1FR1A

Refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
361
structure length
361
Chain Sequence
AAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQWQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMSKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPVKADSIISGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Refined crystal structure of beta-lactamase from Citrobacter freundii indicates a mechanism for beta-lactam hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 114
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fr1A00
4X55A 5EVLA 5U47A 1NRFA 4ZJ1A 3HUNA 2RL3A 5EVIC 2WAFA 5FASA 4FSFA 3DTMA 5GLAA 4Y0TA 1PIOA 1H8ZA 4OQ0A 4R4SA 3ZVWA 3G30A 1GHIA 4DF6A 4H8RA 1Q2PA 2Y2GA 3G34A 3UY6A 4KQRA 1O07A 4UHUA 5CGWA 2Y55A 3SS4A 2BLSA 4RA7A 1WYCA 4GZBA 2Z2MB 3UE3A 4ZJ2A 4FH4A 3MBZA 3OPPA 3BFDA 1VQQA 3BFFA 4P6BA 5FI7A 3UN7A 3BYDA 3UNWA 3VSLA 5EE8A 5CTMA 1FSYA 2Y2LA 1I2SA 5CHJA 4ID4A 4MBKA 4GOGA 3HREA 4QY5A 2Y2PA 3ZG5A 4S2IA 3V39A 5E43A 2ZC5B 4X56A 2FFYA 4E3NA 1QMEA 3LEZA 4QJGA 2X02A 1RGZA 3FKVA 3G4PA 2XD1A 2OV5A 1XA1A 4S2NC 4EWFA 3IHAA 1KVMA 4KZ9A 3IXGA 1IELA 4N9LA 5EOOA 4ZAMA 4E6WA 1W8QA 3E2LA 4LV0A 1GHMA 3UO9A 1DJBA 2Y91A 1YMSA 4D2OA 2XR0A 3IHBA 1KVLA 4OP5A 2G2WA 2ZC3B 2WGWB 1BZAA 1BUEA 3TG9A 3ZNYA 1S0WA 1BSGA 1XX2A 1PW1A 3M6HA 1MBLA 3MZFA 1ONGA 2WKEA 1BLCA 1ESIA 1G6AA 4JKTA 2FFFB 2ZQCA 4K0WA 5E2GA 2XD5A 1E3UA 5CTNA 5HARA 2Y2QA 4OKPA 3VFFA 4IBXA 3CMZA 4PM8A 4ZTKA 2I72A 3O87A 2IWCA 4JPMA 4PM7A 4WMCD 2XFSA 3UPPA 5A93A 5M1AA 1K25A 5TGFA 1LL9A 2Y2OA 3JYIA 4OPYA 3ZG8B 3MFDA 4KZ8A 4E6XA 2HP6A 4E3OA 4Q8IA 5L2FA 3Q07A 3SOIA 2WADA 5FATA 1MY8A 4U0TA 5FQJA 1CEFA 4BENA 1FR6A 5CXWA 3HLDA 3LCEA 3O88A 3PAEA 1I2WA 4JXWA 4DRTA 3G31A 2ZC7A 3AGFA 3IXHA 3N8SA 3W4QA 2HP9A 4KZ5A 1J9MA 5KMWA 3FWLA 4JXSA 1CEGA 2C5WB 3B3XA 2HP5A 1Z6FA 3BLMA 1NXYA 4BL2A 2BG1A 3NY4A 5GL9A 1WYBA 3OPHA 1PI5A 3MKFA 4R23A 3QNBA 2WKIA 2J8YA 3PBTA 3DWZA 1NY0A 3Q7VA 1K57C 2X01A 3IF5A 4RX2A 2JBFA 5DF9A 1GA0A 4EQIA 3VFHA 4HBTA 5FQQA 4GNUA 4IVKA 2DNSA 2WZXA 3N6IA 5FDHA 1IYQA 2HDQA 3OCLA 1SDEA 2WYXA 4WBGA 4XUXA 1K4EA 1LI0A 4KZ7A 2P74A 1SHVA 5A90A 2C6WB 4XUZA 1K55C 1W5DA 5CHUA 1BULA 1SCWA 3C5AA 3BFCA 3CG5A 4S2KA 4Y0UA 4OVDA 1IKGA 1PI4A 5TR7A 1TVFA 4CPKA 4DE3A 4EUZA 1L0DA 3BRMA 4WZ5C 3WS4A 2ZQAA 2Y2NA 3PBSA 1RGYA 2EFXA 3V50A 1BT5A 4EBNA 1TDGA 3GTCA 1IYOA 2GDNA 3SS3A 3W8KA 2V20A 1MWRA 2HDUA 4IEDA 4KZBA 1HTZA 2Y2KA 3A3JA 1FR1A 4WYYA 5FAOA 5A91A 4BL3A 1ERQA 3BLSA 5KSCA 3MZDA 2ZQ7A 3ZVTA 3FZCA 3IT9A 4OQGA 2XFTA 2IWDA 1PZOA 3HLFA 4Z9QA 2ZM2A 3CJMA 1K56A 4KG5A 1IKIA 5EPHA 5CHMA 1PWCA 3TSGA 2OSUA 1AXBA 3W4PA 3OCNA 3WWXA 2V1ZA 5F83A 4KQQA 2H0YA 3ZDJA 4PM5A 2ZM8A 1FCMA 1L0FA 4MBHA 2XQZA 4QY6A 4U3TA 4KZ6A 4B88A 4XXRA 4X53A 5GHXA 5F1GA 1KGGA 3DW0A 4F94A 5DTSA 1YQSA 3HLCA 3VP4A 4ZDXA 3ZFZA 4FCFA 5GHYA 3VP2A 1FCOA 2JCHA 4B4XA 2QPNA 3GMWA 3S22A 2ZQDA 1KE3A 1ERMA 2EXAA 1W79A 1BTLA 1XGJA 1K54A 4HESA 1DJAA 4KG6A 2Y2IA 3M2JA 5AQ7A 2DRWA 5FQIA 1H8YA 3FYZA 3ZNTA 5HAPA 5CGXA 4X68A 3C4OA 3N8LA 2IWBA 4S2MA 4DDSA 1IEMA 1RCJA 3RXXA 1ZG6A 3OPLA 4KQOA 1XPBA 4N1XA 5M19A 3WRZA 1N9BA 1JWVA 2V2FF 1KDSA 1YLTA 2X71A 1WE4A 1VM1A 3IF6B 2H0TA 4C6YA 4OPRA 5HW3A 1FSWA 2WKHA 2Z2LB 1BLHA 1GA9A 5EUAA 1OMEA 4ZJ3A 3WRTA 2Y2HA 4PPRA 3SH7A 4NK3A 4C75A 1DJCA 4WELA 3Q7VB 1NZOA 2R9WA 1FCNA 1TDLA 1EWZA 4RX3A 1XA7A 3M2KA 4OH0A 3NDGA 2EXBA 2EFUA 2ZLYA 3A3EA 1MWUA 4E3MA 1ES3A 3V3SA 4BJPA 3GV9A 2R9XA 5JYPA 3HLWA 5DVAA 2QZ6A 5AQ9A 1L0EA 5EVIA 3ZCZA 3V5MA 3VP0A 4KZAA 4FD8A 4R4RA 3BM6A 4R0QA 3ITAA 4NETA 2ZC4B 5JYOA 3QNCA 4HEFA 1YLWA 1LL5A 1JVJA 3RXWA 5IHVA 4WEJA 5CRFA 5J8XA 2ZQ8A 1C3BA 5HX9A 1LI9A 3BECA 5G18A 5CERA 4JF5A 4PM6A 4UA6A 5HFOA 5HAIA 1Y54A 3FKWA 1MKIA 1HVBA 3IF6A 5DF7A 1FOFA 1YMXA 4UA7A 2ZQ9A 5CEBA 3G35A 2OLUA 1YT4A 2Y2MA 3IWOA 2Q9NA 4GDNA 2B5RA 3AGEA 3NIAA 2H10A 4S2NA 4LV1A 3A3IA 1LLBA 3Q82A 4RYEA 4B4ZA 3E2KA 4EBPA 3OZHA 1PWGA 5FAPA 1O7EA 1EI5A 4P87A 1ZC2A 1GCEA 2PBYA 2XEPA 4QB8A 1LHYA 1MXOA 4MBFA 3A3FA 1K54C 5AQAA 4JXGA 1ZG4A 4LENA 4K0XA 4WM9A 3NC8A 1SDNA 1ES2A 2J9OA 1E3UD 2OLVA 4S2LA 1MWTA 4KG2A 4ZBEA 4R3JA 3Q1FA 2H5SA 5A92A 3VP1A 2Q9MA 3C4PA 4LV2A 5EOEA 5CGSA 4BQMA 4OLGA 5E2FA 4GN2A 3IH9A 5E2HA 3MZEA 4P85A 1NYYA 3FV7A 4O7DA 2CC1A 4JF6A 1IYPA 5F82A 3MKEA 3ZG0A 3G2YA 4PMAA 4GKUA 3HUMA 3IXBA 3Q81A 3UPNA 1DY6A 4BD1A 3N4IA 5CEDA 2HPBA 2WAEA 4R3BA 3N8RA 4OPQA 1YLZA 3RJUA 3P09A 2Y4AA 5FSRA 4DXBA 3WS0A 5FA7A 4QHCA 4X69A 3LO7A 5EECA 1BLSA 3C7VA 4HBUA 5DTTA 3A3DA 1GHPA 3CZDA 2P9VA 4X6TA 3AGDA 3M6BA 3VMAA 5HL1A 5TFQA 2E8IA 3HVFA 1YLJA 2EX8A 4WMCA 4CJNA 3WS1A 4RVAA 4PM9A 1JTDA 2VGJA 4OPZA 3BEBA 3PBQA 4OOLA 3WS5A 4E3IA 2PU4A 3PAGA 4FH2A 1ZKJA 4OONA 3O86A 3G2ZA 4MLLA 3HLEA 5EVIB 4JF4A 4S2JA 1PWDA 4DE0A 4DE2A 2JE5A 3ISGA 5M18A 3SS5A 2HDSA 3IWIA 3NCKA 2JC7A 2XK1A 3GRJA 3TOIA 3HLGA 3DWKA 3HBRA 2EX2A 3OC2A 2RCXA 4OLDA 2EX9A 5E2EA 4DE1A 3IF6C 5GLCA 3I7JA 4YINA 4DXCA 2J9PA 4N92A 4N9KA 3ITBA 1YLYA 4GB7A 1K6SA 3S4XA 4R1GA 4MNRA 1K57A 4Y0OA 5DF8A 3EQUA 2WUQA 2DCFA 3GVBA 1XP4A 1ESUA 5D3OA 3PBOA 4LV3A 5HAQA 3UDFA 2EX6A 3V3RA 3IQAA 4GDBA 2A3UA 4YFMA 3HL9A 2WZZA 2PU2A 2Y59A 2QMIA 2XDMA 1MPLA 1EROA 3UPOA 1IYSA 1ONHA 4GD8A 1TEMA 3UDXA 4BLMA 5I94A 4U0XA 1W8YA 3VP3A 2Y2JA 3LY4A 3PTEA 1K55A 3Q7ZA 5DTKA 5KSHA 1W7FA 2A49A 2ZD8A 3GR2A 3ZG7B 5FQMA 4E3LA 1XKZA 2G2UA 4K91A 4EV4A 3SH9A 4OOYA 4WZ5A 3P98A 4DDYA 4S2PA 5GHZA 2J7VA 3NBLA 1S6RA 3O3VA 1K56D 4JBFA 1NYMA 1NZUA 2XF3A 3LY3A 3W4OA 2XGNA 1QMFA 1PZPA 1M6KA 3HUOA 4WEKA 3VOZA 1HZOA 5FI6A 3G32A 1XGIA 4MEZA 5GLBA 4KZ3A 4LCLA 3PBNA 1PW8A 3BFEA 1JWZA 4OQIA 4E3JA 1PYYA 3HLBA 3WS2A 2ZMAA 3UE1A 2ZC6B 4OQHA 1SKFA 4E3KA 5KZHA 1NJ4A 3OPRA 1L2SA 4EBLA 4P0MA 1K38A 2UWXA 4GD6A 1KDWA 3IXDA 4LCMA 3N7WA 3MXRA 1ALQA 2WK0A 5FI2A 2VGKA 4C3QA 1Q2QA 1CI9A 2P9VB 3UE0A 2WGIA 5FAQA 2WGWA 4N1HA 4JXVA 2HDRA 5CECA 4S2OA 3ZG9B 4UAAA 5FQ9A 5BOHA 5GLDA 4Y7PA 1L0GA 1KE4A 3IWQA 3PBRA 1XXMA 2XH9A 3VSKA 1ES4A 1JTGA 3EQVA 1KE0A 1U60A 4QU3A 2XLNA 1MWSA 3NI9A 4JLFA 1RP5A 2WGVA 3NDEA 3ZHHA 3GSGA 3UDIA 3SH8A 4IVIA 4UA9A 3ZGAB 1HD8A 1CI8A 3QHYA 2ZJ9A 1YM1A 1FQGA 5F1FA 4KZ4A 1E4DA 1H5XA 3IH8A 2ZM0A 1KGEA 1K4FA 4QD4A 4OOMA 5AQBA 5FQKA 4BD0A 3BFGA 1N4OA 1ES5A 1JWPA 1K6RA 4IBRA 1CK3A 3VOYA 1E25A 3D4FA 1KGFA 5EVID 1BLPA 4KENB 1G68A 4M3KA 3C7UA 1M40A 4OP8A 4A5RA 4DKIA 3GQZA 4L0LA 1I5QA 3MXSA 1YLPA 3S1YA 4WZ4A
chains in the Genus database with same CATH superfamily
