1FR1A

Refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
361
structure length
361
Chain Sequence
AAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQWQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMSKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPVKADSIISGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Refined crystal structure of beta-lactamase from Citrobacter freundii indicates a mechanism for beta-lactam hydrolysis.
pubmed doi rcsb
total genus 114
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fr1A00
1TDGA 4S2OA 1L2SA 5FDHA 1LI0A 3Q7VB 3BM6A 4WEKA 5FSRA 3MZFA 1GHIA 4EUZA 5CRFA 4R3JA 3W4OA 1BZAA 4EBPA 4RX3A 3N8RA 2Y4AA 4WZ5A 2ZC6B 4S2LA 3SS4A 1IEMA 2Z2MB 4QU3A 3GR2A 4DRTA 3G34A 3G32A 4M3KA 3NDEA 2PBYA 3VP2A 4KZ9A 4WZ5C 1FQGA 3G30A 3GMWA 1XA7A 3JYIA 1VM1A 3D4FA 1E4DA 3AGEA 1K56A 4PMAA 2ZM8A 5FQJA 4N1XA 3UPNA 4A5RA 4EBLA 4GDNA 5FI6A 2EFUA 4OLGA 4IBRA 5EOOA 2QZ6A 3SH9A 3SOIA 2Y55A 4IVIA 1YQSA 5E2GA 1BLPA 3IF6A 1YLPA 4S2MA 5HL1A 3O3VA 1FCNA 3A3IA 5CHMA 1MY8A 4CJNA 5JYOA 2V2FF 3PBQA 1IKGA 1NZOA 4H8RA 4P0MA 4P85A 2HPBA 4BJPA 4JBFA 5M18A 4EBNA 3PAEA 4OQ0A 5KMWA 1K38A 5DTSA 4U0XA 1XA1A 1XPBA 1S0WA 2WYXA 4CPKA 1YLZA 3PBTA 1HVBA 2JE5A 5A92A 4K0WA 5F82A 4BD1A 1SDEA 5D3OA 4N9KA 5TGFA 5FAPA 1E3UA 3OPHA 4LV2A 3W4QA 3HLBA 4OONA 4L0LA 3IQAA 4LENA 1SDNA 3EQUA 1W79A 2HDQA 4QD4A 4K91A 4KENB 4XUZA 3UY6A 2DRWA 1RGYA 3Q07A 2XH9A 3OPRA 2Y91A 4JXSA 3MZDA 5EVIA 4DE0A 1RCJA 3A3EA 3CMZA 4GKUA 1O7EA 1YLWA 4UA6A 4BL2A 1NJ4A 2PU2A 2A49A 2R9WA 3BLMA 3G4PA 4XXRA 5G18A 2WGVA 3N8LA 3OZHA 4BLMA 4S2JA 3V50A 2XEPA 1LLBA 2G2UA 2Q9NA 5EVIC 1NY0A 3GQZA 3V3RA 1N9BA 3LY4A 4MNRA 5FATA 1ES3A 4ZJ3A 3ZDJA 4E3KA 4R0QA 2WGWA 1LI9A 4ZAMA 3WS2A 3P98A 4MLLA 2WZZA 5CEDA 4Z9QA 3FKWA 3B3XA 1O07A 4DE2A 5HX9A 4WM9A 5HW3A 5KSCA 1ZKJA 3QNCA 2WKEA 4E3LA 3HUMA 3V5MA 4LV0A 4U3TA 2Y2IA 1E25A 1KVMA 2JBFA 1YMSA 3E2KA 3NDGA 1L0EA 1FSWA 1IYQA 4NETA 2XLNA 4YINA 1PW8A 1PI4A 3G31A 5HARA 4C75A 2XQZA 4ZTKA 4R4RA 1YMXA 3CJMA 1I2SA 1K55A 1PWGA 3BLSA 3FKVA 1KE0A 2Y2QA 1K57A 5FQQA 1RGZA 2IWBA 2ZC3B 3OCNA 2XK1A 1Q2PA 3UO9A 2VGKA 2BLSA 4HBUA 5CTNA 1N4OA 3E2LA 3BRMA 4UA7A 4GZBA 4QY5A 3WRTA 5F1FA 1K55C 5GLCA 1LL9A 1XGJA 2WGWB 3WRZA 3Q82A 1K57C 3VP1A 2HP5A 3OC2A 4ID4A 5CGXA 3VFFA 3TOIA 3WS0A 3IXBA 1Y54A 1SKFA 4RYEA 2XFTA 3W8KA 1S6RA 4QY6A 1W8QA 4N92A 4KZ8A 4ZBEA 4WMCA 4KZ3A 1NYMA 3WS1A 4E3IA 4EQIA 1JVJA 2HP6A 3CZDA 2ZC5B 1XKZA 2DNSA 4UHUA 5M1AA 3ZVWA 2VGJA 3C7VA 4LV1A 3VP0A 3SS5A 4UAAA 3WS5A 2X71A 1JWZA 3MBZA 3W4PA 4OLDA 2G2WA 1XX2A 4X56A 3M2KA 5CHJA 4X53A 2WADA 2C5WB 4K0XA 2V20A 4P87A 4OH0A 4BQMA 3ZHHA 1PW1A 5E43A 1ES4A 1TVFA 1YLYA 2XFSA 3MKFA 3Q81A 3VFHA 5HAQA 4JXGA 3M6BA 4N9LA 3BFEA 2ZQDA 3M2JA 3BEBA 1BTLA 4UA9A 3IXDA 4KQRA 4OP8A 1SCWA 5CTMA 5EVLA 1CEFA 5CHUA 3FZCA 4LCMA 5KSHA 3V39A 2EX2A 1PI5A 4GNUA 4JF6A 1G6AA 4GD8A 3IF6C 1KGFA 3NY4A 4JF4A 3VSLA 3LEZA 5DF9A 3ZNTA 3OPPA 1DY6A 1FSYA 1OMEA 4FH2A 4WEJA 1C3BA 1ES5A 3IWQA 2R9XA 4OOMA 3UPOA 5E2FA 5JYPA 3C5AA 4RVAA 4ZJ2A 3I7JA 3MFDA 1PWCA 4E6WA 4OPYA 3VOYA 5FQ9A 3O88A 5GLAA 2OV5A 4LCLA 5GHZA 3ITBA 3ZNYA 3N8SA 4JXVA 3BYDA 2H0TA 4P6BA 4RA7A 4IVKA 3ZG9B 3O86A 1FCOA 3HUNA 5CGSA 4B88A 5A93A 4DXCA 3TSGA 2WKHA 1EROA 3IF6B 1W7FA 1H5XA 4PM9A 1IKIA 3DWKA 3AGFA 4FCFA 1CI8A 2ZJ9A 1H8ZA 5A91A 1BULA 5FQKA 3OCLA 5HAPA 1BLSA 1ZG6A 1K4EA 2J9OA 3UDIA 1PIOA 3S4XA 1HD8A 4OQIA 1XXMA 1U60A 4S2IA 2WKIA 4R3BA 1PWDA 3NIAA 3IH9A 4E3MA 4Q8IA 4KQQA 5KZHA 2ZLYA 3EQVA 4HESA 1KE4A 1YM1A 3SS3A 2X01A 4E6XA 2PU4A 3UPPA 1G68A 1JWPA 4X69A 4OQGA 2JC7A 4X55A 5TR7A 4FSFA 2ZD8A 3N4IA 5CERA 1WYBA 4OPZA 4MBFA 3A3FA 4DE1A 1KVLA 2EX9A 1JWVA 1NXYA 4OOLA 4OPRA 4WBGA 5DVAA 1YLTA 2B5RA 1L0DA 1ONGA 3PTEA 4KG6A 4S2KA 4DKIA 3ITAA 1NRFA 1MPLA 5EVIB 3IHAA 2Y2LA 5HAIA 4BENA 2H10A 4WELA 5DTKA 2WGIA 2J9PA 3C4OA 4Y0TA 5CXWA 3DTMA 2Y2MA 3Q7VA 3UE0A 4X68A 4QB8A 2HDRA 4KZ4A 4E3OA 3MKEA 1ES2A 2ZC4B 2ZC7A 4ZJ1A 2EXBA 1IYSA 3P09A 4C6YA 2E8IA 5EUAA 2OLUA 1DJBA 2ZQ8A 2XD1A 3VOZA 2J7VA 4FD8A 2XD5A 1XP4A 1GA0A 2CC1A 1ERQA 1EWZA 2ZQCA 5EOEA 1KDSA 2Y2GA 1MWTA 1BLHA 4GOGA 3HUOA 2JCHA 3HVFA 4OVDA 5EECA 3S1YA 1MXOA 1FR6A 3IH8A 5CECA 5I94A 1QMFA 3WWXA 3DW0A 5FAQA 3BFDA 1XGIA 4OKPA 5U47A 4B4ZA 2ZMAA 2FFYA 3BFFA 5AQBA 4OOYA 4MEZA 3Q1FA 5CGWA 3LY3A 2Y2KA 5M19A 1ERMA 4KZBA 5AQ7A 4OQHA 3ZGAB 1K6SA 2XR0A 1MWUA 5BOHA 4KG5A 1DJCA 4S2PA 1K56D 5GL9A 2Y2HA 5FI7A 3FYZA 2EFXA 5E2HA 5TFQA 1KGEA 4XUXA 3GVBA 3IWOA 3RJUA 1VQQA 5FQMA 1MWSA 2XDMA 2H5SA 3LCEA 3GTCA 2P74A 5FA7A 3IXGA 3Q7ZA 2A3UA 1HZOA 2C6WB 2P9VA 5GHYA 2WAFA 3C4PA 3ZFZA 4DF6A 2ZQ7A 1J9MA 3GV9A 4IBXA 3O87A 5A90A 2ZM0A 3UN7A 3MXSA 5FAOA 1TDLA 4KG2A 3V3SA 3VSKA 5E2EA 3A3DA 2ZM2A 4HBTA 1ZG4A 3A3JA 4Y7PA 3RXXA 3VP4A 1YT4A 4PM8A 4N1HA 1MBLA 4IEDA 4GN2A 1KGGA 1TEMA 1DJAA 3C7UA 1ONHA 5IHVA 4DDSA 2Y59A 1LL5A 2EX8A 3ZCZA 4R1GA 4JXWA 3PBRA 5HFOA 4EV4A 2WUQA 2HDSA 2Q9MA 4R4SA 3UE3A 3UNWA 2XGNA 1W8YA 1E3UD 1EI5A 3HLDA 4PPRA 3NCKA 4KZ7A 1GHMA 4MBKA 1K54A 2BG1A 3AGDA 1AXBA 2FFFB 4OP5A 3FV7A 4KQOA 5AQAA 2RL3A 4Y0UA 2WAEA 3UE1A 3G2YA 5FASA 1JTGA 1ALQA 1ZC2A 3NC8A 5F1GA 3ZVTA 2ZQ9A 5EVID 5DF8A 1K25A 1MWRA 3PBNA 1SHVA 4WZ4A 4WYYA 5DF7A 3HLEA 4E3NA 1GA9A 1L0GA 1K54C 1GCEA 1M40A 2P9VB 1Z6FA 5DTTA 5GHXA 2Y2NA 3NBLA 1BSGA 3ZG7B 4R23A 1ESUA 3GSGA 4QJGA 3N7WA 1IYOA 1MKIA 2WZXA 3M6HA 2EX6A 3HREA 5AQ9A 1PZPA 4O7DA 4ZDXA 3BECA 4QHCA 2WK0A 3RXWA 1NYYA 4D2OA 2UWXA 3PAGA 4KZ6A 3BFGA 1GHPA 4KZAA 3PBSA 1BUEA 3IF5A 2QPNA 4GB7A 1H8YA 3ISGA 4MBHA 1QMEA 2ZQAA 3S22A 1CI9A 5EE8A 1HTZA 3MZEA 2OLVA 3NI9A 4JPMA 1NZUA 3ZG8B 4Y0OA 2Y2PA 1FOFA 3HL9A 3N6IA 3BFCA 4RX2A 1PZOA 2OSUA 4OPQA 2V1ZA 5EPHA 4JF5A 2I72A 4JKTA 2Y2JA 5L2FA 1BT5A 3PBOA 3GRJA 1I2WA 3MXRA 4HEFA 3HLCA 3SH8A 4DDYA 2RCXA 1WE4A 1YLJA 3G2ZA 3IT9A 2HDUA 1JTDA 3IXHA 4PM5A 3QNBA 2QMIA 4PM7A 4B4XA 4DE3A 1L0FA 1IYPA 3HBRA 2IWCA 1I5QA 2XF3A 4FH4A 5FI2A 1BLCA 3UDFA 4LV3A 3LO7A 1K6RA 3IHBA 2DCFA 4S2NA 3WS4A 3SH7A 5F83A 2IWDA 5J8XA 2Z2LB 3G35A 4BL3A 3ZG0A 3CG5A 1CK3A 1Q2QA 1RP5A 3VP3A 3OPLA 2X02A 3TG9A 3ZG5A 3HLWA 2HP9A 4EWFA 4BD0A 3UDXA 1W5DA 4F94A 4S2NC 1FCMA 1K4FA 1LHYA 4JLFA 4E3JA 2H0YA 2GDNA 3QHYA 4PM6A 4X6TA 3FWLA 4WMCD 1KE3A 4GDBA 4U0TA 5GLDA 3HLGA 2Y2OA 1IELA 2EXAA 4YFMA 1WYCA 4DXBA 4C3QA 1KDWA 1FR1A 1PYYA 4KZ5A 3IWIA 4NK3A 2J8YA 1ESIA 4GD6A 3DWZA 5CEBA 3VMAA 5FQIA 1CEGA 1M6KA 5GLBA 3HLFA
chains in the Genus database with same CATH superfamily
