2W0NA

Plasticity of pas domain and potential role for signal transduction in the histidine-kinase dcus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GHMGLEPYEISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRLLLINTVPVRSNGVIIGAISTFRDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity of the Pas Domain and a Potential Role for Signal Transduction in the Histidine Kinase Dcus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords SENSOR PROTEIN DCUS
total genus 12
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w0nA00
5AVFA 2GJ3A 2V1BA 2PR6A 3LIAA 4NXBA 5DJTA 4L9GA 2CMNA 3UMEA 1EW0A 3UE6A 3E4QA 1N9NA 1DP9A 3LI9A 2PD8A 3LIBA 2W0NA 4M4XA 4JGPA 4H6JB 2D02A 1TS0A 3LICA 4WUJA 3H7WA 2V0UA 1OT6A 1TS8A 5G4YA 1WA9A 3LUQA 5DKKA 4HH3A 3F1NA 4I3AA 4HY8A 2K7SA 1S1YA 5DKLA 4HNBA 5HWWA 3E4OA 1S67L 4HP4A 4HH2A 2QJ7A 4EESA 3IS2B 3BWLA 2EA9A 2VV7A 1GSVA 1V9YA 2WKQA 4LLOB 3RH8B 1XJ3A 1LSWA 4PKYA 4WL9A 3H9WA 1LT0A 3BY9A 1DP8A 3F1OB 2OWJA 1V9ZA 1T19A 5HSQA 4HHDA 3G6OA 3A0RA 1F98A 2ZOHA 3CAXA 3FG8A 1UWPX 4GS9A 1OTDA 3RTYA 3ZQ5A 2A24B 2WKRA 5J4EA 3UMDA 3VE4A 2Z6CA 2VLGA 2V1AA 2ZBBA 5IS1A 2PD7A 3ICYA 3MXQA 3UB6A 4EERA 1OTEA 3C2WA 1T1CA 4HOIA 1N9OA 1OT9A 5TBMB 3B33A 3SW1A 3LI8A 4HJ4A 4L9EA 4I3IA 3P7NA 4GHIB 1TS6A 1ODVA 3MR0A 1XJ6A 3OLOA 4YWZA 4BBVA 4R6LA 3H82A 5AVEA 3F1PB 5DJUA 3NHQA 5G4ZA 2BASA 3E4PA 4KQDA 1T1BA 1S1ZA 2JHEA 2J80A 4KUOA 4EEPA 5HDCA 3EEHA 3MFXA 4HIAA 5F6AA 4LPZA 1Y28A 2YKHA 3UB8A 3ULFA 4I38A 4B9OA 4MN6A 3A0SA 3BY8A 2PR5A 3CLOA 2JN7A 3H7WB 4R3AA 4EQ1A 4I5SA 1VB6A 1D06A 4F3LA 2QKPA 2Z6DA 3HJIA 4R38A 3GDIA 3PYPA 4NXGA 4EXOA 2B02A 3HJKA 2ZOIA 2D01A 1T1AA 5EFWA 3T50A 1KOUA 1XJ4A 2L4RA 3IS2A 3LIFA 3MQOA 4PKYG 2L1MA 1OTBA 1UGUA 2PDRA 3CWFA 4GHIA 4XT2A 2V9AA 5HWVA 4NXFA 2I9VA 2QHKA 