4X55A 2P08A 4B93A 2ZBBA 3EEAA 5FASA 4FSFA 1DP9A 3UE6A 4EESA 4O0PA 3ZVWA 1XFQA 3T4TA 4RA7A 4FH4A 3MBZA 3BFFA 1S1YA 2Y2LA 1I2SA 4ID4A 4MBKA 4QY5A 3V39A 2ZC5B 4X56A 2FFYA 2OV5A 3FKVA 1XA1A 3CPTA 1KVMA 4UQIS 1GHMA 2FH5A 1G6OA 1YMSA 4OP5A 5MC7A 4HNBA 3H7WA 3ZNYA 1D7EA 1BSGA 1XX2A 4GCZA 1PW1A 1W63Q 1MBLA 4R70A 4K0WA 4CQHA 5E2GA 1G5UA 1T18A 1DP8A 3W2ZA 2IWCA 5A8BA 1ZHHB 4WMCD 3UPPA 5A93A 5M1AA 4NXFA 1K25A 3S7PA 5DFYA 4OPYA 4E04A 1OTEA 1NLZA 5IT5A 3Q07A 5FATA 2XA7S 4FUWA 2J3TD 4GHIB 3EOIA 3LCEA 3NHQA 3PAEA 1J9MA 5KMWA 1CEGA 4Y15A 3QP4A 4DMZA 3BLMA 4BL2A 2L4RA 3F1PB 4R38A 4EERA 2IA2A 3NULA 5AVFA 1GA0A 2LB9A 4GNUA 4IVKA 2K31A 2O9AA 1UWNX 1N9LA 2P74A 5A90A 1W5DA 5CHUA 5IU1A 5TR7A 1IKGA 4WUJA 3BJNA 3VV4A 4DE3A 3L7HA 3QP6A 4GW9A 4WZ5C 1N9NA 3H7WB 5EV0A 3GTCA 1IYOA 2GDNA 3SS3A 4EW7A 2V9AA 3SZTA 4KZBA 2Y2KA 5A91A 5FAOA 3LIDA 2PYRA 3BLSA 3FPVA 4LRYC 3IT9A 2IWDA 5L10A 2ZM2A 3CJMA 1IKIA 4HI4A 1T1CA 2XRNA 5CHMA 1PWCA 3WWXA 4KQQA 2XQZA 4KZ6A 3K3CA 4XXRA 4X53A 4MDZA 4F94A 3CAXA 1YQSA 3VP4A 3IX8A 3VP2A 1VEUA 2JCHA 2QPNA 3F1NA 4MCWA 2PRFA 3BW6A 3ZQ5A 4KG6A 5AQ7A 3F1OB 1V9YA 3N8LA 2W3GA 1IEMA 1ZG6A 4BWIA 2VJWA 1KDSA 4L9GA 4C6YA 1FSWA 2Z2LB 1GA9A 2R9WA 5J4EA 1TDLA 1XA7A 2EFUA 1ES3A 3NOUC 1L0EA 4UEYA 5EVIA 4KZAA 3FC7A 3D72A 4NETA 3QNCA 4HEFA 1LL5A 1JVJA 3R4KA 4R3AA 5IHVA 4DJ3A 2ZQ8A 1C3BA 2J80A 2E8JA 5HX9A 5G18A 4JF5A 1Y54A 1FOFA 1YMXA 4GS9B 4UA7A 1OTIA 1TD5A 3IWOA 3S7QA 4B4ZA 3FG8A 3R7WA 4G3VA 1ZC2A 1GCEA 2PBYA 4AFIA 1K54C 4JXGA 3NC8A 1SDNA 1ES2A 2J9OA 4S2LA 4ZBEA 1OTDA 3Q1FA 2H5SA 3VP1A 4LV2A 5EOEA 4D60A 5E2FA 3E4OA 1FIKA 3MQ0A 3HUMA 3IXBA 1DY6A 2HPBA 3L9KA 2B18A 5C5KA 4OPQA 3CUEC 4QHCA 4X69A 4G3KA 3A3DA 4X6TA 3M6BA 5G4YA 3T12B 1YLJA 1T1BA 3WS5A 3PAGA 3O86A 4CLCA 5EVIB 2JC7A 5EVEA 2VV8A 3H82A 4B9OA 4OLDA 3IF6C 2J9PA 1K6SA 1K57A 4XT2A 4GLQA 1OTAA 5D3OA 3UDFA 3V3RA 2PU2A 1MPLA 4GD8A 3UDXA 4LFUA 3LR4A 3R7WB 1S66L 4U0XA 3VP3A 3PTEA 3Q7ZA 1W7FA 2A49A 5FQMA 1XKZA 2JN7A 5EM0A 3VE4A 1MC0A 4HY8A 3O3VA 1NZUA 2XGNA 3BWLA 3E98A 3O5YA 4MEZA 1IOUA 4KZ3A 1PW8A 5FL3A 4MN5A 3HLBA 1SKFA 5KZHA 1NJ4A 3T1RA 2R78A 1L2SA 4GD6A 1OT6A 3IXDA 2WK0A 4QWOA 4I3JA 5FAQA 2WGWA 4JXVA 2VLGA 2KLIA 4R6LA 2ZMVA 1XXMA 3EQVA 1KE0A 5HDDA 4JLFA 2WGVA 3EWKA 4H6JB 3B47A 4UA9A 3ZGAB 3E0YA 2VEAA 2JKRI 3LI8A 4QD4A 5FQKA 1N4OA 1ES5A 4IBRA 1CK3A 3VOYA 3B42A 1G68A 4XT2B 3LYXA 3C7UA 1H8MA 3T1SA 4A5RA 1UGUA 4DKIA 3DBAA 2ZL1A 3GQZA 4L0LA 3MXSA 4B88A 3S1YA 5EVLA 3JVUA 4JGPA 2VV7A 1H8ZA 4R4SA 1NWZA 1GHIA 2M7UA 1Q2PA 2Y2GA 4I3AA 1O07A 1F5MA 5CGWA 2Y55A 1A0KA 2BLSA 3SS4A 4GZBA 2Z2MB 3TE8A 3UE3A 1Y28A 3UN7A 4O01A 3OPPA 3BFDA 5FI7A 5EE8A 5CTMA 3T50A 1GSVA 4NKPA 4QJGA 1RGZA 3G4PA 3GECA 1LT0A 2QJ5A 3IHAA 2HJ9C 1G28A 1ZTUA 2P7JA 2V8FA 3IXGA 4LV0A 1DJBA 4D2OA 4IUHA 3IHBA 2G2WA 1OT9A 2WGWB 1BUEA 2V1BA 1S0WA 2VX8A 4ETXA 3UO9A 1ONGA 1BLCA 1E3UA 2V1AA 3VFFA 3CMZA 4HIAA 2I72A 4JPMA 2XFSA 2VGLM 5F68A 3NOPC 1LL8A 3MQQA 2WADA 1MY8A 4U0TA 4BENA 2ZC7A 3N8SA 4Y3IA 1GSXA 3FWLA 2C5WB 1K0KA 2BG1A 2J3TC 5GL9A 3DAVA 1PFLA 3KYQA 4R23A 2FZ0A 3ZYTA 3Q7VA 1MKMA 1DRMA 2JBFA 4EQIA 3VFHA 2WKPA 2WZXA 3N6IA 3KSHA 5FDHA 4P6ZM 2WYXA 1K4EA 1SHVA 2C6WB 4XUZA 1BULA 1SCWA 3QP1A 4GHIA 3CG5A 4OVDA 4CPKA 1TVFA 4ETZA 3BRMA 3WS4A 2Y2NA 3PBSA 1RGYA 2EFXA 2EWWA 4EBNA 2HDUA 3P01A 1FR1A 4Y17A 1ERQA 5KSCA 3MZDA 3F1PA 2B02A 4OQGA 2XFTA 4Z9QA 1PZOA 3HLFA 1K56A 3OCNA 4EETB 2V1ZA 3MFXA 1FCMA 2AVXA 4QY6A 4U3TA 2INWA 2W27A 3KSIA 3HLCA 4B4XA 3S22A 2EXAA 3C30A 3M2JA 2DRWA 2MJ6A 5HAPA 1FILA 4S2MA 1RCJA 3RXXA 4KQOA 1JWVA 1YLTA 3P7NA 1WE4A 1VM1A 2H0TA 5HW3A 2WKHA 3WRTA 4NK3A 4NXEA 4WELA 5DKLA 3Q7VB 3E4QA 3M2KA 4E3MA 3A3EA 2ZLYA 5EFWA 4I38A 3V3SA 4BJPA 2R9XA 2ACGA 5AQ9A 3V5MA 5HDSA 4FD8A 4R4RA 4Y5FA 1PRQA 3F1OA 4MN7A 3DTKA 2L0WA 1LI9A 4UQIM 3TW8A 4UA6A 5HFOA 4EEPA 4ARZB 3LIBA 5CEBA 1YT4A 4EQ1A 4HJ3A 2PAVP 3OZHA 4P87A 4YNRA 2JKRM 2XEPA 5G4ZA 3A3FA 5AQAA 2OOLA 2M7VA 1D1JA 4LENA 2HZ5A 2I9VA 2OLVA 1MWTA 3CI6A 3KSFA 3C4PA 4BQMA 3T4LA 1NYYA 3FV7A 5F82A 3MKEA 4PMAA 3Q81A 3UPNA 2XA7M 4EXOA 4GS9A 1YLZA 3RJUA 3P09A 3MJQA 4BBVA 1DP6A 5DTTA 1GHPA 5HL6A 2BTFP 4X25A 3VE3A 1P97A 4PM9A 1W63M 3BEBA 4LPZA 4E3IA 4MLLA 3HLEA 4JF4A 3SS5A 3IWIA 1Z09A 2XK1A 3GRJA 3T1QB 3NECA 3HBRA 4DE1A 2EX9A 1SKOB 3I7JA 4YINA 4DXCA 3TJZC 4N9KA 3ITBA 4PKYG 5DF8A 2WUQA 2Y8HA 3LUQA 1H3QA 2A3UA 4YFMA 2WZZA 2W3FA 1F98A 2XDMA 1IYSA 4BLMA 1TEMA 2Y2JA 5KSHA 2ZD8A 3GR2A 3ZG7B 4E3LA 5KIZA 4EV4A 3SH9A 4WZ5A 4DDYA 5GHZA 4PKYA 2J7VA 3NBLA 4JBFA 3W4OA 3LGOA 2PDRA 5FI6A 3V67A 4WLAA 3BQAA 2JKTI 2ZMAA 3UE1A 4E3KA 3OPRA 4EBLA 3A0RA 4P0MA 4FTXA 2UWXA 1KDWA 3N7WA 1Q2QA 3UE0A 4CLCC 2HJEA 5J7EA 5FQ9A 1T1AA 5BOHA 1KE4A 2GNXA 3IWQA 5HZHA 3PBRA 4F3LA 1JTGA 1U60A 2KOIA 3NI9A 3T4OA 2D01A 1P9WA 1PNEA 4NEED 2QWSA 2UV0E 3QHYA 1YM1A 1FQGA 4KZ4A 2ZM0A 3IX3A 5AQBA 1TS6A 3U2AA 5EVID 1KGFA 1BLPA 1IFQA 4KENB 1M40A 1XJ6A 5CGXA 1L3LA 5U47A 3HUNA 2WAFA 3DTMA 5GLAA 4Y0TA 4OQ0A 2OAP1 3GDIA 5J3WA 4HP4A 3UY6A 4KQRA 4UHUA 4ESPA 1WYCA 2QJ7A 4H6JA 4ZJ2A 2O99A 3VSLA 3BYDA 3UNWA 2W1TA 5CHJA 4YOFA 2PHYA 5E43A 4E3NA 2X02A 4S2NC 4BMWA 1Y4OA 1IELA 4N9LA 4ZAMA 1W8QA 3E2LA 2Y91A 3OLOA 3LFVA 3PR6A 1KVLA 1BZAA 3TG9A 4YWZA 3M6HA 4JKTA 4F3LB 1G6AA 1ESIA 2WKRA 5CTNA 2Y2QA 3O87A 1EW0A 4PM7A 3LR3A 3CUEA 5TGFA 1LL9A 2Y2OA 3IBJA 3JYIA 5HPFA 3PYPA 4KZ8A 4E6XA 4CLCD 5DKKA 1XJ4A 4E3OA 1CEFA 1J3WA 1FR6A 3HLDA 2O9CA 3O88A 3K2NA 4JXWA 4DRTA 3IXHA 3KYZA 2HP9A 4JXSA 3B3XA 3HJIA 3UMDA 1WA9A 3NY4A 1WYBA 1VETB 3OPHA 3MKFA 5EM1A 3LR0A 3K3DA 1XJ2A 3PBTA 3DWZA 2GX5A 2X01A 2KDKA 3CITA 2W1TB 4RX2A 4WL9A 4HBTA 2ZMFA 1JNUA 5FQQA 4HH2A 2DNSA 1IYQA 1LSVA 2HDQA 3OCLA 3U4LP 4WBGA 4XUXA 2NUTC 1T19A 1TS7A 1K55C 3C5AA 1PI4A 2Z6DA 4EUZA 3V50A 2PD8A 1HTZA 4WYYA 3A3JA 5HWVA 3FZCA 1H0MA 4KG5A 2L1MA 4BBUA 2D02A 3W4PA 4EU0A 4Q0HA 5F83A 1XFNA 2ZM8A 4MMNA 4MBHA 2A2LA 5CX7A 5GHXA 3DW0A 5DTSA 3ZFZA 4FCFA 4IJGA 1KE3A 1ERMA 1W79A 4O8GA 1XGJA 1DJAA 3FPWA 4HQAA 5FQIA 1H8YA 5HSQA 4L9EA 3FYZA 1YPRA 4X68A 5IS1A 3CHWP 1XPBA 5F69A 2O0YA 1MZUA 3WRZA 2X71A 5AVEA 3IF6B 4JGOA 4HH3A 4WN5A 5EUAA 1OMEA 4PPRA 3SH7A 4C75A 1DJCA 1FCNA 4RX3A 3NDGA 1MWUA 5JYPA 3HLWA 3SW1A 3ZCZA 1VHMA 3VP0A 2JKTM 3BM6A 4R0QA 2J3WA 4WEJA 5AJGA 3BECA 3CWFA 5CERA 4PM6A 5HAIA 3MR0A 3FKWA 3OOVA 1MKIA 1HVBA 3BY8A 5DF7A 5DJTA 2ZQ9A 2OLUA 2B5RA 3AGEA 3NIAA 2H10A 4LV1A 1LLBA 4RQ9A 4RYEA 3E2KA 4QPRA 5FAPA 3C38A 1XJ3A 2PR6A 2XROA 1MXOA 4MBFA 3D3OA 4JGRA 4NG2A 1E3UD 2EWVA 2EA9A 2V0WA 3T4SA 3RFBA 2KX6A 5CGSA 4OLGA 2W1RA 4GN2A 3IH9A 3MF0A 5E2HA 3MZEA 4P85A 3ZG0A 3G2YA 1NLYA 2Y79A 4ARZA 1S1ZA 4R3BA 3EGXC 1YAXA 4DXBA 3WS0A 5FA7A 1LSWA 4HBUA 1HLUP 3VMAA 2DMWA 2EX8A 4WMCA 4LRXC 4CJNA 2VGJA 4OPZA 3PBQA 2PU4A 1SZVA 4FH2A 3G2ZA 4DE0A 4DE2A 4S2JA 1PWDA 2JE5A 3ISGA 3MQOA 4Q0JA 3HLGA 2EX2A 1CF0A 5GLCA 3HJKA 4N92A 4GB7A 3KX0X 4PHTA 4R1GA 2PD7A 1OTBA 2DCFA 3GVBA 1XP4A 3PBOA 1UWPX 4LV3A 2JHEA 4GDBA 3HL9A 1EROA 3UPOA 1ONHA 3LY4A 5DTKA 4K91A 1P9RA 1STZA 2VZWA 1K56D 3KSGA 2XF3A 1SKOA 1QMFA 1PZPA 4LGWA 1M6KA 3HUOA 2A24B 1NRJA 1HZOA 3H9WA 2W0NA 3G32A 4KUKA 5GLBA 3HCYA 5HWWA 4LCLA 4OQIA 3PBNA 1F9IA 1JWZA 4E3JA 1PYYA 4GJ4A 2ZC6B 2HGVA 1YSQA 1BYWA 3MMHA 3MXRA 1VB6A 3T4KA 4C3QA 4N1HA 3PHYA 4S2OA 3ZG9B 4UAAA 1L0GA 5FEGA 3VSKA 1ES4A 1MWSA 2XSSA 3ZHHA 3GSGA 4Z1WA 3E4PA 3UDIA 3SH8A 4IVIA 1HD8A 1P0ZA 4HP9A 1E4DA 1H5XA 3IH8A 1KGEA 