1FR1A

Refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
361
structure length
361
Chain Sequence
AAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQWQGISLLHLATYTAGGLPLQVPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMSKRVLHPLKLAHTWITVPQSEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMTRWVQANMDASQVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPVKADSIISGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of beta-lactamase from Citrobacter freundii indicates a mechanism for beta-lactam hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 114
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fr1A00
2ZC6B 5EOEA 2ZJ9A 3AGDA 5F83A 3V5MA 2J7VA 5DF7A 2Y2KA 3D4FA 4Q8IA 3HLEA 4Y0TA 2ZC7A 4N9KA 5E43A 2A49A 1O07A 3QNBA 3WRZA 3A3DA 4MNRA 4RA7A 3MZFA 1KE4A 1TDLA 2EX8A 3VP4A 3TG9A 2WK0A 3GVBA 1JWPA 1HTZA 3N8LA 5AQAA 5EVIB 1CK3A 5GHXA 1XGJA 3SS5A 3GRJA 5HW3A 4E3LA 2HP6A 4OPQA 1ZC2A 3B3XA 3HBRA 3I7JA 3S4XA 2EXBA 2XF3A 3OPRA 5M1AA 3A3JA 3PBNA 3FYZA 4N1HA 2A3UA 3IT9A 3W8KA 5AQ9A 5EUAA 3O3VA 2XH9A 2XEPA 4KZAA 4U3TA 4B4ZA 4NK3A 3BLSA 4FSFA 2EX6A 3OPPA 5FAPA 3WS4A 4FD8A 4S2NA 2OLVA 4UA9A 1YLWA 3BFEA 5A93A 4WELA 1ONHA 2WZZA 1GA0A 3ZG0A 1BLCA 3IQAA 5DTKA 2P9VB 4JXVA 4JF6A 3HLBA 4X55A 4Z9QA 3WRTA 5TGFA 1DJCA 5JYOA 3HL9A 4X69A 3HUOA 2V2FF 4LV3A 3VFHA 3A3FA 5EOOA 1YQSA 2ZQ9A 3C5AA 4IVIA 4WZ4A 4O7DA 4E3MA 3CJMA 3CG5A 4QB8A 4MLLA 1K55C 5EVIA 4OOLA 1IYOA 2OSUA 4MBFA 1FR6A 3V3RA 1TVFA 1YMSA 2QPNA 3A3IA 1NYMA 1XGIA 5EE8A 5JYPA 1NYYA 3GR2A 4KZ3A 1M6KA 5GL9A 1Q2QA 4PM5A 1DJBA 4ZDXA 2X01A 2JBFA 2B5RA 4N1XA 4U0TA 5KZHA 5M19A 4Y0OA 3DW0A 4EV4A 2X02A 1GHPA 4LV0A 4BL2A 3MKFA 2IWCA 4PPRA 3UY6A 4DKIA 1Z6FA 2HDRA 3M2JA 1FCOA 1XX2A 2HDSA 5EVLA 1XPBA 1CEGA 4BD1A 1LI9A 3PBQA 4DDSA 1PW1A 3G30A 3DTMA 3BFDA 3BECA 3ITAA 4Y0UA 5CTNA 3GMWA 2G2UA 1ZG4A 3MKEA 4UA6A 3WS0A 4ZJ1A 2ZD8A 5IHVA 4OPZA 3ZGAB 1XA7A 3IF5A 4CPKA 1L2SA 4K0XA 5AQ7A 3UDIA 1MWSA 2XD1A 2HPBA 3HVFA 2ZM8A 1G68A 1I5QA 3BFGA 3WS5A 3GTCA 3ITBA 3P09A 3C7UA 4P87A 4WZ5C 4B4XA 2ZC5B 4GKUA 4KZ6A 3O88A 4WEJA 1FQGA 1N9BA 3UPNA 3ZFZA 2ZQCA 2J9PA 4BD0A 3N8RA 2EFXA 2V1ZA 3G32A 3IWIA 5BOHA 1FSWA 1VM1A 4DF6A 3ZCZA 1ES4A 3G34A 5E2EA 1MWRA 1MXOA 3HLGA 3SOIA 3WS1A 1GHMA 5FASA 5GLAA 4S2KA 1OMEA 1PI4A 2Z2LB 3RXXA 3Q81A 4KG6A 4EBLA 1NZOA 3PAGA 4JLFA 3MZEA 5DF9A 2JE5A 1ERMA 3ZNYA 1BT5A 5E2FA 2Y2PA 5CTMA 3IF6B 3BFCA 3TOIA 2XDMA 4OPYA 4C3QA 3IF6C 1BSGA 4PM9A 2E8IA 4PMAA 5FA7A 2EFUA 3ZG8B 4QY5A 4P85A 4LCLA 1IKGA 4MBHA 1JWVA 3ISGA 3MBZA 4MEZA 1YMXA 4N92A 3DWZA 1K56D 2Y59A 4HBUA 2ZQ8A 3OPHA 4GD6A 4JPMA 1O7EA 2EXAA 4OLDA 4RX2A 5HX9A 1H8YA 3LO7A 1NRFA 3V50A 5GLCA 3VSKA 2Y2HA 4KG5A 4M3KA 4BJPA 1K6RA 4DDYA 4IVKA 5L2FA 1BLSA 1KE3A 2WYXA 3PBTA 4NETA 1K6SA 2WAFA 5GHZA 1K4FA 3Q7VB 4GNUA 1W8QA 3E2KA 2Y91A 3GQZA 1TDGA 3GV9A 1YLZA 3UE0A 2JCHA 4GOGA 3W4QA 3S22A 5DTTA 4BL3A 2Y2NA 5U47A 4EBPA 2ZQ7A 5AQBA 4WMCA 3ZG7B 5D3OA 1K55A 5EVIC 4E3NA 4S2OA 2ZMAA 1BUEA 5HL1A 4XUZA 1E4DA 4GDNA 3W4OA 3EQUA 1QMFA 1JTDA 3FKWA 3CZDA 3Q1FA 4HEFA 5HAPA 1TEMA 3HUNA 3P98A 3CMZA 3G4PA 4FCFA 4K0WA 1HVBA 3IWQA 1E3UA 4E3OA 5F1GA 4ZJ2A 1RGYA 1LL9A 4P6BA 2DCFA 1QMEA 3IF6A 5FAQA 2Y2GA 5CHJA 2IWBA 1RP5A 4R0QA 3N8SA 3UDFA 2DRWA 2R9WA 1M40A 1WYBA 4LV2A 4KZ9A 3ZVWA 3HREA 1DY6A 1JWZA 4R23A 3IH9A 3SS3A 5A90A 2JC7A 3LY4A 4WZ5A 1L0DA 1ES5A 4KENB 2ZQDA 1GCEA 2Y2MA 3QNCA 2WZXA 4GB7A 4ZTKA 2Y2JA 1IYPA 3BRMA 3Q07A 3VMAA 3M6HA 5FAOA 3ZNTA 4LENA 5FSRA 1I2WA 5HFOA 1KGFA 5GHYA 1W7FA 3G2ZA 3ZDJA 4JBFA 1KVMA 3HLCA 3PBRA 3BLMA 4KZBA 4OQHA 2J8YA 4OP8A 1LL5A 3UN7A 2VGKA 2OV5A 1PI5A 5CGXA 2X71A 2XFTA 2XLNA 5DF8A 1BTLA 1FCNA 4LV1A 3VOZA 4X53A 4B88A 4C6YA 3BFFA 1BZAA 4HESA 1CEFA 1XP4A 3FV7A 4CJNA 3VOYA 1E3UD 4ZAMA 1RCJA 3SH7A 2WKIA 5TFQA 5E2HA 3TSGA 1GA9A 4RX3A 1MWUA 1LLBA 3MFDA 4XXRA 3PAEA 2ZC3B 2ZM2A 3IH8A 1IYQA 5FATA 1YLJA 3IXGA 4BLMA 1Q2PA 3M2KA 1KGGA 2WGVA 1YT4A 1NZUA 1ONGA 5EPHA 3RJUA 4EQIA 4JXWA 1NJ4A 1NXYA 1PYYA 3C7VA 2XR0A 4R3JA 4U0XA 2H5SA 3IXHA 5FQQA 2WUQA 3OZHA 3UE3A 5J8XA 5FDHA 4ID4A 3UO9A 1KDSA 3VP1A 3WWXA 5DVAA 4OVDA 4E3IA 4WYYA 4S2LA 1IKIA 3OC2A 5CHMA 1AXBA 5A92A 4H8RA 4DE1A 3S1YA 4S2IA 3ZG5A 4UHUA 1SCWA 2H0YA 1KDWA 4A5RA 4EBNA 2ZLYA 2H10A 5KSCA 2H0TA 1K25A 1FCMA 5FI6A 4OP5A 2VGJA 1KVLA 2Q9MA 2RL3A 3WS2A 1BLPA 1CI9A 1IELA 2IWDA 1K54A 1FOFA 5CGWA 3IXDA 4WM9A 3ZVTA 4S2NC 4BENA 4OQIA 4EWFA 1ESUA 3NBLA 2QMIA 4KQRA 5EECA 3UDXA 1MPLA 3A3EA 3AGFA 3HLWA 2PU2A 1K57A 4R4RA 1SDNA 2P9VA 2XD5A 2BLSA 4KQOA 3UNWA 3OCNA 1HD8A 3OPLA 3PBOA 5HARA 1KE0A 4QU3A 2G2WA 2C6WB 4YINA 4D2OA 2Y2IA 2HDQA 3BM6A 5FQKA 1ERQA 1LHYA 4X68A 1XKZA 1PZPA 2V20A 3G35A 2P74A 2WGIA 4Y7PA 1PW8A 2Y2OA 4LCMA 4E6WA 1YLTA 5FQJA 2ZC4B 4R3BA 3E2LA 2PBYA 1GHIA 2XQZA 2I72A 3G2YA 3IWOA 4KZ4A 4JF5A 5F82A 3Q82A 4DE0A 4OQ0A 5TR7A 1WYCA 1EWZA 3N4IA 1PWCA 3Q7ZA 3HUMA 4MBKA 4X6TA 3ZHHA 3W4PA 3IHAA 4JXSA 3LEZA 4R1GA 5CERA 4S2MA 2ZM0A 3EQVA 2WADA 1ESIA 4OOYA 4XUXA 3C4OA 3LY3A 5FI2A 1YLPA 2PU4A 3VP2A 5FQIA 2GDNA 1IEMA 3FZCA 3NIAA 1W8YA 1NY0A 5FQMA 3HLDA 4DRTA 4IBRA 2Y2LA 1EROA 1FSYA 2XK1A 4QY6A 4RVAA 4KQQA 1H5XA 3SH8A 4DE2A 4GN2A 4JKTA 1JVJA 1L0FA 1VQQA 2WGWA 3FKVA 3N6IA 4R4SA 4RYEA 1DJAA 1WE4A 5HAIA 5CEDA 2Y2QA 2Y4AA 4DXBA 3M6BA 1IYSA 4E3JA 3HLFA 2BG1A 4UAAA 1PWGA 3QHYA 2WAEA 5E2GA 5CGSA 5GLBA 1L0GA 4DXCA 3NDEA 3V3SA 3BYDA 3V39A 2CC1A 4KZ8A 1SDEA 3UE1A 1KGEA 3N7WA 1ZKJA 4ZBEA 1K56A 5HAQA 4OONA 2ZQAA 1K4EA 5DTSA 2WKHA 4JF4A 3SH9A 1S6RA 1ZG6A 1ES2A 4KG2A 4PM7A 2OLUA 1XA1A 1Y54A 1ALQA 2WKEA 3SS4A 4OKPA 1U60A 4OQGA 5I94A 1W79A 3O87A 3Q7VA 3IHBA 4QJGA 3G31A 3UPPA 2EX2A 5FQ9A 3FWLA 4OLGA 2C5WB 2QZ6A 4IBXA 5KSHA 5F1FA 4ZJ3A 3PBSA 4JXGA 1H8ZA 4KZ5A 4WBGA 4FH4A 3NI9A 4GDBA 4DE3A 4HBTA 4GD8A 1CI8A 1C3BA 1K57C 1J9MA 3C4PA 5CRFA 5M18A 2Y55A 2HP9A 2J9OA 3IXBA 4WEKA 4IEDA 2XGNA 3ZG9B 3NC8A 3RXWA 4YFMA 4OPRA 4S2PA 1HZOA 4EUZA 3MXRA 1MKIA 1ES3A 4OH0A 5FI7A 4L0LA 1K54C 1S0WA 3VP3A 2Q9NA 3OCLA 3NCKA 3MZDA 4N9LA 4S2JA 1MBLA 1PZOA 5CXWA 1N4OA 1I2SA 3VP0A 1BULA 2HDUA 5EVID 2Z2MB 1K38A 5A91A 4QD4A 1LI0A 4WMCD 2RCXA 2WGWB 1FR1A 1EI5A 1YLYA 2HP5A 3JYIA 5GLDA 4UA7A 3VFFA 4F94A 5KMWA 1BLHA 3NDGA 1L0EA 3BEBA 4QHCA 1MWTA 4FH2A 1G6AA 5CECA 3O86A 4X56A 3NY4A 4KZ7A 2UWXA 4PM8A 5CEBA 1PWDA 2R9XA 4GZBA 2EX9A 2FFYA 4PM6A 1SKFA 1RGZA 2DNSA 3MXSA 3VSLA 2XFSA 5G18A 3GSGA 4P0MA 3UPOA 1SHVA 4E3KA 1YM1A 1PIOA 3PTEA 4OOMA 5CHUA 1MY8A 1XXMA 4K91A 3AGEA 4C75A 4E6XA 1JTGA 2FFFB 3LCEA 3DWKA 1E25A 1W5DA 4BQMA
chains in the Genus database with same CATH superfamily