1UGUA 3LICA 1GHIA 1S1ZA 4BBTA 4EBPA 4PKYA 3BQ8A 3T1XA 2KX6A 4QU3A 4BBVA 1OTBA 3GR2A 3VP2A 3JYIA 3D4FA 3TW8A 1K56A 1N9LA 2PHYA 2JKGA 4HP9A 5HL1A 1OT6A 1MY8A 4CJNA 2W3GA 2HPBA 5DFYA 3ZYTA 4OQ0A 3RH8B 4U0XA 1XPBA 4I39A 4CPKA 3PBTA 4G3KA 2JE5A 4QPRA 3LIDA 3VE3A 4BD1A 5TGFA 3OPHA 4LV2A 2WKPA 4OONA 4XUZA 3UY6A 2XH9A 4JXSA 5EVIA 3ZQ5A 2R9WA 4XXRA 2WGVA 3FG8A 1LT0A 3N8LA 3V50A 3MFXA 1LLBA 3V3RA 1N9BA 4R0QA 2WGWA 1LI9A 4Z9QA 1YPRA 3FKWA 3B3XA 5KSCA 4WM9A 3QNCA 5IS1A 4E3LA 2ZMVA 3CUEC 3HJIA 1FIKA 2JKTM 2JBFA 3E2KA 1FILA 1L0EA 1IYQA 2IA2A 1PI4A 2HV1A 3G31A 4NKPA 5HARA 1YMXA 3CJMA 1K55A 2I9VA 3UO9A 2VA0A 4HBUA 4EERA 4UA7A 5GLCA 1D06A 1K57C 4CLCA 3TOIA 3IXBA 1SKFA 3EOIA 5G4ZA 1A0KA 2XFTA 2PDRA 1S6RA 1W8QA 4N92A 3WS1A 4E3IA 4MN6A 4EQIA 1JVJA 3CZDA 2DNSA 3IX4A 2X71A 3HCYA 3M2KA 5CHJA 4GW9A 2C5WB 4K0XA 2V20A 3T4LA 1X0OA 1YLYA 2XFSA 3TE8A 5HAQA 1S1YA 1VEUB 3M6BA 4ARZA 2ZQDA 4R6LA 2KLIA 4OP8A 1SCWA 5CTMA 5EVLA 1CEFA 2B95A 1F9IA 2EX2A 3OBFA 4X1MA 2VLGA 3IF6C 3MXQA 4II7A 3IWQA 3UPOA 2WKQA 1F5MA 1GSVA 3MFDA 4OPYA 3VOYA 3HJKA 3ZNYA 4IVKA 5HSQA 4DXCA 3TSGA 2D02A 2WKHA 1IOUA 1ZHHB 1EROA 3IF6B 4PM9A 5AVEA 1IKIA 2GJ3A 3CPTB 4HJ3A 1H8ZA 4WUJA 1BULA 4GLQA 5HAPA 1BLSA 4OQIA 4I3IA 2MJ6A 3DAVA 3KYQA 1PWDA 1VETB 4HESA 1KE4A 4B9OA 2X01A 4HJ6A 2E8JA 4AFIA 2ZD8A 4JGRA 4OPZA 2M7UA 1KVLA 1JWVA 4OOLA 2O9CA 3MQQA 2VKSA 3KYZA 4KG6A 1MPLA 1Y4OA 4BENA 5DTKA 1N9NA 2J9PA 4Y0TA 5CXWA 2V8CA 4E3OA 3MKEA 2ZC7A 2EXBA 1OTAA 4JGPA 5HDSA 2ZQ8A 3BJNA 5FEFA 4FD8A 1T1CA 1ERQA 1EWZA 3PHYA 3LR4A 1MWTA 3BY9A 3HVFA 5EECA 3S1YA 2O99A 1FR6A 3IH8A 5I94A 1SKOA 5U47A 3OLOA 4B4ZA 2ZMAA 2FFYA 4MEZA 3Q1FA 5KIZA 5CGWA 1ERMA 4KZBA 5EVEA 4LRXC 3ZGAB 3F1PA 4LRYC 5BOHA 4KG5A 2HF6A 3LFVA 1KGEA 1DP8A 1VQQA 5FA7A 2H5SA 2V9AA 2P9VA 5GHYA 3C4PA 3ZFZA 3GV9A 4IBXA 2A24B 2ZM0A 3UN7A 1OT9A 4Y2FA 4Y17A 1TD5A 4KG2A 3U2AA 4FTXA 5E2EA 4HBTA 3RXXA 3VP4A 1YT4A 2VJWA 3FPVA 1KGGA 1LL5A 2EX8A 3T1RA 3ZCZA 4JXWA 5HFOA 2HDSA 4R4SA 3UNWA 3NULA 1W8YA 3IX3A 1S4SA 3NCKA 3SZTA 3L9KA 2BG1A 4EXOA 3FV7A 3F1NB 2RL3A 4Y0UA 3UE1A 3G2YA 1JTGA 3NC8A 5F1GA 3LR3A 3PBNA 1SHVA 4WYYA 1L0GA 1K54C 1GCEA 3NECA 5GHXA 5DTTA 3ZG7B 2Y2NA 3NBLA 1BSGA 4R23A 2B02A 4QJGA 3N7WA 1MKIA 2WZXA 4F3LB 3HREA 1PZPA 4EEPA 3KSIA 2W0NA 3BECA 1ZTUA 2WK0A 4D2OA 5FEGA 3BFGA 1GHPA 3BQAA 1S67L 1Y28A 3IF5A 3ISGA 4WF0A 4D60A 3OOVA 5EE8A 2W3HA 1NZUA 2ZL1B 4Y0OA 1FOFA 3BFCA 3CUEA 4I3AA 4I38A 4MCWA 4JKTA 5F6AA 2Y2JA 3GRJA 3HLCA 1WE4A 3IXHA 4PM5A 4B4XA 4FH4A 2XF3A 4JGOA 2G7UA 3WS4A 2VGLS 3ZG0A 4RQ9A 2X02A 3TG9A 3ZG5A 4UQIS 3K3CA 4BD0A 4LPZA 1W5DA 4F94A 2NUTC 4JLFA 4E3JA 2ZOIA 2XSSA 4U0TA 3HLGA 2Y2OA 2EXAA 4DXBA 4PAUA 3UB8A 4NK3A 4GD6A 1ESIA 3W2ZA 4B93A 5FQIA 1XJ6A 1CEGA 1BLHA 3HLFA 3LEQA 3BM6A 5FSRA 1VB6A 5CRFA 4R3JA 2P08A 2OAP1 4EQ1A 2HGVA 3G32A 3NDEA 2PBYA 3KSHA 4WZ5C 3GMWA 2VK3A 1XA7A 1VM1A 4HH3A 4N1XA 3UPNA 3UMDA 4O0PA 4GDNA 2EFUA 4IBRA 1PNEA 2Y55A 1YQSA 5E2GA 3IF6A 3O3VA 3R7WB 1FCNA 3A3IA 5JYOA 3LIEA 3F1OB 3PBQA 1HLUP 4K08A 4FOFA 3NOTC 1OTDA 4EBNA 3PAEA 2INWA 5HD5A 1LL8A 1YLZA 3MSHA 3EEAA 4L0LA 3EQUA 1W79A 2HDQA 1RGYA 3Q07A 1ACFA 3OPRA 1LSXA 3PYPA 3S7QA 1CQAA 4GS9B 4BL2A 1P9WA 3G4PA 4S2JA 4XT2B 2XEPA 3GQZA 1W63Q 4LGWA 3LY4A 5FATA 4E3KA 1ES3A 4Y5FA 4ZAMA 3P98A 4KUOA 4DE2A 5HX9A 4IUHA 2NUPC 3IS2A 1BYWA 3HUMA 3V5MA 2Y2IA 1E25A 3NDGA 3PR6A 1FSWA 4NETA 2HJEA 2XLNA 3RFBA 4I5SA 1PWGA 3FKVA 1RGZA 2ZC3B 2XK1A 2PT7A 4GZBA 5L10A 2HP5A 4ID4A 3BW6A 4QY6A 5I5LA 4KZ8A 2J3WA 4KZ3A 3B33A 2ZC5B 5M1AA 3QP6A 2V8FA 2VGJA 3U4LP 1TS7A 3VP0A 3SS5A 4UAAA 1JWZA 4H6JB 4L9FA 4P87A 4CQHA 2O9AA 1PW1A 3VFHA 1ES4A 3Q81A 3MKFA 2YKFA 3BFEA 3SW1A 3BEBA 4KQRA 4NXGA 5HPIA 4Q0JA 5CHUA 3FZCA 3V39A 1P0ZA 1PI5A 3ICYA 4GNUA 4GD8A 3LEZA 5DF9A 4F3LA 1FSYA 1OMEA 4WEJA 4Y15A 1C3BA 2R9XA 4OOMA 5E2FA 4RVAA 2O9BA 3I7JA 1STZA 5FQ9A 3O88A 2OV5A 4GJ4A 5FDSA 3BYDA 4P6BA 3O86A 1FCOA 4P6ZS 4Y13A 4Q0HA 4X25A 1YKDA 3AGFA 2ZJ9A 5FQKA 1OTIA 3OCLA 1ZG6A 3JVVA 1XXMA 2P04A 4NXBA 3IH9A 2PBDP 4KQQA 1CJFA 2QHKA 1YM1A 4FUWA 2XROA 2PU4A 3UPPA 2W27A 4OQGA 2JC7A 4MN5A 1AWIA 2YKHA 3A3FA 4DE1A 2OWJA 4OPRA 4WBGA 3H82B 1YLTA 4ESPA 4DKIA 2EA9A 1NLZA 3IHAA 2Y2LA 3E98A 3T4TA 4QB8A 2GX5A 2ZC4B 2HZ5A 4C6YA 3DTEA 5J4EA 5EUAA 4G3WA 3VOZA 4BWIA 1KOUA 2XD5A 1XP4A 3T4OA 2W1TA 5HDCA 2ZQCA 5F68A 3GECA 2VZWA 2BTFP 2V0WA 3HUOA 4OVDA 1QMFA 3WWXA 3BFDA 3VE4A 2D01A 4OKPA 1V9ZA 3BFFA 5AQBA 3O5YA 4OQHA 1K6SA 3UB5P 1MWUA 4ETZA 2Y2HA 5FI7A 5TFQA 2EFXA 4XUXA 2L0WA 3IWOA 4HJ4A 1P9RA 4I3JA 5FQMA 2XDMA 2P74A 5A90A 4L9GA 5FAOA 4HQAA 3A3DA 2ZM2A 4ETXA 1TEMA 2OOLA 3C7UA 4Q0IA 4DDSA 5DKLA 2WUQA 1LSVA 4Z1WA 4KZ7A 3AGDA 5FASA 4E04A 2ZQ9A 3E0YA 5DF8A 1MWRA 4WZ4A 5DF7A 4DN0A 1GA9A 4E3NA 3JVUA 1XJ4A 1Z6FA 1ESUA 3DBAA 1CF0A 5AVFA 3LIBA 4GCZA 3PBSA 2PAVP 5L09A 2QPNA 4GB7A 1NRJA 2ZQAA 3S22A 2R78A 3MZEA 2OLVA 3ZG8B 2XA7S 3LIFA 2V1ZA 5EPHA 4KUKA 5L2FA 1I2WA 3MXRA 2RCXA 1YLJA 3G2ZA 2QMIA 3T4KA 3VV4A 2IWCA 5FI2A 3UDFA 4LV3A 2Y79A 3UB7A 3E4OA 4S2NA 3SH7A 2IWDA 5EM1A 3G35A 3QP4A 3CG5A 3KO6A 1Q2QA 2HJ9C 3VP3A 3OPLA 4MN7A 3UDXA 2H0YA 2GDNA 4PM6A 1TS0A 4WMCD 4BMWA 5GLDA 2PD7A 1IELA 4YFMA 1WYCA 2GNXA 1ODVA 3S7OA 3DWZA 4L9EA 5CEBA 3VMAA 1M6KA 4S2OA 1IFQA 4WEKA 3BWLA 3N8RA 3FC7A 2ZC6B 3T1QB 4S2LA 3GDIA 3LGOA 2Z2MB 3QP1A 3G34A 4DRTA 3H7WB 4DMZA 3G30A 2ZM8A 3LR0A 5FQJA 2QWSA 5FI6A 4OLGA 5EOOA 2QZ6A 3SH9A 3SOIA 4S2MA 5CHMA 2V2FF 4H8RA 4P0MA 2OWHA 4HY8A 4BJPA 5M18A 3T4SA 5KMWA 5DTSA 3A0RA 1S0WA 4HOIA 5A92A 4K0WA 1SDEA 2JKFA 3V67A 5FAPA 4DJ2A 3IX8A 3W4QA 3HLBA 4YWZA 4LENA 1SDNA 2ZBBA 4K91A 4KENB 2DRWA 2KOIA 1RCJA 3A3EA 4GKUA 1O7EA 5HL6A 1YLWA 4UA6A 2PU2A 3MS6A 5G18A 3OZHA 4BLMA 2DMWA 2Q9NA 5EVIC 1NY0A 3ZDJA 3WS2A 2WZZA 3RTYA 1O07A 2ZMFA 5HW3A 1ZKJA 2WKEA 4U3TA 1UWPX 1KVMA 1YMSA 1NLYA 1T1AA 1PW8A 4CLCE 2VV6A 3LIAA 3BLSA 1K57A 2QYBA 3A0VA 3LR5A 3OCNA 1Q2PA 2VGKA 1VEUA 4BBUA 1N4OA 3E2LA 3UE6A 3WRTA 4QY5A 1S66L 5F1FA 1K55C 1LL9A 1XGJA 2WGWB 2W1RA 3WRZA 3Q82A 2QKPA 1UWNX 5CGXA 5AJGA 1MC0A 3VFFA 3T4QA 3WS0A 1Y54A 4RYEA 3W8KA 4NEED 4ZBEA 4WMCA 1NYMA 4CLCC 4UHUA 3MQ0A 4LV1A 4ME4A 2H28A 3KX0X 3BY8A 3WS5A 4QWOA 4OLDA 1XX2A 4X56A 2WADA 4OH0A 4BQMA 4IUKA 5E43A 1TVFA 4JXGA 2LB5A 5IU1A 3CPTA 4CLCB 5KSHA 4KQDA 3UB6A 1KGFA 3NY4A 3OPPA 1DY6A 2OAQ1 4FH2A 1VETA 3C5AA 4ZJ2A 2M7VA 3TRCA 1PWCA 1K0KA 4E6WA 4EESA 1G5UA 2O0YA 5GLAA 4LCLA 2A2LA 3ITBA 4JXVA 4RA7A 3ZG9B 5A93A 4ARZB 1W7FA 5K5BA 4LRZE 1XJ3A 2M1CA 2K7SA 2J9OA 3MQOA 3UDIA 4PHTA 1HD8A 4S2IA 2WKIA 4R3BA 4Q8IA 4O8GA 1N9OA 2JN7A 5KZHA 2XRNA 3UMEA 2GZAA 1DRMA 5DKKA 1G68A 1YSPA 3C2WA 5CERA 1L0DA 3B42A 2VGLM 3PTEA 4S2KA 3ITAA 4WN5A 4UQIM 4WELA 3C4OA 3DTMA 2W3EA 3UE0A 4X68A 1TF1A 5TBMB 1ES2A 4ZJ1A 1IYSA 3P09A 2E8IA 1T19A 4UEYA 2PR5A 3E4PA 3H7WA 2CC1A 4CLCD 2A24A 3A0SA 1KDSA 4Y3IA 3E4QA 1MXOA 1DP9A 5CECA 5HPFA 4LFUA 3DW0A 4O01A 1XGIA 5M19A 4MMNA 3F1NA 3FYZA 5E2HA 1W63M 5LBRA 1H0MA 3IXGA 3Q7ZA 1HZOA 2C6WB 2ZQ7A 3O87A 3MXSA 1TDLA 3V3SA 1ZG4A 3A3JA 4Y7PA 1SKOB 2JKRI 1MBLA 3EWKA 3EGXC 1DJAA 2UV0E 2Y59A 4R1GA 3PBRA 2PYRA 1E3UD 1EI5A 2ZL1A 3CI6A 3F1PB 3HLDA 3MMHA 4MBKA 1K54A 1P97A 1AXBA 2FFFB 4OP5A 5HD3A 4KQOA 5AQAA 2ZOHA 1ALQA 1ZC2A 3ZVTA 1K25A 3HLEA 2P9VB 3GSGA 1IYOA 2EX6A 4O7DA 4ZDXA 4QHCA 3RXWA 1NYYA 4KZ6A 4KZAA 5DJTA 1QMEA 2CMNA 1HTZA 3NI9A 4JPMA 2Y2PA 3JPUA 3HL9A 4RX2A 4EW7A 5EV0A 5EM0A 1YSQA 4NXFA 2I72A 3PBOA 4HEFA 2KDKA 