2W0NA

Plasticity of pas domain and potential role for signal transduction in the histidine-kinase dcus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GHMGLEPYEISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRLLLINTVPVRSNGVIIGAISTFRDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR PROTEIN DCUS
publication title Plasticity of the Pas Domain and a Potential Role for Signal Transduction in the Histidine Kinase Dcus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 12
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w0nA00
1MZUA 1S67L 1N9NA 3CLOA 1T1CA 5G4YA 3FG8A 4YWZA 2PHYA 2H28A 1TS6A 2Z6CA 3FC7A 3OLOA 2JHEA 5DKKA 1GSXA 4LRZE 5HDSA 3UMDA 1LT0A 3LI9A 2J80A 3E4QA 2QKPA 4JGOA 2VEAA 4XT2A 3IS2A 3SW1A 5IS1A 1XJ2A 2A24B 3NJAA 1OT6A 1BYWA 4NXBA 1KOUA 4R3AA 4EQ1A 2PR5A 1GSWA 3LI8A 4BBTA 2V0UA 2PYPA 1ODVA 2VV7A 2PD7A 3H82A 2M1CA 1Y28A 4MN6A 5IU1A 4LPZA 3C2WA 3MQOA 1LSXA 2ZOIA 4I38A 3T50A 2L0WA 3ZQ5A 1JNUA 2OWJA 4HHDA 4HQAA 1T1AA 4JGRA 4PKYA 3UB8A 3LIDA 3CAXA 1OTDA 4HOIA 4L9FA 4WF0A 1P97A 4RQ9A 1DRMA 3LIFA 2PDRA 4LLOB 3PYPA 1F98A 1OJ5A 1OTAA 3F1NA 5F68A 4HJ3A 5J3WA 4EERA 1XJ4A 4NXFA 1S4SA 4HJ4A 4WLAA 2K7SA 2B02A 1TS0A 4GW9A 4HNBA 1UWPX 4HP4A 4I5SA 3H7WB 2P7JA 4HH3A 4E04A 3VOLA 2PR6A 4R38A 4R70A 3EEHA 3VE3A 1TS8A 4DJ2A 4NXEA 1T18A 3F1OB 2YKFA 2PYRA 3F1PA 3LIEA 1N9OA 4M4XA 4BBVA 1GSVA 1S1YA 3LIBA 1DP8A 1XFNA 4R6LA 2Z6DA 4EXOA 3K3DA 5TBMA 3RH8B 4WUJA 3GECA 1D7EA 4I3JA 2PD8A 3GDIA 4GS9A 2GJ3A 5F6AA 1OTIA 3NOPC 3ULFA 2VV6A 3UB7A 5HWWA 1NWZA 3UB9A 4LRYC 2L4RA 4F3LA 5HDCA 2CMNA 2V9AA 3A0VA 4H6JA 1UWNX 3PHYA 5HZHA 5DJTA 4K08A 4GHIA 2QWSA 3MR0A 1P0ZA 1DP6A 2VLGA 4XT2B 3IS2B 4I3IA 1LL8A 1XJ3A 1S4RA 4I39A 3BWLA 3KX0X 1S66L 3MFXA 5AVFA 3MXQA 2VV8A 1S1ZA 2ZOHA 1OTBA 5J7EA 1N9LA 3K3CA 2W27A 3HJKA 3H82B 4HI4A 4HY8A 5I5LA 2OOLA 5DKLA 4KUKA 2HV1A 4KQDA 1EW0A 1VB6A 1V9ZA 2A24A 2INWA 3LICA 2OWHA 3RTYA 3G6OA 1WA9A 3LYXA 3UE6A 4NXGA 2QJ5A 1D06A 3UB6A 3UMEA 4PKYG 3LIAA 3C8CA 1DP9A 2WKQA 2I9VA 1V9YA 4JGPA 2V1BA 3NOUC 2R78A 5J4EA 3F1NB 3A0RA 3B33A 1LSVA 4EEPA 5A8BA 4WN5A 2V1AA 4JGQA 3HJIA 5KIZA 4I3AA 3VE4A 2YKHA 2KDKA 4DJ3A 5HWVA 1X0OA 2QJ7A 5HD3A 3EWKA 3P7NA 1LSWA 4WL9A 4B9OA 3LUQA 1T1BA 5DJUA 1TS7A 3E4OA 4EETB 3BY8A 4L9EA 3ICYA 2WKRA 2V0WA 2EA9A 4BBUA 3MQQA 3H7WA 3IBRA 1T19A 4EEUA 3F1PB 4EW7A 2QHKA 3NHQA 4HIAA 5EFWA 4GCZA 3CWFA 4HP9A 3NOTC 3E4PA 5HD5A 2W0NA 4LRXC 5HDDA 5TBMB 3H9WA 3F1OA 1F9IA 4GS9B 5F69A 3BY9A 2JN7A 4HJ6A 2KX6A 4KUOA 4MN5A 3D72A 2ZBBA 3MJQA 1OT9A 5HWTA 1OTEA 2D02A 2L1MA 3A0SA 4F3LB 4L9GA 1XJ6A 2D01A 5G4ZA 4H6JB 4EESA 1G28A 5HSQA 1OJGA 5AVEA 1UGUA 5F5YA 1XFQA 2BASA 4GHIB 2WKPA 4HH2A
chains in the Genus database with same CATH superfamily
3K2NA 1L0EA 1MZUA 1DJCA 1W5DA 4Y0OA 1SCWA 2ZMFA 4R3BA 2HDQA 4YWZA 3HLDA 4G3VA 4CPKA 2Z6CA 4DDSA 3D4FA 5DKKA 4LRZE 5HDSA 2QKPA 4OPRA 2JE5A 3TRCA 3S7NA 2R9WA 4GB7A 5EVIA 4PM5A 4DF6A 4QWOA 4XT2A 3IS2A 3LR4A 3NJAA 3QNCA 1BYWA 3EQUA 4RA7A 4XXRA 3IXBA 3OZHA 1W63Q 1HLUP 1VETB 4CJNA 1MKIA 4P6ZS 2V0UA 2PYPA 4FH2A 2VV7A 3H82A 2OSUA 4G3KA 4OP5A 4BLMA 4S2JA 1QMEA 4KZ6A 3C2WA 3MQOA 1M6KA 2OWJA 3O86A 4PKYA 5EPHA 3CAXA 1OTDA 3EQVA 4S2LA 1RP5A 4L9FA 2XRNA 4RQ9A 3IH9A 1PZOA 2HDUA 3C5AA 3NBLA 3BEBA 5FA7A 1IEMA 1YKDA 3ZG0A 5F68A 3LR3A 2JBFA 4EERA 5K5BA 1CJFA 4BJPA 3B42A 4NXFA 4DDYA 4HJ4A 3I7JA 2K7SA 1CI8A 4ID4A 1FILA 1LL5A 4GW9A 1Z6FA 1O07A 2V1ZA 1UWPX 3H7WB 4QY6A 2P7JA 1PNEA 3KYEA 5FQ9A 4E04A 5E2HA 5L10A 1KVLA 1YQSA 2WGIA 4GN2A 3DTIA 3BLSA 4IJGA 5CECA 2X71A 1ES5A 4OQIA 2W1TB 3N8RA 3CJMA 1PW1A 3C7VA 5M19A 4MN7A 5FAQA 5F82A 2Y2IA 3UY6A 2PYRA 5CGWA 2Y2QA 5FL3A 3F1PA 1IYOA 3LIEA 3O3VA 3FPWA 3G34A 3Q1FA 3S7OA 4NKPA 4HESA 5DF9A 3VP2A 4EBNA 1XFNA 3A3JA 3KO6A 3BFGA 4EXOA 3UN7A 3W8KA 4L0LA 2Y2OA 3RH8B 1W8YA 5KZHA 3GECA 5DF8A 3ZG7B 2IWBA 2PD8A 2K31A 4Y5FA 5F6AA 4NEED 1KVMA 2C6WB 3O88A 3BQAA 2LB9A 4QU3A 3ULFA 2VV6A 2EFUA 4X6TA 3S7QA 1NWZA 2L4RA 4F3LA 4UQIS 1YLPA 4E3JA 3A0VA 4GZBA 3NCKA 1ALQA 3SS3A 4GOGA 1UWNX 3BLMA 3PBQA 5HZHA 3BYDA 4X1LA 3MZDA 2QMIA 2A3UA 3ZHHA 5CTMA 1FOFA 5EVIB 1DP6A 4XT2B 3IS2B 4I3IA 3IXGA 4MBFA 2B5RA 1LL8A 1W79A 2W3EA 3IXHA 1YAXA 3GV9A 5HAIA 3D9YA 5CHUA 3OCLA 4LCMA 1GA9A 3C38A 2J3TD 4KZ3A 2V20A 2XFSA 2JKTM 3H82B 3VSLA 1YLZA 3IF6C 5DKLA 1DJAA 3ZG5A 3PAGA 3MF0A 1EW0A 1VB6A 2INWA 1DY6A 4IEDA 1E3UD 4IBRA 3JPUA 1ES3A 1D1JA 3VFHA 2XGNA 4WMCD 3TOIA 5EOOA 3UMEA 5L09A 1DP9A 2WKQA 2HDRA 2WUQA 4JGPA 3ZGAB 2V1BA 1YLTA 2HP6A 2ZM0A 3G4PA 3UO9A 1LI9A 3CI6A 5A90A 4LV2A 4EEPA 5A8BA 3MBZA 3R4KA 4DE0A 2V1AA 4ETZA 3PBTA 2FFYA 4I3AA 3QP1A 4XUXA 3VE4A 3HL9A 5FQKA 2AVXA 5TJJA 3LUQA 1G6OA 1S6RA 2EWWA 5AQBA 3E4OA 5CHMA 4L9EA 2V0WA 1YM1A 1TF1A 4LV1A 3T4QA 2HPBA 3BECA 2EA9A 3IF6A 3WS5A 3A3IA 3JYIA 2VJWA 4JKTA 3KYZA 3IBRA 5HARA 2QPNA 3KSHA 1T19A 4Y0TA 3F1PB 1OPXA 4NK3A 3NC8A 2QHKA 3NHQA 3IF5A 1KDSA 4OLDA 4S2PA 3P09A 5HL6A 3CWFA 1MWUA 4RVAA 4IHQA 1SDNA 2XFTA 3E4PA 4LRXC 3ISGA 1ZKJA 5A91A 4MDZA 2WAFA 3BFFA 3F1OA 4JF4A 3QP6A 3V3SA 1PI4A 2XSSA 2R9XA 1C3BA 4MLLA 1NY0A 1OT9A 5J8XA 4GLQA 2ZQDA 1OTEA 2D02A 4OPYA 3EGDC 4F3LB 