2W0NA

Plasticity of pas domain and potential role for signal transduction in the histidine-kinase dcus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GHMGLEPYEISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRLLLINTVPVRSNGVIIGAISTFRDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SENSOR PROTEIN DCUS
publication title Plasticity of the Pas Domain and a Potential Role for Signal Transduction in the Histidine Kinase Dcus.
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w0nA00
3GDIA 5HSQA 1TS6A 1S1YA 5DKLA 4R38A 2HV1A 2VEAA 2KX6A 4HH3A 5J4EA 3G6OA 2KDKA 4HNBA 3D72A 1DP9A 4GS9A 5F5YA 4HHDA 4EEPA 2V1AA 4HJ3A 4HQAA 4WF0A 5AVFA 4HOIA 2VV8A 1Y28A 5HD3A 3MFXA 1OJGA 2QJ7A 3VE4A 1OTEA 2QWSA 5A8BA 4EESA 3MXQA 5HWVA 3VOLA 2PD7A 5HDDA 2CMNA 1XJ3A 2PD8A 3NOPC 4H6JA 5HZHA 2OWHA 3KX0X 4EEUA 1XJ2A 1JNUA 4HJ4A 2GJ3A 2H28A 1N9OA 3RTYA 1T18A 2L4RA 5F68A 5J7EA 5HWWA 2V0WA 2V9AA 3EEHA 3OLOA 3UB9A 3UB7A 1T1BA 3A0SA 5TBMB 3SW1A 1OTDA 4NXGA 4KUOA 2PYPA 3ZQ5A 3A0RA 4YWZA 3MJQA 2YKHA 4LLOB 4PKYA 5IS1A 4HH2A 4I39A 3BY8A 2R78A 4XT2A 3BY9A 4KQDA 1P97A 2INWA 3H9WA 1D7EA 1P0ZA 2PHYA 3HJKA 3LIFA 5F69A 2YKFA 1F9IA 5G4ZA 5TBMA 3LI8A 4HY8A 4WN5A 4HJ6A 1S67L 1X0OA 1LT0A 2M1CA 3LI9A 5HWTA 3F1NB 5HD5A 3GECA 3IS2A 5J3WA 4E04A 4LPZA 2JHEA 3CWFA 1WA9A 4I38A 4R70A 3A0VA 4M4XA 2VV7A 3ULFA 4HP4A 1NWZA 3P7NA 5I5LA 1OTAA 3C8CA 1LSVA 3LIEA 3F1NA 4H6JB 2L0WA 3UB8A 3CLOA 2VV6A 3LICA 4GHIB 4I3JA 2QKPA 3MQQA 4NXBA 3T50A 2B02A 2WKRA 3MR0A 5EFWA 4HIAA 2A24A 3NJAA 1UWPX 3F1PA 3FC7A 1OJ5A 1DP6A 4PKYG 1LL8A 3NOUC 2D02A 2ZBBA 1MZUA 1ODVA 4JGOA 4GHIA 1T19A 4MN6A 3LIAA 1OT6A 1UWNX 3K3CA 4XT2B 5KIZA 2L1MA 4DJ2A 3NHQA 3H7WB 4HP9A 2WKQA 2PR6A 3PHYA 5DKKA 1XJ4A 4EW7A 1KOUA 3E4PA 4K08A 1GSWA 4DJ3A 3E4OA 3NOTC 4EETB 3IS2B 3RH8B 3H7WA 4I5SA 1VB6A 3LUQA 1XFQA 2P7JA 4RQ9A 3K3DA 5HDSA 1LSWA 3BWLA 4R3AA 3HJIA 4WUJA 2PR5A 2ZOIA 2PDRA 4KUKA 1OTIA 4EQ1A 3VE3A 4L9FA 1UGUA 1TS0A 1T1CA 4WL9A 1GSXA 3UB6A 2BASA 4NXEA 1DP8A 2D01A 5IU1A 3F1OB 5G4YA 2A24B 2PYRA 3F1PB 4LRXC 1EW0A 1DRMA 1S4SA 3H82A 4LRZE 1S1ZA 3C2WA 3UMDA 4WLAA 5DJTA 4JGPA 4L9GA 4HI4A 2Z6CA 1D06A 2J80A 4NXFA 3F1OA 4EXOA 2W27A 4B9OA 2JN7A 4JGQA 4F3LB 3ICYA 4BBVA 1G28A 4GCZA 1XJ6A 1S66L 4R6LA 5DJUA 2Z6DA 4JGRA 2EA9A 2OWJA 1TS7A 1LSXA 2WKPA 3E4QA 3UMEA 4BBTA 1N9NA 1BYWA 2V0UA 2VLGA 4F3LA 4L9EA 2V1BA 3LIBA 5F6AA 2W0NA 3EWKA 4LRYC 4I3IA 1N9LA 2QJ5A 3LYXA 4I3AA 3CAXA 3UE6A 2QHKA 5HDCA 4MN5A 2K7SA 1S4RA 3LIDA 1OT9A 4GW9A 4EERA 1XFNA 1V9YA 2ZOHA 2I9VA 3FG8A 2OOLA 3H82B 3MQOA 1OTBA 1F98A 3B33A 1TS8A 1GSVA 4BBUA 3IBRA 3PYPA 5AVEA 1T1AA 4GS9B 1V9ZA
chains in the Genus database with same CATH superfamily
3GDIA 1YMSA 3G4PA 3OCNA 1XA7A 5HARA 5E43A 2J8YA 3NY4A 5DKLA 4B88A 1E25A 3I7JA 3IHAA 2HV1A 4Y13A 1YM1A 2VEAA 3QNCA 5KSHA 4X68A 1K56A 3ZFZA 5FEFA 3VSLA 2HDUA 1K55C 3OPPA 4LCMA 4IHQA 1FILA 3D72A 4U0XA 1DP9A 5F5YA 4YINA 5DFXA 2V1AA 2C6WB 4HJ3A 3W2ZA 3ZVWA 2VGLS 3IXBA 4WEKA 2W1TB 5AVFA 3UE0A 4HOIA 4KG5A 3V3SA 2Y2GA 3IWIA 4B4XA 4Z9QA 2EFXA 5AJGA 5HWVA 1HVBA 3MBZA 3L9KA 5HDDA 1XJ3A 2PD8A 3S7OA 1KVMA 1K25A 3NOPC 4BL3A 5M18A 2WKIA 3JVVA 4DDSA 3OBFA 1F5MA 2JE5A 1L3LA 3KX0X 3T1XA 4EEUA 5A90A 4HJ4A 2BLSA 3MQ0A 5KMWA 1SDEA 3M2JA 4XXRA 3B42A 3NC8A 4WMCA 4LCLA 5HWWA 3V67A 3LO7A 3VP3A 3W4OA 4X25A 2QMIA 1XXMA 1TVFA 2ZQDA 3T4QA 3ZGAB 1W7FA 1VETA 5L8MA 1A0KA 1I2SA 2W3GA 3BY9A 1FR1A 4KQDA 3LR4A 3V5MA 4BQMA 3H9WA 2W1RA 1KGFA 5F69A 2PHYA 4MBHA 5JYOA 3HREA 2Y2KA 5TBMA 4OPYA 1K0KA 4GDNA 3LGOA 2Y2MA 4ID4A 4HJ6A 1S67L 1M6KA 3OPLA 3MF0A 2ZC7A 3HLBA 1LT0A 4BL2A 3GECA 4OONA 5F82A 3IS2A 4E04A 5A92A 2XRNA 5EECA 3CWFA 2V8FA 4ZTKA 3RJUA 2XD1A 1XGJA 4R70A 3A0VA 4LV3A 2M7UA 4M4XA 2VV7A 3CI6A 4E6WA 2QPNA 3C38A 4UQIS 4CLCC 1ES2A 2WADA 4RX3A 3F1NA 1G68A 4E3LA 1YSPA 3UB8A 1H5XA 3LICA 4I3JA 1FSWA 5EVIC 3MQQA 2A24A 2ZMFA 3G32A 3AGFA 1EROA 2VA0A 2EWWA 3FC7A 4O0PA 1W5DA 1LL8A 4UA7A 1YMXA 1FOFA 2Y2JA 1RP5A 1N9BA 1MZUA 5FDHA 3PXPA 1PI4A 3UE3A 1XGIA 3LR0A 4GHIA 3ZG8B 3V39A 2XH9A 5BOHA 2G7UA 1UWNX 2EFUA 1XKZA 3A3DA 1H8ZA 2XLNA 2L1MA 3IF6C 4MNRA 2HP5A 3DTIA 1QMEA 3ITAA 4DKIA 5DKKA 4LGWA 5CHJA 4PM9A 4R3JA 4Q0IA 4EW7A 3OCLA 4QB8A 2JKFA 3HUOA 1PI5A 3A3IA 3TG9A 3U2AA 1GSWA 2G2UA 4DF6A 4DJ3A 1O07A 1IELA 3IS2B 4YNRA 2EX6A 1VB6A 3KYZA 4X6TA 1MKIA 4S2NA 4R3AA 1PIOA 4KZ3A 3RXWA 4HBUA 3T1QB 5FQMA 1NY0A 2HJ9C 3PAEA 4MN7A 2Y59A 2WGWB 1NZOA 1LI0A 2ZC4B 4L9FA 1ESIA 1UGUA 5AQAA 4MBFA 5C5KA 1TS0A 1PWDA 2ZC3B 3HVFA 3UB6A 2ZM8A 2BASA 1DP8A 2D01A 2A24B 2PYRA 3AGDA 4Y0UA 1KVLA 4LRXC 4GNUA 3OZHA 4LRZE 3WS1A 1S1ZA 3BQAA 3C2WA 5HFOA 4JGPA 4L9GA 3LEZA 1PZOA 3TOIA 3F1OA 1ZG6A 4PM5A 3BFCA 3DW0A 2WGIA 2Y2LA 1YLPA 3ZNYA 1BLCA 3ICYA 3FPWA 3WS2A 4GCZA 3K2NA 5FAOA 1NYYA 5DJUA 4OLDA 3VP4A 2Y2NA 3BJNA 3E4QA 3UMEA 1TDGA 1TEMA 1QMFA 2DNSA 3ZNTA 5FI2A 3MKFA 1L2SA 1BYWA 1EWZA 4FD8A 3BEBA 1ZC2A 4EBNA 3HUMA 4MMNA 4GZBA 2ZM2A 4S2MA 1CI8A 4IJGA 4S2IA 5FQIA 3GR2A 3WRTA 3M2KA 1NXYA 1MWRA 5DF7A 4JXSA 5HPFA 3SH9A 2P74A 2WZZA 1V9YA 3TE8A 2PRFA 5DTTA 2H0YA 2OOLA 2ZQ9A 3T4JA 4GJ4A 2ZL1A 1F98A 4E3JA 1GCEA 3ITBA 4X56A 