3SH8A 4DDYA 2HDUA 3QNBA 2FZ0A 4PM7A 5MC7A 1L0FA 3NOUC 1I5QA 1BLCA 3LO7A 1K6RA 3IHBA 2DCFA 5F83A 5J8XA 4LLOB 2Z2LB 2J80A 2W3FA 1CK3A 2K2NA 2WKRA 5HDDA 1PFLA 3HLWA 2HP9A 1V9YA 1XFNA 4G3VA 1LHYA 3QHYA 4X6TA 3FWLA 4YNRA 3R7WA 1PYYA 4KZ5A 3F1OA 2J8YA 3CAXA 4HP4A 4PKYG 2WGIA 1TDGA 1L2SA 5FDHA 1LI0A 3Q7VB 2JHEA 4WLAA 1D7EA 3T4JA 3MZFA 4EUZA 3W4OA 1BZAA 1VHMA 4RX3A 3EGDC 2Y4AA 4WZ5A 3SS4A 1IEMA 4R38A 2J3TC 4M3KA 4KZ9A 1FQGA 1E4DA 3AGEA 4PMAA 4A5RA 4EBLA 1J3WA 4IVIA 1BLPA 1YLPA 2Z6DA 5FL3A 4GHIB 4GS9A 1WA9A 1IKGA 1NZOA 1GSXA 4P85A 4XT2A 4R3AA 4JBFA 4P6ZM 1K38A 1XA1A 3R4KA 3IBJA 2PRFA 5L8MA 1MZUA 2WYXA 3CITA 3T1SA 2W3DA 1HVBA 3VOLA 5F82A 5D3OA 4N9KA 1E3UA 1D1JA 1H3QA 3C38A 2K31A 3IQAA 4QD4A 3G6OA 1H8MA 1MKMA 2Y91A 3MZDA 2V1AA 4DE0A 3CMZA 3QP8A 2V1BA 1NJ4A 3BLMA 2A49A 5DJUA 5TBMA 2G2UA 3D72A 4MNRA 4ZJ3A 4MLLA 5A8BA 5L07A 5CEDA 4IJGA 2B18A 5IT5A 4IHQA 4LV0A 3ULFA 4HIAA 3B47A 1XJ2A 2V0UA 4YINA 2EWVA 1YAXA 4H6JA 2JKTI 4C75A 2XQZA 4ZTKA 4R4RA 5F5YA 4HNBA 1I2SA 1G6OA 1KE0A 2Y2QA 1G28A 5FQQA 2IWBA 4DJ3A 2BLSA 5CTNA 3BRMA 3LUQA 1S4RA 3VP1A 3OC2A 5HZHA 1T1BA 3LI9A 3IS2B 3S7PA 2HP6A 1XKZA 3ZVWA 2J3TD 3C7VA 2EWWA 5C5KA 3MBZA 3W4PA 2G2WA 3PXPA 4X53A 4ZRRA 3ZHHA 1OJGA 4N9LA 3M2JA 2PYPA 5J3WA 5G4YA 1BTLA 4UA9A 3IXDA 4LCMA 2PD8A 4JF6A 1G6AA 3VSLA 4JF4A 3ZNTA 5DFXA 2VEAA 1ES5A 3LI8A 5JYPA 1F98A 4NG2A 2QJ7A 2LB9A 5GHZA 3N8SA 3H82A 2H0TA 3H9WA 1OPXA 3HUNA 5CGSA 2Y8HA 4B88A 4MDZA 4HH2A 4YOFA 1H5XA 3P7NA 3TJZC 3T12B 3DWKA 3QP2A 4FCFA 1T18A 4X1LA 1CI8A 1OTEA 3KYEA 4R70A 5A91A 1K4EA 1PIOA 2XA7M 3S4XA 4M4XA 3D3OA 1NWZA 1U60A 2PR6A 3NIAA 4E3MA 2ZLYA 3EQVA 4WL9A 3SS3A 1XFQA 5CX7A 4E6XA 3K2NA 1JWPA 4X69A 5J7EA 4X55A 2VV8A 3K3DA 3L7HA 3N4IA 4FSFA 5TR7A 1WYBA 4MBFA 2EX9A 1NXYA 5DVAA 2B5RA 1ONGA 1NRFA 5EVIB 5HAIA 2QJ5A 2H10A 2VX8A 5F69A 2Y2MA 3Q7VA 2HDRA 4KZ4A 2VV7A 3NJAA 2OLUA 1DJBA 2XD1A 2J7VA 3P01A 1GA0A 4EU0A 5EOEA 2Y2GA 4GOGA 2JCHA 4HHDA 4GHIA 5FAQA 1Z09A 2AVXA 4OOYA 3FPWA 3LY3A 2Y2KA 3KSFA 5AQ7A 1TS6A 3MF0A 2XR0A 1PRQA 4HI4A 1DJCA 4S2PA 1K56D 5GL9A 3C8CA 1TS8A 4EETB 3GVBA 3C30A 3DTIA 3RJUA 1MWSA 3LCEA 3GTCA 2L1MA 2A3UA 2W1TB 2BASA 2WAFA 3NOPC 3T50A 4DF6A 1SZVA 1J9MA 5TJJA 3QP5A 2JKRM 4EUVA 3VSKA 2ACGA 2L4RA 5HWWA 4EEUA 4PM8A 4N1HA 4IEDA 2Q0OA 4GN2A 5IHVA 1ONHA 1L3LA 4EV4A 3KSGA 2Q9MA 3UE3A 3EEHA 2XGNA 4PPRA 3DTKA 2FH5A 1F2KA 1GHMA 1GSWA 2WAEA 3IBRA 5EVID 1M40A 1EW0A 3M6HA 5AQ9A 2Z6CA 2UWXA 3NHQA 3PAGA 3MJQA 1BUEA 1H8YA 4MBHA 3MR0A 5HWVA 1CI9A 4NXEA 3N6IA 1PZOA 2OSUA 4OPQA 3UB9A 4JF5A 1BT5A 3LYXA 3D9YA 3IT9A 1JTDA 4DE3A 1IYPA 3HBRA 3CLOA 3S7NA 4BL3A 5HWTA 1RP5A 3CWFA 4EWFA 3CHWP 5EFWA 4S2NC 1FCMA 1K4FA 1KE3A 4GDBA 4JGQA 4C3QA 1DP6A 1KDWA 1FR1A 3IWIA 2P7JA 1JNUA 1LSWA 1OJ5A 5GLBA
chains in the Genus database with same CATH topology
1TDGA 4S2OA 1L2SA 5FDHA 1LI0A 3Q7VB 3BM6A 4WEKA 5FSRA 3MZFA 1GHIA 4EUZA 5CRFA 4R3JA 3W4OA 1BZAA 4EBPA 4RX3A 3N8RA 2Y4AA 4WZ5A 2ZC6B 4S2LA 3SS4A 1IEMA 2Z2MB 4QU3A 3GR2A 4DRTA 3G34A 3G32A 4M3KA 3NDEA 2PBYA 3VP2A 4KZ9A 4WZ5C 1FQGA 3G30A 3GMWA 1XA7A 3JYIA 1VM1A 3D4FA 1E4DA 3AGEA 1K56A 4PMAA 2ZM8A 5FQJA 4N1XA 3UPNA 4A5RA 4EBLA 4GDNA 5FI6A 2EFUA 4OLGA 4IBRA 5EOOA 2QZ6A 3SH9A 3SOIA 2Y55A 4IVIA 1YQSA 5E2GA 1BLPA 3IF6A 1YLPA 4S2MA 5HL1A 3O3VA 1FCNA 3A3IA 5CHMA 1MY8A 4CJNA 5JYOA 2V2FF 3PBQA 1IKGA 1NZOA 4H8RA 4P0MA 4P85A 2HPBA 4BJPA 4JBFA 5M18A 4EBNA 3PAEA 4OQ0A 5KMWA 1K38A 5DTSA 4U0XA 1XA1A 1XPBA 1S0WA 2WYXA 4CPKA 1YLZA 3PBTA 1HVBA 2JE5A 5A92A 4K0WA 5F82A 4BD1A 1SDEA 5D3OA 4N9KA 5TGFA 5FAPA 1E3UA 3OPHA 4LV2A 3W4QA 3HLBA 4OONA 4L0LA 3IQAA 4LENA 1SDNA 3EQUA 1W79A 2HDQA 4QD4A 4K91A 4KENB 4XUZA 3UY6A 2DRWA 1RGYA 3Q07A 2XH9A 3OPRA 2Y91A 4JXSA 3MZDA 5EVIA 4DE0A 1RCJA 3A3EA 3CMZA 4GKUA 1O7EA 1YLWA 4UA6A 4BL2A 1NJ4A 2PU2A 2A49A 2R9WA 3BLMA 3G4PA 4XXRA 5G18A 2WGVA 3N8LA 3OZHA 4BLMA 4S2JA 3V50A 2XEPA 1LLBA 2G2UA 2Q9NA 5EVIC 1NY0A 3GQZA 3V3RA 1N9BA 3LY4A 4MNRA 5FATA 1ES3A 4ZJ3A 3ZDJA 4E3KA 4R0QA 2WGWA 1LI9A 4ZAMA 3WS2A 3P98A 4MLLA 2WZZA 5CEDA 4Z9QA 3FKWA 3B3XA 1O07A 4DE2A 5HX9A 4WM9A 5HW3A 5KSCA 1ZKJA 3QNCA 2WKEA 4E3LA 3HUMA 3V5MA 4LV0A 4U3TA 2Y2IA 1E25A 1KVMA 2JBFA 1YMSA 3E2KA 3NDGA 1L0EA 1FSWA 1IYQA 4NETA 2XLNA 4YINA 1PW8A 1PI4A 3G31A 5HARA 4C75A 2XQZA 4ZTKA 4R4RA 1YMXA 3CJMA 1I2SA 1K55A 1PWGA 3BLSA 3FKVA 1KE0A 2Y2QA 1K57A 5FQQA 1RGZA 2IWBA 2ZC3B 3OCNA 2XK1A 1Q2PA 3UO9A 2VGKA 2BLSA 4HBUA 5CTNA 1N4OA 3E2LA 3BRMA 4UA7A 4GZBA 4QY5A 3WRTA 5F1FA 1K55C 5GLCA 1LL9A 1XGJA 2WGWB 3WRZA 3Q82A 1K57C 3VP1A 2HP5A 3OC2A 4ID4A 5CGXA 3VFFA 3TOIA 3WS0A 3IXBA 1Y54A 1SKFA 4RYEA 2XFTA 3W8KA 1S6RA 4QY6A 1W8QA 4N92A 4KZ8A 4ZBEA 4WMCA 4KZ3A 1NYMA 3WS1A 4E3IA 4EQIA 1JVJA 2HP6A 3CZDA 2ZC5B 1XKZA 2DNSA 4UHUA 5M1AA 3ZVWA 2VGJA 3C7VA 4LV1A 3VP0A 3SS5A 4UAAA 3WS5A 2X71A 1JWZA 3MBZA 3W4PA 4OLDA 2G2WA 1XX2A 4X56A 3M2KA 5CHJA 4X53A 2WADA 2C5WB 4K0XA 2V20A 4P87A 4OH0A 4BQMA 3ZHHA 1PW1A 5E43A 1ES4A 1TVFA 1YLYA 2XFSA 3MKFA 3Q81A 3VFHA 5HAQA 4JXGA 3M6BA 4N9LA 3BFEA 2ZQDA 3M2JA 3BEBA 1BTLA 4UA9A 3IXDA 4KQRA 4OP8A 1SCWA 5CTMA 5EVLA 1CEFA 5CHUA 3FZCA 4LCMA 5KSHA 3V39A 2EX2A 1PI5A 4GNUA 4JF6A 1G6AA 4GD8A 3IF6C 1KGFA 3NY4A 4JF4A 3VSLA 3LEZA 5DF9A 3ZNTA 3OPPA 1DY6A 1FSYA 1OMEA 4FH2A 4WEJA 1C3BA 1ES5A 3IWQA 2R9XA 4OOMA 3UPOA 5E2FA 5JYPA 3C5AA 4RVAA 4ZJ2A 3I7JA 3MFDA 1PWCA 4E6WA 4OPYA 3VOYA 5FQ9A 3O88A 5GLAA 2OV5A 4LCLA 5GHZA 3ITBA 3ZNYA 3N8SA 4JXVA 3BYDA 2H0TA 4P6BA 4RA7A 4IVKA 3ZG9B 3O86A 1FCOA 3HUNA 5CGSA 4B88A 5A93A 4DXCA 3TSGA 2WKHA 1EROA 3IF6B 1W7FA 1H5XA 4PM9A 1IKIA 3DWKA 3AGFA 4FCFA 1CI8A 2ZJ9A 1H8ZA 5A91A 1BULA 5FQKA 3OCLA 5HAPA 1BLSA 1ZG6A 1K4EA 2J9OA 3UDIA 1PIOA 3S4XA 1HD8A 4OQIA 1XXMA 1U60A 4S2IA 2WKIA 4R3BA 1PWDA 3NIAA 3IH9A 4E3MA 4Q8IA 4KQQA 5KZHA 2ZLYA 3EQVA 4HESA 1KE4A 1YM1A 3SS3A 2X01A 4E6XA 2PU4A 3UPPA 1G68A 1JWPA 4X69A 4OQGA 2JC7A 4X55A 5TR7A 4FSFA 2ZD8A 3N4IA 5CERA 1WYBA 4OPZA 4MBFA 3A3FA 4DE1A 1KVLA 2EX9A 1JWVA 1NXYA 4OOLA 4OPRA 4WBGA 5DVAA 1YLTA 2B5RA 1L0DA 1ONGA 3PTEA 4KG6A 4S2KA 4DKIA 3ITAA 1NRFA 1MPLA 5EVIB 3IHAA 2Y2LA 5HAIA 4BENA 2H10A 4WELA 5DTKA 2WGIA 2J9PA 3C4OA 4Y0TA 5CXWA 3DTMA 2Y2MA 3Q7VA 3UE0A 4X68A 4QB8A 2HDRA 4KZ4A 4E3OA 3MKEA 1ES2A 2ZC4B 2ZC7A 4ZJ1A 2EXBA 1IYSA 3P09A 4C6YA 2E8IA 5EUAA 2OLUA 1DJBA 2ZQ8A 2XD1A 3VOZA 2J7VA 4FD8A 2XD5A 1XP4A 1GA0A 2CC1A 1ERQA 1EWZA 2ZQCA 5EOEA 1KDSA 2Y2GA 1MWTA 1BLHA 4GOGA 3HUOA 2JCHA 3HVFA 4OVDA 5EECA 3S1YA 1MXOA 1FR6A 3IH8A 5CECA 5I94A 1QMFA 3WWXA 3DW0A 5FAQA 3BFDA 1XGIA 4OKPA 5U47A 4B4ZA 2ZMAA 2FFYA 3BFFA 5AQBA 4OOYA 4MEZA 3Q1FA 5CGWA 3LY3A 2Y2KA 5M19A 1ERMA 4KZBA 5AQ7A 4OQHA 3ZGAB 1K6SA 2XR0A 1MWUA 5BOHA 4KG5A 1DJCA 4S2PA 1K56D 5GL9A 2Y2HA 5FI7A 3FYZA 2EFXA 5E2HA 5TFQA 1KGEA 4XUXA 3GVBA 3IWOA 3RJUA 1VQQA 5FQMA 1MWSA 2XDMA 2H5SA 3LCEA 3GTCA 2P74A 5FA7A 3IXGA 3Q7ZA 2A3UA 1HZOA 2C6WB 2P9VA 5GHYA 2WAFA 3C4PA 3ZFZA 4DF6A 2ZQ7A 1J9MA 3GV9A 4IBXA 3O87A 5A90A 2ZM0A 3UN7A 3MXSA 