3SOIA 3LO7A 5HPIA 4GD6A 1STZA 2D01A 1K6SA 3HLFA 5A92A 1SDEA 1E25A 3UDIA 3N6IA 1J3WA 5IHVA 2FH5A 2QYBA 5AQAA 4MCWA 5M1AA 2ZLYA 4S2KA 3V67A 1KGFA 2WKPA 2VGJA 3N8LA 5FI7A 4WELA 3Q82A 1H5XA 3TG9A 4ZJ3A 3T1SA 3CLOA 5G4YA 3W4QA 3FG8A 2H28A 4QY5A 2OAQ1 3HLEA 2W3FA 5CX7A 4GJ4A 4ZTKA 5IT5A 4F94A 3OLOA 1BUEA 1GSXA 1CQAA 1ZC2A 3UNWA 3LI9A 5JYOA 4K0WA 1U60A 3FPVA 4HBTA 4Q0HA 2JKFA 1NXYA 5AQ7A 3UPOA 4N9LA 3SW1A 1I2SA 5IS1A 3IX4A 3O87A 3IXDA 4KG5A 1ONHA 1G68A 4OH0A 3UE1A 4R3AA 2X02A 3FV7A 4OQ0A 2PR5A 1A0KA 2V8FA 3PBRA 3LI8A 1LI0A 4UQIM 1K56D 3C7UA 3PBNA 1ODVA 3VP4A 2PD7A 5EUAA 1YPRA 2M1CA 2WZZA 4KQQA 4OPQA 5IU1A 4LPZA 1L0FA 3VOYA 2HP5A 4I38A 4C75A 3T50A 2Q9NA 2L0WA 3LY3A 1JNUA 1T1AA 4JGRA 3S7PA 4RYEA 4HOIA 3SZTA 3L7HA 3PTEA 4X69A 2J8YA 1P97A 1DRMA 5FDHA 3LIFA 2Y2HA 4LLOB 3PYPA 3T4TA 2W1RA 4PAUA 2PAVP 1OJ5A 1SKFA 1OTAA 5U47A 3F1NA 2Y79A 4HJ3A 4YFMA 3S4XA 5EVID 1RGYA 1LLBA 3IF6B 2Y2PA 4N1XA 4E3IA 1TS0A 3C4PA 4HNBA 1G6AA 4HP4A 4I5SA 3GMWA 3SH7A 2JKRI 1ZG4A 4JXWA 2GDNA 4MBHA 1NRJA 3BFCA 3HUOA 3SS5A 3EEHA 3QHYA 1JWVA 1K38A 2VKSA 4OPZA 5KSCA 4KZAA 5DFYA 5GLBA 2ZJ9A 2ZD8A 3F1OB 4RX2A 2HJEA 2PRFA 4BL3A 3RXWA 4Y13A 5TFQA 1H8YA 1N9OA 4M4XA 4B88A 5HW3A 5DTKA 1GSVA 4EBPA 1XA1A 3ZVTA 4R6LA 2CC1A 4C3QA 3K3DA 4WEKA 5TBMA 4WEJA 4WUJA 5MC7A 1PWDA 1D7EA 2GJ3A 3FKVA 1NLYA 4BMWA 1Y4OA 3MQ0A 2WADA 5HWWA 3UDXA 4FH4A 3UB9A 4Y2FA 3BQ8A 5CTNA 5HDCA 2ZQAA 4LFUA 1W8QA 1K4EA 3ITAA 4MEZA 4QD4A 4H6JA 1H8MA 4DKIA 3PHYA 2O0YA 3QP4A 3OCNA 3NI9A 2XH9A 3WRTA 1N9BA 1XA7A 3PBOA 4GHIA 1K0KA 5F1GA 1BLPA 1MBLA 2VZWA 5AQ9A 3OPPA 2O9BA 2VLGA 5JYPA 3N7WA 5DFXA 4LV3A 2JCHA 2M7VA 2ZC6B 4X56A 4BL2A 4QB8A 4I39A 1SKOA 3BRMA 4BENA 3A3EA 5AVFA 4WZ4A 1S1ZA 1OTBA 4JXGA 4P6BA 1KGEA 1N9LA 4HY8A 5I5LA 5CGXA 4CLCC 5HAQA 4KUKA 2HV1A 1V9ZA 3B3XA 3LICA 5EM1A 5EOEA 1WA9A 3LYXA 2ZQ8A 4NXGA 2VA0A 1LHYA 2PU4A 3AGDA 3T12B 1IOUA 2ZM2A 1RGZA 1D06A 3DWKA 3MKFA 3V39A 4KZ8A 3WRZA 3UB6A 4PKYG 3CHWP 3C8CA 1BLCA 4OOYA 3FYZA 2I9VA 4X1MA 1KE3A 4Q0IA 3NOUC 3F1NB 1VEUA 3VV4A 2WAEA 3IX3A 1ONGA 4EQIA 3JVUA 4A5RA 2YKHA 1GHMA 5FEFA 1X0OA 2QJ7A 2PU2A 5DTSA 3UDFA 4E3NA 5HX9A 1LSWA 2EX8A 2DMWA 5EE8A 3WS2A 1WE4A 4UA6A 1JWZA 3BY8A 4LGWA 2WKRA 3O5YA 1HD8A 3VOZA 5BOHA 1YT4A 1XX2A 4CLCA 2DRWA 3MS6A 5E2FA 4ARZA 1KE0A 4KZ9A 3LR5A 3PXPA 3ZNTA 2PT7A 2IWDA 4EEUA 1XPBA 1NYMA 5FEGA 4GCZA 3EEAA 4HP9A 1CK3A 2RCXA 1PWCA 4E3KA 3EOIA 3NOTC 2P04A 5HD5A 1BLHA 3BM6A 3M6HA 5TBMB 3IHBA 1DJBA 4YNRA 1FIKA 3SH8A 1F9IA 1MWRA 3ZG9B 2JN7A 4HJ6A 4KUOA 4ETXA 2VGLS 1EWZA 4MN5A 4OQGA 3KYQA 1P9RA 2ZBBA 3MJQA 5HWTA 4GNUA 3MSHA 4ZJ1A 2NUTC 3DW0A 2L1MA 2Y55A 1TD5A 1NRFA 5AJGA 3W4PA 2P08A 5G4ZA 4H6JB 3LCEA 2ZMVA 4Y17A 2FZ0A 1L0DA 5CHJA 1UGUA 4OOMA 4MNRA 1XFQA 4GHIB 1N4OA 4Z1WA 5GHXA 1N9NA 3DAVA 1T1CA 3NECA 4JBFA 1ESIA 2PHYA 5TR7A 2GZAA 1G5UA 4U0TA 5GL9A 1TS6A 2HJ9C 3S1YA 3P01A 1SKOB 2JHEA 1FSYA 3UMDA 2WK0A 2J80A 3E4QA 4MBKA 3GR2A 1HVBA 1IYSA 4ME4A 5HAPA 1BTLA 2VEAA 3IWOA 5D3OA 4O01A 3GTCA 2LB5A 4P6ZM 1OT6A 4OP8A 4NXBA 1KOUA 4ZRRA 4KQRA 3Q81A 1F2KA 3VFFA 1FR1A 4BQMA 4X68A 1GSWA 4N1HA 4UA7A 3W2ZA 3MXSA 4ZAMA 2Y8HA 1ZTUA 5EVLA 4KG6A 3BW6A 4GDBA 1ESUA 2ZQ9A 3UE3A 4R23A 1Y28A 3T4LA 2J9PA 2V2FF 3C30A 3AGEA 5FATA 2JKTI 1IYQA 1LSXA 2ZOIA 3ZQ5A 4K0XA 4KENB 3KSIA 4HHDA 4WMCA 3CPTA 3LIDA 4GDNA 3N8SA 4U3TA 3M2KA 2DCFA 1MKMA 2HP9A 4WF0A 1KGGA 4XUZA 3NIAA 2ZM8A 4KZBA 1F98A 4IBXA 1BZAA 3IH8A 5FQQA 1XJ4A 3OC2A 4E3OA 1XP4A 2B02A 4CLCB 3A3FA 4ARZB 2XD1A 2JC7A 2J9OA 3HLWA 3NDEA 3VOLA 3N4IA 4R38A 2A49A 2EXBA 2H0TA 1YLWA 3GVBA 3FKWA 1RCJA 3IT9A 2XA7S 4PM9A 3VE3A 2Y4AA 1TDLA 4DJ2A 2DNSA 2EX9A 4NXEA 3QP8A 2J3WA 1XXMA 5L8MA 1Q2PA 3Q7ZA 1IFQA 3GQZA 1TVFA 1MWTA 2H0YA 3G31A 1S1YA 2GNXA 2A2LA 3LIBA 5GLAA 4UAAA 2Z6DA 3CMZA 5FI6A 1JWPA 2WKEA 3B47A 1FSWA 3SH9A 4Y0UA 2ZL1A 2JKRM 3KSGA 1TDGA 3GDIA 4JLFA 1L2SA 4P87A 3GSGA 1ES2A 1XKZA 2GX5A 4LRYC 2CMNA 2ZC4B 1GHPA 3CZDA 5KMWA 3IWIA 3U2AA 4BD0A 1L0GA 3MZFA 4DE1A 1YMSA 4LENA 5DJTA 3VP0A 3UPPA 2G2WA 3T1XA 3TSGA 4U0XA 1MXOA 3M2JA 4R1GA 1FCMA 2W3HA 4GD8A 5F1FA 2JKGA 3LEZA 1YLYA 2HGVA 1ES4A 2VX8A 2VGLM 4S2IA 2W3GA 3QP5A 2WYXA 3U4LP 1S4RA 3HBRA 3BWLA 1K4FA 1S66L 3KX0X 3MFXA 3MXQA 2H5SA 2VV8A 3UB5P 2ZOHA 3T4SA 5J7EA 3NY4A 2XR0A 1EI5A 2XD5A 1AXBA 3HJKA 4S2NC 4HI4A 4M3KA 4Y7PA 2OOLA 5CERA 2KLIA 1FCOA 5GHZA 1PW8A 2ZQ7A 2A24A 3G35A 3RTYA 3G6OA 5E2EA 3CG5A 4S2MA 3CPTB 2QJ5A 4EUZA 4P0MA 1FCNA 3LIAA 1MC0A 5FDSA 1PRQA 1V9YA 3IBJA 1YMXA 1H0MA 2XQZA 5J4EA 3HUNA 3A0RA 1L3LA 3B33A 3R7WA 1IKGA 1NYYA 4JGQA 2IWCA 3HJIA 4KQOA 3DBAA 1P9WA 1CEGA 3CUEC 4E6XA 2Z2MB 5HWVA 1CI9A 3E2KA 5HD3A 3G2ZA 3P7NA 2NUPC 4WL9A 1T1BA 5DJUA 5CEBA 1TS7A 3UE0A 3ICYA 1SZVA 3TE8A 4KZ4A 4UA9A 4DE2A 4S2NA 3T4KA 1E4DA 4DE3A 3OPRA 4EUVA 4DN0A 2V8CA 3MQQA 5KSHA 1SHVA 3RFBA 4IVKA 3ZVWA 3E2LA 3PAEA 3IWQA 4YOFA 3OOVA 3SS4A 4N9KA 2X01A 4KZ7A 3Q7VA 2W0NA 1Q2QA 3DWZA 2Y2LA 2C5WB 4DRTA 1VHMA 2RL3A 2ZL1B 3C4OA 4QPRA 1W63M 2KX6A 4FSFA 3D72A 1WYBA 2FFFB 2Y2KA 2WGVA 3WS1A 2K2NA 3CUEA 4JF5A 2HF6A 4KZ5A 3A0SA 2BLSA 4E6WA 4L9GA 1CF0A 4FTXA 4RX3A 2Q9MA 4FCFA 3T1QB 4EESA 4OLGA 3T1RA 3EGXC 4JXVA 3DTKA 2O9CA 