1K4FA 4BD0A 3BFGA 3BQ8A 3CLOA 1E25A 2PT7A 4CLCE 3CPTB 4M3KA 2G7UA 2CMNA 1I5QA 3Q82A 4NXGA 2OWJA 1NRFA 4ZJ1A 2RL3A 5EVIC 1TS8A 1OJGA 2BASA 1PIOA 3MXQA 3G30A 4DF6A 4H8RA 3G34A 5TBMA 3A0SA 3S7NA 5LBRA 1VQQA 4P6BA 3LEQA 1FSYA 4GOGA 3HREA 1KOUA 2Y2PA 3ZG5A 4S2IA 2H28A 1QMEA 3LEZA 3LIAA 2PR5A 2XD1A 3UB8A 4KZ9A 5EOOA 4E6WA 2XR0A 2GJ3A 2WKQA 2YKFA 2ZC3B 5DJUA 2B95A 3S7OA 2OAQ1 3UB6A 1CJFA 1AWIA 3MZFA 5CEDA 2WKEA 4NXBA 2FFFB 2ZQCA 2QYBA 4HHDA 2XD5A 3IBRA 5HARA 4OKPA 2W3DA 4IBXA 4PM8A 4ZTKA 3RTYA 4ME4A 4PAUA 2OWHA 2V8CA 3ZG8B 3MFDA 2HP6A 3QP2A 4Q8IA 5L2FA 3SOIA 5FQJA 3BY9A 5CXWA 1I2WA 5F6AA 2O9BA 3G31A 3W4QA 3AGFA 4EEUA 4KZ5A 4I3IA 2HP5A 3MSHA 1Z6FA 1NXYA 1YSPA 3UB5P 1PI5A 3IS2A 3QNBA 5TBMB 2J8YA 2WKIA 3OBFA 4HJ6A 3TRCA 1NY0A 1K57C 3T4JA 3IF5A 5DF9A 2VK3A 5HD3A 1SDEA 3LICA 2NUPC 4X1MA 1LI0A 3QP5A 4KZ7A 2M1CA 1OPXA 1VEUB 3BFCA 3F1NB 5HD5A 4S2KA 4IHQA 4Y0UA 1L0DA 2ZQAA 1BT5A 1TDGA 3W8KA 2V20A 1MWRA 4IEDA 5F5YA 1VETA 4BL3A 2ZQ7A 3JPUA 3ZVTA 3NOTC 2V0UA 1S4SA 4DN0A 5EPHA 3TSGA 2OSUA 1AXBA 3T1XA 3ZDJA 2H0YA 4PM5A 1L0FA 5FEFA 2GZAA 5F1GA 1KGGA 4IUKA 4ZDXA 5GHYA 3EGDC 1FCOA 5DFXA 3GMWA 2ZQDA 1BTLA 1K54A 4HESA 2Y2IA 1F2KA 3ZNTA 2QHKA 3C4OA 2IWBA 4DDSA 4HJ4A 4ZRRA 5L07A 3OPLA 4EUVA 4N1XA 5FDSA 3PXPA 5M19A 2Z6CA 1N9BA 2V2FF 2ZOIA 3IS2B 4OPRA 1BLHA 4BBTA 4ZJ3A 3G6OA 2Y2HA 3ICYA 4WF0A 1NZOA 1EWZA 4OH0A 2EXBA 1D06A 3JVVA 2VA0A 2HV1A 3GV9A 2W3EA 1TF1A 5DVAA 2P04A 2QZ6A 4II7A 3ULFA 3LI9A 4KUOA 3UMEA 4KQDA 3C2WA 3ITAA 5HWTA 2ZC4B 5JYOA 3RXWA 1YLWA 5CRFA 5J8XA 1N9OA 4MN6A 3IF6A 4K08A 3G35A 2Y2MA 2Q9NA 4GDNA 4S2NA 3A3IA 2VKSA 3DTEA 4EBPA 1PWGA 1O7EA 1EI5A 3KYEA 3QP8A 4QB8A 1LHYA 1ZG4A 4K0XA 4WM9A 4CLCB 4HOIA 4KG2A 4R3JA 5A92A 2Q9MA 1GSWA 1OJ5A 3H82B 1CQAA 4O7DA 2CC1A 4JF6A 1IYPA 4JGQA 5L09A 4GKUA 4G3WA 1ACFA 4BD1A 3N4IA 2WAEA 3N8RA 3LIFA 2Y4AA 5FSRA 1X0OA 3LO7A 5EECA 1BLSA 3C7VA 3LIEA 3CZDA 2P9VA 3AGDA 3NJAA 5HL1A 3IX4A 5TFQA 2E8IA 3RH8B 3HVFA 3A0VA 4I39A 4RVAA 1JTDA 3WS1A 4OOLA 1ZKJA 4OONA 4EWFA 4M4XA 5M18A 2HDSA 2VGLS 3NCKA 3TOIA 3DWKA 2PBDP 3OC2A 4LRZE 2RCXA 2YKHA 5E2EA 3MS6A 1YLYA 3S4XA 4MNRA 2LB5A 4Y0OA 3EQUA 1ESUA 5HAQA 3B33A 2EX6A 3IQAA 2Y59A 2QMIA 5TJJA 3UB9A 5I94A 5HPIA 1W8YA 4L9FA 4LLOB 1K55A 3T4QA 2PYPA 1ODVA 2G2UA 4OOYA 3P98A 4S2PA 2K7SA 4Y13A 1S67L 1S6RA 4P6ZS 1NYMA 3LY3A 1S4RA 4WEKA 3VOZA 2JKFA 1XGIA 3BFEA 3WS2A 2Q0OA 1LSXA 4OQHA 2HF6A 2VV6A 1K38A 2ZL1B 4I5SA 4Q0IA 4LCMA 1ALQA 5FI2A 5K5BA 2VGKA 1CI9A 2P9VB 3UB7A 2WGIA 1V9ZA 2HDRA 5CECA 3DTIA 5GLDA 4Y7PA 3LR5A 5HDCA 2XH9A 3VOLA 4QU3A 2XLNA 1RP5A 4X1LA 4Y2FA 3NDEA 2QKPA 3EEHA 2JKGA 2W3HA 1CI8A 4DJ2A 2ZJ9A 1TS0A 5F1FA 2A24A 2K2NA 4OOMA 1JWPA 1K6RA 3D9YA 3D4FA 3C8CA 1YKDA 5L8MA 4OP8A 5I5LA 3KO6A 2ZOHA 4FOFA 1YLPA 4WZ4A
chains in the Genus database with same CATH topology
4X55A 5EVLA 5U47A 1NRFA 4ZJ1A 3HUNA 2RL3A 5EVIC 2WAFA 5FASA 4FSFA 3DTMA 5GLAA 4Y0TA 1PIOA 1H8ZA 4OQ0A 4R4SA 3ZVWA 3G30A 1GHIA 4DF6A 4H8RA 1Q2PA 2Y2GA 3G34A 3UY6A 4KQRA 1O07A 4UHUA 5CGWA 2Y55A 3SS4A 2BLSA 4RA7A 1WYCA 4GZBA 2Z2MB 3UE3A 4ZJ2A 4FH4A 3MBZA 3OPPA 3BFDA 1VQQA 3BFFA 4P6BA 5FI7A 3UN7A 3BYDA 3UNWA 3VSLA 5EE8A 5CTMA 1FSYA 2Y2LA 1I2SA 5CHJA 4ID4A 4MBKA 4GOGA 3HREA 4QY5A 2Y2PA 3ZG5A 4S2IA 3V39A 5E43A 2ZC5B 4X56A 2FFYA 4E3NA 1QMEA 3LEZA 4QJGA 2X02A 1RGZA 3FKVA 3G4PA 2XD1A 2OV5A 1XA1A 4S2NC 4EWFA 3IHAA 1KVMA 4KZ9A 3IXGA 1IELA 4N9LA 5EOOA 4ZAMA 4E6WA 1W8QA 3E2LA 4LV0A 1GHMA 3UO9A 1DJBA 2Y91A 1YMSA 4D2OA 2XR0A 3IHBA 1KVLA 4OP5A 2G2WA 2ZC3B 2WGWB 1BZAA 1BUEA 3TG9A 3ZNYA 1S0WA 1BSGA 1XX2A 1PW1A 3M6HA 1MBLA 3MZFA 1ONGA 2WKEA 1BLCA 1ESIA 1G6AA 4JKTA 2FFFB 2ZQCA 4K0WA 5E2GA 2XD5A 1E3UA 5CTNA 5HARA 2Y2QA 4OKPA 3VFFA 4IBXA 3CMZA 4PM8A 4ZTKA 2I72A 3O87A 2IWCA 4JPMA 4PM7A 4WMCD 2XFSA 3UPPA 5A93A 5M1AA 1K25A 5TGFA 1LL9A 2Y2OA 3JYIA 4OPYA 3ZG8B 3MFDA 4KZ8A 4E6XA 2HP6A 4E3OA 4Q8IA 5L2FA 3Q07A 3SOIA 2WADA 5FATA 1MY8A 4U0TA 5FQJA 1CEFA 4BENA 1FR6A 5CXWA 3HLDA 3LCEA 3O88A 3PAEA 1I2WA 4JXWA 4DRTA 3G31A 2ZC7A 3AGFA 3IXHA 3N8SA 3W4QA 2HP9A 4KZ5A 1J9MA 5KMWA 3FWLA 4JXSA 1CEGA 2C5WB 3B3XA 2HP5A 1Z6FA 3BLMA 1NXYA 4BL2A 2BG1A 3NY4A 5GL9A 1WYBA 3OPHA 1PI5A 3MKFA 4R23A 3QNBA 2WKIA 2J8YA 3PBTA 3DWZA 1NY0A 3Q7VA 1K57C 2X01A 3IF5A 4RX2A 2JBFA 5DF9A 1GA0A 4EQIA 3VFHA 4HBTA 5FQQA 4GNUA 4IVKA 2DNSA 2WZXA 3N6IA 5FDHA 1IYQA 2HDQA 3OCLA 1SDEA 2WYXA 4WBGA 4XUXA 1K4EA 1LI0A 4KZ7A 2P74A 1SHVA 5A90A 2C6WB 4XUZA 1K55C 1W5DA 5CHUA 1BULA 1SCWA 3C5AA 3BFCA 3CG5A 4S2KA 4Y0UA 4OVDA 1IKGA 1PI4A 5TR7A 1TVFA 4CPKA 4DE3A 4EUZA 1L0DA 3BRMA 4WZ5C 3WS4A 2ZQAA 2Y2NA 3PBSA 1RGYA 2EFXA 3V50A 1BT5A 4EBNA 1TDGA 3GTCA 1IYOA 2GDNA 3SS3A 3W8KA 2V20A 1MWRA 2HDUA 4IEDA 4KZBA 1HTZA 2Y2KA 3A3JA 1FR1A 4WYYA 5FAOA 5A91A 4BL3A 1ERQA 3BLSA 5KSCA 3MZDA 2ZQ7A 3ZVTA 3FZCA 3IT9A 4OQGA 2XFTA 2IWDA 1PZOA 3HLFA 4Z9QA 2ZM2A 3CJMA 1K56A 4KG5A 1IKIA 5EPHA 5CHMA 1PWCA 3TSGA 2OSUA 1AXBA 3W4PA 3OCNA 3WWXA 2V1ZA 5F83A 4KQQA 2H0YA 3ZDJA 4PM5A 2ZM8A 1FCMA 1L0FA 4MBHA 2XQZA 4QY6A 4U3TA 4KZ6A 4B88A 4XXRA 4X53A 5GHXA 5F1GA 1KGGA 3DW0A 4F94A 5DTSA 1YQSA 3HLCA 3VP4A 4ZDXA 3ZFZA 4FCFA 5GHYA 3VP2A 1FCOA 2JCHA 4B4XA 2QPNA 3GMWA 3S22A 2ZQDA 1KE3A 1ERMA 2EXAA 1W79A 1BTLA 1XGJA 1K54A 4HESA 1DJAA 4KG6A 2Y2IA 3M2JA 5AQ7A 2DRWA 5FQIA 1H8YA 3FYZA 3ZNTA 5HAPA 5CGXA 4X68A 3C4OA 3N8LA 2IWBA 4S2MA 4DDSA 1IEMA 1RCJA 3RXXA 1ZG6A 3OPLA 4KQOA 1XPBA 4N1XA 5M19A 3WRZA 1N9BA 1JWVA 2V2FF 1KDSA 1YLTA 2X71A 1WE4A 1VM1A 3IF6B 2H0TA 4C6YA 4OPRA 5HW3A 1FSWA 2WKHA 2Z2LB 1BLHA 1GA9A 5EUAA 1OMEA 4ZJ3A 3WRTA 2Y2HA 4PPRA 3SH7A 4NK3A 4C75A 1DJCA 4WELA 3Q7VB 1NZOA 2R9WA 1FCNA 1TDLA 1EWZA 4RX3A 1XA7A 3M2KA 4OH0A 3NDGA 2EXBA 2EFUA 2ZLYA 3A3EA 1MWUA 4E3MA 1ES3A 3V3SA 4BJPA 3GV9A 2R9XA 5JYPA 3HLWA 5DVAA 2QZ6A 5AQ9A 1L0EA 5EVIA 3ZCZA 3V5MA 3VP0A 4KZAA 4FD8A 4R4RA 3BM6A 4R0QA 3ITAA 4NETA 2ZC4B 5JYOA 3QNCA 4HEFA 1YLWA 1LL5A 1JVJA 3RXWA 5IHVA 4WEJA 5CRFA 5J8XA 2ZQ8A 1C3BA 5HX9A 1LI9A 3BECA 5G18A 5CERA 4JF5A 4PM6A 4UA6A 5HFOA 5HAIA 1Y54A 3FKWA 1MKIA 1HVBA 3IF6A 5DF7A 1FOFA 1YMXA 4UA7A 2ZQ9A 5CEBA 3G35A 2OLUA 1YT4A 2Y2MA 3IWOA 2Q9NA 4GDNA 2B5RA 3AGEA 3NIAA 2H10A 4S2NA 4LV1A 3A3IA 1LLBA 3Q82A 4RYEA 4B4ZA 3E2KA 4EBPA 3OZHA 1PWGA 5FAPA 1O7EA 1EI5A 4P87A 1ZC2A 1GCEA 2PBYA 2XEPA 4QB8A 1LHYA 1MXOA 4MBFA 3A3FA 1K54C 5AQAA 4JXGA 1ZG4A 4LENA 4K0XA 4WM9A 3NC8A 1SDNA 1ES2A 2J9OA 1E3UD 2OLVA 4S2LA 1MWTA 4KG2A 4ZBEA 4R3JA 3Q1FA 2H5SA 5A92A 3VP1A 2Q9MA 3C4PA 4LV2A 5EOEA 5CGSA 4BQMA 4OLGA 5E2FA 4GN2A 3IH9A 5E2HA 3MZEA 4P85A 1NYYA 3FV7A 4O7DA 2CC1A 4JF6A 1IYPA 5F82A 3MKEA 3ZG0A 3G2YA 4PMAA 4GKUA 3HUMA 3IXBA 3Q81A 3UPNA 1DY6A 4BD1A 3N4IA 5CEDA 2HPBA 2WAEA 4R3BA 3N8RA 4OPQA 1YLZA 3RJUA 3P09A 2Y4AA 5FSRA 4DXBA 3WS0A 5FA7A 4QHCA 4X69A 3LO7A 5EECA 1BLSA 3C7VA 4HBUA 5DTTA 3A3DA 1GHPA 3CZDA 2P9VA 4X6TA 3AGDA 3M6BA 3VMAA 5HL1A 5TFQA 2E8IA 3HVFA 1YLJA 2EX8A 4WMCA 4CJNA 3WS1A 4RVAA 4PM9A 1JTDA 2VGJA 4OPZA 3BEBA 3PBQA 4OOLA 