1XA1A 3UNWA 4KZ7A 3UE1A 4OLGA 3IBRA 5CECA 1KE4A 5AVEA 4DXCA 3DTKA 5FL3A 4EBLA 3N8RA 4EUVA 5HAPA 1G6AA 2A2LA 4G3VA 3HL9A 5HSQA 4OQGA 1TS6A 4E3OA 1YLYA 4GOGA 4QHCA 4ZJ3A 3UO9A 1ACFA 3Q07A 3TSGA 4HH3A 5FATA 5J4EA 1L0EA 2KDKA 2V20A 1BT5A 2XEPA 3DWZA 3IX8A 3LEQA 3HCYA 4HQAA 1IYOA 3MKEA 2P08A 1CI9A 2XSSA 4PM6A 1Y28A 3C30A 4MDZA 3QP8A 2QJ7A 3VE4A 1OTEA 1XX2A 3B47A 3G30A 1OMEA 4EESA 3MXQA 3VOLA 1YT4A 2JC7A 1K54A 4KZ8A 4H6JA 2W1TA 3JYIA 2ZQ8A 3D9YA 4BJPA 3BFEA 1BULA 2GJ3A 4O01A 2H28A 1T18A 2VGLM 1VEUB 4MBKA 2V9AA 2J3TD 3DBAA 4GD8A 4BENA 3IXHA 3SW1A 4NXGA 3ZQ5A 4BLMA 3R7WB 2YKHA 4LLOB 4PKYA 4R23A 1CJFA 2ZQCA 4HH2A 4I39A 3VOZA 3Q1FA 5EVLA 3IF5A 3SS4A 1P97A 1S6RA 2VX8A 1W63Q 1VM1A 3MSHA 3PBTA 2QYBA 1K6SA 3LIFA 4Y15A 5FI6A 5CX7A 4CLCD 5EVEA 4Y3IA 4DXBA 5G4ZA 4OQIA 4IUKA 3LI8A 2GZAA 3BQ8A 3G31A 4WN5A 1W8YA 4FCFA 3WS4A 5A93A 3N8LA 3UDIA 4WZ5C 3UY6A 4BMWA 1L0FA 5FEGA 5EVID 3BFGA 5CXWA 4RYEA 3RFBA 4DRTA 1NRJA 1YLZA 5EM1A 2V8CA 3S7QA 4LV1A 4QY5A 4I38A 4S2JA 2Q9MA 1LL9A 3O88A 3NECA 4R4SA 2G2WA 1K57A 1NWZA 3V50A 1BZAA 4CPKA 4M3KA 1ZG4A 1OTAA 3C8CA 3LIEA 1P9WA 1C3BA 4H6JB 2L0WA 4UA9A 3CLOA 3TW8A 3GTCA 4FUWA 3E0YA 1OJ5A 1Z09A 1DP6A 3SOIA 4PKYG 4OPRA 4IVKA 2D02A 4IBRA 5TJJA 2ZBBA 5GL9A 1ONHA 2ZJ9A 1AWIA 2J9OA 3CUEC 4Q0HA 4HBTA 4HEFA 5FQKA 4UQIM 3OC2A 4MN6A 3LIAA 2LB5A 2XA7M 3IX4A 3EGXC 3IH9A 4JLFA 4HP9A 1NLZA 2PR6A 3QP5A 3OOVA 1YLTA 3C7UA 2GNXA 4FTXA 5EV0A 1TDLA 3SS3A 1MC0A 1KE3A 3P09A 3BW6A 5FQJA 2XF3A 3NOTC 4PAUA 4CQHA 3WS0A 2P7JA 4NETA 4NK3A 4UA6A 3K3DA 5HDSA 3P01A 5HW3A 3OPHA 3HJIA 3JVUA 5E2HA 3O87A 2PR5A 2C5WB 2Y55A 5U47A 2Y91A 4LENA 4KUKA 3FV7A 1TD5A 4EQ1A 2ZQ7A 1GHPA 2HF6A 3SH8A 3VE3A 2P9VA 1GSXA 1J9MA 1Q2QA 5A91A 2MJ6A 3M6HA 3S1YA 5IU1A 2WYXA 1BSGA 4GD6A 3T4TA 4JXVA 1DRMA 1S4SA 2DRWA 3CG5A 3PBRA 2WGWA 2XA7S 3IWQA 4XUZA 4S2LA 3ZG0A 3UMDA 5F1GA 4HI4A 2KOIA 1SDNA 4GLQA 1ALQA 4E3NA 1D06A 2B95A 3PBOA 4OPQA 4JBFA 4KQRA 1HZOA 2V1ZA 2EX8A 5FA7A 3PR6A 4H8RA 3UDFA 4JGQA 4QWOA 5E2FA 4JKTA 1KDSA 5M1AA 4FH4A 3QP1A 2XDMA 1ES4A 4BBVA 1ES5A 3ZHHA 2J7VA 1Z6FA 5MC7A 2O99A 4R6LA 2Z6DA 1BLSA 4L0LA 4Y0OA 4BBTA 3UPPA 3V3RA 2LB9A 3CMZA 3DAVA 4WMCD 3SZTA 5K5BA 4ZJ2A 2XFSA 3CITA 4E3KA 1BLPA 5F6AA 1O7EA 4LFUA 4LRYC 3C4OA 1PRQA 2BTFP 5CGSA 4IUHA 1E3UD 5GHYA 1IYPA 2QHKA 1K54C 2P9VB 4PM8A 5HDCA 1K6RA 2EXBA 3ZG5A 1I5QA 4OOYA 3NI9A 1DJCA 2EWVA 2ZMAA 5L2FA 3N8SA 2M7VA 4WM9A 1JWVA 1P9RA 2O9BA 5AQBA 1YLWA 1G6OA 3S22A 1WE4A 1H8YA 5AQ7A 3B33A 3T12B 2B5RA 3ZCZA 1TS8A 5FDSA 5GLDA 4GN2A 3HLCA 3IHBA 1T1AA 2WGVA 2Y8HA 3GQZA 3T4OA 4GS9B 2R9XA 5IT5A 5HAIA 3NDEA 5KZHA 3PTEA 1S1YA 2H10A 3UB5P 1SCWA 3SH7A 4R38A 1FSYA 1EI5A 3BM6A 3O86A 2XD5A 4LV2A 3G6OA 1IYSA 4JF6A 4OH0A 2OSUA 4OQHA 4HNBA 2Q0OA 4HHDA 4EEPA 2W3HA 4OOLA 3D3OA 4ZDXA 3T4KA 2KLIA 4IEDA 5HD3A 5FQ9A 4KENB 1OJGA 3KSGA 1PFLA 2QWSA 2J9PA 3IXDA 5A8BA 4R0QA 1K57C 4FOFA 5I94A 2E8IA 4PMAA 2PD7A 1GHMA 4N9KA 3QP4A 3S7PA 2ZMVA 1YKDA 2Q9NA 4Z1WA 4OP5A 2OLUA 5EM0A 1DJBA 2OWHA 4ETXA 2E8JA 3LCEA 3ISGA 1N9OA 3RTYA 4X1LA 3A3EA 1H3QA 3GVBA 5F68A 1PW1A 2NUTC 1MPLA 3OLOA 3UB9A 3A0SA 4OQ0A 2XK1A 5CGXA 4KUOA 5CHUA 4D60A 3D4FA 3MFDA 3A0RA 3MJQA 2VJWA 2RCXA 3HLGA 4RVAA 2RL3A 2R78A 4XT2A 4E6XA 1VEUA 2INWA 1FR6A 1YSQA 5GLBA 4F94A 4X1MA 2Z2MB 1P0ZA 2IWBA 2YKFA 4QD4A 1F9IA 2DCFA 3R7WA 1SZVA 2OLVA 1IOUA 4DN0A 1X0OA 1CQAA 2GX5A 2M1CA 3IX3A 2ZM0A 4CLCA 5HD5A 5HAQA 4S2KA 5J3WA 3GSGA 4LPZA 4UEYA 1HTZA 2JHEA 3VP2A 1MKMA 5HL1A 3R4KA 2Y79A 2HDRA 3Q82A 5CTNA 5EVIA 3BYDA 1ES3A 5CEBA 5CERA 1KGGA 3ULFA 1LL5A 3EQUA 4HP4A 5CRFA 3FYZA 1H0MA 3LR5A 2HGVA 1IYQA 2QKPA 4Y17A 2WAFA 1RGZA 3BLSA 2B02A 5FAPA 2WKRA 3MR0A 5EFWA 4HIAA 3NJAA 1BLHA 1UWPX 3FZCA 4WELA 5L09A 3LY3A 3KSIA 3VV4A 1Q2PA 1WYBA 3NOUC 5KSCA 1ZHHB 3HBRA 4Y5FA 5GLAA 1T19A 2WUQA 1OT6A 4C75A 4XT2B 5KIZA 1M40A 1NRFA 1H8MA 3C5AA 4N9LA 2ZC6B 2X01A 2V2FF 1MY8A 1D1JA 3NHQA 1YQSA 2IWCA 1NZUA 1RCJA 3H7WB 4WZ4A 4KQOA 2WKQA 5DF9A 4K0WA 1N4OA 3ZG9B 1XJ4A 5EUAA 3E4PA 3T4LA 2FFYA 4KZBA 3P98A 1CK3A 4C6YA 1GHIA 2Y2OA 3GRJA 1JVJA 3E4OA 4CLCB 1SKOA 3DTMA 4EETB 2A3UA 1PWGA 3RH8B 4MLLA 4I5SA 3LUQA 3HLFA 3HUNA 2ZD8A 2HDQA 4DE2A 3BWLA 1XP4A 2PAVP 5EVIB 4ESPA 1YAXA 3CPTA 1PZPA 3C4PA 3G34A 2B18A 2PDRA 3OPRA 1OTIA 4JXWA 1E4DA 4PHTA 4ZJ1A 4E3MA 2IWDA 5LBRA 4WL9A 4S2NC 2HZ5A 4RX2A 5G4YA 2DMWA 1JWPA 2O0YA 1IKGA 1MWUA 2P04A 3NIAA 1DY6A 4RA7A 1I2WA 3IF6B 4ME4A 3H82A 3G2YA 3VFHA 2OV5A 3N6IA 1L0GA 3CHWP 3HLEA 3CJMA 4KG2A 4NXFA 2VGKA 2W27A 3GMWA 1JWZA 5HPIA 1GA9A 1AXBA 3FKWA 4JXGA 4B9OA 2JN7A 3WS5A 4BD1A 1CEFA 4F3LB 5TGFA 4P6ZM 3HLWA 1J3WA 1G28A 1XJ6A 3NBLA 4Y2FA 1W79A 1FIKA 5DVAA 4YOFA 1SKOB 1NLYA 2EA9A 2OWJA 4X69A 1LSXA 1MXOA 2WKPA 3KYEA 3QNBA 1KGEA 4ARZA 4U3TA 1N9NA 2R9WA 2JKRI 4NEED 2V0UA 2VLGA 3KO6A 4I3IA 3CPTB 4II7A 1N9LA 1GA0A 3IQAA 1RGYA 1IKIA 4B4ZA 3LYXA 4EV4A 4A5RA 1FCNA 2WKHA 3UE6A 5M19A 3EGDC 3T4SA 1VHMA 4N1HA 5E2GA 4S2PA 2I72A 2JKTM 2Y2HA 2Y2IA 4R3BA 2K7SA 1S4RA 3LIDA 2HP6A 4G3WA 3RXXA 1SHVA 1E3UA 1XFNA 3LR3A 3MMHA 2PBYA 2Y2QA 1DJAA 4S2OA 3H82B 1OTBA 4EBPA 1PYYA 2WKEA 3IH8A 4P87A 4BBUA 2HJEA 4P6ZS 3KSFA 4OVDA 4WEJA 3PYPA 