5FAOA 1TDLA 4KG2A 3V3SA 3VSKA 5E2EA 3A3DA 2ZM2A 4HBTA 1ZG4A 3A3JA 4Y7PA 3RXXA 3VP4A 1YT4A 4PM8A 4N1HA 1MBLA 4IEDA 4GN2A 1KGGA 1TEMA 1DJAA 3C7UA 1ONHA 5IHVA 4DDSA 2Y59A 1LL5A 2EX8A 3ZCZA 4R1GA 4JXWA 3PBRA 5HFOA 4EV4A 2WUQA 2HDSA 2Q9MA 4R4SA 3UE3A 3UNWA 2XGNA 1W8YA 1E3UD 1EI5A 3HLDA 4PPRA 3NCKA 4KZ7A 1GHMA 4MBKA 1K54A 2BG1A 3AGDA 1AXBA 2FFFB 4OP5A 3FV7A 4KQOA 5AQAA 2RL3A 4Y0UA 2WAEA 3UE1A 3G2YA 5FASA 1JTGA 1ALQA 1ZC2A 3NC8A 5F1GA 3ZVTA 2ZQ9A 5EVID 5DF8A 1K25A 1MWRA 3PBNA 1SHVA 4WZ4A 4WYYA 5DF7A 3HLEA 4E3NA 1GA9A 1L0GA 1K54C 1GCEA 1M40A 2P9VB 1Z6FA 5DTTA 5GHXA 2Y2NA 3NBLA 1BSGA 3ZG7B 4R23A 1ESUA 3GSGA 4QJGA 3N7WA 1IYOA 1MKIA 2WZXA 3M6HA 2EX6A 3HREA 5AQ9A 1PZPA 4O7DA 4ZDXA 3BECA 4QHCA 2WK0A 3RXWA 1NYYA 4D2OA 2UWXA 3PAGA 4KZ6A 3BFGA 1GHPA 4KZAA 3PBSA 1BUEA 3IF5A 2QPNA 4GB7A 1H8YA 3ISGA 4MBHA 1QMEA 2ZQAA 3S22A 1CI9A 5EE8A 1HTZA 3MZEA 2OLVA 3NI9A 4JPMA 1NZUA 3ZG8B 4Y0OA 2Y2PA 1FOFA 3HL9A 3N6IA 3BFCA 4RX2A 1PZOA 2OSUA 4OPQA 2V1ZA 5EPHA 4JF5A 2I72A 4JKTA 2Y2JA 5L2FA 1BT5A 3PBOA 3GRJA 1I2WA 3MXRA 4HEFA 3HLCA 3SH8A 4DDYA 2RCXA 1WE4A 1YLJA 3G2ZA 3IT9A 2HDUA 1JTDA 3IXHA 4PM5A 3QNBA 2QMIA 4PM7A 4B4XA 4DE3A 1L0FA 1IYPA 3HBRA 2IWCA 1I5QA 2XF3A 4FH4A 5FI2A 1BLCA 3UDFA 4LV3A 3LO7A 1K6RA 3IHBA 2DCFA 4S2NA 3WS4A 3SH7A 5F83A 2IWDA 5J8XA 2Z2LB 3G35A 4BL3A 3ZG0A 3CG5A 1CK3A 1Q2QA 1RP5A 3VP3A 3OPLA 2X02A 3TG9A 3ZG5A 3HLWA 2HP9A 4EWFA 4BD0A 3UDXA 1W5DA 4F94A 4S2NC 1FCMA 1K4FA 1LHYA 4JLFA 4E3JA 2H0YA 2GDNA 3QHYA 4PM6A 4X6TA 3FWLA 4WMCD 1KE3A 4GDBA 4U0TA 5GLDA 3HLGA 2Y2OA 1IELA 2EXAA 4YFMA 1WYCA 4DXBA 4C3QA 1KDWA 1FR1A 1PYYA 4KZ5A 3IWIA 4NK3A 2J8YA 1ESIA 4GD6A 3DWZA 5CEBA 3VMAA 5FQIA 1CEGA 1M6KA 5GLBA 3HLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDG A;  4S2O A;  1L2S A;  5FDH A;  1LI0 A;  3Q7V B;  3BM6 A;  4WEK A;  5FSR A;  3MZF A;  1GHI A;  4EUZ A;  5CRF A;  4R3J A;  3W4O A;  1BZA A;  4EBP A;  4RX3 A;  3N8R A;  2Y4A A;  4WZ5 A;  2ZC6 B;  4S2L A;  3SS4 A;  1IEM A;  2Z2M B;  4QU3 A;  3GR2 A;  4DRT A;  3G34 A;  3G32 A;  4M3K A;  3NDE A;  2PBY A;  3VP2 A;  4KZ9 A;  4WZ5 C;  1FQG A;  3G30 A;  3GMW A;  1XA7 A;  3JYI A;  1VM1 A;  3D4F A;  1E4D A;  3AGE A;  1K56 A;  4PMA A;  2ZM8 A;  5FQJ A;  4N1X A;  3UPN A;  4A5R A;  4EBL A;  4GDN A;  5FI6 A;  2EFU A;  4OLG A;  4IBR A;  5EOO A;  2QZ6 A;  3SH9 A;  3SOI A;  2Y55 A;  4IVI A;  1YQS A;  5E2G A;  1BLP A;  3IF6 A;  1YLP A;  4S2M A;  5HL1 A;  3O3V A;  1FCN A;  3A3I A;  5CHM A;  1MY8 A;  4CJN A;  5JYO A;  2V2F F;  3PBQ A;  1IKG A;  1NZO A;  4H8R A;  4P0M A;  4P85 A;  2HPB A;  4BJP A;  4JBF A;  5M18 A;  4EBN A;  3PAE A;  4OQ0 A;  5KMW A;  1K38 A;  5DTS A;  4U0X A;  1XA1 A;  1XPB A;  1S0W A;  2WYX A;  4CPK A;  1YLZ A;  3PBT A;  1HVB A;  2JE5 A;  5A92 A;  4K0W A;  5F82 A;  4BD1 A;  1SDE A;  5D3O A;  4N9K A;  5TGF A;  5FAP A;  1E3U A;  3OPH A;  4LV2 A;  3W4Q A;  3HLB A;  4OON A;  4L0L A;  3IQA A;  4LEN A;  1SDN A;  3EQU A;  1W79 A;  2HDQ A;  4QD4 A;  4K91 A;  4KEN B;  4XUZ A;  3UY6 A;  2DRW A;  1RGY A;  3Q07 A;  2XH9 A;  3OPR A;  2Y91 A;  4JXS A;  3MZD A;  5EVI A;  4DE0 A;  1RCJ A;  3A3E A;  3CMZ A;  4GKU A;  1O7E A;  1YLW A;  4UA6 A;  4BL2 A;  1NJ4 A;  2PU2 A;  2A49 A;  2R9W A;  3BLM A;  3G4P A;  4XXR A;  5G18 A;  2WGV A;  3N8L A;  3OZH A;  4BLM A;  4S2J A;  3V50 A;  2XEP A;  1LLB A;  2G2U A;  2Q9N A;  5EVI C;  1NY0 A;  3GQZ A;  3V3R A;  1N9B A;  3LY4 A;  4MNR A;  5FAT A;  1ES3 A;  4ZJ3 A;  3ZDJ A;  4E3K A;  4R0Q A;  2WGW A;  1LI9 A;  4ZAM A;  3WS2 A;  3P98 A;  4MLL A;  2WZZ A;  5CED A;  4Z9Q A;  3FKW A;  3B3X A;  1O07 A;  4DE2 A;  5HX9 A;  4WM9 A;  5HW3 A;  5KSC A;  1ZKJ A;  3QNC A;  2WKE A;  4E3L A;  3HUM A;  3V5M A;  4LV0 A;  4U3T A;  2Y2I A;  1E25 A;  1KVM A;  2JBF A;  1YMS A;  3E2K A;  3NDG A;  1L0E A;  1FSW A;  1IYQ A;  4NET A;  2XLN A;  4YIN A;  1PW8 A;  1PI4 A;  3G31 A;  5HAR A;  4C75 A;  2XQZ A;  4ZTK A;  4R4R A;  1YMX A;  3CJM A;  1I2S A;  1K55 A;  1PWG A;  3BLS A;  3FKV A;  1KE0 A;  2Y2Q A;  1K57 A;  5FQQ A;  1RGZ A;  2IWB A;  2ZC3 B;  3OCN A;  2XK1 A;  1Q2P A;  3UO9 A;  2VGK A;  2BLS A;  4HBU A;  5CTN A;  1N4O A;  3E2L A;  3BRM A;  4UA7 A;  4GZB A;  4QY5 A;  3WRT A;  5F1F A;  1K55 C;  5GLC A;  1LL9 A;  1XGJ A;  2WGW B;  3WRZ A;  3Q82 A;  1K57 C;  3VP1 A;  2HP5 A;  3OC2 A;  4ID4 A;  5CGX A;  3VFF A;  3TOI A;  3WS0 A;  3IXB A;  1Y54 A;  1SKF A;  4RYE A;  2XFT A;  3W8K A;  1S6R A;  4QY6 A;  1W8Q A;  4N92 A;  4KZ8 A;  4ZBE A;  4WMC A;  4KZ3 A;  1NYM A;  3WS1 A;  4E3I A;  4EQI A;  1JVJ A;  2HP6 A;  3CZD A;  2ZC5 B;  1XKZ A;  2DNS A;  4UHU A;  5M1A A;  3ZVW A;  2VGJ A;  3C7V A;  4LV1 A;  3VP0 A;  3SS5 A;  4UAA A;  3WS5 A;  2X71 A;  1JWZ A;  3MBZ A;  3W4P A;  4OLD A;  2G2W A;  1XX2 A;  4X56 A;  3M2K A;  5CHJ A;  4X53 A;  2WAD A;  2C5W B;  4K0X A;  2V20 A;  4P87 A;  4OH0 A;  4BQM A;  3ZHH A;  1PW1 A;  5E43 A;  1ES4 A;  1TVF A;  1YLY A;  2XFS A;  3MKF A;  3Q81 A;  3VFH A;  5HAQ A;  4JXG A;  3M6B A;  4N9L A;  3BFE A;  2ZQD A;  3M2J A;  3BEB A;  1BTL A;  4UA9 A;  3IXD A;  4KQR A;  4OP8 A;  1SCW A;  5CTM A;  5EVL A;  1CEF A;  5CHU A;  3FZC A;  4LCM A;  5KSH A;  3V39 A;  2EX2 A;  1PI5 A;  4GNU A;  4JF6 A;  1G6A A;  4GD8 A;  3IF6 C;  1KGF A;  3NY4 A;  4JF4 A;  3VSL A;  3LEZ A;  5DF9 A;  3ZNT A;  3OPP A;  1DY6 A;  1FSY A;  1OME A;  4FH2 A;  4WEJ A;  1C3B A;  1ES5 A;  3IWQ A;  2R9X A;  4OOM A;  3UPO A;  5E2F A;  5JYP A;  3C5A A;  4RVA A;  4ZJ2 A;  3I7J A;  3MFD A;  1PWC A;  4E6W A;  4OPY A;  3VOY A;  5FQ9 A;  3O88 A;  5GLA A;  2OV5 A;  4LCL A;  5GHZ A;  3ITB A;  3ZNY A;  3N8S A;  4JXV A;  3BYD A;  2H0T A;  4P6B A;  4RA7 A;  4IVK A;  3ZG9 B;  3O86 A;  1FCO A;  3HUN A;  5CGS A;  4B88 A;  5A93 A;  4DXC A;  3TSG A;  2WKH A;  1ERO A;  3IF6 B;  1W7F A;  1H5X A;  4PM9 A;  1IKI A;  3DWK A;  3AGF A;  4FCF A;  1CI8 A;  2ZJ9 A;  1H8Z A;  5A91 A;  1BUL A;  5FQK A;  3OCL A;  5HAP A;  1BLS A;  1ZG6 A;  1K4E A;  2J9O A;  3UDI A;  1PIO A;  3S4X A;  1HD8 A;  4OQI A;  1XXM A;  1U60 A;  4S2I A;  2WKI A;  4R3B A;  1PWD A;  3NIA A;  3IH9 A;  4E3M A;  4Q8I A;  4KQQ A;  5KZH A;  2ZLY A;  3EQV A;  4HES A;  1KE4 A;  1YM1 A;  3SS3 A;  2X01 A;  4E6X A;  2PU4 A;  3UPP A;  1G68 A;  1JWP A;  4X69 A;  4OQG A;  2JC7 A;  4X55 A;  5TR7 A;  4FSF A;  2ZD8 A;  3N4I A;  5CER A;  1WYB A;  4OPZ A;  4MBF A;  3A3F A;  4DE1 A;  1KVL A;  2EX9 A;  1JWV A;  1NXY A;  4OOL A;  4OPR A;  4WBG A;  5DVA A;  1YLT A;  2B5R A;  1L0D A;  1ONG A;  3PTE A;  4KG6 A;  4S2K A;  4DKI A;  3ITA A;  1NRF A;  1MPL A;  5EVI B;  3IHA A;  2Y2L A;  5HAI A;  4BEN A;  2H10 A;  4WEL A;  5DTK A;  2WGI A;  2J9P A;  3C4O A;  4Y0T A;  5CXW A;  3DTM A;  2Y2M A;  3Q7V A;  3UE0 A;  4X68 A;  4QB8 A;  2HDR A;  4KZ4 A;  4E3O A;  3MKE A;  1ES2 A;  2ZC4 B;  2ZC7 A;  4ZJ1 A;  2EXB A;  1IYS A;  3P09 A;  4C6Y A;  2E8I A;  5EUA A;  2OLU A;  