3WS5A 4E3IA 2PU4A 3PAGA 4FH2A 1ZKJA 4OONA 3O86A 3G2ZA 4MLLA 3HLEA 5EVIB 4JF4A 4S2JA 1PWDA 4DE0A 4DE2A 2JE5A 3ISGA 5M18A 3SS5A 2HDSA 3IWIA 3NCKA 2JC7A 2XK1A 3GRJA 3TOIA 3HLGA 3DWKA 3HBRA 2EX2A 3OC2A 2RCXA 4OLDA 2EX9A 5E2EA 4DE1A 3IF6C 5GLCA 3I7JA 4YINA 4DXCA 2J9PA 4N92A 4N9KA 3ITBA 1YLYA 4GB7A 1K6SA 3S4XA 4R1GA 4MNRA 1K57A 4Y0OA 5DF8A 3EQUA 2WUQA 2DCFA 3GVBA 1XP4A 1ESUA 5D3OA 3PBOA 4LV3A 5HAQA 3UDFA 2EX6A 3V3RA 3IQAA 4GDBA 2A3UA 4YFMA 3HL9A 2WZZA 2PU2A 2Y59A 2QMIA 2XDMA 1MPLA 1EROA 3UPOA 1IYSA 1ONHA 4GD8A 1TEMA 3UDXA 4BLMA 5I94A 4U0XA 1W8YA 3VP3A 2Y2JA 3LY4A 3PTEA 1K55A 3Q7ZA 5DTKA 5KSHA 1W7FA 2A49A 2ZD8A 3GR2A 3ZG7B 5FQMA 4E3LA 1XKZA 2G2UA 4K91A 4EV4A 3SH9A 4OOYA 4WZ5A 3P98A 4DDYA 4S2PA 5GHZA 2J7VA 3NBLA 1S6RA 3O3VA 1K56D 4JBFA 1NYMA 1NZUA 2XF3A 3LY3A 3W4OA 2XGNA 1QMFA 1PZPA 1M6KA 3HUOA 4WEKA 3VOZA 1HZOA 5FI6A 3G32A 1XGIA 4MEZA 5GLBA 4KZ3A 4LCLA 3PBNA 1PW8A 3BFEA 1JWZA 4OQIA 4E3JA 1PYYA 3HLBA 3WS2A 2ZMAA 3UE1A 2ZC6B 4OQHA 1SKFA 4E3KA 5KZHA 1NJ4A 3OPRA 1L2SA 4EBLA 4P0MA 1K38A 2UWXA 4GD6A 1KDWA 3IXDA 4LCMA 3N7WA 3MXRA 1ALQA 2WK0A 5FI2A 2VGKA 4C3QA 1Q2QA 1CI9A 2P9VB 3UE0A 2WGIA 5FAQA 2WGWA 4N1HA 4JXVA 2HDRA 5CECA 4S2OA 3ZG9B 4UAAA 5FQ9A 5BOHA 5GLDA 4Y7PA 1L0GA 1KE4A 3IWQA 3PBRA 1XXMA 2XH9A 3VSKA 1ES4A 1JTGA 3EQVA 1KE0A 1U60A 4QU3A 2XLNA 1MWSA 3NI9A 4JLFA 1RP5A 2WGVA 3NDEA 3ZHHA 3GSGA 3UDIA 3SH8A 4IVIA 4UA9A 3ZGAB 1HD8A 1CI8A 3QHYA 2ZJ9A 1YM1A 1FQGA 5F1FA 4KZ4A 1E4DA 1H5XA 3IH8A 2ZM0A 1KGEA 1K4FA 4QD4A 4OOMA 5AQBA 5FQKA 4BD0A 3BFGA 1N4OA 1ES5A 1JWPA 1K6RA 4IBRA 1CK3A 3VOYA 1E25A 3D4FA 1KGFA 5EVID 1BLPA 4KENB 1G68A 4M3KA 3C7UA 1M40A 4OP8A 4A5RA 4DKIA 3GQZA 4L0LA 1I5QA 3MXSA 1YLPA 3S1YA 4WZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X55 A;  5EVL A;  5U47 A;  1NRF A;  4ZJ1 A;  3HUN A;  2RL3 A;  5EVI C;  2WAF A;  5FAS A;  4FSF A;  3DTM A;  5GLA A;  4Y0T A;  1PIO A;  1H8Z A;  4OQ0 A;  4R4S A;  3ZVW A;  3G30 A;  1GHI A;  4DF6 A;  4H8R A;  1Q2P A;  2Y2G A;  3G34 A;  3UY6 A;  4KQR A;  1O07 A;  4UHU A;  5CGW A;  2Y55 A;  3SS4 A;  2BLS A;  4RA7 A;  1WYC A;  4GZB A;  2Z2M B;  3UE3 A;  4ZJ2 A;  4FH4 A;  3MBZ A;  3OPP A;  3BFD A;  1VQQ A;  3BFF A;  4P6B A;  5FI7 A;  3UN7 A;  3BYD A;  3UNW A;  3VSL A;  5EE8 A;  5CTM A;  1FSY A;  2Y2L A;  1I2S A;  5CHJ A;  4ID4 A;  4MBK A;  4GOG A;  3HRE A;  4QY5 A;  2Y2P A;  3ZG5 A;  4S2I A;  3V39 A;  5E43 A;  2ZC5 B;  4X56 A;  2FFY A;  4E3N A;  1QME A;  3LEZ A;  4QJG A;  2X02 A;  1RGZ A;  3FKV A;  3G4P A;  2XD1 A;  2OV5 A;  1XA1 A;  4S2N C;  4EWF A;  3IHA A;  1KVM A;  4KZ9 A;  3IXG A;  1IEL A;  4N9L A;  5EOO A;  4ZAM A;  4E6W A;  1W8Q A;  3E2L A;  4LV0 A;  1GHM A;  3UO9 A;  1DJB A;  2Y91 A;  1YMS A;  4D2O A;  2XR0 A;  3IHB A;  1KVL A;  4OP5 A;  2G2W A;  2ZC3 B;  2WGW B;  1BZA A;  1BUE A;  3TG9 A;  3ZNY A;  1S0W A;  1BSG A;  1XX2 A;  1PW1 A;  3M6H A;  1MBL A;  3MZF A;  1ONG A;  2WKE A;  1BLC A;  1ESI A;  1G6A A;  4JKT A;  2FFF B;  2ZQC A;  4K0W A;  5E2G A;  2XD5 A;  1E3U A;  5CTN A;  5HAR A;  2Y2Q A;  4OKP A;  3VFF A;  4IBX A;  3CMZ A;  4PM8 A;  4ZTK A;  2I72 A;  3O87 A;  2IWC A;  4JPM A;  4PM7 A;  4WMC D;  2XFS A;  3UPP A;  5A93 A;  5M1A A;  1K25 A;  5TGF A;  1LL9 A;  2Y2O A;  3JYI A;  4OPY A;  3ZG8 B;  3MFD A;  4KZ8 A;  4E6X A;  2HP6 A;  4E3O A;  4Q8I A;  5L2F A;  3Q07 A;  3SOI A;  2WAD A;  5FAT A;  1MY8 A;  4U0T A;  5FQJ A;  1CEF A;  4BEN A;  1FR6 A;  5CXW A;  3HLD A;  3LCE A;  3O88 A;  3PAE A;  1I2W A;  4JXW A;  4DRT A;  3G31 A;  2ZC7 A;  3AGF A;  3IXH A;  3N8S A;  3W4Q A;  2HP9 A;  4KZ5 A;  1J9M A;  5KMW A;  3FWL A;  4JXS A;  1CEG A;  2C5W B;  3B3X A;  2HP5 A;  1Z6F A;  3BLM A;  1NXY A;  4BL2 A;  2BG1 A;  3NY4 A;  5GL9 A;  1WYB A;  3OPH A;  1PI5 A;  3MKF A;  4R23 A;  3QNB A;  2WKI A;  2J8Y A;  3PBT A;  3DWZ A;  1NY0 A;  3Q7V A;  1K57 C;  2X01 A;  3IF5 A;  4RX2 A;  2JBF A;  5DF9 A;  1GA0 A;  4EQI A;  3VFH A;  4HBT A;  5FQQ A;  4GNU A;  4IVK A;  2DNS A;  2WZX A;  3N6I A;  5FDH A;  1IYQ A;  2HDQ A;  3OCL A;  1SDE A;  2WYX A;  4WBG A;  4XUX A;  1K4E A;  1LI0 A;  4KZ7 A;  2P74 A;  1SHV A;  5A90 A;  2C6W B;  4XUZ A;  1K55 C;  1W5D A;  5CHU A;  1BUL A;  1SCW A;  3C5A A;  3BFC A;  3CG5 A;  4S2K A;  4Y0U A;  4OVD A;  1IKG A;  1PI4 A;  5TR7 A;  1TVF A;  4CPK A;  4DE3 A;  4EUZ A;  1L0D A;  3BRM A;  4WZ5 C;  3WS4 A;  2ZQA A;  2Y2N A;  3PBS A;  1RGY A;  2EFX A;  3V50 A;  1BT5 A;  4EBN A;  1TDG A;  3GTC A;  1IYO A;  2GDN A;  3SS3 A;  3W8K A;  2V20 A;  1MWR A;  2HDU A;  4IED A;  4KZB A;  1HTZ A;  2Y2K A;  3A3J A;  1FR1 A;  4WYY A;  5FAO A;  5A91 A;  4BL3 A;  1ERQ A;  3BLS A;  5KSC A;  3MZD A;  2ZQ7 A;  3ZVT A;  3FZC A;  3IT9 A;  4OQG A;  2XFT A;  2IWD A;  1PZO A;  3HLF A;  4Z9Q A;  2ZM2 A;  3CJM A;  1K56 A;  4KG5 A;  1IKI A;  5EPH A;  5CHM A;  1PWC A;  3TSG A;  2OSU A;  1AXB A;  3W4P A;  3OCN A;  3WWX A;  2V1Z A;  5F83 A;  4KQQ A;  2H0Y A;  3ZDJ A;  4PM5 A;  2ZM8 A;  1FCM A;  1L0F A;  4MBH A;  2XQZ A;  4QY6 A;  4U3T A;  4KZ6 A;  4B88 A;  4XXR A;  4X53 A;  5GHX A;  5F1G A;  1KGG A;  3DW0 A;  4F94 A;  5DTS A;  1YQS A;  3HLC A;  3VP4 A;  4ZDX A;  3ZFZ A;  4FCF A;  5GHY A;  3VP2 A;  1FCO A;  2JCH A;  4B4X A;  2QPN A;  3GMW A;  3S22 A;  2ZQD A;  1KE3 A;  1ERM A;  2EXA A;  1W79 A;  1BTL A;  1XGJ A;  1K54 A;  4HES A;  1DJA A;  4KG6 A;  2Y2I A;  3M2J A;  5AQ7 A;  2DRW A;  5FQI A;  1H8Y A;  3FYZ A;  3ZNT A;  5HAP A;  5CGX A;  4X68 A;  3C4O A;  3N8L A;  2IWB A;  4S2M A;  4DDS A;  1IEM A;  1RCJ A;  3RXX A;  1ZG6 A;  3OPL A;  4KQO A;  1XPB A;  4N1X A;  5M19 A;  3WRZ A;  1N9B A;  1JWV A;  2V2F F;  1KDS A;  1YLT A;  2X71 A;  1WE4 A;  1VM1 A;  3IF6 B;  2H0T A;  4C6Y A;  4OPR A;  5HW3 A;  1FSW A;  2WKH A;  2Z2L B;  1BLH A;  1GA9 A;  5EUA A;  1OME A;  4ZJ3 A;  3WRT A;  2Y2H A;  4PPR A;  3SH7 A;  4NK3 A;  4C75 A;  1DJC A;  4WEL A;  3Q7V B;  1NZO A;  2R9W A;  1FCN A;  1TDL A;  1EWZ A;  4RX3 A;  1XA7 A;  3M2K A;  4OH0 A;  3NDG A;  2EXB A;  2EFU A;  2ZLY A;  3A3E A;  1MWU A;  4E3M A;  1ES3 A;  3V3S A;  4BJP A;  3GV9 A;  2R9X A;  5JYP A;  3HLW A;  5DVA A;  2QZ6 A;  5AQ9 A;  1L0E A;  5EVI A;  3ZCZ A;  3V5M A;  3VP0 A;  4KZA A;  4FD8 A;  4R4R A;  3BM6 A;  4R0Q A;  3ITA A;  4NET A;  2ZC4 B;  5JYO A;  3QNC A;  4HEF A;  1YLW A;  1LL5 A;  1JVJ A;  3RXW A;  5IHV A;  4WEJ A;  5CRF A;  5J8X A;  2ZQ8 A;  1C3B A;  5HX9 A;  1LI9 A;  3BEC A;  5G18 A;  5CER A;  4JF5 A;  4PM6 A;  4UA6 A;  5HFO A;  5HAI A;  1Y54 A;  3FKW A;  1MKI A;  1HVB A;  3IF6 A;  5DF7 A;  1FOF A;  1YMX A;  4UA7 A;  2ZQ9 A;  5CEB A;  3G35 A;  2OLU A;  1YT4 A;  2Y2M A;  3IWO A;  2Q9N A;  4GDN A;  2B5R A;  3AGE A;  3NIA A;  2H10 A;  4S2N A;  4LV1 A;  3A3I A;  1LLB A;  3Q82 A;  4RYE A;  4B4Z A;  3E2K A;  4EBP A;  3OZH A;  1PWG A;  5FAP A;  1O7E A;  1EI5 A;  4P87 A;  1ZC2 A;  1GCE A;  2PBY A;  2XEP A;  4QB8 A;  1LHY A;  