3ZDJA 2GDNA 2J3TC 4ZRRA 1K56D 4GKUA 4JF5A 3PBQA 2W3EA 3MZFA 5DTSA 3ZG7B 1Y4OA 4KZ4A 2AVXA 4OP8A 2KX6A 2PBDP 3IWOA 3ZYTA 4KZAA 3S4XA 4MCWA 3MZEA 4GS9A 2OAP1 4ARZB 5JYPA 3T1SA 5F1FA 4WF0A 2XR0A 2H0TA 5GLCA 2EX9A 3E2KA 4OKPA 4CLCE 3W4QA 1ONGA 4EQIA 2VV8A 2VGJA 3MFXA 1TF1A 4K91A 3G2ZA 3FKVA 2K31A 4U0TA 1KE0A 3UPOA 3TJZC 3BLMA 2FH5A 3BFFA 3VMAA 1JTGA 2CMNA 2IA2A 1U60A 4DE0A 1K4EA 1G5UA 1ZTUA 2UV0E 2XGNA 5HZHA 1PWCA 1LHYA 3DWKA 5CGWA 1XJ2A 1JNUA 1NJ4A 3AGEA 1VETB 1YLJA 2Z2LB 1IEMA 2JKTI 2L4RA 2XROA 2HDSA 1S0WA 5J7EA 1L0DA 2V0WA 3EEHA 3VP1A 4R1GA 3UB7A 1T1BA 5TBMB 3O5YA 4IBXA 1OTDA 1W8QA 3VOYA 2PYPA 2PT7A 5AQ9A 3FPVA 4YWZA 5IS1A 3PBNA 3ZVTA 3BY8A 2UWXA 2XQZA 4WZ5A 3TRCA 3UN7A 4DDYA 1PNEA 1D7EA 5J8XA 3A3FA 3KSHA 3HJKA 3M6BA 2NUPC 4C3QA 3WWXA 1FQGA 2CC1A 2ZC5B 3UDXA 4HY8A 1XPBA 4JF4A 5IHVA 1FCMA 1CEGA 5DFYA 1K55A 5TR7A 1LLBA 3VFFA 3E2LA 3LI9A 5HWTA 3F1NB 4R4RA 4P85A 3N4IA 3DTEA 3E98A 3QP6A 1W63M 3CZDA 1WA9A 4ZBEA 3HLDA 4UAAA 1JTDA 3QHYA 3Q81A 4WBGA 3P7NA 1LI9A 4DMZA 3VP0A 5I5LA 1LSVA 3BRMA 4HESA 3C7VA 4ZAMA 2VV6A 4FH2A 3N7WA 4GHIB 1BUEA 3CUEA 2H5SA 4D2OA 2EX2A 4NXBA 3T50A 4Q8IA 3F1PA 4O8GA 4QU3A 2X71A 4KZ9A 3PBSA 4K0XA 1ODVA 3NULA 1OPXA 4JGOA 4N92A 4UHUA 5EE8A 4GDBA 2JCHA 4PPRA 4P0MA 5CHMA 2VK3A 4BD0A 1ERQA 3K3CA 4KG6A 4KZ5A 4DJ2A 2HP9A 2FFFB 3SS5A 2QZ6A 3O3VA 3PHYA 1ZKJA 5F83A 5FI7A 1KOUA 2VZWA 3W8KA 5GHXA 4Y7PA 4K08A 4GB7A 4LV0A 2JKGA 1YPRA 4KQQA 1SKFA 2K2NA 1ESUA 3H7WA 1Y54A 5FAQA 1XFQA 3IXGA 4RQ9A 5HX9A 1LSWA 3S7NA 4EWFA 1HD8A 1BTLA 4WUJA 4Y0TA 1IFQA 2ZOIA 5GHZA 3T1RA 5DTKA 5EPHA 5G18A 3IT9A 1F2KA 5E2EA 4AFIA 1T1CA 4KZ6A 4EUZA 3B3XA 5EOOA 1STZA 2OAQ1 4NXEA 1MWTA 3BECA 3LY4A 3F1OB 3FWLA 2ZQAA 3F1PB 3LFVA 1EW0A 5EOEA 4OPZA 2EXAA 2ZLYA 3MXRA 4MEZA 3A3JA 4DE1A 3EOIA 4P6BA 3IBJA 4WLAA 5CTMA 5DJTA 1K38A 2Z6CA 2W3DA 1KDWA 5FASA 2J80A 4DE3A 2O9AA 1VQQA 4OOMA 1ERMA 4FSFA 4EXOA 2VKSA 5L10A 3Q7VA 3IF6A 3UPNA 1WYCA 4PM7A 4ETZA 4NKPA 2PU4A 2WAEA 4E3IA 5FSRA 1CF0A 3EQVA 4NG2A 2HPBA 3PAGA 4X55A 1K4FA 1S66L 4XUXA 4Q0JA 4N1XA 2WK0A 3L7HA 4JGRA 1TS7A 4G3KA 1HLUP 4QPRA 3G35A 3EEAA 4F3LA 4X53A 3W4PA 4L9EA 2V1BA 3LIBA 2W0NA 3EWKA 2J3WA 4JPMA 2JKRM 2W3FA 2QJ5A 4WYYA 5L07A 2ACGA 2XFTA 4I3AA 2FZ0A 3CAXA 3JPUA 2O9CA 2WZXA 2A49A 2ZL1B 3WRZA 1NYMA 4B93A 2JBFA 4MN5A 3KYQA 3MXSA 3MZDA 2X02A 3MS6A 4BWIA 1OT9A 5TFQA 3GV9A 4GW9A 2BG1A 4IVIA 5FQQA 3QP2A 4O7DA 4EERA 4QJGA 2ZOHA 1MWSA 5DF8A 2I9VA 3VSKA 3FG8A 4YFMA 1MBLA 2Y2PA 2Y4AA 3MQOA 5HL6A 3Q7ZA 3BFDA 4CJNA 3U4LP 1GSVA 5CEDA 5D3OA 3NCKA 1FCOA 1PW8A 4EU0A 4QY6A 3NDGA 2PU2A 3Q7VB 1V9ZA
chains in the Genus database with same CATH topology
3GDIA 5IT5A 2A2LA 3PBQA 4G3VA 2W3EA 3OCNA 5HSQA 1TS6A 1S1YA 5DKLA 4R38A 2HV1A 2VEAA 2KX6A 5KSHA 4HH3A 3ZYTA 5J4EA 3G6OA 4IHQA 2KDKA 4HNBA 3D72A 4MCWA 1DP9A 4GS9A 5F5YA 2OAP1 5DFXA 4HHDA 4EEPA 2V1AA 3HCYA 4HJ3A 2W3HA 4HQAA 3W2ZA 4ARZB 2VGLS 4OOLA 4WF0A 3D3OA 4WEKA 2W1TB 5AVFA 2P08A 4HOIA 3T4KA 4CLCE 2KLIA 2VV8A 2XSSA 1Y28A 5HD3A 3C30A 3MFXA 4MDZA 1OJGA 2QJ7A 3VE4A 1OTEA 1TF1A 3KSGA 3B47A 2QWSA 2K31A 5A8BA 5AJGA 4EESA 3MXQA 3TJZC 4FOFA 5HWVA 2FH5A 3VOLA 2PD7A 5HDDA 2CMNA 1XJ3A 2PD8A 2IA2A 3S7OA 3S7PA 2ZMVA 1YKDA 3NOPC 4Z1WA 4H6JA 1ZTUA 2W1TA 3JVVA 5HZHA 3OBFA 1F5MA 2OWHA 3KX0X 4ETXA 4EEUA 1XJ2A 1JNUA 4HJ4A 4BJPA 3MQ0A 2GJ3A 4O01A 2H28A 1N9OA 3RTYA 1T18A 2VGLM 2JKTI 1H3QA 2L4RA 3B42A 5F68A 2XROA 2NUTC 5J7EA 5HWWA 2V0WA 2V9AA 3V67A 3EEHA 3OLOA 3UB9A 2J3TD 3DBAA 3UB7A 1T1BA 3A0SA 5TBMB 3O5YA 3SW1A 1OTDA 4NXGA 4KUOA 2PYPA 2PT7A 3ZQ5A 3FPVA 3A0RA 4YWZA 3R7WB 3MJQA 2YKHA 4LLOB 2VJWA 4PKYA 5IS1A 3PBNA 3T4QA 5L8MA 4HH2A 4I39A 3BY8A 2R78A 4XT2A 2W3GA 3BY9A 4KQDA 3TRCA 1P97A 3LR4A 2INWA 2VX8A 3H9WA 1W63Q 1YSQA 3PBTA 2W1RA 1D7EA 3KSHA 2QYBA 1P0ZA 2PHYA 3HJKA 3LIFA 5F69A 2YKFA 2NUPC 5CX7A 4CLCD 1F9IA 4Y3IA 5G4ZA 5TBMA 4IUKA 3LI8A 2GZAA 4HY8A 3BQ8A 4WN5A 3R7WA 4HJ6A 1IOUA 4DN0A 1S67L 1X0OA 5DFYA 3MF0A 2GX5A 1LT0A 2M1CA 4BMWA 4CLCA 3LI9A 5HWTA 3F1NB 5HD5A 3GECA 3RFBA 3IS2A 1NRJA 5J3WA 4E04A 3E98A 2XRNA 4LPZA 4UEYA 2JHEA 3CWFA 1W63M 3S7QA 1MKMA 1WA9A 3R4KA 4I38A 2Y79A 4R70A 3A0VA 2M7UA 4M4XA 2VV7A 3CI6A 3ULFA 3C38A 3EQUA 4HP4A 4UQIS 1NWZA 3P7NA 4CLCC 4DMZA 5FL3A 5I5LA 1OTAA 3C8CA 1LSVA 3LIEA 1P9WA 3F1NA 4H6JB 2L0WA 1YSPA 3UB8A 3CLOA 3TW8A 2VV6A 3LR5A 2HGVA 3LICA 4GHIB 4I3JA 2QKPA 3T4OA 3CUEA 3MQQA 4NXBA 3T50A 2B02A 2WKRA 3MR0A 5EFWA 4HIAA 2A24A 3NJAA 2ZMFA 3E0YA 1UWPX 3F1PA 4O8GA 2VA0A 2EWWA 3FC7A 1OJ5A 4O0PA 4WELA 1DP6A 3KSIA 3VV4A 4PKYG 1LL8A 3PBSA 3NOUC 2D02A 5TJJA 2ZBBA 1MZUA 1ODVA 1OPXA 3PXPA 4JGOA 3UE3A 1ZHHB 3CUEC 4Y5FA 3LR0A 4GHIA 4Q0HA 1T19A 2G7UA 4UQIM 3OC2A 4MN6A 3LIAA 1OT6A 1UWNX 2LB5A 3K3CA 4XT2B 5KIZA 2XA7M 1H8MA 2L1MA 4DJ2A 3EGXC 3NHQA 3H7WB 4HP9A 4KQOA 1NLZA 2WKQA 5DF9A 2PR6A 3PHYA 5DKKA 1XJ4A 3OOVA 4Q0IA 4EW7A 1KOUA 2VZWA 2GNXA 3OCLA 3E4PA 3T4LA 4K08A 1MC0A 3U2AA 1GSWA 3BW6A 4DJ3A 3E4OA 4CLCB 3NOTC 4EETB 3IS2B 4YNRA 2K2NA 3RH8B 3H7WA 4I5SA 1VB6A 3KYZA 4PAUA 3LUQA 4CQHA 1XFQA 2P7JA 4RQ9A 3K3DA 5HDSA 1LSWA 3P01A 3BWLA 3S7NA 4R3AA 3HJIA 3JVUA 4WUJA 1YAXA 2PR5A 1IFQA 2ZOIA 2HJ9C 