5AVEA

The ligand binding domain of mlp37 with serine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
SVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRSTLIHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Vibrio cholerae chemoreceptor that senses taurine and amino acids as attractants
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis (MCP) signaling domain protein
total genus 82
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5aveA02
2OOLA 2OWJA 4WL9A 5G4YA 1V9ZA 3F1NB 4PKYA 2INWA 4I3AA 2PR5A 1DRMA 3GDIA 3MQOA 4HI4A 1XJ2A 2PYRA 4R70A 5HWVA 1BYWA 2L4RA 5F68A 4GW9A 1S1YA 2KDKA 3K3CA 3LIFA 3LUQA 4NXFA 3A0RA 4NXEA 1N9OA 2YKFA 3KX0X 1GSXA 4H6JA 5IS1A 2D02A 3BY8A 4LRXC 4MN6A 1XJ3A 4HHDA 2H28A 4WLAA 2V1BA 1UWNX 2QJ5A 4MN5A 4R38A 3IBRA 4I5SA 2VLGA 4JGPA 3SW1A 3FG8A 3LIDA 3LIAA 3BWLA 4WN5A 1GSWA 4LRYC 3BY9A 4WUJA 2VEAA 3LI9A 5J3WA 1G28A 4HY8A 3T50A 4GS9A 4HP9A 5G4ZA 2QHKA 1DP6A 2PR6A 3VE4A 3H82A 3UB8A 4EETB 4L9GA 5HD3A 4F3LB 2QWSA 2GJ3A 3F1PA 2WKRA 2ZOHA 3H9WA 5DKKA 5DKLA 4GHIA 5F6AA 3F1PB 3ICYA 2J80A 2V9AA 3H7WB 3ZQ5A 4E04A 3LIBA 4EXOA 5HZHA 3FC7A 5HWWA 1XJ6A 3OLOA 4RQ9A 3CAXA 3E4PA 4HP4A 3PYPA 3MXQA 5TBMA 3VOLA 5EFWA 1F98A 4BBUA 3G6OA 1JNUA 5KIZA 5TBMB 1LT0A 4BBVA 1N9LA 4HH3A 4HIAA 4EEPA 1TS8A 1OTBA 2D01A 3H7WA 4EESA 2B02A 1OJGA 1T19A 3RH8B 3LICA 4HJ4A 4HOIA 3UB6A 2M1CA 1N9NA 2KX6A 4DJ2A 1V9YA 1D7EA 2JN7A 4L9FA 5A8BA 3VE3A 2JHEA 3A0VA 3GECA 4GS9B 5HSQA 1P0ZA 1S4SA 3NOPC 4JGRA 3MFXA 3UMEA 2I9VA 1TS6A 1MZUA 1XFQA 3MJQA 1OT6A 2Z6DA 4I3JA 3LIEA 4H6JB 1UGUA 2YKHA 1ODVA 1S1ZA 3NHQA 4EQ1A 5F69A 2P7JA 1S67L 5HWTA 2L1MA 2A24B 4KUKA 3CLOA 2V0UA 3UMDA 1XFNA 3IS2A 4R3AA 3E4QA 3PHYA 4F3LA 4HH2A 2W0NA 3NJAA 2W27A 2OWHA 2Z6CA 3F1NA 5IU1A 2L0WA 3K3DA 2V0WA 3F1OA 4YWZA 1S4RA 1WA9A 3B33A 4HJ3A 5J7EA 4I38A 3C8CA 4GHIB 2EA9A 1VB6A 2R78A 2QKPA 1F9IA 4PKYG 3ULFA 4BBTA 2ZOIA 3H82B 3MQQA 2WKPA 2ZBBA 5I5LA 1LSWA 2PD8A 4EEUA 2BASA 1DP8A 3LI8A 4R6LA 5DJTA 4EW7A 1OTAA 4LLOB 5J4EA 1D06A 2PYPA 3HJIA 3EWKA 2VV8A 4L9EA 5HDCA 3D72A 1OT9A 2VV7A 4EERA 5AVEA 3CWFA 1T18A 2HV1A 4XT2A 1P97A 3NOTC 1XJ4A 3E4OA 3MR0A 5DJUA 4I39A 1X0OA 4LPZA 3IS2B 3HJKA 1T1CA 2CMNA 1LSVA 1OTEA 1DP9A 1LL8A 2A24A 3C2WA 3LYXA 4GCZA 4JGQA 1T1BA 4I3IA 1T1AA 3F1OB 2PDRA 4KQDA 4WF0A 1KOUA 1OJ5A 2PD7A 2VV6A 3A0SA 5AVFA 4LRZE 1OTDA 2V1AA 5HDDA 1NWZA 2WKQA 4HJ6A 4JGOA 4HNBA 1OTIA 4NXBA 5F5YA 3UB9A 1Y28A 5HDSA 1S66L 1UWPX 2QJ7A 2K7SA 3NOUC 4KUOA 3UE6A 4M4XA 4XT2B 4B9OA 1TS0A 4K08A 3EEHA 1GSVA 4HQAA 5HD5A 3RTYA 1EW0A 3P7NA 1TS7A 4DJ3A 4NXGA 1LSXA 2PHYA 3UB7A
chains in the Genus database with same CATH superfamily
5TGFA 5FA7A 4I3AA 3G2YA 3GTCA 1YSQA 4HI4A 5HWVA 1K57C 4R70A 5FATA 1WE4A 4E3LA 2W3FA 1K56A 3MZEA 2H28A 4GB7A 1LI9A 3UDXA 2Y2NA 3Q7ZA 2PAVP 1VETA 3MXSA 2GJ3A 3MBZA 2Y2QA 4GHIA 1K25A 3S7NA 1ES2A 5EVIA 4U0XA 2BLSA 5E2FA 5EFWA 4DDYA 4ZRRA 4HH3A 4KQOA 3S4XA 3SS3A 3LICA 3TOIA 1NYMA 3IWOA 4OOLA 1RGZA 2JHEA 5HSQA 1VM1A 2GZAA 2I9VA 3PR6A 1SHVA 3IQAA 2XRNA 3ZCZA 5BOHA 4RA7A 1GA9A 3V50A 1NLYA 1ES5A 1LHYA 4WZ5C 4QB8A 2G2UA 2XD1A 5MC7A 1BLPA 1CEFA 2CC1A 4JF5A 1AXBA 4GN2A 3KYEA 3IXDA 4R6LA 1HLUP 1F2KA 3KSFA 1H0MA 3DAVA 4WYYA 1L3LA 4JGQA 1YAXA 3T1RA 4KQDA 3Q7VB 2WYXA 2NUPC 3BQ8A 5DF7A 2C5WB 3NI9A 3EEHA 2W3GA 3GQZA 3T4KA 1BSGA 2XLNA 2VK3A 2L4RA 5F68A 4PM5A 3CITA 1YKDA 3SZTA 4H6JA 4OH0A 4HHDA 3V5MA 2XK1A 3SW1A 4HY8A 1TVFA 5CHMA 3NIAA 4ARZA 5L8MA 5DKKA 5FDSA 1PW1A 1F5MA 4RQ9A 3MXQA 3VOZA 2X01A 4XUZA 2DRWA 2B02A 2X02A 1N9NA 4HBUA 1VHMA 2V20A 1IOUA 4Y3IA 3D4FA 4QD4A 3M6HA 2A24B 1HVBA 5FQKA 3IS2A 2ZL1A 1FQGA 3NJAA 2BG1A 2RL3A 2L0WA 3WS5A 4XXRA 2PBDP 2QKPA 3QNBA 2W1TB 2WKPA 2ZBBA 5I5LA 1LSWA 1RGYA 1ZKJA 2LB5A 3QP8A 2OAP1 4MLLA 1D06A 4L0LA 1K54C 4XT2A 1K56D 3NDEA 3CZDA 1G6AA 4OOYA 3HJKA 3NULA 4K0XA 1FCNA 3C2WA 1YLZA 4I3IA 1KOUA 1W8YA 3MZFA 4BL3A 3BJNA 2Y2KA 4LCLA 1CJFA 4KZ5A 4O01A 5EVID 4Q0HA 2ZMVA 4OLDA 4YOFA 3GDIA 4N1HA 4Y17A 2KDKA 3IHBA 4EBLA 4Y15A 2D02A 1FR6A 3E98A 4MN6A 5CTMA 2RCXA 1NLZA 2QJ5A 2HDQA 1L0FA 3Q81A 3LIDA 3BWLA 2Y2PA 3G31A 3LR0A 4L9GA 5DKLA 4EEPA 5F6AA 2V9AA 1YM1A 5HWWA 4ZTKA 3PYPA 3QP1A 1KE3A 3HL9A 1ZTUA 1DJAA 5A8BA 4KZ7A 3MKFA 4GS9B 3LEZA 1P0ZA 3NOPC 4ZJ3A 3DTEA 3BECA 3MJQA 5CRFA 4H6JB 1L0EA 3NCKA 4UQIM 1IYQA 2Z6CA 3ZNYA 4R1GA 4YWZA 1IYOA 1DY6A 5EVEA 5M18A 3EGDC 5LBRA 4EEUA 4UAAA 4YINA 1GCEA 4B4XA 3LY3A 3MR0A 4I39A 1ESUA 1JWPA 3HLGA 3V39A 5F5YA 4EBPA 4B93A 3ZVTA 2J9OA 4IJGA 4QY6A 5FEFA 2BTFP 3G30A 3LCEA 4IUKA 3VP1A 1HTZA 5HPIA 5EOEA 5CHUA 3FKWA 4IUHA 5HX9A 3DWKA 1IKIA 1FOFA 3D9YA 4LV2A 2JKGA 3SH7A 4LRXC 1LLBA 1MWTA 1E3UD 4S2KA 4RX3A 5KSCA 3KYQA 3G34A 4P6BA 3OPRA 4E3IA 1CEGA 4EETB 5EVLA 5GL9A 5KSHA 3Q07A 2LB9A 3QP4A 3CUEC 5TBMA 1PFLA 4ETXA 5TBMB 2Q9MA 4BBVA 4BMWA 5HAQA 3CI6A 4LV1A 3FZCA 2IA2A 1MC0A 2ZLYA 4EU0A 4GDNA 4JXGA 1ESIA 1TS6A 1W7FA 4N9LA 4JPMA 5HWTA 3ZG9B 3MQ0A 2W0NA 2W27A 1G5UA 4JXWA 3B33A 4I38A 5F1FA 4IVIA 1F9IA 2XFTA 1EWZA 2ZJ9A 3CPTA 3EGXC 3HJIA 2VV8A 1E25A 4LENA 1Y4OA 4X55A 3LYXA 1NJ4A 2Y2OA 1T1AA 4CLCC 2Y2GA 2IWBA 4E3KA 4FTXA 3LEQA 4EQIA 3JVUA 