1MXO A;  4MBF A;  3A3F A;  1K54 C;  5AQA A;  4JXG A;  1ZG4 A;  4LEN A;  4K0X A;  4WM9 A;  3NC8 A;  1SDN A;  1ES2 A;  2J9O A;  1E3U D;  2OLV A;  4S2L A;  1MWT A;  4KG2 A;  4ZBE A;  4R3J A;  3Q1F A;  2H5S A;  5A92 A;  3VP1 A;  2Q9M A;  3C4P A;  4LV2 A;  5EOE A;  5CGS A;  4BQM A;  4OLG A;  5E2F A;  4GN2 A;  3IH9 A;  5E2H A;  3MZE A;  4P85 A;  1NYY A;  3FV7 A;  4O7D A;  2CC1 A;  4JF6 A;  1IYP A;  5F82 A;  3MKE A;  3ZG0 A;  3G2Y A;  4PMA A;  4GKU A;  3HUM A;  3IXB A;  3Q81 A;  3UPN A;  1DY6 A;  4BD1 A;  3N4I A;  5CED A;  2HPB A;  2WAE A;  4R3B A;  3N8R A;  4OPQ A;  1YLZ A;  3RJU A;  3P09 A;  2Y4A A;  5FSR A;  4DXB A;  3WS0 A;  5FA7 A;  4QHC A;  4X69 A;  3LO7 A;  5EEC A;  1BLS A;  3C7V A;  4HBU A;  5DTT A;  3A3D A;  1GHP A;  3CZD A;  2P9V A;  4X6T A;  3AGD A;  3M6B A;  3VMA A;  5HL1 A;  5TFQ A;  2E8I A;  3HVF A;  1YLJ A;  2EX8 A;  4WMC A;  4CJN A;  3WS1 A;  4RVA A;  4PM9 A;  1JTD A;  2VGJ A;  4OPZ A;  3BEB A;  3PBQ A;  4OOL A;  3WS5 A;  4E3I A;  2PU4 A;  3PAG A;  4FH2 A;  1ZKJ A;  4OON A;  3O86 A;  3G2Z A;  4MLL A;  3HLE A;  5EVI B;  4JF4 A;  4S2J A;  1PWD A;  4DE0 A;  4DE2 A;  2JE5 A;  3ISG A;  5M18 A;  3SS5 A;  2HDS A;  3IWI A;  3NCK A;  2JC7 A;  2XK1 A;  3GRJ A;  3TOI A;  3HLG A;  3DWK A;  3HBR A;  2EX2 A;  3OC2 A;  2RCX A;  4OLD A;  2EX9 A;  5E2E A;  4DE1 A;  3IF6 C;  5GLC A;  3I7J A;  4YIN A;  4DXC A;  2J9P A;  4N92 A;  4N9K A;  3ITB A;  1YLY A;  4GB7 A;  1K6S A;  3S4X A;  4R1G A;  4MNR A;  1K57 A;  4Y0O A;  5DF8 A;  3EQU A;  2WUQ A;  2DCF A;  3GVB A;  1XP4 A;  1ESU A;  5D3O A;  3PBO A;  4LV3 A;  5HAQ A;  3UDF A;  2EX6 A;  3V3R A;  3IQA A;  4GDB A;  2A3U A;  4YFM A;  3HL9 A;  2WZZ A;  2PU2 A;  2Y59 A;  2QMI A;  2XDM A;  1MPL A;  1ERO A;  3UPO A;  1IYS A;  1ONH A;  4GD8 A;  1TEM A;  3UDX A;  4BLM A;  5I94 A;  4U0X A;  1W8Y A;  3VP3 A;  2Y2J A;  3LY4 A;  3PTE A;  1K55 A;  3Q7Z A;  5DTK A;  5KSH A;  1W7F A;  2A49 A;  2ZD8 A;  3GR2 A;  3ZG7 B;  5FQM A;  4E3L A;  1XKZ A;  2G2U A;  4K91 A;  4EV4 A;  3SH9 A;  4OOY A;  4WZ5 A;  3P98 A;  4DDY A;  4S2P A;  5GHZ A;  2J7V A;  3NBL A;  1S6R A;  3O3V A;  1K56 D;  4JBF A;  1NYM A;  1NZU A;  2XF3 A;  3LY3 A;  3W4O A;  2XGN A;  1QMF A;  1PZP A;  1M6K A;  3HUO A;  4WEK A;  3VOZ A;  1HZO A;  5FI6 A;  3G32 A;  1XGI A;  4MEZ A;  5GLB A;  4KZ3 A;  4LCL A;  3PBN A;  1PW8 A;  3BFE A;  1JWZ A;  4OQI A;  4E3J A;  1PYY A;  3HLB A;  3WS2 A;  2ZMA A;  3UE1 A;  2ZC6 B;  4OQH A;  1SKF A;  4E3K A;  5KZH A;  1NJ4 A;  3OPR A;  1L2S A;  4EBL A;  4P0M A;  1K38 A;  2UWX A;  4GD6 A;  1KDW A;  3IXD A;  4LCM A;  3N7W A;  3MXR A;  1ALQ A;  2WK0 A;  5FI2 A;  2VGK A;  4C3Q A;  1Q2Q A;  1CI9 A;  2P9V B;  3UE0 A;  2WGI A;  5FAQ A;  2WGW A;  4N1H A;  4JXV A;  2HDR A;  5CEC A;  4S2O A;  3ZG9 B;  4UAA A;  5FQ9 A;  5BOH A;  5GLD A;  4Y7P A;  1L0G A;  1KE4 A;  3IWQ A;  3PBR A;  1XXM A;  2XH9 A;  3VSK A;  1ES4 A;  1JTG A;  3EQV A;  1KE0 A;  1U60 A;  4QU3 A;  2XLN A;  1MWS A;  3NI9 A;  4JLF A;  1RP5 A;  2WGV A;  3NDE A;  3ZHH A;  3GSG A;  3UDI A;  3SH8 A;  4IVI A;  4UA9 A;  3ZGA B;  1HD8 A;  1CI8 A;  3QHY A;  2ZJ9 A;  1YM1 A;  1FQG A;  5F1F A;  4KZ4 A;  1E4D A;  1H5X A;  3IH8 A;  2ZM0 A;  1KGE A;  1K4F A;  4QD4 A;  4OOM A;  5AQB A;  5FQK A;  4BD0 A;  3BFG A;  1N4O A;  1ES5 A;  1JWP A;  1K6R A;  4IBR A;  1CK3 A;  3VOY A;  1E25 A;  3D4F A;  1KGF A;  5EVI D;  1BLP A;  4KEN B;  1G68 A;  4M3K A;  3C7U A;  1M40 A;  4OP8 A;  4A5R A;  4DKI A;  3GQZ A;  4L0L A;  1I5Q A;  3MXS A;  1YLP A;  3S1Y A;  4WZ4 A; 
#chains in the Genus database with same CATH topology
 4X55 A;  2P08 A;  4B93 A;  2ZBB A;  3EEA A;  5FAS A;  4FSF A;  1DP9 A;  3UE6 A;  4EES A;  4O0P A;  3ZVW A;  1XFQ A;  3T4T A;  4RA7 A;  4FH4 A;  3MBZ A;  3BFF A;  1S1Y A;  2Y2L A;  1I2S A;  4ID4 A;  4MBK A;  4QY5 A;  3V39 A;  2ZC5 B;  4X56 A;  2FFY A;  2OV5 A;  3FKV A;  1XA1 A;  3CPT A;  1KVM A;  4UQI S;  1GHM A;  2FH5 A;  1G6O A;  1YMS A;  4OP5 A;  5MC7 A;  4HNB A;  3H7W A;  3ZNY A;  1D7E A;  1BSG A;  1XX2 A;  4GCZ A;  1PW1 A;  1W63 Q;  1MBL A;  4R70 A;  4K0W A;  4CQH A;  5E2G A;  1G5U A;  1T18 A;  1DP8 A;  3W2Z A;  2IWC A;  5A8B A;  1ZHH B;  4WMC D;  3UPP A;  5A93 A;  5M1A A;  4NXF A;  1K25 A;  3S7P A;  5DFY A;  4OPY A;  4E04 A;  1OTE A;  1NLZ A;  5IT5 A;  3Q07 A;  5FAT A;  2XA7 S;  4FUW A;  2J3T D;  4GHI B;  3EOI A;  3LCE A;  3NHQ A;  3PAE A;  1J9M A;  5KMW A;  1CEG A;  4Y15 A;  3QP4 A;  4DMZ A;  3BLM A;  4BL2 A;  2L4R A;  3F1P B;  4R38 A;  4EER A;  2IA2 A;  3NUL A;  5AVF A;  1GA0 A;  2LB9 A;  4GNU A;  4IVK A;  2K31 A;  2O9A A;  1UWN X;  1N9L A;  2P74 A;  5A90 A;  1W5D A;  5CHU A;  5IU1 A;  5TR7 A;  1IKG A;  4WUJ A;  3BJN A;  3VV4 A;  4DE3 A;  3L7H A;  3QP6 A;  4GW9 A;  4WZ5 C;  1N9N A;  3H7W B;  5EV0 A;  3GTC A;  1IYO A;  2GDN A;  3SS3 A;  4EW7 A;  2V9A A;  3SZT A;  4KZB A;  2Y2K A;  5A91 A;  5FAO A;  3LID A;  2PYR A;  3BLS A;  3FPV A;  4LRY C;  3IT9 A;  2IWD A;  5L10 A;  2ZM2 A;  3CJM A;  1IKI A;  4HI4 A;  1T1C A;  2XRN A;  5CHM A;  1PWC A;  3WWX A;  4KQQ A;  2XQZ A;  4KZ6 A;  3K3C A;  4XXR A;  4X53 A;  4MDZ A;  4F94 A;  3CAX A;  1YQS A;  3VP4 A;  3IX8 A;  3VP2 A;  1VEU A;  2JCH A;  2QPN A;  3F1N A;  4MCW A;  2PRF A;  3BW6 A;  3ZQ5 A;  4KG6 A;  5AQ7 A;  3F1O B;  1V9Y A;  3N8L A;  2W3G A;  1IEM A;  1ZG6 A;  4BWI A;  2VJW A;  1KDS A;  4L9G A;  4C6Y A;  1FSW A;  2Z2L B;  1GA9 A;  2R9W A;  5J4E A;  1TDL A;  1XA7 A;  2EFU A;  1ES3 A;  3NOU C;  1L0E A;  4UEY A;  5EVI A;  4KZA A;  3FC7 A;  3D72 A;  4NET A;  3QNC A;  4HEF A;  1LL5 A;  1JVJ A;  3R4K A;  4R3A A;  5IHV A;  4DJ3 A;  2ZQ8 A;  1C3B A;  2J80 A;  2E8J A;  5HX9 A;  5G18 A;  4JF5 A;  1Y54 A;  1FOF A;  1YMX A;  4GS9 B;  4UA7 A;  1OTI A;  1TD5 A;  3IWO A;  3S7Q A;  4B4Z A;  3FG8 A;  3R7W A;  4G3V A;  1ZC2 A;  1GCE A;  2PBY A;  4AFI A;  1K54 C;  4JXG A;  3NC8 A;  1SDN A;  1ES2 A;  2J9O A;  4S2L A;  4ZBE A;  1OTD A;  3Q1F A;  2H5S A;  3VP1 A;  4LV2 A;  5EOE A;  4D60 A;  5E2F A;  3E4O A;  1FIK A;  3MQ0 A;  3HUM A;  3IXB A;  1DY6 A;  2HPB A;  3L9K A;  2B18 A;  5C5K A;  4OPQ A;  3CUE C;  4QHC A;  4X69 A;  4G3K A;  3A3D A;  4X6T A;  3M6B A;  5G4Y A;  3T12 B;  1YLJ A;  1T1B A;  3WS5 A;  3PAG A;  3O86 A;  4CLC A;  5EVI B;  2JC7 A;  5EVE A;  2VV8 A;  3H82 A;  4B9O A;  4OLD A;  3IF6 C;  2J9P A;  1K6S A;  1K57 A;  4XT2 A;  4GLQ A;  1OTA A;  5D3O A;  3UDF A;  3V3R A;  2PU2 A;  1MPL A;  4GD8 A;  3UDX A;  4LFU A;  3LR4 A;  3R7W B;  1S66 L;  4U0X A;  3VP3 A;  3PTE A;  3Q7Z A;  1W7F A;  2A49 A;  5FQM A;  1XKZ A;  2JN7 A;  5EM0 A;  3VE4 A;  1MC0 A;  4HY8 A;  3O3V A;  1NZU A;  2XGN A;  3BWL A;  3E98 A;  3O5Y A;  4MEZ A;  1IOU A;  4KZ3 A;  1PW8 A;  5FL3 A;  4MN5 A;  3HLB A;  1SKF A;  5KZH A;  1NJ4 A;  3T1R A;  2R78 A;  1L2S A;  4GD6 A;  1OT6 A;  3IXD A;  2WK0 A;  4QWO A;  4I3J A;  5FAQ A;  