3FC7A 3D72A 3F1OA 3LIEA 1X0OA 2VEAA 3MJQA 2KDKA 1D7EA 3A0VA 4GS9B 4JGRA 1OTIA 1T18A 4HI4A 4MN5A 4NXEA 2W27A 5HDDA 1JNUA 3LYXA 4BBUA 5J3WA 4EEUA 3C8CA 5I5LA 5F5YA 2WKPA 3NJAA 3NOUC 4E04A 2P7JA 4EW7A 1N9LA 2OWHA 2VV8A 4H6JA 4DJ2A 1OJGA 2PHYA 4KUKA 2M1CA 2INWA 3NOTC 3VOLA 2H28A 1OTAA 1S4SA 4L9FA 1S66L 1XFQA 3GECA 3F1NB 2PYPA 2VV6A 3H82B 1DP6A 3K3CA 3NOPC 4I39A 3F1PA 1G28A 4HJ6A 5F69A 4WF0A 4BBTA 4JGQA 2PYRA 3KX0X 4HQAA 4GCZA 1TS7A 2OOLA 1UWNX 2HV1A 1NWZA 3MQQA 1P0ZA 3UB7A 3UB9A 2V0WA 1LSXA 1LL8A 4DJ3A 4R70A 4F3LB 4WLAA 5F68A 4EETB 1LSVA 2QJ5A 4I3JA 1P97A 5J7EA 3VE3A 4HP9A 4HJ3A 1OJ5A 2L0WA 1F9IA 1MZUA 2YKFA 1GSWA 3LIDA 4LRYC 5HD3A 1S4RA 2A24A 2KX6A 4LRXC 3EWKA 2QWSA 4JGOA 4K08A 5HZHA 5A8BA 5HD5A 5HWTA 5HDSA 1GSXA 4XT2B 3IBRA 4RQ9A 4WN5A 4LRZE 1XJ2A 5TBMA 1XFNA 3K3DA 5KIZA 2R78A 1DRMA 5IU1A 1BYWA 4GW9A 3PHYA
chains in the Genus database with same CATH superfamily
1E25A 3NCKA 2PR6A 2G2UA 2FFFB 2K31A 2HJEA 3EQUA 3E4QA 3VP2A 1IYPA 4FSFA 4H6JB 1NXYA 2ZQ9A 3T4JA 3NY4A 5GHZA 2J8YA 1S1YA 3N8RA 2UV0E 3IWQA 1S67L 5DFXA 3ZG0A 3NBLA 4OOLA 1LSWA 3WS4A 2OWJA 3S7PA 4DE2A 1W7FA 2ZC3B 2Y59A 3ZQ5A 3FG8A 2GDNA 5FL3A 5M18A 3SW1A 1NY0A 4FTXA 3N7WA 4PAUA 4JXGA 3VFFA 3NHQA 2J80A 5EPHA 2WGWB 2PR5A 2VJWA 4IVIA 2J7VA 5E43A 4IBXA 2PBYA 1PWCA 1E3UA 1KOUA 1AXBA 3JYIA 5KZHA 2I9VA 4MEZA 3IX3A 5EVIB 3S7OA 5J3WA 4LV3A 1N9LA 2PAVP 2ZC5B 3F1NB 1MWTA 3K3CA 3F1PA 2ZMVA 4O01A 1P0ZA 1ZG4A 4DE1A 3SOIA 3FYZA 4HJ3A 3BM6A 2A24A 2HPBA 2Z2LB 3P09A 4X55A 5HD5A 5DFYA 3Q7VB 2R78A 2KLIA 4QWOA 4IUHA 4Y3IA 1NRJA 1BLCA 4KZ7A 1N9NA 1KE4A 4RX2A 2IWDA 4X53A 3NC8A 1TS8A 3UB5P 3UN7A 3E2KA 1W63Q 3FV7A 5FAQA 4E3LA 2PU2A 2O9AA 4GOGA 3PXPA 1F5MA 3LR3A 1MPLA 2XROA 5IHVA 3CAXA 2JKGA 4KG6A 1OTEA 5TBMB 3LI8A 4E6WA 4ETXA 4R3BA 2JHEA 3VV4A 3UB8A 1G6OA 