1DJB A;  2ZQ8 A;  2XD1 A;  3VOZ A;  2J7V A;  4FD8 A;  2XD5 A;  1XP4 A;  1GA0 A;  2CC1 A;  1ERQ A;  1EWZ A;  2ZQC A;  5EOE A;  1KDS A;  2Y2G A;  1MWT A;  1BLH A;  4GOG A;  3HUO A;  2JCH A;  3HVF A;  4OVD A;  5EEC A;  3S1Y A;  1MXO A;  1FR6 A;  3IH8 A;  5CEC A;  5I94 A;  1QMF A;  3WWX A;  3DW0 A;  5FAQ A;  3BFD A;  1XGI A;  4OKP A;  5U47 A;  4B4Z A;  2ZMA A;  2FFY A;  3BFF A;  5AQB A;  4OOY A;  4MEZ A;  3Q1F A;  5CGW A;  3LY3 A;  2Y2K A;  5M19 A;  1ERM A;  4KZB A;  5AQ7 A;  4OQH A;  3ZGA B;  1K6S A;  2XR0 A;  1MWU A;  5BOH A;  4KG5 A;  1DJC A;  4S2P A;  1K56 D;  5GL9 A;  2Y2H A;  5FI7 A;  3FYZ A;  2EFX A;  5E2H A;  5TFQ A;  1KGE A;  4XUX A;  3GVB A;  3IWO A;  3RJU A;  1VQQ A;  5FQM A;  1MWS A;  2XDM A;  2H5S A;  3LCE A;  3GTC A;  2P74 A;  5FA7 A;  3IXG A;  3Q7Z A;  2A3U A;  1HZO A;  2C6W B;  2P9V A;  5GHY A;  2WAF A;  3C4P A;  3ZFZ A;  4DF6 A;  2ZQ7 A;  1J9M A;  3GV9 A;  4IBX A;  3O87 A;  5A90 A;  2ZM0 A;  3UN7 A;  3MXS A;  5FAO A;  1TDL A;  4KG2 A;  3V3S A;  3VSK A;  5E2E A;  3A3D A;  2ZM2 A;  4HBT A;  1ZG4 A;  3A3J A;  4Y7P A;  3RXX A;  3VP4 A;  1YT4 A;  4PM8 A;  4N1H A;  1MBL A;  4IED A;  4GN2 A;  1KGG A;  1TEM A;  1DJA A;  3C7U A;  1ONH A;  5IHV A;  4DDS A;  2Y59 A;  1LL5 A;  2EX8 A;  3ZCZ A;  4R1G A;  4JXW A;  3PBR A;  5HFO A;  4EV4 A;  2WUQ A;  2HDS A;  2Q9M A;  4R4S A;  3UE3 A;  3UNW A;  2XGN A;  1W8Y A;  1E3U D;  1EI5 A;  3HLD A;  4PPR A;  3NCK A;  4KZ7 A;  1GHM A;  4MBK A;  1K54 A;  2BG1 A;  3AGD A;  1AXB A;  2FFF B;  4OP5 A;  3FV7 A;  4KQO A;  5AQA A;  2RL3 A;  4Y0U A;  2WAE A;  3UE1 A;  3G2Y A;  5FAS A;  1JTG A;  1ALQ A;  1ZC2 A;  3NC8 A;  5F1G A;  3ZVT A;  2ZQ9 A;  5EVI D;  5DF8 A;  1K25 A;  1MWR A;  3PBN A;  1SHV A;  4WZ4 A;  4WYY A;  5DF7 A;  3HLE A;  4E3N A;  1GA9 A;  1L0G A;  1K54 C;  1GCE A;  1M40 A;  2P9V B;  1Z6F A;  5DTT A;  5GHX A;  2Y2N A;  3NBL A;  1BSG A;  3ZG7 B;  4R23 A;  1ESU A;  3GSG A;  4QJG A;  3N7W A;  1IYO A;  1MKI A;  2WZX A;  3M6H A;  2EX6 A;  3HRE A;  5AQ9 A;  1PZP A;  4O7D A;  4ZDX A;  3BEC A;  4QHC A;  2WK0 A;  3RXW A;  1NYY A;  4D2O A;  2UWX A;  3PAG A;  4KZ6 A;  3BFG A;  1GHP A;  4KZA A;  3PBS A;  1BUE A;  3IF5 A;  2QPN A;  4GB7 A;  1H8Y A;  3ISG A;  4MBH A;  1QME A;  2ZQA A;  3S22 A;  1CI9 A;  5EE8 A;  1HTZ A;  3MZE A;  2OLV A;  3NI9 A;  4JPM A;  1NZU A;  3ZG8 B;  4Y0O A;  2Y2P A;  1FOF A;  3HL9 A;  3N6I A;  3BFC A;  4RX2 A;  1PZO A;  2OSU A;  4OPQ A;  2V1Z A;  5EPH A;  4JF5 A;  2I72 A;  4JKT A;  2Y2J A;  5L2F A;  1BT5 A;  3PBO A;  3GRJ A;  1I2W A;  3MXR A;  4HEF A;  3HLC A;  3SH8 A;  4DDY A;  2RCX A;  1WE4 A;  1YLJ A;  3G2Z A;  3IT9 A;  2HDU A;  1JTD A;  3IXH A;  4PM5 A;  3QNB A;  2QMI A;  4PM7 A;  4B4X A;  4DE3 A;  1L0F A;  1IYP A;  3HBR A;  2IWC A;  1I5Q A;  2XF3 A;  4FH4 A;  5FI2 A;  1BLC A;  3UDF A;  4LV3 A;  3LO7 A;  1K6R A;  3IHB A;  2DCF A;  4S2N A;  3WS4 A;  3SH7 A;  5F83 A;  2IWD A;  5J8X A;  2Z2L B;  3G35 A;  4BL3 A;  3ZG0 A;  3CG5 A;  1CK3 A;  1Q2Q A;  1RP5 A;  3VP3 A;  3OPL A;  2X02 A;  3TG9 A;  3ZG5 A;  3HLW A;  2HP9 A;  4EWF A;  4BD0 A;  3UDX A;  1W5D A;  4F94 A;  4S2N C;  1FCM A;  1K4F A;  1LHY A;  4JLF A;  4E3J A;  2H0Y A;  2GDN A;  3QHY A;  4PM6 A;  4X6T A;  3FWL A;  4WMC D;  1KE3 A;  4GDB A;  4U0T A;  5GLD A;  3HLG A;  2Y2O A;  1IEL A;  2EXA A;  4YFM A;  1WYC A;  4DXB A;  4C3Q A;  1KDW A;  1FR1 A;  1PYY A;  4KZ5 A;  3IWI A;  4NK3 A;  2J8Y A;  1ESI A;  4GD6 A;  3DWZ A;  5CEB A;  3VMA A;  5FQI A;  1CEG A;  1M6K A;  5GLB A;  3HLF A; 
#chains in the Genus database with same CATH topology
 1UGU A;  3LIC A;  1GHI A;  1S1Z A;  4BBT A;  4EBP A;  4PKY A;  3BQ8 A;  3T1X A;  2KX6 A;  4QU3 A;  4BBV A;  1OTB A;  3GR2 A;  3VP2 A;  3JYI A;  3D4F A;  3TW8 A;  1K56 A;  1N9L A;  2PHY A;  2JKG A;  4HP9 A;  5HL1 A;  1OT6 A;  1MY8 A;  4CJN A;  2W3G A;  2HPB A;  5DFY A;  3ZYT A;  4OQ0 A;  3RH8 B;  4U0X A;  1XPB A;  4I39 A;  4CPK A;  3PBT A;  4G3K A;  2JE5 A;  4QPR A;  3LID A;  3VE3 A;  4BD1 A;  5TGF A;  3OPH A;  4LV2 A;  2WKP A;  4OON A;  4XUZ A;  3UY6 A;  2XH9 A;  4JXS A;  5EVI A;  3ZQ5 A;  2R9W A;  4XXR A;  2WGV A;  3FG8 A;  1LT0 A;  3N8L A;  3V50 A;  3MFX A;  1LLB A;  3V3R A;  1N9B A;  4R0Q A;  2WGW A;  1LI9 A;  4Z9Q A;  1YPR A;  3FKW A;  3B3X A;  5KSC A;  4WM9 A;  3QNC A;  5IS1 A;  4E3L A;  2ZMV A;  3CUE C;  3HJI A;  1FIK A;  2JKT M;  2JBF A;  3E2K A;  1FIL A;  1L0E A;  1IYQ A;  2IA2 A;  1PI4 A;  2HV1 A;  3G31 A;  4NKP A;  5HAR A;  1YMX A;  3CJM A;  1K55 A;  2I9V A;  3UO9 A;  2VA0 A;  4HBU A;  4EER A;  4UA7 A;  5GLC A;  1D06 A;  1K57 C;  4CLC A;  3TOI A;  3IXB A;  1SKF A;  3EOI A;  5G4Z A;  1A0K A;  2XFT A;  2PDR A;  1S6R A;  1W8Q A;  4N92 A;  3WS1 A;  4E3I A;  4MN6 A;  4EQI A;  1JVJ A;  3CZD A;  2DNS A;  3IX4 A;  2X71 A;  3HCY A;  3M2K A;  5CHJ A;  4GW9 A;  2C5W B;  4K0X A;  2V20 A;  3T4L A;  1X0O A;  1YLY A;  2XFS A;  3TE8 A;  5HAQ A;  1S1Y A;  1VEU B;  3M6B A;  4ARZ A;  2ZQD A;  4R6L A;  2KLI A;  4OP8 A;  1SCW A;  5CTM A;  5EVL A;  1CEF A;  2B95 A;  1F9I A;  2EX2 A;  3OBF A;  4X1M A;  2VLG A;  3IF6 C;  3MXQ A;  4II7 A;  3IWQ A;  3UPO A;  2WKQ A;  1F5M A;  1GSV A;  3MFD A;  4OPY A;  3VOY A;  3HJK A;  3ZNY A;  4IVK A;  5HSQ A;  4DXC A;  3TSG A;  2D02 A;  2WKH A;  1IOU A;  1ZHH B;  1ERO A;  3IF6 B;  4PM9 A;  5AVE A;  1IKI A;  2GJ3 A;  3CPT B;  4HJ3 A;  1H8Z A;  4WUJ A;  1BUL A;  4GLQ A;  5HAP A;  1BLS A;  4OQI A;  4I3I A;  2MJ6 A;  3DAV A;  3KYQ A;  1PWD A;  1VET B;  4HES A;  1KE4 A;  4B9O A;  2X01 A;  4HJ6 A;  2E8J A;  4AFI A;  2ZD8 A;  4JGR A;  4OPZ A;  2M7U A;  1KVL A;  1JWV A;  4OOL A;  2O9C A;  3MQQ A;  2VKS A;  3KYZ A;  4KG6 A;  1MPL A;  1Y4O A;  4BEN A;  5DTK A;  1N9N A;  2J9P A;  4Y0T A;  5CXW A;  2V8C A;  4E3O A;  3MKE A;  2ZC7 A;  2EXB A;  1OTA A;  4JGP A;  5HDS A;  2ZQ8 A;  3BJN A;  5FEF A;  4FD8 A;  1T1C A;  1ERQ A;  1EWZ A;  3PHY A;  3LR4 A;  1MWT A;  3BY9 A;  3HVF A;  5EEC A;  3S1Y A;  2O99 A;  1FR6 A;  3IH8 A;  5I94 A;  1SKO A;  5U47 A;  3OLO A;  4B4Z A;  2ZMA A;  2FFY A;  4MEZ A;  3Q1F A;  5KIZ A;  5CGW A;  1ERM A;  4KZB A;  5EVE A;  4LRX C;  3ZGA B;  3F1P A;  4LRY C;  5BOH A;  4KG5 A;  2HF6 A;  3LFV A;  1KGE A;  1DP8 A;  1VQQ A;  5FA7 A;  2H5S A;  2V9A A;  2P9V A;  5GHY A;  3C4P A;  3ZFZ A;  3GV9 A;  4IBX A;  2A24 B;  2ZM0 A;  3UN7 A;  1OT9 A;  4Y2F A;  4Y17 A;  1TD5 A;  4KG2 A;  3U2A A;  4FTX A;  5E2E A;  4HBT A;  3RXX A;  3VP4 A;  1YT4 A;  2VJW A;  3FPV A;  1KGG A;  1LL5 A;  2EX8 A;  3T1R A;  3ZCZ A;  4JXW A;  5HFO A;  2HDS A;  4R4S A;  3UNW A;  3NUL A;  1W8Y A;  3IX3 A;  1S4S A;  3NCK A;  3SZT A;  3L9K A;  2BG1 A;  4EXO A;  3FV7 A;  3F1N B;  2RL3 A;  4Y0U A;  3UE1 A;  3G2Y A;  1JTG A;  3NC8 A;  5F1G A;  3LR3 A;  3PBN A;  1SHV A;  4WYY A;  1L0G A;  1K54 C;  1GCE A;  3NEC A;  5GHX A;  5DTT A;  3ZG7 B;  2Y2N A;  