2WGW A;  4JXV A;  2VLG A;  2KLI A;  4R6L A;  2ZMV A;  1XXM A;  3EQV A;  1KE0 A;  5HDD A;  4JLF A;  2WGV A;  3EWK A;  4H6J B;  3B47 A;  4UA9 A;  3ZGA B;  3E0Y A;  2VEA A;  2JKR I;  3LI8 A;  4QD4 A;  5FQK A;  1N4O A;  1ES5 A;  4IBR A;  1CK3 A;  3VOY A;  3B42 A;  1G68 A;  4XT2 B;  3LYX A;  3C7U A;  1H8M A;  3T1S A;  4A5R A;  1UGU A;  4DKI A;  3DBA A;  2ZL1 A;  3GQZ A;  4L0L A;  3MXS A;  4B88 A;  3S1Y A;  5EVL A;  3JVU A;  4JGP A;  2VV7 A;  1H8Z A;  4R4S A;  1NWZ A;  1GHI A;  2M7U A;  1Q2P A;  2Y2G A;  4I3A A;  1O07 A;  1F5M A;  5CGW A;  2Y55 A;  1A0K A;  2BLS A;  3SS4 A;  4GZB A;  2Z2M B;  3TE8 A;  3UE3 A;  1Y28 A;  3UN7 A;  4O01 A;  3OPP A;  3BFD A;  5FI7 A;  5EE8 A;  5CTM A;  3T50 A;  1GSV A;  4NKP A;  4QJG A;  1RGZ A;  3G4P A;  3GEC A;  1LT0 A;  2QJ5 A;  3IHA A;  2HJ9 C;  1G28 A;  1ZTU A;  2P7J A;  2V8F A;  3IXG A;  4LV0 A;  1DJB A;  4D2O A;  4IUH A;  3IHB A;  2G2W A;  1OT9 A;  2WGW B;  1BUE A;  2V1B A;  1S0W A;  2VX8 A;  4ETX A;  3UO9 A;  1ONG A;  1BLC A;  1E3U A;  2V1A A;  3VFF A;  3CMZ A;  4HIA A;  2I72 A;  4JPM A;  2XFS A;  2VGL M;  5F68 A;  3NOP C;  1LL8 A;  3MQQ A;  2WAD A;  1MY8 A;  4U0T A;  4BEN A;  2ZC7 A;  3N8S A;  4Y3I A;  1GSX A;  3FWL A;  2C5W B;  1K0K A;  2BG1 A;  2J3T C;  5GL9 A;  3DAV A;  1PFL A;  3KYQ A;  4R23 A;  2FZ0 A;  3ZYT A;  3Q7V A;  1MKM A;  1DRM A;  2JBF A;  4EQI A;  3VFH A;  2WKP A;  2WZX A;  3N6I A;  3KSH A;  5FDH A;  4P6Z M;  2WYX A;  1K4E A;  1SHV A;  2C6W B;  4XUZ A;  1BUL A;  1SCW A;  3QP1 A;  4GHI A;  3CG5 A;  4OVD A;  4CPK A;  1TVF A;  4ETZ A;  3BRM A;  3WS4 A;  2Y2N A;  3PBS A;  1RGY A;  2EFX A;  2EWW A;  4EBN A;  2HDU A;  3P01 A;  1FR1 A;  4Y17 A;  1ERQ A;  5KSC A;  3MZD A;  3F1P A;  2B02 A;  4OQG A;  2XFT A;  4Z9Q A;  1PZO A;  3HLF A;  1K56 A;  3OCN A;  4EET B;  2V1Z A;  3MFX A;  1FCM A;  2AVX A;  4QY6 A;  4U3T A;  2INW A;  2W27 A;  3KSI A;  3HLC A;  4B4X A;  3S22 A;  2EXA A;  3C30 A;  3M2J A;  2DRW A;  2MJ6 A;  5HAP A;  1FIL A;  4S2M A;  1RCJ A;  3RXX A;  4KQO A;  1JWV A;  1YLT A;  3P7N A;  1WE4 A;  1VM1 A;  2H0T A;  5HW3 A;  2WKH A;  3WRT A;  4NK3 A;  4NXE A;  4WEL A;  5DKL A;  3Q7V B;  3E4Q A;  3M2K A;  4E3M A;  3A3E A;  2ZLY A;  5EFW A;  4I38 A;  3V3S A;  4BJP A;  2R9X A;  2ACG A;  5AQ9 A;  3V5M A;  5HDS A;  4FD8 A;  4R4R A;  4Y5F A;  1PRQ A;  3F1O A;  4MN7 A;  3DTK A;  2L0W A;  1LI9 A;  4UQI M;  3TW8 A;  4UA6 A;  5HFO A;  4EEP A;  4ARZ B;  3LIB A;  5CEB A;  1YT4 A;  4EQ1 A;  4HJ3 A;  2PAV P;  3OZH A;  4P87 A;  4YNR A;  2JKR M;  2XEP A;  5G4Z A;  3A3F A;  5AQA A;  2OOL A;  2M7V A;  1D1J A;  4LEN A;  2HZ5 A;  2I9V A;  2OLV A;  1MWT A;  3CI6 A;  3KSF A;  3C4P A;  4BQM A;  3T4L A;  1NYY A;  3FV7 A;  5F82 A;  3MKE A;  4PMA A;  3Q81 A;  3UPN A;  2XA7 M;  4EXO A;  4GS9 A;  1YLZ A;  3RJU A;  3P09 A;  3MJQ A;  4BBV A;  1DP6 A;  5DTT A;  1GHP A;  5HL6 A;  2BTF P;  4X25 A;  3VE3 A;  1P97 A;  4PM9 A;  1W63 M;  3BEB A;  4LPZ A;  4E3I A;  4MLL A;  3HLE A;  4JF4 A;  3SS5 A;  3IWI A;  1Z09 A;  2XK1 A;  3GRJ A;  3T1Q B;  3NEC A;  3HBR A;  4DE1 A;  2EX9 A;  1SKO B;  3I7J A;  4YIN A;  4DXC A;  3TJZ C;  4N9K A;  3ITB A;  4PKY G;  5DF8 A;  2WUQ A;  2Y8H A;  3LUQ A;  1H3Q A;  2A3U A;  4YFM A;  2WZZ A;  2W3F A;  1F98 A;  2XDM A;  1IYS A;  4BLM A;  1TEM A;  2Y2J A;  5KSH A;  2ZD8 A;  3GR2 A;  3ZG7 B;  4E3L A;  5KIZ A;  4EV4 A;  3SH9 A;  4WZ5 A;  4DDY A;  5GHZ A;  4PKY A;  2J7V A;  3NBL A;  4JBF A;  3W4O A;  3LGO A;  2PDR A;  5FI6 A;  3V67 A;  4WLA A;  3BQA A;  2JKT I;  2ZMA A;  3UE1 A;  4E3K A;  3OPR A;  4EBL A;  3A0R A;  4P0M A;  4FTX A;  2UWX A;  1KDW A;  3N7W A;  1Q2Q A;  3UE0 A;  4CLC C;  2HJE A;  5J7E A;  5FQ9 A;  1T1A A;  5BOH A;  1KE4 A;  2GNX A;  3IWQ A;  5HZH A;  3PBR A;  4F3L A;  1JTG A;  1U60 A;  2KOI A;  3NI9 A;  3T4O A;  2D01 A;  1P9W A;  1PNE A;  4NEE D;  2QWS A;  2UV0 E;  3QHY A;  1YM1 A;  1FQG A;  4KZ4 A;  2ZM0 A;  3IX3 A;  5AQB A;  1TS6 A;  3U2A A;  5EVI D;  1KGF A;  1BLP A;  1IFQ A;  4KEN B;  1M40 A;  1XJ6 A;  5CGX A;  1L3L A;  5U47 A;  3HUN A;  2WAF A;  3DTM A;  5GLA A;  4Y0T A;  4OQ0 A;  2OAP 1;  3GDI A;  5J3W A;  4HP4 A;  3UY6 A;  4KQR A;  4UHU A;  4ESP A;  1WYC A;  2QJ7 A;  4H6J A;  4ZJ2 A;  2O99 A;  3VSL A;  3BYD A;  3UNW A;  2W1T A;  5CHJ A;  4YOF A;  2PHY A;  5E43 A;  4E3N A;  2X02 A;  4S2N C;  4BMW A;  1Y4O A;  1IEL A;  4N9L A;  4ZAM A;  1W8Q A;  3E2L A;  2Y91 A;  3OLO A;  3LFV A;  3PR6 A;  1KVL A;  1BZA A;  3TG9 A;  4YWZ A;  3M6H A;  4JKT A;  4F3L B;  1G6A A;  1ESI A;  2WKR A;  5CTN A;  2Y2Q A;  3O87 A;  1EW0 A;  4PM7 A;  3LR3 A;  3CUE A;  5TGF A;  1LL9 A;  2Y2O A;  3IBJ A;  3JYI A;  5HPF A;  3PYP A;  4KZ8 A;  4E6X A;  4CLC D;  5DKK A;  1XJ4 A;  4E3O A;  1CEF A;  1J3W A;  1FR6 A;  3HLD A;  2O9C A;  3O88 A;  3K2N A;  4JXW A;  4DRT A;  3IXH A;  3KYZ A;  2HP9 A;  4JXS A;  3B3X A;  3HJI A;  3UMD A;  1WA9 A;  3NY4 A;  1WYB A;  1VET B;  3OPH A;  3MKF A;  5EM1 A;  3LR0 A;  3K3D A;  1XJ2 A;  3PBT A;  3DWZ A;  2GX5 A;  2X01 A;  2KDK A;  3CIT A;  2W1T B;  4RX2 A;  4WL9 A;  4HBT A;  2ZMF A;  1JNU A;  5FQQ A;  4HH2 A;  2DNS A;  1IYQ A;  1LSV A;  2HDQ A;  3OCL A;  3U4L P;  4WBG A;  4XUX A;  2NUT C;  1T19 A;  1TS7 A;  1K55 C;  3C5A A;  1PI4 A;  2Z6D A;  4EUZ A;  3V50 A;  2PD8 A;  1HTZ A;  4WYY A;  3A3J A;  5HWV A;  3FZC A;  1H0M A;  4KG5 A;  2L1M A;  4BBU A;  2D02 A;  3W4P A;  4EU0 A;  4Q0H A;  5F83 A;  1XFN A;  2ZM8 A;  4MMN A;  4MBH A;  2A2L A;  5CX7 A;  5GHX A;  3DW0 A;  5DTS A;  3ZFZ A;  4FCF A;  4IJG A;  1KE3 A;  1ERM A;  1W79 A;  4O8G A;  1XGJ A;  1DJA A;  3FPW A;  4HQA A;  5FQI A;  1H8Y A;  5HSQ A;  4L9E A;  3FYZ A;  1YPR A;  4X68 A;  5IS1 A;  3CHW P;  1XPB A;  5F69 A;  2O0Y A;  1MZU A;  3WRZ A;  2X71 A;  5AVE A;  3IF6 B;  4JGO A;  4HH3 A;  4WN5 A;  5EUA A;  1OME A;  4PPR A;  3SH7 A;  4C75 A;  1DJC A;  1FCN A;  4RX3 A;  3NDG A;  1MWU A;  5JYP A;  3HLW A;  3SW1 A;  3ZCZ A;  1VHM A;  3VP0 A;  2JKT M;  3BM6 A;  4R0Q A;  2J3W A;  4WEJ A;  5AJG A;  3BEC A;  3CWF A;  5CER A;  4PM6 A;  5HAI A;  3MR0 A;  3FKW A;  3OOV A;  1MKI A;  1HVB A;  3BY8 A;  5DF7 A;  5DJT A;  2ZQ9 A;  2OLU A;  2B5R A;  3AGE A;  3NIA A;  2H10 A;  4LV1 A;  1LLB A;  4RQ9 A;  4RYE A;  3E2K A;  4QPR A;  5FAP A;  3C38 A;  1XJ3 A;  2PR6 A;  2XRO A;  1MXO A;  4MBF A;  3D3O A;  4JGR A;  4NG2 A;  1E3U D;  2EWV A;  2EA9 A;  2V0W A;  3T4S A;  3RFB A;  2KX6 A;  5CGS A;  4OLG A;  2W1R A;  4GN2 A;  3IH9 A;  3MF0 A;  5E2H A;  3MZE A;  4P85 A;  3ZG0 A;  3G2Y A;  1NLY A;  2Y79 A;  4ARZ A;  1S1Z A;  4R3B A;  3EGX C;  1YAX A;  4DXB A;  3WS0 A;  5FA7 A;  1LSW A;  4HBU A;  1HLU P;  3VMA A;  2DMW A;  2EX8 A;  4WMC A;  4LRX C;  4CJN A;  2VGJ A;  4OPZ A;  3PBQ A;  2PU4 A;  1SZV A;  4FH2 A;  3G2Z A;  4DE0 A;  4DE2 A;  4S2J A;  1PWD A;  2JE5 A;  3ISG A;  3MQO A;  4Q0J A;  3HLG A;  2EX2 A;  1CF0 