2IA2A 5AVEA 3MZEA 4CLCD 2PBDP 2XA7M 4ZBEA 4IUKA 1NJ4A 1IELA 1O7EA 2ACGA 4HH2A 4Y3IA 3NDGA 3V3RA 4FOFA 3HLCA 2BG1A 1S67L 2OAP1 1ZG6A 2H10A 2Y2JA 5FAOA 1YSQA 3FC7A 5FI2A 1LT0A 2WGWA 2UWXA 4R3JA 4DMZA 3TJZC 3S22A 4LCLA 3E98A 4JGOA 4B4XA 1PIOA 4D2OA 1JVJA 3HLGA 3UPNA 1XJ2A 2A24B 1AWIA 4QJGA 3ZCZA 1FR6A 2M7UA 5CRFA 4EQ1A 3PR6A 2XDMA 3V50A 2WKIA 4BBTA 5E43A 1MPLA 1NZUA 3E0YA 1IKIA 4JPMA 1Z09A 3ZDJA 4Z9QA 5LBRA 4MN6A 4G3WA 1I2WA 4WM9A 2E8JA 3OPLA 4CLCE 3R7WB 2ZC7A 4IVIA 4BWIA 4HQAA 3BFEA 3UB8A 4DXBA 1XGIA 4Q0JA 5EV0A 4PM8A 5G18A 4EBLA 4OONA 5DTTA 4ZJ2A 2PDRA 2P9VA 3L9KA 1KE4A 4R0QA 1ZHHB 2VGKA 5EM0A 2O9AA 4HEFA 4WBGA 4PM7A 1PWGA 1YLJA 2J3TC 5J3WA 2PBYA 4FUWA 1LL9A 1S4SA 1VQQA 3IQAA 4O0PA 1ACFA 2WKHA 4WLAA 4HBUA 1YSPA 5C5KA 3IX8A 2BTFP 3JVVA 5DVAA 1VM1A 3OPHA 5CEDA 3T4JA 2MJ6A 5EVEA 5CXWA 1EROA 4HH3A 2Y59A 2G7UA 1BLSA 4C6YA 3HVFA 2PR6A 3Q7VB 4R70A 4K91A 1TS8A 3HCYA 5L07A 3LFVA 1T18A 1K55C 4R4RA 2Y91A 5F83A 2YKFA 3M6BA 4LV0A 5HL1A 4BBVA 5CGSA 4OKPA 4IUHA 1DP8A 5GLDA 1PFLA 4O7DA 3WWXA 3TW8A 2VK3A 3DTMA 4GKUA 4I3JA 4N92A 4GS9A 2OLVA 4EWFA 3G2YA 2Y2MA 1OTIA 3NOPC 1K6RA 4WYYA 3UB7A 1Y54A 3VSKA 3ITBA 3ZG8B 2G2UA 3W4OA 4B4ZA 1E3UA 5FQMA 1VEUB 4KG2A 2V9AA 2XK1A 4X53A 3P98A 3T4OA 2Q0OA 5M18A 1W7FA 1HZOA 2WGWB 4K08A 4X55A 2KOIA 2QWSA 4WZ5C 3MR0A 1K55A 5FSRA 1P0ZA 2EXAA 1K54C 1H3QA 2I72A 4JXSA 4YINA 3RJUA 1NLZA 1XJ3A 1TEMA 2E8IA 2P74A 4CQHA 4OVDA 1BULA 3A3DA 2B95A 1K57C 3ZFZA 2OV5A 3K3CA 2W27A 3RXXA 3NULA 2B18A 3LR0A 4PHTA 3Q07A 4KQDA 2ZC3B 2XLNA 2OWHA 3UE6A 3CITA 3AGFA 4JF6A 4E3LA 1ERQA 1FQGA 2UV0E 1IYPA 5GLCA 1VETA 2EX6A 4QHCA 4II7A 5A93A 1PI5A 4DXCA 2P9VB 5FASA 3KSFA 3WS0A 2QZ6A 3HLBA 1BSGA 2R78A 3WS4A 1JTDA 2Y2GA 4ESPA 1ERMA 1WYCA 1LSVA 1S0WA 4X25A 4NG2A 5I94A 4WZ5A 3G30A 4Y15A 3QNBA 4WN5A 5TGFA 4EU0A 1K54A 5KIZA 2XROA 4Q8IA 3ZYTA 2KDKA 3D3OA 4DJ3A 3BJNA 1NZOA 2Z2LB 1J9MA 4O8GA 5FQJA 2EFXA 3EWKA 3DTEA 4B9OA 2XEPA 2EX2A 1JTGA 3FWLA 4H8RA 4EETB 2O99A 4PM6A 5FQIA 1K57A 2W3DA 3FZCA 1QMFA 3HREA 4NETA 4UEYA 1F5MA 2ZQCA 4AFIA 3V5MA 4BBUA 1BT5A 3LEQA 3H7WA 3G32A 5DF7A 3MFDA 4ZDXA 3HUMA 3MKEA 4BD1A 4E3MA 4S2OA 1GA0A 4EW7A 3VP1A 4HIAA 4MMNA 5E2GA 3GRJA 1GHIA 1H8ZA 5EFWA 4EV4A 2ZC5B 2Y2NA 2ZMAA 1KDWA 1MWSA 2W1TA 5HPFA 3MXRA 2HDSA 3PBSA 4PMAA 3QP2A 3MMHA 4B93A 5HDDA 3LGOA 5GHYA 1MY8A 3H9WA 5EECA 4P85A 4OOLA 2WZXA 1K25A 3LY4A 1I5QA 4GS9B 5F69A 5EVIC 3BY9A 1CEFA 4OQHA 3ZNYA 2J7VA 3IHAA 5L2FA 2EWVA 5HFOA 4PPRA 1M40A 2HZ5A 1XJ6A 5FAPA 1XGJA 3VMAA 1K56A 1G28A 2OLUA 3VP3A 1PYYA 5HSQA 1OJGA 1GCEA 4R4SA 1OMEA 4FD8A 5F5YA 3OBFA 2XF3A 2BASA 4UHUA 4D60A 3BFDA 1HTZA 1PZPA
chains in the Genus database with same CATH topology
4Y3IA 3K2NA 1MZUA 4FOFA 4Z1WA 4WELA 1S67L 2ZMFA 1N9NA 3CLOA 1T1CA 5G4YA 2OAP1 3FG8A 4YWZA 2PHYA 2H28A 2GZAA 2OAQ1 5CX7A 2W3FA 4G3VA 4GJ4A 1TS6A 2HJ9C 5IT5A 1YSQA 2Z6CA 3FC7A 3OLOA 3P01A 2JHEA 5DKKA 1GSXA 4LRZE 5HDSA 3UMDA 1LT0A 3LI9A 2J80A 4DMZA 3E4QA 2QKPA 3FPVA 4Q0HA 3TJZC 3E98A 4JGOA 3TRCA 3S7NA 4ME4A 2VEAA 4XT2A 3IS2A 3SW1A 5IS1A 1XJ2A 4O01A 2LB5A 2A24B 3LR4A 3NJAA 1OT6A 4P6ZM 1BYWA 4NXBA 1KOUA 3EQUA 4ZRRA 2M7UA 4R3AA 4EQ1A 3PR6A 1W63Q 2PR5A 1GSWA 3PBRA 3LI8A 4UQIM 4BBTA 3W2ZA 2Y8HA 4P6ZS 2V0UA 2PYPA 1ZTUA 3PBNA 3BW6A 3E0YA 1ODVA 2VV7A 2PD7A 3H82A 3UE3A 4G3KA 2M1CA 5LBRA 1Y28A 3T4LA 3C30A 4MN6A 4G3WA 5IU1A 2JKTI 4LPZA 3C2WA 3MQOA 1LSXA 2ZOIA 4I38A 4CLCE 3R7WB 3T50A 2L0WA 3ZQ5A 1JNUA 2OWJA 3KSIA 4HHDA 1T1AA 4HQAA 4JGRA 4BWIA 4PKYA 3UB8A 3LIDA 3S7PA 3CAXA 1OTDA 4Q0JA 4HOIA 1MKMA 3EQVA 4L9FA 4WF0A 1P97A 2XRNA 4RQ9A 1DRMA 3LIFA 2PDRA 4LLOB 3PYPA 3T4TA 2W1RA 1ZHHB 4PAUA 1F98A 1OJ5A 1OTAA 2O9AA 1YKDA 3F1NA 2Y79A 5F68A 3LR3A 4HJ3A 2J3TC 5J3WA 4EERA 5K5BA 1XJ4A 3B42A 4NXFA 4BJPA 1S4SA 3OC2A 4HJ4A 4O0PA 4WLAA 2K7SA 1YSPA 2B02A 1TS0A 5C5KA 4CLCB 4GW9A 3JVVA 4ARZB 4HNBA 1UWPX 4HP4A 4I5SA 3H7WB 2MJ6A 3T4JA 2P7JA 4HH3A 2JKRI 4E04A 2G7UA 3VOLA 1NRJA 2PR6A 4R38A 4IJGA 4R70A 3EEHA 2W1TB 2XA7S 2VKSA 3VE3A 1TS8A 5DFYA 4DJ2A 3HCYA 4NXEA 4MN7A 3LFVA 2J3WA 1T18A 3F1OB 2HJEA 5L8MA 2YKFA 2PYRA 1IFQA 5FL3A 3F1PA 3LIEA 3FPWA 3S7OA 1N9OA 4M4XA 4NKPA 4BBVA 5DF9A 1GSVA 1S1YA 2GNXA 2A2LA 3LIBA 4IUHA 1DP8A 1XFNA 3KO6A 4R6LA 2Z6DA 4EXOA 3K3DA 4WEKA 4L0LA 5TBMA 4WEJA 3RH8B 4WUJA 3B47A 3TW8A 5MC7A 3GECA 1D7EA 4I3JA 2JKRM 3KSGA 2PD8A 3GDIA 4GS9A 2GJ3A 2K31A 4Y5FA 5F6AA 4NEED 3BQAA 1NLYA 1OTIA 2LB9A 4BMWA 3NOPC 3ULFA 3MQ0A 2VV6A 3UB7A 5HWWA 3S7QA 1NWZA 3UB9A 2GX5A 4LRYC 4Y2FA 3BQ8A 2L4RA 4F3LA 5HDCA 4UQIS 2CMNA 2V9AA 3A0VA 4H6JA 1H8MA 3T4OA 1UWNX 3U2AA 3PHYA 3PBQA 5HZHA 2O0YA 3OCNA 5DJTA 4K08A 3PBOA 4GHIA 2KOIA 2QWSA 3MR0A 2W3HA 2VZWA 1P0ZA 1DP6A 2O9BA 1H3QA 2VLGA 4XT2B 2HGVA 3IS2B 4I3IA 5DFXA 2VX8A 2M7VA 2VGLM 1NLZA 1LL8A 2W3GA 1XJ3A 2W3EA 1S4RA 4I39A 1YAXA 3BWLA 3KX0X 1S66L 3MFXA 5AVFA 4CQHA 3OCLA 3MXQA 2VV8A 1S1ZA 2ZOHA 3T4SA 1OTBA 3C38A 2J3TD 5J7EA 1N9LA 3K3CA 2W27A 2JKTM 3H82B 3HJKA 4HI4A 2B18A 3LR0A 4HY8A 5I5LA 2OOLA 4PHTA 2KLIA 5DKLA 4CLCC 4KUKA 3MF0A 2HV1A 4KQDA 1EW0A 1VB6A 1V9ZA 2A24A 2INWA 3LICA 2OWHA 3RTYA 3G6OA 1WA9A 3LYXA 3UE6A 4NXGA 3CITA 2VA0A 1IOUA 2QJ5A 