2B18A 4MN7A 2PDRA 4KUKA 1OTIA 1TD5A 4EQ1A 2HF6A 4PHTA 4L9FA 3VE3A 1UGUA 4AFIA 5C5KA 1TS0A 1T1CA 5LBRA 4WL9A 1GSXA 3UB6A 1STZA 2OAQ1 2BASA 4NXEA 2MJ6A 1DP8A 2D01A 5IU1A 3F1OB 5G4YA 2DMWA 2A24B 2O0YA 2PYRA 2P04A 3F1PB 3LFVA 4LRXC 1EW0A 3T4TA 1DRMA 1S4SA 4ME4A 3H82A 4LRZE 3PBRA 1S1ZA 2XA7S 3BQAA 3C2WA 3EOIA 3IBJA 3UMDA 4WLAA 5DJTA 4JGPA 4L9GA 4HI4A 2KOIA 2Z6CA 4GLQA 2W3DA 1D06A 2J80A 3PBOA 2O9AA 4NXFA 3F1OA 4OOMA 4FSFA 4EXOA 2W27A 5HPIA 2VKSA 4B9OA 2JN7A 3PR6A 4JGQA 4ETZA 4F3LB 4NKPA 4P6ZM 3ICYA 3FPWA 4BBVA 1G28A 4GCZA 1XJ6A 3K2NA 4Y2FA 3EQVA 5MC7A 1S66L 2O99A 4R6LA 4YOFA 5DJUA 4Q0JA 2Z6DA 3BJNA 4JGRA 1NLYA 2EA9A 4L0LA 2OWJA 1TS7A 1LSXA 2WKPA 3E4QA 3UMEA 4G3KA 4BBTA 4ARZA 1N9NA 2LB9A 2JKRI 4QPRA 1BYWA 5K5BA 4NEED 2V0UA 2VLGA 3CITA 3EEAA 4F3LA 4L9EA 2V1BA 3LIBA 5F6AA 2W0NA 3EWKA 3KO6A 2J3WA 4LRYC 4I3IA 2JKRM 4II7A 2W3FA 1N9LA 2QJ5A 4MMNA 3LYXA 4I3AA 2FZ0A 4IUHA 3CAXA 2O9CA 3UE6A 3EGDC 3T4SA 1VHMA 2QHKA 4IJGA 4B93A 5HDCA 2JKTM 4MN5A 3KYQA 2K7SA 1S4RA 3LIDA 2EWVA 4G3WA 1OT9A 4BWIA 4GW9A 5HPFA 4EERA 1XFNA 3MMHA 3LR3A 1V9YA 2ZOHA 3TE8A 2M7VA 1P9RA 2I9VA 2O9BA 3FG8A 2OOLA 3T4JA 3H82B 4GJ4A 1G6OA 3MQOA 5HL6A 1OTBA 1F98A 3B33A 1TS8A 1GSVA 4BBUA 2HJEA 4P6ZS 3KSFA 4WEJA 3IBRA 3PYPA 5AVEA 4EU0A 1T1AA 2Y8HA 2J3TC 4EUVA 4ZRRA 4GS9B 1V9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDI A;  5HSQ A;  1TS6 A;  1S1Y A;  5DKL A;  4R38 A;  2HV1 A;  2VEA A;  2KX6 A;  4HH3 A;  5J4E A;  3G6O A;  2KDK A;  4HNB A;  3D72 A;  1DP9 A;  4GS9 A;  5F5Y A;  4HHD A;  4EEP A;  2V1A A;  4HJ3 A;  4HQA A;  4WF0 A;  5AVF A;  4HOI A;  2VV8 A;  1Y28 A;  5HD3 A;  3MFX A;  1OJG A;  2QJ7 A;  3VE4 A;  1OTE A;  2QWS A;  5A8B A;  4EES A;  3MXQ A;  5HWV A;  3VOL A;  2PD7 A;  5HDD A;  2CMN A;  1XJ3 A;  2PD8 A;  3NOP C;  4H6J A;  5HZH A;  2OWH A;  3KX0 X;  4EEU A;  1XJ2 A;  1JNU A;  4HJ4 A;  2GJ3 A;  2H28 A;  1N9O A;  3RTY A;  1T18 A;  2L4R A;  5F68 A;  5J7E A;  5HWW A;  2V0W A;  2V9A A;  3EEH A;  3OLO A;  3UB9 A;  3UB7 A;  1T1B A;  3A0S A;  5TBM B;  3SW1 A;  1OTD A;  4NXG A;  4KUO A;  2PYP A;  3ZQ5 A;  3A0R A;  4YWZ A;  3MJQ A;  2YKH A;  4LLO B;  4PKY A;  5IS1 A;  4HH2 A;  4I39 A;  3BY8 A;  2R78 A;  4XT2 A;  3BY9 A;  4KQD A;  1P97 A;  2INW A;  3H9W A;  1D7E A;  1P0Z A;  2PHY A;  3HJK A;  3LIF A;  5F69 A;  2YKF A;  1F9I A;  5G4Z A;  5TBM A;  3LI8 A;  4HY8 A;  4WN5 A;  4HJ6 A;  1S67 L;  1X0O A;  1LT0 A;  2M1C A;  3LI9 A;  5HWT A;  3F1N B;  5HD5 A;  3GEC A;  3IS2 A;  5J3W A;  4E04 A;  4LPZ A;  2JHE A;  3CWF A;  1WA9 A;  4I38 A;  4R70 A;  3A0V A;  4M4X A;  2VV7 A;  3ULF A;  4HP4 A;  1NWZ A;  3P7N A;  5I5L A;  1OTA A;  3C8C A;  1LSV A;  3LIE A;  3F1N A;  4H6J B;  2L0W A;  3UB8 A;  3CLO A;  2VV6 A;  3LIC A;  4GHI B;  4I3J A;  2QKP A;  3MQQ A;  4NXB A;  3T50 A;  2B02 A;  2WKR A;  3MR0 A;  5EFW A;  4HIA A;  2A24 A;  3NJA A;  1UWP X;  3F1P A;  3FC7 A;  1OJ5 A;  1DP6 A;  4PKY G;  1LL8 A;  3NOU C;  2D02 A;  2ZBB A;  1MZU A;  1ODV A;  4JGO A;  4GHI A;  1T19 A;  4MN6 A;  3LIA A;  1OT6 A;  1UWN X;  3K3C A;  4XT2 B;  5KIZ A;  2L1M A;  4DJ2 A;  3NHQ A;  3H7W B;  4HP9 A;  2WKQ A;  2PR6 A;  3PHY A;  5DKK A;  1XJ4 A;  4EW7 A;  1KOU A;  3E4P A;  4K08 A;  1GSW A;  4DJ3 A;  3E4O A;  3NOT C;  4EET B;  3IS2 B;  3RH8 B;  3H7W A;  4I5S A;  1VB6 A;  3LUQ A;  1XFQ A;  2P7J A;  4RQ9 A;  3K3D A;  5HDS A;  1LSW A;  3BWL A;  4R3A A;  3HJI A;  4WUJ A;  2PR5 A;  2ZOI A;  2PDR A;  4KUK A;  1OTI A;  4EQ1 A;  3VE3 A;  4L9F A;  1UGU A;  1TS0 A;  1T1C A;  4WL9 A;  1GSX A;  3UB6 A;  2BAS A;  4NXE A;  1DP8 A;  2D01 A;  5IU1 A;  3F1O B;  5G4Y A;  2A24 B;  2PYR A;  3F1P B;  4LRX C;  1EW0 A;  1DRM A;  1S4S A;  3H82 A;  4LRZ E;  1S1Z A;  3C2W A;  3UMD A;  4WLA A;  5DJT A;  4JGP A;  4L9G A;  4HI4 A;  2Z6C A;  1D06 A;  2J80 A;  4NXF A;  3F1O A;  4EXO A;  2W27 A;  4B9O A;  2JN7 A;  4JGQ A;  4F3L B;  3ICY A;  4BBV A;  1G28 A;  4GCZ A;  1XJ6 A;  1S66 L;  4R6L A;  5DJU A;  2Z6D A;  4JGR A;  2EA9 A;  2OWJ A;  1TS7 A;  1LSX A;  2WKP A;  3E4Q A;  3UME A;  4BBT A;  1N9N A;  1BYW A;  2V0U A;  2VLG A;  4F3L A;  4L9E A;  2V1B A;  3LIB A;  5F6A A;  2W0N A;  3EWK A;  4LRY C;  4I3I A;  1N9L A;  2QJ5 A;  3LYX A;  4I3A A;  3CAX A;  3UE6 A;  2QHK A;  5HDC A;  4MN5 A;  2K7S A;  1S4R A;  3LID A;  1OT9 A;  4GW9 A;  4EER A;  1XFN A;  1V9Y A;  2ZOH A;  2I9V A;  3FG8 A;  2OOL A;  3H82 B;  3MQO A;  1OTB A;  1F98 A;  3B33 A;  1TS8 A;  1GSV A;  4BBU A;  3IBR A;  3PYP A;  5AVE A;  1T1A A;  4GS9 B;  1V9Z A; 
#chains in the Genus database with same CATH topology