3NBL A;  1BSG A;  4R23 A;  2B02 A;  4QJG A;  3N7W A;  1MKI A;  2WZX A;  4F3L B;  3HRE A;  1PZP A;  4EEP A;  3KSI A;  2W0N A;  3BEC A;  1ZTU A;  2WK0 A;  4D2O A;  5FEG A;  3BFG A;  1GHP A;  3BQA A;  1S67 L;  1Y28 A;  3IF5 A;  3ISG A;  4WF0 A;  4D60 A;  3OOV A;  5EE8 A;  2W3H A;  1NZU A;  2ZL1 B;  4Y0O A;  1FOF A;  3BFC A;  3CUE A;  4I3A A;  4I38 A;  4MCW A;  4JKT A;  5F6A A;  2Y2J A;  3GRJ A;  3HLC A;  1WE4 A;  3IXH A;  4PM5 A;  4B4X A;  4FH4 A;  2XF3 A;  4JGO A;  2G7U A;  3WS4 A;  2VGL S;  3ZG0 A;  4RQ9 A;  2X02 A;  3TG9 A;  3ZG5 A;  4UQI S;  3K3C A;  4BD0 A;  4LPZ A;  1W5D A;  4F94 A;  2NUT C;  4JLF A;  4E3J A;  2ZOI A;  2XSS A;  4U0T A;  3HLG A;  2Y2O A;  2EXA A;  4DXB A;  4PAU A;  3UB8 A;  4NK3 A;  4GD6 A;  1ESI A;  3W2Z A;  4B93 A;  5FQI A;  1XJ6 A;  1CEG A;  1BLH A;  3HLF A;  3LEQ A;  3BM6 A;  5FSR A;  1VB6 A;  5CRF A;  4R3J A;  2P08 A;  2OAP 1;  4EQ1 A;  2HGV A;  3G32 A;  3NDE A;  2PBY A;  3KSH A;  4WZ5 C;  3GMW A;  2VK3 A;  1XA7 A;  1VM1 A;  4HH3 A;  4N1X A;  3UPN A;  3UMD A;  4O0P A;  4GDN A;  2EFU A;  4IBR A;  1PNE A;  2Y55 A;  1YQS A;  5E2G A;  3IF6 A;  3O3V A;  3R7W B;  1FCN A;  3A3I A;  5JYO A;  3LIE A;  3F1O B;  3PBQ A;  1HLU P;  4K08 A;  4FOF A;  3NOT C;  1OTD A;  4EBN A;  3PAE A;  2INW A;  5HD5 A;  1LL8 A;  1YLZ A;  3MSH A;  3EEA A;  4L0L A;  3EQU A;  1W79 A;  2HDQ A;  1RGY A;  3Q07 A;  1ACF A;  3OPR A;  1LSX A;  3PYP A;  3S7Q A;  1CQA A;  4GS9 B;  4BL2 A;  1P9W A;  3G4P A;  4S2J A;  4XT2 B;  2XEP A;  3GQZ A;  1W63 Q;  4LGW A;  3LY4 A;  5FAT A;  4E3K A;  1ES3 A;  4Y5F A;  4ZAM A;  3P98 A;  4KUO A;  4DE2 A;  5HX9 A;  4IUH A;  2NUP C;  3IS2 A;  1BYW A;  3HUM A;  3V5M A;  2Y2I A;  1E25 A;  3NDG A;  3PR6 A;  1FSW A;  4NET A;  2HJE A;  2XLN A;  3RFB A;  4I5S A;  1PWG A;  3FKV A;  1RGZ A;  2ZC3 B;  2XK1 A;  2PT7 A;  4GZB A;  5L10 A;  2HP5 A;  4ID4 A;  3BW6 A;  4QY6 A;  5I5L A;  4KZ8 A;  2J3W A;  4KZ3 A;  3B33 A;  2ZC5 B;  5M1A A;  3QP6 A;  2V8F A;  2VGJ A;  3U4L P;  1TS7 A;  3VP0 A;  3SS5 A;  4UAA A;  1JWZ A;  4H6J B;  4L9F A;  4P87 A;  4CQH A;  2O9A A;  1PW1 A;  3VFH A;  1ES4 A;  3Q81 A;  3MKF A;  2YKF A;  3BFE A;  3SW1 A;  3BEB A;  4KQR A;  4NXG A;  5HPI A;  4Q0J A;  5CHU A;  3FZC A;  3V39 A;  1P0Z A;  1PI5 A;  3ICY A;  4GNU A;  4GD8 A;  3LEZ A;  5DF9 A;  4F3L A;  1FSY A;  1OME A;  4WEJ A;  4Y15 A;  1C3B A;  2R9X A;  4OOM A;  5E2F A;  4RVA A;  2O9B A;  3I7J A;  1STZ A;  5FQ9 A;  3O88 A;  2OV5 A;  4GJ4 A;  5FDS A;  3BYD A;  4P6B A;  3O86 A;  1FCO A;  4P6Z S;  4Y13 A;  4Q0H A;  4X25 A;  1YKD A;  3AGF A;  2ZJ9 A;  5FQK A;  1OTI A;  3OCL A;  1ZG6 A;  3JVV A;  1XXM A;  2P04 A;  4NXB A;  3IH9 A;  2PBD P;  4KQQ A;  1CJF A;  2QHK A;  1YM1 A;  4FUW A;  2XRO A;  2PU4 A;  3UPP A;  2W27 A;  4OQG A;  2JC7 A;  4MN5 A;  1AWI A;  2YKH A;  3A3F A;  4DE1 A;  2OWJ A;  4OPR A;  4WBG A;  3H82 B;  1YLT A;  4ESP A;  4DKI A;  2EA9 A;  1NLZ A;  3IHA A;  2Y2L A;  3E98 A;  3T4T A;  4QB8 A;  2GX5 A;  2ZC4 B;  2HZ5 A;  4C6Y A;  3DTE A;  5J4E A;  5EUA A;  4G3W A;  3VOZ A;  4BWI A;  1KOU A;  2XD5 A;  1XP4 A;  3T4O A;  2W1T A;  5HDC A;  2ZQC A;  5F68 A;  3GEC A;  2VZW A;  2BTF P;  2V0W A;  3HUO A;  4OVD A;  1QMF A;  3WWX A;  3BFD A;  3VE4 A;  2D01 A;  4OKP A;  1V9Z A;  3BFF A;  5AQB A;  3O5Y A;  4OQH A;  1K6S A;  3UB5 P;  1MWU A;  4ETZ A;  2Y2H A;  5FI7 A;  5TFQ A;  2EFX A;  4XUX A;  2L0W A;  3IWO A;  4HJ4 A;  1P9R A;  4I3J A;  5FQM A;  2XDM A;  2P74 A;  5A90 A;  4L9G A;  5FAO A;  4HQA A;  3A3D A;  2ZM2 A;  4ETX A;  1TEM A;  2OOL A;  3C7U A;  4Q0I A;  4DDS A;  5DKL A;  2WUQ A;  1LSV A;  4Z1W A;  4KZ7 A;  3AGD A;  5FAS A;  4E04 A;  2ZQ9 A;  3E0Y A;  5DF8 A;  1MWR A;  4WZ4 A;  5DF7 A;  4DN0 A;  1GA9 A;  4E3N A;  3JVU A;  1XJ4 A;  1Z6F A;  1ESU A;  3DBA A;  1CF0 A;  5AVF A;  3LIB A;  4GCZ A;  3PBS A;  2PAV P;  5L09 A;  2QPN A;  4GB7 A;  1NRJ A;  2ZQA A;  3S22 A;  2R78 A;  3MZE A;  2OLV A;  3ZG8 B;  2XA7 S;  3LIF A;  2V1Z A;  5EPH A;  4KUK A;  5L2F A;  1I2W A;  3MXR A;  2RCX A;  1YLJ A;  3G2Z A;  2QMI A;  3T4K A;  3VV4 A;  2IWC A;  5FI2 A;  3UDF A;  4LV3 A;  2Y79 A;  3UB7 A;  3E4O A;  4S2N A;  3SH7 A;  2IWD A;  5EM1 A;  3G35 A;  3QP4 A;  3CG5 A;  3KO6 A;  1Q2Q A;  2HJ9 C;  3VP3 A;  3OPL A;  4MN7 A;  3UDX A;  2H0Y A;  2GDN A;  4PM6 A;  1TS0 A;  4WMC D;  4BMW A;  5GLD A;  2PD7 A;  1IEL A;  4YFM A;  1WYC A;  2GNX A;  1ODV A;  3S7O A;  3DWZ A;  4L9E A;  5CEB A;  3VMA A;  1M6K A;  4S2O A;  1IFQ A;  4WEK A;  3BWL A;  3N8R A;  3FC7 A;  2ZC6 B;  3T1Q B;  4S2L A;  3GDI A;  3LGO A;  2Z2M B;  3QP1 A;  3G34 A;  4DRT A;  3H7W B;  4DMZ A;  3G30 A;  2ZM8 A;  3LR0 A;  5FQJ A;  2QWS A;  5FI6 A;  4OLG A;  5EOO A;  2QZ6 A;  3SH9 A;  3SOI A;  4S2M A;  5CHM A;  2V2F F;  4H8R A;  4P0M A;  2OWH A;  4HY8 A;  4BJP A;  5M18 A;  3T4S A;  5KMW A;  5DTS A;  3A0R A;  1S0W A;  4HOI A;  5A92 A;  4K0W A;  1SDE A;  2JKF A;  3V67 A;  5FAP A;  4DJ2 A;  3IX8 A;  3W4Q A;  3HLB A;  4YWZ A;  4LEN A;  1SDN A;  2ZBB A;  4K91 A;  4KEN B;  2DRW A;  2KOI A;  1RCJ A;  3A3E A;  4GKU A;  1O7E A;  5HL6 A;  1YLW A;  4UA6 A;  2PU2 A;  3MS6 A;  5G18 A;  3OZH A;  4BLM A;  2DMW A;  2Q9N A;  5EVI C;  1NY0 A;  3ZDJ A;  3WS2 A;  2WZZ A;  3RTY A;  1O07 A;  2ZMF A;  5HW3 A;  1ZKJ A;  2WKE A;  4U3T A;  1UWP X;  1KVM A;  1YMS A;  1NLY A;  1T1A A;  1PW8 A;  4CLC E;  2VV6 A;  3LIA A;  3BLS A;  1K57 A;  2QYB A;  3A0V A;  3LR5 A;  3OCN A;  1Q2P A;  2VGK A;  1VEU A;  4BBU A;  1N4O A;  3E2L A;  3UE6 A;  3WRT A;  4QY5 A;  1S66 L;  5F1F A;  1K55 C;  1LL9 A;  1XGJ A;  2WGW B;  2W1R A;  3WRZ A;  3Q82 A;  2QKP A;  1UWN X;  5CGX A;  5AJG A;  1MC0 A;  3VFF A;  3T4Q A;  3WS0 A;  1Y54 A;  4RYE A;  3W8K A;  4NEE D;  4ZBE A;  4WMC A;  1NYM A;  4CLC C;  4UHU A;  3MQ0 A;  4LV1 A;  4ME4 A;  2H28 A;  3KX0 X;  3BY8 A;  3WS5 A;  4QWO A;  4OLD A;  1XX2 A;  4X56 A;  2WAD A;  4OH0 A;  4BQM A;  4IUK A;  5E43 A;  1TVF A;  4JXG A;  2LB5 A;  5IU1 A;  3CPT A;  4CLC B;  5KSH A;  4KQD A;  3UB6 A;  1KGF A;  3NY4 A;  3OPP A;  1DY6 A;  2OAQ 1;  4FH2 A;  1VET A;  3C5A A;  4ZJ2 A;  2M7V A;  3TRC A;  1PWC A;  1K0K A;  4E6W A;  4EES A;  1G5U A;  2O0Y A;  5GLA A;  4LCL A;  2A2L A;  3ITB A;  4JXV A;  4RA7 A;  3ZG9 B;  5A93 A;  4ARZ B;  1W7F A;  5K5B A;  4LRZ E;  1XJ3 A;  2M1C A;  2K7S A;  2J9O A;  3MQO A;  3UDI A;  4PHT A;  1HD8 A;  4S2I A;  2WKI A;  4R3B A;  4Q8I A;  4O8G A;  1N9O A;  2JN7 A;  5KZH A;  2XRN A;  3UME A;  2GZA A;  1DRM A;  5DKK A;  1G68 A;  1YSP A;  3C2W A;  5CER A;  1L0D A;  3B42 A;  2VGL M;  3PTE A;  4S2K A;  3ITA A;  4WN5 A;  4UQI M;  4WEL A;  3C4O A;  3DTM A;  2W3E A;  3UE0 A;  4X68 A;  1TF1 A;  5TBM B;  1ES2 A;  4ZJ1 A;  1IYS A;  3P09 A;  2E8I A;  1T19 A;  4UEY A;  2PR5 A;  3E4P A;  3H7W A;  2CC1 A;  4CLC D;  2A24 A;  3A0S A;  1KDS A;  4Y3I A;  3E4Q A;  1MXO A;  1DP9 