2W0NA

Plasticity of pas domain and potential role for signal transduction in the histidine-kinase dcus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GHMGLEPYEISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRLLLINTVPVRSNGVIIGAISTFRDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR PROTEIN DCUS
publication title Plasticity of the Pas Domain and a Potential Role for Signal Transduction in the Histidine Kinase Dcus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 12
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w0nA00
1V9ZA 4HJ3A 3E4QA 5G4YA 1S66L 4KUOA 4NXFA 3RH8B 3LUQA 3LYXA 5J7EA 3BY8A 3CLOA 1T1BA 3B33A 5J3WA 2OWJA 2PYPA 3NJAA 3EEHA 5HD5A 2V1AA 4YWZA 4F3LB 2PHYA 1TS6A 3LIDA 4HOIA 4BBVA 2PR6A 3D72A 2ZBBA 4XT2B 4GHIB 1V9YA 1N9LA 4EQ1A 2I9VA 2W27A 2WKQA 5F69A 5EFWA 4I3AA 2YKFA 3IS2B 4I5SA 4EXOA 4HHDA 5I5LA 3EWKA 4HJ4A 1XJ6A 3FC7A 4I39A 1LSWA 4JGPA 5DJUA 2CMNA 3NHQA 1S4SA 3IBRA 2J80A 3ICYA 4H6JA 4EERA 2W0NA 3F1PB 4K08A 1DP8A 1Y28A 2VV6A 3F1OA 5J4EA 2Z6DA 5DJTA 4WL9A 1GSWA 3GDIA 5DKLA 2ZOIA 4WF0A 3UB8A 3HJIA 4LLOB 4B9OA 4HI4A 2OOLA 3NOUC 4L9EA 4EESA 3H7WB 1DRMA 3MXQA 5A8BA 5HZHA 4WUJA 4HY8A 2OWHA 1VB6A 1UWPX 1S1ZA 2L4RA 5IS1A 1LSVA 1OTDA 5HWWA 3F1NB 1XJ4A 2PR5A 2V0WA 1XJ2A 4HQAA 4KUKA 5HDDA 2QHKA 4EEUA 2QJ5A 1OTEA 3HJKA 1MZUA 5DKKA 4EEPA 4LRZE 3CWFA 4LRXC 1P0ZA 4I38A 2EA9A 3LIBA 1JNUA 2WKPA 4M4XA 1DP9A 4HH2A 2ZOHA 1XFQA 4LRYC 4HP4A 2JHEA 4F3LA 1D06A 2INWA 1LL8A 3MQOA 1N9OA 2A24B 1F9IA 3H82B 4L9GA 4R6LA 1KOUA 3LI9A 1G28A 2L0WA 2HV1A 1LSXA 4XT2A 2M1CA 3LIFA 3LIEA 1DP6A 3E4PA 4GHIA 4DJ3A 3ULFA 2R78A 4JGOA 2QWSA 2VLGA 3A0RA 3LICA 1S1YA 3IS2A 3UMEA 4R70A 3RTYA 4WLAA 5HDCA 2D01A 4GCZA 1TS8A 1X0OA 3NOPC 3LIAA 5HSQA 3F1PA 5TBMA 3P7NA 1GSVA 3UE6A 4I3JA 1T18A 1OJ5A 1BYWA 1TS7A 5AVFA 3T50A 2L1MA 4PKYG 1N9NA 2QKPA 2D02A 4RQ9A 2Z6CA 2WKRA 3BY9A 4BBUA 4PKYA 5F68A 1T1AA 1XFNA 4HIAA 4LPZA 4KQDA 3H7WA 2PD7A 5HDSA 2V1BA 1P97A 4L9FA 1GSXA 2PD8A 5AVEA 5HWVA 1OTAA 4GS9B 3F1NA 2VEAA 3BWLA 4DJ2A 3PYPA 3UB6A 2YKHA 4GW9A 1TS0A 3C2WA 1T1CA 4EETB 3H9WA 3UB7A 3FG8A 1OT9A 4BBTA 3G6OA 1OJGA 2K7SA 4R38A 1S4RA 4R3AA 3MR0A 2A24A 3H82A 4NXEA 2JN7A 1OT6A 5F6AA 3A0VA 2BASA 4HP9A 3PHYA 2P7JA 3ZQ5A 3NOTC 3LI8A 3E4OA 5F5YA 2VV8A 3GECA 1EW0A 5G4ZA 2QJ7A 2V9AA 2PDRA 1OTIA 4EW7A 2H28A 4WN5A 4JGQA 1S67L 3KX0X 3MQQA 1UGUA 3VOLA 4H6JB 1F98A 5HD3A 3SW1A 3K3DA 5TBMB 1LT0A 3F1OB 4HJ6A 3MJQA 3CAXA 1WA9A 4MN6A 1ODVA 4NXBA 3UB9A 3C8CA 1UWNX 2KDKA 4E04A 4HNBA 2PYRA 3OLOA 1D7EA 4MN5A 1XJ3A 2VV7A 2B02A 1OTBA 4JGRA 2GJ3A 5HWTA 5KIZA 3A0SA 1NWZA 3MFXA 2V0UA 3K3CA 4NXGA 4I3IA 3UMDA 3VE3A 1T19A 4HH3A 4GS9A 2KX6A 5IU1A 3VE4A
chains in the Genus database with same CATH superfamily
4HJ3A 3OBFA 4KZ3A 4C3QA 1KDSA 4KUOA 3UB5P 5E2FA 2M7UA 2ZL1A 4IJGA 4NXFA 3CI6A 3N4IA 1MC0A 5LBRA 3TW8A 2XH9A 1YAXA 4KZ6A 3Q82A 4B4XA 5AQ7A 4S2LA 3L9KA 1XP4A 2Y2HA 1T1BA 2OWJA 2PYPA 4HBTA 4LCMA 5FI6A 3UPPA 3MF0A 4YOFA 5CHJA 3UDXA 3SS5A 1FR6A 2VGLS 4BBVA 2PR6A 3D72A 2ZBBA 3QP1A 5MC7A 4BWIA 4QY5A 2Q0OA 3QP5A 3VOZA 5CEBA 3IX3A 4N9LA 2DMWA 4LV1A 2XSSA 4QD4A 2G7UA 2ZLYA 3G2YA 3WS5A 5IHVA 4HHDA 4X6TA 4QJGA 5A91A 3FC7A 4JLFA 4JGPA 3NHQA 3IBRA 2J80A 3GR2A 2HPBA 2ZQAA 3MSHA 5EVLA 1H8ZA 3NY4A 3F1OA 2B95A 4YINA 5HW3A 4UAAA 1GSWA 3G4PA 4JXSA 1MWSA 2ZOIA 5HAQA 4JBFA 4KZ4A 3UB8A 3NDEA 2OV5A 4LLOB 3VP4A 4GD8A 1IYQA 1NLZA 4B9OA 3AGDA 2OOLA 3NOUC 4WEKA 4E3OA 4KQRA 5FDHA 2QMIA 1YMSA 4GLQA 1TD5A 4JF5A 4P6ZS 2PBYA 5CX7A 1TDLA 5TJJA 2OWHA 3GVBA 2IWBA 1J9MA 1UWPX 4EV4A 3QP8A 4X69A 3BECA 2L4RA 4G3VA 3UY6A 3QP6A 2BG1A 1NLYA 1XJ4A 1K6SA 2V0WA 1QMEA 3QP2A 4X25A 3GMWA 4Y2FA 1K4EA 1L0EA 4U0XA 4EEPA 1L2SA 1P9RA 1NYYA 4I38A 2EFXA 3LIBA 2JKRI 2ZC4B 4ZJ2A 1JNUA 3ZCZA 4IUHA 1DP9A 4Y5FA 3VFHA 4Z1WA 2V1ZA 3A3DA 2G2UA 1L0DA 4F3LA 2INWA 5DTKA 1IYOA 1N9OA 1CI8A 2A24B 5BOHA 4L9GA 4R6LA 4DMZA 1G28A 2LB5A 1LSXA 3Q07A 1FQGA 4Q0JA 3LIFA 3LIEA 5L2FA 1H3QA 3MBZA 4GHIA 4JGOA 4P87A 2ZC7A 1I2SA 4N9KA 2EX6A 3PBQA 3T4SA 4P85A 3UMEA 1I2WA 4R70A 3W4PA 2HJ9C 2D01A 2Q9MA 4GCZA 3EQUA 1W5DA 2HDQA 3BRMA 2JE5A 1GHIA 2KOIA 4I3JA 2W1TA 3NECA 3BQAA 4OKPA 1T18A 2HGVA 4Q0IA 4CLCA 2L1MA 3OPHA 2B5RA 2WUQA 4R23A 4E3LA 4ETXA 4RQ9A 2WKRA 1OMEA 4X68A 5GLBA 2M7VA 5A93A 4OQIA 1WYCA 3G32A 2OAP1 2Y79A 1D1JA 3IF6C 1MWUA 4HIAA 4OP5A 3UE1A 4RVAA 1SKOB 4CQHA 1O7EA 4KENB 3C4PA 4GJ4A 3ZHHA 1GHPA 4S2NA 1NRJA 1YLJA 3ZDJA 2WAFA 2PT7A 2R9XA 2Y2OA 4E6WA 1OTAA 3NI9A 3MXRA 2VEAA 3M2KA 2HP6A 5CEDA 3FWLA 4GW9A 2WKEA 1K38A 1L0GA 3GV9A 3IXDA 4EWFA 1YMXA 3IF6A 5HPIA 4R38A 1DY6A 4R3AA 1KVLA 3M6BA 2HZ5A 3S7QA 3MR0A 3TSGA 2HDUA 4MLLA 5DFXA 1YSQA 1FILA 1MWTA 4BENA 3G2ZA 1H0MA 4G3WA 2P7JA 4WMCD 3EQVA 5FI2A 5GLDA 3ZQ5A 2J3TD 5CERA 2JKFA 3PXPA 4A5RA 1ESIA 3JYIA 1EW0A 2XRNA 2OLVA 5G4ZA 3TE8A 1BLSA 3FPWA 2QJ7A 2PAVP 3HUNA 3G31A 3ITAA 4S2OA 3KX0X 3MQQA 1UGUA 3T12B 5F1FA 1F98A 3VP1A 3N8RA 4NG2A 3QP4A 3PAEA 3V39A 5EM0A 2V2FF 4WYYA 1LT0A 3MJQA 2W1TB 3UPNA 2LB9A 3IX8A 3VOYA 1WA9A 1NJ4A 1EROA 3LR3A 2NUPC 1ODVA 2J7VA 3GQZA 2ZMAA 3E2LA 4Q0HA 1EWZA 1IKGA 4PMAA 4BL3A 5HAIA 4E04A 3WS0A 4HNBA 