 3ZNYA 3Q07A 4YWZA 3QNCA 2GNXA 4E3KA 3JVUA 3G30A 4NKPA 3OCNA 5IS1A 4UA6A 4G3WA 1LL8A 2Z2MB 1LSVA 1Q2QA 3IX8A 1DJBA 4GHIB 1OTEA 2O9CA 1PWCA 1FCNA 1NLYA 1T19A 4KQRA 2VZWA 2Y55A 5CGWA 3T4KA 3MXSA 3FKVA 3EEAA 4H6JA 3R7WB 3AGDA 4KQOA 2Y2LA 4NXBA 1IYPA 1Y54A 2WUQA 3SW1A 2VGLM 3PBTA 1NZUA 1P97A 3UB6A 2XD5A 5EOEA 2W3EA 1S0WA 4QHCA 3NC8A 1F2KA 1U60A 5A91A 1PIOA 4MCWA 2YKHA 2B02A 3TRCA 4X56A 4R3AA 1DY6A 1CI9A 4EUVA 1ERQA 1YLWA 2WKRA 4HESA 4RA7A 5AQAA 2P04A 2VJWA 2ZMVA 2M7UA 3W4PA 3IWQA 3PHYA 3IHAA 1OTBA 2ZC3B 1ES4A 4WMCA 1IYQA 5HWTA 1TVFA 4E6XA 1GA9A 5FEGA 3VP4A 4Q8IA 2HP6A 4M3KA 4X1MA 4OOMA 1YLZA 5DTSA 1ZKJA 3E2KA 1K6RA 4O01A 1MWSA 4X53A 2QZ6A 4OP8A 4ARZB 3PAEA 3ZG7B 1PZPA 1S1YA 1CI8A 2ZL1B 5IHVA 1KE4A 1LLBA 5GLDA 5KSCA 5HDDA 4DXCA 1NZOA 1XP4A 1KGFA 1OT9A 4Y0UA 3PR6A 4JXSA 2Y2MA 3DAVA 4KZ5A 3VE4A 3S22A 4WMCD 2ZD8A 3UE0A 1GHPA 3GDIA 5CERA 1TDGA 1HVBA 4R23A 1GHMA 3IF5A 3E4OA 3WS5A 3K3DA 3SH7A 3CITA 2EWWA 5GHXA 3LUQA 2XLNA 4GDNA 4OPRA 3SOIA 2Y2JA 2INWA 1H8YA 4QPRA 3RTYA 1Q2PA 3PTEA 4OOLA 2Y2KA 3NJAA 1G6OA 3ITBA 1K56A 3UDFA 3L9KA 1KOUA 2GZAA 1VQQA 5F6AA 4MDZA 4IHQA 5FAOA 4EQ1A 3LY4A 3HLEA 4JF5A 1K54C 2XA7M 4GW9A 4ID4A 1KVLA 3G2ZA 2BLSA 5HWWA 4A5RA 3BFEA 2QJ7A 3IF6C 3O88A 5FQQA 4KG6A 1BLCA 3ZFZA 2JC7A 3UNWA 4DKIA 4JF6A 3UPPA 5AQBA 1F98A 4I3IA 1H3QA 2W1TA 2V1AA 3VSLA 2XQZA 4FSFA 2D01A 3CUEA 2P9VB 4IVIA 4WL9A 1PW8A 3KSGA 3PXPA 1LSWA 2PHYA 1FCMA 5DTTA 4HNBA 4XUXA 1K4EA 1XFQA 3NOUC 2WAFA 3MZDA 3FPWA 1TS0A 4EV4A 1K38A 4FH4A 4U0TA 1K57C 4UA7A 4UAAA 4EBPA 4CPKA 4S2NA 5M19A 1IYSA 3G2YA 5F5YA 1T18A 5CEBA 3OPHA 4UQIS 2EX8A 3CWFA 3IBJA 3A3IA 2XF3A 4NETA 4WF0A 1BTLA 3S7QA 1M6KA 1K0KA 1IKGA 1K6SA 5FQJA 3QNBA 4OQIA 1T1BA 4Z1WA 2NUPC 5GL9A 2WKEA 3S4XA 1H0MA 3SH9A 4CLCB 2IWDA 3MR0A 3NECA 4DE3A 3FYZA 5AVFA 2V0UA 4GLQA 5EVIA 1P9RA 1BLHA 1ACFA 3T50A 2O99A 3ZDJA 3W4OA 1MC0A 1J3WA 5FSRA 4GN2A 3ZG9B 2OSUA 1IKIA 3A0SA 2A49A 3E4PA 3KYEA 4CLCD
chains in the Genus database with same CATH topology
1OT6A 1MKMA 4NXEA 3EWKA 2PYRA 2WKQA 1UGUA 2O0YA 4JGOA 5DKKA 2W1RA 2J3TC 4LRXC 5HSQA 3CI6A 3UE3A 4BJPA 5DJUA 3JVVA 3T4LA 3PBSA 4HQAA 2VV7A 2PT7A 3LR0A 2QYBA 4MN5A 4NEED 3TJZC 2FZ0A 4Y2FA 4R6LA 2VV8A 3CUEC 3F1NA 3K2NA 2A24B 4O0PA 2ZOIA 1IOUA 1OPXA 3MQOA 5HDCA 2CMNA 3UB9A 2PR6A 4HI4A 5F68A 3IBRA 4Y3IA 3KYQA 3LIAA 5HPFA 4M4XA 2PDRA 3BQAA 2EA9A 4HP9A 4HY8A 4WELA 4WEKA 4DMZA 5HDSA 4PHTA 1TS7A 4MN6A 2EWVA 4ETXA 3RH8B 4G3KA 4ARZA 3R4KA 5DKLA 4MN7A 2PR5A 4HIAA 3BQ8A 2XRNA 4EEPA 3MFXA 4I39A 3F1OB 3H7WB 3VOLA 3CAXA 3LI9A 2QJ5A 3LFVA 3MXQA 3LI8A 4L9EA 2XSSA 2W3FA 1STZA 3KSFA 4L0LA 5HD5A 4Q0HA 4NXGA 1LT0A 4ZRRA 3MQ0A 3F1PA 3UMEA 3S7OA 2Z6CA 4ETZA 1V9YA 3D72A 1YSQA 2L4RA 3CLOA 2I9VA 3KX0X 1ZTUA 4HOIA 1G28A 3EEHA 3UB8A 2R78A 3ULFA 4B9OA 2M1CA 2J3TD 3LR3A 3ZYTA 4YNRA 3NOPC 3MF0A 2ZMFA 3H82B 4EXOA 3MQQA 3E0YA 4YWZA 3HJKA 5AJGA 1DP8A 2GNXA 3UE6A 4LRYC 3JVUA 4HHDA 4NKPA 3OCNA 1N9OA 5IS1A 3B42A 1UWPX 4G3WA 3TE8A 5I5LA 5IT5A 1LL8A 3LIDA 2M7VA 3LICA 2V0WA 1LSXA 1LSVA 4GHIB 3C2WA 1OTEA 5KSHA 3BJNA 3OC2A 2O9CA 2JKTM 4RQ9A 1NLYA 1T19A 3IS2A 2VZWA 1YKDA 3U2AA 5F69A 3PBRA 1TF1A 3T4KA 3UB7A 2G7UA 3NOTC 3HJIA 4DN0A 1EW0A 5EFWA 3EEAA 1S66L 2JKTI 1OJ5A 4H6JA 4WEJA 2IA2A 2VEAA 4GCZA 2KDKA 3R7WB 4K08A 1JNUA 4KQDA 1S1ZA 4KQOA 5J7EA 4AFIA 1W63M 4DJ3A 3O5YA 4CQHA 4NXBA 5MC7A 3BWLA 3SW1A 4BBVA 1F9IA 2VGLM 3PBTA 3VV4A 3C8CA 1P97A 1S4RA 3UB6A 2W3EA 4P6ZS 3GECA 2O9BA 1OTDA 3ZQ5A 2A24A 2QWSA 4IUHA 1MZUA 4Q0JA 4I3AA 2QHKA 2OWHA 4GS9B 2D02A 2JKRM 3MMHA 2HF6A 2YKHA 4MCWA 2B02A 4XT2B 3TRCA 2H28A 5A8BA 5HPIA 4R3AA 3KYZA 4DJ2A 4EUVA 4EEUA 2V1BA 1TS6A 5DF9A 2WKRA 3LIBA 3P01A 2Y79A 4G3VA 4PAUA 2K7SA 3BY9A 3EQUA 2P04A 2VJWA 2JKRI 2OOLA 5FL3A 2ZMVA 5C5KA 3FC7A 