 3GDI A;  1YMS A;  3G4P A;  3OCN A;  1XA7 A;  5HAR A;  5E43 A;  2J8Y A;  3NY4 A;  5DKL A;  4B88 A;  1E25 A;  3I7J A;  3IHA A;  2HV1 A;  4Y13 A;  1YM1 A;  2VEA A;  3QNC A;  5KSH A;  4X68 A;  1K56 A;  3ZFZ A;  5FEF A;  3VSL A;  2HDU A;  1K55 C;  3OPP A;  4LCM A;  4IHQ A;  1FIL A;  3D72 A;  4U0X A;  1DP9 A;  5F5Y A;  4YIN A;  5DFX A;  2V1A A;  2C6W B;  4HJ3 A;  3W2Z A;  3ZVW A;  2VGL S;  3IXB A;  4WEK A;  2W1T B;  5AVF A;  3UE0 A;  4HOI A;  4KG5 A;  3V3S A;  2Y2G A;  3IWI A;  4B4X A;  4Z9Q A;  2EFX A;  5AJG A;  5HWV A;  1HVB A;  3MBZ A;  3L9K A;  5HDD A;  1XJ3 A;  2PD8 A;  3S7O A;  1KVM A;  1K25 A;  3NOP C;  4BL3 A;  5M18 A;  2WKI A;  3JVV A;  4DDS A;  3OBF A;  1F5M A;  2JE5 A;  1L3L A;  3KX0 X;  3T1X A;  4EEU A;  5A90 A;  4HJ4 A;  2BLS A;  3MQ0 A;  5KMW A;  1SDE A;  3M2J A;  4XXR A;  3B42 A;  3NC8 A;  4WMC A;  4LCL A;  5HWW A;  3V67 A;  3LO7 A;  3VP3 A;  3W4O A;  4X25 A;  2QMI A;  1XXM A;  1TVF A;  2ZQD A;  3T4Q A;  3ZGA B;  1W7F A;  1VET A;  5L8M A;  1A0K A;  1I2S A;  2W3G A;  3BY9 A;  1FR1 A;  4KQD A;  3LR4 A;  3V5M A;  4BQM A;  3H9W A;  2W1R A;  1KGF A;  5F69 A;  2PHY A;  4MBH A;  5JYO A;  3HRE A;  2Y2K A;  5TBM A;  4OPY A;  1K0K A;  4GDN A;  3LGO A;  2Y2M A;  4ID4 A;  4HJ6 A;  1S67 L;  1M6K A;  3OPL A;  3MF0 A;  2ZC7 A;  3HLB A;  1LT0 A;  4BL2 A;  3GEC A;  4OON A;  5F82 A;  3IS2 A;  4E04 A;  5A92 A;  2XRN A;  5EEC A;  3CWF A;  2V8F A;  4ZTK A;  3RJU A;  2XD1 A;  1XGJ A;  4R70 A;  3A0V A;  4LV3 A;  2M7U A;  4M4X A;  2VV7 A;  3CI6 A;  4E6W A;  2QPN A;  3C38 A;  4UQI S;  4CLC C;  1ES2 A;  2WAD A;  4RX3 A;  3F1N A;  1G68 A;  4E3L A;  1YSP A;  3UB8 A;  1H5X A;  3LIC A;  4I3J A;  1FSW A;  5EVI C;  3MQQ A;  2A24 A;  2ZMF A;  3G32 A;  3AGF A;  1ERO A;  2VA0 A;  2EWW A;  3FC7 A;  4O0P A;  1W5D A;  1LL8 A;  4UA7 A;  1YMX A;  1FOF A;  2Y2J A;  1RP5 A;  1N9B A;  1MZU A;  5FDH A;  3PXP A;  1PI4 A;  3UE3 A;  1XGI A;  3LR0 A;  4GHI A;  3ZG8 B;  3V39 A;  2XH9 A;  5BOH A;  2G7U A;  1UWN X;  2EFU A;  1XKZ A;  3A3D A;  1H8Z A;  2XLN A;  2L1M A;  3IF6 C;  4MNR A;  2HP5 A;  3DTI A;  1QME A;  3ITA A;  4DKI A;  5DKK A;  4LGW A;  5CHJ A;  4PM9 A;  4R3J A;  4Q0I A;  4EW7 A;  3OCL A;  4QB8 A;  2JKF A;  3HUO A;  1PI5 A;  3A3I A;  3TG9 A;  3U2A A;  1GSW A;  2G2U A;  4DF6 A;  4DJ3 A;  1O07 A;  1IEL A;  3IS2 B;  4YNR A;  2EX6 A;  1VB6 A;  3KYZ A;  4X6T A;  1MKI A;  4S2N A;  4R3A A;  1PIO A;  4KZ3 A;  3RXW A;  4HBU A;  3T1Q B;  5FQM A;  1NY0 A;  2HJ9 C;  3PAE A;  4MN7 A;  2Y59 A;  2WGW B;  1NZO A;  1LI0 A;  2ZC4 B;  4L9F A;  1ESI A;  1UGU A;  5AQA A;  4MBF A;  5C5K A;  1TS0 A;  1PWD A;  2ZC3 B;  3HVF A;  3UB6 A;  2ZM8 A;  2BAS A;  1DP8 A;  2D01 A;  2A24 B;  2PYR A;  3AGD A;  4Y0U A;  1KVL A;  4LRX C;  4GNU A;  3OZH A;  4LRZ E;  3WS1 A;  1S1Z A;  3BQA A;  3C2W A;  5HFO A;  4JGP A;  4L9G A;  3LEZ A;  1PZO A;  3TOI A;  3F1O A;  1ZG6 A;  4PM5 A;  3BFC A;  3DW0 A;  2WGI A;  2Y2L A;  1YLP A;  3ZNY A;  1BLC A;  3ICY A;  3FPW A;  3WS2 A;  4GCZ A;  3K2N A;  5FAO A;  1NYY A;  5DJU A;  4OLD A;  3VP4 A;  2Y2N A;  3BJN A;  3E4Q A;  3UME A;  1TDG A;  1TEM A;  1QMF A;  2DNS A;  3ZNT A;  5FI2 A;  3MKF A;  1L2S A;  1BYW A;  1EWZ A;  4FD8 A;  3BEB A;  1ZC2 A;  4EBN A;  3HUM A;  4MMN A;  4GZB A;  2ZM2 A;  4S2M A;  1CI8 A;  4IJG A;  4S2I A;  5FQI A;  3GR2 A;  3WRT A;  3M2K A;  1NXY A;  1MWR A;  5DF7 A;  4JXS A;  5HPF A;  3SH9 A;  2P74 A;  2WZZ A;  1V9Y A;  3TE8 A;  2PRF A;  5DTT A;  2H0Y A;  2OOL A;  2ZQ9 A;  3T4J A;  4GJ4 A;  2ZL1 A;  1F98 A;  4E3J A;  1GCE A;  3ITB A;  4X56 A;  1XA1 A;  3UNW A;  4KZ7 A;  3UE1 A;  4OLG A;  3IBR A;  5CEC A;  1KE4 A;  5AVE A;  4DXC A;  3DTK A;  5FL3 A;  4EBL A;  3N8R A;  4EUV A;  5HAP A;  1G6A A;  2A2L A;  4G3V A;  3HL9 A;  5HSQ A;  4OQG A;  1TS6 A;  4E3O A;  1YLY A;  4GOG A;  4QHC A;  4ZJ3 A;  3UO9 A;  1ACF A;  3Q07 A;  3TSG A;  4HH3 A;  5FAT A;  5J4E A;  1L0E A;  2KDK A;  2V20 A;  1BT5 A;  2XEP A;  3DWZ A;  3IX8 A;  3LEQ A;  3HCY A;  4HQA A;  1IYO A;  3MKE A;  2P08 A;  1CI9 A;  2XSS A;  4PM6 A;  1Y28 A;  3C30 A;  4MDZ A;  3QP8 A;  2QJ7 A;  3VE4 A;  1OTE A;  1XX2 A;  3B47 A;  3G30 A;  1OME A;  4EES A;  3MXQ A;  3VOL A;  1YT4 A;  2JC7 A;  1K54 A;  4KZ8 A;  4H6J A;  2W1T A;  3JYI A;  2ZQ8 A;  3D9Y A;  4BJP A;  3BFE A;  1BUL A;  2GJ3 A;  4O01 A;  2H28 A;  1T18 A;  2VGL M;  1VEU B;  4MBK A;  2V9A A;  2J3T D;  3DBA A;  4GD8 A;  4BEN A;  3IXH A;  3SW1 A;  4NXG A;  3ZQ5 A;  4BLM A;  3R7W B;  2YKH A;  4LLO B;  4PKY A;  4R23 A;  1CJF A;  2ZQC A;  4HH2 A;  4I39 A;  3VOZ A;  3Q1F A;  5EVL A;  3IF5 A;  3SS4 A;  1P97 A;  1S6R A;  2VX8 A;  1W63 Q;  1VM1 A;  3MSH A;  3PBT A;  2QYB A;  1K6S A;  3LIF A;  4Y15 A;  5FI6 A;  5CX7 A;  4CLC D;  5EVE A;  4Y3I A;  4DXB A;  5G4Z A;  4OQI A;  4IUK A;  3LI8 A;  2GZA A;  3BQ8 A;  3G31 A;  4WN5 A;  1W8Y A;  4FCF A;  3WS4 A;  5A93 A;  3N8L A;  3UDI A;  4WZ5 C;  3UY6 A;  4BMW A;  1L0F A;  5FEG A;  5EVI D;  3BFG A;  5CXW A;  4RYE A;  3RFB A;  4DRT A;  1NRJ A;  1YLZ A;  5EM1 A;  2V8C A;  3S7Q A;  4LV1 A;  4QY5 A;  4I38 A;  4S2J A;  2Q9M A;  1LL9 A;  3O88 A;  3NEC A;  4R4S A;  2G2W A;  1K57 A;  1NWZ A;  3V50 A;  1BZA A;  4CPK A;  4M3K A;  1ZG4 A;  1OTA A;  3C8C A;  3LIE A;  1P9W A;  1C3B A;  4H6J B;  2L0W A;  4UA9 A;  3CLO A;  3TW8 A;  3GTC A;  4FUW A;  3E0Y A;  1OJ5 A;  1Z09 A;  1DP6 A;  3SOI A;  4PKY G;  4OPR A;  4IVK A;  2D02 A;  4IBR A;  5TJJ A;  2ZBB A;  5GL9 A;  1ONH A;  2ZJ9 A;  1AWI A;  2J9O A;  3CUE C;  4Q0H A;  4HBT A;  4HEF A;  5FQK A;  4UQI M;  3OC2 A;  4MN6 A;  3LIA A;  2LB5 