3S4XA 3V50A 5FEGA 2PYRA 3C5AA 4XXRA 3W4QA 4MN5A 1XA7A 5KIZA 3A0SA 4RX3A 4S2MA 3MFXA 1DJBA 3V3SA 2DNSA 4PAUA 1PW1A 2PU4A 2V8FA 3E2KA 4NXGA 4CLCE 2O9AA 4MDZA 5FDSA 3HL9A 4HH3A 5CTMA 3HLEA 4NEED 2BLSA 2VGJA 3RXWA 2KX6A 5IU1A 3FPVA 2PRFA 4FD8A 3E4QA 3G30A 3MQ0A 4N1HA 4QHCA 4LV0A 5FQKA 1S66L 4S2PA 4OOMA 5U47A 3E98A 4X1LA 1RGYA 3EEAA 3SH8A 3KSHA 1FCOA 3RH8B 3BM6A 3LUQA 2Y2MA 1ALQA 5CRFA 3CLOA 4OLGA 3B33A 1BT5A 4D60A 2Y4AA 2V1AA 2O9CA 5EVIA 4CLCD 3N8LA 4OPRA 1TVFA 4RX2A 1PYYA 2Z2MB 3OOVA 3IX4A 4QU3A 4EQ1A 2FZ0A 2W27A 5CGXA 3UE0A 1WYBA 5F69A 4GDNA 3IS2B 4OP8A 3UE3A 2VA0A 5I5LA 3VFFA 3KSGA 4HJ4A 4B4ZA 1GA0A 1LSWA 4NK3A 2CMNA 2UWXA 1N4OA 2A3UA 4H6JA 4EERA 3F1PB 2JKTM 3ZG0A 1ES5A 2XD5A 1IYPA 4U0TA 5J4EA 1Z6FA 3W2ZA 4DXCA 1ES4A 5DFYA 1NZOA 4D2OA 3T1RA 4OQGA 5DKLA 2DRWA 1S0WA 5CGSA 3PBNA 1ONHA 1E4DA 4MBFA 3HJIA 3T4JA 5TGFA 4E3KA 2FFFB 2VZWA 5J8XA 4HI4A 4R0QA 4L9EA 2ZC3B 1DRMA 2HF6A 2J3WA 3MXQA 5GL9A 3HVFA 2P08A 1VB6A 4PM5A 3BLSA 2H5SA 5DTSA 3CPTA 4P0MA 3KYQA 3LY3A 2ZQ8A 1L0FA 4O0PA 3V67A 2WYXA 3HLDA 2ZQ9A 3DTEA 4CJNA 4JXGA 4HQAA 1ES2A 2QHKA 5HARA 3WS4A 1OTEA 1MKMA 1MZUA 5DKKA 4LRZE 4BL2A 2ACGA 4R4SA 5EUAA 1P0ZA 4JXVA 3MFDA 2ZQDA 4HH2A 5F1GA 2HP9A 1XFQA 4BLMA 2JHEA 3C38A 3EOIA 4K91A 4RYEA 2P9VA 4E3NA 2W3FA 3MQOA 5FAPA 1F9IA 2CC1A 3H82B 1KOUA 2XD1A 2IWCA 4XT2A 3U2AA 4ZRRA 2VK3A 1DP6A 2P74A 5EOEA 3E4PA 3MS6A 3Q7VB 2R78A 2EWVA 3AGFA 3HLWA 2VLGA 3JVVA 2J3TC 3LICA 1S1YA 1P9WA 1TEMA 3DTKA 1TDGA 2ZM2A 1BZAA 1VETA 5TR7A 2XFSA 3HLFA 2FFYA 4PM8A 1E25A 1X0OA 3LIAA 3P7NA 1GSVA 1SDNA 3UE6A 4X1MA 4UA7A 3N8SA 1BYWA 3BW6A 3W8KA 1TS7A 5GHZA 3SZTA 1QMFA 3GTCA 4PKYG 3IHBA 4WMCA 4KZ5A 2D02A 2WGVA 5FL3A 5JYPA 1CEFA 5FSRA 2XDMA 4GNUA 3O87A 4OQHA 3P09A 1PNEA 2XLNA 4QY6A 3BQ8A 2WZXA 4GOGA 4KQDA 3H7WA 2H10A 4DKIA 4OOLA 3T1SA 3ZNYA 5EVID 1EI5A 5HDSA 1IELA 2Y2QA 4IVIA 4MEZA 2PD8A 5AVEA 1M6KA 2WGWA 5HFOA 1PRQA 1YSPA 3F1NA 3KYZA 4P6BA 3PAGA 5D3OA 3VMAA 4DJ2A 1PI5A 3WS2A 3C2WA 3SH9A 4EETB 2ZL1B 4OVDA 3FG8A 1YPRA 1MY8A 4Z9QA 3IHAA 3LY4A 5I94A 1PWDA 1XA1A 3D9YA 3T4QA 3B47A 2Y2GA 2G2WA 4WM9A 4EBPA 2JCHA 3D3OA 3D4FA 4CLCC 1K57C 4DE3A 1K25A 3EGXC 3NIAA 4OLDA 2BASA 4HP9A 4GD6A 3PHYA 2X01A 3A3FA 3IXBA 3DWZA 1NY0A 4XUXA 3NOTC 3E4OA 5F5YA 5AQBA 3GECA 2XQZA 4FCFA 1NZUA 1OTIA 4EW7A 1CF0A 2EWWA 4WN5A 1H8MA 3JVUA 4S2NC 1S67L 3VOLA 1HVBA 1JVJA 1VETB 4EBLA 4B88A 5CGWA 1LHYA 2J8YA 5DTTA 1K57A 1PZOA 1JTDA 3UNWA 4MN7A 3F1OB 4BJPA 1H5XA 4UQIM 3EGDC 1I5QA 4HESA 4QPRA 1XPBA 5EPHA 1XXMA 2ZC5B 4C6YA 1PI4A 1H8YA 3UB9A 4K0WA 4O01A 1IOUA 2KDKA 4XUZA 3DAVA 3N7WA 1D7EA 4BQMA 4JGRA 5HWTA 1ACFA 1FR1A 3CUEA 5HPFA 1XKZA 2XFTA 3T4LA 3CHWP 3CJMA 3LR4A 2V0UA 5E43A 4I3IA 3WRTA 3UMDA 3VE3A 4ID4A 2E8JA 4UA9A 1K0KA 4GS9A 3IWQA 5FQMA 1V9ZA 5G4YA 4KZ8A 1RGZA 5FASA 2FH5A 5F83A 1N9BA 1BLCA 2ZM0A 4S2KA 5HX9A 3S1YA 4PM7A 3S7PA 5J7EA 3SH7A 3Q7ZA 2Y8HA 3T4OA 1DJAA 2JKRM 4O8GA 4KZAA 4WEJA 3T4KA 4F3LB 2O99A 2Y2NA 3IXHA 1LLBA 4X55A 5F82A 1KE4A 4LV2A 1IKIA 2Y2LA 1J3WA 4GHIB 1V9YA 1N9LA 2OAQ1 3LEZA 5EE8A 3AGEA 2GNXA 4CPKA 5L8MA 1STZA 2I72A 2YKFA 1ONGA 2NUTC 2AVXA 3ZVTA 1XJ6A 3ZYTA 1PWCA 2KLIA 5DJUA 5DF8A 5E2EA 4LCLA 2H0TA 2WKHA 3BYDA 4S2IA 3WS1A 3FKVA 1AWIA 4E3MA 4L0LA 2WGIA 4UA6A 1MWRA 5DJTA 1G68A 3CZDA 4WL9A 4CLCB 3GDIA 2W3HA 4PM9A 3K2NA 3IWIA 3UDIA 3R7WA 4ZDXA 1M40A 1ZG4A 4EUZA 3HUOA 3CG5A 1KGFA 4EESA 4Y3IA 4IVKA 1LI0A 4KG5A 5A8BA 5CXWA 4WUJA 5EVIC 2B18A 1W63M 1HD8A 3MXSA 2DCFA 1G6OA 1YKDA 2WKIA 2XR0A 4DE2A 3KSIA 2PU2A 4E3IA 1OTDA 3MZDA 5HWWA 5A90A 2PR5A 4KUKA 2QJ5A 2O0YA 3OZHA 3M6HA 3ZNTA 4X53A 2XF3A 4R3BA 5EVEA 1K4FA 3IH8A 3DW0A 4LRXC 3IF6B 2WKPA 3P98A 2GZAA 4R4RA 5CTNA 4WBGA 1F5MA 3TG9A 3G34A 5FEFA 2HJEA 4HP4A 3LCEA 4QB8A 1LL8A 1JWZA 3BFCA 1LI9A 3LI9A 3V3RA 3ZFZA 2L0WA 2HV1A 5FQJA 5CECA 3WWXA 2OLUA 3BFGA 3IXGA 1K55C 2ZC6B 4ZTKA 2W3GA 4Y0TA 1K6RA 1ES3A 3BFFA 4MNRA 3RTYA 4WLAA 5HDCA 1RP5A 5HL6A 1Y54A 4KQQA 3ZGAB 3C7VA 1YLYA 1TS8A 3FYZA 1FIKA 5HSQA 4LGWA 4HEFA 2C6WB 2OSUA 4KZ9A 3O5YA 3IT9A 4PHTA 1MPLA 3T50A 3LEQA 2Y2IA 1K54C 1K55A 2QKPA 2Z6CA 2QZ6A 2IWDA 3BY9A 5CHUA 3MKEA 4BBUA 4JXWA 4PKYA 2RCXA 5F68A 4OPYA 4LPZA 5TFQA 3A3EA 1W8YA 1E3UA 3BJNA 4ARZA 1BULA 3ZG8B 4X56A 2X02A 4UQIS 4BD0A 1P97A 4B93A 5DF7A 1YQSA 5HWVA 2HP5A 4F94A 4DE1A 1K54A 1GHMA 3PYPA 1W79A 3UB6A 4OPZA 1TS0A 2RL3A 3E0YA 4UHUA 1T1CA 3BLMA 3H9WA 1PIOA 3UB7A 2ZD8A 4KZ7A 3OCNA 2JKGA 3HREA 3G6OA 4BD1A 2K7SA 1ERQA 2XGNA 4JF4A 4ESPA 2J9OA 1ERMA 2A24A 2W3DA 3M2JA 4M3KA 3UDFA 5EVIB 3A0VA 3GRJA 2WADA 4G3KA 2ZMVA 1YLPA 3FZCA 5AQ9A 2Y2PA 5FATA 3LI8A 2XROA 4IHQA 2R9WA 3UPOA 5FQQA 2EXAA 1ESUA 4UEYA 2A49A 4ZJ1A 2V9AA 2Z2LB 2PDRA 2H28A 3VV4A 2ZQCA 1Q2PA 4MBHA 1K56A 1RCJA 1Y4OA 2K31A 3O88A 4H6JB 1GA9A 1CI9A 1AXBA 3SW1A 1VEUA 3KO6A 3Q1FA 4HJ6A 4AFIA 1W63Q 1MXOA 3CAXA 4MMNA 5GLAA 5HAPA 1YLWA 4NXBA 3P01A 3PTEA 4Y15A 3C8CA 4DXBA 4OQ0A 1YT4A 2XA7M 5EECA 1IEMA 2VV7A 3ZVWA 2GJ3A 3T1QB 1SKOA 2XK1A 2MJ6A 5M18A 3QNCA 1TF1A 4DE0A 3LGOA 1T19A 4ARZB 4FTXA 3ZG7B 3FV7A 3HCYA 3N6IA 1JTGA 3CMZA 3CPTB 3HLBA 3NULA 3SS3A 2VGKA 1CEGA 1PFLA 3OPLA 3T4TA 3QNBA 4IBXA 5FI7A 4WELA 3NBLA 1KE3A 