2ZC6B 3H82A 4BBVA 4Q8IA 4N9KA 3F1NB 3A3DA 4MNRA 4RA7A 4FOFA 1TDLA 2WK0A 5AQAA 5GHXA 1XGJA 3GRJA 4E3LA 2EXBA 2XF3A 3OPRA 3A3JA 3FYZA 3W8KA 4U3TA 1NRJA 3MXQA 2IA2A 4S2NA 2NUTC 2OLVA 5A93A 1WA9A 2WZZA 1BLCA 2V1AA 5DTKA 4X55A 5TGFA 5JYOA 2D02A 2V2FF 1ACFA 3VFHA 1P97A 1F9IA 2ZQ9A 4WZ4A 5DFYA 2HV1A 4E3MA 4QB8A 2YKFA 5EVIA 4EETB 4UQIS 4LFUA 1FR6A 1TVFA 2QPNA 5HDDA 1NYYA 4KZ3A 4ZDXA 2B5RA 4N1XA 5M19A 3DW0A 4EV4A 2X02A 1NLZA 3UY6A 2IWCA 4DKIA 3F1NA 3QP8A 1XX2A 5EVLA 1LI9A 4ARZA 5IS1A 4Y0UA 5CTNA 2G2UA 3DAVA 1G28A 3PYPA 1XA7A 2QJ7A 1L2SA 3LEQA 4K0XA 3NJAA 2XD1A 2HPBA 3CITA 4G3VA 2BASA 4WZ5C 2LB9A 4GKUA 4WEJA 3U2AA 1FQGA 1N9BA 3UPNA 4YOFA 3G34A 2VV6A 2L4RA 3HLGA 3SOIA 2VJWA 1OMEA 3RXXA 4E04A 4EBLA 5DF9A 4FUWA 1ERMA 3IF6B 3TOIA 4OPYA 2O99A 1BSGA 2BTFP 1IKGA 4MBHA 4Q0HA 4MEZA 4G3WA 1YMXA 4N92A 5J3WA 1K56D 2Y59A 4X1MA 3CWFA 2EWVA 4OLDA 3OPHA 4JPMA 1O7EA 5HX9A 1H8YA 5GLCA 4BJPA 1K6RA 5L2FA 1BLSA 4UQIM 2PYPA 4L9EA 2W3GA 3Q7VB 1W8QA 2PD8A 3GV9A 4Y13A 2JCHA 2OAP1 5DTTA 4O8GA 1OTBA 2QHKA 3ZG7B 1K55A 4GDNA 4R3AA 3FKWA 1LL8A 4KUOA 3IWQA 4MDZA 1RP5A 3N8SA 4EU0A 1M40A 1WYBA 3CPTA 4KZ9A 3R7WA 5J4EA 4GLQA 2JC7A 1L0DA 3QNCA 2PBDP 4YWZA 4ZTKA 3BRMA 1IYPA 3Q07A 5FSRA 3MFXA 4LLOB 3G2ZA 3BQ8A 2VGKA 3K3CA 5CGXA 1YSPA 2XLNA 4LV1A 4EERA 1CEFA 1XP4A 4HNBA 3T1QB 1OJ5A 4ZAMA 2HJ9C 2WKIA 4RX3A 3PAEA 3IH8A 1IYQA 4MMNA 2PR6A 5EPHA 1NZUA 2JKTM 3PR6A 5FL3A 3RJUA 5HWVA 1PYYA 4U0XA 1OTAA 2XR0A 1VETA 3C7VA 4R3JA 3UE3A 5FDHA 5EFWA 3WWXA 2O9BA 2QWSA 3EOIA 4WYYA 4E3IA 5HDCA 5CHMA 3S1YA 2K7SA 4UHUA 1KDWA 1FCMA 2A2LA 2VGJA 1VEUA 5HZHA 1CI9A 2IWDA 1K54A 4M4XA 4OQIA 5EECA 3AGFA 3DTEA 4ME4A 1NWZA 2XD5A 1ZHHB 3OCNA 2OWHA 3IS2B 5KIZA 5L09A 4Y17A 4D2OA 1F5MA 1XKZA 1YLTA 5FQJA 2ZC4B 4R3BA 5F82A 3E2LA 3G2YA 4O01A 4KZ4A 4IJGA 4DE0A 5TR7A 2W3DA 2I9VA 1LSWA 2JKTI 1N9LA 3IHAA 1ZTUA 3T4TA 5CERA 4P6ZM 4S2MA 2WADA 1YLPA 2GDNA 4FTXA 3FZCA 1W8YA 1NY0A 5L10A 3HLDA 3S7NA 1V9YA 1FSYA 2XK1A 4D60A 3SH8A 1H5XA 3OBFA 4GN2A 2VKSA 5HDSA 4NEED 2PDRA 1L0FA 3N6IA 3FKVA 4R4SA 2AVXA 2PAVP 3M6BA 2BG1A 1XJ2A 3C38A 1STZA 3UB9A 1PWGA 5CGSA 4AFIA 3BYDA 2CC1A 4KZ8A 4ZBEA 1K56A 3KX0X 4HJ6A 1K4EA 3IX3A 4I3IA 4JF4A 2GJ3A 3GECA 3BY9A 2XROA 2V8FA 4PM7A 1XA1A 3SS4A 4OQGA 5I94A 1W79A 2QKPA 3JVVA 5FQ9A 3S7OA 3FWLA 4OLGA 2KDKA 5KSHA 3T4KA 1V9ZA 1PNEA 3PBSA 4JXGA 4LRZE 1H8ZA 3MMHA 4KZ5A 3NI9A 2P7JA 4IUKA 4GD8A 1CI8A 3A0VA 3LGOA 3C4PA 2HP9A 2J9OA 2XGNA 4I5SA 3RXWA 4LPZA 4S2PA 3LIFA 1HZOA 4Y2FA 5DKKA 1MKIA 1JNUA 3T50A 3OCLA 3MZDA 3UE6A 2HDUA 4CLCE 3R4KA 5A91A 4QD4A 1EI5A 2HP5A 3JYIA 5GLDA 4UA7A 1H8MA 3SZTA 1L0EA 3RH8B 1MWTA 4FH2A 4QPRA 3NY4A 4KZ7A 4PM8A 2W3FA 3VSLA 4ETXA 4P0MA 3UPOA 1SHVA 2JN7A 5CHUA 2FH5A 4K91A 2XA7M 4E6XA 1JTGA 2FFFB 5IU1A 5EOEA 2ZJ9A 5F83A 2Y2KA 4Y0TA 2K31A 2B95A 3E4QA 5EVEA 3VP4A 1HTZA 4EW7A 1XFQA 4OPQA 3JVUA 4UEYA 3S4XA 3PBNA 2A3UA 3IT9A 3O3VA 2XH9A 4NK3A 4GS9A 3BLSA 3OPPA 3LIAA 3MJQA 3BFEA 3T4JA 1MZUA 1OT6A 2JHEA 3HLBA 3WRTA 3KYEA 1YSQA 3HUOA 5EOOA 2JKRI 3T4LA 4IVIA 3HCYA 3T4QA 4JGPA 3CJMA 4JGOA 1IYOA 3V3RA 1NYMA 3V67A 5GL9A 3HJIA 2JBFA 4U0TA 1Z6FA 1FCOA 4XT2B 2HDSA 1XPBA 1LSXA 1CEGA 1UWNX 3G30A 3DTMA 3MKEA 4WL9A 1ODVA 4CPKA 1FIKA 3UDIA 3HVFA 2PT7A 3P09A 3C7UA 4B4XA 3O88A 2ZQCA 3RTYA 3N8RA 4JGQA 3H7WA 4GS9B 5BOHA 1FSWA 3ZCZA 1ES4A 5E2EA 3NOPC 5IT5A 2V1BA 2K2NA 5FASA 5GLAA 1TS8A 3Q81A 4KG6A 3PAGA 3MZEA 2HZ5A 3ZNYA 1BT5A 5E2FA 3DTIA 4NKPA 1PRQA 3IF6C 3LR4A 4PM9A 2E8IA 4PMAA 5FA7A 2EFUA 1BYWA 3MBZA 3RFBA 2O0YA 2B18A 4CLCC 4RX2A 3F1OA 2JKFA 1NRFA 4M3KA 4F3LA 4DDYA 4IVKA 1KE3A 2WYXA 4GHIB 2WAFA 5GHZA 2EA9A 2Y91A 1TDGA 3UE0A 1YLZA 4GOGA 3S22A 5U47A 5AQBA 4CLCA 4E3NA 4S2OA 2ZMAA 3F1PA 5HL1A 1E4DA 3W4OA 2JKRM 3EQUA 3CZDA 5HAPA 4HEFA 3CMZA 4FCFA 3TE8A 2V9AA 5F1GA 4ZJ2A 4P6BA 2DCFA 3IF6A 4Q0IA 4R0QA 3UDFA 3FC7A 2O9CA 3E98A 3HREA 1DY6A 1JWZA 4R23A 3BY8A 3SS3A 4G3KA 5A90A 1LT0A 4KENB 2Y2MA 4GB7A 3VMAA 5FAOA 5A8BA 4DMZA 3ZNTA 1KGFA 5GHYA 3IX4A 4JBFA 1S1YA 3PBRA 3BLMA 4KZBA 1MC0A 4OP8A 3UN7A 2OV5A 3VE4A 4Y15A 1BTLA 4X53A 4CJNA 5F68A 1RCJA 5G4YA 5TFQA 4CQHA 2VV7A 5E2HA 3TSGA 1GA9A 1TS0A 3LUQA 2ZM2A 5AVFA 3M2KA 1YT4A 1NJ4A 2ZMVA 2INWA 4IUHA 2H5SA 2WUQA 3VP1A 5DVAA 1T1CA 4NG2A 4EEUA 1IKIA 4WF0A 2W3HA 1AXBA 5A92A 4H8RA 4S2IA 1SCWA 3OLOA 2M7VA 1YKDA 3L9KA 3LFVA 1K25A 2W1RA 4OP5A 3MF0A 2Q9MA 1IELA 1LSVA 4ZRRA 3P7NA 4WM9A 3ZVTA 3KO6A 4KQRA 1P0ZA 5J7EA 1Y4OA 4R4RA 3UMDA 2BLSA 1KE0A 3T1SA 1P9RA 4X68A 2P74A 2WGIA 3BW6A 3BQAA 4HJ3A 4JF5A 1F98A 5TJJA 1WYCA 1PWCA 4NXBA 1OTDA 4X6TA 3HUMA 3ZHHA 3W4PA 3LEZA 4R1GA 3LYXA 5FI2A 4OOYA 1SZVA 3VP2A 2PU4A 5FQIA 2CMNA 4B9OA 3NIAA 5FQMA 5HPFA 1N9OA 1EROA 2Y2LA 4QWOA 4JKTA 1VQQA 4RYEA 2J3TC 3FPVA 1WE4A 5HAIA 5CEDA 2B02A 4JGRA 2QYBA 4PKYA 5DJUA 4E3JA 5MC7A 3HLFA 1SDEA 3UE1A 2A24A 5HAQA 4OONA 2KX6A 2ZQAA 3SH9A 1S6RA 1GSWA 3T1RA 3QP5A 2WKEA 4OKPA 1U60A 3KSHA 4HY8A 3UPPA 2EX2A 2QJ5A 2J3TD 3QP6A 4CLCB 1H3QA 4H6JA 3ZQ5A 4WBGA 4GDBA 5L8MA 1OT9A 4Q0JA 1K57C 2GX5A 5CRFA 2Y55A 4WEKA 4YFMA 2G7UA 4OH0A 1K54C 3NCKA 4S2JA 2VK3A 5CXWA 3VP0A 2Z2MB 1CJFA 3DTKA 4I39A 1FR1A 3O5YA 4PHTA 4HQAA 4O0PA 3VFFA 4F94A 1BLHA 3NDGA 4R70A 3BEBA 1G6AA 3T4SA 3O86A 4X56A 2R9XA 4PM6A 1RGZA 3MXSA 2E8JA 3GSGA 5C5KA 4E3KA 1YM1A 3PTEA 4OOMA 1XXMA 3AGEA 4KUKA 2LB5A 4BQMA 3AGDA 2J7VA 5DF7A 3VE3A 3D4FA 3HLEA 2A49A 3QNBA 4HOIA 1DP9A 3MZFA 3E4PA 1KE4A 5EV0A 2EX8A 3N8LA 5EVIB 1CK3A 2YKHA 2HP6A 3HBRA 3I7JA 4WUJA 5M1AA 4N1HA 4KZAA 4HHDA 1VEUB 4LRYC 4FD8A 1G5UA 4UA9A 1ONHA 2VLGA 1GA0A 1T1AA 3IQAA 2P9VB 4JXVA 4Z9QA 3LICA 1DJCA 3LIDA 4LV3A 1YQSA 2HJEA 3C5AA 4LGWA 4O7DA 3K3DA 4MLLA 1K55C 4OOLA 2WKQA 3B47A 5EE8A 3GR2A 1M6KA 4BBTA 4PM5A 1DJBA 4NXGA 4BL2A 3MKFA 4PPRA 2HDRA 3C2WA 4BD1A 3CI6A 3PBQA 4DDSA 3U4LP 1FILA 3BECA 4GCZA 3WS0A 1ZG4A 4ZJ1A 2ZBBA 5IHVA 4OPZA 3ZGAB 1MWSA 2ZM8A 1I5QA 3BFGA 4Y3IA 3GTCA 3FPWA 1X0OA 1XJ6A 3ZFZA 5HD5A 2EFXA 2V1ZA 1VM1A 4DF6A 1PI4A 2Z2LB 2Q0OA 1NZOA 4JLFA 2JE5A 5CTMA 1SKOB 3BFCA 1H0MA 4C3QA 1S66L 1N9NA 2ZOHA 4YNRA 2XRNA 4MN6A 2XSSA 4P85A 4LCLA 2PHYA 1JWVA 3ISGA 2VGLS 2HF6A 3ZYTA 2ZQ8A 3CAXA 1MKMA 2VEAA 2PYRA 3LO7A 3V50A 2Y2HA 4KG5A 4F3LB 3LIEA 3EEHA 3PBTA 3A0RA 1W63M 3CLOA 1K4FA 2XA7S 3QP4A 3W4QA 2ZQ7A 5D3OA 5EVIC 4XUZA 4MCWA 3R7WB 4DJ3A 3LR0A 1JTDA 3HUNA 3P98A 4E3OA 5AVEA 1E3UA 4EXOA 1RGYA 1LL9A 4ETZA 5F6AA 2R9WA 4LV2A 4B93A 3EEAA 3MS6A 3A0SA 3IH9A 2GZAA 4HH2A 3LY4A 4WZ5A 1OPXA 2PR5A 3MQQA 2WZXA 5HD3A 4RQ9A 4I3JA 5HFOA 1EW0A 1W7FA 4GHIA 4L9FA 3ZDJA 2OOLA 3HLCA 1VHMA 2J8YA 1LL5A 2Z6CA 2X71A 3MQOA 5DF8A 3VOZA 4C6YA 3FV7A 1W63Q 1Z09A 3SH7A 1MWUA 1LLBA 3KSIA 1YLJA 1Q2PA 1F2KA 1ONGA 4EQIA 2W1TA 1L3LA 3IS2A 5FQQA 5EM0A 4ID4A 3UO9A 1D06A 4S2LA 1UGUA 3ZG5A 1TS6A 2ZLYA 2W1TB 2H10A 2H0TA 1KVLA 3HJKA 1UWPX 1OTIA 3D72A 4GJ4A 4S2NC 4GW9A 4EWFA 4P6ZS 5G4ZA 5F69A 2QMIA 3UDXA 3A3EA 2M7UA 1XJ3A 3HLWA 1K57A 4X1LA 1SDNA 4KQOA 3UNWA 2KOIA 3PBOA 2G2WA 2HDQA 1LHYA 2V20A 3G35A 4R38A 4Y7PA 1PW8A 2Y2OA 3NOTC 4EESA 2PBYA 2XQZA 2I72A 3IWOA 3Q82A 4OQ0A 1TD5A 5I5LA 2VV8A 4MN5A 2PD7A 1EWZA 3N4IA 3IBJA 1VETB 3C30A 4MBKA 3TJZC 2ZM0A 3EQVA 4XUXA 3C4OA 5FEFA 4QY6A 4KQQA 4DE2A 3E4OA 4L9GA 1JVJA 1XFNA 3K2NA 4BMWA 2Y2QA 4DXBA 3CUEC 4BBUA 3IX8A 2W3EA 4UAAA 2WKRA 5E2GA 5GLBA 4DXCA 1ZKJA 3H7WB 3S7QA 3LR3A 5DTSA 1ES2A 4KG2A 1Y54A 1ALQA 2VZWA 2FZ0A 