2M7UA 5DFYA 4ME4A 3PHYA 2W3HA 2ZBBA 1OTBA 4LRZE 2ZOHA 2J80A 4E04A 2Y8HA 5HWTA 1DP6A 1W63Q 1ZHHB 3K3CA 3EGXC 1TD5A 4YOFA 2WKPA 3F1NB 2PYPA 4OOMA 4HJ6A 4F3LA 2L0WA 3T4OA 1D7EA 4O01A 3OBFA 2W1TB 3LIFA 3KSHA 2VX8A 4ARZB 4FOFA 3BY8A 1DP9A 1S1YA 3G6OA 2FH5A 4KUKA 2JHEA 2Z6DA 5G4ZA 2HV1A 5HDDA 2QKPA 2VGLS 1NRJA 1S67L 4CLCA 2A2LA 4R70A 1OT9A 3F1PB 4KUOA 3D3OA 3PR6A 1GSXA 4WLAA 5TBMB 3KSIA 3A0VA 5LBRA 4L9FA 4WN5A 3VE4A 1P9WA 3KO6A 1T1AA 4I3JA 1TS8A 1OTAA 1H8MA 4II7A 1NLZA 5CX7A 3BW6A 2J3WA 3GDIA 4EW7A 3LYXA 5J3WA 4EERA 4JGPA 3P7NA 3E4OA 3K3DA 3CITA 3OLOA 1OJGA 2PD8A 2DMWA 4NXFA 2P7JA 1BYWA 2EWWA 3ICYA 3LUQA 4JGQA 2W0NA 3PBNA 2K31A 3PBQA 5HWVA 4BBUA 4UEYA 4Q0IA 4EETB 5KIZA 1S4SA 2INWA 4GS9A 4UQIM 4QPRA 2OAP1 2VA0A 4XT2A 5TJJA 3RTYA 2L1MA 3V67A 4OOLA 3B47A 4BWIA 3NJAA 1G6OA 2BASA 4H6JB 2HGVA 1D06A 1KOUA 2GZAA 3DBAA 1XFNA 2GJ3A 4I38A 5F6AA 4MDZA 1DRMA 4IHQA 1V9ZA 4BMWA 4EQ1A 3T4SA 1YSPA 3MJQA 4CLCD 1N9NA 2XA7M 2KLIA 3F1OA 2HJEA 3H7WA 4GW9A 5HWWA 5AVEA 2QJ7A 4EU0A 2XROA 1XJ4A 2VV6A 3RFBA 4HH2A 5DFXA 3EOIA 2KX6A 2OWJA 4B93A 2V9AA 4HP4A 1F98A 3T4QA 4HH3A 4I3IA 1H3QA 2W1TA 2V1AA 3NHQA 4FSFA 2D01A 3CUEA 2B18A 2PD7A 4WL9A 3KSGA 4MMNA 3PXPA 1LSWA 1VB6A 2PHYA 3C38A 4LPZA 4I5SA 4O8GA 3PYPA 3S7NA 3TW8A 4HNBA 3W2ZA 2YKFA 1XFQA 5J4EA 3NOUC 2HJ9C 3H82A 4CLCC 5G4YA 2OAQ1 1WA9A 3EQVA 4IJGA 2GX5A 4Y5FA 3T4JA 3LR5A 5K5BA 3FPWA 4P6ZM 1TS0A 3FPVA 2O9AA 2P08A 1XJ2A 4EESA 1P0ZA 4R38A 3LR4A 5HZHA 5TBMA 4F3LB 3E4QA 4GHIA 5F5YA 1N9LA 2W3DA 1T18A 4UQIS 1NWZA 3CWFA 3EGDC 4BBTA 3B33A 3IBJA 4HJ4A 3PBOA 4JGRA 1GSWA 4WF0A 2KOIA 3OCLA 3C30A 1GSVA 4GJ4A 3A0RA 5HL6A 5DJTA 3S7QA 1IFQA 3R7WA 1YAXA 2W3GA 5HD3A 4WUJA 2JN7A 1T1BA 4Z1WA 2NUPC 3S7PA 2XA7S 2VLGA 4CLCB 1XJ6A 5L8MA 4CLCE 4HJ3A 2VKSA 3MR0A 5AVFA 2V0UA 2K2NA 3H9WA 4L9GA 4GLQA 4LLOB 3UMDA 1P9RA 4IUKA 1VHMA 4PKYA 2NUTC 2W27A 4PKYG 3T50A 2O99A 1XJ3A 1MC0A 3LIEA 3VE3A 2MJ6A 1UWNX 3T4TA 3IS2B 3OOVA 3HCYA 1X0OA 5IU1A 3A0SA 3FG8A 3E4PA 2LB9A 1OTIA 3E98A 1ODVA 1T1CA 1Y28A 1F5MA 2LB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT6 A;  4NXE A;  3EWK A;  2PYR A;  2WKQ A;  1UGU A;  4JGO A;  5DKK A;  4LRX C;  5HSQ A;  5DJU A;  4HQA A;  2VV7 A;  4MN5 A;  4R6L A;  2VV8 A;  3F1N A;  2A24 B;  2ZOI A;  3MQO A;  5HDC A;  2CMN A;  3UB9 A;  2PR6 A;  4HI4 A;  5F68 A;  3IBR A;  3LIA A;  4M4X A;  2PDR A;  2EA9 A;  4HP9 A;  4HY8 A;  5HDS A;  1TS7 A;  4MN6 A;  3RH8 B;  5DKL A;  2PR5 A;  4HIA A;  4EEP A;  3MFX A;  4I39 A;  3F1O B;  3H7W B;  3VOL A;  3CAX A;  3LI9 A;  2QJ5 A;  3MXQ A;  3LI8 A;  4L9E A;  5HD5 A;  4NXG A;  1LT0 A;  3F1P A;  3UME A;  2Z6C A;  1V9Y A;  3D72 A;  2L4R A;  3CLO A;  2I9V A;  3KX0 X;  4HOI A;  1G28 A;  3EEH A;  3UB8 A;  2R78 A;  3ULF A;  4B9O A;  2M1C A;  3NOP C;  3H82 B;  4EXO A;  3MQQ A;  4YWZ A;  3HJK A;  1DP8 A;  3UE6 A;  4LRY C;  4HHD A;  1N9O A;  5IS1 A;  1UWP X;  5I5L A;  1LL8 A;  3LID A;  3LIC A;  2V0W A;  1LSX A;  1LSV A;  4GHI B;  3C2W A;  1OTE A;  4RQ9 A;  1T19 A;  3IS2 A;  5F69 A;  3UB7 A;  3NOT C;  3HJI A;  1EW0 A;  5EFW A;  1S66 L;  1OJ5 A;  4H6J A;  2VEA A;  4GCZ A;  2KDK A;  4K08 A;  1JNU A;  4KQD A;  1S1Z A;  5J7E A;  4DJ3 A;  4NXB A;  3BWL A;  3SW1 A;  4BBV A;  1F9I A;  3C8C A;  1P97 A;  1S4R A;  3UB6 A;  3GEC A;  1OTD A;  3ZQ5 A;  2A24 A;  2QWS A;  1MZU A;  4I3A A;  2QHK A;  2OWH A;  4GS9 B;  2D02 A;  2YKH A;  2B02 A;  4XT2 B;  2H28 A;  5A8B A;  4R3A A;  4DJ2 A;  4EEU A;  2V1B A;  1TS6 A;  2WKR A;  3LIB A;  2K7S A;  3BY9 A;  2OOL A;  3FC7 A;  3PHY A;  2ZBB A;  1OTB A;  4LRZ E;  2ZOH A;  2J80 A;  4E04 A;  5HWT A;  1DP6 A;  3K3C A;  2WKP A;  3F1N B;  2PYP A;  4HJ6 A;  4F3L A;  2L0W A;  1D7E A;  3LIF A;  3BY8 A;  1DP9 A;  1S1Y A;  3G6O