2O9BA 4ZBEA 5L07A 1A0KA 5K5BA 1W7FA 2VX8A 4IUKA 1FSWA 3LYXA 1KGEA 3BY8A 4FH2A 4Y0UA 3PBTA 1WE4A 5J3WA 4EU0A 3NJAA 4GN2A 1U60A 3EEHA 4DRTA 4N92A 1PWGA 5HD5A 4OONA 1VHMA 1YLZA 4YWZA 2HDRA 2P9VB 2PHYA 1TS6A 3LIDA 4HOIA 2VKSA 4ZAMA 4DDSA 3U4LP 4Y0OA 2K2NA 1OPXA 5KSCA 3RJUA 2WK0A 4XT2B 3GSGA 4NETA 4H8RA 2Y91A 2I9VA 1FCNA 3A3IA 3RFBA 2WKQA 4Y13A 5EFWA 4I3AA 3NC8A 4I5SA 4EXOA 3DWKA 3CUEC 2ZMFA 3MZEA 3EWKA 5GHYA 4FH4A 1E3UD 4KG2A 4WZ5C 2EX2A 4I39A 3V5MA 1S4SA 3LR5A 3S7NA 4JPMA 2P04A 3ICYA 3ZG5A 2W0NA 5FA7A 1PZPA 5GLCA 3O86A 4K08A 1DP8A 1Y28A 3FKWA 1KVMA 2VV6A 1KDWA 2Z6DA 2QYBA 5FQ9A 1VEUB 1SZVA 3R4KA 1XGIA 3VP2A 1ZC2A 4FSFA 4LV3A 4WF0A 5EOOA 5G18A 2WAEA 3IWOA 5EV0A 4R1GA 2H0YA 4EQIA 3PBOA 5KMWA 1JWVA 3HBRA 4WZ5A 4EBNA 4BMWA 3H7WB 4S2JA 5HZHA 4HY8A 3NCKA 4Y17A 5DF9A 5FQIA 3HUMA 3QHYA 2X71A 4O7DA 1S1ZA 3G35A 1NXYA 5IS1A 1LSVA 2WGWB 5FAQA 2VGLM 3IF5A 3F1NB 1XJ2A 3L7HA 3PR6A 5AJGA 5HDDA 3S7OA 1SHVA 3LFVA 1W8QA 3MZFA 4EEUA 3C30A 4EUVA 3HJKA 4JKTA 4YNRA 5KSHA 3OC2A 2ZQ7A 3CWFA 2VJWA 1BSGA 3HLCA 5E2HA 2EA9A 3VP0A 1XX2A 3I7JA 1ZKJA 4MBKA 4M4XA 3VP3A 2ZOHA 1K56D 1IFQA 3C7UA 5HL1A 3KYEA 4LRYC 4E6XA 1D06A 3OPPA 1SKFA 4DF6A 1PW8A 2XEPA 2M1CA 2BTFP 4U3TA 3HLGA 1MKIA 5L09A 4DJ3A 2W3EA 3UN7A 3ULFA 1JWPA 2PBDP 1BLPA 2QPNA 2QWSA 2JC7A 3A0RA 3IS2A 1VQQA 5KZHA 4ZJ3A 2EX8A 1C3BA 1MBLA 1BUEA 2Y2KA 3TJZC 1F2KA 4R3JA 2IA2A 1VM1A 4E3JA 3IQAA 2JKTI 3NOPC 3PBSA 5EM1A 3BEBA 3F1PA 5TBMA 3DTMA 5A92A 4P6ZM 1OJ5A 4YFMA 3IH9A 5AVFA 4QWOA 4GDBA 4LENA 3B3XA 2J9PA 5FAOA 1N9NA 3RXXA 4RA7A 4GB7A 5CHMA 4OPQA 3LR0A 4IEDA 4N1XA 4ETZA 1ZTUA 3O3VA 4Y7PA 1T1AA 2ZJ9A 3T1XA 3UO9A 4C75A 1DJCA 1XFNA 1HZOA 4KG6A 3TOIA 1CJFA 3CITA 4OH0A 2PD7A 4KZBA 3ZG9B 2JBFA 1Q2QA 4JF6A 5E2GA 1SCWA 1XGJA 2V1BA 1SDEA 1GCEA 1NRFA 3NDGA 3VSKA 4L9FA 1NYMA 1GSXA 3MMHA 1IYSA 3BFDA 2GX5A 4NKPA 4GS9B 3W4OA 1ZG6A 4K0XA 1G6AA 3A3JA 3BWLA 2Q9NA 5JYOA 2C5WB 3TRCA 2YKHA 1G5UA 2XA7S 5L10A 1HTZA 1OT9A 4BBTA 3S22A 1KGGA 1OJGA 1S6RA 5M1AA 4FOFA 5DVAA 3BFEA 1S4RA 2V20A 3B42A 3H82A 4NXEA 5M19A 2JN7A 2W1RA 5IT5A 1OT6A 5F6AA 3KSFA 1HLUP 1CQAA 1YM1A 3Q7VA 3Q81A 4HBUA 3C4OA 2Y2JA 4DDYA 2E8IA 4KQOA 2VV8A 4ME4A 4PPRA 1BTLA 2A2LA 1FCMA 2HDSA 4PM6A 4JGQA 1KE0A 5GHXA 1BLHA 2GDNA 3ITBA 4DN0A 2WZZA 1O07A 4GZBA 4FUWA 5HD3A 3K3DA 5C5KA 5TBMB 1Z09A 4Q8IA 4LFUA 2EXBA 1CK3A 3JPUA 3VSLA 4MN6A 3LO7A 3MKFA 3R7WB 1YLTA 1UWNX 2UV0E 1FOFA 1ZHHB 2Y55A 3OPRA 3OLOA 1XJ3A 2B02A 1OTBA 4MCWA 2Y59A 4WZ4A 3ISGA 1NWZA 4GKUA 3K3CA 4OOYA 3DTIA 2V8CA 1LL9A 3SOIA 3WRZA 5AQAA 4IBRA 2ZM8A 2EFUA 3DBAA 3PBRA 2EX9A 3OCLA 3SS4A 1LL5A 1FSYA 4II7A 3IBJA 3VE4A 1L3LA
chains in the Genus database with same CATH topology
3FPVA 1V9ZA 4HJ3A 3E4QA 3MQ0A 3T4TA 5G4YA 3OBFA 1S66L 4KUOA 4OOMA 2M7UA 4IJGA 4NXFA 3E98A 4WELA 3EEAA 2O9BA 3CI6A 2FH5A 3KSHA 1MC0A 5K5BA 3RH8B 5LBRA 3TW8A 2VX8A 1YAXA 3LUQA 4IUKA 3LYXA 3S7PA 5J7EA 3BY8A 3CLOA 1T1BA 3PBTA 2Y8HA 3B33A 5J3WA 2OWJA 4EU0A 2PYPA 3T4OA 3NJAA 3EEHA 2JKRM 4O8GA 4WEJA 5HD5A 1VHMA 3T4KA 2V1AA 4YWZA 2O9CA 4F3LB 3MF0A 4YOFA 2PHYA 2O99A 1TS6A 4CLCD 3LIDA 4HOIA 2VKSA 2VGLS 4BBVA 2PR6A 3D72A 2ZBBA 2K2NA 1OPXA 4XT2B 5MC7A 3OOVA 4GHIB 4BWIA 1V9YA 1N9LA 2OAQ1 4EQ1A 2FZ0A 2I9VA 2W27A 2GNXA 3RFBA 2WKQA 5L8MA 2DMWA 5F69A 5EFWA 2XSSA 4I3AA 1STZA 2YKFA 3IS2B 3UE3A 2G7UA 2NUTC 4I5SA 4EXOA 2VA0A 4HHDA 3CUEC 5I5LA 2ZMFA 3KSGA 3EWKA 4HJ4A 1XJ6A 3ZYTA 3FC7A 4I39A 1LSWA 2KLIA 4JGPA 2CMNA 3NHQA 1S4SA 5DJUA 3IBRA 3LR5A 3S7NA 2J80A 2P04A 3ICYA 4H6JA 4EERA 2W0NA 3F1PB 2JKTM 4K08A 1DP8A 1Y28A 4L0LA 2VV6A 3F1OA 5J4EA 2Z6DA 3W2ZA 5DJTA 5DFYA 2QYBA 4WL9A 4CLCB 1GSWA 3GDIA 3R4KA 5DKLA 2W3HA 4FSFA 2ZOIA 3K2NA 4WF0A 3R7WA 3UB8A 3PBNA 3HJIA 4LLOB 3T4JA 1NLZA 4B9OA 2VZWA 3PBOA 4HI4A 2OOLA 3NOUC 4WEKA 4GLQA 1TD5A 4L9EA 4EESA 4BMWA 4Y3IA 3H7WB 1DRMA 2HF6A 2J3WA 3MXQA 4P6ZS 5A8BA 5HZHA 5CX7A 4WUJA 5TJJA 4HY8A 2P08A 5DF9A 2OWHA 2B18A 1W63M 1VB6A 1UWPX 1S1ZA 1G6OA 1YKDA 2L4RA 4G3VA 3KYQA 5IS1A 1LSVA 3KSIA 4O0PA 3V67A 1OTDA 2VGLM 1NLYA 5HWWA 3F1NB 1XJ4A 2PR5A 2V0WA 1XJ2A 3PR6A 4HQAA 5AJGA 4KUKA 5HDDA 3S7OA 3LFVA 2QHKA 4EEUA 2QJ5A 2O0YA 3C30A 1OTEA 4EUVA 1MKMA 3HJKA 4Y2FA 4YNRA 1MZUA 5DKKA 4EEPA 5KSHA 3OC2A 1P9RA 4LRZE 3CWFA 2VJWA 4LRXC 1P0ZA 4I38A 2EA9A 3LIBA 2JKRI 1JNUA 2WKPA 4IUHA 4M4XA 1DP9A 4HH2A 2GZAA 4Y5FA 2ZOHA 1F5MA 1XFQA 4Z1WA 1IFQA 2HJEA 4LRYC 4HP4A 2JHEA 3C38A 3EOIA 4F3LA 1D06A 2INWA 1LL8A 2W3FA 3MQOA 1N9OA 2A24B 1F9IA 3H82B 4L9GA 4R6LA 1KOUA 3LI9A 4DMZA 1G28A 2L0WA 2HV1A 1LSXA 2LB5A 2M1CA 4Q0JA 4XT2A 3LIFA 3LIEA 3U2AA 4ZRRA 1DP6A 1H3QA 3E4PA 4GHIA 4DJ3A 2W3EA 3ULFA 2R78A 2EWVA 4JGOA 2QWSA 2VLGA 3JVVA 2J3TC 3A0RA 3LICA 2W3GA 3PBQA 1S1YA 3T4SA 3IS2A 3UMEA 1P9WA 4R70A 3RTYA 4WLAA 5HDCA 2HJ9C 3TJZC 2D01A 4GCZA 5HL6A 2IA2A 3EQUA 2JKTI 1TS8A 1X0OA 3NOPC 3PBSA 3LIAA 5HSQA 2KOIA 3F1PA 5TBMA 3P7NA 1GSVA 3UE6A 4I3JA 2W1TA 3BQAA 4P6ZM 1T18A 3O5YA 1OJ5A 2HGVA 1BYWA 3BW6A 4Q0IA 4PHTA 4CLCA 1TS7A 5AVFA 3T50A 2L1MA 4PKYG 1N9NA 2QKPA 4ETXA 2D02A 4RQ9A 5FL3A 2Z6CA 2WKRA 3LR0A 2M7VA 3BY9A 2OAP1 4BBUA 4ETZA 2Y79A 4PKYA 1ZTUA 3BQ8A 5F68A 1T1AA 1XFNA 4HIAA 4LPZA 4KQDA 