4QJGA 2C5WB 2QZ6A 4IBXA 5F1FA 5L07A 3ICYA 4DE3A 4CLCD 1C3BA 1J9MA 5TBMB 1D1JA 3ZG9B 3PXPA 3NC8A 4HP4A 4OPRA 4EUZA 1ES3A 4NXEA 5FI7A 4L0LA 3W2ZA 2Q9NA 3LIBA 4Y5FA 4N9LA 3UB8A 1YPRA 1I2SA 1BULA 3ULFA 5EVID 4WMCD 2WGWB 1A0KA 1YLYA 5KMWA 5K5BA 5CECA 2L1MA 3C8CA 2ACGA 2UWXA 4GZBA 1PWDA 3B42A 2XFSA 5G18A 3F1PB 1PIOA 3NECA 1VB6A 3UB5P 3DWKA 1E25A 1W5DA 4HH3A 3V5MA 3NULA 2ZC7A 5E43A 1O07A 3UB6A 3WRZA 3TG9A 3GVBA 1JWPA 3SS5A 3F1OB 3D9YA 5HW3A 1ZC2A 3B3XA 5EM1A 4K08A 2W0NA 2Y79A 3KSGA 2MJ6A 5AQ9A 1YAXA 5EUAA 2XEPA 4B4ZA 4FSFA 2EX6A 5FAPA 3WS4A 1SKOA 2DMWA 1YLWA 4WELA 3ZG0A 4JF6A 3HL9A 4X69A 3A3FA 5FEGA 3CG5A 4II7A 2OSUA 4MBFA 3A3IA 1YMSA 1XGIA 5JYPA 1Q2QA 5LBRA 1DRMA 2X01A 2UV0E 5KZHA 4Y0OA 1GHPA 4LV0A 3FG8A 3M2JA 5HSQA 5CX7A 2ZMFA 1DP8A 1PW1A 2D01A 2J3WA 3BFDA 3ITAA 3GMWA 4UA6A 4DN0A 3MSHA 3T12B 1OJGA 3IBRA 2ZD8A 4R6LA 3IF5A 3E0YA 3EGDC 4I3AA 5AQ7A 2HGVA 1G68A 2OAQ1 1K0KA 3KYZA 5DFXA 3WS5A 3ITBA 4P87A 2OWJA 2ZC5B 4KZ6A 2J9PA 2ZL1B 4BD0A 3CHWP 3G32A 3IWIA 1MWRA 1MXOA 3WS1A 1GHMA 1D7EA 4S2KA 2H28A 3BWLA 3UB7A 2Y2PA 3LR5A 3D3OA 2XDMA 1DP6A 2WKPA 4KQDA 3ZG8B 3P01A 1J3WA 4QY5A 3GDIA 2V0WA 2J80A 3DWZA 3KSFA 4HBUA 5FDSA 4GD6A 1P9WA 3DBAA 2EXAA 3VSKA 4HJ4A 4NETA 1K6SA 2PRFA 4GNUA 1XJ4A 3E2KA 3GQZA 3B33A 4BL3A 2Y2NA 1GSVA 4EBPA 2ZOIA 4WMCA 2L0WA 3G6OA 2V0UA 1BUEA 1QMFA 1TF1A 3Q1FA 1TEMA 3G4PA 4K0WA 1HVBA 1S67L 4PKYG 1QMEA 5FAQA 2Y2GA 5CHJA 2IWBA 1NLYA 2DRWA 3ZVWA 4X25A 5HWTA 3QP1A 2VX8A 1CQAA 3EGXC 1ES5A 3BJNA 2ZQDA 1GCEA 3NHQA 2Y2JA 3M6HA 3VV4A 4LENA 1KOUA 1I2WA 2EWWA 1S1ZA 3L7HA 4IHQA 1KVMA 4OQHA 3T1XA 4Z1WA 3OOVA 1PI5A 2XFTA 1FCNA 4B88A 1PFLA 4EEPA 3BFFA 1BZAA 4HESA 3VOYA 1E3UD 3MFDA 4XXRA 2ZC3B 3SW1A 3KYQA 5FATA 4BLMA 3IXGA 1KGGA 2WGVA 4JXWA 1S4SA 2Y8HA 1NXYA 3IXHA 3OZHA 5J8XA 1KDSA 4OVDA 4BWIA 3OC2A 4DE1A 2H0YA 4A5RA 4EBNA 3NOUC 5KSCA 5FI6A 2RL3A 3WS2A 1BLPA 1FOFA 5CGWA 3QP2A 3IXDA 4BENA 3MQ0A 3H82B 1ESUA 3NBLA 1MPLA 2W27A 5DKLA 2ZL1A 2PU2A 1T18A 2P9VA 4HI4A 3OPLA 1HD8A 5HARA 4QU3A 2C6WB 3PHYA 4YINA 2Y2IA 3BM6A 5FQKA 1ERQA 1PZPA 4E6WA 4LCMA 1GHIA 2Z6DA 1G6OA 4DJ2A 4ESPA 1Y28A 3Q7ZA 4EUVA 2A24B 4WN5A 2VGLM 1OTEA 4JXSA 2R78A 1ESIA 3TW8A 3LY3A 3H9WA 1IEMA 1TS7A 4DRTA 4IBRA 4RVAA 3LI8A 4LRXC 2WGWA 1DJAA 1GSXA 2NUPC 3UMEA 2Y4AA 1IYSA 2V8CA 3MR0A 3QHYA 2WAEA 1L0GA 3NDEA 3V3SA 3V39A 1KGEA 3N7WA 2P04A 1IOUA 2WKHA 1ZG6A 2OLUA 2VA0A 4XT2A 4H6JB 5F5YA 3O87A 3Q7VA 3IHBA 3G31A 2P08A 5HWWA 2JKGA 4ARZB 4ZJ3A 4I38A 3EWKA 3VOLA 4FH4A 4HBTA 4PAUA 2O9AA 5M18A 3IXBA 4IEDA 3S7PA 3TRCA 4WLAA 3CUEA 3MXRA 1CF0A 4HIAA 1HLUP 1S0WA 3VP3A 2M1CA 1MBLA 1PZOA 4HP9A 1N4OA 4NXFA 5HL6A 1K38A 2KLIA 1AWIA 3CPTB 1LI0A 2RCXA 5HPIA 4MN7A 3T4OA 4EQ1A 3LI9A 4QHCA 5AJGA 3JPUA 1S4RA 1T19A 5CEBA 1IFQA 2EX9A 2FFYA 2GNXA 1SKFA 2DNSA 5TBMA 1T1BA 4C75A 1MY8A 5DJTA 3LCEA
chains in the Genus database with same CATH topology
2ZC6B 5EOEA 2ZJ9A 3AGDA 5F83A 3V5MA 2J7VA 5DF7A 2Y2KA 3D4FA 4Q8IA 3HLEA 4Y0TA 2ZC7A 4N9KA 5E43A 2A49A 1O07A 3QNBA 3WRZA 3A3DA 4MNRA 4RA7A 3MZFA 1KE4A 1TDLA 2EX8A 3VP4A 3TG9A 2WK0A 3GVBA 1JWPA 1HTZA 3N8LA 5AQAA 5EVIB 1CK3A 5GHXA 1XGJA 3SS5A 3GRJA 5HW3A 4E3LA 2HP6A 4OPQA 1ZC2A 3B3XA 3HBRA 3I7JA 3S4XA 2EXBA 2XF3A 3OPRA 5M1AA 3A3JA 3PBNA 3FYZA 4N1HA 2A3UA 3IT9A 3W8KA 5AQ9A 5EUAA 3O3VA 2XH9A 2XEPA 4KZAA 4U3TA 4B4ZA 4NK3A 3BLSA 4FSFA 2EX6A 3OPPA 5FAPA 3WS4A 4FD8A 4S2NA 2OLVA 4UA9A 1YLWA 3BFEA 5A93A 4WELA 1ONHA 2WZZA 1GA0A 3ZG0A 1BLCA 3IQAA 5DTKA 2P9VB 4JXVA 4JF6A 3HLBA 4X55A 4Z9QA 3WRTA 5TGFA 1DJCA 5JYOA 3HL9A 4X69A 3HUOA 2V2FF 4LV3A 3VFHA 3A3FA 5EOOA 1YQSA 2ZQ9A 3C5AA 4IVIA 4WZ4A 4O7DA 4E3MA 3CJMA 3CG5A 4QB8A 4MLLA 1K55C 5EVIA 4OOLA 1IYOA 2OSUA 4MBFA 1FR6A 3V3RA 1TVFA 1YMSA 2QPNA 3A3IA 1NYMA 1XGIA 5EE8A 5JYPA 1NYYA 3GR2A 4KZ3A 1M6KA 5GL9A 1Q2QA 4PM5A 1DJBA 4ZDXA 2X01A 2JBFA 2B5RA 4N1XA 4U0TA 5KZHA 5M19A 4Y0OA 3DW0A 4EV4A 2X02A 1GHPA 4LV0A 4BL2A 3MKFA 2IWCA 4PPRA 3UY6A 4DKIA 1Z6FA 2HDRA 3M2JA 1FCOA 1XX2A 2HDSA 5EVLA 1XPBA 1CEGA 4BD1A 1LI9A 3PBQA 4DDSA 1PW1A 3G30A 3DTMA 3BFDA 3BECA 3ITAA 4Y0UA 5CTNA 3GMWA 2G2UA 1ZG4A 3MKEA 4UA6A 3WS0A 4ZJ1A 2ZD8A 5IHVA 4OPZA 3ZGAB 1XA7A 3IF5A 4CPKA 1L2SA 4K0XA 5AQ7A 3UDIA 1MWSA 2XD1A 2HPBA 3HVFA 2ZM8A 1G68A 1I5QA 3BFGA 3WS5A 3GTCA 3ITBA 3P09A 3C7UA 4P87A 4WZ5C 4B4XA 2ZC5B 4GKUA 4KZ6A 3O88A 4WEJA 1FQGA 1N9BA 3UPNA 3ZFZA 2ZQCA 2J9PA 4BD0A 3N8RA 2EFXA 2V1ZA 3G32A 3IWIA 5BOHA 1FSWA 1VM1A 4DF6A 3ZCZA 1ES4A 3G34A 5E2EA 1MWRA 1MXOA 3HLGA 3SOIA 3WS1A 1GHMA 5FASA 5GLAA 4S2KA 1OMEA 1PI4A 2Z2LB 3RXXA 3Q81A 4KG6A 4EBLA 1NZOA 3PAGA 4JLFA 3MZEA 5DF9A 2JE5A 1ERMA 3ZNYA 1BT5A 5E2FA 2Y2PA 5CTMA 3IF6B 3BFCA 3TOIA 2XDMA 4OPYA 4C3QA 3IF6C 1BSGA 4PM9A 2E8IA 4PMAA 5FA7A 2EFUA 3ZG8B 4QY5A 4P85A 4LCLA 1IKGA 4MBHA 1JWVA 3ISGA 3MBZA 4MEZA 1YMXA 4N92A 3DWZA 1K56D 2Y59A 4HBUA 2ZQ8A 3OPHA 4GD6A 4JPMA 1O7EA 2EXAA 4OLDA 4RX2A 5HX9A 1H8YA 3LO7A 1NRFA 3V50A 5GLCA 3VSKA 2Y2HA 4KG5A 4M3KA 4BJPA 1K6RA 4DDYA 4IVKA 5L2FA 1BLSA 1KE3A 2WYXA 3PBTA 4NETA 1K6SA 2WAFA 5GHZA 1K4FA 3Q7VB 4GNUA 1W8QA 3E2KA 2Y91A 3GQZA 1TDGA 3GV9A 1YLZA 3UE0A 2JCHA 4GOGA 3W4QA 3S22A 5DTTA 4BL3A 2Y2NA 5U47A 4EBPA 2ZQ7A 5AQBA 4WMCA 3ZG7B 5D3OA 1K55A 5EVIC 4E3NA 4S2OA 2ZMAA 1BUEA 5HL1A 4XUZA 1E4DA 4GDNA 3W4OA 3EQUA 1QMFA 1JTDA 3FKWA 3CZDA 3Q1FA 4HEFA 5HAPA 1TEMA 3HUNA 3P98A 3CMZA 3G4PA 4FCFA 4K0WA 1HVBA 3IWQA 1E3UA 4E3OA 5F1GA 4ZJ2A 1RGYA 1LL9A 4P6BA 2DCFA 1QMEA 3IF6A 5FAQA 2Y2GA 5CHJA 2IWBA 1RP5A 4R0QA 3N8SA 3UDFA 2DRWA 2R9WA 1M40A 1WYBA 4LV2A 4KZ9A 3ZVWA 3HREA 1DY6A 1JWZA 4R23A 3IH9A 3SS3A 5A90A 2JC7A 3LY4A 4WZ5A 1L0DA 1ES5A 4KENB 2ZQDA 1GCEA 2Y2MA 3QNCA 2WZXA 4GB7A 4ZTKA 2Y2JA 1IYPA 3BRMA 3Q07A 3VMAA 3M6HA 5FAOA 3ZNTA 4LENA 5FSRA 1I2WA 5HFOA 1KGFA 5GHYA 1W7FA 3G2ZA 3ZDJA 4JBFA 1KVMA 3HLCA 3PBRA 3BLMA 4KZBA 4OQHA 2J8YA 4OP8A 1LL5A 3UN7A 2VGKA 2OV5A 1PI5A 5CGXA 2X71A 2XFTA 2XLNA 5DF8A 1BTLA 1FCNA 4LV1A 3VOZA 4X53A 4B88A 4C6YA 3BFFA 1BZAA 4HESA 1CEFA 1XP4A 3FV7A 4CJNA 3VOYA 1E3UD 4ZAMA 1RCJA 3SH7A 2WKIA 5TFQA 5E2HA 3TSGA 1GA9A 4RX3A 1MWUA 1LLBA 3MFDA 4XXRA 3PAEA 2ZC3B 2ZM2A 3IH8A 1IYQA 5FATA 1YLJA 3IXGA 4BLMA 1Q2PA 3M2KA 1KGGA 2WGVA 1YT4A 1NZUA 1ONGA 5EPHA 3RJUA 4EQIA 4JXWA 1NJ4A 1NXYA 1PYYA 3C7VA 2XR0A 4R3JA 4U0XA 2H5SA 3IXHA 5FQQA 2WUQA 3OZHA 3UE3A 5J8XA 5FDHA 4ID4A 3UO9A 1KDSA 3VP1A 3WWXA 5DVAA 4OVDA 4E3IA 4WYYA 4S2LA 1IKIA 3OC2A 5CHMA 1AXBA 5A92A 4H8RA 4DE1A 3S1YA 4S2IA 3ZG5A 4UHUA 1SCWA 2H0YA 1KDWA 4A5RA 4EBNA 2ZLYA 2H10A 5KSCA 2H0TA 1K25A 1FCMA 5FI6A 4OP5A 2VGJA 1KVLA 2Q9MA 2RL3A 3WS2A 1BLPA 1CI9A 1IELA 2IWDA 1K54A 1FOFA 5CGWA 3IXDA 4WM9A 3ZVTA 4S2NC 4BENA 4OQIA 4EWFA 1ESUA 3NBLA 2QMIA 4KQRA 5EECA 3UDXA 1MPLA 3A3EA 3AGFA 3HLWA 2PU2A 1K57A 4R4RA 1SDNA 2P9VA 2XD5A 2BLSA 4KQOA 3UNWA 3OCNA 1HD8A 3OPLA 3PBOA 5HARA 1KE0A 4QU3A 2G2WA 2C6WB 4YINA 4D2OA 2Y2IA 2HDQA 3BM6A 5FQKA 1ERQA 1LHYA 4X68A 1XKZA 1PZPA 2V20A 3G35A 2P74A 2WGIA 4Y7PA 1PW8A 2Y2OA 4LCMA 4E6WA 