A;  4KUK A;  2JHE A;  2Z6D A;  5G4Z A;  2HV1 A;  5HDD A;  2QKP A;  1S67 L;  4R70 A;  1OT9 A;  3F1P B;  4KUO A;  1GSX A;  4WLA A;  5TBM B;  3A0V A;  4L9F A;  4WN5 A;  3VE4 A;  1T1A A;  4I3J A;  1TS8 A;  1OTA A;  3GDI A;  4EW7 A;  3LYX A;  5J3W A;  4EER A;  4JGP A;  3P7N A;  3E4O A;  3K3D A;  3OLO A;  1OJG A;  2PD8 A;  4NXF A;  2P7J A;  1BYW A;  3ICY A;  3LUQ A;  4JGQ A;  2W0N A;  5HWV A;  4BBU A;  5KIZ A;  4EET B;  1S4S A;  2INW A;  4GS9 A;  4XT2 A;  3RTY A;  2L1M A;  3NJA A;  2BAS A;  4H6J B;  1D06 A;  1KOU A;  1XFN A;  2GJ3 A;  4I38 A;  5F6A A;  1DRM A;  1V9Z A;  4EQ1 A;  3MJQ A;  1N9N A;  3F1O A;  3H7W A;  4GW9 A;  5HWW A;  5AVE A;  2QJ7 A;  1XJ4 A;  2VV6 A;  4HH2 A;  2KX6 A;  2OWJ A;  2V9A A;  4HP4 A;  1F98 A;  4HH3 A;  4I3I A;  2V1A A;  3NHQ A;  2D01 A;  2PD7 A;  4WL9 A;  1LSW A;  1VB6 A;  2PHY A;  4LPZ A;  4I5S A;  3PYP A;  4HNB A;  2YKF A;  1XFQ A;  5J4E A;  3NOU C;  3H82 A;  5G4Y A;  1WA9 A;  1TS0 A;  1XJ2 A;  4EES A;  1P0Z A;  4R38 A;  5HZH A;  5TBM A;  4F3L B;  3E4Q A;  4GHI A;  5F5Y A;  1N9L A;  1T18 A;  1NWZ A;  3CWF A;  4BBT A;  3B33 A;  4HJ4 A;  4JGR A;  1GSW A;  4WF0 A;  1GSV A;  3A0R A;  5DJT A;  5HD3 A;  4WUJ A;  2JN7 A;  1T1B A;  2VLG A;  1XJ6 A;  4HJ3 A;  3MR0 A;  5AVF A;  2V0U A;  3H9W A;  4L9G A;  4LLO B;  3UMD A;  4PKY A;  2W27 A;  4PKY G;  3T50 A;  1XJ3 A;  3LIE A;  3VE3 A;  1UWN X;  3IS2 B;  1X0O A;  5IU1 A;  3A0S A;  3FG8 A;  3E4P A;  1OTI A;  1ODV A;  1T1C A;  1Y28 A; 
#chains in the Genus database with same CATH topology
 4E3I A;  4YIN A;  2EFU A;  3QP8 A;  5JYO A;  3PAG A;  3O3V A;  2PYR A;  4KZA A;  2C6W B;  2E8I A;  4GKU A;  4O7D A;  2Y59 A;  2W1R A;  3UE3 A;  1KE0 A;  3HLC A;  4X6T A;  3LR0 A;  2PT7 A;  4LEN A;  1FCO A;  3TSG A;  2Q9N A;  4DE1 A;  4E3N A;  2WGW A;  3WRZ A;  2V1Z A;  3HUO A;  2VV8 A;  4E3O A;  5F83 A;  3K2N A;  3MBZ A;  5HDC A;  3UB9 A;  5F68 A;  4OH0 A;  3IBR A;  1N4O A;  5HPF A;  4M4X A;  2PDR A;  5D3O A;  2EA9 A;  4P87 A;  4WEK A;  5HDS A;  1TS7 A;  3IWO A;  1FIL A;  4X55 A;  3BEB A;  3R4K A;  4MN7 A;  1A0K A;  3OPP A;  4KG2 A;  4E3J A;  4EBL A;  2G2U A;  1NYM A;  5AQ9 A;  3VOL A;  3CAX A;  1SKF A;  2QJ5 A;  3GTC A;  1K54 A;  4ZRR A;  2ZC5 B;  3MZF A;  3F1P A;  3UME A;  2B95 A;  3RJU A;  3HLD A;  4ETZ A;  1YSQ A;  3CLO A;  1D1J A;  3Q7V A;  3KX0 X;  3VOY A;  5CHJ A;  1ZTU A;  1HTZ A;  1IEL A;  2Y2Q A;  2R78 A;  2M1C A;  3ZYT A;  4MNR A;  2P74 A;  3MQQ A;  4EWF A;  5FAS A;  3HJK A;  1DP8 A;  4QU3 A;  3LEQ A;  3GVB A;  4PM8 A;  3TE8 A;  5IT5 A;  2ZQ8 A;  2M7V A;  2PU4 A;  1LSX A;  2I72 A;  3FV7 A;  1JTD A;  1QMF A;  4IVK A;  1K57 A;  4MBF A;  3BJN A;  2ZQD A;  3IS2 A;  1CQA A;  5GHY A;  1TF1 A;  3HVF A;  3UB7 A;  3V3R A;  4BEN A;  3HLG A;  4C6Y A;  5EV0 A;  1S66 L;  2JKT I;  1OJ5 A;  3S1Y A;  4GCZ A;  2KDK A;  3HL9 A;  1YLT A;  1JNU A;  4KQD A;  4R4S A;  3V5M A;  3C7V A;  4CQH A;  1K55 C;  4HBU A;  1AXB A;  4BBV A;  4NK3 A;  1F9I A;  3UY6 A;  4RX2 A;  3IX3 A;  2O9B A;  1E3U A;  1W8Q A;  5EE8 A;  4X25 A;  2QWS A;  4PMA A;  4I3A A;  2QHK A;  4GS9 B;  2VGJ A;  3BFD A;  4GB7 A;  3NIA A;  4E6W A;  5JYP A;  4XT2 B;  4CJN A;  2G2W A;  2H5S A;  3LIB A;  2Y79 A;  4G3V A;  2JKR I;  4S2P A;  4S2M A;  3FC7 A;  2Y2O A;  4DRT A;  3D9Y A;  4LFU A;  4IBR A;  5DF8 A;  4C3Q A;  4RX3 A;  4LRZ E;  4E04 A;  4YFM A;  3K3C A;  1L0E A;  4YOF A;  2WKP A;  2OV5 A;  2WGV A;  5F1G A;  2XR0 A;  4F3L A;  1KDW A;  2XFT A;  2WYX A;  1M40 A;  3LIF A;  3KSH A;  1IEM A;  4B4X A;  2FH5 A;  4KUK A;  2JHE A;  2Z6D A;  2HV1 A;  1Y4O A;  1SZV A;  1S67 L;  1BSG A;  4BD1 A;  4PM5 A;  3T1S A;  3D3O A;  4WLA A;  3KSI A;  3GSG A;  2WZZ A;  2XGN A;  1CF0 A;  1MWT