1D06A 4II7A 3UB6A 3UMEA 4PKYG 3LIAA 3C8CA 1MC0A 1DP9A 2WKQA 3KSFA 2I9VA 1V9YA 3IBJA 4JGPA 2V1BA 4Q0IA 3NOUC 2R78A 5J4EA 3F1NB 3A0RA 3B33A 1LSVA 3VV4A 3CI6A 3R7WA 4EEPA 5A8BA 3R4KA 4WN5A 2V1AA 4ETZA 4JGQA 4EU0A 3HJIA 4KQOA 3PBTA 3DBAA 1P9WA 5KIZA 4I3AA 3VE4A 2XROA 3JVUA 2YKHA 3ZYTA 3CUEC 2KDKA 3D3OA 4DJ3A 3BJNA 1X0OA 5HWVA 2QJ7A 4O8GA 5HD3A 3EWKA 3P7NA 5TJJA 2NUPC 1LSWA 4WL9A 4B9OA 3LUQA 2DMWA 1G6OA 1T1BA 5DJUA 2EWWA 1TS7A 3E4OA 4EETB 3BY8A 4L9EA 2O99A 3ICYA 3TE8A 2WKRA 3O5YA 2W3DA 2V0WA 4UEYA 1TF1A 3T4QA 1F5MA 3T4KA 2EA9A 4AFIA 4CLCA 4EUVA 4DN0A 4BBUA 4ARZA 2VJWA 3MQQA 5KSHA 3H7WA 3KYZA 3RFBA 3IBRA 3LR5A 3PXPA 2PT7A 3KSHA 1T19A 4EEUA 3F1PB 1OPXA 4EW7A 2QHKA 3NHQA 4HIAA 4MMNA 4YOFA 3OOVA 5EFWA 5HL6A 4GCZA 3CWFA 3EEAA 4HP9A 3EOIA 3NOTC 4IHQA 2W1TA 2P04A 3E4PA 5HPFA 5HD5A 2W0NA 4LRXC 3PBSA 3MMHA 4B93A 5HDDA 5TBMB 3H9WA 4MDZA 1VHMA 3F1OA 4OOLA 4YNRA 1F9IA 4GS9B 5F69A 3BY9A 4QPRA 2JN7A 2XSSA 4HJ6A 1W63M 2KX6A 4KUOA 4FSFA 4ETXA 2VGLS 4MN5A 3D72A 3KYQA 1P9RA 2ZBBA 3MJQA 1OT9A 5HWTA 4GLQA 1OTEA 2EWVA 2K2NA 2D02A 2NUTC 3CUEA 2HF6A 2L1MA 3EGDC 3A0SA 4F3LB 5HPIA 1TD5A 5AJGA 4L9GA 1XJ6A 1STZA 2D01A 2P08A 5G4ZA 4H6JB 4EESA 2FH5A 2QYBA 1G28A 2ZMVA 3EGXC 5HSQA 2FZ0A 2O9CA 1OJGA 4MCWA 2IA2A 5AVEA 1UGUA 4CLCD 2XA7M 4OOMA 3OBFA 5F5YA 3V67A 4IUKA 1XFQA 2BASA 4GHIB 2WKPA 4HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZU A;  1S67 L;  1N9N A;  3CLO A;  1T1C A;  5G4Y A;  3FG8 A;  4YWZ A;  2PHY A;  2H28 A;  1TS6 A;  2Z6C A;  3FC7 A;  3OLO A;  2JHE A;  5DKK A;  1GSX A;  4LRZ E;  5HDS A;  3UMD A;  1LT0 A;  3LI9 A;  2J80 A;  3E4Q A;  2QKP A;  4JGO A;  2VEA A;  4XT2 A;  3IS2 A;  3SW1 A;  5IS1 A;  1XJ2 A;  2A24 B;  3NJA A;  1OT6 A;  1BYW A;  4NXB A;  1KOU A;  4R3A A;  4EQ1 A;  2PR5 A;  1GSW A;  3LI8 A;  4BBT A;  2V0U A;  2PYP A;  1ODV A;  2VV7 A;  2PD7 A;  3H82 A;  2M1C A;  1Y28 A;  4MN6 A;  5IU1 A;  4LPZ A;  3C2W A;  3MQO A;  1LSX A;  2ZOI A;  4I38 A;  3T50 A;  2L0W A;  3ZQ5 A;  1JNU A;  2OWJ A;  4HHD A;  4HQA A;  1T1A A;  4JGR A;  4PKY A;  3UB8 A;  3LID A;  3CAX A;  1OTD A;  4HOI A;  4L9F A;  4WF0 A;  1P97 A;  4RQ9 A;  1DRM A;  3LIF A;  2PDR A;  4LLO B;  3PYP A;  1F98 A;  1OJ5 A;  1OTA A;  3F1N A;  5F68 A;  4HJ3 A;  5J3W A;  4EER A;  1XJ4 A;  4NXF A;  1S4S A;  4HJ4 A;  4WLA A;  2K7S A;  2B02 A;  1TS0 A;  4GW9 A;  4HNB A;  1UWP X;  4HP4 A;  4I5S A;  3H7W B;  2P7J A;  4HH3 A;  4E04 A;  3VOL A;  2PR6 A;  4R38 A;  4R70 A;  3EEH A;  3VE3 A;  1TS8 A;  4DJ2 A;  4NXE A;  1T18 A;  3F1O B;  2YKF A;  2PYR A;  3F1P A;  3LIE A;  1N9O A;  4M4X A;  4BBV A;  1GSV A;  1S1Y A;  3LIB A;  1DP8 A;  1XFN A;  4R6L A;  2Z6D A;  4EXO A;  3K3D A;  5TBM A;  3RH8 B;  4WUJ A;  3GEC A;  1D7E A;  4I3J A;  2PD8 A;  3GDI A;  4GS9 A;  2GJ3 A;  5F6A A;  1OTI A;  3NOP C;  3ULF A;  2VV6 A;  3UB7 A;  5HWW A;  1NWZ A;  3UB9 A;  4LRY C;  2L4R A;  4F3L A;  5HDC A;  2CMN A;  2V9A A;  3A0V A;  4H6J A;  1UWN X;  3PHY A;  5HZH A;  5DJT A;  4K08 A;  4GHI A;  2QWS A;  3MR0 A;  1P0Z A;  1DP6 A;  2VLG A;  4XT2 B;  3IS2 B;  4I3I A;  1LL8 A;  1XJ3 A;  1S4R A;  4I39 A;  3BWL A;  3KX0 X;  1S66 L;  3MFX A;  5AVF A;  3MXQ A;  2VV8 A;  1S1Z A;  2ZOH A;  1OTB A;  5J7E A;  1N9L A;  3K3C A;  2W27 A;  3HJK A;  3H82 B;  4HI4 A;  4HY8 A;  5I5L A;  2OOL A;  5DKL A;  4KUK A;  2HV1 A;  4KQD A;  1EW0 A;  1VB6 A;  1V9Z A;  2A24 A;  2INW A;  3LIC A;  2OWH A;  3RTY A;  3G6O A;  1WA9 A;  3LYX A;  3UE6 A;  4NXG A;  2QJ5 A;  1D06 A;  3UB6 A;  3UME A;  4PKY G;  3LIA A;  3C8C A;  1DP9 A;  2WKQ A;  2I9V A;  1V9Y A;  4JGP A;  2V1B A;  3NOU C;  2R78 A;  5J4E A;  3F1N B;  3A0R A;  3B33 A;  1LSV A;  4EEP A;  5A8B A;  4WN5 A;  2V1A A;  4JGQ A;  3HJI A;  5KIZ A;  4I3A A;  3VE4 A;  2YKH A;  2KDK A;  4DJ3 A;  5HWV A;  1X0O A;  2QJ7 A;  5HD3 A;  3EWK A;  3P7N A;  1LSW A;  4WL9 A;  4B9O A;  3LUQ A;  1T1B A;  5DJU A;  1TS7 A;  3E4O A;  4EET B;  3BY8 A;  4L9E A;  3ICY A;  2WKR A;  2V0W A;  2EA9 A;  4BBU A;  3MQQ A;  3H7W A;  3IBR A;  1T19 A;  4EEU A;  3F1P B;  4EW7 A;  2QHK A;  3NHQ A;  4HIA A;  5EFW A;  4GCZ A;  3CWF A;  4HP9 A;  3NOT C;  3E4P A;  5HD5 A;  2W0N A;  4LRX C;  5HDD A;  5TBM B;  3H9W A;  3F1O A;  1F9I A;  4GS9 B;  5F69 A;  3BY9 A;  2JN7 A;  4HJ6 A;  2KX6 A;  4KUO A;  4MN5 A;  3D72 A;  2ZBB A;  3MJQ A;  1OT9 A;  5HWT A;  1OTE A;  2D02 A;  2L1M A;  3A0S A;  4F3L B;  4L9G A;  1XJ6 A;  2D01 A;  5G4Z A;  4H6J B;  4EES A;  1G28 A;  5HSQ A;  1OJG A;  5AVE A;  1UGU A;  5F5Y A;  1XFQ A;  2BAS A;  4GHI B;  2WKP A;  4HH2 A; 
#chains in the Genus database with same CATH topology