A;  2XA7 M;  3IX4 A;  3EGX C;  3IH9 A;  4JLF A;  4HP9 A;  1NLZ A;  2PR6 A;  3QP5 A;  3OOV A;  1YLT A;  3C7U A;  2GNX A;  4FTX A;  5EV0 A;  1TDL A;  3SS3 A;  1MC0 A;  1KE3 A;  3P09 A;  3BW6 A;  5FQJ A;  2XF3 A;  3NOT C;  4PAU A;  4CQH A;  3WS0 A;  2P7J A;  4NET A;  4NK3 A;  4UA6 A;  3K3D A;  5HDS A;  3P01 A;  5HW3 A;  3OPH A;  3HJI A;  3JVU A;  5E2H A;  3O87 A;  2PR5 A;  2C5W B;  2Y55 A;  5U47 A;  2Y91 A;  4LEN A;  4KUK A;  3FV7 A;  1TD5 A;  4EQ1 A;  2ZQ7 A;  1GHP A;  2HF6 A;  3SH8 A;  3VE3 A;  2P9V A;  1GSX A;  1J9M A;  1Q2Q A;  5A91 A;  2MJ6 A;  3M6H A;  3S1Y A;  5IU1 A;  2WYX A;  1BSG A;  4GD6 A;  3T4T A;  4JXV A;  1DRM A;  1S4S A;  2DRW A;  3CG5 A;  3PBR A;  2WGW A;  2XA7 S;  3IWQ A;  4XUZ A;  4S2L A;  3ZG0 A;  3UMD A;  5F1G A;  4HI4 A;  2KOI A;  1SDN A;  4GLQ A;  1ALQ A;  4E3N A;  1D06 A;  2B95 A;  3PBO A;  4OPQ A;  4JBF A;  4KQR A;  1HZO A;  2V1Z A;  2EX8 A;  5FA7 A;  3PR6 A;  4H8R A;  3UDF A;  4JGQ A;  4QWO A;  5E2F A;  4JKT A;  1KDS A;  5M1A A;  4FH4 A;  3QP1 A;  2XDM A;  1ES4 A;  4BBV A;  1ES5 A;  3ZHH A;  2J7V A;  1Z6F A;  5MC7 A;  2O99 A;  4R6L A;  2Z6D A;  1BLS A;  4L0L A;  4Y0O A;  4BBT A;  3UPP A;  3V3R A;  2LB9 A;  3CMZ A;  3DAV A;  4WMC D;  3SZT A;  5K5B A;  4ZJ2 A;  2XFS A;  3CIT A;  4E3K A;  1BLP A;  5F6A A;  1O7E A;  4LFU A;  4LRY C;  3C4O A;  1PRQ A;  2BTF P;  5CGS A;  4IUH A;  1E3U D;  5GHY A;  1IYP A;  2QHK A;  1K54 C;  2P9V B;  4PM8 A;  5HDC A;  1K6R A;  2EXB A;  3ZG5 A;  1I5Q A;  4OOY A;  3NI9 A;  1DJC A;  2EWV A;  2ZMA A;  5L2F A;  3N8S A;  2M7V A;  4WM9 A;  1JWV A;  1P9R A;  2O9B A;  5AQB A;  1YLW A;  1G6O A;  3S22 A;  1WE4 A;  1H8Y A;  5AQ7 A;  3B33 A;  3T12 B;  2B5R A;  3ZCZ A;  1TS8 A;  5FDS A;  5GLD A;  4GN2 A;  3HLC A;  3IHB A;  1T1A A;  2WGV A;  2Y8H A;  3GQZ A;  3T4O A;  4GS9 B;  2R9X A;  5IT5 A;  5HAI A;  3NDE A;  5KZH A;  3PTE A;  1S1Y A;  2H10 A;  3UB5 P;  1SCW A;  3SH7 A;  4R38 A;  1FSY A;  1EI5 A;  3BM6 A;  3O86 A;  2XD5 A;  4LV2 A;  3G6O A;  1IYS A;  4JF6 A;  4OH0 A;  2OSU A;  4OQH A;  4HNB A;  2Q0O A;  4HHD A;  4EEP A;  2W3H A;  4OOL A;  3D3O A;  4ZDX A;  3T4K A;  2KLI A;  4IED A;  5HD3 A;  5FQ9 A;  4KEN B;  1OJG A;  3KSG A;  1PFL A;  2QWS A;  2J9P A;  3IXD A;  5A8B A;  4R0Q A;  1K57 C;  4FOF A;  5I94 A;  2E8I A;  4PMA A;  2PD7 A;  1GHM A;  4N9K A;  3QP4 A;  3S7P A;  2ZMV A;  1YKD A;  2Q9N A;  4Z1W A;  4OP5 A;  2OLU A;  5EM0 A;  1DJB A;  2OWH A;  4ETX A;  2E8J A;  3LCE A;  3ISG A;  1N9O A;  3RTY A;  4X1L A;  3A3E A;  1H3Q A;  3GVB A;  5F68 A;  1PW1 A;  2NUT C;  1MPL A;  3OLO A;  3UB9 A;  3A0S A;  4OQ0 A;  2XK1 A;  5CGX A;  4KUO A;  5CHU A;  4D60 A;  3D4F A;  3MFD A;  3A0R A;  3MJQ A;  2VJW A;  2RCX A;  3HLG A;  4RVA A;  2RL3 A;  2R78 A;  4XT2 A;  4E6X A;  1VEU A;  2INW A;  1FR6 A;  1YSQ A;  5GLB A;  4F94 A;  4X1M A;  2Z2M B;  1P0Z A;  2IWB A;  2YKF A;  4QD4 A;  1F9I A;  2DCF A;  3R7W A;  1SZV A;  2OLV A;  1IOU A;  4DN0 A;  1X0O A;  1CQA A;  2GX5 A;  2M1C A;  3IX3 A;  2ZM0 A;  4CLC A;  5HD5 A;  5HAQ A;  4S2K A;  5J3W A;  3GSG A;  4LPZ A;  4UEY A;  1HTZ A;  2JHE A;  3VP2 A;  1MKM A;  5HL1 A;  3R4K A;  2Y79 A;  2HDR A;  3Q82 A;  5CTN A;  5EVI A;  3BYD A;  1ES3 A;  5CEB A;  5CER A;  1KGG A;  3ULF A;  1LL5 A;  3EQU A;  4HP4 A;  5CRF A;  3FYZ A;  1H0M A;  3LR5 A;  2HGV A;  1IYQ A;  2QKP A;  4Y17 A;  2WAF A;  1RGZ A;  3BLS A;  2B02 A;  5FAP A;  2WKR A;  3MR0 A;  5EFW A;  4HIA A;  3NJA A;  1BLH A;  1UWP X;  3FZC A;  4WEL A;  5L09 A;  3LY3 A;  3KSI A;  3VV4 A;  1Q2P A;  1WYB A;  3NOU C;  5KSC A;  1ZHH B;  3HBR A;  4Y5F A;  5GLA A;  1T19 A;  2WUQ A;  1OT6 A;  4C75 A;  4XT2 B;  5KIZ A;  1M40 A;  1NRF A;  1H8M A;  3C5A A;  4N9L A;  2ZC6 B;  2X01 A;  2V2F F;  1MY8 A;  1D1J A;  3NHQ A;  1YQS A;  2IWC A;  1NZU A;  1RCJ A;  3H7W B;  4WZ4 A;  4KQO A;  2WKQ A;  5DF9 A;  4K0W A;  1N4O A;  3ZG9 B;  1XJ4 A;  5EUA A;  3E4P A;  3T4L A;  2FFY A;  4KZB A;  3P98 A;  1CK3 A;  4C6Y A;  1GHI A;  2Y2O A;  3GRJ A;  1JVJ A;  3E4O A;  4CLC B;  1SKO A;  3DTM A;  4EET B;  2A3U A;  1PWG A;  3RH8 B;  4MLL A;  4I5S A;  3LUQ A;  3HLF A;  3HUN A;  2ZD8 A;  2HDQ A;  4DE2 A;  3BWL A;  1XP4 A;  2PAV P;  5EVI B;  4ESP A;  1YAX A;  3CPT A;  1PZP A;  3C4P A;  3G34 A;  2B18 A;  2PDR A;  3OPR A;  1OTI A;  4JXW A;  1E4D A;  4PHT A;  4ZJ1 A;  4E3M A;  2IWD A;  5LBR A;  4WL9 A;  4S2N C;  2HZ5 A;  4RX2 A;  5G4Y A;  2DMW A;  1JWP A;  2O0Y A;  1IKG A;  1MWU A;  2P04 A;  3NIA A;  1DY6 A;  4RA7 A;  1I2W A;  3IF6 B;  4ME4 A;  3H82 A;  3G2Y A;  3VFH A;  2OV5 A;  3N6I A;  1L0G A;  3CHW P;  3HLE A;  3CJM A;  4KG2 A;  4NXF A;  2VGK A;  2W27 A;  3GMW A;  1JWZ A;  5HPI A;  1GA9 A;  1AXB A;  3FKW A;  4JXG A;  4B9O A;  2JN7 A;  3WS5 A;  4BD1 A;  1CEF A;  4F3L B;  5TGF A;  4P6Z M;  3HLW A;  1J3W A;  1G28 A;  1XJ6 A;  3NBL A;  4Y2F A;  1W79 A;  1FIK A;  5DVA A;  4YOF A;  1SKO B;  1NLY A;  2EA9 A;  2OWJ A;  4X69 A;  1LSX A;  1MXO A;  2WKP A;  3KYE A;  3QNB A;  1KGE A;  4ARZ A;  4U3T A;  1N9N A;  2R9W A;  2JKR I;  4NEE D;  2V0U A;  2VLG A;  3KO6 