A;  3MXR A;  5GLB A;  2HDQ A;  4QB8 A;  1OTA A;  4ZJ1 A;  1H8M A;  1VET B;  4E3L A;  3UE1 A;  2J3W A;  3HRE A;  5J3W A;  2J9P A;  5BOH A;  3IWI A;  3SS4 A;  3ZG0 A;  2DMW A;  4FTX A;  4NXF A;  3G32 A;  3JPU A;  4JF4 A;  1ERO A;  2XDM A;  4ZJ3 A;  3VFH A;  4K0X A;  5HWV A;  4BBU A;  4PM7 A;  4Q0I A;  1ALQ A;  3GR2 A;  4UQI M;  5EPH A;  1H8Z A;  2L1M A;  1I5Q A;  3V67 A;  3FKW A;  2Y2H A;  4BWI A;  1C3B A;  2BAS A;  1BLS A;  4H6J B;  4C75 A;  3AGF A;  4DXB A;  4I38 A;  1KE3 A;  1V9Z A;  1N9B A;  4BMW A;  3ISG A;  4JXG A;  4JBF A;  2OLV A;  3N8S A;  3H7W A;  1J9M A;  1NJ4 A;  5FAP A;  1NY0 A;  3EOI A;  4OOY A;  5TR7 A;  2V9A A;  3OPL A;  1KDS A;  4HP4 A;  5KZH A;  3GRJ A;  3IXD A;  3NHQ A;  3CZD A;  4P0M A;  4R4R A;  2E8J A;  3TW8 A;  1VB6 A;  4O8G A;  3PYP A;  5GLA A;  4JXW A;  5FI2 A;  1Z09 A;  3H82 A;  4CLC C;  3CPT A;  1YM1 A;  3ZHH A;  3EQV A;  3LR5 A;  4N9K A;  1VM1 A;  1XKZ A;  1BT5 A;  1QME A;  2ZQA A;  3UPO A;  4EES A;  1YLY A;  4S2I A;  3LEZ A;  3LR4 A;  5I94 A;  2DNS A;  3E4Q A;  5E2E A;  2DCF A;  4UA9 A;  4F94 A;  2XD1 A;  3C30 A;  4MLL A;  3A0R A;  5DJT A;  5TGF A;  1K25 A;  3UDX A;  5E43 A;  3ITA A;  2RL3 A;  2JN7 A;  2HZ5 A;  5CRF A;  2VLG A;  1XPB A;  5L8M A;  4HJ3 A;  4EUZ A;  4L9G A;  1ES3 A;  2V20 A;  4LLO B;  4IUK A;  1VHM A;  3AGE A;  3C4O A;  3VE3 A;  5FQK A;  2XEP A;  1UWN X;  3T4T A;  4KZ8 A;  3UPN A;  1X0O A;  5IU1 A;  3FG8 A;  1VEU B;  2ZC4 B;  1Y28 A;  2J9O A;  3QP6 A;  4H8R A;  4PM9 A;  3V39 A;  5F1F A;  4NXE A;  2WKQ A;  3CG5 A;  2O0Y A;  5DKK A;  4LRX C;  5HSQ A;  3T4L A;  5EM1 A;  2VV7 A;  3GV9 A;  5EUA A;  2QYB A;  4NEE D;  3TJZ C;  2FZ0 A;  4B88 A;  3BFG A;  4BLM A;  1I2S A;  3F1N A;  2A24 B;  4O0P A;  2ZOI A;  1HD8 A;  5L2F A;  1IOU A;  1RGZ A;  4Y3I A;  3KYQ A;  2AVX A;  4Y7P A;  4K0W A;  5GHZ A;  4WEL A;  4DMZ A;  3WS4 A;  5DKL A;  2HP9 A;  2PR5 A;  1ES2 A;  1MBL A;  1XX2 A;  4HIA A;  3BQ8 A;  4DDY A;  2XRN A;  3MFX A;  4I39 A;  1G5U A;  3VP1 A;  3LFV A;  4L9E A;  4Y0T A;  1K56 D;  4UHU A;  2C5W B;  5HD5 A;  4ESP A;  4Q0H A;  3IH9 A;  1LT0 A;  3N4I A;  4R1G A;  3MQ0 A;  2ZM2 A;  3S7O A;  3UB5 P;  1XGJ A;  1V9Y A;  3D72 A;  4OPQ A;  4WYY A;  5HL1 A;  2I9V A;  3MKF A;  3C7U A;  4DE0 A;  4HOI A;  1G28 A;  4B9O A;  3LR3 A;  1FIK A;  3NOP C;  3MF0 A;  4EXO A;  3MSH A;  4OPY A;  1MY8 A;  1KVM A;  3VFF A;  3E0Y A;  4JKT A;  5AJG A;  4LRY C;  4HHD A;  4LCL A;  4E3M A;  1W7F A;  2V8F A;  3DWK A;  1UWP X;  3OZH A;  5I5L A;  1JVJ A;  2HPB A;  3LIC A;  3A3J A;  3C2W A;  5KSH A;  3OC2 A;  2JKT M;  5FDS A;  3N8R A;  3PBR A;  1SKO B;  2G7U A;  3NOT C;  3HJI A;  1EW0 A;  5EFW A;  3HLW A;  3A3E A;  1ONH A;  4PM6 A;  3T1Q B;  3W8K A;  2IA2 A;  2VEA A;  3IT9 A;  5M18 A;  1MXO A;  4KQQ A;  4U3T A;  2IWB A;  3FWL A;  2ZMA A;  5J7E A;  4AFI A;  1W63 M;  3O5Y A;  2BTF P;  4HBT A;  1AWI A;  4ZDX A;  4R3J A;  3C8C A;  3Q82 A;  1S4R A;  1XA7 A;  5EVI B;  3GEC A;  2R9W A;  3T1X A;  5HX9 A;  4WBG A;  3O87 A;  1OTD A;  2WGI A;  2V8C A;  2PRF A;  1ONG A;  1HZO A;  3D4F A;  4Q0J A;  4LV0 A;  2D02 A;  2JKR M;  3MMH A;  2HF6 A;  4N9L A;  5G18 A;  3UN7 A;  1JWV A;  1NXY A;  2H28 A;  5A8B A;  5HPI A;  3KYZ A;  4DJ2 A;  4EEU A;  3SH8 A;  3P01 A;  5EVI D;  3BY9 A;  3NDG A;  5FL3 A;  1YQS A;  5AQ7 A;  5FQI A;  4ME4 A;  4D60 A;  1MPL A;  2ZBB A;  2ZOH A;  5FAT A;  5L10 A;  2Y8H A;  5FA7 A;  3A3F A;  3IXG A;  1DP6 A;  1W63 Q;  2Y2P A;  1RCJ A;  3EGX C;  1TD5 A;  5A92 A;  2CC1 A;  2JBF A;  3NY4 A;  1TDL A;  3IF6 A;  1CEF A;  4OLD A;  3LCE A;  3T4O A;  1D7E A;  3HUM A;  2WKI A;  3OBF A;  2VX8 A;  4WM9 A;  1L3L A;  3E2L A;  4FOF A;  5A93 A;  1SDE A;  3BY8 A;  1YMS A;  2XH9 A;  