 3K2N A;  1L0E A;  1MZU A;  1DJC A;  1W5D A;  4Y0O A;  1SCW A;  2ZMF A;  4R3B A;  2HDQ A;  4YWZ A;  3HLD A;  4G3V A;  4CPK A;  2Z6C A;  4DDS A;  3D4F A;  5DKK A;  4LRZ E;  5HDS A;  2QKP A;  4OPR A;  2JE5 A;  3TRC A;  3S7N A;  2R9W A;  4GB7 A;  5EVI A;  4PM5 A;  4DF6 A;  4QWO A;  4XT2 A;  3IS2 A;  3LR4 A;  3NJA A;  3QNC A;  1BYW A;  3EQU A;  4RA7 A;  4XXR A;  3IXB A;  3OZH A;  1W63 Q;  1HLU P;  1VET B;  4CJN A;  1MKI A;  4P6Z S;  2V0U A;  2PYP A;  4FH2 A;  2VV7 A;  3H82 A;  2OSU A;  4G3K A;  4OP5 A;  4BLM A;  4S2J A;  1QME A;  4KZ6 A;  3C2W A;  3MQO A;  1M6K A;  2OWJ A;  3O86 A;  4PKY A;  5EPH A;  3CAX A;  1OTD A;  3EQV A;  4S2L A;  1RP5 A;  4L9F A;  2XRN A;  4RQ9 A;  3IH9 A;  1PZO A;  2HDU A;  3C5A A;  3NBL A;  3BEB A;  5FA7 A;  1IEM A;  1YKD A;  3ZG0 A;  5F68 A;  3LR3 A;  2JBF A;  4EER A;  5K5B A;  1CJF A;  4BJP A;  3B42 A;  4NXF A;  4DDY A;  4HJ4 A;  3I7J A;  2K7S A;  1CI8 A;  4ID4 A;  1FIL A;  1LL5 A;  4GW9 A;  1Z6F A;  1O07 A;  2V1Z A;  1UWP X;  3H7W B;  4QY6 A;  2P7J A;  1PNE A;  3KYE A;  5FQ9 A;  4E04 A;  5E2H A;  5L10 A;  1KVL A;  1YQS A;  2WGI A;  4GN2 A;  3DTI A;  3BLS A;  4IJG A;  5CEC A;  2X71 A;  1ES5 A;  4OQI A;  2W1T B;  3N8R A;  3CJM A;  1PW1 A;  3C7V A;  5M19 A;  4MN7 A;  5FAQ A;  5F82 A;  2Y2I A;  3UY6 A;  2PYR A;  5CGW A;  2Y2Q A;  5FL3 A;  3F1P A;  1IYO A;  3LIE A;  3O3V A;  3FPW A;  3G34 A;  3Q1F A;  3S7O A;  4NKP A;  4HES A;  5DF9 A;  3VP2 A;  4EBN A;  1XFN A;  3A3J A;  3KO6 A;  3BFG A;  4EXO A;  3UN7 A;  3W8K A;  4L0L A;  2Y2O A;  3RH8 B;  1W8Y A;  5KZH A;  3GEC A;  5DF8 A;  3ZG7 B;  2IWB A;  2PD8 A;  2K31 A;  4Y5F A;  5F6A A;  4NEE D;  1KVM A;  2C6W B;  3O88 A;  3BQA A;  2LB9 A;  4QU3 A;  3ULF A;  2VV6 A;  2EFU A;  4X6T A;  3S7Q A;  1NWZ A;  2L4R A;  4F3L A;  4UQI S;  1YLP A;  4E3J A;  3A0V A;  4GZB A;  3NCK A;  1ALQ A;  3SS3 A;  4GOG A;  1UWN X;  3BLM A;  3PBQ A;  5HZH A;  3BYD A;  4X1L A;  3MZD A;  2QMI A;  2A3U A;  3ZHH A;  5CTM A;  1FOF A;  5EVI B;  1DP6 A;  4XT2 B;  3IS2 B;  4I3I A;  3IXG A;  4MBF A;  2B5R A;  1LL8 A;  1W79 A;  2W3E A;  3IXH A;  1YAX A;  3GV9 A;  5HAI A;  3D9Y A;  5CHU A;  3OCL A;  4LCM A;  1GA9 A;  3C38 A;  2J3T D;  4KZ3 A;  2V20 A;  2XFS A;  2JKT M;  3H82 B;  3VSL A;  1YLZ A;  3IF6 C;  5DKL A;  1DJA A;  3ZG5 A;  3PAG A;  3MF0 A;  1EW0 A;  1VB6 A;  2INW A;  1DY6 A;  4IED A;  1E3U D;  4IBR A;  3JPU A;  1ES3 A;  1D1J A;  3VFH A;  2XGN A;  4WMC D;  3TOI A;  5EOO A;  3UME A;  5L09 A;  1DP9 A;  2WKQ A;  2HDR A;  2WUQ A;  4JGP A;  3ZGA B;  2V1B A;  1YLT A;  2HP6 A;  2ZM0 A;  3G4P A;  3UO9 A;  1LI9 A;  3CI6 A;  5A90 A;  4LV2 A;  4EEP A;  5A8B A;  3MBZ A;  3R4K A;  4DE0 A;  2V1A A;  4ETZ A;  3PBT A;  2FFY A;  4I3A A;  3QP1 A;  4XUX A;  3VE4 A;  3HL9 A;  5FQK A;  2AVX A;  5TJJ A;  3LUQ A;  1G6O A;  1S6R A;  2EWW A;  5AQB A;  3E4O A;  5CHM A;  4L9E A;  2V0W A;  1YM1 A;  1TF1 A;  4LV1 A;  3T4Q A;  2HPB A;  3BEC A;  2EA9 A;  3IF6 A;  3WS5 A;  3A3I A;  3JYI A;  2VJW A;  4JKT A;  3KYZ A;  3IBR A;  5HAR A;  2QPN A;  3KSH A;  1T19 A;  4Y0T A;  3F1P B;  1OPX A;  4NK3 A;  3NC8 A;  2QHK A;  3NHQ A;  3IF5 A;  1KDS A;  4OLD A;  4S2P A;  3P09 A;  5HL6 A;  3CWF A;  1MWU A;  4RVA A;  4IHQ A;  1SDN A;  2XFT A;  3E4P A;  4LRX C;  3ISG A;  1ZKJ A;  5A91 A;  4MDZ A;  2WAF A;  3BFF A;  3F1O A;  4JF4 A;  3QP6 A;  3V3S A;  1PI4 A;  2XSS A;  2R9X A;  1C3B A;  4MLL A;  1NY0 A;  1OT9 A;  5J8X A;  4GLQ A;  2ZQD A;  1OTE A;  2D02 A;  4OPY A;  3EGD C;  4F3L B;  3SOI A;  3LO7 A;  5HPI A;  4GD6 A;  1STZ A;  2D01 A;  1K6S A;  3HLF A;  5A92 A;  1SDE A;  1E25 A;  3UDI A;  3N6I A;  1J3W A;  5IHV A;  2FH5 A;  2QYB A;  5AQA A;  4MCW A;  5M1A A;  2ZLY A;  4S2K A;  3V67 A;  1KGF A;  2WKP A;  2VGJ A;  3N8L A;  5FI7 A;  4WEL A;  3Q82 A;  1H5X A;  3TG9 A;  4ZJ3 A;  3T1S A;  3CLO A;  5G4Y A;  3W4Q A;  3FG8 A;  2H28 A;  4QY5 A;  2OAQ 1;  3HLE A;  2W3F A;  5CX7 A;  4GJ4 A;  4ZTK A;  5IT5 A;  4F94 A;  3OLO A;  1BUE A;  1GSX A;  1CQA A;  1ZC2 A;  3UNW A;  3LI9 A;  5JYO A;  4K0W A;  1U60 A;  3FPV A;  4HBT A;  4Q0H A;  2JKF A;  1NXY A;  5AQ7 A;  3UPO A;  4N9L A;  3SW1 A;  1I2S A;  5IS1 A;  3IX4 A;  3O87 A;  3IXD A;  4KG5 A;  1ONH A;  1G68 A;  4OH0 A;  3UE1 A;  4R3A A;  2X02 A;  3FV7 A;  4OQ0 A;  2PR5 A;  1A0K A;  2V8F A;  3PBR A;  3LI8 A;  1LI0 A;  4UQI M;  1K56 D;  3C7U A;  3PBN A;  1ODV A;  3VP4 A;  2PD7 A;  5EUA A;  1YPR A;  2M1C A;  2WZZ A;  4KQQ A;  4OPQ A;  5IU1 A;  4LPZ A;  1L0F A;  3VOY A;  2HP5 A;  4I38 A;  4C75 A;  3T50 A;  2Q9N A;  2L0W A;  3LY3 A;  1JNU A;  1T1A A;  4JGR A;  3S7P A;  4RYE A;  4HOI A;  3SZT A;  3L7H A;  3PTE A;  4X69 A;  2J8Y A;  1P97 A;  1DRM A;  5FDH A;  3LIF A;  2Y2H A;  4LLO B;  3PYP A;  3T4T A;  2W1R A;  4PAU A;  2PAV P;  1OJ5 A;  1SKF A;  1OTA A;  5U47 A;  3F1N A;  2Y79 A;  4HJ3 A;  4YFM A;  3S4X A;  5EVI D;  1RGY A;  1LLB A;  3IF6 B;  2Y2P A;  4N1X A;  4E3I A;  1TS0 A;  3C4P A;  4HNB A;  1G6A A;  4HP4 A;  4I5S A;  3GMW A;  3SH7 A;  2JKR I;  1ZG4 A;  4JXW A;  2GDN A;  4MBH A;  1NRJ A;  3BFC A;  3HUO A;  3SS5 A;  3EEH A;  3QHY A;  1JWV A;  1K38 A;  2VKS A;  4OPZ A;  5KSC A;  4KZA A;  5DFY A;  5GLB A;  2ZJ9 A;  2ZD8 A;  3F1O B;  4RX2 A;  2HJE A;  2PRF A;  4BL3 A;  3RXW A;  4Y13 A;  5TFQ A;  1H8Y A;  1N9O A;  4M4X A;  4B88 A;  5HW3 A;  5DTK A;  1GSV A;  4EBP A;  1XA1 A;  3ZVT A;  4R6L A;  2CC1 A;  4C3Q A;  3K3D A;  4WEK A;  5TBM A;  4WEJ A;  4WUJ A;  5MC7 A;  1PWD A;  1D7E A;  2GJ3 A;  3FKV A;  1NLY A;  4BMW A;  1Y4O A;  3MQ0 A;  2WAD A;  5HWW A;  3UDX