A;  4I3I A;  3CPT B;  4II7 A;  1N9L A;  1GA0 A;  3IQA A;  1RGY A;  1IKI A;  4B4Z A;  3LYX A;  4EV4 A;  4A5R A;  1FCN A;  2WKH A;  3UE6 A;  5M19 A;  3EGD C;  3T4S A;  1VHM A;  4N1H A;  5E2G A;  4S2P A;  2I72 A;  2JKT M;  2Y2H A;  2Y2I A;  4R3B A;  2K7S A;  1S4R A;  3LID A;  2HP6 A;  4G3W A;  3RXX A;  1SHV A;  1E3U A;  1XFN A;  3LR3 A;  3MMH A;  2PBY A;  2Y2Q A;  1DJA A;  4S2O A;  3H82 B;  1OTB A;  4EBP A;  1PYY A;  2WKE A;  3IH8 A;  4P87 A;  4BBU A;  2HJE A;  4P6Z S;  3KSF A;  4OVD A;  4WEJ A;  3PYP A;  3ZDJ A;  2GDN A;  2J3T C;  4ZRR A;  1K56 D;  4GKU A;  4JF5 A;  3PBQ A;  2W3E A;  3MZF A;  5DTS A;  3ZG7 B;  1Y4O A;  4KZ4 A;  2AVX A;  4OP8 A;  2KX6 A;  2PBD P;  3IWO A;  3ZYT A;  4KZA A;  3S4X A;  4MCW A;  3MZE A;  4GS9 A;  2OAP 1;  4ARZ B;  5JYP A;  3T1S A;  5F1F A;  4WF0 A;  2XR0 A;  2H0T A;  5GLC A;  2EX9 A;  3E2K A;  4OKP A;  4CLC E;  3W4Q A;  1ONG A;  4EQI A;  2VV8 A;  2VGJ A;  3MFX A;  1TF1 A;  4K91 A;  3G2Z A;  3FKV A;  2K31 A;  4U0T A;  1KE0 A;  3UPO A;  3TJZ C;  3BLM A;  2FH5 A;  3BFF A;  3VMA A;  1JTG A;  2CMN A;  2IA2 A;  1U60 A;  4DE0 A;  1K4E A;  1G5U A;  1ZTU A;  2UV0 E;  2XGN A;  5HZH A;  1PWC A;  1LHY A;  3DWK A;  5CGW A;  1XJ2 A;  1JNU A;  1NJ4 A;  3AGE A;  1VET B;  1YLJ A;  2Z2L B;  1IEM A;  2JKT I;  2L4R A;  2XRO A;  2HDS A;  1S0W A;  5J7E A;  1L0D A;  2V0W A;  3EEH A;  3VP1 A;  4R1G A;  3UB7 A;  1T1B A;  5TBM B;  3O5Y A;  4IBX A;  1OTD A;  1W8Q A;  3VOY A;  2PYP A;  2PT7 A;  5AQ9 A;  3FPV A;  4YWZ A;  5IS1 A;  3PBN A;  3ZVT A;  3BY8 A;  2UWX A;  2XQZ A;  4WZ5 A;  3TRC A;  3UN7 A;  4DDY A;  1PNE A;  1D7E A;  5J8X A;  3A3F A;  3KSH A;  3HJK A;  3M6B A;  2NUP C;  4C3Q A;  3WWX A;  1FQG A;  2CC1 A;  2ZC5 B;  3UDX A;  4HY8 A;  1XPB A;  4JF4 A;  5IHV A;  1FCM A;  1CEG A;  5DFY A;  1K55 A;  5TR7 A;  1LLB A;  3VFF A;  3E2L A;  3LI9 A;  5HWT A;  3F1N B;  4R4R A;  4P85 A;  3N4I A;  3DTE A;  3E98 A;  3QP6 A;  1W63 M;  3CZD A;  1WA9 A;  4ZBE A;  3HLD A;  4UAA A;  1JTD A;  3QHY A;  3Q81 A;  4WBG A;  3P7N A;  1LI9 A;  4DMZ A;  3VP0 A;  5I5L A;  1LSV A;  3BRM A;  4HES A;  3C7V A;  4ZAM A;  2VV6 A;  4FH2 A;  3N7W A;  4GHI B;  1BUE A;  3CUE A;  2H5S A;  4D2O A;  2EX2 A;  4NXB A;  3T50 A;  4Q8I A;  3F1P A;  4O8G A;  4QU3 A;  2X71 A;  4KZ9 A;  3PBS A;  4K0X A;  1ODV A;  3NUL A;  1OPX A;  4JGO A;  4N92 A;  4UHU A;  5EE8 A;  4GDB A;  2JCH A;  4PPR A;  4P0M A;  5CHM A;  2VK3 A;  4BD0 A;  1ERQ A;  3K3C A;  4KG6 A;  4KZ5 A;  4DJ2 A;  2HP9 A;  2FFF B;  3SS5 A;  2QZ6 A;  3O3V A;  3PHY A;  1ZKJ A;  5F83 A;  5FI7 A;  1KOU A;  2VZW A;  3W8K A;  5GHX A;  4Y7P A;  4K08 A;  4GB7 A;  4LV0 A;  2JKG A;  1YPR A;  4KQQ A;  1SKF A;  2K2N A;  1ESU A;  3H7W A;  1Y54 A;  5FAQ A;  1XFQ A;  3IXG A;  4RQ9 A;  5HX9 A;  1LSW A;  3S7N A;  4EWF A;  1HD8 A;  1BTL A;  4WUJ A;  4Y0T A;  1IFQ A;  2ZOI A;  5GHZ A;  3T1R A;  5DTK A;  5EPH A;  5G18 A;  3IT9 A;  1F2K A;  5E2E A;  4AFI A;  1T1C A;  4KZ6 A;  4EUZ A;  3B3X A;  5EOO A;  1STZ A;  2OAQ 1;  4NXE A;  1MWT A;  3BEC A;  3LY4 A;  3F1O B;  3FWL A;  2ZQA A;  3F1P B;  3LFV A;  1EW0 A;  5EOE A;  4OPZ A;  2EXA A;  2ZLY A;  3MXR A;  4MEZ A;  3A3J A;  4DE1 A;  3EOI A;  4P6B A;  3IBJ A;  4WLA A;  5CTM A;  5DJT A;  1K38 A;  2Z6C A;  2W3D A;  1KDW A;  5FAS A;  2J80 A;  4DE3 A;  2O9A A;  1VQQ A;  4OOM A;  1ERM A;  4FSF A;  4EXO A;  2VKS A;  5L10 A;  3Q7V A;  3IF6 A;  3UPN A;  1WYC A;  4PM7 A;  4ETZ A;  4NKP A;  2PU4 A;  2WAE A;  4E3I A;  5FSR A;  1CF0 A;  3EQV A;  4NG2 A;  2HPB A;  3PAG A;  4X55 A;  1K4F A;  1S66 L;  4XUX A;  4Q0J A;  4N1X A;  2WK0 A;  3L7H A;  4JGR A;  1TS7 A;  4G3K A;  1HLU P;  4QPR A;  3G35 A;  3EEA A;  4F3L A;  4X53 A;  3W4P A;  4L9E A;  2V1B A;  3LIB A;  2W0N A;  3EWK A;  2J3W A;  4JPM A;  2JKR M;  2W3F A;  2QJ5 A;  4WYY A;  5L07 A;  2ACG A;  2XFT A;  4I3A A;  2FZ0 A;  3CAX A;  3JPU A;  2O9C A;  2WZX A;  2A49 A;  2ZL1 B;  3WRZ A;  1NYM A;  4B93 A;  2JBF A;  4MN5 A;  3KYQ A;  3MXS A;  3MZD A;  2X02 A;  3MS6 A;  4BWI A;  1OT9 A;  5TFQ A;  3GV9 A;  4GW9 A;  2BG1 A;  4IVI A;  5FQQ A;  3QP2 A;  4O7D A;  4EER A;  4QJG A;  2ZOH A;  1MWS A;  5DF8 A;  2I9V A;  3VSK A;  3FG8 A;  4YFM A;  1MBL A;  2Y2P A;  2Y4A A;  3MQO A;  5HL6 A;  3Q7Z A;  3BFD A;  4CJN A;  3U4L P;  1GSV A;  5CED A;  5D3O A;  3NCK A;  1FCO A;  1PW8 A;  4EU0 A;  4QY6 A;  3NDG A;  2PU2 A;  3Q7V B;  1V9Z A; 
#chains in the Genus database with same CATH homology