3G6O A;  5CEC A;  1JTG A;  2ZQ7 A;  5G4Z A;  4ZJ2 A;  1HLU P;  3IXB A;  2A2L A;  4R70 A;  1XA1 A;  3F1P B;  4KUO A;  1JWP A;  3G34 A;  3M2K A;  2ZJ9 A;  1GSX A;  5TBM B;  3A0V A;  5LBR A;  4L9F A;  4WN5 A;  1G68 A;  3KO6 A;  1ES5 A;  3G31 A;  1T1A A;  4II7 A;  3QP1 A;  1PZO A;  5CX7 A;  3BW6 A;  4JLF A;  4EW7 A;  4IED A;  5EOO A;  4JGP A;  3O86 A;  3P7N A;  2ZLY A;  3OLO A;  1OJG A;  2PD8 A;  5E2H A;  1BYW A;  3LY3 A;  2X71 A;  2PU2 A;  1GA0 A;  5EVL A;  3DTE A;  4JGQ A;  2W0N A;  4KZ3 A;  3N7W A;  4N1X A;  1FOF A;  1RP5 A;  4MEZ A;  3PBN A;  2K31 A;  5KIZ A;  4EET B;  4GD6 A;  3DTK A;  1S4S A;  4GS9 A;  5U47 A;  2OAP 1;  2A3U A;  4FD8 A;  4XT2 A;  5TJJ A;  4QY6 A;  2EX2 A;  1LHY A;  3VP2 A;  1PNE A;  1IYO A;  1XFN A;  1DRM A;  1PFL A;  5FQM A;  2XFS A;  1N9N A;  2JKG A;  3F1O A;  1I2W A;  1DJC A;  2XRO A;  2HP5 A;  3WS0 A;  4WZ5 C;  3RFB A;  4HH2 A;  5DFX A;  2OWJ A;  4B93 A;  1W8Y A;  3T4Q A;  2EXA A;  3TG9 A;  5CTN A;  3ZG8 B;  1G6A A;  1NYY A;  3C38 A;  1E3U D;  3S7N A;  3W2Z A;  2Q9M A;  3NDE A;  2YKF A;  5J4E A;  5G4Y A;  2OAQ 1;  1WA9 A;  4Y5F A;  3FZC A;  2GX5 A;  4IJG A;  4QJG A;  5K5B A;  4P6Z M;  3FPV A;  2O9A A;  2P08 A;  5CGS A;  1WE4 A;  1P0Z A;  4KZ7 A;  5FEF A;  4F3L B;  4GHI A;  1N9L A;  1NWZ A;  3B33 A;  1KGG A;  2VGK A;  4HJ4 A;  4KEN B;  3C5A A;  4BQM A;  1YT4 A;  3G4P A;  4GD8 A;  1GSV A;  3M6B A;  3CHW P;  5HL6 A;  1K4F A;  2ZM8 A;  1E25 A;  3P09 A;  1IFQ A;  3ZGA B;  3R7W A;  5HD3 A;  4WUJ A;  1YPR A;  5L09 A;  3S7P A;  1WYB A;  1XJ6 A;  2VKS A;  5CXW A;  2K2N A;  5EM0 A;  2WAE A;  3UMD A;  4PKY A;  2NUT C;  2W27 A;  3LIE A;  2MJ6 A;  3RXW A;  2VK3 A;  3M2J A;  1PYY A;  2QPN A;  2ZQ9 A;  4BL3 A;  1OTI A;  1ODV A;  3CJM A;  1MKM A;  3SS3 A;  2PBD P;  3EWK A;  4NG2 A;  5CED A;  3GQZ A;  2Y2I A;  4Y15 A;  2V2F F;  1UGU A;  4RVA A;  5CHU A;  3WWX A;  3CI6 A;  2DRW A;  4BJP A;  1PW1 A;  5DJU A;  3JVV A;  4FH2 A;  1FR6 A;  4D2O A;  1K55 A;  2ACG A;  4ZBE A;  3SS5 A;  3CUE C;  3U4L P;  2PAV P;  1OPX A;  3I7J A;  4LCM A;  2J7V A;  4HI4 A;  5GLC A;  3QHY A;  2RCX A;  4HP9 A;  4X1L A;  3VMA A;  4R3B A;  4MN6 A;  2EWV A;  4ETX A;  3RH8 B;  3HBR A;  4ARZ A;  2HDS A;  3ZVT A;  1CK3 A;  3IXH A;  4EEP A;  3H7W B;  2ZL1 A;  4S2N C;  3LI8 A;  4DE2 A;  1BUE A;  1Z6F A;  4QY5 A;  3Q1F A;  4HEF A;  4JPM A;  3MS6 A;  3NBL A;  2R9X A;  3BRM A;  1ZG6 A;  4WZ5 A;  1O7E A;  4FUW A;  1PWD A;  3BFC A;  1OME A;  1TEM A;  3T12 B;  3M6H A;  1FR1 A;  4GDB A;  3HUN A;  4N92 A;  1E4D A;  2J3T D;  3B3X A;  4BL2 A;  3QP2 A;  3BEC A;  4YNR A;  3H82 B;  3ZNT A;  3CPT B;  3V3S A;  4XUZ A;  3UE6 A;  5EVI C;  1N9O A;  3B42 A;  3LID A;  2X02 A;  5EVE A;  2V0W A;  3P98 A;  3C4P A;  1XGI A;  4RQ9 A;  5FDH A;  1YKD A;  3U2A A;  5F69 A;  1VEU A;  1ESU A;  3OPR A;  4DN0 A;  4LV1 A;  3WS2 A;  2H10 A;  2WZX A;  4WEJ A;  4K08 A;  5KMW A;  5HAP A;  3NUL A;  1S1Z A;  4GOG A;  1H5X A;  2OLU A;  2ZQC A;  4DJ3 A;  5MC7 A;  3BWL A;  1ERM A;  3VV4 A;  5FI6 A;  2HDR A;  1SDN A;  4P6Z S;  3TOI A;  3ZQ5 A;  2A24 A;  2EX9 A;  3SZT A;  4IUH A;  1MZU A;  1O07 A;  2OWH A;  4KG5 A;  4Y13 A;  4FCF A;  1KGE A;  5E2F A;  5EEC A;  2V1B A;  3MKE A;  1TS6 A;  2P9V A;  5DF9 A;  4RYE A;  4PAU A;  2K7S A;  2Y4A A;  3EQU A;  3QP5 A;  2OOL A;  5C5K A;  3N6I A;  4OPZ A;  5DFY A;  2IWC A;  1BUL A;  2W3H A;  5HAQ A;  2J80 A;  4ZAM A;  2UWX A;  4ZTK A;  1ZHH B;  4S2L A;  4K91 A;  2GDN A;  3F1N B;  2PYP A;  4Y17 A;  4MBH A;  4HJ6 A;  2L0W A;  4P85 A;  1SCW A;  4EBN A;  1L0D A;  4OQG A;  3ZVW A;  3IQA A;  2W1T B;  2WK0 A;  4QWO A;  5L07 A;  4GZB A;  4OKP A;  1DP9 A;  2ZC7 A;  1LI0 A;  3JYI A;  1L0G A;  3DWZ A;  3BYD A;  