3H7WA 3CITA 4CQHA 4OOLA 2PD7A 3BJNA 4GJ4A 4ARZA 1NRJA 5HDSA 2V1BA 4UQIS 1P97A 4L9FA 1GSXA 4B93A 2PD8A 2PT7A 3MMHA 5AVEA 5HWVA 2GX5A 4NKPA 1OTAA 4GS9B 3F1NA 1YSPA 3KYZA 2VEAA 3BWLA 4DJ2A 3TRCA 3PYPA 3UB6A 2YKHA 4GW9A 1TS0A 3C2WA 2XA7S 3E0YA 1T1CA 4EETB 3H9WA 3UB7A 3FG8A 1OT9A 3OCNA 4BBTA 3G6OA 1OJGA 2K7SA 5HPIA 4R38A 4FOFA 1S4RA 4R3AA 3T4QA 3B47A 3S7QA 3MR0A 3B42A 2W3DA 2A24A 3D3OA 3H82A 4NXEA 4CLCC 5DFXA 2JN7A 2W1RA 1YSQA 3EGXC 1OT6A 5IT5A 5F6AA 3A0VA 3KSFA 4G3KA 2BASA 4HP9A 2ZMVA 4G3WA 3PHYA 2P7JA 3EQVA 3ZQ5A 2J3TD 4KQOA 3NOTC 3LI8A 3E4OA 2XROA 4IHQA 5F5YA 3PXPA 2VV8A 4ME4A 3GECA 1EW0A 2XRNA 3TE8A 5G4ZA 4UEYA 3FPWA 2QJ7A 2V9AA 2PDRA 1OTIA 4EW7A 2H28A 2A2LA 2EWWA 4WN5A 1H8MA 3JVUA 3VV4A 4JGQA 1S67L 3KX0X 3MQQA 1UGUA 4DN0A 3VOLA 2K31A 4H6JB 1F98A 5HD3A 3SW1A 3K3DA 3KO6A 5C5KA 5TBMB 4MN7A 1LT0A 3F1OB 4HJ6A 3MJQA 2W1TB 4UQIM 3EGDC 4BJPA 4AFIA 2LB9A 1W63Q 3CAXA 4MMNA 4QPRA 1WA9A 4MN6A 3LR3A 2NUPC 1ODVA 3R7WB 4NXBA 3UB9A 4Q0HA 3P01A 4O01A 1IOUA 3C8CA 1UWNX 2KDKA 4E04A 4HNBA 1ZHHB 2XA7M 2PYRA 3OLOA 1D7EA 1XJ3A 4MN5A 2VV7A 2B02A 1OTBA 4MCWA 4JGRA 2GJ3A 5HWTA 5KIZA 2MJ6A 3CUEA 3A0SA 5HPFA 1NWZA 3MFXA 1TF1A 3T4LA 3LR4A 4PAUA 2V0UA 3K3CA 4NXGA 4I3IA 4CLCE 2O9AA 3UMDA 4MDZA 3VE3A 1T19A 4HH3A 4ARZB 3DBAA 3PBRA 4NEED 3HCYA 3OCLA 4GS9A 2KX6A 4II7A 5IU1A 3IBJA 3VE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9Z A;  4HJ3 A;  3E4Q A;  5G4Y A;  1S66 L;  4KUO A;  4NXF A;  3RH8 B;  3LUQ A;  3LYX A;  5J7E A;  3BY8 A;  3CLO A;  1T1B A;  3B33 A;  5J3W A;  2OWJ A;  2PYP A;  3NJA A;  3EEH A;  5HD5 A;  2V1A A;  4YWZ A;  4F3L B;  2PHY A;  1TS6 A;  3LID A;  4HOI A;  4BBV A;  2PR6 A;  3D72 A;  2ZBB A;  4XT2 B;  4GHI B;  1V9Y A;  1N9L A;  4EQ1 A;  2I9V A;  2W27 A;  2WKQ A;  5F69 A;  5EFW A;  4I3A A;  2YKF A;  3IS2 B;  4I5S A;  4EXO A;  4HHD A;  5I5L A;  3EWK A;  4HJ4 A;  1XJ6 A;  3FC7 A;  4I39 A;  1LSW A;  4JGP A;  5DJU A;  2CMN A;  3NHQ A;  1S4S A;  3IBR A;  2J80 A;  3ICY A;  4H6J A;  4EER A;  2W0N A;  3F1P B;  4K08 A;  1DP8 A;  1Y28 A;  2VV6 A;  3F1O A;  5J4E A;  2Z6D A;  5DJT A;  4WL9 A;  1GSW A;  3GDI A;  5DKL A;  2ZOI A;  4WF0 A;  3UB8 A;  3HJI A;  4LLO B;  4B9O A;  4HI4 A;  2OOL A;  3NOU C;  4L9E A;  4EES A;  3H7W B;  1DRM A;  3MXQ A;  5A8B A;  5HZH A;  4WUJ A;  4HY8 A;  2OWH A;  1VB6 A;  1UWP X;  1S1Z A;  2L4R A;  5IS1 A;  1LSV A;  1OTD A;  5HWW A;  3F1N B;  1XJ4 A;  2PR5 A;  2V0W A;  1XJ2 A;  4HQA A;  4KUK A;  5HDD A;  2QHK A;  4EEU A;  2QJ5 A;  1OTE A;  3HJK A;  1MZU A;  5DKK A;  4EEP A;  4LRZ E;  3CWF A;  4LRX C;  1P0Z A;  4I38 A;  2EA9 A;  3LIB A;  1JNU A;  2WKP A;  4M4X A;  1DP9 A;  4HH2 A;  2ZOH A;  1XFQ A;  4LRY C;  4HP4 A;  2JHE A;  4F3L A;  1D06 A;  2INW A;  1LL8 A;  3MQO A;  1N9O A;  2A24 B;  1F9I A;  3H82 B;  4L9G A;  4R6L A;  1KOU A;  3LI9 A;  1G28 A;  2L0W A;  2HV1 A;  1LSX A;  4XT2 A;  2M1C A;  3LIF A;  3LIE A;  1DP6 A;  3E4P A;  4GHI A;  4DJ3 A;  3ULF A;  2R78 A;  4JGO A;  2QWS A;  2VLG A;  3A0R A;  3LIC A;  1S1Y A;  3IS2 A;  3UME A;  4R70 A;  3RTY A;  4WLA A;  5HDC A;  2D01 A;  4GCZ A;  1TS8 A;  1X0O A;  3NOP C;  3LIA A;  5HSQ A;  3F1P A;  5TBM A;  3P7N A;  1GSV A;  3UE6 A;  4I3J A;  1T18 A;  1OJ5 A;  1BYW A;  1TS7 A;  5AVF A;  3T50 A;  2L1M A;  4PKY G;  1N9N A;  2QKP A;  2D02 A;  4RQ9 A;  2Z6C A;  2WKR A;  3BY9 A;  4BBU A;  4PKY A;  5F68 A;  1T1A A;  1XFN A;  4HIA A;  4LPZ A;  4KQD A;  3H7W A;  2PD7 A;  5HDS A;  2V1B A;  1P97 A;  4L9F A;  1GSX A;  2PD8 A;  5AVE A;  5HWV A;  1OTA A;  4GS9 B;  3F1N A;  2VEA A;  3BWL A;  4DJ2 A;  3PYP A;  3UB6 A;  2YKH A;  4GW9 A;  1TS0 A;  3C2W A;  1T1C A;  4EET B;  3H9W A;  3UB7 A;  3FG8 A;  1OT9 A;  4BBT A;  3G6O A;  1OJG A;  2K7S A;  4R38 A;  1S4R A;  4R3A A;  3MR0 A;  2A24 A;  3H82 A;  4NXE A;  2JN7 A;  1OT6 A;  5F6A A;  3A0V A;  2BAS A;  4HP9 A;  3PHY A;  2P7J A;  3ZQ5 A;  3NOT C;  3LI8 A;  3E4O A;  5F5Y A;  2VV8 A;  3GEC A;  1EW0 A;  5G4Z A;  2QJ7 A;  2V9A A;  2PDR A;  1OTI A;  4EW7 A;  2H28 A;  4WN5 A;  4JGQ A;  1S67 L;  3KX0 X;  3MQQ A;  1UGU A;  3VOL A;  4H6J B;  1F98 A;  5HD3 A;  3SW1 A;  3K3D A;  5TBM B;  1LT0 A;  3F1O B;  4HJ6 A;  3MJQ A;  3CAX A;  1WA9 A;  4MN6 A;  1ODV A;  4NXB A;  3UB9 A;  3C8C A;  1UWN X;  2KDK A;  4E04 A;  4HNB A;  2PYR A;  3OLO A;  1D7E A;  4MN5 A;  1XJ3 A;  2VV7 A;  2B02 A;  1OTB A;  4JGR A;  2GJ3 A;  5HWT A;  5KIZ A;  3A0S A;  1NWZ A;  3MFX A;  2V0U A;  3K3C A;  4NXG A;  4I3I A;  3UMD A;  3VE3 A;  1T19 A;  4HH3 A;  4GS9 A;  2KX6 A;  5IU1 A;  3VE4 A; 
#chains in the Genus database with same CATH topology