2JKTM 3JVVA 4GZBA 2V8FA 4DJ3A 4MMNA 4FSFA 4KG5A 4R4RA 1V9ZA 4X25A 5TFQA 1SKFA 2PR5A 2C6WB 5CHJA 5D3OA 1S1YA 1TEMA 1Q2QA 4KQQA 4UQIS 2J3TC 4WN5A 2P08A 4PM7A 4GS9A 1JTDA 4X1MA 1BULA 4BJPA 5L2FA 3VP3A 4R3JA 3LIBA 3FC7A 1PNEA 1PW8A 1MXOA 5KIZA 3L9KA 1LT0A 1N9LA 1TS8A 1OJGA 3HBRA 4WMCD 3RH8B 3V3SA 4JF4A 2JN7A 5GLBA 3UE0A 2Y2HA 2JBFA 3NDGA 5GLDA 2P7JA 2E8JA 3BYDA 2JC7A 1XFNA 1G68A 5FI2A 4KG2A 1PWGA 4S2JA 5IU1A 1YLWA 2GNXA 4Y0UA 4DKIA 4KZBA 4GDBA 2VGLS 3T4QA 1TD5A 4LCMA 1X0OA 1CI8A 1BTLA 4UHUA 2HP6A 4WF0A 4IHQA 2JKRM 3T1SA 3MF0A 3LR5A 2JKFA 3UPOA 2W1TA 4E6XA 1MWRA 4B9OA 1GSVA 5HD5A 1EW0A 3P7NA 1LL9A 3HLDA 3CJMA 2OOLA 2ZC4B 4DE2A 2OSUA 1D1JA 3E0YA 5G18A 2P04A 3B47A 4LV3A 1GHIA 4DE3A 2V1BA 2O9AA 4GD8A 4OONA 4HP9A 1EROA 3CG5A 2VGLM 4BWIA 2WKRA 4M3KA 2B5RA 4YNRA 3WS2A 5A90A 4ZDXA 1L2SA 3IF6A 1OTBA 5F82A 2Q9NA 3WS1A 3GSGA 4DJ2A 3ZG8B 3BRMA 4U3TA 3TW8A 3LIEA 1UGUA 4ESPA 3ITBA 3OOVA 3T1QB 1WYCA 1I5QA 4WZ5A 2HDUA 4GJ4A 1STZA 1GHPA 3GV9A 4EUVA 4E3JA 5FDHA 4HEFA 4Y7PA 4R0QA 3OC2A 1K55C 3EOIA 2Z2LB 4OVDA 1XXMA 3IXHA 5A93A 5HDCA 4R4SA 3P01A 5AVEA 2HV1A 4DE1A 1FIKA 1P97A 4KZ6A 1W63Q 3O88A 5EM1A 1OTEA 4NK3A 3DBAA 2P9VB 3B3XA 1JTGA 4Q0JA 5DTSA 1DJCA 3UB9A 3UE6A 3UB7A 4WL9A 1YQSA 4ZBEA 3VV4A 3QNCA 2FFFB 1XJ3A 4KZ8A 2KLIA 3RFBA 2W1RA 4R3BA 3TG9A 2PR6A 2J8YA 4F3LB 3U2AA 1GHMA 3G35A 1XKZA 1J3WA 2H10A 2MJ6A 2PBYA 4CPKA 1FSWA 4HIAA 5IHVA 2XEPA 1PI4A 2Y59A 1YLPA 2IWDA 2EX9A 1KGFA 4CLCE 1ERQA 4QPRA 4P6ZS 3B42A 2ACGA 3N6IA 4JKTA 3W4QA 3S7PA 3PBNA 4CLCD 4OPZA 4R3AA 4F3LA 4HH2A 3BQAA 4PM6A 2R9WA 3VP2A 1BZAA 4S2NC 1S4RA 3WS0A 4DDSA 2EA9A 3BFCA 3MS6A 5GHZA 2ZOIA 3DTIA 2PD8A 5A92A 1IYPA 5DFYA 3BFFA 1BUEA 2ZC5B 1T18A 5DVAA 2P74A 1DP9A 1H8ZA 5FQ9A 2JCHA 2PU2A 5HDDA 2WKQA 5FSRA 1CQAA 4M4XA 1K4FA 2XROA 4U0TA 4OP8A 3PAEA 2VKSA 1PWDA 2DNSA 3Q7VA 3L7HA 4GNUA 3QHYA 4X69A 3HREA 5EV0A 3DTKA 2A3UA 4K91A 1MKMA 2DMWA 1YLYA 1SZVA 4I5SA 4PPRA 5J3WA 4Y13A 4EUZA 1Q2PA 4C75A 1NZOA 2IWCA 1IEMA 2HGVA 4F94A 3H9WA 4EXOA 3VP0A 1K6RA 3OLOA 3P09A 3A3JA 2K31A 4GOGA 4S2MA 3IT9A 1FCOA 3ZG5A 3HUNA 1I2WA 5AQ9A 1I2SA 3C30A 3O87A 4KENB 3GECA 3U4LP 3IBJA 1PYYA 4Y5FA 4P6ZM 4I3JA 2WZXA 3PBTA 5FQMA 5C5KA 1M40A 4P87A 4X6TA 1CF0A 3IHAA 2FZ0A 4FH4A 4QU3A 4BENA 3KSHA 2B95A 4BQMA 5JYPA 1KGEA 4E3OA 4GHIB 5J4EA 2ZQ9A 4P85A 4DE0A 4ZAMA 1W79A 1U60A 3M2KA 1KDWA 1XGIA 4K0WA 4FUWA 3UY6A 2CMNA 4NETA 1LL8A 5G4YA 3WS4A 3MMHA 5GLAA 4B4ZA 1A0KA 3S22A 1KE0A 2XGNA 2ZQDA 4HNBA 1K0KA 3OZHA 5FAPA 3E2KA 1WYBA 1DJBA 4MNRA 5CGSA 5EE8A 4IVKA 3IX4A 3MQOA 1XJ2A 1IELA 3K3CA 3S7OA 2ZMFA 2HP9A 2E8IA 5U47A 4OP5A 4LRYC 5IT5A 4OPYA 1W8QA 4QJGA 2XQZA 1HZOA 3ICYA 5HZHA 1ES3A 4A5RA 4WZ4A 3NBLA 3BM6A 4BBUA 5E2EA 5JYOA 3PBQA 3S7QA 1KVMA 3ITAA 2QPNA 3A3EA 1PI5A 3MXRA 3PAGA 3DW0A 3PXPA 2EX2A 5FAOA 1OPXA 1W5DA 4JGRA 2VJWA 4OKPA 1YLTA 1OMEA 5F69A 4UA9A 2V0UA 3CHWP 3E4QA 4N1XA 3UE3A 3GRJA 3G4PA 2ZQCA 4Y2FA 1WA9A 4QWOA 5DFXA 3C4PA 4BBTA 5A91A 4D60A 2J9PA 1OTAA 1PZPA 1NRFA 4Q0IA 1KVLA 5GHYA 3RXXA 1LI0A 2XDMA 3IF5A 3UDIA 4LPZA 3R7WA 2P9VA 4DXBA 4OOMA 3F1OB 1OJ5A 2FFYA 1H8YA 1SKOA 2PD7A 4JGOA 4PM8A 3R7WB 2NUTC 1UWPX 5FQJA 1SCWA 4NXGA 1TF1A 1KDSA 4FH2A 2Q0OA 4EBNA 3F1NB 3K2NA 5DF9A 2WADA 2PYRA 2XFSA 1BYWA 2EX6A 2Y2LA 3KX0X 3W8KA 2EXBA 3FWLA 5J8XA 1UWNX 4R38A 4NG2A 3FG8A 2VGJA 3R4KA 1TDGA 1XA7A 5G4ZA 1K57A 3SH9A 3H7WB 3UNWA 3C7UA 4HP4A 2VX8A 1F98A 3BFDA 3G6OA 3PTEA 4G3WA 2M7VA 4N92A 3T4SA 3PBOA 1Z09A 2ZQ7A 2WGWB 2WGVA 3OCLA 2W3HA 5FQQA 3VE3A 1SDNA 2ZM2A 2W3EA 3FPWA 1K55A 1S1ZA 2ZC7A 4LFUA 2J3WA 2L1MA 3CLOA 3UMDA 2AVXA 5TJJA 2G7UA 2OWHA 5CERA 3OPLA 3MSHA 3VSLA 3V3RA 1VB6A 1Z6FA 2V1ZA 4DN0A 2Y2JA 3W4OA 3HCYA 4LLOB 4KG6A 3UN7A 1JWVA 4R23A 3ZVWA 3QP2A 2R9XA 3BEBA 4UA6A 1BT5A 1T1CA 2DCFA 2ZM0A 3EQVA 3SH8A 2KOIA 2XF3A 3UPNA 2VGKA 4HQAA 1IFQA 1QMFA 3T4OA 2HJ9C 3ZFZA 1L0GA 3VOYA 1S0WA 2EX8A 1GA0A 4JXSA 2GX5A 5HAIA 3IXGA 1N9OA 4NKPA 2YKFA 2A2LA 3ISGA 2VLGA 3M2JA 3LIAA 3MFDA 1K4EA 5FI7A 2ZOHA 1Y54A 1YMXA 1ES4A 4G3KA 1XJ6A 3ZHHA 3C5AA 3CAXA 3E4PA 4OQHA 5CTNA 4BL2A 1JNUA 1HD8A 3GMWA 4Z1WA 4EWFA 2PU4A 1MBLA 3M6BA 3PBRA 4HJ4A 5DTKA 3ZG7B 5K5BA 3I7JA 1C3BA 2A49A 3IX3A 4GKUA 4Y0OA 1VEUA 3C8CA 5HAPA 4CLCA 3FKVA 1SKOB 1DP8A 1NRJA 4Y0TA 4OQ0A 2HDRA 3ZDJA 3AGDA 2ZC6B 2WAFA 2K2NA 4RVAA 2VA0A 4LRZE 1FCMA 4HJ6A 4NXBA 1OTIA 5HDSA 1YPRA 2WKEA 2QJ7A 3C4OA 4NEED 1TS0A 5HL6A 3CPTB 1TS7A 1LSXA 4S2OA 2B18A 3FPVA 2INWA 2ZMAA 2EWVA 2ZQAA 3LUQA 4NXEA 4S2IA 3IWQA 4WLAA 4HESA 5HL1A 5AJGA 5F83A 2Y55A 2Y91A 4GD6A 4WUJA 3T50A 2ZQ8A 4BD0A 5GHXA 1DP6A 3VE4A 1E4DA 4KZAA 2EFXA 3HVFA 2ZL1B 3IXBA 4X56A 2J80A 2G2WA 3O86A 5KZHA 5CGWA 5HARA 3A3DA 3D3OA 4II7A 4B88A 5FASA 3TSGA 2HF6A 3IH9A 3UB6A 1V9YA 2J3TD 3UO9A 2EWWA 1OT6A 1YLJA 1ODVA 4S2NA 4MDZA 2OV5A 3TRCA 3N8SA 3MKEA 2WKIA 4UA7A 4OPRA 3UE1A 2HPBA 3K3DA 2JKTI 1BLCA 2H0YA 2R78A 4ZJ2A 3EQUA 3W4PA 1K38A 3H82B 3AGEA 3LI8A 4MEZA 4EW7A 3EWKA 5I94A 3WWXA 5DJUA 3N4IA 4IEDA 3IS2B 1LSVA 2A24A 3HLWA 3UPPA 3SS4A 3WRZA 2FH5A 3KSIA 3LO7A 1S66L 1YMSA 4CLCB 1LL5A 3JPUA 3RTYA 3DTMA 2JKRI 2OWJA 4LV0A 3C38A 5EVIC 1MPLA 4PMAA 5HFOA 4FD8A 4OPQA 5EPHA 