3ZVWA 1XX2A 3FKVA 4R3AA 3H7WB 1LL5A 5E2GA 2HZ5A 4NETA 1W79A 3GSGA 1PNEA 1S0WA 4Q8IA 4O0PA 4OQ0A 3CWFA 5AJGA 2XFSA 2ZLYA 5TR7A 4CJNA 2P7JA 4KZ5A 4H6JA 4R3JA 1MWRA 2R9XA 4HBTA 5FI2A 5EM0A 2M7VA 1OPXA 4UA6A 3LEQA 4QY6A 2R9WA 1RGYA 1Y4OA 4LRXC 4LCMA 2EXBA 5CGXA 4EWFA 4S2IA 5CTMA 4ME4A 1BLSA 1STZA 5MC7A 3T4OA 3BFEA 2EWWA 1JWPA 4M4XA 4ESPA 1N4OA 3CPTB 1OT6A 2K7SA 2XD5A 3GRJA 4WM9A 4IHQA 3IXBA 2WKQA 2EXAA 1DP8A 1V9ZA 2EX9A 2BG1A 4BL3A 4UAAA 1XGIA 3OPLA 1YLJA 2VGJA 4JF4A 3HLBA 1N9OA 2H10A 5FAPA 1MC0A 4KG5A 1H8YA 4S2NC 4C3QA 5GLBA 5DJUA 3QP4A 2OLVA 5FQKA 4OLGA 2VGLS 4I38A 2O99A 4AFIA 3T50A 2ZOIA 3UPOA 1DJCA 2Q9MA 4XT2A 2V9AA 4GDNA 3FC7A 1K57A 1X0OA 4P6ZS 2HDUA 1D7EA 3FPWA 2OWHA 2WAFA 1NLYA 4H8RA 2Y2KA 2P08A 4PM6A 2M7UA 1W5DA 3VE3A 1GCEA 2DCFA 4WZ4A 3WRZA 2YKFA 4L0LA 4DE0A 2KX6A 4NG2A 1XA7A 2XSSA 4X69A 1KGEA 2B95A 5GLCA 4RQ9A 4BD1A 4X6TA 2ZM0A 1BYWA 3PHYA 2Y79A 4JXVA 1PI5A 2ZQ8A 2ZMAA 4WMCD 3RFBA 4LFUA 2XD1A 3S7NA 1VEUB 4IBRA 3H7WA 3CUEA 2Y2OA 1JVJA 5FI7A 5HPIA 1CQAA 5HWWA 3Q1FA 4U3TA 1TVFA 3A3DA 3AGDA 3OPPA 3VFHA 5GHYA 1UWPX 5CGWA 3UMDA 2JC7A 2PD7A 3AGFA 3C2WA 1GHIA 1L0DA 4S2JA 5BOHA 1ES3A 3OLOA 4LCLA 2Y2MA 5HDCA 3MFXA 2ZQAA 3DTKA 2JE5A 4I5SA 4KZBA 4MCWA 3VP0A 3PAGA 5HPFA 4N9LA 1KVMA 1IYQA 2D01A 4D60A 2L4RA 3LIFA 4K0WA 2L1MA 2DNSA 2VGKA 1NJ4A 3CUEC 3A0VA 2A49A 1K4EA 3LYXA 3HLEA 1K55A 5FQQA 2J9OA 3JVVA 5F1FA 3VP4A 4PPRA 3R4KA 5C5KA 3TJZC 3CPTA 4YOFA 1FSYA 5F69A 1DJAA 2OOLA 3IXGA 3CI6A 3IH9A 2W1RA 3K2NA 3NIAA 5F68A 2ZC7A 5E2EA 4EETB 4OH0A 1F9IA 4EBNA 3MBZA 3Q81A 1FQGA 1K0KA 4WMCA 3GQZA 4GHIA 1E3UD 1O7EA 2J9PA 4OOMA 3S22A 5DJTA 1XPBA 3UE6A 3LIBA 1CI8A 1TS0A 1YMXA 4WUJA 3EGDC 4B4XA 5HX9A 4X68A 5DKKA 1MKMA 2W1TB 1G6AA 4I3AA 4WELA 5DKLA 5DF7A 2OSUA 3VP3A 4GKUA 4Z1WA 3BWLA 4ZDXA 2WUQA 3V67A 3V5MA 3M6HA 