 4HJ3 A;  3OBF A;  4KZ3 A;  4C3Q A;  1KDS A;  4KUO A;  3UB5 P;  5E2F A;  2M7U A;  2ZL1 A;  4IJG A;  4NXF A;  3CI6 A;  3N4I A;  1MC0 A;  5LBR A;  3TW8 A;  2XH9 A;  1YAX A;  4KZ6 A;  3Q82 A;  4B4X A;  5AQ7 A;  4S2L A;  3L9K A;  1XP4 A;  2Y2H A;  1T1B A;  2OWJ A;  2PYP A;  4HBT A;  4LCM A;  5FI6 A;  3UPP A;  3MF0 A;  4YOF A;  5CHJ A;  3UDX A;  3SS5 A;  1FR6 A;  2VGL S;  4BBV A;  2PR6 A;  3D72 A;  2ZBB A;  3QP1 A;  5MC7 A;  4BWI A;  4QY5 A;  2Q0O A;  3QP5 A;  3VOZ A;  5CEB A;  3IX3 A;  4N9L A;  2DMW A;  4LV1 A;  2XSS A;  4QD4 A;  2G7U A;  2ZLY A;  3G2Y A;  3WS5 A;  5IHV A;  4HHD A;  4X6T A;  4QJG A;  5A91 A;  3FC7 A;  4JLF A;  4JGP A;  3NHQ A;  3IBR A;  2J80 A;  3GR2 A;  2HPB A;  2ZQA A;  3MSH A;  5EVL A;  1H8Z A;  3NY4 A;  3F1O A;  2B95 A;  4YIN A;  5HW3 A;  4UAA A;  1GSW A;  3G4P A;  4JXS A;  1MWS A;  2ZOI A;  5HAQ A;  4JBF A;  4KZ4 A;  3UB8 A;  3NDE A;  2OV5 A;  4LLO B;  3VP4 A;  4GD8 A;  1IYQ A;  1NLZ A;  4B9O A;  3AGD A;  2OOL A;  3NOU C;  4WEK A;  4E3O A;  4KQR A;  5FDH A;  2QMI A;  1YMS A;  4GLQ A;  1TD5 A;  4JF5 A;  4P6Z S;  2PBY A;  5CX7 A;  1TDL A;  5TJJ A;  2OWH A;  3GVB A;  2IWB A;  1J9M A;  1UWP X;  4EV4 A;  3QP8 A;  4X69 A;  3BEC A;  2L4R A;  4G3V A;  3UY6 A;  3QP6 A;  2BG1 A;  1NLY A;  1XJ4 A;  1K6S A;  2V0W A;  1QME A;  3QP2 A;  4X25 A;  3GMW A;  4Y2F A;  1K4E A;  1L0E A;  4U0X A;  4EEP A;  1L2S A;  1P9R A;  1NYY A;  4I38 A;  2EFX A;  3LIB A;  2JKR I;  2ZC4 B;  4ZJ2 A;  1JNU A;  3ZCZ A;  4IUH A;  1DP9 A;  4Y5F A;  3VFH A;  4Z1W A;  2V1Z A;  3A3D A;  2G2U A;  1L0D A;  4F3L A;  2INW A;  5DTK A;  1IYO A;  1N9O A;  1CI8 A;  2A24 B;  5BOH A;  4L9G A;  4R6L A;  4DMZ A;  1G28 A;  2LB5 A;  1LSX A;  3Q07 A;  1FQG A;  4Q0J A;  3LIF A;  3LIE A;  5L2F A;  1H3Q A;  3MBZ A;  4GHI A;  4JGO A;  4P87 A;  2ZC7 A;  1I2S A;  4N9K A;  2EX6 A;  3PBQ A;  3T4S A;  4P85 A;  3UME A;  1I2W A;  4R70 A;  3W4P A;  2HJ9 C;  2D01 A;  2Q9M A;  4GCZ A;  3EQU A;  1W5D A;  2HDQ A;  3BRM A;  2JE5 A;  1GHI A;  2KOI A;  4I3J A;  2W1T A;  3NEC A;  3BQA A;  4OKP A;  1T18 A;  2HGV A;  4Q0I A;  4CLC A;  2L1M A;  3OPH A;  2B5R A;  2WUQ A;  4R23 A;  4E3L A;  4ETX A;  4RQ9 A;  2WKR A;  1OME A;  4X68 A;  5GLB A;  2M7V A;  5A93 A;  4OQI A;  1WYC A;  3G32 A;  2OAP 1;  2Y79 A;  1D1J A;  3IF6 C;  1MWU A;  4HIA A;  4OP5 A;  3UE1 A;  4RVA A;  1SKO B;  4CQH A;  1O7E A;  4KEN B;  3C4P A;  4GJ4 A;  3ZHH A;  1GHP A;  4S2N A;  1NRJ A;  1YLJ A;  3ZDJ A;  2WAF A;  2PT7 A;  2R9X A;  2Y2O A;  4E6W A;  1OTA A;  3NI9 A;  3MXR A;  2VEA A;  3M2K A;  2HP6 A;  5CED A;  3FWL A;  4GW9 A;  2WKE A;  1K38 A;  1L0G A;  3GV9 A;  3IXD A;  4EWF A;  1YMX A;  3IF6 A;  5HPI A;  4R38 A;  1DY6 A;  4R3A A;  1KVL A;  3M6B A;  2HZ5 A;  3S7Q A;  3MR0 A;  3TSG A;  2HDU A;  4MLL A;  5DFX A;  1YSQ A;  1FIL A;  1MWT A;  4BEN A;  3G2Z A;  1H0M A;  4G3W A;  2P7J A;  4WMC D;  3EQV A;  5FI2 A;  5GLD A;  3ZQ5 A;  2J3T D;  5CER A;  2JKF A;  3PXP A;  4A5R A;  1ESI A;  3JYI A;  1EW0 A;  2XRN A;  2OLV A;  5G4Z A;  3TE8 A;  1BLS A;  3FPW A;  2QJ7 A;  2PAV P;  3HUN A;  3G31 A;  3ITA A;  4S2O A;  3KX0 X;  3MQQ A;  1UGU A;  3T12 B;  5F1F A;  1F98 A;  3VP1 A;  3N8R A;  4NG2 A;  3QP4 A;  3PAE A;  3V39 A;  5EM0 A;  2V2F F;  4WYY A;  1LT0 A;  3MJQ A;  2W1T B;  3UPN A;  2LB9 A;  3IX8 A;  3VOY A;  1WA9 A;  1NJ4 A;  1ERO A;  3LR3 A;  2NUP C;  1ODV A;  2J7V A;  3GQZ A;  2ZMA A;  3E2L A;  4Q0H A;  1EWZ A;  1IKG A;  4PMA A;  4BL3 A;  5HAI A;  4E04 A;  3WS0 A;  4HNB A;  3S4X A;  3V50 A;  5FEG A;  2PYR A;  3C5A A;  4XXR A;  3W4Q A;  4MN5 A;  1XA7 A;  5KIZ A;  3A0S A;  4RX3 A;  4S2M A;  3MFX A;  1DJB A;  3V3S A;  2DNS A;  4PAU A;  1PW1 A;  2PU4 A;  2V8F A;  3E2K A;  4NXG A;  4CLC E;  2O9A A;  4MDZ A;  5FDS A;  3HL9 A;  4HH3 A;  5CTM A;  3HLE A;  4NEE D;  2BLS A;  2VGJ A;  3RXW A;  2KX6 A;  5IU1 A;  3FPV A;  2PRF A;  4FD8 A;  3E4Q A;  3G30 A;  3MQ0 A;  4N1H A;  4QHC A;  4LV0 A;  5FQK A;  1S66 L;  4S2P A;  4OOM A;  5U47 A;  3E98 A;  4X1L A;  1RGY A;  3EEA A;  3SH8 A;  3KSH A;  1FCO A;  3RH8 B;  3BM6 A;  3LUQ A;  2Y2M A;  1ALQ A;  5CRF A;  3CLO A;  4OLG A;  3B33 A;  1BT5 A;  4D60 A;  2Y4A A;  2V1A A;  2O9C A;  5EVI A;  4CLC D;  3N8L A;  4OPR A;  1TVF A;  4RX2 A;  1PYY A;  2Z2M B;  3OOV A;  3IX4 A;  4QU3 A;  4EQ1 A;  2FZ0 A;  2W27 A;  5CGX A;  3UE0 A;  1WYB A;  5F69 A;  4GDN A;  3IS2 B;  4OP8 A;  3UE3 A;  2VA0 A;  5I5L A;  3VFF A;  3KSG A;  4HJ4 A;  4B4Z A;  1GA0 A;  1LSW A;  4NK3 A;  2CMN A;  2UWX A;  1N4O A;  2A3U A;  4H6J A;  4EER A;  3F1P B;  2JKT M;  3ZG0 A;  1ES5 A;  2XD5 A;  1IYP A;  4U0T A;  5J4E A;  1Z6F A;  3W2Z A;  4DXC A;  1ES4 A;  5DFY A;  1NZO A;  4D2O A;  3T1R A;  4OQG A;  5DKL A;  2DRW A;  1S0W A;  5CGS A;  3PBN A;  1ONH A;  1E4D A;  4MBF A;  3HJI A;  3T4J A;  5TGF A;  4E3K A;  2FFF B;  2VZW A;  5J8X A;  4HI4 A;  4R0Q A;  4L9E A;  2ZC3 B;  1DRM A;  2HF6 A;  2J3W A;  3MXQ A;  5GL9 A;  3HVF A;  2P08 A;  1VB6 A;  4PM5 A;  3BLS A;  2H5S A;  5DTS A;  3CPT A;  4P0M A;  3KYQ A;  3LY3 A;  2ZQ8 A;  1L0F A;  4O0P A;  3V67 A;  2WYX A;  3HLD A;  2ZQ9 A;  3DTE A;  4CJN A;  4JXG A;  4HQA A;  1ES2 A;  2QHK A;  5HAR A;  3WS4 A;  1OTE A;  1MKM A;  1MZU A;  5DKK A;  4LRZ E;  4BL2 A;  2ACG A;  4R4S A;  5EUA A;  1P0Z A;  4JXV A;  3MFD A;  2ZQD A;  4HH2 A;  5F1G A;  2HP9 A;  1XFQ A;  4BLM A;  2JHE A;  3C38 A;  3EOI A;  4K91 A;  4RYE A;  2P9V A;  4E3N A;  2W3F A;  3MQO A;  5FAP A;  1F9I A;  2CC1 A;  3H82 B;  1KOU A;  2XD1 A;  2IWC A;  4XT2 A;  3U2A A;  4ZRR A;  2VK3 A;  1DP6 A;  2P74 