1YLTA 5FQJA 2ZC4B 4R3BA 3E2LA 2PBYA 1GHIA 2XQZA 2I72A 3G2YA 3IWOA 4KZ4A 4JF5A 5F82A 3Q82A 4DE0A 4OQ0A 5TR7A 1WYCA 1EWZA 3N4IA 1PWCA 3Q7ZA 3HUMA 4MBKA 4X6TA 3ZHHA 3W4PA 3IHAA 4JXSA 3LEZA 4R1GA 5CERA 4S2MA 2ZM0A 3EQVA 2WADA 1ESIA 4OOYA 4XUXA 3C4OA 3LY3A 5FI2A 1YLPA 2PU4A 3VP2A 5FQIA 2GDNA 1IEMA 3FZCA 3NIAA 1W8YA 1NY0A 5FQMA 3HLDA 4DRTA 4IBRA 2Y2LA 1EROA 1FSYA 2XK1A 4QY6A 4RVAA 4KQQA 1H5XA 3SH8A 4DE2A 4GN2A 4JKTA 1JVJA 1L0FA 1VQQA 2WGWA 3FKVA 3N6IA 4R4SA 4RYEA 1DJAA 1WE4A 5HAIA 5CEDA 2Y2QA 2Y4AA 4DXBA 3M6BA 1IYSA 4E3JA 3HLFA 2BG1A 4UAAA 1PWGA 3QHYA 2WAEA 5E2GA 5CGSA 5GLBA 1L0GA 4DXCA 3NDEA 3V3SA 3BYDA 3V39A 2CC1A 4KZ8A 1SDEA 3UE1A 1KGEA 3N7WA 1ZKJA 4ZBEA 1K56A 5HAQA 4OONA 2ZQAA 1K4EA 5DTSA 2WKHA 4JF4A 3SH9A 1S6RA 1ZG6A 1ES2A 4KG2A 4PM7A 2OLUA 1XA1A 1Y54A 1ALQA 2WKEA 3SS4A 4OKPA 1U60A 4OQGA 5I94A 1W79A 3O87A 3Q7VA 3IHBA 4QJGA 3G31A 3UPPA 2EX2A 5FQ9A 3FWLA 4OLGA 2C5WB 2QZ6A 4IBXA 5KSHA 5F1FA 4ZJ3A 3PBSA 4JXGA 1H8ZA 4KZ5A 4WBGA 4FH4A 3NI9A 4GDBA 4DE3A 4HBTA 4GD8A 1CI8A 1C3BA 1K57C 1J9MA 3C4PA 5CRFA 5M18A 2Y55A 2HP9A 2J9OA 3IXBA 4WEKA 4IEDA 2XGNA 3ZG9B 3NC8A 3RXWA 4YFMA 4OPRA 4S2PA 1HZOA 4EUZA 3MXRA 1MKIA 1ES3A 4OH0A 5FI7A 4L0LA 1K54C 1S0WA 3VP3A 2Q9NA 3OCLA 3NCKA 3MZDA 4N9LA 4S2JA 1MBLA 1PZOA 5CXWA 1N4OA 1I2SA 3VP0A 1BULA 2HDUA 5EVID 2Z2MB 1K38A 5A91A 4QD4A 1LI0A 4WMCD 2RCXA 2WGWB 1FR1A 1EI5A 1YLYA 2HP5A 3JYIA 5GLDA 4UA7A 3VFFA 4F94A 5KMWA 1BLHA 3NDGA 1L0EA 3BEBA 4QHCA 1MWTA 4FH2A 1G6AA 5CECA 3O86A 4X56A 3NY4A 4KZ7A 2UWXA 4PM8A 5CEBA 1PWDA 2R9XA 4GZBA 2EX9A 2FFYA 4PM6A 1SKFA 1RGZA 2DNSA 3MXSA 3VSLA 2XFSA 5G18A 3GSGA 4P0MA 3UPOA 1SHVA 4E3KA 1YM1A 1PIOA 3PTEA 4OOMA 5CHUA 1MY8A 1XXMA 4K91A 3AGEA 4C75A 4E6XA 1JTGA 2FFFB 3LCEA 3DWKA 1E25A 1W5DA 4BQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZC6 B;  5EOE A;  2ZJ9 A;  3AGD A;  5F83 A;  3V5M A;  2J7V A;  5DF7 A;  2Y2K A;  3D4F A;  4Q8I A;  3HLE A;  4Y0T A;  2ZC7 A;  4N9K A;  5E43 A;  2A49 A;  1O07 A;  3QNB A;  3WRZ A;  3A3D A;  4MNR A;  4RA7 A;  3MZF A;  1KE4 A;  1TDL A;  2EX8 A;  3VP4 A;  3TG9 A;  2WK0 A;  3GVB A;  1JWP A;  1HTZ A;  3N8L A;  5AQA A;  5EVI B;  1CK3 A;  5GHX A;  1XGJ A;  3SS5 A;  3GRJ A;  5HW3 A;  4E3L A;  2HP6 A;  4OPQ A;  1ZC2 A;  3B3X A;  3HBR A;  3I7J A;  3S4X A;  2EXB A;  2XF3 A;  3OPR A;  5M1A A;  3A3J A;  3PBN A;  3FYZ A;  4N1H A;  2A3U A;  3IT9 A;  3W8K A;  5AQ9 A;  5EUA A;  3O3V A;  2XH9 A;  2XEP A;  4KZA A;  4U3T A;  4B4Z A;  4NK3 A;  3BLS A;  4FSF A;  2EX6 A;  3OPP A;  5FAP A;  3WS4 A;  4FD8 A;  4S2N A;  2OLV A;  4UA9 A;  1YLW A;  3BFE A;  5A93 A;  4WEL A;  1ONH A;  2WZZ A;  1GA0 A;  3ZG0 A;  1BLC A;  3IQA A;  5DTK A;  2P9V B;  4JXV A;  4JF6 A;  3HLB A;  4X55 A;  4Z9Q A;  3WRT A;  5TGF A;  1DJC A;  5JYO A;  3HL9 A;  4X69 A;  3HUO A;  2V2F F;  4LV3 A;  3VFH A;  3A3F A;  5EOO A;  1YQS A;  2ZQ9 A;  3C5A A;  4IVI A;  4WZ4 A;  4O7D A;  4E3M A;  3CJM A;  3CG5 A;  4QB8 A;  4MLL A;  1K55 C;  5EVI A;  4OOL A;  1IYO A;  2OSU A;  4MBF A;  1FR6 A;  3V3R A;  1TVF A;  1YMS A;  2QPN A;  3A3I A;  1NYM A;  1XGI A;  5EE8 A;  5JYP A;  1NYY A;  3GR2 A;  4KZ3 A;  1M6K A;  5GL9 A;  1Q2Q A;  4PM5 A;  1DJB A;  4ZDX A;  2X01 A;  2JBF A;  2B5R A;  4N1X A;  4U0T A;  5KZH A;  5M19 A;  4Y0O A;  3DW0 A;  4EV4 A;  2X02 A;  1GHP A;  4LV0 A;  4BL2 A;  3MKF A;  2IWC A;  4PPR A;  3UY6 A;  4DKI A;  1Z6F A;  2HDR A;  3M2J A;  1FCO A;  1XX2 A;  2HDS A;  5EVL A;  1XPB A;  1CEG A;  4BD1 A;  1LI9 A;  3PBQ A;  4DDS A;  1PW1 A;  3G30 A;  3DTM A;  3BFD A;  3BEC A;  3ITA A;  4Y0U A;  5CTN A;  3GMW A;  2G2U A;  1ZG4 A;  3MKE A;  4UA6 A;  3WS0 A;  4ZJ1 A;  2ZD8 A;  5IHV A;  4OPZ A;  3ZGA B;  1XA7 A;  3IF5 A;  4CPK A;  1L2S A;  4K0X A;  5AQ7 A;  3UDI A;  1MWS A;  2XD1 A;  2HPB A;  3HVF A;  2ZM8 A;  1G68 A;  1I5Q A;  3BFG A;  3WS5 A;  3GTC A;  3ITB A;  3P09 A;  3C7U A;  4P87 A;  4WZ5 C;  4B4X A;  2ZC5 B;  4GKU A;  4KZ6 A;  3O88 A;  4WEJ A;  1FQG A;  1N9B A;  3UPN A;  3ZFZ A;  2ZQC A;  2J9P A;  4BD0 A;  3N8R A;  2EFX A;  2V1Z A;  3G32 A;  3IWI A;  5BOH A;  1FSW A;  1VM1 A;  4DF6 A;  3ZCZ A;  1ES4 A;  3G34 A;  5E2E A;  1MWR A;  1MXO A;  3HLG A;  3SOI A;  3WS1 A;  1GHM A;  5FAS A;  5GLA A;  4S2K A;  1OME A;  1PI4 A;  2Z2L B;  3RXX A;  3Q81 A;  4KG6 A;  4EBL A;  1NZO A;  3PAG A;  4JLF A;  3MZE A;  5DF9 A;  2JE5 A;  1ERM A;  3ZNY A;  1BT5 A;  5E2F A;  2Y2P A;  5CTM A;  3IF6 B;  3BFC A;  3TOI A;  2XDM A;  4OPY A;  4C3Q A;  3IF6 C;  1BSG A;  4PM9 A;  2E8I A;  4PMA A;  5FA7 A;  2EFU A;  3ZG8 B;  4QY5 A;  4P85 A;  4LCL A;  1IKG A;  4MBH A;  1JWV A;  3ISG A;  3MBZ A;  4MEZ A;  1YMX A;  4N92 A;  3DWZ A;  1K56 D;  2Y59 A;  4HBU A;  2ZQ8 A;  3OPH A;  4GD6 A;  4JPM A;  1O7E A;  2EXA A;  4OLD A;  4RX2 A;  5HX9 A;  1H8Y A;  3LO7 A;  1NRF A;  3V50 A;  5GLC A;  3VSK A;  2Y2H A;  4KG5 A;  4M3K A;  4BJP A;  1K6R A;  4DDY A;  4IVK A;  5L2F A;  1BLS A;  1KE3 A;  2WYX A;  3PBT A;  4NET A;  1K6S A;  2WAF A;  5GHZ A;  1K4F A;  3Q7V B;  4GNU A;  1W8Q A;  3E2K A;  2Y91 A;  3GQZ A;  1TDG A;  3GV9 A;  1YLZ A;  3UE0 A;  2JCH A;  4GOG A;  3W4Q A;  3S22 A;  5DTT A;  4BL3 A;  2Y2N A;  5U47 A;  4EBP A;  2ZQ7 A;  5AQB A;  4WMC A;  3ZG7 B;  5D3O A;  1K55 A;  5EVI C;  4E3N A;  4S2O A;  2ZMA A;  1BUE A;  5HL1 A;  4XUZ A;  1E4D A;  4GDN A;  3W4O A;  3EQU A;  1QMF A;  1JTD A;  3FKW A;  3CZD A;  3Q1F A;  4HEF A;  5HAP A;  1TEM A;  3HUN A;  3P98 A;  3CMZ A;  3G4P A;  4FCF A;  4K0W A;  1HVB A;  3IWQ A;  1E3U A;  4E3O A;  5F1G A;  4ZJ2 A;  1RGY A;  1LL9 A;  4P6B A;  2DCF A;  1QME A;  3IF6 A;  5FAQ A;  2Y2G A;  5CHJ A;  2IWB A;  1RP5 A;  4R0Q A;  3N8S A;  3UDF A;  2DRW A;  2R9W A;  1M40 A;  1WYB A;  4LV2 A;  4KZ9 A;  3ZVW A;  3HRE A;  1DY6 A;  1JWZ A;  4R23 A;  3IH9 A;  3SS3 A;  5A90 A;  2JC7 A;  3LY4 A;  4WZ5 A;  1L0D A;  1ES5 A;  4KEN B;  2ZQD A;  1GCE A;  2Y2M A;  3QNC A;  2WZX A;  4GB7 A;  4ZTK A;  2Y2J A;  1IYP A;  3BRM A;  3Q07 A;  3VMA A;  3M6H A;  5FAO A;  3ZNT A;  4LEN A;  5FSR A;  1I2W A;  5HFO A;  1KGF A;  5GHY A;  1W7F A;  3G2Z A;  3ZDJ A;  4JBF A;  1KVM A;  3HLC A;  3PBR A;  3BLM A;  4KZB A;  4OQH A;  2J8Y A;  4OP8 A;  1LL5 A;  3UN7 A;  2VGK A;  2OV5 A;  1PI5 A;  5CGX A;  2X71 A;  2XFT A;  2XLN A;  5DF8 A;  1BTL A;  1FCN A;  4LV1 A;  3VOZ A;  4X53 A;  4B88 A;  4C6Y A;  3BFF A;  1BZA A;  4HES A;  1CEF A;  1XP4 A;  3FV7 A;  4CJN A;  3VOY A;  1E3U D;  4ZAM A;  1RCJ A;  3SH7 A;  2WKI A;  5TFQ A;  5E2H A;  3TSG A;  1GA9 A;  4RX3 A;  1MWU A;  1LLB A;  3MFD A;  4XXR A;  3PAE A;  2ZC3 B;  2ZM2 A;  3IH8 A;  1IYQ A;  5FAT A;  1YLJ A;  3IXG A;  4BLM A;  1Q2P A;  3M2K A;  1KGG A;  2WGV A;  1YT4 A;  1NZU A;  1ONG A;  5EPH A;  3RJU A;  4EQI A;  4JXW A;  1NJ4 A;  1NXY A;  1PYY A;  3C7V A;  2XR0 A;  4R3J A;  4U0X A;  2H5S A;  3IXH A;  5FQQ A;  2WUQ A;  3OZH A;  3UE3 A;  5J8X A;  5FDH A;  4ID4 A;  3UO9 