3F1OB 2H0YA 4R4RA 4R1GA 4U0TA 5CEBA 1PZPA 4EERA 1EWZA 1K56A 1Z6FA 4R6LA 3MQ0A 4FUWA 4KUOA 4N1XA 4OQIA 3WS1A 4B93A 4EBPA 4DE3A 3B47A 3HJIA 2W3FA 4X25A 4UQIS 2O9CA 1JWZA 2XGNA 3D72A 4KZ8A 4FOFA 4CLCE 3PBNA 3V50A 4ARZA 3BJNA 1IYSA 3KYEA 2Q0OA 2OLUA 3HLFA 3KYQA 2INWA 2H28A 1H8ZA 3H82B 2V20A 1DP6A 3OPRA 4DDSA 3UE3A 3EGXC 1MWSA 4F3LB 4WLAA 2JKRM 1MZUA 1IYOA 2E8JA 3T4LA 4JGOA 1H8MA 4DRTA 3TG9A 5AVFA 4ZJ1A 2GNXA 2OAQ1 3S7QA 2PU4A 1MKIA 3QP8A 1CJFA 3LI9A 4P0MA 1FR6A 4G3VA 5CEDA 2VGLM 4N9KA 5EUAA 3E4OA 1AWIA 2Y4AA 3OCNA 4KQOA 4LLOB 5IT5A 4DN0A 3BY9A 3OCLA 3A0RA 1K38A 4P6ZM 4DDYA 2WKRA 2VX8A 1ODVA 4BBVA 1XJ6A 5G4ZA 4OPQA 3TRCA 2YKHA 3ULFA 4CLCD 4B9OA 1VB6A 1FOFA 3IWIA 4ZBEA 3FZCA 3MFDA 4WBGA 3SS5A 1CK3A 1ERMA 2WKHA 4OPZA 1Y54A 1CEGA 4D2OA 2KDKA 1IKIA 4QPRA 5A92A 3MS6A 3DTMA 1L0GA 1FILA 4OPYA 4E04A 1LI9A 3MKFA 1OJGA 4KUKA 4UA7A 4Y2FA 1XFQA 4I39A 4FH4A 1LLBA 1K54A 2XK1A 3P98A 2IA2A 3M6BA 3LIDA 4CQHA 1FSWA 3HLDA 3TE8A 3HLCA 2Y2IA 5EM1A 5EVEA 5HWTA 5FDSA 3L7HA 3CG5A 1XJ2A 3DTEA 2V1BA 3E2LA 4NXBA 3B3XA 1PI4A 2IWBA 3PBTA 3V3SA 4EV4A 3LR0A 2VA0A 3FKWA 5G4YA 4ETZA 3NECA 3GTCA 3MZEA 3HREA 5FEGA 1PWGA 4IUKA 3H9WA 3CZDA 3BRMA 1IEMA 2A2LA 2JBFA 2EX6A 3G6OA 4GZBA 3MF0A 1XXMA 4ARZB 1KDWA 2Z6CA 2V1AA 4WEKA 3KSIA 4OP8A 2QYBA 3V39A 3MR0A 3IWOA 4HESA 4MBHA 3H82A 1YLTA 2HDRA 1PYYA 3F1PB 2BASA 1T1BA 1S1ZA 3T1RA 5IS1A 3EEHA 3ITBA 1ZC2A 4MN6A 3A0SA 4F3LA 2Z6DA 5DVAA 4HBUA 4UA9A 4S2KA 3PAEA 3UDIA 3RJUA 1SCWA 2W3DA 1WE4A 3Q7VA 4E3MA 1U60A 1I2SA 1TDGA 4JKTA 5HAQA 1ES2A 2HDQA 1TDLA 1PFLA 2OAP1 4WZ5A 3W4OA 2PYPA 3G4PA 4QB8A 2PYRA 3KSGA 4GCZA 1UWNX 2PBDP 3KYZA 2DMWA 2Z2MB 3B42A 1ONGA 3OZHA 4Y15A 3T1SA 5HZHA 4QY5A 3ZG8B 1GHPA 1N9BA 5TBMA 4LRZE 5KIZA 1JNUA 4IVKA 4KZ3A 4BENA 2DRWA 4DKIA 5CTNA 2W0NA 4G3KA 3UO9A 4OPRA 1MBLA 1YMSA 