A;  4FH4 A;  3UB9 A;  4Y2F A;  3BQ8 A;  5CTN A;  5HDC A;  2ZQA A;  4LFU A;  1W8Q A;  1K4E A;  3ITA A;  4MEZ A;  4QD4 A;  4H6J A;  1H8M A;  4DKI A;  3PHY A;  2O0Y A;  3QP4 A;  3OCN A;  3NI9 A;  2XH9 A;  3WRT A;  1N9B A;  1XA7 A;  3PBO A;  4GHI A;  1K0K A;  5F1G A;  1BLP A;  1MBL A;  2VZW A;  5AQ9 A;  3OPP A;  2O9B A;  2VLG A;  5JYP A;  3N7W A;  5DFX A;  4LV3 A;  2JCH A;  2M7V A;  2ZC6 B;  4X56 A;  4BL2 A;  4QB8 A;  4I39 A;  1SKO A;  3BRM A;  4BEN A;  3A3E A;  5AVF A;  4WZ4 A;  1S1Z A;  1OTB A;  4JXG A;  4P6B A;  1KGE A;  1N9L A;  4HY8 A;  5I5L A;  5CGX A;  4CLC C;  5HAQ A;  4KUK A;  2HV1 A;  1V9Z A;  3B3X A;  3LIC A;  5EM1 A;  5EOE A;  1WA9 A;  3LYX A;  2ZQ8 A;  4NXG A;  2VA0 A;  1LHY A;  2PU4 A;  3AGD A;  3T12 B;  1IOU A;  2ZM2 A;  1RGZ A;  1D06 A;  3DWK A;  3MKF A;  3V39 A;  4KZ8 A;  3WRZ A;  3UB6 A;  4PKY G;  3CHW P;  3C8C A;  1BLC A;  4OOY A;  3FYZ A;  2I9V A;  4X1M A;  1KE3 A;  4Q0I A;  3NOU C;  3F1N B;  1VEU A;  3VV4 A;  2WAE A;  3IX3 A;  1ONG A;  4EQI A;  3JVU A;  4A5R A;  2YKH A;  1GHM A;  5FEF A;  1X0O A;  2QJ7 A;  2PU2 A;  5DTS A;  3UDF A;  4E3N A;  5HX9 A;  1LSW A;  2EX8 A;  2DMW A;  5EE8 A;  3WS2 A;  1WE4 A;  4UA6 A;  1JWZ A;  3BY8 A;  4LGW A;  2WKR A;  3O5Y A;  1HD8 A;  3VOZ A;  5BOH A;  1YT4 A;  1XX2 A;  4CLC A;  2DRW A;  3MS6 A;  5E2F A;  4ARZ A;  1KE0 A;  4KZ9 A;  3LR5 A;  3PXP A;  3ZNT A;  2PT7 A;  2IWD A;  4EEU A;  1XPB A;  1NYM A;  5FEG A;  4GCZ A;  3EEA A;  4HP9 A;  1CK3 A;  2RCX A;  1PWC A;  4E3K A;  3EOI A;  3NOT C;  2P04 A;  5HD5 A;  1BLH A;  3BM6 A;  3M6H A;  5TBM B;  3IHB A;  1DJB A;  4YNR A;  1FIK A;  3SH8 A;  1F9I A;  1MWR A;  3ZG9 B;  2JN7 A;  4HJ6 A;  4KUO A;  4ETX A;  2VGL S;  1EWZ A;  4MN5 A;  4OQG A;  3KYQ A;  1P9R A;  2ZBB A;  3MJQ A;  5HWT A;  4GNU A;  3MSH A;  4ZJ1 A;  2NUT C;  3DW0 A;  2L1M A;  2Y55 A;  1TD5 A;  1NRF A;  5AJG A;  3W4P A;  2P08 A;  5G4Z A;  4H6J B;  3LCE A;  2ZMV A;  4Y17 A;  2FZ0 A;  1L0D A;  5CHJ A;  1UGU A;  4OOM A;  4MNR A;  1XFQ A;  4GHI B;  1N4O A;  4Z1W A;  5GHX A;  1N9N A;  3DAV A;  1T1C A;  3NEC A;  4JBF A;  1ESI A;  2PHY A;  5TR7 A;  2GZA A;  1G5U A;  4U0T A;  5GL9 A;  1TS6 A;  2HJ9 C;  3S1Y A;  3P01 A;  1SKO B;  2JHE A;  1FSY A;  3UMD A;  2WK0 A;  2J80 A;  3E4Q A;  4MBK A;  3GR2 A;  1HVB A;  1IYS A;  4ME4 A;  5HAP A;  1BTL A;  2VEA A;  3IWO A;  5D3O A;  4O01 A;  3GTC A;  2LB5 A;  4P6Z M;  1OT6 A;  4OP8 A;  4NXB A;  1KOU A;  4ZRR A;  4KQR A;  3Q81 A;  1F2K A;  3VFF A;  1FR1 A;  4BQM A;  4X68 A;  1GSW A;  4N1H A;  4UA7 A;  3W2Z A;  3MXS A;  4ZAM A;  2Y8H A;  1ZTU A;  5EVL A;  4KG6 A;  3BW6 A;  4GDB A;  1ESU A;  2ZQ9 A;  3UE3 A;  4R23 A;  1Y28 A;  3T4L A;  2J9P A;  2V2F F;  3C30 A;  3AGE A;  5FAT A;  2JKT I;  1IYQ A;  1LSX A;  2ZOI A;  3ZQ5 A;  4K0X A;  4KEN B;  3KSI A;  4HHD A;  4WMC A;  3CPT A;  3LID A;  4GDN A;  3N8S A;  4U3T A;  3M2K A;  2DCF A;  1MKM A;  2HP9 A;  4WF0 A;  1KGG A;  4XUZ A;  3NIA A;  2ZM8 A;  4KZB A;  1F98 A;  4IBX A;  1BZA A;  3IH8 A;  5FQQ A;  1XJ4 A;  3OC2 A;  4E3O A;  1XP4 A;  2B02 A;  4CLC B;  3A3F A;  4ARZ B;  2XD1 A;  2JC7 A;  2J9O A;  3HLW A;  3NDE A;  3VOL A;  3N4I A;  4R38 A;  2A49 A;  2EXB A;  2H0T A;  1YLW A;  3GVB A;  3FKW A;  1RCJ A;  3IT9 A;  2XA7 S;  4PM9 A;  3VE3 A;  2Y4A A;  1TDL A;  4DJ2 A;  2DNS A;  2EX9 A;  4NXE A;  3QP8 A;  2J3W A;  1XXM A;  5L8M A;  1Q2P A;  3Q7Z A;  1IFQ A;  3GQZ A;  1TVF A;  1MWT A;  2H0Y A;  3G31 A;  1S1Y A;  2GNX A;  2A2L A;  3LIB A;  5GLA A;  4UAA A;  2Z6D A;  3CMZ A;  5FI6 A;  1JWP A;  2WKE A;  3B47 A;  1FSW A;  3SH9 A;  4Y0U A;  2ZL1 A;  2JKR M;  3KSG A;  1TDG A;  3GDI A;  4JLF A;  1L2S A;  4P87 A;  3GSG A;  1ES2 A;  1XKZ A;  2GX5 A;  4LRY C;  2CMN A;  2ZC4 B;  1GHP A;  3CZD A;  5KMW A;  3IWI A;  3U2A A;  4BD0 A;  1L0G A;  3MZF A;  4DE1 A;  1YMS A;  4LEN A;  5DJT A;  3VP0 A;  3UPP A;  2G2W A;  3T1X A;  3TSG A;  4U0X A;  1MXO A;  3M2J A;  4R1G A;  1FCM A;  2W3H A;  4GD8 A;  5F1F A;  2JKG A;  3LEZ A;  1YLY A;  2HGV A;  1ES4 A;  2VX8 A;  2VGL M;  4S2I A;  2W3G A;  3QP5 A;  2WYX A;  3U4L P;  1S4R A;  3HBR A;  3BWL A;  1K4F A;  1S66 L;  3KX0 X;  3MFX A;  3MXQ A;  2H5S A;  2VV8 A;  3UB5 P;  2ZOH A;  3T4S A;  5J7E A;  3NY4 A;  2XR0 A;  1EI5 A;  2XD5 A;  1AXB A;  3HJK A;  4S2N C;  4HI4 A;  4M3K A;  4Y7P A;  2OOL A;  5CER A;  2KLI A;  1FCO A;  5GHZ A;  1PW8 A;  2ZQ7 A;  2A24 A;  3G35 A;  3RTY A;  3G6O A;  5E2E A;  3CG5 A;  4S2M A;  3CPT B;  2QJ5 A;  4EUZ A;  4P0M A;  1FCN A;  3LIA A;  1MC0 A;  5FDS A;  1PRQ A;  1V9Y A;  3IBJ A;  1YMX A;  1H0M A;  2XQZ A;  5J4E A;  3HUN A;  3A0R A;  1L3L A;  3B33 A;  3R7W A;  1IKG A;  1NYY A;  4JGQ A;  2IWC A;  3HJI A;  4KQO A;  3DBA A;  1P9W A;  1CEG A;  3CUE C;  4E6X A;  2Z2M B;  5HWV A;  1CI9 A;  3E2K A;  5HD3 A;  3G2Z A;  3P7N A;  2NUP C;  4WL9 A;  1T1B A;  5DJU A;  5CEB A;  1TS7 A;  3UE0 A;  3ICY A;  1SZV A;  3TE8 A;  4KZ4 A;  4UA9 A;  4DE2 A;  4S2N A;  3T4K A;  1E4D A;  4DE3 A;  3OPR A;  4EUV A;  4DN0 A;  2V8C A;  3MQQ A;  5KSH A;  1SHV A;  3RFB A;  4IVK A;  3ZVW A;  