 3GDI A;  5IT5 A;  2A2L A;  3PBQ A;  4G3V A;  2W3E A;  3OCN A;  5HSQ A;  1TS6 A;  1S1Y A;  5DKL A;  4R38 A;  2HV1 A;  2VEA A;  2KX6 A;  5KSH A;  4HH3 A;  3ZYT A;  5J4E A;  3G6O A;  4IHQ A;  2KDK A;  4HNB A;  3D72 A;  4MCW A;  1DP9 A;  4GS9 A;  5F5Y A;  2OAP 1;  5DFX A;  4HHD A;  4EEP A;  2V1A A;  3HCY A;  4HJ3 A;  2W3H A;  4HQA A;  3W2Z A;  4ARZ B;  2VGL S;  4OOL A;  4WF0 A;  3D3O A;  4WEK A;  2W1T B;  5AVF A;  2P08 A;  4HOI A;  3T4K A;  4CLC E;  2KLI A;  2VV8 A;  2XSS A;  1Y28 A;  5HD3 A;  3C30 A;  3MFX A;  4MDZ A;  1OJG A;  2QJ7 A;  3VE4 A;  1OTE A;  1TF1 A;  3KSG A;  3B47 A;  2QWS A;  2K31 A;  5A8B A;  5AJG A;  4EES A;  3MXQ A;  3TJZ C;  4FOF A;  5HWV A;  2FH5 A;  3VOL A;  2PD7 A;  5HDD A;  2CMN A;  1XJ3 A;  2PD8 A;  2IA2 A;  3S7O A;  3S7P A;  2ZMV A;  1YKD A;  3NOP C;  4Z1W A;  4H6J A;  1ZTU A;  2W1T A;  3JVV A;  5HZH A;  3OBF A;  1F5M A;  2OWH A;  3KX0 X;  4ETX A;  4EEU A;  1XJ2 A;  1JNU A;  4HJ4 A;  4BJP A;  3MQ0 A;  2GJ3 A;  4O01 A;  2H28 A;  1N9O A;  3RTY A;  1T18 A;  2VGL M;  2JKT I;  1H3Q A;  2L4R A;  3B42 A;  5F68 A;  2XRO A;  2NUT C;  5J7E A;  5HWW A;  2V0W A;  2V9A A;  3V67 A;  3EEH A;  3OLO A;  3UB9 A;  2J3T D;  3DBA A;  3UB7 A;  1T1B A;  3A0S A;  5TBM B;  3O5Y A;  3SW1 A;  1OTD A;  4NXG A;  4KUO A;  2PYP A;  2PT7 A;  3ZQ5 A;  3FPV A;  3A0R A;  4YWZ A;  3R7W B;  3MJQ A;  2YKH A;  4LLO B;  2VJW A;  4PKY A;  5IS1 A;  3PBN A;  3T4Q A;  5L8M A;  4HH2 A;  4I39 A;  3BY8 A;  2R78 A;  4XT2 A;  2W3G A;  3BY9 A;  4KQD A;  3TRC A;  1P97 A;  3LR4 A;  2INW A;  2VX8 A;  3H9W A;  1W63 Q;  1YSQ A;  3PBT A;  2W1R A;  1D7E A;  3KSH A;  2QYB A;  1P0Z A;  2PHY A;  3HJK A;  3LIF A;  5F69 A;  2YKF A;  2NUP C;  5CX7 A;  4CLC D;  1F9I A;  4Y3I A;  5G4Z A;  5TBM A;  4IUK A;  3LI8 A;  2GZA A;  4HY8 A;  3BQ8 A;  4WN5 A;  3R7W A;  4HJ6 A;  1IOU A;  4DN0 A;  1S67 L;  1X0O A;  5DFY A;  3MF0 A;  2GX5 A;  1LT0 A;  2M1C A;  4BMW A;  4CLC A;  3LI9 A;  5HWT A;  3F1N B;  5HD5 A;  3GEC A;  3RFB A;  3IS2 A;  1NRJ A;  5J3W A;  4E04 A;  3E98 A;  2XRN A;  4LPZ A;  4UEY A;  2JHE A;  3CWF A;  1W63 M;  3S7Q A;  1MKM A;  1WA9 A;  3R4K A;  4I38 A;  2Y79 A;  4R70 A;  3A0V A;  2M7U A;  4M4X A;  2VV7 A;  3CI6 A;  3ULF A;  3C38 A;  3EQU A;  4HP4 A;  4UQI S;  1NWZ A;  3P7N A;  4CLC C;  4DMZ A;  5FL3 A;  5I5L A;  1OTA A;  3C8C A;  1LSV A;  3LIE A;  1P9W A;  3F1N A;  4H6J B;  2L0W A;  1YSP A;  3UB8 A;  3CLO A;  3TW8 A;  2VV6 A;  3LR5 A;  2HGV A;  3LIC A;  4GHI B;  4I3J A;  2QKP A;  3T4O A;  3CUE A;  3MQQ A;  4NXB A;  3T50 A;  2B02 A;  2WKR A;  3MR0 A;  5EFW A;  4HIA A;  2A24 A;  3NJA A;  2ZMF A;  3E0Y A;  1UWP X;  3F1P A;  4O8G A;  2VA0 A;  2EWW A;  3FC7 A;  1OJ5 A;  4O0P A;  4WEL A;  1DP6 A;  3KSI A;  3VV4 A;  4PKY G;  1LL8 A;  3PBS A;  3NOU C;  2D02 A;  5TJJ A;  2ZBB A;  1MZU A;  1ODV A;  1OPX A;  3PXP A;  4JGO A;  3UE3 A;  1ZHH B;  3CUE C;  4Y5F A;  3LR0 A;  4GHI A;  4Q0H A;  1T19 A;  2G7U A;  4UQI M;  3OC2 A;  4MN6 A;  3LIA A;  1OT6 A;  1UWN X;  2LB5 A;  3K3C A;  4XT2 B;  5KIZ A;  2XA7 M;  1H8M A;  2L1M A;  4DJ2 A;  3EGX C;  3NHQ A;  3H7W B;  4HP9 A;  4KQO A;  1NLZ A;  2WKQ A;  5DF9 A;  2PR6 A;  3PHY A;  5DKK A;  1XJ4 A;  3OOV A;  4Q0I A;  4EW7 A;  1KOU A;  2VZW A;  2GNX A;  3OCL A;  3E4P A;  3T4L A;  4K08 A;  1MC0 A;  3U2A A;  1GSW A;  3BW6 A;  4DJ3 A;  3E4O A;  4CLC B;  3NOT C;  4EET B;  3IS2 B;  4YNR A;  2K2N A;  3RH8 B;  3H7W A;  4I5S A;  1VB6 A;  3KYZ A;  4PAU A;  3LUQ A;  4CQH A;  1XFQ A;  2P7J A;  4RQ9 A;  3K3D A;  5HDS A;  1LSW A;  3P01 A;  3BWL A;  3S7N A;  4R3A A;  3HJI A;  3JVU A;  4WUJ A;  1YAX A;  2PR5 A;  1IFQ A;  2ZOI A;  2HJ9 C;  2B18 A;  4MN7 A;  2PDR A;  4KUK A;  1OTI A;  1TD5 A;  4EQ1 A;  2HF6 A;  4PHT A;  4L9F A;  3VE3 A;  1UGU A;  4AFI A;  5C5K A;  1TS0 A;  1T1C A;  5LBR A;  4WL9 A;  1GSX A;  3UB6 A;  1STZ A;  2OAQ 1;  2BAS A;  4NXE A;  2MJ6 A;  1DP8 A;  2D01 A;  5IU1 A;  3F1O B;  5G4Y A;  2DMW A;  2A24 B;  2O0Y A;  2PYR A;  2P04 A;  3F1P B;  3LFV A;  4LRX C;  1EW0 A;  3T4T A;  1DRM A;  1S4S A;  4ME4 A;  3H82 A;  4LRZ E;  3PBR A;  1S1Z A;  2XA7 S;  3BQA A;  3C2W A;  3EOI A;  3IBJ A;  3UMD A;  4WLA A;  5DJT A;  4JGP A;  4L9G A;  4HI4 A;  2KOI A;  2Z6C A;  4GLQ A;  2W3D A;  1D06 A;  2J80 A;  3PBO A;  2O9A A;  4NXF A;  3F1O A;  4OOM A;  4FSF A;  4EXO A;  2W27 A;  5HPI A;  2VKS A;  4B9O A;  2JN7 A;  3PR6 A;  4JGQ A;  4ETZ A;  4F3L B;  4NKP A;  4P6Z M;  3ICY A;  3FPW A;  4BBV A;  1G28 A;  4GCZ A;  1XJ6 A;  3K2N A;  4Y2F A;  3EQV A;  5MC7 A;  1S66 L;  2O99 A;  4R6L A;  4YOF A;  5DJU A;  4Q0J A;  2Z6D A;  3BJN A;  4JGR A;  1NLY A;  2EA9 A;  4L0L A;  2OWJ A;  1TS7 A;  1LSX A;  2WKP A;  3E4Q A;  3UME A;  4G3K A;  4BBT A;  4ARZ A;  1N9N A;  2LB9 A;  2JKR I;  4QPR A;  1BYW A;  5K5B A;  4NEE D;  2V0U A;  2VLG A;  3CIT A;  3EEA A;  4F3L A;  4L9E A;  2V1B A;  3LIB A;  5F6A A;  2W0N A;  3EWK A;  3KO6 A;  2J3W A;  4LRY C;  4I3I A;  2JKR M;  4II7 A;  2W3F A;  1N9L A;  2QJ5 A;  4MMN A;  3LYX A;  4I3A A;  2FZ0 A;  4IUH A;  3CAX A;  2O9C A;  3UE6 A;  3EGD C;  3T4S A;  1VHM A;  2QHK A;  4IJG A;  4B93 A;  5HDC A;  2JKT M;  4MN5 A;  3KYQ A;  2K7S A;  1S4R A;  3LID A;  2EWV A;  4G3W A;  1OT9 A;  4BWI A;  4GW9 A;  5HPF A;  4EER A;  1XFN A;  3MMH A;  3LR3 A;  1V9Y A;  2ZOH A;  3TE8 A;  2M7V A;  1P9R A;  2I9V A;  2O9B A;  3FG8 A;  2OOL A;  3T4J A;  3H82 B;  4GJ4 A;  1G6O A;  3MQO A;  5HL6 A;  1OTB A;  1F98 A;  3B33 A;  1TS8 A;  1GSV A;  4BBU A;  2HJE A;  4P6Z S;  3KSF A;  4WEJ A;  3IBR A;  3PYP A;  5AVE A;  4EU0 A;  1T1A A;  2Y8H A;  2J3T C;  4EUV A;  4ZRR A;  4GS9 B;  1V9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...