3T4TA 4S2PA 4DMZA 2Y4AA 4WM9A 5E43A 3ZG0A 4RX2A 4X68A 3IBRA 3ZGAB 5FAQA 2VZWA 1NYYA 4ARZB 3VSKA 3H82A 4MN7A 3F1PA 1AWIA 3F1PB 4WMCA 5GLCA 3CMZA 3DWZA 3VFFA 2Y2MA 1YSPA 3SOIA 3IF6B 5CGXA 3BLMA 1T19A 1PZOA 2EXAA 4AFIA 2O99A 2O9BA 1H3QA 1D7EA 1RCJA 3A0VA 1S4SA 3MFXA 1MZUA 2XA7M 4HBTA 1G6OA 1FILA 2OLVA 2ZM8A 4N9KA 5EVIB 3OCNA 1E3UA 1FR1A 5EECA 3VP4A 3RJUA 2HP5A 1H5XA 4WEJA 2J7VA 3T1XA 3AGFA 4IBXA 1NXYA 2XSSA 5E2HA 3LR4A 3HUOA 3OBFA 4EERA 2OLUA 3CWFA 4DF6A 3N7WA 1XJ4A 3VFHA 3NC8A 3ZNTA 1T1BA 1MWSA 3LGOA 3GR2A 1OTDA 2QZ6A 3N8LA 4WBGA 3UDFA 1PRQA 4KZ9A 1M6KA 3NOUC 4KUOA 5EM0A 4K08A 1EI5A 1VQQA 1BLHA 4OQIA 3MZDA 5FQIA 3SS5A 4EV4A 3N8RA 4P0MA 4S2LA 2GDNA 4NXFA 3A0RA 2QMIA 1L0DA 4OLGA 5F1GA 3LI9A 3VMAA 5CECA 1G28A 5M19A 1VETB 4JLFA 3O3VA 3UB8A 5HD3A 1ZG4A 1VEUB 3ZQ5A 3Q1FA 3TE8A 5FI6A 3FV7A 3VOLA 2PT7A 3TJZC 4C6YA 5CEBA 5M1AA 3H7WA 5KMWA 2HZ5A 1MKIA 3IF6C 3KSGA 5FL3A 2W3DA 2KX6A 5L09A 3P98A 3HLEA 1TDLA 1XGJA 4O0PA 5DF8A 4KQRA 4YFMA 3V67A 4MCWA 5AQAA 3NHQA 4JBFA 1CI9A 2ZD8A 1ONHA 4E3MA 4MBFA 3F1NA 1NY0A 2V0WA 1N9BA 2WKHA 3NECA 2WAEA 2PRFA 1H8MA 2BASA 3QP5A 1J9MA 1PWCA 2WK0A 4X1LA 2OAQ1 3E4OA 4DXCA 4JF6A 4BLMA 4GCZA 4LGWA 1KGGA 4KZ3A 2VV6A 1O07A 2V1AA 1BLSA 1Y28A 5HW3A 1JWZA 2K7SA 2XD5A 3T4LA 1S6RA 3LFVA 2Y79A 2PHYA 1IKGA 1P9WA 1P9RA 1ZHHB 1DRMA 4PM9A 1RP5A 2Y2IA 3LIFA 4MBHA 2O0YA 1CK3A 3LR3A 4JGPA 4C3QA 1QMEA 1GSWA 2VEAA 4ID4A 4G3VA 2QWSA 4MBKA 3IX8A 1MWUA 3G2ZA 4WEKA 4Q8IA 5EOOA 4OQGA 3NY4A 3UB5P 5AQBA 3A3FA 2WGIA 5E2GA 1ZC2A 5CXWA 3EEAA 2O9CA 1ALQA 4DRTA 4CJNA 4QY5A 4L9FA 3UMEA 2HDSA 1ONGA 3BFEA 2YKHA 1XA1A 1S67L 1PIOA 1ZG6A 4JXVA 4PHTA 3PHYA 1XX2A 4HJ3A 5J7EA 1O7EA 5FEGA 2UV0E 3IH8A 3BLSA 2H5SA 5CX7A 1KE4A 3A3IA 3HLFA 1XPBA 2ZC3B 1ACFA 2VV7A 3NOTC 4IBRA 2WUQA 4FOFA 5CEDA 3FYZA 3LY4A 4KZ4A 2XA7S 1NWZA 1YT4A 4PAUA 5AVFA 1N4OA 5EUAA 1FSYA 1JVJA 4PKYA 3OPHA 4GW9A 1IYSA 3QP6A 1K6SA 5IS1A 1GSXA 2HJEA 3BY8A 2WGWA 4MN5A 4D2OA 5HPFA 3BW6A 3BY9A 1ERMA 3W2ZA 2QHKA 2EFUA 3PBSA 2UWXA 4E04A 4UEYA 4O7DA 4E3NA 4X53A 4WELA 5L07A 2H0TA 3ZYTA 3WRTA 3HUMA 2D01A 4EESA 4CQHA 1SDEA 3JYIA 4XUXA 4HOIA 2M1CA 4E6WA 2V8CA 2V2FF 2QYBA 1XFQA 4QHCA 2Z6DA 4Z9QA 2JE5A 3CUEA 5AQ7A 4H8RA 4EQ1A 2Z2MB 4KUKA 5DTTA 3HLBA 4FCFA 2M7UA 3OPPA 3F1OA 3KO6A 4ETZA 2X71A 4PKYG 3ULFA 3T12B 2I72A 3MQQA 3S1YA 3HLCA 3KYZA 2XR0A 3GVBA 5DJTA 2PYPA 2WZZA 4L9EA 3T4JA 3D72A 3O5YA 1OT9A 3Q82A 4ZJ1A 1MY8A 1NZUA 4RYEA 2XH9A 4O8GA 2Y8HA 3IWIA 3RXWA 1K54A 4GLQA 2PDRA 3A0SA 3BFGA 3E2LA 3G32A 1XP4A 4XT2B 1W63M 3C7VA 4BD1A 5L10A 5TR7A 4ME4A
chains in the Genus database with same CATH topology
2OWJA 3C38A 1V9ZA 4I3AA 3T4TA 2PR5A 1YSQA 3MQOA 4HI4A 1XJ2A 5HWVA 4R70A 4DMZA 1S1YA 3K3CA 3S7OA 2ZMFA 2W3FA 2H28A 4UQIS 3IBRA 2J3TC 2VZWA 4WN5A 2P08A 4LRYC 5IT5A 4GS9A 4ARZB 4BJPA 3H82A 2GJ3A 4MN7A 3F1PA 4GHIA 3F1PB 3ICYA 5HZHA 3LIBA 3FC7A 3S7NA 5EFWA 4BBUA 5KIZA 1LT0A 4ZRRA 1N9LA 4HH3A 1YSPA 3PBQA 3S7QA 1TS8A 4KQOA 1OJGA 1T19A 3RH8B 3LICA 4AFIA 2O99A 2O9BA 3PXPA 4OOLA 1H3QA 1D7EA 2JN7A 1OPXA 2JHEA 3A0VA 5HSQA 1S4SA 4JGRA 3MFXA 2GZAA 2I9VA 1MZUA 3PR6A 2XA7M 2VJWA 2XRNA 1G6OA 3OCNA 1NLYA 5F69A 2P7JA 2V0UA 1XFNA 3E4QA 5IU1A 3UE3A 4WEJA 4Y2FA 1WA9A 5DFXA 5MC7A 2GNXA 2XSSA 4BBTA 3LR4A 4R6LA 1OTAA 2VGLS 3OBFA 4Q0IA 3T4QA 4EERA 3KSFA 1TD5A 3CWFA 1XJ4A 1X0OA 4LPZA 3R7WA 4OOMA 4WF0A 4JGQA 1T1BA 1YAXA 4IHQA 2JKRM 3F1OB 4KQDA 1OJ5A 2PD7A 3MF0A 1OTDA 3LR5A 4JGOA 3R7WB 2NUPC 2NUTC 3BQ8A 1UWPX 3NOUC 4KUOA 2W1TA 4B9OA 4K08A 3EEHA 1GSVA 2W3GA 5HD5A 1EW0A 3P7NA 4NXGA 1TF1A 3T4KA 2OOLA 3F1NB 3K2NA 5DF9A 2PYRA 1BYWA 2L4RA 5F68A 3E0YA 4NXFA 2P04A 3B47A 3A0RA 3CITA 1YKDA 3KX0X 4H6JA 4HHDA 2V1BA 1UWNX 4R38A 3SW1A 2O9AA 3FG8A 3R4KA 3LI9A 1G28A 4HY8A 4HP9A 5G4ZA 3UB8A 4ARZA 2VGLM 5HD3A 5L8MA 4BWIA 2WKRA 5DKKA 4YNRA 3ZQ5A 3H7WB 3TE8A 1F5MA 4RQ9A 4HP4A 3MXQA 2PT7A 2VX8A 3TJZC 1F98A 3VOLA 3G6OA 4G3WA 2M7VA 3T4SA 1OTBA 3H7WA 3PBOA 2B02A 3OCLA 3KSGA 5FL3A 1N9NA 2KX6A 2W3DA 4DJ2A 2W3HA 3VE3A 1VHMA 2W3EA 3FPWA 4O0PA 1IOUA 3TW8A 3LIEA 1UGUA 4Y3IA 3V67A 4MCWA 3OOVA 3NHQA 1S1ZA 4GJ4A 2J3WA 2L1MA 2A24B 3CLOA 1STZA 3UMDA 5TJJA 3IS2A 2G7UA 4EUVA 3NJAA 2OWHA 3F1NA 2L0WA 2V0WA 1VB6A 2QKPA 3OC2A 3EOIA 4DN0A 2W1TB 2WKPA 2ZBBA 5I5LA 1LSWA 1H8MA 2BASA 3HCYA 2LB5A 2OAP1 4LLOB 1D06A 5HDCA 3P01A 5AVEA 4L0LA 2HV1A 4XT2A 1P97A 2OAQ1 3E4OA 3HJKA 1W63Q 1T1CA 1OTEA 3C2WA 4GCZA 3DBAA 4I3IA 1KOUA 2VV6A 2V1AA 3EQVA 4Q0JA 2KOIA 3BJNA 3UB9A 1Y28A 3UE6A 2K7SA 3T4LA 4O01A 3LFVA 4HQAA 2Y79A 1IFQA 3T4OA 2PHYA 3UB7A 2HJ9C 4Q0HA 4WL9A 2ZMVA 1P9WA 1P9RA 1ZHHB 4YOFA 1DRMA 3GDIA 3VV4A 2KDKA 3LIFA 2GX5A 1N9OA 4NKPA 2O0YA 2YKFA 3LR3A 2D02A 3E98A 4MN6A 1XJ3A 2A2LA 2KLIA 1NLZA 3RFBA 2QJ5A 2VLGA 4JGPA 3LIDA 3LIAA 3BWLA 1GSWA 2VEAA 2W1RA 2PR6A 3LR0A 4L9GA 4G3VA 4F3LB 2QWSA 3U2AA 2ZOHA 5DKLA 4EEPA 5F6AA 2V9AA 4G3KA 5HWWA 1XJ6A 4WEKA 3CAXA 3E4PA 3PYPA 1JNUA 2MJ6A 4HIAA 4Z1WA 1ZTUA 3EEAA 2O9CA 3PBRA 4HJ4A 5A8BA 4L9FA 4CLCE 4GS9B 1P0ZA 3NOPC 3UMEA 3MJQA 4QPRA 4P6ZS 4H6JB 5K5BA 3B42A 2YKHA 3S7PA 1S67L 3PBNA 4CLCD 4PHTA 4R3AA 3PHYA 4UQIM 4F3LA 4HH2A 3BQAA 2Z6CA 4YWZA 