A;  1KDS A;  3VP1 A;  3WWX A;  5DVA A;  4OVD A;  4E3I A;  4WYY A;  4S2L A;  1IKI A;  3OC2 A;  5CHM A;  1AXB A;  5A92 A;  4H8R A;  4DE1 A;  3S1Y A;  4S2I A;  3ZG5 A;  4UHU A;  1SCW A;  2H0Y A;  1KDW A;  4A5R A;  4EBN A;  2ZLY A;  2H10 A;  5KSC A;  2H0T A;  1K25 A;  1FCM A;  5FI6 A;  4OP5 A;  2VGJ A;  1KVL A;  2Q9M A;  2RL3 A;  3WS2 A;  1BLP A;  1CI9 A;  1IEL A;  2IWD A;  1K54 A;  1FOF A;  5CGW A;  3IXD A;  4WM9 A;  3ZVT A;  4S2N C;  4BEN A;  4OQI A;  4EWF A;  1ESU A;  3NBL A;  2QMI A;  4KQR A;  5EEC A;  3UDX A;  1MPL A;  3A3E A;  3AGF A;  3HLW A;  2PU2 A;  1K57 A;  4R4R A;  1SDN A;  2P9V A;  2XD5 A;  2BLS A;  4KQO A;  3UNW A;  3OCN A;  1HD8 A;  3OPL A;  3PBO A;  5HAR A;  1KE0 A;  4QU3 A;  2G2W A;  2C6W B;  4YIN A;  4D2O A;  2Y2I A;  2HDQ A;  3BM6 A;  5FQK A;  1ERQ A;  1LHY A;  4X68 A;  1XKZ A;  1PZP A;  2V20 A;  3G35 A;  2P74 A;  2WGI A;  4Y7P A;  1PW8 A;  2Y2O A;  4LCM A;  4E6W A;  1YLT A;  5FQJ A;  2ZC4 B;  4R3B A;  3E2L A;  2PBY A;  1GHI A;  2XQZ A;  2I72 A;  3G2Y A;  3IWO A;  4KZ4 A;  4JF5 A;  5F82 A;  3Q82 A;  4DE0 A;  4OQ0 A;  5TR7 A;  1WYC A;  1EWZ A;  3N4I A;  1PWC A;  3Q7Z A;  3HUM A;  4MBK A;  4X6T A;  3ZHH A;  3W4P A;  3IHA A;  4JXS A;  3LEZ A;  4R1G A;  5CER A;  4S2M A;  2ZM0 A;  3EQV A;  2WAD A;  1ESI A;  4OOY A;  4XUX A;  3C4O A;  3LY3 A;  5FI2 A;  1YLP A;  2PU4 A;  3VP2 A;  5FQI A;  2GDN A;  1IEM A;  3FZC A;  3NIA A;  1W8Y A;  1NY0 A;  5FQM A;  3HLD A;  4DRT A;  4IBR A;  2Y2L A;  1ERO A;  1FSY A;  2XK1 A;  4QY6 A;  4RVA A;  4KQQ A;  1H5X A;  3SH8 A;  4DE2 A;  4GN2 A;  4JKT A;  1JVJ A;  1L0F A;  1VQQ A;  2WGW A;  3FKV A;  3N6I A;  4R4S A;  4RYE A;  1DJA A;  1WE4 A;  5HAI A;  5CED A;  2Y2Q A;  2Y4A A;  4DXB A;  3M6B A;  1IYS A;  4E3J A;  3HLF A;  2BG1 A;  4UAA A;  1PWG A;  3QHY A;  2WAE A;  5E2G A;  5CGS A;  5GLB A;  1L0G A;  4DXC A;  3NDE A;  3V3S A;  3BYD A;  3V39 A;  2CC1 A;  4KZ8 A;  1SDE A;  3UE1 A;  1KGE A;  3N7W A;  1ZKJ A;  4ZBE A;  1K56 A;  5HAQ A;  4OON A;  2ZQA A;  1K4E A;  5DTS A;  2WKH A;  4JF4 A;  3SH9 A;  1S6R A;  1ZG6 A;  1ES2 A;  4KG2 A;  4PM7 A;  2OLU A;  1XA1 A;  1Y54 A;  1ALQ A;  2WKE A;  3SS4 A;  4OKP A;  1U60 A;  4OQG A;  5I94 A;  1W79 A;  3O87 A;  3Q7V A;  3IHB A;  4QJG A;  3G31 A;  3UPP A;  2EX2 A;  5FQ9 A;  3FWL A;  4OLG A;  2C5W B;  2QZ6 A;  4IBX A;  5KSH A;  5F1F A;  4ZJ3 A;  3PBS A;  4JXG A;  1H8Z A;  4KZ5 A;  4WBG A;  4FH4 A;  3NI9 A;  4GDB A;  4DE3 A;  4HBT A;  4GD8 A;  1CI8 A;  1C3B A;  1K57 C;  1J9M A;  3C4P A;  5CRF A;  5M18 A;  2Y55 A;  2HP9 A;  2J9O A;  3IXB A;  4WEK A;  4IED A;  2XGN A;  3ZG9 B;  3NC8 A;  3RXW A;  4YFM A;  4OPR A;  4S2P A;  1HZO A;  4EUZ A;  3MXR A;  1MKI A;  1ES3 A;  4OH0 A;  5FI7 A;  4L0L A;  1K54 C;  1S0W A;  3VP3 A;  2Q9N A;  3OCL A;  3NCK A;  3MZD A;  4N9L A;  4S2J A;  1MBL A;  1PZO A;  5CXW A;  1N4O A;  1I2S A;  3VP0 A;  1BUL A;  2HDU A;  5EVI D;  2Z2M B;  1K38 A;  5A91 A;  4QD4 A;  1LI0 A;  4WMC D;  2RCX A;  2WGW B;  1FR1 A;  1EI5 A;  1YLY A;  2HP5 A;  3JYI A;  5GLD A;  4UA7 A;  3VFF A;  4F94 A;  5KMW A;  1BLH A;  3NDG A;  1L0E A;  3BEB A;  4QHC A;  1MWT A;  4FH2 A;  1G6A A;  5CEC A;  3O86 A;  4X56 A;  3NY4 A;  4KZ7 A;  2UWX A;  4PM8 A;  5CEB A;  1PWD A;  2R9X A;  4GZB A;  2EX9 A;  2FFY A;  4PM6 A;  1SKF A;  1RGZ A;  2DNS A;  3MXS A;  3VSL A;  2XFS A;  5G18 A;  3GSG A;  4P0M A;  3UPO A;  1SHV A;  4E3K A;  1YM1 A;  1PIO A;  3PTE A;  4OOM A;  5CHU A;  1MY8 A;  1XXM A;  4K91 A;  3AGE A;  4C75 A;  4E6X A;  1JTG A;  2FFF B;  3LCE A;  3DWK A;  1E25 A;  1W5D A;  4BQM A; 
#chains in the Genus database with same CATH topology
 2ZC6 B;  3H82 A;  4BBV A;  4Q8I A;  4N9K A;  3F1N B;  3A3D A;  4MNR A;  4RA7 A;  4FOF A;  1TDL A;  2WK0 A;  5AQA A;  5GHX A;  1XGJ A;  3GRJ A;  4E3L A;  2EXB A;  2XF3 A;  3OPR A;  3A3J A;  3FYZ A;  3W8K A;  4U3T A;  1NRJ A;  3MXQ A;  2IA2 A;  4S2N A;  2NUT C;  2OLV A;  5A93 A;  1WA9 A;  2WZZ A;  1BLC A;  2V1A A;  5DTK A;  4X55 A;  5TGF A;  5JYO A;  2D02 A;  2V2F F;  1ACF A;  3VFH A;  1P97 A;  1F9I A;  2ZQ9 A;  4WZ4 A;  5DFY A;  2HV1 A;  4E3M A;  4QB8 A;  2YKF A;  5EVI A;  4EET B;  4UQI S;  4LFU A;  1FR6 A;  1TVF A;  2QPN A;  5HDD A;  1NYY A;  4KZ3 A;  4ZDX A;  2B5R A;  4N1X A;  5M19 A;  3DW0 A;  4EV4 A;  2X02 A;  1NLZ A;  3UY6 A;  2IWC A;  4DKI A;  3F1N A;  3QP8 A;  1XX2 A;  5EVL A;  1LI9 A;  4ARZ A;  5IS1 A;  4Y0U A;  5CTN A;  2G2U A;  3DAV A;  1G28 A;  3PYP A;  1XA7 A;  2QJ7 A;  1L2S A;  3LEQ A;  4K0X A;  3NJA A;  2XD1 A;  2HPB A;  3CIT A;  4G3V A;  2BAS A;  4WZ5 C;  2LB9 A;  4GKU A;  4WEJ A;  3U2A A;  1FQG A;  1N9B A;  3UPN A;  4YOF A;  3G34 A;  2VV6 A;  2L4R A;  3HLG A;  3SOI A;  2VJW A;  1OME A;  3RXX A;  4E04 A;  4EBL A;  5DF9 A;  4FUW A;  1ERM A;  3IF6 B;  3TOI A;  4OPY A;  2O99 A;  1BSG A;  2BTF P;  1IKG A;  4MBH A;  4Q0H A;  4MEZ A;  4G3W A;  1YMX A;  4N92 A;  5J3W A;  1K56 D;  2Y59 A;  4X1M A;  3CWF A;  2EWV A;  4OLD A;  3OPH A;  4JPM A;  1O7E A;  5HX9 A;  1H8Y A;  5GLC A;  4BJP A;  1K6R A;  5L2F A;  1BLS A;  4UQI M;  2PYP A;  4L9E A;  2W3G A;  3Q7V B;  1W8Q A;  2PD8 A;  3GV9 A;  4Y13 A;  2JCH A;  2OAP 1;  5DTT A;  4O8G A;  1OTB A;  2QHK A;  3ZG7 B;  1K55 A;  4GDN A;  4R3A A;  3FKW A;  1LL8 A;  4KUO A;  3IWQ A;  4MDZ A;  1RP5 A;  3N8S A;  4EU0 A;  1M40 A;  1WYB A;  3CPT A;  4KZ9 A;  3R7W A;  5J4E A;  4GLQ A;  2JC7 A;  1L0D A;  3QNC A;  2PBD P;  4YWZ A;  4ZTK A;  3BRM A;  1IYP A;  3Q07 A;  5FSR A;  3MFX A;  4LLO B;  3G2Z A;  3BQ8 A;  2VGK A;  3K3C A;  5CGX A;  1YSP A;  2XLN A;  4LV1 A;  4EER A;  1CEF A;  1XP4 A;  4HNB A;  3T1Q B;  1OJ5 A;  4ZAM A;  2HJ9 C;  2WKI A;  4RX3 A;  3PAE A;  3IH8 A;  1IYQ A;  4MMN A;  2PR6 A;  5EPH A;  1NZU A;  2JKT M;  3PR6 A;  5FL3 A;  3RJU A;  5HWV A;  1PYY A;  4U0X A;  1OTA A;  2XR0 A;  1VET A;  3C7V A;  4R3J A;  3UE3 A;  5FDH A;  5EFW A;  3WWX A;  2O9B A;  2QWS A;  3EOI A;  4WYY A;  4E3I A;  5HDC A;  5CHM A;  3S1Y A;  2K7S A;  4UHU A;  1KDW A;  1FCM A;  2A2L A;  2VGJ A;  1VEU A;  5HZH A;  1CI9 A;  2IWD A;  1K54 A;  4M4X A;  4OQI A;  5EEC A;  3AGF A;  3DTE A;  4ME4 A;  1NWZ A;  2XD5 A;  1ZHH B;  3OCN A;  2OWH A;  3IS2 B;  5KIZ A;  5L09 A;  4Y17 A;  4D2O A;  1F5M A;  1XKZ A;  1YLT A;  5FQJ A;  2ZC4 B;  4R3B A;  5F82 A;  3E2L A;  3G2Y A;  4O01 A;  4KZ4 A;  4IJG A;  4DE0 A;  5TR7 A;  2W3D A;  2I9V A;  1LSW A;  2JKT I;  1N9L A;  3IHA A;  1ZTU A;  3T4T A;  5CER A;  4P6Z M;  4S2M A;  2WAD A;  1YLP A;  2GDN A;  4FTX A;  3FZC A;  1W8Y A;  1NY0 A;  5L10 A;  3HLD A;  3S7N A;  1V9Y A;  1FSY A;  2XK1 A;  4D60 A;  3SH8 A;  1H5X A;  3OBF A;  4GN2 A;  2VKS A;  5HDS A;  4NEE D;  2PDR A;  1L0F A;  3N6I A;  3FKV A;  4R4S A;  2AVX A;  2PAV P;  3M6B A;  2BG1 A;  1XJ2 A;  3C38 A;  1STZ A;  3UB9 A;  1PWG A;  5CGS A;  4AFI A;  3BYD A;  2CC1 A;  4KZ8 A;  4ZBE A;  1K56 A;  3KX0 X;  