2QMI A;  4DF6 A;  1NRF A;  2QKP A;  2VGL S;  5J8X A;  3NCK A;  1NRJ A;  3VSK A;  4KZ9 A;  3BM6 A;  2Q0O A;  4CLC A;  3VOZ A;  1YLJ A;  5DTK A;  2ZC6 B;  3W4Q A;  1RGY A;  1SKO A;  5DF7 A;  4IBX A;  4OON A;  1P9W A;  4JXV A;  3HLF A;  4I3J A;  1TS8 A;  2WKH A;  1MKI A;  1SHV A;  1JWZ A;  1NLZ A;  4Y0O A;  1S6R A;  5HAI A;  2Y2N A;  3LYX A;  5DVA A;  3IHB A;  4EER A;  4DDS A;  3DTI A;  3IX4 A;  2H0T A;  4N1H A;  4XXR A;  5HAR A;  3ZG5 A;  2P7J A;  3VP3 A;  3DW0 A;  3ICY A;  4R0Q A;  4EQI A;  5TFQ A;  3ZCZ A;  4OQ0 A;  4OP5 A;  4OLG A;  3PBQ A;  4UEY A;  1PRQ A;  1L2S A;  2VA0 A;  4LV3 A;  3L7H A;  3B47 A;  3LO7 A;  3MZE A;  2HGV A;  1D06 A;  1GHI A;  3IH8 A;  2Y2G A;  4S2J A;  3DBA A;  2GJ3 A;  1LI9 A;  3T4S A;  2JCH A;  1YSP A;  1FQG A;  3MJQ A;  1CEG A;  3BLM A;  2KLI A;  2HJE A;  4BD0 A;  1CJF A;  5CGX A;  5AVE A;  1BZA A;  4EU0 A;  3GMW A;  2WAD A;  1XJ4 A;  2VV6 A;  3A3D A;  5FQ9 A;  2WGW B;  2KX6 A;  4HH3 A;  5E2G A;  1W79 A;  1FSY A;  2B18 A;  2PD7 A;  3RXX A;  2EX6 A;  4MMN A;  2PBY A;  3HLB A;  4LPZ A;  4I5S A;  2HJ9 C;  3V50 A;  3T4J A;  2HDU A;  2UV0 E;  4U0X A;  1XJ2 A;  4R38 A;  1PWG A;  4KZB A;  5HZH A;  3MFD A;  5TBM A;  3IF6 B;  1GCE A;  2W3D A;  3EGD C;  4BBT A;  3Q7Z A;  1XXM A;  4X68 A;  3G35 A;  3PBO A;  3Q7V B;  4JGR A;  1GSW A;  4P6B A;  5A90 A;  1PI4 A;  1PI5 A;  2KOI A;  3OCL A;  1FSW A;  5F82 A;  4GJ4 A;  1L0F A;  2FFF B;  1DJA A;  4LGW A;  1YAX A;  2W3G A;  2EFX A;  2Y91 A;  2XA7 S;  3UO9 A;  1LL9 A;  4CLC E;  2J8Y A;  1YLP A;  3H9W A;  4KZ4 A;  3Q81 A;  4PKY G;  1XJ3 A;  4OVD A;  3IS2 B;  3T1R A;  1WYC A;  2Z2L B;  3OOV A;  2X01 A;  3HCY A;  5HFO A;  2BG1 A;  4B4Z A;  2LB9 A;  3E98 A;  1T1C A;  1F5M A;  2LB5 A;  1LL5 A;  5HW3 A;  4PPR A;  1OT6 A;  3LGO A;  3WS1 A;  2FFY A;  2JE5 A;  3BFF A;  3UDI A;  4JGO A;  4OQH A;  4MBK A;  2J3T C;  3QP4 A;  2H0Y A;  3NI9 A;  3PBS A;  4HQA A;  4MN5 A;  3N8L A;  1MWR A;  5CHM A;  4GNU A;  3CMZ A;  4Y2F A;  4R6L A;  4S2O A;  3VP0 A;  4S2K A;  3MQO A;  2CMN A;  5FAQ A;  5FI7 A;  2PR6 A;  1ZG4 A;  1EWZ A;  3BLS A;  1YMX A;  3LIA A;  2B5R A;  3BQA A;  4HY8 A;  4KZ6 A;  4LV2 A;  3DTM A;  4PHT A;  1MWU A;  4G3K A;  1EI5 A;  3F1O B;  3LI9 A;  2JKF A;  3MXQ A;  4X69 A;  2XSS A;  1BLP A;  2W3F A;  1STZ A;  3KSF A;  4L0L A;  4NXG A;  1ZC2 A;  5CTM A;  5M1A A;  2XK1 A;  4WZ4 A;  2Z6C A;  2L4R A;  3WRT A;  4Z9Q A;  2EXB A;  3EEH A;  4QD4 A;  3UB8 A;  3ULF A;  1VET A;  1W5D A;  1ESI A;  2ZMF A;  2ZM0 A;  3ZNY A;  3Q07 A;  4YWZ A;  3QNC A;  2GNX A;  4E3K A;  3JVU A;  3G30 A;  4NKP A;  3OCN A;  5IS1 A;  4UA6 A;  4G3W A;  1LL8 A;  2Z2M B;  1LSV A;  1Q2Q A;  3IX8 A;  1DJB A;  4GHI B;  1OTE A;  2O9C A;  1PWC A;  1FCN A;  1NLY A;  1T19 A;  4KQR A;  2VZW A;  2Y55 A;  5CGW A;  3T4K A;  3MXS A;  3FKV A;  3EEA A;  4H6J A;  3R7W B;  3AGD A;  4KQO A;  2Y2L A;  4NXB A;  1IYP A;  1Y54 A;  2WUQ A;  3SW1 A;  2VGL M;  3PBT A;  1NZU A;  1P97 A;  3UB6 A;  2XD5 A;  5EOE A;  2W3E A;  1S0W A;  4QHC A;  3NC8 A;  1F2K A;  1U60 A;  5A91 A;  1PIO A;  4MCW A;  2YKH A;  2B02 A;  3TRC A;  4X56 A;  4R3A A;  1DY6 A;  1CI9 A;  4EUV A;  1ERQ A;  1YLW A;  2WKR A;  4HES A;  4RA7 A;  5AQA A;  2P04 A;  2VJW A;  2ZMV A;  2M7U A;  3W4P A;  3IWQ A;  3PHY A;  3IHA A;  1OTB A;  2ZC3 B;  1ES4 A;  4WMC A;  1IYQ A;  5HWT A;  1TVF A;  4E6X A;  1GA9 A;  5FEG A;  3VP4 A;  4Q8I A;  2HP6 A;  4M3K A;  4X1M A;  4OOM A;  1YLZ A;  5DTS A;  1ZKJ A;  3E2K A;  1K6R A;  4O01 A;  1MWS A;  4X53 A;  2QZ6 A;  4OP8 A;  4ARZ B;  3PAE A;  3ZG7 B;  1PZP A;  1S1Y A;  1CI8 A;  2ZL1 B;  5IHV A;  1KE4 A;  1LLB A;  5GLD A;  5KSC A;  5HDD A;  4DXC A;  1NZO A;  1XP4 A;  1KGF A;  1OT9 A;  4Y0U