1S4RA 4HJ3A 5J7EA 3C8CA 2EA9A 2ZOIA 3EGDC 4CLCA 2PD8A 5LBRA 4EEUA 1NRJA 1DP8A 5CX7A 5DFYA 2VV7A 1T18A 3NOTC 3MR0A 4I39A 4FOFA 2K2NA 1DP9A 2XA7S 5F5YA 2VA0A 4B93A 4LRZE 5HDDA 1NWZA 2WKQA 4HJ6A 4NXBA 1OTIA 4IJGA 5HDSA 2QJ7A 4NEED 4M4XA 1TS0A 2XROA 5HL6A 1TS7A 4PAUA 1LSXA 5AVFA 4IUKA 5HPIA 2VKSA 2B18A 3FPVA 4IUHA 4PKYA 2INWA 2EWVA 4GW9A 3LUQA 4NXEA 5IS1A 1GSXA 2HJEA 4LRXC 3BY8A 1MKMA 2DMWA 4WLAA 4MN5A 5AJGA 4I5SA 5HPFA 3BW6A 3BY9A 4WUJA 3T50A 5J3WA 3KYQA 3W2ZA 2QHKA 1DP6A 3VE4A 3PBSA 4EETB 2HGVA 3H9WA 4EXOA 4E04A 2J80A 4UEYA 5KSHA 3OLOA 4WELA 2LB9A 3CUEC 5TBMA 4ETXA 2K31A 3D3OA 5TBMB 4BBVA 3ZYTA 4II7A 4BMWA 3CI6A 2D01A 4EESA 4CQHA 2HF6A 2IA2A 4HOIA 3UB6A 1MC0A 3C30A 2M1CA 4EU0A 1V9YA 2J3TD 3GECA 2QYBA 3IBJA 2EWWA 1TS6A 1XFQA 4Y5FA 1OT6A 2Z6DA 4P6ZM 4I3JA 3CUEA 3PBTA 5C5KA 1ODVA 4EQ1A 3TRCA 4MDZA 5HWTA 2FZ0A 4KUKA 3KSHA 3MQ0A 2W0NA 2W27A 2M7UA 3K3DA 2JKTI 3F1OA 3KO6A 4ETZA 3B33A 4I38A 4GHIB 2R78A 1F9IA 4PKYG 3EQUA 3ULFA 3H82B 3MQQA 3KYZA 5DJTA 3LI8A 4EW7A 5J4EA 2PYPA 3EGXC 3HJIA 3EWKA 2VV8A 4L9EA 3T4JA 3D72A 3O5YA 1OT9A 5DJUA 4O8GA 3IS2B 2Y8HA 2CMNA 3LYXA 1LSVA 1LL8A 2A24A 5G4YA 4GLQA 1T1AA 3MMHA 2PDRA 4CLCC 3A0SA 4HNBA 2FH5A 3KSIA 1S66L 4CLCB 4XT2B 3JVUA 1W63M 2JKTM 3JVVA 3RTYA 2JKRI 4DJ3A 4MMNA 4FSFA 4ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOL A;  2OWJ A;  4WL9 A;  5G4Y A;  1V9Z A;  3F1N B;  4PKY A;  2INW A;  4I3A A;  2PR5 A;  1DRM A;  3GDI A;  3MQO A;  4HI4 A;  1XJ2 A;  2PYR A;  4R70 A;  5HWV A;  1BYW A;  2L4R A;  5F68 A;  4GW9 A;  1S1Y A;  2KDK A;  3K3C A;  3LIF A;  3LUQ A;  4NXF A;  3A0R A;  4NXE A;  1N9O A;  2YKF A;  3KX0 X;  1GSX A;  4H6J A;  5IS1 A;  2D02 A;  3BY8 A;  4LRX C;  4MN6 A;  1XJ3 A;  4HHD A;  2H28 A;  4WLA A;  2V1B A;  1UWN X;  2QJ5 A;  4MN5 A;  4R38 A;  3IBR A;  4I5S A;  2VLG A;  4JGP A;  3SW1 A;  3FG8 A;  3LID A;  3LIA A;  3BWL A;  4WN5 A;  1GSW A;  4LRY C;  3BY9 A;  4WUJ A;  2VEA A;  3LI9 A;  5J3W A;  1G28 A;  4HY8 A;  3T50 A;  4GS9 A;  4HP9 A;  5G4Z A;  2QHK A;  1DP6 A;  2PR6 A;  3VE4 A;  3H82 A;  3UB8 A;  4EET B;  4L9G A;  5HD3 A;  4F3L B;  2QWS A;  2GJ3 A;  3F1P A;  2WKR A;  2ZOH A;  3H9W A;  5DKK A;  5DKL A;  4GHI A;  5F6A A;  3F1P B;  3ICY A;  2J80 A;  2V9A A;  3H7W B;  3ZQ5 A;  4E04 A;  3LIB A;  4EXO A;  5HZH A;  3FC7 A;  5HWW A;  1XJ6 A;  3OLO A;  4RQ9 A;  3CAX A;  3E4P A;  4HP4 A;  3PYP A;  3MXQ A;  5TBM A;  3VOL A;  5EFW A;  1F98 A;  4BBU A;  3G6O A;  1JNU A;  5KIZ A;  5TBM B;  1LT0 A;  4BBV A;  1N9L A;  4HH3 A;  4HIA A;  4EEP A;  1TS8 A;  1OTB A;  2D01 A;  3H7W A;  4EES A;  2B02 A;  1OJG A;  1T19 A;  3RH8 B;  3LIC A;  4HJ4 A;  4HOI A;  3UB6 A;  2M1C A;  1N9N A;  2KX6 A;  4DJ2 A;  1V9Y A;  1D7E A;  2JN7 A;  4L9F A;  5A8B A;  3VE3 A;  2JHE A;  3A0V A;  3GEC A;  4GS9 B;  5HSQ A;  1P0Z A;  1S4S A;  3NOP C;  4JGR A;  3MFX A;  3UME A;  2I9V A;  1TS6 A;  1MZU A;  1XFQ A;  3MJQ A;  1OT6 A;  2Z6D A;  4I3J A;  3LIE A;  4H6J B;  1UGU A;  2YKH A;  1ODV A;  1S1Z A;  3NHQ A;  4EQ1 A;  5F69 A;  2P7J A;  1S67 L;  5HWT A;  2L1M A;  2A24 B;  4KUK A;  3CLO A;  2V0U A;  3UMD A;  1XFN A;  3IS2 A;  4R3A A;  3E4Q A;  3PHY A;  4F3L A;  4HH2 A;  2W0N A;  3NJA A;  2W27 A;  2OWH A;  2Z6C A;  3F1N A;  5IU1 A;  2L0W A;  3K3D A;  2V0W A;  3F1O A;  4YWZ A;  1S4R A;  1WA9 A;  3B33 A;  4HJ3 A;  5J7E A;  4I38 A;  3C8C A;  4GHI B;  2EA9 A;  1VB6 A;  2R78 A;  2QKP A;  1F9I A;  4PKY G;  3ULF A;  4BBT A;  2ZOI A;  3H82 B;  3MQQ A;  2WKP A;  2ZBB A;  5I5L A;  1LSW A;  2PD8 A;  4EEU A;  2BAS A;  1DP8 A;  3LI8 A;  4R6L A;  5DJT A;  4EW7 A;  1OTA A;  4LLO B;  5J4E A;  1D06 A;  2PYP A;  3HJI A;  3EWK A;  2VV8 A;  4L9E A;  5HDC A;  3D72 A;  1OT9 A;  2VV7 A;  4EER A;  5AVE A;  3CWF A;  1T18 A;  2HV1 A;  4XT2 A;  1P97 A;  3NOT C;  1XJ4 A;  3E4O A;  3MR0 A;  5DJU A;  4I39 A;  1X0O A;  4LPZ A;  3IS2 B;  3HJK A;  1T1C A;  2CMN A;  1LSV A;  1OTE A;  1DP9 A;  1LL8 A;  2A24 A;  3C2W A;  3LYX A;  4GCZ A;  4JGQ A;  1T1B A;  4I3I A;  1T1A A;  3F1O B;  2PDR A;  4KQD A;  4WF0 A;  1KOU A;  1OJ5 A;  2PD7 A;  2VV6 A;  3A0S A;  5AVF A;  4LRZ E;  1OTD A;  2V1A A;  5HDD A;  1NWZ A;  2WKQ A;  4HJ6 A;  4JGO A;  4HNB A;  1OTI A;  4NXB A;  5F5Y A;  3UB9 A;  1Y28 A;  5HDS A;  1S66 L;  1UWP X;  2QJ7 A;  2K7S A;  3NOU C;  4KUO A;  3UE6 A;  4M4X A;  4XT2 B;  4B9O A;  1TS0 A;  4K08 A;  3EEH A;  1GSV A;  4HQA A;  5HD5 A;  3RTY A;  1EW0 A;  3P7N A;  1TS7 A;  4DJ3 A;  4NXG A;  1LSX A;  2PHY A;  3UB7 A; 
#chains in the Genus database with same CATH topology