4HJ6 A;  1K4E A;  3IX3 A;  4I3I A;  4JF4 A;  2GJ3 A;  3GEC A;  3BY9 A;  2XRO A;  2V8F A;  4PM7 A;  1XA1 A;  3SS4 A;  4OQG A;  5I94 A;  1W79 A;  2QKP A;  3JVV A;  5FQ9 A;  3S7O A;  3FWL A;  4OLG A;  2KDK A;  5KSH A;  3T4K A;  1V9Z A;  1PNE A;  3PBS A;  4JXG A;  4LRZ E;  1H8Z A;  3MMH A;  4KZ5 A;  3NI9 A;  2P7J A;  4IUK A;  4GD8 A;  1CI8 A;  3A0V A;  3LGO A;  3C4P A;  2HP9 A;  2J9O A;  2XGN A;  4I5S A;  3RXW A;  4LPZ A;  4S2P A;  3LIF A;  1HZO A;  4Y2F A;  5DKK A;  1MKI A;  1JNU A;  3T50 A;  3OCL A;  3MZD A;  3UE6 A;  2HDU A;  4CLC E;  3R4K A;  5A91 A;  4QD4 A;  1EI5 A;  2HP5 A;  3JYI A;  5GLD A;  4UA7 A;  1H8M A;  3SZT A;  1L0E A;  3RH8 B;  1MWT A;  4FH2 A;  4QPR A;  3NY4 A;  4KZ7 A;  4PM8 A;  2W3F A;  3VSL A;  4ETX A;  4P0M A;  3UPO A;  1SHV A;  2JN7 A;  5CHU A;  2FH5 A;  4K91 A;  2XA7 M;  4E6X A;  1JTG A;  2FFF B;  5IU1 A;  5EOE A;  2ZJ9 A;  5F83 A;  2Y2K A;  4Y0T A;  2K31 A;  2B95 A;  3E4Q A;  5EVE A;  3VP4 A;  1HTZ A;  4EW7 A;  1XFQ A;  4OPQ A;  3JVU A;  4UEY A;  3S4X A;  3PBN A;  2A3U A;  3IT9 A;  3O3V A;  2XH9 A;  4NK3 A;  4GS9 A;  3BLS A;  3OPP A;  3LIA A;  3MJQ A;  3BFE A;  3T4J A;  1MZU A;  1OT6 A;  2JHE A;  3HLB A;  3WRT A;  3KYE A;  1YSQ A;  3HUO A;  5EOO A;  2JKR I;  3T4L A;  4IVI A;  3HCY A;  3T4Q A;  4JGP A;  3CJM A;  4JGO A;  1IYO A;  3V3R A;  1NYM A;  3V67 A;  5GL9 A;  3HJI A;  2JBF A;  4U0T A;  1Z6F A;  1FCO A;  4XT2 B;  2HDS A;  1XPB A;  1LSX A;  1CEG A;  1UWN X;  3G30 A;  3DTM A;  3MKE A;  4WL9 A;  1ODV A;  4CPK A;  1FIK A;  3UDI A;  3HVF A;  2PT7 A;  3P09 A;  3C7U A;  4B4X A;  3O88 A;  2ZQC A;  3RTY A;  3N8R A;  4JGQ A;  3H7W A;  4GS9 B;  5BOH A;  1FSW A;  3ZCZ A;  1ES4 A;  5E2E A;  3NOP C;  5IT5 A;  2V1B A;  2K2N A;  5FAS A;  5GLA A;  1TS8 A;  3Q81 A;  4KG6 A;  3PAG A;  3MZE A;  2HZ5 A;  3ZNY A;  1BT5 A;  5E2F A;  3DTI A;  4NKP A;  1PRQ A;  3IF6 C;  3LR4 A;  4PM9 A;  2E8I A;  4PMA A;  5FA7 A;  2EFU A;  1BYW A;  3MBZ A;  3RFB A;  2O0Y A;  2B18 A;  4CLC C;  4RX2 A;  3F1O A;  2JKF A;  1NRF A;  4M3K A;  4F3L A;  4DDY A;  4IVK A;  1KE3 A;  2WYX A;  4GHI B;  2WAF A;  5GHZ A;  2EA9 A;  2Y91 A;  1TDG A;  3UE0 A;  1YLZ A;  4GOG A;  3S22 A;  5U47 A;  5AQB A;  4CLC A;  4E3N A;  4S2O A;  2ZMA A;  3F1P A;  5HL1 A;  1E4D A;  3W4O A;  2JKR M;  3EQU A;  3CZD A;  5HAP A;  4HEF A;  3CMZ A;  4FCF A;  3TE8 A;  2V9A A;  5F1G A;  4ZJ2 A;  4P6B A;  2DCF A;  3IF6 A;  4Q0I A;  4R0Q A;  3UDF A;  3FC7 A;  2O9C A;  3E98 A;  3HRE A;  1DY6 A;  1JWZ A;  4R23 A;  3BY8 A;  3SS3 A;  4G3K A;  5A90 A;  1LT0 A;  4KEN B;  2Y2M A;  4GB7 A;  3VMA A;  5FAO A;  5A8B A;  4DMZ A;  3ZNT A;  1KGF A;  5GHY A;  3IX4 A;  4JBF A;  1S1Y A;  3PBR A;  3BLM A;  4KZB A;  1MC0 A;  4OP8 A;  3UN7 A;  2OV5 A;  3VE4 A;  4Y15 A;  1BTL A;  4X53 A;  4CJN A;  5F68 A;  1RCJ A;  5G4Y A;  5TFQ A;  4CQH A;  2VV7 A;  5E2H A;  3TSG A;  1GA9 A;  1TS0 A;  3LUQ A;  2ZM2 A;  5AVF A;  3M2K A;  1YT4 A;  1NJ4 A;  2ZMV A;  2INW A;  4IUH A;  2H5S A;  2WUQ A;  3VP1 A;  5DVA A;  1T1C A;  4NG2 A;  4EEU A;  1IKI A;  4WF0 A;  2W3H A;  1AXB A;  5A92 A;  4H8R A;  4S2I A;  1SCW A;  3OLO A;  2M7V A;  1YKD A;  3L9K A;  3LFV A;  1K25 A;  2W1R A;  4OP5 A;  3MF0 A;  2Q9M A;  1IEL A;  1LSV A;  4ZRR A;  3P7N A;  4WM9 A;  3ZVT A;  3KO6 A;  4KQR A;  1P0Z A;  5J7E A;  1Y4O A;  4R4R A;  3UMD A;  2BLS A;  1KE0 A;  3T1S A;  1P9R A;  4X68 A;  2P74 A;  2WGI A;  3BW6 A;  3BQA A;  4HJ3 A;  4JF5 A;  1F98 A;  5TJJ A;  1WYC A;  1PWC A;  4NXB A;  1OTD A;  4X6T A;  3HUM A;  3ZHH A;  3W4P A;  3LEZ A;  4R1G A;  3LYX A;  5FI2 A;  4OOY A;  1SZV A;  3VP2 A;  2PU4 A;  5FQI A;  2CMN A;  4B9O A;  3NIA A;  5FQM A;  5HPF A;  1N9O A;  1ERO A;  2Y2L A;  4QWO A;  4JKT A;  1VQQ A;  4RYE A;  2J3T C;  3FPV A;  1WE4 A;  5HAI A;  5CED A;  2B02 A;  4JGR A;  2QYB A;  4PKY A;  5DJU A;  4E3J A;  5MC7 A;  3HLF A;  1SDE A;  3UE1 A;  2A24 A;  5HAQ A;  4OON A;  2KX6 A;  2ZQA A;  3SH9 A;  1S6R A;  1GSW A;  3T1R A;  3QP5 A;  2WKE A;  4OKP A;  1U60 A;  3KSH A;  4HY8 A;  3UPP A;  2EX2 A;  2QJ5 A;  2J3T D;  3QP6 A;  4CLC B;  1H3Q A;  4H6J A;  3ZQ5 A;  4WBG A;  4GDB A;  5L8M A;  1OT9 A;  4Q0J A;  1K57 C;  2GX5 A;  5CRF A;  2Y55 A;  4WEK A;  4YFM A;  2G7U A;  4OH0 A;  1K54 C;  3NCK A;  4S2J A;  2VK3 A;  5CXW A;  3VP0 A;  2Z2M B;  1CJF A;  3DTK A;  4I39 A;  1FR1 A;  3O5Y A;  4PHT A;  4HQA A;  4O0P A;  3VFF A;  4F94 A;  1BLH A;  3NDG A;  4R70 A;  3BEB A;  1G6A A;  3T4S A;  3O86 A;  4X56 A;  2R9X A;  4PM6 A;  1RGZ A;  3MXS A;  2E8J A;  3GSG A;  5C5K A;  4E3K A;  1YM1 A;  3PTE A;  4OOM A;  1XXM A;  3AGE A;  4KUK A;  2LB5 A;  4BQM A;  3AGD A;  2J7V A;  5DF7 A;  3VE3 A;  3D4F A;  3HLE A;  2A49 A;  3QNB A;  4HOI A;  1DP9 A;  3MZF A;  3E4P A;  1KE4 A;  5EV0 A;  2EX8 A;  3N8L A;  5EVI B;  1CK3 A;  2YKH A;  2HP6 A;  3HBR A;  3I7J A;  4WUJ A;  5M1A A;  4N1H A;  4KZA A;  4HHD A;  1VEU B;  4LRY C;  4FD8 A;  1G5U A;  4UA9 A;  1ONH A;  2VLG A;  1GA0 A;  1T1A A;  3IQA A;  2P9V B;  4JXV A;  4Z9Q A;  3LIC A;  1DJC A;  3LID A;  4LV3 A;  1YQS A;  2HJE A;  3C5A A;  4LGW A;  4O7D A;  3K3D A;  4MLL A;  1K55 C;  4OOL A;  2WKQ A;  3B47 A;  5EE8 A;  3GR2 A;  1M6K A;  4BBT A;  4PM5 A;  1DJB A;  4NXG A;  4BL2 A;  3MKF A;  4PPR A;  2HDR A;  3C2W A;  4BD1 A;  3CI6 A;  3PBQ A;  4DDS A;  3U4L P;  1FIL A;  3BEC A;  4GCZ A;  3WS0 A;  1ZG4 A;  4ZJ1 A;  2ZBB A;  5IHV A;  4OPZ A;  3ZGA B;  1MWS A;  2ZM8 A;  1I5Q A;  3BFG A;  4Y3I A;  3GTC A;  3FPW A;  1X0O A;  1XJ6 A;  3ZFZ A;  5HD5 A;  2EFX A;  2V1Z A;  1VM1 A;  4DF6 A;  1PI4 A;  2Z2L B;  2Q0O A;  1NZO A;  4JLF A;  2JE5 A;  5CTM A;  1SKO B;  3BFC A;  1H0M A;  4C3Q A;  1S66 L;  1N9N A;  2ZOH A;  4YNR A;  2XRN A;  4MN6 A;  2XSS A;  4P85 A;  4LCL A;  2PHY A;  1JWV A;  3ISG A;  2VGL S;  2HF6 A;  3ZYT A;  2ZQ8 A;  3CAX A;  1MKM A;  2VEA A;  2PYR A;  3LO7 A;  3V50 A;  2Y2H A;  4KG5 A;  4F3L B;  3LIE A;  3EEH A;  3PBT A;  3A0R A;  1W63 M;  3CLO A;  1K4F A;  2XA7 S;  3QP4 A;  3W4Q A;  2ZQ7 A;  5D3O A;  5EVI C;  4XUZ A;  4MCW A;  3R7W B;  4DJ3 A;  3LR0 A;  1JTD A;  3HUN A;  3P98 A;  4E3O A;  5AVE A;  1E3U A;  4EXO A;  1RGY A;  1LL9 A;  4ETZ A;  5F6A A;  2R9W A;  4LV2 A;  4B93 A;  3EEA A;  3MS6 A;  3A0S A;  3IH9 A;  2GZA A;  4HH2 A;  3LY4 A;  4WZ5 A;  1OPX A;  2PR5 A;  3MQQ A;  2WZX A;  5HD3 A;  4RQ9 A;  4I3J A;  5HFO A;  1EW0 A;  1W7F A;  4GHI A;  4L9F A;  3ZDJ A;  2OOL A;  3HLC A;  1VHM A;  2J8Y A;  1LL5 A;  2Z6C A;  2X71 A;  3MQO A;  5DF8 A;  3VOZ A;  4C6Y A;  3FV7 A;  1W63 Q;  1Z09 A;  3SH7 A;  1MWU A;  1LLB A;  3KSI A;  1YLJ A;  1Q2P A;  1F2K A;  1ONG A;  4EQI A;  2W1T A;  1L3L A;  3IS2 A;  5FQQ A;  5EM0 A;  4ID4 A;  3UO9 A;  1D06 A;  4S2L A;  1UGU A;  3ZG5 A;  1TS6 A;  2ZLY A;  2W1T B;  2H10 A;  2H0T A;  1KVL A;  3HJK A;  1UWP X;  1OTI A;  3D72 A;  4GJ4 A;  4S2N C;  4GW9 A;  4EWF A;  4P6Z S;  5G4Z A;  5F69 A;  2QMI A;  3UDX A;  3A3E A;  2M7U A;  1XJ3 A;  3HLW A;  1K57 A;  4X1L A;  1SDN A;  4KQO A;  3UNW A;  2KOI A;  3PBO A;  2G2W A;  2HDQ A;  1LHY A;  2V20 A;  3G35 A;  4R38 A;  4Y7P A;  1PW8 A;  2Y2O A;  3NOT C;  4EES A;  2PBY A;  2XQZ A;  2I72 A;  3IWO A;  3Q82 A;  4OQ0 A;  1TD5 A;  5I5L A;  2VV8 A;  4MN5 A;  2PD7 A;  1EWZ A;  3N4I A;  3IBJ A;  1VET B;  3C30 A;  4MBK A;  3TJZ C;  2ZM0 A;  3EQV A;  4XUX A;  3C4O A;  5FEF A;  4QY6 A;  4KQQ A;  4DE2 A;  3E4O A;  4L9G A;  1JVJ A;  1XFN A;  3K2N A;  4BMW A;  2Y2Q A;  4DXB A;  3CUE C;  4BBU A;  3IX8 A;  2W3E A;  4UAA A;  2WKR A;  5E2G A;  5GLB A;  4DXC A;  1ZKJ A;  3H7W B;  3S7Q A;  3LR3 A;  5DTS A;  1ES2 A;  4KG2 A;  1Y54 A;  1ALQ A;  2VZW A;  2FZ0 A;  4QJG A;  2C5W B;  2QZ6 A;  4IBX A;  5F1F A;  5L07 A;  3ICY A;  4DE3 A;  4CLC D;  1C3B A;  1J9M A;  5TBM B;  1D1J A;  3ZG9 B;  3PXP A;  3NC8 A;  4HP4 A;  4OPR A;  4EUZ A;  1ES3 A;  4NXE A;  5FI7 A;  4L0L A;  3W2Z A;  2Q9N A;  3LIB A;  4Y5F A;  4N9L A;  3UB8 A;  1YPR A;  1I2S A;  1BUL A;  3ULF A;  5EVI D;  4WMC D;  2WGW B;  1A0K A;  1YLY A;  5KMW A;  5K5B A;  5CEC A;  2L1M A;  3C8C A;  2ACG A;  2UWX A;  4GZB A;  1PWD A;  3B42 A;  2XFS A;  5G18 A;  3F1P B;  1PIO A;  3NEC A;  1VB6 A;  3UB5 P;  3DWK A;  1E25 A;  1W5D A;  4HH3 A;  3V5M A;  3NUL A;  2ZC7 A;  5E43 A;  1O07 A;  3UB6 A;  3WRZ A;  3TG9 A;  3GVB A;  1JWP A;  3SS5 A;  3F1O B;  3D9Y A;  5HW3 A;  1ZC2 A;  3B3X A;  5EM1 A;  4K08 A;  2W0N A;  2Y79 A;  3KSG A;  2MJ6 A;  5AQ9 A;  1YAX A;  5EUA A;  2XEP A;  4B4Z A;  4FSF A;  2EX6 A;  5FAP A;  3WS4 A;  1SKO A;  2DMW A;  1YLW A;  4WEL A;  3ZG0 A;  4JF6 A;  3HL9 A;  4X69 A;  3A3F A;  5FEG A;  3CG5 A;  4II7 A;  2OSU A;  4MBF A;  3A3I A;  1YMS A;  1XGI A;  5JYP A;  1Q2Q A;  5LBR A;  1DRM A;  2X01 A;  2UV0 E;  5KZH A;  4Y0O A;  1GHP A;  4LV0 A;  3FG8 A;  3M2J A;  5HSQ A;  5CX7 A;  2ZMF A;  1DP8 A;  1PW1 A;  2D01 A;  2J3W A;  3BFD A;  3ITA A;  3GMW A;  4UA6 A;  4DN0 A;  3MSH A;  3T12 B;  1OJG A;  3IBR A;  2ZD8 A;  4R6L A;  3IF5 A;  3E0Y A;  3EGD C;  4I3A A;  5AQ7 A;  2HGV A;  1G68 A;  2OAQ 1;  1K0K A;  3KYZ A;  5DFX A;  3WS5 A;  3ITB A;  4P87 A;  2OWJ A;  2ZC5 B;  4KZ6 A;  2J9P A;  2ZL1 B;  4BD0 A;  3CHW P;  3G32 A;  3IWI A;  1MWR A;  1MXO A;  3WS1 A;  1GHM A;  1D7E A;  4S2K A;  2H28 A;  3BWL A;  3UB7 A;  2Y2P A;  3LR5 A;  3D3O A;  2XDM A;  1DP6 A;  2WKP A;  4KQD A;  3ZG8 B;  3P01 A;  1J3W A;  4QY5 A;  3GDI A;  2V0W A;  2J80 A;  3DWZ A;  3KSF A;  4HBU A;  5FDS A;  4GD6 A;  1P9W A;  3DBA A;  2EXA A;  3VSK A;  4HJ4 A;  4NET A;  1K6S A;  2PRF A;  4GNU A;  1XJ4 A;  3E2K A;  3GQZ A;  3B33 A;  4BL3 A;  2Y2N A;  1GSV A;  4EBP A;  2ZOI A;  4WMC A;  2L0W A;  3G6O A;  2V0U A;  1BUE A;  1QMF A;  1TF1 A;  3Q1F A;  1TEM A;  3G4P A;  4K0W A;  1HVB A;  1S67 L;  4PKY G;  1QME A;  5FAQ A;  2Y2G A;  5CHJ A;  2IWB A;  1NLY A;  2DRW A;  3ZVW A;  4X25 A;  5HWT A;  3QP1 A;  2VX8 A;  1CQA A;  3EGX C;  1ES5 A;  3BJN A;  2ZQD A;  1GCE A;  3NHQ A;  2Y2J A;  3M6H A;  3VV4 A;  4LEN A;  1KOU A;  1I2W A;  2EWW A;  1S1Z A;  3L7H A;  4IHQ A;  1KVM A;  4OQH A;  3T1X A;  4Z1W A;  3OOV A;  1PI5 A;  2XFT A;  1FCN A;  4B88 A;  1PFL A;  4EEP A;  3BFF A;  1BZA A;  4HES A;  3VOY A;  1E3U D;  3MFD A;  4XXR A;  2ZC3 B;  3SW1 A;  3KYQ A;  5FAT A;  4BLM A;  3IXG A;  1KGG A;  2WGV A;  4JXW A;  1S4S A;  2Y8H A;  1NXY A;  3IXH A;  3OZH A;  5J8X A;  1KDS A;  4OVD A;  4BWI A;  3OC2 A;  4DE1 A;  2H0Y A;  4A5R A;  4EBN A;  3NOU C;  5KSC A;  5FI6 A;  2RL3 A;  3WS2 A;  1BLP A;  1FOF A;  5CGW A;  3QP2 A;  3IXD A;  4BEN A;  3MQ0 A;  3H82 B;  1ESU A;  3NBL A;  1MPL A;  2W27 A;  5DKL A;  2ZL1 A;  2PU2 A;  1T18 A;  2P9V A;  4HI4 A;  3OPL A;  1HD8 A;  5HAR A;  4QU3 A;  2C6W B;  3PHY A;  4YIN A;  2Y2I A;  3BM6 A;  5FQK A;  1ERQ A;  1PZP A;  4E6W A;  4LCM A;  1GHI A;  2Z6D A;  1G6O A;  4DJ2 A;  4ESP A;  1Y28 A;  3Q7Z A;  4EUV A;  2A24 B;  4WN5 A;  2VGL M;  1OTE A;  4JXS A;  2R78 A;  1ESI A;  3TW8 A;  3LY3 A;  3H9W A;  1IEM A;  1TS7 A;  4DRT A;  4IBR A;  4RVA A;  3LI8 A;  4LRX C;  2WGW A;  1DJA A;  1GSX A;  2NUP C;  3UME A;  2Y4A A;  1IYS A;  2V8C A;  3MR0 A;  3QHY A;  2WAE A;  1L0G A;  3NDE A;  3V3S A;  3V39 A;  1KGE A;  3N7W A;  2P04 A;  1IOU A;  2WKH A;  1ZG6 A;  2OLU A;  2VA0 A;  4XT2 A;  4H6J B;  5F5Y A;  3O87 A;  3Q7V A;  3IHB A;  3G31 A;  2P08 A;  5HWW A;  2JKG A;  4ARZ B;  4ZJ3 A;  4I38 A;  3EWK A;  3VOL A;  4FH4 A;  4HBT A;  4PAU A;  2O9A A;  5M18 A;  3IXB A;  4IED A;  3S7P A;  3TRC A;  4WLA A;  3CUE A;  3MXR A;  1CF0 A;  4HIA A;  1HLU P;  1S0W A;  3VP3 A;  2M1C A;  1MBL A;  1PZO A;  4HP9 A;  1N4O A;  4NXF A;  5HL6 A;  1K38 A;  2KLI A;  1AWI A;  3CPT B;  1LI0 A;  2RCX A;  5HPI A;  4MN7 A;  3T4O A;  4EQ1 A;  3LI9 A;  4QHC A;  5AJG A;  3JPU A;  1S4R A;  1T19 A;  5CEB A;  1IFQ A;  2EX9 A;  2FFY A;  2GNX A;  1SKF A;  2DNS A;  5TBM A;  1T1B A;  4C75 A;  1MY8 A;  5DJT A;  3LCE A; 
#chains in the Genus database with same CATH homology
 2ZC6 B;  5EOE A;  2ZJ9 A;  3AGD A;  5F83 A;  3V5M A;  2J7V A;  5DF7 A;  2Y2K A;  3D4F A;  4Q8I A;  3HLE A;  4Y0T A;  2ZC7 A;  4N9K A;  5E43 A;  2A49 A;  1O07 A;  3QNB A;  3WRZ A;  3A3D A;  4MNR A;  4RA7 A;  3MZF A;  1KE4 A;  1TDL A;  2EX8 A;  3VP4 A;  3TG9 A;  2WK0 A;  3GVB A;  1JWP A;  1HTZ A;  3N8L A;  5AQA A;  5EVI B;  1CK3 A;  5GHX A;  1XGJ A;  3SS5 A;  3GRJ A;  5HW3 A;  4E3L A;  2HP6 A;  4OPQ A;  1ZC2 A;  3B3X A;  3HBR A;  3I7J A;  3S4X A;  2EXB A;  2XF3 A;  3OPR A;  5M1A A;  3A3J A;  3PBN A;  3FYZ A;  4N1H A;  2A3U A;  3IT9 A;  3W8K A;  5AQ9 A;  5EUA A;  3O3V A;  2XH9 A;  2XEP A;  4KZA A;  4U3T A;  4B4Z A;  4NK3 A;  3BLS A;  4FSF A;  2EX6 A;  3OPP A;  5FAP A;  3WS4 A;  4FD8 A;  4S2N A;  2OLV A;  4UA9 A;  1YLW A;  3BFE A;  5A93 A;  4WEL A;  1ONH A;  2WZZ A;  1GA0 A;  3ZG0 A;  1BLC A;  3IQA A;  5DTK A;  2P9V B;  4JXV A;  4JF6 A;  3HLB A;  4X55 A;  4Z9Q A;  3WRT A;  5TGF A;  1DJC A;  5JYO A;  3HL9 A;  4X69 A;  3HUO A;  2V2F F;  4LV3 A;  3VFH A;  3A3F A;  5EOO A;  1YQS A;  2ZQ9 A;  3C5A A;  4IVI A;  4WZ4 A;  4O7D A;  4E3M A;  3CJM A;  3CG5 A;  4QB8 A;  4MLL A;  1K55 C;  5EVI A;  4OOL A;  1IYO A;  2OSU A;  4MBF A;  1FR6 A;  3V3R A;  1TVF A;  1YMS A;  2QPN A;  3A3I A;  1NYM A;  1XGI A;  5EE8 A;  5JYP A;  1NYY A;  3GR2 A;  4KZ3 A;  1M6K A;  5GL9 A;  1Q2Q A;  4PM5 A;  1DJB A;  4ZDX A;  2X01 A;  2JBF A;  2B5R A;  4N1X A;  4U0T A;  5KZH A;  5M19 A;  4Y0O A;  3DW0 A;  4EV4 A;  2X02 A;  1GHP A;  4LV0 A;  4BL2 A;  3MKF A;  2IWC A;  4PPR A;  3UY6 A;  4DKI A;  1Z6F A;  2HDR A;  3M2J A;  1FCO A;  1XX2 A;  2HDS A;  5EVL A;  1XPB A;  1CEG A;  4BD1 A;  1LI9 A;  3PBQ A;  4DDS A;  1PW1 A;  3G30 A;  3DTM A;  3BFD A;  3BEC A;  3ITA A;  4Y0U A;  5CTN A;  3GMW A;  2G2U A;  1ZG4 A;  3MKE A;  4UA6 A;  3WS0 A;  4ZJ1 A;  