A;  5GLC A;  3HJK A;  4N92 A;  4GB7 A;  3KX0 X;  4PHT A;  4R1G A;  2PD7 A;  1OTB A;  2DCF A;  3GVB A;  1XP4 A;  3PBO A;  1UWP X;  4LV3 A;  2JHE A;  4GDB A;  3HL9 A;  1ERO A;  3UPO A;  1ONH A;  3LY4 A;  5DTK A;  4K91 A;  1P9R A;  1STZ A;  2VZW A;  1K56 D;  3KSG A;  2XF3 A;  1SKO A;  1QMF A;  1PZP A;  4LGW A;  1M6K A;  3HUO A;  2A24 B;  1NRJ A;  1HZO A;  3H9W A;  2W0N A;  3G32 A;  4KUK A;  5GLB A;  3HCY A;  5HWW A;  4LCL A;  4OQI A;  3PBN A;  1F9I A;  1JWZ A;  4E3J A;  1PYY A;  4GJ4 A;  2ZC6 B;  2HGV A;  1YSQ A;  1BYW A;  3MMH A;  3MXR A;  1VB6 A;  3T4K A;  4C3Q A;  4N1H A;  3PHY A;  4S2O A;  3ZG9 B;  4UAA A;  1L0G A;  5FEG A;  3VSK A;  1ES4 A;  1MWS A;  2XSS A;  3ZHH A;  3GSG A;  4Z1W A;  3E4P A;  3UDI A;  3SH8 A;  4IVI A;  1HD8 A;  1P0Z A;  4HP9 A;  1E4D A;  1H5X A;  3IH8 A;  1KGE A;  1K4F A;  4BD0 A;  3BFG A;  3BQ8 A;  3CLO A;  1E25 A;  2PT7 A;  4CLC E;  3CPT B;  4M3K A;  2G7U A;  2CMN A;  1I5Q A;  3Q82 A;  4NXG A;  2OWJ A;  1NRF A;  4ZJ1 A;  2RL3 A;  5EVI C;  1TS8 A;  1OJG A;  2BAS A;  1PIO A;  3MXQ A;  3G30 A;  4DF6 A;  4H8R A;  3G34 A;  5TBM A;  3A0S A;  3S7N A;  5LBR A;  1VQQ A;  4P6B A;  3LEQ A;  1FSY A;  4GOG A;  3HRE A;  1KOU A;  2Y2P A;  3ZG5 A;  4S2I A;  2H28 A;  1QME A;  3LEZ A;  3LIA A;  2PR5 A;  2XD1 A;  3UB8 A;  4KZ9 A;  5EOO A;  4E6W A;  2XR0 A;  2GJ3 A;  2WKQ A;  2YKF A;  2ZC3 B;  5DJU A;  2B95 A;  3S7O A;  2OAQ 1;  3UB6 A;  1CJF A;  1AWI A;  3MZF A;  5CED A;  2WKE A;  4NXB A;  2FFF B;  2ZQC A;  2QYB A;  4HHD A;  2XD5 A;  3IBR A;  5HAR A;  4OKP A;  2W3D A;  4IBX A;  4PM8 A;  4ZTK A;  3RTY A;  4ME4 A;  4PAU A;  2OWH A;  2V8C A;  3ZG8 B;  3MFD A;  2HP6 A;  3QP2 A;  4Q8I A;  5L2F A;  3SOI A;  5FQJ A;  3BY9 A;  5CXW A;  1I2W A;  5F6A A;  2O9B A;  3G31 A;  3W4Q A;  3AGF A;  4EEU A;  4KZ5 A;  4I3I A;  2HP5 A;  3MSH A;  1Z6F A;  1NXY A;  1YSP A;  3UB5 P;  1PI5 A;  3IS2 A;  3QNB A;  5TBM B;  2J8Y A;  2WKI A;  3OBF A;  4HJ6 A;  3TRC A;  1NY0 A;  1K57 C;  3T4J A;  3IF5 A;  5DF9 A;  2VK3 A;  5HD3 A;  1SDE A;  3LIC A;  2NUP C;  4X1M A;  1LI0 A;  3QP5 A;  4KZ7 A;  2M1C A;  1OPX A;  1VEU B;  3BFC A;  3F1N B;  5HD5 A;  4S2K A;  4IHQ A;  4Y0U A;  1L0D A;  2ZQA A;  1BT5 A;  1TDG A;  3W8K A;  2V20 A;  1MWR A;  4IED A;  5F5Y A;  1VET A;  4BL3 A;  2ZQ7 A;  3JPU A;  3ZVT A;  3NOT C;  2V0U A;  1S4S A;  4DN0 A;  5EPH A;  3TSG A;  2OSU A;  1AXB A;  3T1X A;  3ZDJ A;  2H0Y A;  4PM5 A;  1L0F A;  5FEF A;  2GZA A;  5F1G A;  1KGG A;  4IUK A;  4ZDX A;  5GHY A;  3EGD C;  1FCO A;  5DFX A;  3GMW A;  2ZQD A;  1BTL A;  1K54 A;  4HES A;  2Y2I A;  1F2K A;  3ZNT A;  2QHK A;  3C4O A;  2IWB A;  4DDS A;  4HJ4 A;  4ZRR A;  5L07 A;  3OPL A;  4EUV A;  4N1X A;  5FDS A;  3PXP A;  5M19 A;  2Z6C A;  1N9B A;  2V2F F;  2ZOI A;  3IS2 B;  4OPR A;  1BLH A;  4BBT A;  4ZJ3 A;  3G6O A;  2Y2H A;  3ICY A;  4WF0 A;  1NZO A;  1EWZ A;  4OH0 A;  2EXB A;  1D06 A;  3JVV A;  2VA0 A;  2HV1 A;  3GV9 A;  2W3E A;  1TF1 A;  5DVA A;  2P04 A;  2QZ6 A;  4II7 A;  3ULF A;  3LI9 A;  4KUO A;  3UME A;  4KQD A;  3C2W A;  3ITA A;  5HWT A;  2ZC4 B;  5JYO A;  3RXW A;  1YLW A;  5CRF A;  5J8X A;  1N9O A;  4MN6 A;  3IF6 A;  4K08 A;  3G35 A;  2Y2M A;  2Q9N A;  4GDN A;  4S2N A;  3A3I A;  2VKS A;  3DTE A;  4EBP A;  1PWG A;  1O7E A;  1EI5 A;  3KYE A;  3QP8 A;  4QB8 A;  1LHY A;  1ZG4 A;  4K0X A;  4WM9 A;  4CLC B;  4HOI A;  4KG2 A;  4R3J A;  5A92 A;  2Q9M A;  1GSW A;  1OJ5 A;  3H82 B;  1CQA A;  4O7D A;  2CC1 A;  4JF6 A;  1IYP A;  4JGQ A;  5L09 A;  4GKU A;  4G3W A;  1ACF A;  4BD1 A;  3N4I A;  2WAE A;  3N8R A;  3LIF A;  2Y4A A;  5FSR A;  1X0O A;  3LO7 A;  5EEC A;  1BLS A;  3C7V A;  3LIE A;  3CZD A;  2P9V A;  3AGD A;  3NJA A;  5HL1 A;  3IX4 A;  5TFQ A;  2E8I A;  3RH8 B;  3HVF A;  3A0V A;  4I39 A;  4RVA A;  1JTD A;  3WS1 A;  4OOL A;  1ZKJ A;  4OON A;  4EWF A;  4M4X A;  5M18 A;  2HDS A;  2VGL S;  3NCK A;  3TOI A;  3DWK A;  2PBD P;  3OC2 A;  4LRZ E;  2RCX A;  2YKH A;  5E2E A;  3MS6 A;  1YLY A;  3S4X A;  4MNR A;  2LB5 A;  4Y0O A;  3EQU A;  1ESU A;  5HAQ A;  3B33 A;  2EX6 A;  3IQA A;  2Y59 A;  2QMI A;  5TJJ A;  3UB9 A;  5I94 A;  5HPI A;  1W8Y A;  4L9F A;  4LLO B;  1K55 A;  3T4Q A;  2PYP A;  1ODV A;  2G2U A;  4OOY A;  3P98 A;  4S2P A;  2K7S A;  4Y13 A;  1S67 L;  1S6R A;  4P6Z S;  1NYM A;  3LY3 A;  1S4R A;  4WEK A;  3VOZ A;  2JKF A;  1XGI A;  3BFE A;  3WS2 A;  2Q0O A;  1LSX A;  4OQH A;  2HF6 A;  2VV6 A;  1K38 A;  2ZL1 B;  4I5S A;  4Q0I A;  4LCM A;  1ALQ A;  5FI2 A;  5K5B A;  2VGK A;  1CI9 A;  2P9V B;  3UB7 A;  2WGI A;  1V9Z A;  2HDR A;  5CEC A;  3DTI A;  5GLD A;  4Y7P A;  3LR5 A;  5HDC A;  2XH9 A;  3VOL A;  4QU3 A;  2XLN A;  1RP5 A;  4X1L A;  4Y2F A;  3NDE A;  2QKP A;  3EEH A;  2JKG A;  2W3H A;  1CI8 A;  4DJ2 A;  2ZJ9 A;  1TS0 A;  5F1F A;  2A24 A;  2K2N A;  4OOM A;  1JWP A;  1K6R A;  3D9Y A;  3D4F A;  3C8C A;  1YKD A;  5L8M A;  4OP8 A;  5I5L A;  3KO6 A;  2ZOH A;  4FOF A;  1YLP A;  4WZ4 A; 
#chains in the Genus database with same CATH homology
 4X55 A;  5EVL A;  5U47 A;  1NRF A;  4ZJ1 A;  3HUN A;  2RL3 A;  5EVI C;  2WAF A;  5FAS A;  4FSF A;  3DTM A;  5GLA A;  4Y0T A;  1PIO A;  1H8Z A;  4OQ0 A;  4R4S A;  3ZVW A;  3G30 A;  1GHI A;  4DF6 A;  4H8R A;  1Q2P A;  2Y2G A;  3G34 A;  3UY6 A;  4KQR A;  1O07 A;  4UHU A;  5CGW A;  2Y55 A;  3SS4 A;  2BLS A;  4RA7 A;  1WYC A;  4GZB A;  2Z2M B;  3UE3 A;  4ZJ2 A;  4FH4 A;  3MBZ A;  3OPP A;  3BFD A;  1VQQ A;  3BFF A;  4P6B A;  5FI7 A;  3UN7 A;  3BYD A;  3UNW A;  3VSL A;  5EE8 A;  5CTM A;  1FSY A;  2Y2L A;  1I2S A;  5CHJ A;  4ID4 A;  4MBK A;  4GOG A;  3HRE A;  4QY5 A;  2Y2P A;  3ZG5 A;  4S2I A;  3V39 A;  5E43 A;  2ZC5 B;  4X56 A;  2FFY A;  4E3N A;  1QME A;  3LEZ A;  4QJG A;  2X02 A;  1RGZ A;  3FKV A;  3G4P A;  2XD1 A;  2OV5 A;  1XA1 A;  4S2N C;  4EWF A;  3IHA A;  1KVM A;  4KZ9 A;  3IXG A;  1IEL A;  4N9L A;  5EOO A;  4ZAM A;  4E6W A;  1W8Q A;  3E2L A;  4LV0 A;  1GHM A;  3UO9 A;  1DJB A;  2Y91 A;  1YMS A;  4D2O A;  2XR0 A;  3IHB A;  1KVL A;  4OP5 A;  2G2W A;  2ZC3 B;  2WGW B;  1BZA A;  1BUE A;  3TG9 A;  3ZNY A;  1S0W A;  1BSG A;  1XX2 A;  1PW1 A;  3M6H A;  1MBL A;  3MZF A;  1ONG A;  2WKE A;  1BLC A;  1ESI A;  1G6A A;  4JKT A;  2FFF B;  2ZQC A;  4K0W A;  5E2G A;  2XD5 A;  1E3U A;  5CTN A;  5HAR A;  2Y2Q A;  4OKP A;  3VFF A;  4IBX A;  3CMZ A;  4PM8 A;  4ZTK A;  2I72 A;  3O87 A;  2IWC A;  4JPM A;  4PM7 A;  4WMC D;  2XFS A;  3UPP A;  5A93 A;  5M1A A;  1K25 A;  5TGF A;  1LL9 A;  2Y2O A;  3JYI A;  4OPY A;  3ZG8 B;  3MFD A;  4KZ8 A;  4E6X A;  2HP6 A;  4E3O A;  4Q8I A;  5L2F A;  3Q07 A;  3SOI A;  2WAD A;  5FAT A;  1MY8 A;  4U0T A;  5FQJ A;  1CEF A;  4BEN A;  1FR6 A;  5CXW A;  3HLD A;  3LCE A;  3O88 A;  3PAE A;  1I2W A;  4JXW A;  4DRT A;  3G31 A;  2ZC7 A;  3AGF A;  3IXH A;  3N8S A;  3W4Q A;  2HP9 A;  4KZ5 A;  1J9M A;  5KMW A;  3FWL