A;  5EOE A;  3E4P A;  3MS6 A;  3Q7V B;  2R78 A;  2EWV A;  3AGF A;  3HLW A;  2VLG A;  3JVV A;  2J3T C;  3LIC A;  1S1Y A;  1P9W A;  1TEM A;  3DTK A;  1TDG A;  2ZM2 A;  1BZA A;  1VET A;  5TR7 A;  2XFS A;  3HLF A;  2FFY A;  4PM8 A;  1E25 A;  1X0O A;  3LIA A;  3P7N A;  1GSV A;  1SDN A;  3UE6 A;  4X1M A;  4UA7 A;  3N8S A;  1BYW A;  3BW6 A;  3W8K A;  1TS7 A;  5GHZ A;  3SZT A;  1QMF A;  3GTC A;  4PKY G;  3IHB A;  4WMC A;  4KZ5 A;  2D02 A;  2WGV A;  5FL3 A;  5JYP A;  1CEF A;  5FSR A;  2XDM A;  4GNU A;  3O87 A;  4OQH A;  3P09 A;  1PNE A;  2XLN A;  4QY6 A;  3BQ8 A;  2WZX A;  4GOG A;  4KQD A;  3H7W A;  2H10 A;  4DKI A;  4OOL A;  3T1S A;  3ZNY A;  5EVI D;  1EI5 A;  5HDS A;  1IEL A;  2Y2Q A;  4IVI A;  4MEZ A;  2PD8 A;  5AVE A;  1M6K A;  2WGW A;  5HFO A;  1PRQ A;  1YSP A;  3F1N A;  3KYZ A;  4P6B A;  3PAG A;  5D3O A;  3VMA A;  4DJ2 A;  1PI5 A;  3WS2 A;  3C2W A;  3SH9 A;  4EET B;  2ZL1 B;  4OVD A;  3FG8 A;  1YPR A;  1MY8 A;  4Z9Q A;  3IHA A;  3LY4 A;  5I94 A;  1PWD A;  1XA1 A;  3D9Y A;  3T4Q A;  3B47 A;  2Y2G A;  2G2W A;  4WM9 A;  4EBP A;  2JCH A;  3D3O A;  3D4F A;  4CLC C;  1K57 C;  4DE3 A;  1K25 A;  3EGX C;  3NIA A;  4OLD A;  2BAS A;  4HP9 A;  4GD6 A;  3PHY A;  2X01 A;  3A3F A;  3IXB A;  3DWZ A;  1NY0 A;  4XUX A;  3NOT C;  3E4O A;  5F5Y A;  5AQB A;  3GEC A;  2XQZ A;  4FCF A;  1NZU A;  1OTI A;  4EW7 A;  1CF0 A;  2EWW A;  4WN5 A;  1H8M A;  3JVU A;  4S2N C;  1S67 L;  3VOL A;  1HVB A;  1JVJ A;  1VET B;  4EBL A;  4B88 A;  5CGW A;  1LHY A;  2J8Y A;  5DTT A;  1K57 A;  1PZO A;  1JTD A;  3UNW A;  4MN7 A;  3F1O B;  4BJP A;  1H5X A;  4UQI M;  3EGD C;  1I5Q A;  4HES A;  4QPR A;  1XPB A;  5EPH A;  1XXM A;  2ZC5 B;  4C6Y A;  1PI4 A;  1H8Y A;  3UB9 A;  4K0W A;  4O01 A;  1IOU A;  2KDK A;  4XUZ A;  3DAV A;  3N7W A;  1D7E A;  4BQM A;  4JGR A;  5HWT A;  1ACF A;  1FR1 A;  3CUE A;  5HPF A;  1XKZ A;  2XFT A;  3T4L A;  3CHW P;  3CJM A;  3LR4 A;  2V0U A;  5E43 A;  4I3I A;  3WRT A;  3UMD A;  3VE3 A;  4ID4 A;  2E8J A;  4UA9 A;  1K0K A;  4GS9 A;  3IWQ A;  5FQM A;  1V9Z A;  5G4Y A;  4KZ8 A;  1RGZ A;  5FAS A;  2FH5 A;  5F83 A;  1N9B A;  1BLC A;  2ZM0 A;  4S2K A;  5HX9 A;  3S1Y A;  4PM7 A;  3S7P A;  5J7E A;  3SH7 A;  3Q7Z A;  2Y8H A;  3T4O A;  1DJA A;  2JKR M;  4O8G A;  4KZA A;  4WEJ A;  3T4K A;  4F3L B;  2O99 A;  2Y2N A;  3IXH A;  1LLB A;  4X55 A;  5F82 A;  1KE4 A;  4LV2 A;  1IKI A;  2Y2L A;  1J3W A;  4GHI B;  1V9Y A;  1N9L A;  2OAQ 1;  3LEZ A;  5EE8 A;  3AGE A;  2GNX A;  4CPK A;  5L8M A;  1STZ A;  2I72 A;  2YKF A;  1ONG A;  2NUT C;  2AVX A;  3ZVT A;  1XJ6 A;  3ZYT A;  1PWC A;  2KLI A;  5DJU A;  5DF8 A;  5E2E A;  4LCL A;  2H0T A;  2WKH A;  3BYD A;  4S2I A;  3WS1 A;  3FKV A;  1AWI A;  4E3M A;  4L0L A;  2WGI A;  4UA6 A;  1MWR A;  5DJT A;  1G68 A;  3CZD A;  4WL9 A;  4CLC B;  3GDI A;  2W3H A;  4PM9 A;  3K2N A;  3IWI A;  3UDI A;  3R7W A;  4ZDX A;  1M40 A;  1ZG4 A;  4EUZ A;  3HUO A;  3CG5 A;  1KGF A;  4EES A;  4Y3I A;  4IVK A;  1LI0 A;  4KG5 A;  5A8B A;  5CXW A;  4WUJ A;  5EVI C;  2B18 A;  1W63 M;  1HD8 A;  3MXS A;  2DCF A;  1G6O A;  1YKD A;  2WKI A;  2XR0 A;  4DE2 A;  3KSI A;  2PU2 A;  4E3I A;  1OTD A;  3MZD A;  5HWW A;  5A90 A;  2PR5 A;  4KUK A;  2QJ5 A;  2O0Y A;  3OZH A;  3M6H A;  3ZNT A;  4X53 A;  2XF3 A;  4R3B A;  5EVE A;  1K4F A;  3IH8 A;  3DW0 A;  4LRX C;  3IF6 B;  2WKP A;  3P98 A;  2GZA A;  4R4R A;  5CTN A;  4WBG A;  1F5M A;  3TG9 A;  3G34 A;  5FEF A;  2HJE A;  4HP4 A;  3LCE A;  4QB8 A;  1LL8 A;  1JWZ A;  3BFC A;  1LI9 A;  3LI9 A;  3V3R A;  3ZFZ A;  2L0W A;  2HV1 A;  5FQJ A;  5CEC A;  3WWX A;  2OLU A;  3BFG A;  3IXG A;  1K55 C;  2ZC6 B;  4ZTK A;  2W3G A;  4Y0T A;  1K6R A;  1ES3 A;  3BFF A;  4MNR A;  3RTY A;  4WLA A;  5HDC A;  1RP5 A;  5HL6 A;  1Y54 A;  4KQQ A;  3ZGA B;  3C7V A;  1YLY A;  1TS8 A;  3FYZ A;  1FIK A;  5HSQ A;  4LGW A;  4HEF A;  2C6W B;  2OSU A;  4KZ9 A;  3O5Y A;  3IT9 A;  4PHT A;  1MPL A;  3T50 A;  3LEQ A;  2Y2I A;  1K54 C;  1K55 A;  2QKP A;  2Z6C A;  2QZ6 A;  2IWD A;  3BY9 A;  5CHU A;  3MKE A;  4BBU A;  4JXW A;  4PKY A;  2RCX A;  5F68 A;  4OPY A;  4LPZ A;  5TFQ A;  3A3E A;  1W8Y A;  1E3U A;  3BJN A;  4ARZ A;  1BUL A;  3ZG8 B;  4X56 A;  2X02 A;  4UQI S;  4BD0 A;  1P97 A;  4B93 A;  5DF7 A;  1YQS A;  5HWV A;  2HP5 A;  4F94 A;  4DE1 A;  1K54 A;  1GHM A;  3PYP A;  1W79 A;  3UB6 A;  4OPZ A;  1TS0 A;  2RL3 A;  3E0Y A;  4UHU A;  1T1C A;  3BLM A;  3H9W A;  1PIO A;  3UB7 A;  2ZD8 A;  4KZ7 A;  3OCN A;  2JKG A;  3HRE A;  3G6O A;  4BD1 A;  2K7S A;  1ERQ A;  2XGN A;  4JF4 A;  4ESP A;  2J9O A;  1ERM A;  2A24 A;  2W3D A;  3M2J A;  4M3K A;  3UDF A;  5EVI B;  3A0V A;  3GRJ A;  2WAD A;  4G3K A;  2ZMV A;  1YLP A;  3FZC A;  5AQ9 A;  2Y2P A;  5FAT A;  3LI8 A;  2XRO A;  4IHQ A;  2R9W A;  3UPO A;  5FQQ A;  2EXA A;  1ESU A;  4UEY A;  2A49 A;  4ZJ1 A;  2V9A A;  2Z2L B;  2PDR A;  2H28 A;  3VV4 A;  2ZQC A;  1Q2P A;  4MBH A;  1K56 A;  1RCJ A;  1Y4O A;  2K31 A;  3O88 A;  4H6J B;  1GA9 A;  1CI9 A;  1AXB A;  3SW1 A;  1VEU A;  3KO6 A;  3Q1F A;  4HJ6 A;  4AFI A;  1W63 Q;  1MXO A;  