3E2L A;  3PAE A;  3IWQ A;  4YOF A;  3OOV A;  3SS4 A;  4N9K A;  2X01 A;  4KZ7 A;  3Q7V A;  2W0N A;  1Q2Q A;  3DWZ A;  2Y2L A;  2C5W B;  4DRT A;  1VHM A;  2RL3 A;  2ZL1 B;  3C4O A;  4QPR A;  1W63 M;  2KX6 A;  4FSF A;  3D72 A;  1WYB A;  2FFF B;  2Y2K A;  2WGV A;  3WS1 A;  2K2N A;  3CUE A;  4JF5 A;  2HF6 A;  4KZ5 A;  3A0S A;  2BLS A;  4E6W A;  4L9G A;  1CF0 A;  4FTX A;  4RX3 A;  2Q9M A;  4FCF A;  3T1Q B;  4EES A;  4OLG A;  3T1R A;  3EGX C;  4JXV A;  3DTK A;  2O9C A;  2IA2 A;  5AVE A;  3MZE A;  4CLC D;  2PBD P;  2XA7 M;  4ZBE A;  4IUK A;  1NJ4 A;  1IEL A;  1O7E A;  2ACG A;  4HH2 A;  4Y3I A;  3NDG A;  3V3R A;  4FOF A;  3HLC A;  2BG1 A;  1S67 L;  2OAP 1;  1ZG6 A;  2H10 A;  2Y2J A;  5FAO A;  1YSQ A;  3FC7 A;  5FI2 A;  1LT0 A;  2WGW A;  2UWX A;  4R3J A;  4DMZ A;  3TJZ C;  3S22 A;  4LCL A;  3E98 A;  4JGO A;  4B4X A;  1PIO A;  4D2O A;  1JVJ A;  3HLG A;  3UPN A;  1XJ2 A;  2A24 B;  1AWI A;  4QJG A;  3ZCZ A;  1FR6 A;  2M7U A;  5CRF A;  4EQ1 A;  3PR6 A;  2XDM A;  3V50 A;  2WKI A;  4BBT A;  5E43 A;  1MPL A;  1NZU A;  3E0Y A;  1IKI A;  4JPM A;  1Z09 A;  3ZDJ A;  4Z9Q A;  5LBR A;  4MN6 A;  4G3W A;  1I2W A;  4WM9 A;  2E8J A;  3OPL A;  4CLC E;  3R7W B;  2ZC7 A;  4IVI A;  4BWI A;  4HQA A;  3BFE A;  3UB8 A;  4DXB A;  1XGI A;  4Q0J A;  5EV0 A;  4PM8 A;  5G18 A;  4EBL A;  4OON A;  5DTT A;  4ZJ2 A;  2PDR A;  2P9V A;  3L9K A;  1KE4 A;  4R0Q A;  1ZHH B;  2VGK A;  5EM0 A;  2O9A A;  4HEF A;  4WBG A;  4PM7 A;  1PWG A;  1YLJ A;  2J3T C;  5J3W A;  2PBY A;  4FUW A;  1LL9 A;  1S4S A;  1VQQ A;  3IQA A;  4O0P A;  1ACF A;  2WKH A;  4WLA A;  4HBU A;  1YSP A;  5C5K A;  3IX8 A;  2BTF P;  3JVV A;  5DVA A;  1VM1 A;  3OPH A;  5CED A;  3T4J A;  2MJ6 A;  5EVE A;  5CXW A;  1ERO A;  4HH3 A;  2Y59 A;  2G7U A;  1BLS A;  4C6Y A;  3HVF A;  2PR6 A;  3Q7V B;  4R70 A;  4K91 A;  1TS8 A;  3HCY A;  5L07 A;  3LFV A;  1T18 A;  1K55 C;  4R4R A;  2Y91 A;  5F83 A;  2YKF A;  3M6B A;  4LV0 A;  5HL1 A;  4BBV A;  5CGS A;  4OKP A;  4IUH A;  1DP8 A;  5GLD A;  1PFL A;  4O7D A;  3WWX A;  3TW8 A;  2VK3 A;  3DTM A;  4GKU A;  4I3J A;  4N92 A;  4GS9 A;  2OLV A;  4EWF A;  3G2Y A;  2Y2M A;  1OTI A;  3NOP C;  1K6R A;  4WYY A;  3UB7 A;  1Y54 A;  3VSK A;  3ITB A;  3ZG8 B;  2G2U A;  3W4O A;  4B4Z A;  1E3U A;  5FQM A;  1VEU B;  4KG2 A;  2V9A A;  2XK1 A;  4X53 A;  3P98 A;  3T4O A;  2Q0O A;  5M18 A;  1W7F A;  1HZO A;  2WGW B;  4K08 A;  4X55 A;  2KOI A;  2QWS A;  4WZ5 C;  3MR0 A;  1K55 A;  5FSR A;  1P0Z A;  2EXA A;  1K54 C;  1H3Q A;  2I72 A;  4JXS A;  4YIN A;  3RJU A;  1NLZ A;  1XJ3 A;  1TEM A;  2E8I A;  2P74 A;  4CQH A;  4OVD A;  1BUL A;  3A3D A;  2B95 A;  1K57 C;  3ZFZ A;  2OV5 A;  3K3C A;  2W27 A;  3RXX A;  3NUL A;  2B18 A;  3LR0 A;  4PHT A;  3Q07 A;  4KQD A;  2ZC3 B;  2XLN A;  2OWH A;  3UE6 A;  3CIT A;  3AGF A;  4JF6 A;  4E3L A;  1ERQ A;  1FQG A;  2UV0 E;  1IYP A;  5GLC A;  1VET A;  2EX6 A;  4QHC A;  4II7 A;  5A93 A;  1PI5 A;  4DXC A;  2P9V B;  5FAS A;  3KSF A;  3WS0 A;  2QZ6 A;  3HLB A;  1BSG A;  2R78 A;  3WS4 A;  1JTD A;  2Y2G A;  4ESP A;  1ERM A;  1WYC A;  1LSV A;  1S0W A;  4X25 A;  4NG2 A;  5I94 A;  4WZ5 A;  3G30 A;  4Y15 A;  3QNB A;  4WN5 A;  5TGF A;  4EU0 A;  1K54 A;  5KIZ A;  2XRO A;  4Q8I A;  3ZYT A;  2KDK A;  3D3O A;  4DJ3 A;  3BJN A;  1NZO A;  2Z2L B;  1J9M A;  4O8G A;  5FQJ A;  2EFX A;  3EWK A;  3DTE A;  4B9O A;  2XEP A;  2EX2 A;  1JTG A;  3FWL A;  4H8R A;  4EET B;  2O99 A;  4PM6 A;  5FQI A;  1K57 A;  2W3D A;  3FZC A;  1QMF A;  3HRE A;  4NET A;  4UEY A;  1F5M A;  2ZQC A;  4AFI A;  3V5M A;  4BBU A;  1BT5 A;  3LEQ A;  3H7W A;  3G32 A;  5DF7 A;  3MFD A;  4ZDX A;  3HUM A;  3MKE A;  4BD1 A;  4E3M A;  4S2O A;  1GA0 A;  4EW7 A;  3VP1 A;  4HIA A;  4MMN A;  5E2G A;  3GRJ A;  1GHI A;  1H8Z A;  5EFW A;  4EV4 A;  2ZC5 B;  2Y2N A;  2ZMA A;  1KDW A;  1MWS A;  2W1T A;  5HPF A;  3MXR A;  2HDS A;  3PBS A;  4PMA A;  3QP2 A;  3MMH A;  4B93 A;  5HDD A;  3LGO A;  5GHY A;  1MY8 A;  3H9W A;  5EEC A;  4P85 A;  4OOL A;  2WZX A;  1K25 A;  3LY4 A;  1I5Q A;  4GS9 B;  5F69 A;  5EVI C;  3BY9 A;  1CEF A;  4OQH A;  3ZNY A;  2J7V A;  3IHA A;  5L2F A;  2EWV A;  5HFO A;  4PPR A;  1M40 A;  2HZ5 A;  1XJ6 A;  5FAP A;  1XGJ A;  3VMA A;  1K56 A;  1G28 A;  2OLU A;  3VP3 A;  1PYY A;  5HSQ A;  1OJG A;  1GCE A;  4R4S A;  1OME A;  4FD8 A;  5F5Y A;  3OBF A;  2XF3 A;  2BAS A;  4UHU A;  4D60 A;  3BFD A;  1HTZ A;  1PZP A; 
#chains in the Genus database with same CATH homology