A;  5CEC A;  5HPF A;  4LFU A;  3DW0 A;  4O01 A;  1XGI A;  5M19 A;  4MMN A;  3F1N A;  3FYZ A;  5E2H A;  1W63 M;  5LBR A;  1H0M A;  3IXG A;  3Q7Z A;  1HZO A;  2C6W B;  2ZQ7 A;  3O87 A;  3MXS A;  1TDL A;  3V3S A;  1ZG4 A;  3A3J A;  4Y7P A;  1SKO B;  2JKR I;  1MBL A;  3EWK A;  3EGX C;  1DJA A;  2UV0 E;  2Y59 A;  4R1G A;  3PBR A;  2PYR A;  1E3U D;  1EI5 A;  2ZL1 A;  3CI6 A;  3F1P B;  3HLD A;  3MMH A;  4MBK A;  1K54 A;  1P97 A;  1AXB A;  2FFF B;  4OP5 A;  5HD3 A;  4KQO A;  5AQA A;  2ZOH A;  1ALQ A;  1ZC2 A;  3ZVT A;  1K25 A;  3HLE A;  2P9V B;  3GSG A;  1IYO A;  2EX6 A;  4O7D A;  4ZDX A;  4QHC A;  3RXW A;  1NYY A;  4KZ6 A;  4KZA A;  5DJT A;  1QME A;  2CMN A;  1HTZ A;  3NI9 A;  4JPM A;  2Y2P A;  3JPU A;  3HL9 A;  4RX2 A;  4EW7 A;  5EV0 A;  5EM0 A;  1YSQ A;  4NXF A;  2I72 A;  3PBO A;  4HEF A;  2KDK A;  3SH8 A;  4DDY A;  2HDU A;  3QNB A;  2FZ0 A;  4PM7 A;  5MC7 A;  1L0F A;  3NOU C;  1I5Q A;  1BLC A;  3LO7 A;  1K6R A;  3IHB A;  2DCF A;  5F83 A;  5J8X A;  4LLO B;  2Z2L B;  2J80 A;  2W3F A;  1CK3 A;  2K2N A;  2WKR A;  5HDD A;  1PFL A;  3HLW A;  2HP9 A;  1V9Y A;  1XFN A;  4G3V A;  1LHY A;  3QHY A;  4X6T A;  3FWL A;  4YNR A;  3R7W A;  1PYY A;  4KZ5 A;  3F1O A;  2J8Y A;  3CAX A;  4HP4 A;  4PKY G;  2WGI A;  1TDG A;  1L2S A;  5FDH A;  1LI0 A;  3Q7V B;  2JHE A;  4WLA A;  1D7E A;  3T4J A;  3MZF A;  4EUZ A;  3W4O A;  1BZA A;  1VHM A;  4RX3 A;  3EGD C;  2Y4A A;  4WZ5 A;  3SS4 A;  1IEM A;  4R38 A;  2J3T C;  4M3K A;  4KZ9 A;  1FQG A;  1E4D A;  3AGE A;  4PMA A;  4A5R A;  4EBL A;  1J3W A;  4IVI A;  1BLP A;  1YLP A;  2Z6D A;  5FL3 A;  4GHI B;  4GS9 A;  1WA9 A;  1IKG A;  1NZO A;  1GSX A;  4P85 A;  4XT2 A;  4R3A A;  4JBF A;  4P6Z M;  1K38 A;  1XA1 A;  3R4K A;  3IBJ A;  2PRF A;  5L8M A;  1MZU A;  2WYX A;  3CIT A;  3T1S A;  2W3D A;  1HVB A;  3VOL A;  5F82 A;  5D3O A;  4N9K A;  1E3U A;  1D1J A;  1H3Q A;  3C38 A;  2K31 A;  3IQA A;  4QD4 A;  3G6O A;  1H8M A;  1MKM A;  2Y91 A;  3MZD A;  2V1A A;  4DE0 A;  3CMZ A;  3QP8 A;  2V1B A;  1NJ4 A;  3BLM A;  2A49 A;  5DJU A;  5TBM A;  2G2U A;  3D72 A;  4MNR A;  4ZJ3 A;  4MLL A;  5A8B A;  5L07 A;  5CED A;  4IJG A;  2B18 A;  5IT5 A;  4IHQ A;  4LV0 A;  3ULF A;  4HIA A;  3B47 A;  1XJ2 A;  2V0U A;  4YIN A;  2EWV A;  1YAX A;  4H6J A;  2JKT I;  4C75 A;  2XQZ A;  4ZTK A;  4R4R A;  5F5Y A;  4HNB A;  1I2S A;  1G6O A;  1KE0 A;  2Y2Q A;  1G28 A;  5FQQ A;  2IWB A;  4DJ3 A;  2BLS A;  5CTN A;  3BRM A;  3LUQ A;  1S4R A;  3VP1 A;  3OC2 A;  5HZH A;  1T1B A;  3LI9 A;  3IS2 B;  3S7P A;  2HP6 A;  1XKZ A;  3ZVW A;  2J3T D;  3C7V A;  2EWW A;  5C5K A;  3MBZ A;  3W4P A;  2G2W A;  3PXP A;  4X53 A;  4ZRR A;  3ZHH A;  1OJG A;  4N9L A;  3M2J A;  2PYP A;  5J3W A;  5G4Y A;  1BTL A;  4UA9 A;  3IXD A;  4LCM A;  2PD8 A;  4JF6 A;  1G6A A;  3VSL A;  4JF4 A;  3ZNT A;  5DFX A;  2VEA A;  1ES5 A;  3LI8 A;  5JYP A;  1F98 A;  4NG2 A;  2QJ7 A;  2LB9 A;  5GHZ A;  3N8S A;  3H82 A;  2H0T A;  3H9W A;  1OPX A;  3HUN A;  5CGS A;  2Y8H A;  4B88 A;  4MDZ A;  4HH2 A;  4YOF A;  1H5X A;  3P7N A;  3TJZ C;  3T12 B;  3DWK A;  3QP2 A;  4FCF A;  1T18 A;  4X1L A;  1CI8 A;  1OTE A;  3KYE A;  4R70 A;  5A91 A;  1K4E A;  1PIO A;  2XA7 M;  3S4X A;  4M4X A;  3D3O A;  1NWZ A;  1U60 A;  2PR6 A;  3NIA A;  4E3M A;  2ZLY A;  3EQV A;  4WL9 A;  3SS3 A;  1XFQ A;  5CX7 A;  4E6X A;  3K2N A;  1JWP A;  4X69 A;  5J7E A;  4X55 A;  2VV8 A;  3K3D A;  3L7H A;  3N4I A;  4FSF A;  5TR7 A;  1WYB A;  4MBF A;  2EX9 A;  1NXY A;  5DVA A;  2B5R A;  1ONG A;  1NRF A;  5EVI B;  5HAI A;  2QJ5 A;  2H10 A;  2VX8 A;  5F69 A;  2Y2M A;  3Q7V A;  2HDR A;  4KZ4 A;  2VV7 A;  3NJA A;  2OLU A;  1DJB A;  2XD1 A;  2J7V A;  3P01 A;  1GA0 A;  4EU0 A;  5EOE A;  2Y2G A;  4GOG A;  2JCH A;  4HHD A;  4GHI A;  5FAQ A;  1Z09 A;  2AVX A;  4OOY A;  3FPW A;  3LY3 A;  2Y2K A;  3KSF A;  5AQ7 A;  1TS6 A;  3MF0 A;  2XR0 A;  1PRQ A;  4HI4 A;  1DJC A;  4S2P A;  1K56 D;  5GL9 A;  3C8C A;  1TS8 A;  4EET B;  3GVB A;  3C30 A;  3DTI A;  3RJU A;  1MWS A;  3LCE A;  3GTC A;  2L1M A;  2A3U A;  2W1T B;  2BAS A;  2WAF A;  3NOP C;  3T50 A;  4DF6 A;  1SZV A;  1J9M A;  5TJJ A;  3QP5 A;  2JKR M;  4EUV A;  3VSK A;  2ACG A;  2L4R A;  5HWW A;  4EEU A;  4PM8 A;  4N1H A;  4IED A;  2Q0O A;  4GN2 A;  5IHV A;  1ONH A;  1L3L A;  4EV4 A;  3KSG A;  2Q9M A;  3UE3 A;  3EEH A;  2XGN A;  4PPR A;  3DTK A;  2FH5 A;  1F2K A;  1GHM A;  1GSW A;  2WAE A;  3IBR A;  5EVI D;  1M40 A;  1EW0 A;  3M6H A;  5AQ9 A;  2Z6C A;  2UWX A;  3NHQ A;  3PAG A;  3MJQ A;  1BUE A;  1H8Y A;  4MBH A;  3MR0 A;  5HWV A;  1CI9 A;  4NXE A;  3N6I A;  1PZO A;  2OSU A;  4OPQ A;  3UB9 A;  4JF5 A;  1BT5 A;  3LYX A;  3D9Y A;  3IT9 A;  1JTD A;  4DE3 A;  1IYP A;  3HBR A;  3CLO A;  3S7N A;  4BL3 A;  5HWT A;  1RP5 A;  3CWF A;  4EWF A;  3CHW P;  5EFW A;  4S2N C;  1FCM A;  1K4F A;  1KE3 A;  4GDB A;  4JGQ A;  4C3Q A;  1DP6 A;  1KDW A;  1FR1 A;  3IWI A;  2P7J A;  1JNU A;  1LSW A;  1OJ5 A;  5GLB A; 
#chains in the Genus database with same CATH homology
 1TDG A;  4S2O A;  1L2S A;  5FDH A;  1LI0 A;  3Q7V B;  3BM6 A;  4WEK A;  5FSR A;  3MZF A;  1GHI A;  4EUZ A;  5CRF A;  4R3J A;  3W4O A;  1BZA A;  4EBP A;  4RX3 A;  3N8R A;  2Y4A A;  4WZ5 A;  2ZC6 B;  4S2L A;  3SS4 A;  1IEM A;  2Z2M B;  4QU3 A;  3GR2 A;  4DRT A;  3G34 A;  3G32 A;  4M3K A;  3NDE A;  2PBY A;  3VP2 A;  4KZ9 A;  4WZ5 C;  1FQG A;  3G30 A;  3GMW A;  1XA7 A;  3JYI A;  1VM1 A;  3D4F A;  1E4D A;  3AGE A;  1K56 A;  4PMA A;  2ZM8 A;  5FQJ A;  4N1X A;  3UPN A;  4A5R A;  4EBL A;  4GDN A;  5FI6 A;  2EFU A;  4OLG A;  4IBR A;  5EOO A;  2QZ6 A;  3SH9 A;  3SOI A;  2Y55 A;  4IVI A;  1YQS A;  5E2G A;  1BLP A;  3IF6 A;  1YLP A;  4S2M A;  5HL1 A;  3O3V A;  1FCN A;  3A3I A;  5CHM A;  1MY8 A;  4CJN A;  5JYO A;  2V2F F;  3PBQ A;  1IKG A;  1NZO A;  4H8R A;  4P0M A;  4P85 A;  2HPB A;  4BJP A;  4JBF A;  5M18 A;  4EBN A;  3PAE A;  4OQ0 A;  5KMW A;  1K38 A;  5DTS A;  4U0X A;  1XA1 A;  1XPB A;  1S0W A;  2WYX A;  4CPK A;  1YLZ A;  3PBT A;  1HVB A;  2JE5 A;  5A92 A;  4K0W A;  5F82 A;  4BD1 A;  1SDE A;  5D3O A;  4N9K A;  5TGF A;  5FAP A;  1E3U A;  3OPH A;  4LV2 A;  3W4Q A;  3HLB A;  4OON A;  4L0L A;  3IQA A;  4LEN A;  1SDN A;  3EQU A;  1W79 A;  2HDQ A;  4QD4 A;  4K91 A;  4KEN B;  4XUZ A;  3UY6 A;  2DRW A;  1RGY A;  3Q07 A;  2XH9 A;  3OPR A;  2Y91 A;  4JXS A;  3MZD A;  5EVI A;  4DE0 A;  1RCJ A;  3A3E A;  3CMZ A;  4GKU A;  1O7E A;  1YLW A;  4UA6 A;  4BL2 A;  1NJ4 A;  2PU2 A;  2A49 A;  2R9W A;  3BLM A;  3G4P A;  4XXR A;  5G18 A;  2WGV A;  3N8L A;  3OZH A;  4BLM A;  4S2J A;  3V50 A;  2XEP A;  1LLB A;  2G2U A;  2Q9N A;  5EVI C;  1NY0 A;  3GQZ A;  3V3R A;  1N9B A;  3LY4 A;  4MNR A;  5FAT A;  1ES3 A;  4ZJ3 A;  3ZDJ A;  4E3K A;  4R0Q A;  2WGW A;  1LI9 A;  4ZAM A;  3WS2 A;  3P98 A;  4MLL A;  2WZZ A;  5CED A;  4Z9Q A;  3FKW A;  3B3X A;  1O07 