3T4TA 1K57C 3N8LA 4LV1A 1ESUA 3EEAA 4HP4A 4EESA 4Z9QA 1V9YA 2XEPA 3C5AA 1SHVA 5EVIC 1LI0A 4P85A 2WGVA 1YLWA 4UEYA 5L07A 4PM9A 1A0KA 5EVID 4QJGA 2ZM2A 1BSGA 2E8IA 5DTTA 2J3TD 3E4PA 3DW0A 4PM7A 4KENB 3C30A 3KSHA 3LR5A 4R38A 3SH7A 1OMEA 5EECA 4KZAA 4MDZA 3ZVTA 2P04A 1VHMA 2QHKA 1YT4A 2ACGA 4QHCA 4BBUA 3ZHHA 2XR0A 4KZ9A 4JXWA 1JWVA 3PR6A 5I5LA 2WKPA 3TOIA 3QNBA 3LY3A 4S2PA 3GECA 1HD8A 2WGIA 1I2WA 1ZKJA 3UB7A 5CERA 5FQMA 3OOVA 4HP9A 1L0FA 4LRYC 3A3EA 3LGOA 2P74A 5FSRA 3I7JA 2O0YA 1JTDA 3NULA 4B4ZA 3QP5A 5HDSA 2JKTM 2P9VB 3BYDA 4R4SA 4GW9A 4JLFA 3LIAA 1F2KA 2O9BA 1PZOA 2D02A 3HUOA 3GR2A 4GD8A 3LUQA 5HARA 5A93A 4OLDA 1PIOA 1RGZA 2Y55A 3RXWA 1JTGA 4E3KA 3RH8B 3EOIA 5AQAA 4WL9A 4BLMA 5HAPA 1IELA 1YLYA 3E0YA 3OPHA 1M6KA 2WADA 3MXQA 3IF6C 4C75A 3MMHA 3NDEA 1SKOA 3N4IA 4L9EA 3PTEA 1YSPA 1ZTUA 4I3IA 1TS6A 2ZJ9A 5AVEA 1KDSA 3IF6A 4DMZA 4Y17A 5F6AA 5FATA 2ZQCA 5A90A 2C6WB 1YPRA 4Q0IA 3U2AA 1D06A 3N6IA 2ZC4B 3O3VA 4E3IA 2B02A 1XJ4A 3A3JA 4CLCC 3G34A 3MSHA 1YAXA 3LIEA 5L2FA 4HI4A 3IXDA 1HZOA 3NOUC 1CEFA 4NK3A 2PHYA 3BFFA 1IOUA 2HGVA 2WKIA 2ZQ7A 4S2OA 2EWVA 4ZAMA 3HBRA 2WK0A 3KX0X 4UHUA 1TS7A 1VM1A 2RCXA 3UB9A 4U0XA 1LSXA 2HP6A 1P97A 5TJJA 4OOYA 1IFQA 2X02A 3HVFA 3T1QB 3CHWP 4WN5A 1PRQA 5EV0A 1WYBA 2GJ3A 1J9MA 2CMNA 3EQVA 3Q07A 4OKPA 3ZNTA 3MXSA 2WZZA 4FH2A 1YQSA 4MBFA 4RX3A 4HY8A 5EE8A 2VK3A 3T1XA 4WEJA 2H5SA 5AQBA 1H0MA 5CRFA 5FI6A 1M40A 2C5WB 3P7NA 5AQ9A 5F1GA 2XFTA 3O88A 4WZ5C 3VSLA 4EEPA 1K55C 4YNRA 3G32A 3BY8A 2V2FF 4BL2A 3UE1A 5CHJA 2QKPA 4RYEA 3SS3A 3M2JA 4MMNA 3MQOA 3IS2A 1QMEA 1OTBA 1UGUA 2FH5A 2Y2GA 3MJQA 2WAEA 4EU0A 4X56A 5F5YA 2XDMA 4EW7A 3QP1A 1ONHA 3IT9A 3HCYA 3GV9A 4A5RA 3VP1A 1P9WA 1G28A 2JKFA 4O8GA 3KO6A 3HUNA 2Y2QA 2HV1A 2W3GA 1KE3A 1NYYA 4R70A 1LSVA 2VZWA 4Y13A 1EROA 2L0WA 3M2KA 2W3EA 