 5TGF A;  5FA7 A;  4I3A A;  3G2Y A;  3GTC A;  1YSQ A;  4HI4 A;  5HWV A;  1K57 C;  4R70 A;  5FAT A;  1WE4 A;  4E3L A;  2W3F A;  1K56 A;  3MZE A;  2H28 A;  4GB7 A;  1LI9 A;  3UDX A;  2Y2N A;  3Q7Z A;  2PAV P;  1VET A;  3MXS A;  2GJ3 A;  3MBZ A;  2Y2Q A;  4GHI A;  1K25 A;  3S7N A;  1ES2 A;  5EVI A;  4U0X A;  2BLS A;  5E2F A;  5EFW A;  4DDY A;  4ZRR A;  4HH3 A;  4KQO A;  3S4X A;  3SS3 A;  3LIC A;  3TOI A;  1NYM A;  3IWO A;  4OOL A;  1RGZ A;  2JHE A;  5HSQ A;  1VM1 A;  2GZA A;  2I9V A;  3PR6 A;  1SHV A;  3IQA A;  2XRN A;  3ZCZ A;  5BOH A;  4RA7 A;  1GA9 A;  3V50 A;  1NLY A;  1ES5 A;  1LHY A;  4WZ5 C;  4QB8 A;  2G2U A;  2XD1 A;  5MC7 A;  1BLP A;  1CEF A;  2CC1 A;  4JF5 A;  1AXB A;  4GN2 A;  3KYE A;  3IXD A;  4R6L A;  1HLU P;  1F2K A;  3KSF A;  1H0M A;  3DAV A;  4WYY A;  1L3L A;  4JGQ A;  1YAX A;  3T1R A;  4KQD A;  3Q7V B;  2WYX A;  2NUP C;  3BQ8 A;  5DF7 A;  2C5W B;  3NI9 A;  3EEH A;  2W3G A;  3GQZ A;  3T4K A;  1BSG A;  2XLN A;  2VK3 A;  2L4R A;  5F68 A;  4PM5 A;  3CIT A;  1YKD A;  3SZT A;  4H6J A;  4OH0 A;  4HHD A;  3V5M A;  2XK1 A;  3SW1 A;  4HY8 A;  1TVF A;  5CHM A;  3NIA A;  4ARZ A;  5L8M A;  5DKK A;  5FDS A;  1PW1 A;  1F5M A;  4RQ9 A;  3MXQ A;  3VOZ A;  2X01 A;  4XUZ A;  2DRW A;  2B02 A;  2X02 A;  1N9N A;  4HBU A;  1VHM A;  2V20 A;  1IOU A;  4Y3I A;  3D4F A;  4QD4 A;  3M6H A;  2A24 B;  1HVB A;  5FQK A;  3IS2 A;  2ZL1 A;  1FQG A;  3NJA A;  2BG1 A;  2RL3 A;  2L0W A;  3WS5 A;  4XXR A;  2PBD P;  2QKP A;  3QNB A;  2W1T B;  2WKP A;  2ZBB A;  5I5L A;  1LSW A;  1RGY A;  1ZKJ A;  2LB5 A;  3QP8 A;  2OAP 1;  4MLL A;  1D06 A;  4L0L A;  1K54 C;  4XT2 A;  1K56 D;  3NDE A;  3CZD A;  1G6A A;  4OOY A;  3HJK A;  3NUL A;  4K0X A;  1FCN A;  3C2W A;  1YLZ A;  4I3I A;  1KOU A;  1W8Y A;  3MZF A;  4BL3 A;  3BJN A;  2Y2K A;  4LCL A;  1CJF A;  4KZ5 A;  4O01 A;  5EVI D;  4Q0H A;  2ZMV A;  4OLD A;  4YOF A;  3GDI A;  4N1H A;  4Y17 A;  2KDK A;  3IHB A;  4EBL A;  4Y15 A;  2D02 A;  1FR6 A;  3E98 A;  4MN6 A;  5CTM A;  2RCX A;  1NLZ A;  2QJ5 A;  2HDQ A;  1L0F A;  3Q81 A;  3LID A;  3BWL A;  2Y2P A;  3G31 A;  3LR0 A;  4L9G A;  5DKL A;  4EEP A;  5F6A A;  2V9A A;  1YM1 A;  5HWW A;  4ZTK A;  3PYP A;  3QP1 A;  1KE3 A;  3HL9 A;  1ZTU A;  1DJA A;  5A8B A;  4KZ7 A;  3MKF A;  4GS9 B;  3LEZ A;  1P0Z A;  3NOP C;  4ZJ3 A;  3DTE A;  3BEC A;  3MJQ A;  5CRF A;  4H6J B;  1L0E A;  3NCK A;  4UQI M;  1IYQ A;  2Z6C A;  3ZNY A;  4R1G A;  4YWZ A;  1IYO A;  1DY6 A;  5EVE A;  5M18 A;  3EGD C;  5LBR A;  4EEU A;  4UAA A;  4YIN A;  1GCE A;  4B4X A;  3LY3 A;  3MR0 A;  4I39 A;  1ESU A;  1JWP A;  3HLG A;  3V39 A;  5F5Y A;  4EBP A;  4B93 A;  3ZVT A;  2J9O A;  4IJG A;  4QY6 A;  5FEF A;  2BTF P;  3G30 A;  3LCE A;  4IUK A;  3VP1 A;  1HTZ A;  5HPI A;  5EOE A;  5CHU A;  3FKW A;  4IUH A;  5HX9 A;  3DWK A;  1IKI A;  1FOF A;  3D9Y A;  4LV2 A;  2JKG A;  3SH7 A;  4LRX C;  1LLB A;  1MWT A;  1E3U D;  4S2K A;  4RX3 A;  5KSC A;  3KYQ A;  3G34 A;  4P6B A;  3OPR A;  4E3I A;  1CEG A;  4EET B;  5EVL A;  5GL9 A;  5KSH A;  3Q07 A;  2LB9 A;  3QP4 A;  3CUE C;  5TBM A;  1PFL A;  4ETX A;  5TBM B;  2Q9M A;  4BBV A;  4BMW A;  5HAQ A;  3CI6 A;  4LV1 A;  3FZC A;  2IA2 A;  1MC0 A;  2ZLY A;  4EU0 A;  4GDN A;  4JXG A;  1ESI A;  1TS6 A;  1W7F A;  4N9L A;  4JPM A;  5HWT A;  3ZG9 B;  3MQ0 A;  2W0N A;  2W27 A;  1G5U A;  4JXW A;  3B33 A;  4I38 A;  5F1F A;  4IVI A;  1F9I A;  2XFT A;  1EWZ A;  2ZJ9 A;  3CPT A;  3EGX C;  3HJI A;  2VV8 A;  1E25 A;  4LEN A;  1Y4O A;  4X55 A;  3LYX A;  1NJ4 A;  2Y2O A;  1T1A A;  4CLC C;  2Y2G A;  2IWB A;  4E3K A;  4FTX A;  3LEQ A;  4EQI A;  3JVU A;  2JKT M;  3JVV A;  4GZB A;  2V8F A;  4DJ3 A;  4MMN A;  4FSF A;  4KG5 A;  4R4R A;  1V9Z A;  4X25 A;  5TFQ A;  1SKF A;  2PR5 A;  2C6W B;  5CHJ A;  5D3O A;  1S1Y A;  1TEM A;  1Q2Q A;  4KQQ A;  4UQI S;  2J3T C;  4WN5 A;  2P08 A;  4PM7 A;  4GS9 A;  1JTD A;  4X1M A;  1BUL A;  4BJP A;  5L2F A;  3VP3 A;  4R3J A;  3LIB A;  3FC7 A;  1PNE A;  1PW8 A;  1MXO A;  5KIZ A;  3L9K A;  1LT0 A;  1N9L A;  1TS8 A;  1OJG A;  3HBR A;  4WMC D;  3RH8 B;  3V3S A;  4JF4 A;  2JN7 A;  5GLB A;  3UE0 A;  2Y2H A;  2JBF A;  3NDG A;  5GLD A;  2P7J A;  2E8J A;  3BYD A;  2JC7 A;  1XFN A;  1G68 A;  5FI2 A;  4KG2 A;  1PWG A;  4S2J A;  5IU1 A;  1YLW A;  2GNX A;  4Y0U A;  4DKI A;  4KZB A;  4GDB A;  2VGL S;  3T4Q A;  1TD5 A;  4LCM A;  1X0O A;  1CI8 A;  1BTL A;  4UHU A;  2HP6 A;  4WF0 A;  4IHQ A;  2JKR M;  3T1S A;  3MF0 A;  3LR5 A;  2JKF A;  3UPO A;  2W1T A;  4E6X A;  1MWR A;  4B9O A;  1GSV A;  5HD5 A;  1EW0 A;  3P7N A;  1LL9 A;  3HLD A;  3CJM A;  2OOL A;  2ZC4 B;  4DE2 A;  2OSU A;  1D1J A;  3E0Y A;  5G18 A;  2P04 A;  3B47 A;  4LV3 A;  1GHI A;  4DE3 A;  2V1B A;  2O9A A;  4GD8 A;  4OON A;  4HP9 A;  1ERO A;  3CG5 A;  2VGL M;  4BWI A;  2WKR A;  4M3K A;  2B5R A;  4YNR A;  3WS2 A;  5A90 A;  4ZDX A;  1L2S A;  3IF6 A;  1OTB A;  5F82 A;  2Q9N A;  3WS1 A;  3GSG A;  4DJ2 A;  3ZG8 B;  3BRM A;  4U3T A;  3TW8 A;  3LIE A;  1UGU A;  4ESP A;  3ITB A;  3OOV A;  3T1Q B;  1WYC A;  1I5Q A;  4WZ5 A;  2HDU A;  4GJ4 A;  1STZ A;  1GHP A;  3GV9 A;  4EUV A;  4E3J A;  5FDH A;  4HEF A;  4Y7P A;  4R0Q A;  3OC2 A;  1K55 C;  3EOI A;  2Z2L B;  4OVD A;  1XXM A;  3IXH A;  5A93 A;  5HDC A;  4R4S A;  3P01 A;  5AVE A;  2HV1 A;  4DE1 A;  1FIK A;  1P97 A;  4KZ6 A;  1W63 Q;  3O88 A;  5EM1 A;  1OTE A;  4NK3 A;  3DBA A;  2P9V B;  3B3X A;  1JTG A;  4Q0J A;  5DTS A;  1DJC A;  3UB9 A;  3UE6 A;  3UB7 A;  4WL9 A;  1YQS A;  4ZBE A;  3VV4 A;  3QNC A;  2FFF B;  1XJ3 A;  4KZ8 A;  2KLI A;  3RFB A;  2W1R A;  4R3B A;  3TG9 A;  