A;  4DE2 A;  5HX9 A;  4WM9 A;  5HW3 A;  5KSC A;  1ZKJ A;  3QNC A;  2WKE A;  4E3L A;  3HUM A;  3V5M A;  4LV0 A;  4U3T A;  2Y2I A;  1E25 A;  1KVM A;  2JBF A;  1YMS A;  3E2K A;  3NDG A;  1L0E A;  1FSW A;  1IYQ A;  4NET A;  2XLN A;  4YIN A;  1PW8 A;  1PI4 A;  3G31 A;  5HAR A;  4C75 A;  2XQZ A;  4ZTK A;  4R4R A;  1YMX A;  3CJM A;  1I2S A;  1K55 A;  1PWG A;  3BLS A;  3FKV A;  1KE0 A;  2Y2Q A;  1K57 A;  5FQQ A;  1RGZ A;  2IWB A;  2ZC3 B;  3OCN A;  2XK1 A;  1Q2P A;  3UO9 A;  2VGK A;  2BLS A;  4HBU A;  5CTN A;  1N4O A;  3E2L A;  3BRM A;  4UA7 A;  4GZB A;  4QY5 A;  3WRT A;  5F1F A;  1K55 C;  5GLC A;  1LL9 A;  1XGJ A;  2WGW B;  3WRZ A;  3Q82 A;  1K57 C;  3VP1 A;  2HP5 A;  3OC2 A;  4ID4 A;  5CGX A;  3VFF A;  3TOI A;  3WS0 A;  3IXB A;  1Y54 A;  1SKF A;  4RYE A;  2XFT A;  3W8K A;  1S6R A;  4QY6 A;  1W8Q A;  4N92 A;  4KZ8 A;  4ZBE A;  4WMC A;  4KZ3 A;  1NYM A;  3WS1 A;  4E3I A;  4EQI A;  1JVJ A;  2HP6 A;  3CZD A;  2ZC5 B;  1XKZ A;  2DNS A;  4UHU A;  5M1A A;  3ZVW A;  2VGJ A;  3C7V A;  4LV1 A;  3VP0 A;  3SS5 A;  4UAA A;  3WS5 A;  2X71 A;  1JWZ A;  3MBZ A;  3W4P A;  4OLD A;  2G2W A;  1XX2 A;  4X56 A;  3M2K A;  5CHJ A;  4X53 A;  2WAD A;  2C5W B;  4K0X A;  2V20 A;  4P87 A;  4OH0 A;  4BQM A;  3ZHH A;  1PW1 A;  5E43 A;  1ES4 A;  1TVF A;  1YLY A;  2XFS A;  3MKF A;  3Q81 A;  3VFH A;  5HAQ A;  4JXG A;  3M6B A;  4N9L A;  3BFE A;  2ZQD A;  3M2J A;  3BEB A;  1BTL A;  4UA9 A;  3IXD A;  4KQR A;  4OP8 A;  1SCW A;  5CTM A;  5EVL A;  1CEF A;  5CHU A;  3FZC A;  4LCM A;  5KSH A;  3V39 A;  2EX2 A;  1PI5 A;  4GNU A;  4JF6 A;  1G6A A;  4GD8 A;  3IF6 C;  1KGF A;  3NY4 A;  4JF4 A;  3VSL A;  3LEZ A;  5DF9 A;  3ZNT A;  3OPP A;  1DY6 A;  1FSY A;  1OME A;  4FH2 A;  4WEJ A;  1C3B A;  1ES5 A;  3IWQ A;  2R9X A;  4OOM A;  3UPO A;  5E2F A;  5JYP A;  3C5A A;  4RVA A;  4ZJ2 A;  3I7J A;  3MFD A;  1PWC A;  4E6W A;  4OPY A;  3VOY A;  5FQ9 A;  3O88 A;  5GLA A;  2OV5 A;  4LCL A;  5GHZ A;  3ITB A;  3ZNY A;  3N8S A;  4JXV A;  3BYD A;  2H0T A;  4P6B A;  4RA7 A;  4IVK A;  3ZG9 B;  3O86 A;  1FCO A;  3HUN A;  5CGS A;  4B88 A;  5A93 A;  4DXC A;  3TSG A;  2WKH A;  1ERO A;  3IF6 B;  1W7F A;  1H5X A;  4PM9 A;  1IKI A;  3DWK A;  3AGF A;  4FCF A;  1CI8 A;  2ZJ9 A;  1H8Z A;  5A91 A;  1BUL A;  5FQK A;  3OCL A;  5HAP A;  1BLS A;  1ZG6 A;  1K4E A;  2J9O A;  3UDI A;  1PIO A;  3S4X A;  1HD8 A;  4OQI A;  1XXM A;  1U60 A;  4S2I A;  2WKI A;  4R3B A;  1PWD A;  3NIA A;  3IH9 A;  4E3M A;  4Q8I A;  4KQQ A;  5KZH A;  2ZLY A;  3EQV A;  4HES A;  1KE4 A;  1YM1 A;  3SS3 A;  2X01 A;  4E6X A;  2PU4 A;  3UPP A;  1G68 A;  1JWP A;  4X69 A;  4OQG A;  2JC7 A;  4X55 A;  5TR7 A;  4FSF A;  2ZD8 A;  3N4I A;  5CER A;  1WYB A;  4OPZ A;  4MBF A;  3A3F A;  4DE1 A;  1KVL A;  2EX9 A;  1JWV A;  1NXY A;  4OOL A;  4OPR A;  4WBG A;  5DVA A;  1YLT A;  2B5R A;  1L0D A;  1ONG A;  3PTE A;  4KG6 A;  4S2K A;  4DKI A;  3ITA A;  1NRF A;  1MPL A;  5EVI B;  3IHA A;  2Y2L A;  5HAI A;  4BEN A;  2H10 A;  4WEL A;  5DTK A;  2WGI A;  2J9P A;  3C4O A;  4Y0T A;  5CXW A;  3DTM A;  2Y2M A;  3Q7V A;  3UE0 A;  4X68 A;  4QB8 A;  2HDR A;  4KZ4 A;  4E3O A;  3MKE A;  1ES2 A;  2ZC4 B;  2ZC7 A;  4ZJ1 A;  2EXB A;  1IYS A;  3P09 A;  4C6Y A;  2E8I A;  5EUA A;  2OLU A;  1DJB A;  2ZQ8 A;  2XD1 A;  3VOZ A;  2J7V A;  4FD8 A;  2XD5 A;  1XP4 A;  1GA0 A;  2CC1 A;  1ERQ A;  1EWZ A;  2ZQC A;  5EOE A;  1KDS A;  2Y2G A;  1MWT A;  1BLH A;  4GOG A;  3HUO A;  2JCH A;  3HVF A;  4OVD A;  5EEC A;  3S1Y A;  1MXO A;  1FR6 A;  3IH8 A;  5CEC A;  5I94 A;  1QMF A;  3WWX A;  3DW0 A;  5FAQ A;  3BFD A;  1XGI A;  4OKP A;  5U47 A;  4B4Z A;  2ZMA A;  2FFY A;  3BFF A;  5AQB A;  4OOY A;  4MEZ A;  3Q1F A;  5CGW A;  3LY3 A;  2Y2K A;  5M19 A;  1ERM A;  4KZB A;  5AQ7 A;  4OQH A;  3ZGA B;  1K6S A;  2XR0 A;  1MWU A;  5BOH A;  4KG5 A;  1DJC A;  4S2P A;  1K56 D;  5GL9 A;  2Y2H A;  5FI7 A;  3FYZ A;  2EFX A;  5E2H A;  5TFQ A;  1KGE A;  4XUX A;  3GVB A;  3IWO A;  3RJU A;  1VQQ A;  5FQM A;  1MWS A;  2XDM A;  2H5S A;  3LCE A;  3GTC A;  2P74 A;  5FA7 A;  3IXG A;  3Q7Z A;  2A3U A;  1HZO A;  2C6W B;  2P9V A;  5GHY A;  2WAF A;  3C4P A;  3ZFZ A;  4DF6 A;  2ZQ7 A;  1J9M A;  3GV9 A;  4IBX A;  3O87 A;  5A90 A;  2ZM0 A;  3UN7 A;  3MXS A;  5FAO A;  1TDL A;  4KG2 A;  3V3S A;  3VSK A;  5E2E A;  3A3D A;  2ZM2 A;  4HBT A;  1ZG4 A;  3A3J A;  4Y7P A;  3RXX A;  3VP4 A;  1YT4 A;  4PM8 A;  4N1H A;  1MBL A;  4IED A;  4GN2 A;  1KGG A;  1TEM A;  1DJA A;  3C7U A;  1ONH A;  5IHV A;  4DDS A;  2Y59 A;  1LL5 A;  2EX8 A;  3ZCZ A;  4R1G A;  4JXW A;  3PBR A;  5HFO A;  4EV4 A;  2WUQ A;  2HDS A;  2Q9M A;  4R4S A;  3UE3 A;  3UNW A;  2XGN A;  1W8Y A;  1E3U D;  1EI5 A;  3HLD A;  4PPR A;  3NCK A;  4KZ7 A;  1GHM A;  4MBK A;  1K54 A;  2BG1 A;  3AGD A;  1AXB A;  2FFF B;  4OP5 A;  3FV7 A;  4KQO A;  5AQA A;  2RL3 A;  4Y0U A;  2WAE A;  3UE1 A;  3G2Y A;  5FAS A;  1JTG A;  1ALQ A;  1ZC2 A;  3NC8 A;  5F1G A;  3ZVT A;  2ZQ9 A;  5EVI D;  5DF8 A;  1K25 A;  1MWR A;  3PBN A;  1SHV A;  4WZ4 A;  4WYY A;  5DF7 A;  3HLE A;  4E3N A;  1GA9 A;  1L0G A;  1K54 C;  1GCE A;  1M40 A;  2P9V B;  1Z6F A;  5DTT A;  5GHX A;  2Y2N A;  3NBL A;  1BSG A;  3ZG7 B;  4R23 A;  1ESU A;  3GSG A;  4QJG A;  3N7W A;  1IYO A;  1MKI A;  2WZX A;  3M6H A;  2EX6 A;  3HRE A;  5AQ9 A;  1PZP A;  4O7D A;  4ZDX A;  3BEC A;  4QHC A;  2WK0 A;  3RXW A;  1NYY A;  4D2O A;  2UWX A;  3PAG A;  4KZ6 A;  3BFG A;  1GHP A;  4KZA A;  3PBS A;  1BUE A;  3IF5 A;  2QPN A;  4GB7 A;  1H8Y A;  3ISG A;  4MBH A;  1QME A;  2ZQA A;  3S22 A;  1CI9 A;  5EE8 A;  1HTZ A;  3MZE A;  2OLV A;  3NI9 A;  4JPM A;  1NZU A;  3ZG8 B;  4Y0O A;  2Y2P A;  1FOF A;  3HL9 A;  3N6I A;  3BFC A;  4RX2 A;  1PZO A;  2OSU A;  4OPQ A;  2V1Z A;  5EPH A;  4JF5 A;  2I72 A;  4JKT A;  2Y2J A;  5L2F A;  1BT5 A;  3PBO A;  3GRJ A;  1I2W A;  3MXR A;  4HEF A;  3HLC A;  3SH8 A;  4DDY A;  2RCX A;  1WE4 A;  1YLJ A;  3G2Z A;  3IT9 A;  2HDU A;  1JTD A;  3IXH A;  4PM5 A;  3QNB A;  2QMI A;  4PM7 A;  4B4X A;  4DE3 A;  1L0F A;  1IYP A;  3HBR A;  2IWC A;  1I5Q A;  2XF3 A;  4FH4 A;  5FI2 A;  1BLC A;  3UDF A;  4LV3 A;  3LO7 A;  1K6R A;  3IHB A;  2DCF A;  4S2N A;  3WS4 A;  3SH7 A;  5F83 A;  2IWD A;  5J8X A;  2Z2L B;  3G35 A;  4BL3 A;  3ZG0 A;  3CG5 A;  1CK3 A;  1Q2Q A;  1RP5 A;  3VP3 A;  3OPL A;  2X02 A;  3TG9 A;  3ZG5 A;  3HLW A;  2HP9 A;  4EWF A;  4BD0 A;  3UDX A;  1W5D A;  4F94 A;  4S2N C;  1FCM A;  1K4F A;  1LHY A;  4JLF A;  4E3J A;  2H0Y A;  2GDN A;  3QHY A;  4PM6 A;  4X6T A;  3FWL A;  4WMC D;  1KE3 A;  4GDB A;  4U0T A;  5GLD A;  3HLG A;  2Y2O A;  1IEL A;  2EXA A;  4YFM A;  1WYC A;  4DXB A;  4C3Q A;  1KDW A;  1FR1 A;  1PYY A;  4KZ5 A;  3IWI A;  4NK3 A;  2J8Y A;  1ESI A;  4GD6 A;  3DWZ A;  5CEB A;  3VMA A;  5FQI A;  1CEG A;  1M6K A;  5GLB A;  3HLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...