1H5XA 4II7A 3FPVA 3VSKA 1SKOB 4OP5A 3K3DA 4OQHA 1DRMA 5AQ7A 2KOIA 4JXSA 3UMEA 5JYPA 4JGPA 2ZL1A 4QD4A 1W63M 3BQAA 2UWXA 4YINA 1GA9A 3O5YA 3HLWA 2EA9A 5FQIA 1LT0A 3CMZA 5GLDA 3C7VA 3ZDJA 3ZCZA 3ICYA 1T1CA 1ZG6A 4JPMA 4PM8A 4XUXA 5L8MA 4OVDA 2HDSA 4PM5A 4RA7A 3TW8A 4EQ1A 5KSCA 1FCMA 3L9KA 3Q82A 4S2MA 1L0EA 2EX8A 5EVLA 3VOYA 1W8YA 3W2ZA 4ZTKA 2ZM8A 3ISGA 5D3OA 3C8CA 3NJAA 1ESIA 1C3BA 3NOTC 1G68A 2BLSA 1GA0A 4JBFA 2V1ZA 4S2NA 5GL9A 1S4SA 2ZC6B 1S66L 5EOEA 1VETB 3DBAA 2HF6A 5E2HA 5U47A 2WGWA 1WYCA 1SDEA 2QJ5A 5FQJA 1ERQA 4ZJ2A 3DAVA 3PBQA 3MZFA 2QWSA 4K08A 3C7UA 3IH8A 4KZ6A 4E3NA 1XFNA 2Y2LA 5G18A 1NYMA 5EVIA 1H3QA 4EQIA 4Y5FA 2PD8A 5L09A 4GD6A 3O86A 4GDBA 3JVUA 2ZQDA 3LY4A 1XJ3A 3S4XA 3G30A 3D9YA 1D1JA 5DTSA 2FFYA 2ZOHA 5HAIA 3QP2A 2J3TC 3MKEA 2ZBBA 2QZ6A 2G2WA 3DWKA 4O7DA 4Q0HA 4ZJ3A 1K25A 2QPNA 1KGGA 4LV0A 2XQZA 1HVBA 3UNWA 4Y0UA 2Y2NA 3GDIA 5LBRA 2GX5A 1O07A 4GB7A 4IEDA 3C38A 5CECA 1DJBA 4EEUA 2W3HA 5CX7A 5M19A 3S1YA 1LHYA 2AVXA 3WWXA 2VV6A 4PHTA 4WF0A 3T4KA 4JGQA 1NWZA 3MQQA 4N1HA 1PWDA 1GHMA 3SH9A 3CITA 1MXOA 3PBSA 1FCNA 3IX4A 5HD3A 3GMWA 4UQIM 3NDGA 3WRTA 1S6RA 3IBRA 3Q7ZA 5DTKA 1ACFA 4N92A 3O87A 1FR1A 2I72A 2WKEA 3DWZA 5JYOA 2MJ6A 2XH9A 4X1LA 5I94A 3LICA 4K91A 2V8CA 3UDXA 4HH2A 2QJ7A 4P6BA 5GLAA 4PKYA 3HUMA 4IJGA 2QMIA 4BQMA 3RTYA 1F98A 5HL6A 4OONA 3BW6A 1OTDA 3ZYTA 3IXHA 3VE4A 2PRFA 2VLGA 2Y2PA 1KVLA 1YKDA 3UB6A 1PW1A 3G2ZA 2JCHA 5HFOA 1E4DA 3IBJA 1VETA 1NRFA 3DTIA 1BZAA 5DF8A 2H0TA 2Y2JA 4EUZA 1I5QA 4NXGA 4EXOA 2EX2A 4PKYG 4QU3A 2CC1A 5HWVA 5TFQA 3GVBA 4GS9B 3W4QA 2LB9A 1T18A 4MN5A 1Q2PA 5J8XA 1IKGA 1LL9A 2IWCA 3HLGA 2Q9NA 3VOLA 2X01A 3WS5A 3NOPC 4ID4A 4HJ6A 4BBTA 5FASA 3LFVA 4M3KA 1YLZA 3P01A 3TSGA 2FZ0A 2X71A 5J7EA 1K4FA 2BTFP 1NZOA 4P87A 1GSWA 1GSXA 4XT2B 4R23A 3W4PA 3T4SA 5KSHA 