A;  4JXS A;  1CEG A;  2C5W B;  3B3X A;  2HP5 A;  1Z6F A;  3BLM A;  1NXY A;  4BL2 A;  2BG1 A;  3NY4 A;  5GL9 A;  1WYB A;  3OPH A;  1PI5 A;  3MKF A;  4R23 A;  3QNB A;  2WKI A;  2J8Y A;  3PBT A;  3DWZ A;  1NY0 A;  3Q7V A;  1K57 C;  2X01 A;  3IF5 A;  4RX2 A;  2JBF A;  5DF9 A;  1GA0 A;  4EQI A;  3VFH A;  4HBT A;  5FQQ A;  4GNU A;  4IVK A;  2DNS A;  2WZX A;  3N6I A;  5FDH A;  1IYQ A;  2HDQ A;  3OCL A;  1SDE A;  2WYX A;  4WBG A;  4XUX A;  1K4E A;  1LI0 A;  4KZ7 A;  2P74 A;  1SHV A;  5A90 A;  2C6W B;  4XUZ A;  1K55 C;  1W5D A;  5CHU A;  1BUL A;  1SCW A;  3C5A A;  3BFC A;  3CG5 A;  4S2K A;  4Y0U A;  4OVD A;  1IKG A;  1PI4 A;  5TR7 A;  1TVF A;  4CPK A;  4DE3 A;  4EUZ A;  1L0D A;  3BRM A;  4WZ5 C;  3WS4 A;  2ZQA A;  2Y2N A;  3PBS A;  1RGY A;  2EFX A;  3V50 A;  1BT5 A;  4EBN A;  1TDG A;  3GTC A;  1IYO A;  2GDN A;  3SS3 A;  3W8K A;  2V20 A;  1MWR A;  2HDU A;  4IED A;  4KZB A;  1HTZ A;  2Y2K A;  3A3J A;  1FR1 A;  4WYY A;  5FAO A;  5A91 A;  4BL3 A;  1ERQ A;  3BLS A;  5KSC A;  3MZD A;  2ZQ7 A;  3ZVT A;  3FZC A;  3IT9 A;  4OQG A;  2XFT A;  2IWD A;  1PZO A;  3HLF A;  4Z9Q A;  2ZM2 A;  3CJM A;  1K56 A;  4KG5 A;  1IKI A;  5EPH A;  5CHM A;  1PWC A;  3TSG A;  2OSU A;  1AXB A;  3W4P A;  3OCN A;  3WWX A;  2V1Z A;  5F83 A;  4KQQ A;  2H0Y A;  3ZDJ A;  4PM5 A;  2ZM8 A;  1FCM A;  1L0F A;  4MBH A;  2XQZ A;  4QY6 A;  4U3T A;  4KZ6 A;  4B88 A;  4XXR A;  4X53 A;  5GHX A;  5F1G A;  1KGG A;  3DW0 A;  4F94 A;  5DTS A;  1YQS A;  3HLC A;  3VP4 A;  4ZDX A;  3ZFZ A;  4FCF A;  5GHY A;  3VP2 A;  1FCO A;  2JCH A;  4B4X A;  2QPN A;  3GMW A;  3S22 A;  2ZQD A;  1KE3 A;  1ERM A;  2EXA A;  1W79 A;  1BTL A;  1XGJ A;  1K54 A;  4HES A;  1DJA A;  4KG6 A;  2Y2I A;  3M2J A;  5AQ7 A;  2DRW A;  5FQI A;  1H8Y A;  3FYZ A;  3ZNT A;  5HAP A;  5CGX A;  4X68 A;  3C4O A;  3N8L A;  2IWB A;  4S2M A;  4DDS A;  1IEM A;  1RCJ A;  3RXX A;  1ZG6 A;  3OPL A;  4KQO A;  1XPB A;  4N1X A;  5M19 A;  3WRZ A;  1N9B A;  1JWV A;  2V2F F;  1KDS A;  1YLT A;  2X71 A;  1WE4 A;  1VM1 A;  3IF6 B;  2H0T A;  4C6Y A;  4OPR A;  5HW3 A;  1FSW A;  2WKH A;  2Z2L B;  1BLH A;  1GA9 A;  5EUA A;  1OME A;  4ZJ3 A;  3WRT A;  2Y2H A;  4PPR A;  3SH7 A;  4NK3 A;  4C75 A;  1DJC A;  4WEL A;  3Q7V B;  1NZO A;  2R9W A;  1FCN A;  1TDL A;  1EWZ A;  4RX3 A;  1XA7 A;  3M2K A;  4OH0 A;  3NDG A;  2EXB A;  2EFU A;  2ZLY A;  3A3E A;  1MWU A;  4E3M A;  1ES3 A;  3V3S A;  4BJP A;  3GV9 A;  2R9X A;  5JYP A;  3HLW A;  5DVA A;  2QZ6 A;  5AQ9 A;  1L0E A;  5EVI A;  3ZCZ A;  3V5M A;  3VP0 A;  4KZA A;  4FD8 A;  4R4R A;  3BM6 A;  4R0Q A;  3ITA A;  4NET A;  2ZC4 B;  5JYO A;  3QNC A;  4HEF A;  1YLW A;  1LL5 A;  1JVJ A;  3RXW A;  5IHV A;  4WEJ A;  5CRF A;  5J8X A;  2ZQ8 A;  1C3B A;  5HX9 A;  1LI9 A;  3BEC A;  5G18 A;  5CER A;  4JF5 A;  4PM6 A;  4UA6 A;  5HFO A;  5HAI A;  1Y54 A;  3FKW A;  1MKI A;  1HVB A;  3IF6 A;  5DF7 A;  1FOF A;  1YMX A;  4UA7 A;  2ZQ9 A;  5CEB A;  3G35 A;  2OLU A;  1YT4 A;  2Y2M A;  3IWO A;  2Q9N A;  4GDN A;  2B5R A;  3AGE A;  3NIA A;  2H10 A;  4S2N A;  4LV1 A;  3A3I A;  1LLB A;  3Q82 A;  4RYE A;  4B4Z A;  3E2K A;  4EBP A;  3OZH A;  1PWG A;  5FAP A;  1O7E A;  1EI5 A;  4P87 A;  1ZC2 A;  1GCE A;  2PBY A;  2XEP A;  4QB8 A;  1LHY A;  1MXO A;  4MBF A;  3A3F A;  1K54 C;  5AQA A;  4JXG A;  1ZG4 A;  4LEN A;  4K0X A;  4WM9 A;  3NC8 A;  1SDN A;  1ES2 A;  2J9O A;  1E3U D;  2OLV A;  4S2L A;  1MWT A;  4KG2 A;  4ZBE A;  4R3J A;  3Q1F A;  2H5S A;  5A92 A;  3VP1 A;  2Q9M A;  3C4P A;  4LV2 A;  5EOE A;  5CGS A;  4BQM A;  4OLG A;  5E2F A;  4GN2 A;  3IH9 A;  5E2H A;  3MZE A;  4P85 A;  1NYY A;  3FV7 A;  4O7D A;  2CC1 A;  4JF6 A;  1IYP A;  5F82 A;  3MKE A;  3ZG0 A;  3G2Y A;  4PMA A;  4GKU A;  3HUM A;  3IXB A;  3Q81 A;  3UPN A;  1DY6 A;  4BD1 A;  3N4I A;  5CED A;  2HPB A;  2WAE A;  4R3B A;  3N8R A;  4OPQ A;  1YLZ A;  3RJU A;  3P09 A;  2Y4A A;  5FSR A;  4DXB A;  3WS0 A;  5FA7 A;  4QHC A;  4X69 A;  3LO7 A;  5EEC A;  1BLS A;  3C7V A;  4HBU A;  5DTT A;  3A3D A;  1GHP A;  3CZD A;  2P9V A;  4X6T A;  3AGD A;  3M6B A;  3VMA A;  5HL1 A;  5TFQ A;  2E8I A;  3HVF A;  1YLJ A;  2EX8 A;  4WMC A;  4CJN A;  3WS1 A;  4RVA A;  4PM9 A;  1JTD A;  2VGJ A;  4OPZ A;  3BEB A;  3PBQ A;  4OOL A;  3WS5 A;  4E3I A;  2PU4 A;  3PAG A;  4FH2 A;  1ZKJ A;  4OON A;  3O86 A;  3G2Z A;  4MLL A;  3HLE A;  5EVI B;  4JF4 A;  4S2J A;  1PWD A;  4DE0 A;  4DE2 A;  2JE5 A;  3ISG A;  5M18 A;  3SS5 A;  2HDS A;  3IWI A;  3NCK A;  2JC7 A;  2XK1 A;  3GRJ A;  3TOI A;  3HLG A;  3DWK A;  3HBR A;  2EX2 A;  3OC2 A;  2RCX A;  4OLD A;  2EX9 A;  5E2E A;  4DE1 A;  3IF6 C;  5GLC A;  3I7J A;  4YIN A;  4DXC A;  2J9P A;  4N92 A;  4N9K A;  3ITB A;  1YLY A;  4GB7 A;  1K6S A;  3S4X A;  4R1G A;  4MNR A;  1K57 A;  4Y0O A;  5DF8 A;  3EQU A;  2WUQ A;  2DCF A;  3GVB A;  1XP4 A;  1ESU A;  5D3O A;  3PBO A;  4LV3 A;  5HAQ A;  3UDF A;  2EX6 A;  3V3R A;  3IQA A;  4GDB A;  2A3U A;  4YFM A;  3HL9 A;  2WZZ A;  2PU2 A;  2Y59 A;  2QMI A;  2XDM A;  1MPL A;  1ERO A;  3UPO A;  1IYS A;  1ONH A;  4GD8 A;  1TEM A;  3UDX A;  4BLM A;  5I94 A;  4U0X A;  1W8Y A;  3VP3 A;  2Y2J A;  3LY4 A;  3PTE A;  1K55 A;  3Q7Z A;  5DTK A;  5KSH A;  1W7F A;  2A49 A;  2ZD8 A;  3GR2 A;  3ZG7 B;  5FQM A;  4E3L A;  1XKZ A;  2G2U A;  4K91 A;  4EV4 A;  3SH9 A;  4OOY A;  4WZ5 A;  3P98 A;  4DDY A;  4S2P A;  5GHZ A;  2J7V A;  3NBL A;  1S6R A;  3O3V A;  1K56 D;  4JBF A;  1NYM A;  1NZU A;  2XF3 A;  3LY3 A;  3W4O A;  2XGN A;  1QMF A;  1PZP A;  1M6K A;  3HUO A;  4WEK A;  3VOZ A;  1HZO A;  5FI6 A;  3G32 A;  1XGI A;  4MEZ A;  5GLB A;  4KZ3 A;  4LCL A;  3PBN A;  1PW8 A;  3BFE A;  1JWZ A;  4OQI A;  4E3J A;  1PYY A;  3HLB A;  3WS2 A;  2ZMA A;  3UE1 A;  2ZC6 B;  4OQH A;  1SKF A;  4E3K A;  5KZH A;  1NJ4 A;  3OPR A;  1L2S A;  4EBL A;  4P0M A;  1K38 A;  2UWX A;  4GD6 A;  1KDW A;  3IXD A;  4LCM A;  3N7W A;  3MXR A;  1ALQ A;  2WK0 A;  5FI2 A;  2VGK A;  4C3Q A;  1Q2Q A;  1CI9 A;  2P9V B;  3UE0 A;  2WGI A;  5FAQ A;  2WGW A;  4N1H A;  4JXV A;  2HDR A;  5CEC A;  4S2O A;  3ZG9 B;  4UAA A;  5FQ9 A;  5BOH A;  5GLD A;  4Y7P A;  1L0G A;  1KE4 A;  3IWQ A;  3PBR A;  1XXM A;  2XH9 A;  3VSK A;  1ES4 A;  1JTG A;  3EQV A;  1KE0 A;  1U60 A;  4QU3 A;  2XLN A;  1MWS A;  3NI9 A;  4JLF A;  1RP5 A;  2WGV A;  3NDE A;  3ZHH A;  3GSG A;  3UDI A;  3SH8 A;  4IVI A;  4UA9 A;  3ZGA B;  1HD8 A;  1CI8 A;  3QHY A;  2ZJ9 A;  1YM1 A;  1FQG A;  5F1F A;  4KZ4 A;  1E4D A;  1H5X A;  3IH8 A;  2ZM0 A;  1KGE A;  1K4F A;  4QD4 A;  4OOM A;  5AQB A;  5FQK A;  4BD0 A;  3BFG A;  1N4O A;  1ES5 A;  1JWP A;  1K6R A;  4IBR A;  1CK3 A;  3VOY A;  1E25 A;  3D4F A;  1KGF A;  5EVI D;  1BLP A;  4KEN B;  1G68 A;  4M3K A;  3C7U A;  1M40 A;  4OP8 A;  4A5R A;  4DKI A;  3GQZ A;  4L0L A;  1I5Q A;  3MXS A;  1YLP A;  3S1Y A;  4WZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...