2PR6 A;  2J8Y A;  4F3L B;  3U2A A;  1GHM A;  3G35 A;  1XKZ A;  1J3W A;  2H10 A;  2MJ6 A;  2PBY A;  4CPK A;  1FSW A;  4HIA A;  5IHV A;  2XEP A;  1PI4 A;  2Y59 A;  1YLP A;  2IWD A;  2EX9 A;  1KGF A;  4CLC E;  1ERQ A;  4QPR A;  4P6Z S;  3B42 A;  2ACG A;  3N6I A;  4JKT A;  3W4Q A;  3S7P A;  3PBN A;  4CLC D;  4OPZ A;  4R3A A;  4F3L A;  4HH2 A;  3BQA A;  4PM6 A;  2R9W A;  3VP2 A;  1BZA A;  4S2N C;  1S4R A;  3WS0 A;  4DDS A;  2EA9 A;  3BFC A;  3MS6 A;  5GHZ A;  2ZOI A;  3DTI A;  2PD8 A;  5A92 A;  1IYP A;  5DFY A;  3BFF A;  1BUE A;  2ZC5 B;  1T18 A;  5DVA A;  2P74 A;  1DP9 A;  1H8Z A;  5FQ9 A;  2JCH A;  2PU2 A;  5HDD A;  2WKQ A;  5FSR A;  1CQA A;  4M4X A;  1K4F A;  2XRO A;  4U0T A;  4OP8 A;  3PAE A;  2VKS A;  1PWD A;  2DNS A;  3Q7V A;  3L7H A;  4GNU A;  3QHY A;  4X69 A;  3HRE A;  5EV0 A;  3DTK A;  2A3U A;  4K91 A;  1MKM A;  2DMW A;  1YLY A;  1SZV A;  4I5S A;  4PPR A;  5J3W A;  4Y13 A;  4EUZ A;  1Q2P A;  4C75 A;  1NZO A;  2IWC A;  1IEM A;  2HGV A;  4F94 A;  3H9W A;  4EXO A;  3VP0 A;  1K6R A;  3OLO A;  3P09 A;  3A3J A;  2K31 A;  4GOG A;  4S2M A;  3IT9 A;  1FCO A;  3ZG5 A;  3HUN A;  1I2W A;  5AQ9 A;  1I2S A;  3C30 A;  3O87 A;  4KEN B;  3GEC A;  3U4L P;  3IBJ A;  1PYY A;  4Y5F A;  4P6Z M;  4I3J A;  2WZX A;  3PBT A;  5FQM A;  5C5K A;  1M40 A;  4P87 A;  4X6T A;  1CF0 A;  3IHA A;  2FZ0 A;  4FH4 A;  4QU3 A;  4BEN A;  3KSH A;  2B95 A;  4BQM A;  5JYP A;  1KGE A;  4E3O A;  4GHI B;  5J4E A;  2ZQ9 A;  4P85 A;  4DE0 A;  4ZAM A;  1W79 A;  1U60 A;  3M2K A;  1KDW A;  1XGI A;  4K0W A;  4FUW A;  3UY6 A;  2CMN A;  4NET A;  1LL8 A;  5G4Y A;  3WS4 A;  3MMH A;  5GLA A;  4B4Z A;  1A0K A;  3S22 A;  1KE0 A;  2XGN A;  2ZQD A;  4HNB A;  1K0K A;  3OZH A;  5FAP A;  3E2K A;  1WYB A;  1DJB A;  4MNR A;  5CGS A;  5EE8 A;  4IVK A;  3IX4 A;  3MQO A;  1XJ2 A;  1IEL A;  3K3C A;  3S7O A;  2ZMF A;  2HP9 A;  2E8I A;  5U47 A;  4OP5 A;  4LRY C;  5IT5 A;  4OPY A;  1W8Q A;  4QJG A;  2XQZ A;  1HZO A;  3ICY A;  5HZH A;  1ES3 A;  4A5R A;  4WZ4 A;  3NBL A;  3BM6 A;  4BBU A;  5E2E A;  5JYO A;  3PBQ A;  3S7Q A;  1KVM A;  3ITA A;  2QPN A;  3A3E A;  1PI5 A;  3MXR A;  3PAG A;  3DW0 A;  3PXP A;  2EX2 A;  5FAO A;  1OPX A;  1W5D A;  4JGR A;  2VJW A;  4OKP A;  1YLT A;  1OME A;  5F69 A;  4UA9 A;  2V0U A;  3CHW P;  3E4Q A;  4N1X A;  3UE3 A;  3GRJ A;  3G4P A;  2ZQC A;  4Y2F A;  1WA9 A;  4QWO A;  5DFX A;  3C4P A;  4BBT A;  5A91 A;  4D60 A;  2J9P A;  1OTA A;  1PZP A;  1NRF A;  4Q0I A;  1KVL A;  5GHY A;  3RXX A;  1LI0 A;  2XDM A;  3IF5 A;  3UDI A;  4LPZ A;  3R7W A;  2P9V A;  4DXB A;  4OOM A;  3F1O B;  1OJ5 A;  2FFY A;  1H8Y A;  1SKO A;  2PD7 A;  4JGO A;  4PM8 A;  3R7W B;  2NUT C;  1UWP X;  5FQJ A;  1SCW A;  4NXG A;  1TF1 A;  1KDS A;  4FH2 A;  2Q0O A;  4EBN A;  3F1N B;  3K2N A;  5DF9 A;  2WAD A;  2PYR A;  2XFS A;  1BYW A;  2EX6 A;  2Y2L A;  3KX0 X;  3W8K A;  2EXB A;  3FWL A;  5J8X A;  1UWN X;  4R38 A;  4NG2 A;  3FG8 A;  2VGJ A;  3R4K A;  1TDG A;  1XA7 A;  5G4Z A;  1K57 A;  3SH9 A;  3H7W B;  3UNW A;  3C7U A;  4HP4 A;  2VX8 A;  1F98 A;  3BFD A;  3G6O A;  3PTE A;  4G3W A;  2M7V A;  4N92 A;  3T4S A;  3PBO A;  1Z09 A;  2ZQ7 A;  2WGW B;  2WGV A;  3OCL A;  2W3H A;  5FQQ A;  3VE3 A;  1SDN A;  2ZM2 A;  2W3E A;  3FPW A;  1K55 A;  1S1Z A;  2ZC7 A;  4LFU A;  2J3W A;  2L1M A;  3CLO A;  3UMD A;  2AVX A;  5TJJ A;  2G7U A;  2OWH A;  5CER A;  3OPL A;  3MSH A;  3VSL A;  3V3R A;  1VB6 A;  1Z6F A;  2V1Z A;  4DN0 A;  2Y2J A;  3W4O A;  3HCY A;  4LLO B;  4KG6 A;  3UN7 A;  1JWV A;  4R23 A;  3ZVW A;  3QP2 A;  2R9X A;  3BEB A;  4UA6 A;  1BT5 A;  1T1C A;  2DCF A;  2ZM0 A;  3EQV A;  3SH8 A;  2KOI A;  2XF3 A;  3UPN A;  2VGK A;  4HQA A;  1IFQ A;  1QMF A;  3T4O A;  2HJ9 C;  3ZFZ A;  1L0G A;  3VOY A;  1S0W A;  2EX8 A;  1GA0 A;  4JXS A;  2GX5 A;  5HAI A;  3IXG A;  1N9O A;  4NKP A;  2YKF A;  2A2L A;  3ISG A;  2VLG A;  3M2J A;  3LIA A;  3MFD A;  1K4E A;  5FI7 A;  2ZOH A;  1Y54 A;  1YMX A;  1ES4 A;  4G3K A;  1XJ6 A;  3ZHH A;  3C5A A;  3CAX A;  3E4P A;  4OQH A;  5CTN A;  4BL2 A;  1JNU A;  1HD8 A;  3GMW A;  4Z1W A;  4EWF A;  2PU4 A;  1MBL A;  3M6B A;  3PBR A;  4HJ4 A;  5DTK A;  3ZG7 B;  5K5B A;  3I7J A;  1C3B A;  2A49 A;  3IX3 A;  4GKU A;  4Y0O A;  1VEU A;  3C8C A;  5HAP A;  4CLC A;  3FKV A;  1SKO B;  1DP8 A;  1NRJ A;  4Y0T A;  4OQ0 A;  2HDR A;  3ZDJ A;  3AGD A;  2ZC6 B;  2WAF A;  2K2N A;  4RVA A;  2VA0 A;  4LRZ E;  1FCM A;  4HJ6 A;  4NXB A;  1OTI A;  5HDS A;  1YPR A;  2WKE A;  2QJ7 A;  3C4O A;  4NEE D;  1TS0 A;  5HL6 A;  3CPT B;  1TS7 A;  1LSX A;  4S2O A;  2B18 A;  3FPV A;  2INW A;  2ZMA A;  2EWV A;  2ZQA A;  3LUQ A;  4NXE A;  4S2I A;  3IWQ A;  4WLA A;  4HES A;  5HL1 A;  5AJG A;  5F83 A;  2Y55 A;  2Y91 A;  4GD6 A;  4WUJ A;  3T50 A;  2ZQ8 A;  4BD0 A;  5GHX A;  1DP6 A;  3VE4 A;  1E4D A;  4KZA A;  2EFX A;  3HVF A;  2ZL1 B;  3IXB A;  4X56 A;  2J80 A;  2G2W A;  3O86 A;  5KZH A;  5CGW A;  5HAR A;  3A3D A;  3D3O A;  4II7 A;  4B88 A;  5FAS A;  3TSG A;  2HF6 A;  3IH9 A;  3UB6 A;  1V9Y A;  2J3T D;  3UO9 A;  2EWW A;  1OT6 A;  1YLJ A;  1ODV A;  4S2N A;  4MDZ A;  2OV5 A;  3TRC A;  3N8S A;  3MKE A;  2WKI A;  4UA7 A;  4OPR A;  3UE1 A;  2HPB A;  3K3D A;  2JKT I;  1BLC A;  2H0Y A;  2R78 A;  4ZJ2 A;  3EQU A;  3W4P A;  1K38 A;  3H82 B;  3AGE A;  3LI8 A;  4MEZ A;  4EW7 A;  3EWK A;  5I94 A;  3WWX A;  5DJU A;  3N4I A;  4IED A;  3IS2 B;  1LSV A;  2A24 A;  3HLW A;  3UPP A;  3SS4 A;  3WRZ A;  2FH5 A;  3KSI A;  3LO7 A;  1S66 L;  1YMS A;  4CLC B;  1LL5 A;  3JPU A;  3RTY A;  3DTM A;  2JKR I;  2OWJ A;  4LV0 A;  3C38 A;  5EVI C;  1MPL A;  4PMA A;  5HFO A;  4FD8 A;  4OPQ A;  5EPH A;  3T4T A;  4S2P A;  4DMZ A;  2Y4A A;  4WM9 A;  5E43 A;  3ZG0 A;  4RX2 A;  4X68 A;  3IBR A;  3ZGA B;  5FAQ A;  2VZW A;  1NYY A;  4ARZ B;  3VSK A;  3H82 A;  4MN7 A;  3F1P A;  1AWI A;  3F1P B;  4WMC A;  5GLC A;  3CMZ A;  3DWZ A;  3VFF A;  2Y2M A;  1YSP A;  3SOI A;  3IF6 B;  5CGX A;  3BLM A;  1T19 A;  1PZO A;  2EXA A;  4AFI A;  2O99 A;  2O9B A;  1H3Q A;  1D7E A;  1RCJ A;  3A0V A;  1S4S A;  3MFX A;  1MZU A;  2XA7 M;  4HBT A;  1G6O A;  1FIL A;  2OLV A;  2ZM8 A;  4N9K A;  5EVI B;  3OCN A;  1E3U A;  1FR1 A;  5EEC A;  3VP4 A;  3RJU A;  2HP5 A;  1H5X A;  4WEJ A;  2J7V A;  3T1X A;  3AGF A;  4IBX A;  1NXY A;  2XSS A;  5E2H A;  3LR4 A;  3HUO A;  3OBF A;  4EER A;  2OLU A;  3CWF A;  4DF6 A;  3N7W A;  1XJ4 A;  3VFH A;  3NC8 A;  3ZNT A;  1T1B A;  1MWS A;  3LGO A;  3GR2 A;  1OTD A;  2QZ6 A;  3N8L A;  4WBG A;  3UDF A;  1PRQ A;  4KZ9 A;  1M6K A;  3NOU C;  4KUO A;  5EM0 A;  4K08 A;  1EI5 A;  1VQQ A;  1BLH A;  4OQI A;  3MZD A;  5FQI A;  3SS5 A;  4EV4 A;  3N8R A;  4P0M A;  4S2L A;  2GDN A;  4NXF A;  3A0R A;  2QMI A;  1L0D A;  4OLG A;  5F1G A;  3LI9 A;  3VMA A;  5CEC A;  1G28 A;  5M19 A;  1VET B;  4JLF A;  3O3V A;  3UB8 A;  5HD3 A;  1ZG4 A;  1VEU B;  3ZQ5 A;  3Q1F A;  3TE8 A;  5FI6 A;  3FV7 A;  3VOL A;  2PT7 A;  3TJZ C;  4C6Y A;  5CEB A;  5M1A A;  3H7W A;  5KMW A;  2HZ5 A;  1MKI A;  3IF6 C;  3KSG A;  5FL3 A;  2W3D A;  2KX6 A;  5L09 A;  3P98 A;  3HLE A;  1TDL A;  1XGJ A;  4O0P A;  5DF8 A;  4KQR A;  4YFM A;  3V67 A;  4MCW A;  5AQA A;  3NHQ A;  4JBF A;  1CI9 A;  2ZD8 A;  1ONH A;  4E3M A;  4MBF A;  3F1N A;  1NY0 A;  2V0W A;  1N9B A;  2WKH A;  3NEC A;  2WAE A;  2PRF A;  1H8M A;  2BAS A;  3QP5 A;  1J9M A;  1PWC A;  2WK0 A;  4X1L A;  2OAQ 1;  3E4O A;  4DXC A;  4JF6 A;  4BLM A;  4GCZ A;  4LGW A;  1KGG A;  4KZ3 A;  2VV6 A;  1O07 A;  2V1A A;  1BLS A;  1Y28 A;  5HW3 A;  1JWZ A;  2K7S A;  2XD5 A;  3T4L A;  1S6R A;  3LFV A;  2Y79 A;  2PHY A;  1IKG A;  1P9W A;  1P9R A;  1ZHH B;  1DRM A;  4PM9 A;  1RP5 A;  2Y2I A;  3LIF A;  4MBH A;  2O0Y A;  1CK3 A;  3LR3 A;  4JGP A;  4C3Q A;  1QME A;  1GSW A;  2VEA A;  4ID4 A;  4G3V A;  2QWS A;  4MBK A;  3IX8 A;  1MWU A;  3G2Z A;  4WEK A;  4Q8I A;  5EOO A;  4OQG A;  3NY4 A;  3UB5 P;  5AQB A;  3A3F A;  2WGI A;  5E2G A;  1ZC2 A;  5CXW A;  3EEA A;  2O9C A;  1ALQ A;  4DRT A;  4CJN A;  4QY5 A;  4L9F A;  3UME A;  2HDS A;  1ONG A;  3BFE A;  2YKH A;  1XA1 A;  1S67 L;  1PIO A;  1ZG6 A;  4JXV A;  4PHT A;  3PHY A;  1XX2 A;  4HJ3 A;  5J7E A;  1O7E A;  5FEG A;  2UV0 E;  3IH8 A;  3BLS A;  2H5S A;  5CX7 A;  1KE4 A;  3A3I A;  3HLF A;  1XPB A;  2ZC3 B;  1ACF A;  2VV7 A;  3NOT C;  4IBR A;  2WUQ A;  4FOF A;  5CED A;  3FYZ A;  3LY4 A;  4KZ4 A;  2XA7 S;  1NWZ A;  1YT4 A;  4PAU A;  5AVF A;  1N4O A;  5EUA A;  1FSY A;  1JVJ A;  4PKY A;  3OPH A;  4GW9 A;  1IYS A;  3QP6 A;  1K6S A;  5IS1 A;  1GSX A;  2HJE A;  3BY8 A;  2WGW A;  4MN5 A;  4D2O A;  5HPF A;  3BW6 A;  3BY9 A;  1ERM A;  3W2Z A;  2QHK A;  2EFU A;  3PBS A;  2UWX A;  4E04 A;  4UEY A;  4O7D A;  4E3N A;  4X53 A;  4WEL A;  5L07 A;  2H0T A;  3ZYT A;  3WRT A;  3HUM A;  2D01 A;  4EES A;  4CQH A;  1SDE A;  3JYI A;  4XUX A;  4HOI A;  2M1C A;  4E6W A;  2V8C A;  2V2F F;  2QYB A;  1XFQ A;  4QHC A;  2Z6D A;  4Z9Q A;  2JE5 A;  3CUE A;  5AQ7 A;  4H8R A;  4EQ1 A;  2Z2M B;  4KUK A;  5DTT A;  3HLB A;  4FCF A;  2M7U A;  3OPP A;  3F1O A;  3KO6 A;  4ETZ A;  2X71 A;  4PKY G;  3ULF A;  3T12 B;  2I72 A;  3MQQ A;  3S1Y A;  3HLC A;  3KYZ A;  2XR0 A;  3GVB A;  5DJT A;  2PYP A;  2WZZ A;  4L9E A;  3T4J A;  3D72 A;  3O5Y A;  1OT9 A;  3Q82 A;  4ZJ1 A;  1MY8 A;  1NZU A;  4RYE A;  2XH9 A;  4O8G A;  2Y8H A;  3IWI A;  3RXW A;  1K54 A;  4GLQ A;  2PDR A;  3A0S A;  3BFG A;  3E2L A;  3G32 A;  1XP4 A;  4XT2 B;  1W63 M;  3C7V A;  4BD1 A;  5L10 A;  5TR7 A;  4ME4 A; 
#chains in the Genus database with same CATH homology