3CAX A;  4MMN A;  5GLA A;  5HAP A;  1YLW A;  4NXB A;  3P01 A;  3PTE A;  4Y15 A;  3C8C A;  4DXB A;  4OQ0 A;  1YT4 A;  2XA7 M;  5EEC A;  1IEM A;  2VV7 A;  3ZVW A;  2GJ3 A;  3T1Q B;  1SKO A;  2XK1 A;  2MJ6 A;  5M18 A;  3QNC A;  1TF1 A;  4DE0 A;  3LGO A;  1T19 A;  4ARZ B;  4FTX A;  3ZG7 B;  3FV7 A;  3HCY A;  3N6I A;  1JTG A;  3CMZ A;  3CPT B;  3HLB A;  3NUL A;  3SS3 A;  2VGK A;  1CEG A;  1PFL A;  3OPL A;  3T4T A;  3QNB A;  4IBX A;  5FI7 A;  4WEL A;  3NBL A;  1KE3 A;  2O9B A;  4ZBE A;  5L07 A;  1A0K A;  5K5B A;  1W7F A;  2VX8 A;  4IUK A;  1FSW A;  3LYX A;  1KGE A;  3BY8 A;  4FH2 A;  4Y0U A;  3PBT A;  1WE4 A;  5J3W A;  4EU0 A;  3NJA A;  4GN2 A;  1U60 A;  3EEH A;  4DRT A;  4N92 A;  1PWG A;  5HD5 A;  4OON A;  1VHM A;  1YLZ A;  4YWZ A;  2HDR A;  2P9V B;  2PHY A;  1TS6 A;  3LID A;  4HOI A;  2VKS A;  4ZAM A;  4DDS A;  3U4L P;  4Y0O A;  2K2N A;  1OPX A;  5KSC A;  3RJU A;  2WK0 A;  4XT2 B;  3GSG A;  4NET A;  4H8R A;  2Y91 A;  2I9V A;  1FCN A;  3A3I A;  3RFB A;  2WKQ A;  4Y13 A;  5EFW A;  4I3A A;  3NC8 A;  4I5S A;  4EXO A;  3DWK A;  3CUE C;  2ZMF A;  3MZE A;  3EWK A;  5GHY A;  4FH4 A;  1E3U D;  4KG2 A;  4WZ5 C;  2EX2 A;  4I39 A;  3V5M A;  1S4S A;  3LR5 A;  3S7N A;  4JPM A;  2P04 A;  3ICY A;  3ZG5 A;  2W0N A;  5FA7 A;  1PZP A;  5GLC A;  3O86 A;  4K08 A;  1DP8 A;  1Y28 A;  3FKW A;  1KVM A;  2VV6 A;  1KDW A;  2Z6D A;  2QYB A;  5FQ9 A;  1VEU B;  1SZV A;  3R4K A;  1XGI A;  3VP2 A;  1ZC2 A;  4FSF A;  4LV3 A;  4WF0 A;  5EOO A;  5G18 A;  2WAE A;  3IWO A;  5EV0 A;  4R1G A;  2H0Y A;  4EQI A;  3PBO A;  5KMW A;  1JWV A;  3HBR A;  4WZ5 A;  4EBN A;  4BMW A;  3H7W B;  4S2J A;  5HZH A;  4HY8 A;  3NCK A;  4Y17 A;  5DF9 A;  5FQI A;  3HUM A;  3QHY A;  2X71 A;  4O7D A;  1S1Z A;  3G35 A;  1NXY A;  5IS1 A;  1LSV A;  2WGW B;  5FAQ A;  2VGL M;  3IF5 A;  3F1N B;  1XJ2 A;  3L7H A;  3PR6 A;  5AJG A;  5HDD A;  3S7O A;  1SHV A;  3LFV A;  1W8Q A;  3MZF A;  4EEU A;  3C30 A;  4EUV A;  3HJK A;  4JKT A;  4YNR A;  5KSH A;  3OC2 A;  2ZQ7 A;  3CWF A;  2VJW A;  1BSG A;  3HLC A;  5E2H A;  2EA9 A;  3VP0 A;  1XX2 A;  3I7J A;  1ZKJ A;  4MBK A;  4M4X A;  3VP3 A;  2ZOH A;  1K56 D;  1IFQ A;  3C7U A;  5HL1 A;  3KYE A;  4LRY C;  4E6X A;  1D06 A;  3OPP A;  1SKF A;  4DF6 A;  1PW8 A;  2XEP A;  2M1C A;  2BTF P;  4U3T A;  3HLG A;  1MKI A;  5L09 A;  4DJ3 A;  2W3E A;  3UN7 A;  3ULF A;  1JWP A;  2PBD P;  1BLP A;  2QPN A;  2QWS A;  2JC7 A;  3A0R A;  3IS2 A;  1VQQ A;  5KZH A;  4ZJ3 A;  2EX8 A;  1C3B A;  1MBL A;  1BUE A;  2Y2K A;  3TJZ C;  1F2K A;  4R3J A;  2IA2 A;  1VM1 A;  4E3J A;  3IQA A;  2JKT I;  3NOP C;  3PBS A;  5EM1 A;  3BEB A;  3F1P A;  5TBM A;  3DTM A;  5A92 A;  4P6Z M;  1OJ5 A;  4YFM A;  3IH9 A;  5AVF A;  4QWO A;  4GDB A;  4LEN A;  3B3X A;  2J9P A;  5FAO A;  1N9N A;  3RXX A;  4RA7 A;  4GB7 A;  5CHM A;  4OPQ A;  3LR0 A;  4IED A;  4N1X A;  4ETZ A;  1ZTU A;  3O3V A;  4Y7P A;  1T1A A;  2ZJ9 A;  3T1X A;  3UO9 A;  4C75 A;  1DJC A;  1XFN A;  1HZO A;  4KG6 A;  3TOI A;  1CJF A;  3CIT A;  4OH0 A;  2PD7 A;  4KZB A;  3ZG9 B;  2JBF A;  1Q2Q A;  4JF6 A;  5E2G A;  1SCW A;  1XGJ A;  2V1B A;  1SDE A;  1GCE A;  1NRF A;  3NDG A;  3VSK A;  4L9F A;  1NYM A;  1GSX A;  3MMH A;  1IYS A;  3BFD A;  2GX5 A;  4NKP A;  4GS9 B;  3W4O A;  1ZG6 A;  4K0X A;  1G6A A;  3A3J A;  3BWL A;  2Q9N A;  5JYO A;  2C5W B;  3TRC A;  2YKH A;  1G5U A;  2XA7 S;  5L10 A;  1HTZ A;  1OT9 A;  4BBT A;  3S22 A;  1KGG A;  1OJG A;  1S6R A;  5M1A A;  4FOF A;  5DVA A;  3BFE A;  1S4R A;  2V20 A;  3B42 A;  3H82 A;  4NXE A;  5M19 A;  2JN7 A;  2W1R A;  5IT5 A;  1OT6 A;  5F6A A;  3KSF A;  1HLU P;  1CQA A;  1YM1 A;  3Q7V A;  3Q81 A;  4HBU A;  3C4O A;  2Y2J A;  4DDY A;  2E8I A;  4KQO A;  2VV8 A;  4ME4 A;  4PPR A;  1BTL A;  2A2L A;  1FCM A;  2HDS A;  4PM6 A;  4JGQ A;  1KE0 A;  5GHX A;  1BLH A;  2GDN A;  3ITB A;  4DN0 A;  2WZZ A;  1O07 A;  4GZB A;  4FUW A;  5HD3 A;  3K3D A;  5C5K A;  5TBM B;  1Z09 A;  4Q8I A;  4LFU A;  2EXB A;  1CK3 A;  3JPU A;  3VSL A;  4MN6 A;  3LO7 A;  3MKF A;  3R7W B;  1YLT A;  1UWN X;  2UV0 E;  1FOF A;  1ZHH B;  2Y55 A;  3OPR A;  3OLO A;  1XJ3 A;  2B02 A;  1OTB A;  4MCW A;  2Y59 A;  4WZ4 A;  3ISG A;  1NWZ A;  4GKU A;  3K3C A;  4OOY A;  3DTI A;  2V8C A;  1LL9 A;  3SOI A;  3WRZ A;  5AQA A;  4IBR A;  2ZM8 A;  2EFU A;  3DBA A;  3PBR A;  2EX9 A;  3OCL A;  3SS4 A;  1LL5 A;  1FSY A;  4II7 A;  3IBJ A;  3VE4 A;  1L3L A; 
#chains in the Genus database with same CATH homology