2ZD8 A;  5IHV A;  4OPZ A;  3ZGA B;  1XA7 A;  3IF5 A;  4CPK A;  1L2S A;  4K0X A;  5AQ7 A;  3UDI A;  1MWS A;  2XD1 A;  2HPB A;  3HVF A;  2ZM8 A;  1G68 A;  1I5Q A;  3BFG A;  3WS5 A;  3GTC A;  3ITB A;  3P09 A;  3C7U A;  4P87 A;  4WZ5 C;  4B4X A;  2ZC5 B;  4GKU A;  4KZ6 A;  3O88 A;  4WEJ A;  1FQG A;  1N9B A;  3UPN A;  3ZFZ A;  2ZQC A;  2J9P A;  4BD0 A;  3N8R A;  2EFX A;  2V1Z A;  3G32 A;  3IWI A;  5BOH A;  1FSW A;  1VM1 A;  4DF6 A;  3ZCZ A;  1ES4 A;  3G34 A;  5E2E A;  1MWR A;  1MXO A;  3HLG A;  3SOI A;  3WS1 A;  1GHM A;  5FAS A;  5GLA A;  4S2K A;  1OME A;  1PI4 A;  2Z2L B;  3RXX A;  3Q81 A;  4KG6 A;  4EBL A;  1NZO A;  3PAG A;  4JLF A;  3MZE A;  5DF9 A;  2JE5 A;  1ERM A;  3ZNY A;  1BT5 A;  5E2F A;  2Y2P A;  5CTM A;  3IF6 B;  3BFC A;  3TOI A;  2XDM A;  4OPY A;  4C3Q A;  3IF6 C;  1BSG A;  4PM9 A;  2E8I A;  4PMA A;  5FA7 A;  2EFU A;  3ZG8 B;  4QY5 A;  4P85 A;  4LCL A;  1IKG A;  4MBH A;  1JWV A;  3ISG A;  3MBZ A;  4MEZ A;  1YMX A;  4N92 A;  3DWZ A;  1K56 D;  2Y59 A;  4HBU A;  2ZQ8 A;  3OPH A;  4GD6 A;  4JPM A;  1O7E A;  2EXA A;  4OLD A;  4RX2 A;  5HX9 A;  1H8Y A;  3LO7 A;  1NRF A;  3V50 A;  5GLC A;  3VSK A;  2Y2H A;  4KG5 A;  4M3K A;  4BJP A;  1K6R A;  4DDY A;  4IVK A;  5L2F A;  1BLS A;  1KE3 A;  2WYX A;  3PBT A;  4NET A;  1K6S A;  2WAF A;  5GHZ A;  1K4F A;  3Q7V B;  4GNU A;  1W8Q A;  3E2K A;  2Y91 A;  3GQZ A;  1TDG A;  3GV9 A;  1YLZ A;  3UE0 A;  2JCH A;  4GOG A;  3W4Q A;  3S22 A;  5DTT A;  4BL3 A;  2Y2N A;  5U47 A;  4EBP A;  2ZQ7 A;  5AQB A;  4WMC A;  3ZG7 B;  5D3O A;  1K55 A;  5EVI C;  4E3N A;  4S2O A;  2ZMA A;  1BUE A;  5HL1 A;  4XUZ A;  1E4D A;  4GDN A;  3W4O A;  3EQU A;  1QMF A;  1JTD A;  3FKW A;  3CZD A;  3Q1F A;  4HEF A;  5HAP A;  1TEM A;  3HUN A;  3P98 A;  3CMZ A;  3G4P A;  4FCF A;  4K0W A;  1HVB A;  3IWQ A;  1E3U A;  4E3O A;  5F1G A;  4ZJ2 A;  1RGY A;  1LL9 A;  4P6B A;  2DCF A;  1QME A;  3IF6 A;  5FAQ A;  2Y2G A;  5CHJ A;  2IWB A;  1RP5 A;  4R0Q A;  3N8S A;  3UDF A;  2DRW A;  2R9W A;  1M40 A;  1WYB A;  4LV2 A;  4KZ9 A;  3ZVW A;  3HRE A;  1DY6 A;  1JWZ A;  4R23 A;  3IH9 A;  3SS3 A;  5A90 A;  2JC7 A;  3LY4 A;  4WZ5 A;  1L0D A;  1ES5 A;  4KEN B;  2ZQD A;  1GCE A;  2Y2M A;  3QNC A;  2WZX A;  4GB7 A;  4ZTK A;  2Y2J A;  1IYP A;  3BRM A;  3Q07 A;  3VMA A;  3M6H A;  5FAO A;  3ZNT A;  4LEN A;  5FSR A;  1I2W A;  5HFO A;  1KGF A;  5GHY A;  1W7F A;  3G2Z A;  3ZDJ A;  4JBF A;  1KVM A;  3HLC A;  3PBR A;  3BLM A;  4KZB A;  4OQH A;  2J8Y A;  4OP8 A;  1LL5 A;  3UN7 A;  2VGK A;  2OV5 A;  1PI5 A;  5CGX A;  2X71 A;  2XFT A;  2XLN A;  5DF8 A;  1BTL A;  1FCN A;  4LV1 A;  3VOZ A;  4X53 A;  4B88 A;  4C6Y A;  3BFF A;  1BZA A;  4HES A;  1CEF A;  1XP4 A;  3FV7 A;  4CJN A;  3VOY A;  1E3U D;  4ZAM A;  1RCJ A;  3SH7 A;  2WKI A;  5TFQ A;  5E2H A;  3TSG A;  1GA9 A;  4RX3 A;  1MWU A;  1LLB A;  3MFD A;  4XXR A;  3PAE A;  2ZC3 B;  2ZM2 A;  3IH8 A;  1IYQ A;  5FAT A;  1YLJ A;  3IXG A;  4BLM A;  1Q2P A;  3M2K A;  1KGG A;  2WGV A;  1YT4 A;  1NZU A;  1ONG A;  5EPH A;  3RJU A;  4EQI A;  4JXW A;  1NJ4 A;  1NXY A;  1PYY A;  3C7V A;  2XR0 A;  4R3J A;  4U0X A;  2H5S A;  3IXH A;  5FQQ A;  2WUQ A;  3OZH A;  3UE3 A;  5J8X A;  5FDH A;  4ID4 A;  3UO9 A;  1KDS A;  3VP1 A;  3WWX A;  5DVA A;  4OVD A;  4E3I A;  4WYY A;  4S2L A;  1IKI A;  3OC2 A;  5CHM A;  1AXB A;  5A92 A;  4H8R A;  4DE1 A;  3S1Y A;  4S2I A;  3ZG5 A;  4UHU A;  1SCW A;  2H0Y A;  1KDW A;  4A5R A;  4EBN A;  2ZLY A;  2H10 A;  5KSC A;  2H0T A;  1K25 A;  1FCM A;  5FI6 A;  4OP5 A;  2VGJ A;  1KVL A;  2Q9M A;  2RL3 A;  3WS2 A;  1BLP A;  1CI9 A;  1IEL A;  2IWD A;  1K54 A;  1FOF A;  5CGW A;  3IXD A;  4WM9 A;  3ZVT A;  4S2N C;  4BEN A;  4OQI A;  4EWF A;  1ESU A;  3NBL A;  2QMI A;  4KQR A;  5EEC A;  3UDX A;  1MPL A;  3A3E A;  3AGF A;  3HLW A;  2PU2 A;  1K57 A;  4R4R A;  1SDN A;  2P9V A;  2XD5 A;  2BLS A;  4KQO A;  3UNW A;  3OCN A;  1HD8 A;  3OPL A;  3PBO A;  5HAR A;  1KE0 A;  4QU3 A;  2G2W A;  2C6W B;  4YIN A;  4D2O A;  2Y2I A;  2HDQ A;  3BM6 A;  5FQK A;  1ERQ A;  1LHY A;  4X68 A;  1XKZ A;  1PZP A;  2V20 A;  3G35 A;  2P74 A;  2WGI A;  4Y7P A;  1PW8 A;  2Y2O A;  4LCM A;  4E6W A;  1YLT A;  5FQJ A;  2ZC4 B;  4R3B A;  3E2L A;  2PBY A;  1GHI A;  2XQZ A;  2I72 A;  3G2Y A;  3IWO A;  4KZ4 A;  4JF5 A;  5F82 A;  3Q82 A;  4DE0 A;  4OQ0 A;  5TR7 A;  1WYC A;  1EWZ A;  3N4I A;  1PWC A;  3Q7Z A;  3HUM A;  4MBK A;  4X6T A;  3ZHH A;  3W4P A;  3IHA A;  4JXS A;  3LEZ A;  4R1G A;  5CER A;  4S2M A;  2ZM0 A;  3EQV A;  2WAD A;  1ESI A;  4OOY A;  4XUX A;  3C4O A;  3LY3 A;  5FI2 A;  1YLP A;  2PU4 A;  3VP2 A;  5FQI A;  2GDN A;  1IEM A;  3FZC A;  3NIA A;  1W8Y A;  1NY0 A;  5FQM A;  3HLD A;  4DRT A;  4IBR A;  2Y2L A;  1ERO A;  1FSY A;  2XK1 A;  4QY6 A;  4RVA A;  4KQQ A;  1H5X A;  3SH8 A;  4DE2 A;  4GN2 A;  4JKT A;  1JVJ A;  1L0F A;  1VQQ A;  2WGW A;  3FKV A;  3N6I A;  4R4S A;  4RYE A;  1DJA A;  1WE4 A;  5HAI A;  5CED A;  2Y2Q A;  2Y4A A;  4DXB A;  3M6B A;  1IYS A;  4E3J A;  3HLF A;  2BG1 A;  4UAA A;  1PWG A;  3QHY A;  2WAE A;  5E2G A;  5CGS A;  5GLB A;  1L0G A;  4DXC A;  3NDE A;  3V3S A;  3BYD A;  3V39 A;  2CC1 A;  4KZ8 A;  1SDE A;  3UE1 A;  1KGE A;  3N7W A;  1ZKJ A;  4ZBE A;  1K56 A;  5HAQ A;  4OON A;  2ZQA A;  1K4E A;  5DTS A;  2WKH A;  4JF4 A;  3SH9 A;  1S6R A;  1ZG6 A;  1ES2 A;  4KG2 A;  4PM7 A;  2OLU A;  1XA1 A;  1Y54 A;  1ALQ A;  2WKE A;  3SS4 A;  4OKP A;  1U60 A;  4OQG A;  5I94 A;  1W79 A;  3O87 A;  3Q7V A;  3IHB A;  4QJG A;  3G31 A;  3UPP A;  2EX2 A;  5FQ9 A;  3FWL A;  4OLG A;  2C5W B;  2QZ6 A;  4IBX A;  5KSH A;  5F1F A;  4ZJ3 A;  3PBS A;  4JXG A;  1H8Z A;  4KZ5 A;  4WBG A;  4FH4 A;  3NI9 A;  4GDB A;  4DE3 A;  4HBT A;  4GD8 A;  1CI8 A;  1C3B A;  1K57 C;  1J9M A;  3C4P A;  5CRF A;  5M18 A;  2Y55 A;  2HP9 A;  2J9O A;  3IXB A;  4WEK A;  4IED A;  2XGN A;  3ZG9 B;  3NC8 A;  3RXW A;  4YFM A;  4OPR A;  4S2P A;  1HZO A;  4EUZ A;  3MXR A;  1MKI A;  1ES3 A;  4OH0 A;  5FI7 A;  4L0L A;  1K54 C;  1S0W A;  3VP3 A;  2Q9N A;  3OCL A;  3NCK A;  3MZD A;  4N9L A;  4S2J A;  1MBL A;  1PZO A;  5CXW A;  1N4O A;  1I2S A;  3VP0 A;  1BUL A;  2HDU A;  5EVI D;  2Z2M B;  1K38 A;  5A91 A;  4QD4 A;  1LI0 A;  4WMC D;  2RCX A;  2WGW B;  1FR1 A;  1EI5 A;  1YLY A;  2HP5 A;  3JYI A;  5GLD A;  4UA7 A;  3VFF A;  4F94 A;  5KMW A;  1BLH A;  3NDG A;  1L0E A;  3BEB A;  4QHC A;  1MWT A;  4FH2 A;  1G6A A;  5CEC A;  3O86 A;  4X56 A;  3NY4 A;  4KZ7 A;  2UWX A;  4PM8 A;  5CEB A;  1PWD A;  2R9X A;  4GZB A;  2EX9 A;  2FFY A;  4PM6 A;  1SKF A;  1RGZ A;  2DNS A;  3MXS A;  3VSL A;  2XFS A;  5G18 A;  3GSG A;  4P0M A;  3UPO A;  1SHV A;  4E3K A;  1YM1 A;  1PIO A;  3PTE A;  4OOM A;  5CHU A;  1MY8 A;  1XXM A;  4K91 A;  3AGE A;  4C75 A;  4E6X A;  1JTG A;  2FFF B;  3LCE A;  3DWK A;  1E25 A;  1W5D A;  4BQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...