A;  3PR6 A;  4JXS A;  2Y2M A;  3DAV A;  4KZ5 A;  3VE4 A;  3S22 A;  4WMC D;  2ZD8 A;  3UE0 A;  1GHP A;  3GDI A;  5CER A;  1TDG A;  1HVB A;  4R23 A;  1GHM A;  3IF5 A;  3E4O A;  3WS5 A;  3K3D A;  3SH7 A;  3CIT A;  2EWW A;  5GHX A;  3LUQ A;  2XLN A;  4GDN A;  4OPR A;  3SOI A;  2Y2J A;  2INW A;  1H8Y A;  4QPR A;  3RTY A;  1Q2P A;  3PTE A;  4OOL A;  2Y2K A;  3NJA A;  1G6O A;  3ITB A;  1K56 A;  3UDF A;  3L9K A;  1KOU A;  2GZA A;  1VQQ A;  5F6A A;  4MDZ A;  4IHQ A;  5FAO A;  4EQ1 A;  3LY4 A;  3HLE A;  4JF5 A;  1K54 C;  2XA7 M;  4GW9 A;  4ID4 A;  1KVL A;  3G2Z A;  2BLS A;  5HWW A;  4A5R A;  3BFE A;  2QJ7 A;  3IF6 C;  3O88 A;  5FQQ A;  4KG6 A;  1BLC A;  3ZFZ A;  2JC7 A;  3UNW A;  4DKI A;  4JF6 A;  3UPP A;  5AQB A;  1F98 A;  4I3I A;  1H3Q A;  2W1T A;  2V1A A;  3VSL A;  2XQZ A;  4FSF A;  2D01 A;  3CUE A;  2P9V B;  4IVI A;  4WL9 A;  1PW8 A;  3KSG A;  3PXP A;  1LSW A;  2PHY A;  1FCM A;  5DTT A;  4HNB A;  4XUX A;  1K4E A;  1XFQ A;  3NOU C;  2WAF A;  3MZD A;  3FPW A;  1TS0 A;  4EV4 A;  1K38 A;  4FH4 A;  4U0T A;  1K57 C;  4UA7 A;  4UAA A;  4EBP A;  4CPK A;  4S2N A;  5M19 A;  1IYS A;  3G2Y A;  5F5Y A;  1T18 A;  5CEB A;  3OPH A;  4UQI S;  2EX8 A;  3CWF A;  3IBJ A;  3A3I A;  2XF3 A;  4NET A;  4WF0 A;  1BTL A;  3S7Q A;  1M6K A;  1K0K A;  1IKG A;  1K6S A;  5FQJ A;  3QNB A;  4OQI A;  1T1B A;  4Z1W A;  2NUP C;  5GL9 A;  2WKE A;  3S4X A;  1H0M A;  3SH9 A;  4CLC B;  2IWD A;  3MR0 A;  3NEC A;  4DE3 A;  3FYZ A;  5AVF A;  2V0U A;  4GLQ A;  5EVI A;  1P9R A;  1BLH A;  1ACF A;  3T50 A;  2O99 A;  3ZDJ A;  3W4O A;  1MC0 A;  1J3W A;  5FSR A;  4GN2 A;  3ZG9 B;  2OSU A;  1IKI A;  3A0S A;  2A49 A;  3E4P A;  3KYE A;  4CLC D; 
#chains in the Genus database with same CATH homology
 1OT6 A;  1MKM A;  4NXE A;  3EWK A;  2PYR A;  2WKQ A;  1UGU A;  2O0Y A;  4JGO A;  5DKK A;  2W1R A;  2J3T C;  4LRX C;  5HSQ A;  3CI6 A;  3UE3 A;  4BJP A;  5DJU A;  3JVV A;  3T4L A;  3PBS A;  4HQA A;  2VV7 A;  2PT7 A;  3LR0 A;  2QYB A;  4MN5 A;  4NEE D;  3TJZ C;  2FZ0 A;  4Y2F A;  4R6L A;  2VV8 A;  3CUE C;  3F1N A;  3K2N A;  2A24 B;  4O0P A;  2ZOI A;  1IOU A;  1OPX A;  3MQO A;  5HDC A;  2CMN A;  3UB9 A;  2PR6 A;  4HI4 A;  5F68 A;  3IBR A;  4Y3I A;  3KYQ A;  3LIA A;  5HPF A;  4M4X A;  2PDR A;  3BQA A;  2EA9 A;  4HP9 A;  4HY8 A;  4WEL A;  4WEK A;  4DMZ A;  5HDS A;  4PHT A;  1TS7 A;  4MN6 A;  2EWV A;  4ETX A;  3RH8 B;  4G3K A;  4ARZ A;  3R4K A;  5DKL A;  4MN7 A;  2PR5 A;  4HIA A;  3BQ8 A;  2XRN A;  4EEP A;  3MFX A;  4I39 A;  3F1O B;  3H7W B;  3VOL A;  3CAX A;  3LI9 A;  2QJ5 A;  3LFV A;  3MXQ A;  3LI8 A;  4L9E A;  2XSS A;  2W3F A;  1STZ A;  3KSF A;  4L0L A;  5HD5 A;  4Q0H A;  4NXG A;  1LT0 A;  4ZRR A;  3MQ0 A;  3F1P A;  3UME A;  3S7O A;  2Z6C A;  4ETZ A;  1V9Y A;  3D72 A;  1YSQ A;  2L4R A;  3CLO A;  2I9V A;  3KX0 X;  1ZTU A;  4HOI A;  1G28 A;  3EEH A;  3UB8 A;  2R78 A;  3ULF A;  4B9O A;  2M1C A;  2J3T D;  3LR3 A;  3ZYT A;  4YNR A;  3NOP C;  3MF0 A;  2ZMF A;  3H82 B;  4EXO A;  3MQQ A;  3E0Y A;  4YWZ A;  3HJK A;  5AJG A;  1DP8 A;  2GNX A;  3UE6 A;  4LRY C;  3JVU A;  4HHD A;  4NKP A;  3OCN A;  1N9O A;  5IS1 A;  3B42 A;  1UWP X;  4G3W A;  3TE8 A;  5I5L A;  5IT5 A;  1LL8 A;  3LID A;  2M7V A;  3LIC A;  2V0W A;  1LSX A;  1LSV A;  4GHI B;  3C2W A;  1OTE A;  5KSH A;  3BJN A;  3OC2 A;  2O9C A;  2JKT M;  4RQ9 A;  1NLY A;  1T19 A;  3IS2 A;  2VZW A;  1YKD A;  3U2A A;  5F69 A;  3PBR A;  1TF1 A;  3T4K A;  3UB7 A;  2G7U A;  3NOT C;  3HJI A;  4DN0 A;  1EW0 A;  5EFW A;  3EEA A;  1S66 L;  2JKT I;  1OJ5 A;  4H6J A;  4WEJ A;  2IA2 A;  2VEA A;  4GCZ A;  2KDK A;  3R7W B;  4K08 A;  1JNU A;  4KQD A;  1S1Z A;  4KQO A;  5J7E A;  4AFI A;  1W63 M;  4DJ3 A;  3O5Y