 4Y3I A;  3K2N A;  1MZU A;  4FOF A;  4Z1W A;  4WEL A;  1S67 L;  2ZMF A;  1N9N A;  3CLO A;  1T1C A;  5G4Y A;  2OAP 1;  3FG8 A;  4YWZ A;  2PHY A;  2H28 A;  2GZA A;  2OAQ 1;  5CX7 A;  2W3F A;  4G3V A;  4GJ4 A;  1TS6 A;  2HJ9 C;  5IT5 A;  1YSQ A;  2Z6C A;  3FC7 A;  3OLO A;  3P01 A;  2JHE A;  5DKK A;  1GSX A;  4LRZ E;  5HDS A;  3UMD A;  1LT0 A;  3LI9 A;  2J80 A;  4DMZ A;  3E4Q A;  2QKP A;  3FPV A;  4Q0H A;  3TJZ C;  3E98 A;  4JGO A;  3TRC A;  3S7N A;  4ME4 A;  2VEA A;  4XT2 A;  3IS2 A;  3SW1 A;  5IS1 A;  1XJ2 A;  4O01 A;  2LB5 A;  2A24 B;  3LR4 A;  3NJA A;  1OT6 A;  4P6Z M;  1BYW A;  4NXB A;  1KOU A;  3EQU A;  4ZRR A;  2M7U A;  4R3A A;  4EQ1 A;  3PR6 A;  1W63 Q;  2PR5 A;  1GSW A;  3PBR A;  3LI8 A;  4UQI M;  4BBT A;  3W2Z A;  2Y8H A;  4P6Z S;  2V0U A;  2PYP A;  1ZTU A;  3PBN A;  3BW6 A;  3E0Y A;  1ODV A;  2VV7 A;  2PD7 A;  3H82 A;  3UE3 A;  4G3K A;  2M1C A;  5LBR A;  1Y28 A;  3T4L A;  3C30 A;  4MN6 A;  4G3W A;  5IU1 A;  2JKT I;  4LPZ A;  3C2W A;  3MQO A;  1LSX A;  2ZOI A;  4I38 A;  4CLC E;  3R7W B;  3T50 A;  2L0W A;  3ZQ5 A;  1JNU A;  2OWJ A;  3KSI A;  4HHD A;  1T1A A;  4HQA A;  4JGR A;  4BWI A;  4PKY A;  3UB8 A;  3LID A;  3S7P A;  3CAX A;  1OTD A;  4Q0J A;  4HOI A;  1MKM A;  3EQV A;  4L9F A;  4WF0 A;  1P97 A;  2XRN A;  4RQ9 A;  1DRM A;  3LIF A;  2PDR A;  4LLO B;  3PYP A;  3T4T A;  2W1R A;  1ZHH B;  4PAU A;  1F98 A;  1OJ5 A;  1OTA A;  2O9A A;  1YKD A;  3F1N A;  2Y79 A;  5F68 A;  3LR3 A;  4HJ3 A;  2J3T C;  5J3W A;  4EER A;  5K5B A;  1XJ4 A;  3B42 A;  4NXF A;  4BJP A;  1S4S A;  3OC2 A;  4HJ4 A;  4O0P A;  4WLA A;  2K7S A;  1YSP A;  2B02 A;  1TS0 A;  5C5K A;  4CLC B;  4GW9 A;  3JVV A;  4ARZ B;  4HNB A;  1UWP X;  4HP4 A;  4I5S A;  3H7W B;  2MJ6 A;  3T4J A;  2P7J A;  4HH3 A;  2JKR I;  4E04 A;  2G7U A;  3VOL A;  1NRJ A;  2PR6 A;  4R38 A;  4IJG A;  4R70 A;  3EEH A;  2W1T B;  2XA7 S;  2VKS A;  3VE3 A;  1TS8 A;  5DFY A;  4DJ2 A;  3HCY A;  4NXE A;  4MN7 A;  3LFV A;  2J3W A;  1T18 A;  3F1O B;  2HJE A;  5L8M A;  2YKF A;  2PYR A;  1IFQ A;  5FL3 A;  3F1P A;  3LIE A;  3FPW A;  3S7O A;  1N9O A;  4M4X A;  4NKP A;  4BBV A;  5DF9 A;  1GSV A;  1S1Y A;  2GNX A;  2A2L A;  3LIB A;  4IUH A;  1DP8 A;  1XFN A;  3KO6 A;  4R6L A;  2Z6D A;  4EXO A;  3K3D A;  4WEK A;  4L0L A;  5TBM A;  4WEJ A;  3RH8 B;  4WUJ A;  3B47 A;  3TW8 A;  5MC7 A;  3GEC A;  1D7E A;  4I3J A;  2JKR M;  3KSG A;  2PD8 A;  3GDI A;  4GS9 A;  2GJ3 A;  2K31 A;  4Y5F A;  5F6A A;  4NEE D;  3BQA A;  1NLY A;  1OTI A;  2LB9 A;  4BMW A;  3NOP C;  3ULF A;  3MQ0 A;  2VV6 A;  3UB7 A;  5HWW A;  3S7Q A;  1NWZ A;  3UB9 A;  2GX5 A;  4LRY C;  4Y2F A;  3BQ8 A;  2L4R A;  4F3L A;  5HDC A;  4UQI S;  2CMN A;  2V9A A;  3A0V A;  4H6J A;  1H8M A;  3T4O A;  1UWN X;  3U2A A;  3PHY A;  3PBQ A;  5HZH A;  2O0Y A;  3OCN A;  5DJT A;  4K08 A;  3PBO A;  4GHI A;  2KOI A;  2QWS A;  3MR0 A;  2W3H A;  2VZW A;  1P0Z A;  1DP6 A;  2O9B A;  1H3Q A;  2VLG A;  4XT2 B;  2HGV A;  3IS2 B;  4I3I A;  5DFX A;  2VX8 A;  2M7V A;  2VGL M;  1NLZ A;  1LL8 A;  2W3G A;  1XJ3 A;  2W3E A;  1S4R A;  4I39 A;  1YAX A;  3BWL A;  3KX0 X;  1S66 L;  3MFX A;  5AVF A;  4CQH A;  3OCL A;  3MXQ A;  2VV8 A;  1S1Z A;  2ZOH A;  3T4S A;  1OTB A;  3C38 A;  2J3T D;  5J7E A;  1N9L A;  3K3C A;  2W27 A;  2JKT M;  3H82 B;  3HJK A;  4HI4 A;  2B18 A;  3LR0 A;  4HY8 A;  5I5L A;  2OOL A;  4PHT A;  2KLI A;  5DKL A;  4CLC C;  4KUK A;  3MF0 A;  2HV1 A;  4KQD A;  1EW0 A;  1VB6 A;  1V9Z A;  2A24 A;  2INW A;  3LIC A;  2OWH A;  3RTY A;  3G6O A;  1WA9 A;  3LYX A;  3UE6 A;  4NXG A;  3CIT A;  2VA0 A;  1IOU A;  2QJ5 A;  1D06 A;  4II7 A;  3UB6 A;  3UME A;  4PKY G;  3LIA A;  3C8C A;  1MC0 A;  1DP9 A;  2WKQ A;  3KSF A;  2I9V A;  1V9Y A;  3IBJ A;  4JGP A;  2V1B A;  4Q0I A;  3NOU C;  2R78 A;  5J4E A;  3F1N B;  3A0R A;  3B33 A;  1LSV A;  3VV4 A;  3CI6 A;  3R7W A;  4EEP A;  5A8B A;  3R4K A;  4WN5 A;  2V1A A;  4ETZ A;  4JGQ A;  4EU0 A;  3HJI A;  4KQO A;  3PBT A;  3DBA A;  1P9W A;  5KIZ A;  4I3A A;  3VE4 A;  2XRO A;  3JVU A;  2YKH A;  3ZYT A;  3CUE C;  2KDK A;  3D3O A;  4DJ3 A;  3BJN A;  1X0O A;  5HWV A;  2QJ7 A;  4O8G A;  5HD3 A;  3EWK A;  3P7N A;  5TJJ A;  2NUP C;  1LSW A;  4WL9 A;  4B9O A;  3LUQ A;  2DMW A;  1G6O A;  1T1B A;  5DJU A;  2EWW A;  1TS7 A;  3E4O A;  4EET B;  3BY8 A;  4L9E A;  2O99 A;  3ICY A;  3TE8 A;  2WKR A;  3O5Y A;  2W3D A;  2V0W A;  4UEY A;  1TF1 A;  3T4Q A;  1F5M A;  3T4K A;  2EA9 A;  4AFI A;  4CLC A;  4EUV A;  4DN0 A;  4BBU A;  4ARZ A;  2VJW A;  3MQQ A;  5KSH A;  3H7W A;  3KYZ A;  3RFB A;  3IBR A;  3LR5 A;  3PXP A;  2PT7 A;  3KSH A;  1T19 A;  4EEU A;  3F1P B;  1OPX A;  4EW7 A;  2QHK A;  3NHQ A;  4HIA A;  4MMN A;  4YOF A;  3OOV A;  5EFW A;  5HL6 A;  4GCZ A;  3CWF A;  3EEA A;  4HP9 A;  3EOI A;  3NOT C;  4IHQ A;  2W1T A;  2P04 A;  3E4P A;  5HPF A;  5HD5 A;  2W0N A;  4LRX C;  3PBS A;  3MMH A;  4B93 A;  5HDD A;  5TBM B;  3H9W A;  4MDZ A;  1VHM A;  3F1O A;  4OOL A;  4YNR A;  1F9I A;  4GS9 B;  5F69 A;  3BY9 A;  4QPR A;  2JN7 A;  2XSS A;  4HJ6 A;  1W63 M;  2KX6 A;  4KUO A;  4FSF A;  4ETX A;  2VGL S;  4MN5 A;  3D72 A;  3KYQ A;  1P9R A;  2ZBB A;  3MJQ A;  1OT9 A;  5HWT A;  4GLQ A;  1OTE A;  2EWV A;  2K2N A;  2D02 A;  2NUT C;  3CUE A;  2HF6 A;  2L1M A;  3EGD C;  3A0S A;  4F3L B;  5HPI A;  1TD5 A;  5AJG A;  4L9G A;  1XJ6 A;  1STZ A;  2D01 A;  2P08 A;  5G4Z A;  4H6J B;  4EES A;  2FH5 A;  2QYB A;  1G28 A;  2ZMV A;  3EGX C;  5HSQ A;  2FZ0 A;  2O9C A;  1OJG A;  4MCW A;  2IA2 A;  5AVE A;  1UGU A;  4CLC D;  2XA7 M;  4OOM A;  3OBF A;  5F5Y A;  3V67 A;  4IUK A;  1XFQ A;  2BAS A;  4GHI B;  2WKP A;  4HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...