 2OWJ A;  3C38 A;  1V9Z A;  4I3A A;  3T4T A;  2PR5 A;  1YSQ A;  3MQO A;  4HI4 A;  1XJ2 A;  5HWV A;  4R70 A;  4DMZ A;  1S1Y A;  3K3C A;  3S7O A;  2ZMF A;  2W3F A;  2H28 A;  4UQI S;  3IBR A;  2J3T C;  2VZW A;  4WN5 A;  2P08 A;  4LRY C;  5IT5 A;  4GS9 A;  4ARZ B;  4BJP A;  3H82 A;  2GJ3 A;  4MN7 A;  3F1P A;  4GHI A;  3F1P B;  3ICY A;  5HZH A;  3LIB A;  3FC7 A;  3S7N A;  5EFW A;  4BBU A;  5KIZ A;  1LT0 A;  4ZRR A;  1N9L A;  4HH3 A;  1YSP A;  3PBQ A;  3S7Q A;  1TS8 A;  4KQO A;  1OJG A;  1T19 A;  3RH8 B;  3LIC A;  4AFI A;  2O99 A;  2O9B A;  3PXP A;  4OOL A;  1H3Q A;  1D7E A;  2JN7 A;  1OPX A;  2JHE A;  3A0V A;  5HSQ A;  1S4S A;  4JGR A;  3MFX A;  2GZA A;  2I9V A;  1MZU A;  3PR6 A;  2XA7 M;  2VJW A;  2XRN A;  1G6O A;  3OCN A;  1NLY A;  5F69 A;  2P7J A;  2V0U A;  1XFN A;  3E4Q A;  5IU1 A;  3UE3 A;  4WEJ A;  4Y2F A;  1WA9 A;  5DFX A;  5MC7 A;  2GNX A;  2XSS A;  4BBT A;  3LR4 A;  4R6L A;  1OTA A;  2VGL S;  3OBF A;  4Q0I A;  3T4Q A;  4EER A;  3KSF A;  1TD5 A;  3CWF A;  1XJ4 A;  1X0O A;  4LPZ A;  3R7W A;  4OOM A;  4WF0 A;  4JGQ A;  1T1B A;  1YAX A;  4IHQ A;  2JKR M;  3F1O B;  4KQD A;  1OJ5 A;  2PD7 A;  3MF0 A;  1OTD A;  3LR5 A;  4JGO A;  3R7W B;  2NUP C;  2NUT C;  3BQ8 A;  1UWP X;  3NOU C;  4KUO A;  2W1T A;  4B9O A;  4K08 A;  3EEH A;  1GSV A;  2W3G A;  5HD5 A;  1EW0 A;  3P7N A;  4NXG A;  1TF1 A;  3T4K A;  2OOL A;  3F1N B;  3K2N A;  5DF9 A;  2PYR A;  1BYW A;  2L4R A;  5F68 A;  3E0Y A;  4NXF A;  2P04 A;  3B47 A;  3A0R A;  3CIT A;  1YKD A;  3KX0 X;  4H6J A;  4HHD A;  2V1B A;  1UWN X;  4R38 A;  3SW1 A;  2O9A A;  3FG8 A;  3R4K A;  3LI9 A;  1G28 A;  4HY8 A;  4HP9 A;  5G4Z A;  3UB8 A;  4ARZ A;  2VGL M;  5HD3 A;  5L8M A;  4BWI A;  2WKR A;  5DKK A;  4YNR A;  3ZQ5 A;  3H7W B;  3TE8 A;  1F5M A;  4RQ9 A;  4HP4 A;  3MXQ A;  2PT7 A;  2VX8 A;  3TJZ C;  1F98 A;  3VOL A;  3G6O A;  4G3W A;  2M7V A;  3T4S A;  1OTB A;  3H7W A;  3PBO A;  2B02 A;  3OCL A;  3KSG A;  5FL3 A;  1N9N A;  2KX6 A;  2W3D A;  4DJ2 A;  2W3H A;  3VE3 A;  1VHM A;  2W3E A;  3FPW A;  4O0P A;  1IOU A;  3TW8 A;  3LIE A;  1UGU A;  4Y3I A;  3V67 A;  4MCW A;  3OOV A;  3NHQ A;  1S1Z A;  4GJ4 A;  2J3W A;  2L1M A;  2A24 B;  3CLO A;  1STZ A;  3UMD A;  5TJJ A;  3IS2 A;  2G7U A;  4EUV A;  3NJA A;  2OWH A;  3F1N A;  2L0W A;  2V0W A;  1VB6 A;  2QKP A;  3OC2 A;  3EOI A;  4DN0 A;  2W1T B;  2WKP A;  2ZBB A;  5I5L A;  1LSW A;  1H8M A;  2BAS A;  3HCY A;  2LB5 A;  2OAP 1;  4LLO B;  1D06 A;  5HDC A;  3P01 A;  5AVE A;  4L0L A;  2HV1 A;  4XT2 A;  1P97 A;  2OAQ 1;  3E4O A;  3HJK A;  1W63 Q;  1T1C A;  1OTE A;  3C2W A;  4GCZ A;  3DBA A;  4I3I A;  1KOU A;  2VV6 A;  2V1A A;  3EQV A;  4Q0J A;  2KOI A;  3BJN A;  3UB9 A;  1Y28 A;  3UE6 A;  2K7S A;  3T4L A;  4O01 A;  3LFV A;  4HQA A;  2Y79 A;  1IFQ A;  3T4O A;  2PHY A;  3UB7 A;  2HJ9 C;  4Q0H A;  4WL9 A;  2ZMV A;  1P9W A;  1P9R A;  1ZHH B;  4YOF A;  1DRM A;  3GDI A;  3VV4 A;  2KDK A;  3LIF A;  2GX5 A;  1N9O A;  4NKP A;  2O0Y A;  2YKF A;  3LR3 A;  2D02 A;  3E98 A;  4MN6 A;  1XJ3 A;  2A2L A;  2KLI A;  1NLZ A;  3RFB A;  2QJ5 A;  2VLG A;  4JGP A;  3LID A;  3LIA A;  3BWL A;  1GSW A;  2VEA A;  2W1R A;  2PR6 A;  3LR0 A;  4L9G A;  4G3V A;  4F3L B;  2QWS A;  3U2A A;  2ZOH A;  5DKL A;  4EEP A;  5F6A A;  2V9A A;  4G3K A;  5HWW A;  1XJ6 A;  4WEK A;  3CAX A;  3E4P A;  3PYP A;  1JNU A;  2MJ6 A;  4HIA A;  4Z1W A;  1ZTU A;  3EEA A;  2O9C A;  3PBR A;  4HJ4 A;  5A8B A;  4L9F A;  4CLC E;  4GS9 B;  1P0Z A;  3NOP C;  3UME A;  3MJQ A;  4QPR A;  4P6Z S;  4H6J B;  5K5B A;  3B42 A;  2YKH A;  3S7P A;  1S67 L;  3PBN A;  4CLC D;  4PHT A;  4R3A A;  3PHY A;  4UQI M;  4F3L A;  4HH2 A;  3BQA A;  2Z6C A;  4YWZ A;  1S4R A;  4HJ3 A;  5J7E A;  3C8C A;  2EA9 A;  2ZOI A;  3EGD C;  4CLC A;  2PD8 A;  5LBR A;  4EEU A;  1NRJ A;  1DP8 A;  5CX7 A;  5DFY A;  2VV7 A;  1T18 A;  3NOT C;  3MR0 A;  4I39 A;  4FOF A;  2K2N A;  1DP9 A;  2XA7 S;  5F5Y A;  2VA0 A;  4B93 A;  4LRZ E;  5HDD A;  1NWZ A;  2WKQ A;  4HJ6 A;  4NXB A;  1OTI A;  4IJG A;  5HDS A;  2QJ7 A;  4NEE D;  4M4X A;  1TS0 A;  2XRO A;  5HL6 A;  1TS7 A;  4PAU A;  1LSX A;  5AVF A;  4IUK A;  5HPI A;  2VKS A;  2B18 A;  3FPV A;  4IUH A;  4PKY A;  2INW A;  2EWV A;  4GW9 A;  3LUQ A;  4NXE A;  5IS1 A;  1GSX A;  2HJE A;  4LRX C;  3BY8 A;  1MKM A;  2DMW A;  4WLA A;  4MN5 A;  5AJG A;  4I5S A;  5HPF A;  3BW6 A;  3BY9 A;  4WUJ A;  3T50 A;  5J3W A;  3KYQ A;  3W2Z A;  2QHK A;  1DP6 A;  3VE4 A;  3PBS A;  4EET B;  2HGV A;  3H9W A;  4EXO A;  4E04 A;  2J80 A;  4UEY A;  5KSH A;  3OLO A;  4WEL A;  2LB9 A;  3CUE C;  5TBM A;  4ETX A;  2K31 A;  3D3O A;  5TBM B;  4BBV A;  3ZYT A;  4II7 A;  4BMW A;  3CI6 A;  2D01 A;  4EES A;  4CQH A;  2HF6 A;  2IA2 A;  4HOI A;  3UB6 A;  1MC0 A;  3C30 A;  2M1C A;  4EU0 A;  1V9Y A;  2J3T D;  3GEC A;  2QYB A;  3IBJ A;  2EWW A;  1TS6 A;  1XFQ A;  4Y5F A;  1OT6 A;  2Z6D A;  4P6Z M;  4I3J A;  3CUE A;  3PBT A;  5C5K A;  1ODV A;  4EQ1 A;  3TRC A;  4MDZ A;  5HWT A;  2FZ0 A;  4KUK A;  3KSH A;  3MQ0 A;  2W0N A;  2W27 A;  2M7U A;  3K3D A;  2JKT I;  3F1O A;  3KO6 A;  4ETZ A;  3B33 A;  4I38 A;  4GHI B;  2R78 A;  1F9I A;  4PKY G;  3EQU A;  3ULF A;  3H82 B;  3MQQ A;  3KYZ A;  5DJT A;  3LI8 A;  4EW7 A;  5J4E A;  2PYP A;  3EGX C;  3HJI A;  3EWK A;  2VV8 A;  4L9E A;  3T4J A;  3D72 A;  3O5Y A;  1OT9 A;  5DJU A;  4O8G A;  3IS2 B;  2Y8H A;  2CMN A;  3LYX A;  1LSV A;  1LL8 A;  2A24 A;  5G4Y A;  4GLQ A;  1T1A A;  3MMH A;  2PDR A;  4CLC C;  3A0S A;  4HNB A;  2FH5 A;  3KSI A;  1S66 L;  4CLC B;  4XT2 B;  3JVU A;  1W63 M;  2JKT M;  3JVV A;  3RTY A;  2JKR I;  4DJ3 A;  4MMN A;  4FSF A;  4ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...