A;  4CQH A;  4NXB A;  5MC7 A;  3BWL A;  3SW1 A;  4BBV A;  1F9I A;  2VGL M;  3PBT A;  3VV4 A;  3C8C A;  1P97 A;  1S4R A;  3UB6 A;  2W3E A;  4P6Z S;  3GEC A;  2O9B A;  1OTD A;  3ZQ5 A;  2A24 A;  2QWS A;  4IUH A;  1MZU A;  4Q0J A;  4I3A A;  2QHK A;  2OWH A;  4GS9 B;  2D02 A;  2JKR M;  3MMH A;  2HF6 A;  2YKH A;  4MCW A;  2B02 A;  4XT2 B;  3TRC A;  2H28 A;  5A8B A;  5HPI A;  4R3A A;  3KYZ A;  4DJ2 A;  4EUV A;  4EEU A;  2V1B A;  1TS6 A;  5DF9 A;  2WKR A;  3LIB A;  3P01 A;  2Y79 A;  4G3V A;  4PAU A;  2K7S A;  3BY9 A;  3EQU A;  2P04 A;  2VJW A;  2JKR I;  2OOL A;  5FL3 A;  2ZMV A;  5C5K A;  3FC7 A;  2M7U A;  5DFY A;  4ME4 A;  3PHY A;  2W3H A;  2ZBB A;  1OTB A;  4LRZ E;  2ZOH A;  2J80 A;  4E04 A;  2Y8H A;  5HWT A;  1DP6 A;  1W63 Q;  1ZHH B;  3K3C A;  3EGX C;  1TD5 A;  4YOF A;  2WKP A;  3F1N B;  2PYP A;  4OOM A;  4HJ6 A;  4F3L A;  2L0W A;  3T4O A;  1D7E A;  4O01 A;  3OBF A;  2W1T B;  3LIF A;  3KSH A;  2VX8 A;  4ARZ B;  4FOF A;  3BY8 A;  1DP9 A;  1S1Y A;  3G6O A;  2FH5 A;  4KUK A;  2JHE A;  2Z6D A;  5G4Z A;  2HV1 A;  5HDD A;  2QKP A;  2VGL S;  1NRJ A;  1S67 L;  4CLC A;  2A2L A;  4R70 A;  1OT9 A;  3F1P B;  4KUO A;  3D3O A;  3PR6 A;  1GSX A;  4WLA A;  5TBM B;  3KSI A;  3A0V A;  5LBR A;  4L9F A;  4WN5 A;  3VE4 A;  1P9W A;  3KO6 A;  1T1A A;  4I3J A;  1TS8 A;  1OTA A;  1H8M A;  4II7 A;  1NLZ A;  5CX7 A;  3BW6 A;  2J3W A;  3GDI A;  4EW7 A;  3LYX A;  5J3W A;  4EER A;  4JGP A;  3P7N A;  3E4O A;  3K3D A;  3CIT A;  3OLO A;  1OJG A;  2PD8 A;  2DMW A;  4NXF A;  2P7J A;  1BYW A;  2EWW A;  3ICY A;  3LUQ A;  4JGQ A;  2W0N A;  3PBN A;  2K31 A;  3PBQ A;  5HWV A;  4BBU A;  4UEY A;  4Q0I A;  4EET B;  5KIZ A;  1S4S A;  2INW A;  4GS9 A;  4UQI M;  4QPR A;  2OAP 1;  2VA0 A;  4XT2 A;  5TJJ A;  3RTY A;  2L1M A;  3V67 A;  4OOL A;  3B47 A;  4BWI A;  3NJA A;  1G6O A;  2BAS A;  4H6J B;  2HGV A;  1D06 A;  1KOU A;  2GZA A;  3DBA A;  1XFN A;  2GJ3 A;  4I38 A;  5F6A A;  4MDZ A;  1DRM A;  4IHQ A;  1V9Z A;  4BMW A;  4EQ1 A;  3T4S A;  1YSP A;  3MJQ A;  4CLC D;  1N9N A;  2XA7 M;  2KLI A;  3F1O A;  2HJE A;  3H7W A;  4GW9 A;  5HWW A;  5AVE A;  2QJ7 A;  4EU0 A;  2XRO A;  1XJ4 A;  2VV6 A;  3RFB A;  4HH2 A;  5DFX A;  3EOI A;  2KX6 A;  2OWJ A;  4B93 A;  2V9A A;  4HP4 A;  1F98 A;  3T4Q A;  4HH3 A;  4I3I A;  1H3Q A;  2W1T A;  2V1A A;  3NHQ A;  4FSF A;  2D01 A;  3CUE A;  2B18 A;  2PD7 A;  4WL9 A;  3KSG A;  4MMN A;  3PXP A;  1LSW A;  1VB6 A;  2PHY A;  3C38 A;  4LPZ A;  4I5S A;  4O8G A;  3PYP A;  3S7N A;  3TW8 A;  4HNB A;  3W2Z A;  2YKF A;  1XFQ A;  5J4E A;  3NOU C;  2HJ9 C;  3H82 A;  4CLC C;  5G4Y A;  2OAQ 1;  1WA9 A;  3EQV A;  4IJG A;  2GX5 A;  4Y5F A;  3T4J A;  3LR5 A;  5K5B A;  3FPW A;  4P6Z M;  1TS0 A;  3FPV A;  2O9A A;  2P08 A;  1XJ2 A;  4EES A;  1P0Z A;  4R38 A;  3LR4 A;  5HZH A;  5TBM A;  4F3L B;  3E4Q A;  4GHI A;  5F5Y A;  1N9L A;  2W3D A;  1T18 A;  4UQI S;  1NWZ A;  3CWF A;  3EGD C;  4BBT A;  3B33 A;  3IBJ A;  4HJ4 A;  3PBO A;  4JGR A;  1GSW A;  4WF0 A;  2KOI A;  3OCL A;  3C30 A;  1GSV A;  4GJ4 A;  3A0R A;  5HL6 A;  5DJT A;  3S7Q A;  1IFQ A;  3R7W A;  1YAX A;  2W3G A;  5HD3 A;  4WUJ A;  2JN7 A;  1T1B A;  4Z1W A;  2NUP C;  3S7P A;  2XA7 S;  2VLG A;  4CLC B;  1XJ6 A;  5L8M A;  4CLC E;  4HJ3 A;  2VKS A;  3MR0 A;  5AVF A;  2V0U A;  2K2N A;  3H9W A;  4L9G A;  4GLQ A;  4LLO B;  3UMD A;  1P9R A;  4IUK A;  1VHM A;  4PKY A;  2NUT C;  2W27 A;  4PKY G;  3T50 A;  2O99 A;  1XJ3 A;  1MC0 A;  3LIE A;  3VE3 A;  2MJ6 A;  1UWN X;  3T4T A;  3IS2 B;  3OOV A;  3HCY A;  1X0O A;  5IU1 A;  3A0S A;  3FG8 A;  3E4P A;  2LB9 A;  1OTI A;  3E98 A;  1ODV A;  1T1C A;  1Y28 A;  1F5M A;  2LB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...