 3FPV A;  1V9Z A;  4HJ3 A;  3E4Q A;  3MQ0 A;  3T4T A;  5G4Y A;  3OBF A;  1S66 L;  4KUO A;  4OOM A;  2M7U A;  4IJG A;  4NXF A;  3E98 A;  4WEL A;  3EEA A;  2O9B A;  3CI6 A;  2FH5 A;  3KSH A;  1MC0 A;  5K5B A;  3RH8 B;  5LBR A;  3TW8 A;  2VX8 A;  1YAX A;  3LUQ A;  4IUK A;  3LYX A;  3S7P A;  5J7E A;  3BY8 A;  3CLO A;  1T1B A;  3PBT A;  2Y8H A;  3B33 A;  5J3W A;  2OWJ A;  4EU0 A;  2PYP A;  3T4O A;  3NJA A;  3EEH A;  2JKR M;  4O8G A;  4WEJ A;  5HD5 A;  1VHM A;  3T4K A;  2V1A A;  4YWZ A;  2O9C A;  4F3L B;  3MF0 A;  4YOF A;  2PHY A;  2O99 A;  1TS6 A;  4CLC D;  3LID A;  4HOI A;  2VKS A;  2VGL S;  4BBV A;  2PR6 A;  3D72 A;  2ZBB A;  2K2N A;  1OPX A;  4XT2 B;  5MC7 A;  3OOV A;  4GHI B;  4BWI A;  1V9Y A;  1N9L A;  2OAQ 1;  4EQ1 A;  2FZ0 A;  2I9V A;  2W27 A;  2GNX A;  3RFB A;  2WKQ A;  5L8M A;  2DMW A;  5F69 A;  5EFW A;  2XSS A;  4I3A A;  1STZ A;  2YKF A;  3IS2 B;  3UE3 A;  2G7U A;  2NUT C;  4I5S A;  4EXO A;  2VA0 A;  4HHD A;  3CUE C;  5I5L A;  2ZMF A;  3KSG A;  3EWK A;  4HJ4 A;  1XJ6 A;  3ZYT A;  3FC7 A;  4I39 A;  1LSW A;  2KLI A;  4JGP A;  2CMN A;  3NHQ A;  1S4S A;  5DJU A;  3IBR A;  3LR5 A;  3S7N A;  2J80 A;  2P04 A;  3ICY A;  4H6J A;  4EER A;  2W0N A;  3F1P B;  2JKT M;  4K08 A;  1DP8 A;  1Y28 A;  4L0L A;  2VV6 A;  3F1O A;  5J4E A;  2Z6D A;  3W2Z A;  5DJT A;  5DFY A;  2QYB A;  4WL9 A;  4CLC B;  1GSW A;  3GDI A;  3R4K A;  5DKL A;  2W3H A;  4FSF A;  2ZOI A;  3K2N A;  4WF0 A;  3R7W A;  3UB8 A;  3PBN A;  3HJI A;  4LLO B;  3T4J A;  1NLZ A;  4B9O A;  2VZW A;  3PBO A;  4HI4 A;  2OOL A;  3NOU C;  4WEK A;  4GLQ A;  1TD5 A;  4L9E A;  4EES A;  4BMW A;  4Y3I A;  3H7W B;  1DRM A;  2HF6 A;  2J3W A;  3MXQ A;  4P6Z S;  5A8B A;  5HZH A;  5CX7 A;  4WUJ A;  5TJJ A;  4HY8 A;  2P08 A;  5DF9 A;  2OWH A;  2B18 A;  1W63 M;  1VB6 A;  1UWP X;  1S1Z A;  1G6O A;  1YKD A;  2L4R A;  4G3V A;  3KYQ A;  5IS1 A;  1LSV A;  3KSI A;  4O0P A;  3V67 A;  1OTD A;  2VGL M;  1NLY A;  5HWW A;  3F1N B;  1XJ4 A;  2PR5 A;  2V0W A;  1XJ2 A;  3PR6 A;  4HQA A;  5AJG A;  4KUK A;  5HDD A;  3S7O A;  3LFV A;  2QHK A;  4EEU A;  2QJ5 A;  2O0Y A;  3C30 A;  1OTE A;  4EUV A;  1MKM A;  3HJK A;  4Y2F A;  4YNR A;  1MZU A;  5DKK A;  4EEP A;  5KSH A;  3OC2 A;  1P9R A;  4LRZ E;  3CWF A;  2VJW A;  4LRX C;  1P0Z A;  4I38 A;  2EA9 A;  3LIB A;  2JKR I;  1JNU A;  2WKP A;  4IUH A;  4M4X A;  1DP9 A;  4HH2 A;  2GZA A;  4Y5F A;  2ZOH A;  1F5M A;  1XFQ A;  4Z1W A;  1IFQ A;  2HJE A;  4LRY C;  4HP4 A;  2JHE A;  3C38 A;  3EOI A;  4F3L A;  1D06 A;  2INW A;  1LL8 A;  2W3F A;  3MQO A;  1N9O A;  2A24 B;  1F9I A;  3H82 B;  4L9G A;  4R6L A;  1KOU A;  3LI9 A;  4DMZ A;  1G28 A;  2L0W A;  2HV1 A;  1LSX A;  2LB5 A;  2M1C A;  4Q0J A;  4XT2 A;  3LIF A;  3LIE A;  3U2A A;  4ZRR A;  1DP6 A;  1H3Q A;  3E4P A;  4GHI A;  4DJ3 A;  2W3E A;  3ULF A;  2R78 A;  2EWV A;  4JGO A;  2QWS A;  2VLG A;  3JVV A;  2J3T C;  3A0R A;  3LIC A;  2W3G A;  3PBQ A;  1S1Y A;  3T4S A;  3IS2 A;  3UME A;  1P9W A;  4R70 A;  3RTY A;  4WLA A;  5HDC A;  2HJ9 C;  3TJZ C;  2D01 A;  4GCZ A;  5HL6 A;  2IA2 A;  3EQU A;  2JKT I;  1TS8 A;  1X0O A;  3NOP C;  3PBS A;  3LIA A;  5HSQ A;  2KOI A;  3F1P A;  5TBM A;  3P7N A;  1GSV A;  3UE6 A;  4I3J A;  2W1T A;  3BQA A;  4P6Z M;  1T18 A;  3O5Y A;  1OJ5 A;  2HGV A;  1BYW A;  3BW6 A;  4Q0I A;  4PHT A;  4CLC A;  1TS7 A;  5AVF A;  3T50 A;  2L1M A;  4PKY G;  1N9N A;  2QKP A;  4ETX A;  2D02 A;  4RQ9 A;  5FL3 A;  2Z6C A;  2WKR A;  3LR0 A;  2M7V A;  3BY9 A;  2OAP 1;  4BBU A;  4ETZ A;  2Y79 A;  4PKY A;  1ZTU A;  3BQ8 A;  5F68 A;  1T1A A;  1XFN A;  4HIA A;  4LPZ A;  4KQD A;  3H7W A;  3CIT A;  4CQH A;  4OOL A;  2PD7 A;  3BJN A;  4GJ4 A;  4ARZ A;  1NRJ A;  5HDS A;  2V1B A;  4UQI S;  1P97 A;  4L9F A;  1GSX A;  4B93 A;  2PD8 A;  2PT7 A;  3MMH A;  5AVE A;  5HWV A;  2GX5 A;  4NKP A;  1OTA A;  4GS9 B;  3F1N A;  1YSP A;  3KYZ A;  2VEA A;  3BWL A;  4DJ2 A;  3TRC A;  3PYP A;  3UB6 A;  2YKH A;  4GW9 A;  1TS0 A;  3C2W A;  2XA7 S;  3E0Y A;  1T1C A;  4EET B;  3H9W A;  3UB7 A;  3FG8 A;  1OT9 A;  3OCN A;  4BBT A;  3G6O A;  1OJG A;  2K7S A;  5HPI A;  4R38 A;  4FOF A;  1S4R A;  4R3A A;  3T4Q A;  3B47 A;  3S7Q A;  3MR0 A;  3B42 A;  2W3D A;  2A24 A;  3D3O A;  3H82 A;  4NXE A;  4CLC C;  5DFX A;  2JN7 A;  2W1R A;  1YSQ A;  3EGX C;  1OT6 A;  5IT5 A;  5F6A A;  3A0V A;  3KSF A;  4G3K A;  2BAS A;  4HP9 A;  2ZMV A;  4G3W A;  3PHY A;  2P7J A;  3EQV A;  3ZQ5 A;  2J3T D;  4KQO A;  3NOT C;  3LI8 A;  3E4O A;  2XRO A;  4IHQ A;  5F5Y A;  3PXP A;  2VV8 A;  4ME4 A;  3GEC A;  1EW0 A;  2XRN A;  3TE8 A;  5G4Z A;  4UEY A;  3FPW A;  2QJ7 A;  2V9A A;  2PDR A;  1OTI A;  4EW7 A;  2H28 A;  2A2L A;  2EWW A;  4WN5 A;  1H8M A;  3JVU A;  3VV4 A;  4JGQ A;  1S67 L;  3KX0 X;  3MQQ A;  1UGU A;  4DN0 A;  3VOL A;  2K31 A;  4H6J B;  1F98 A;  5HD3 A;  3SW1 A;  3K3D A;  3KO6 A;  5C5K A;  5TBM B;  4MN7 A;  1LT0 A;  3F1O B;  4HJ6 A;  3MJQ A;  2W1T B;  4UQI M;  3EGD C;  4BJP A;  4AFI A;  2LB9 A;  1W63 Q;  3CAX A;  4MMN A;  4QPR A;  1WA9 A;  4MN6 A;  3LR3 A;  2NUP C;  1ODV A;  3R7W B;  4NXB A;  3UB9 A;  4Q0H A;  3P01 A;  4O01 A;  1IOU A;  3C8C A;  1UWN X;  2KDK A;  4E04 A;  4HNB A;  1ZHH B;  2XA7 M;  2PYR A;  3OLO A;  1D7E A;  1XJ3 A;  4MN5 A;  2VV7 A;  2B02 A;  1OTB A;  4MCW A;  4JGR A;  2GJ3 A;  5HWT A;  5KIZ A;  2MJ6 A;  3CUE A;  3A0S A;  5HPF A;  1NWZ A;  3MFX A;  1TF1 A;  3T4L A;  3LR4 A;  4PAU A;  2V0U A;  3K3C A;  4NXG A;  4I3I A;  4CLC E;  2O9A A;  3UMD A;  4MDZ A;  3VE3 A;  1T19 A;  4HH3 A;  4ARZ B;  3DBA A;  3PBR A;  4NEE D;  3HCY A;  3OCL A;  4GS9 A;  2KX6 A;  4II7 A;  5IU1 A;  3IBJ A;  3VE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...