3G35A 4L9GA 5HW3A 1ZHHB 2WYXA 1KE0A 1DP9A 4E3OA 2XRNA 3SH8A 3ZG5A 3BFCA 2VV7A 4B88A 1BTLA 1BT5A 1GSVA 1TF1A 1L3LA 2WZXA 3IQAA 3D3OA 4GJ4A 5FEFA 2Y91A 1K54C 3PBRA 1OT9A 2XLNA 4ZRRA 4WYYA 1ES5A 3MZDA 4C6YA 4LENA 2Y2HA 3QHYA 4DXCA 1VEUA 3D4FA 2JN7A 3N8SA 2VKSA 5DF9A 3FWLA 4LGWA 2XA7S 1MWUA 2ZMFA 3ITAA 3BEBA 4CLCA 5FAOA 2EFUA 2PDRA 5K5BA 1TEMA 2P9VA 3OBFA 4Y7PA 4G3WA 2VEAA 4JGRA 3PBOA 5HDDA 4Q0JA 4DXBA 1BLPA 2M1CA 3LR4A 4GN2A 4KQRA 3C4PA 5TGFA 3UY6A 4PMAA 4JF6A 4HQAA 3BQ8A 3ZG9B 3AGEA 1K6SA 1LL8A 3V3RA 3A3FA 3WS0A 1OJ5A 1EI5A 2RL3A 1L2SA 1S4RA 2JKRI 4EBLA 4E3JA 5A8BA 1FIKA 1G5UA 2J3WA 4KZ4A 3E98A 1ALQA 5M1AA 3T4QA 3IF6B 3UDFA 5CXWA 2K2NA 5CHUA 3KSFA 4HEFA 1WA9A 5CGSA 4HNBA 3T12B 3WS2A 3SS4A 5EOOA 1W8QA 3RXXA 1FCOA 1T19A 3MXRA 5HSQA 4GS9A 4R0QA 5J4EA 4JF5A 1RCJA 3R7WA 1J3WA 2JKTI 3LCEA 4GHIB 4YWZA 3VMAA 1XKZA 4KQDA 2V8FA 3A3IA 5L10A 4HIAA 4LV2A 1Y28A 5E2FA 4FD8A 3IX8A 4E6XA 2W1TA 4KQQA 4FCFA 2G7UA 4S2LA 4GLQA 3HJKA 1T1AA 2HP5A 2NUPC 3ZG7B 1K6RA 1PW8A 1XGJA 1YSQA 1HLUP 4Y0OA 2HP9A 3F1OA 4EUVA 1TD5A 3JPUA 5A91A 1OTIA 4NXEA 2W27A 4KG2A 2XA7M 2VV8A 2GZAA 2OV5A 4K0XA 1OTAA 1MY8A 1Q2QA 4GNUA 1P9RA 4L9FA 3G31A 4F94A 3LO7A 1HTZA 1CI9A 5FA7A 4DJ3A 3CJMA 3BLMA 4CPKA 3BLSA 1SZVA 1BUEA 3EWKA 1NLZA 1BLHA 5F82A 2B5RA 3C4OA 4MNRA 3OC2A 5IU1A 3QP6A 4BD0A 5F83A 4MBKA 4NKPA 1EW0A 3UPNA 1SDNA 3LEZA 4RVAA 2V0UA 1YM1A 1RP5A 4BMWA 4MN7A 4HH3A 3F1NA 3UE0A 1DY6A 3U4LP 4CLCB 1SKFA 3IS2B 3ZNYA 4NEED 3BECA 1K56D 4HHDA 5CHMA 5KMWA 2A3UA 5HL1A 2A24B 2LB5A 3BFDA 4HOIA 3B33A 4HJ4A 2XF3A 2ZD8A 1XA1A 4LPZA 1XP4A 1BULA 5FQ9A 3CLOA 3NI9A 1KGFA 5FDHA 3PYPA 5EFWA 3VOZA 1QMFA 4NXFA 3IHBA 4XUZA 4XXRA 1YLPA 1Z09A 4X1MA 1NZUA 4DJ2A 2ZL1B 3BFGA 2NUTC 4OQGA 2B18A 2PT7A 4Y0TA 2EFXA 3IHAA 3IF5A 4YFMA 3W8KA 3ZFZA 4BWIA 2V0WA 4I3JA 2HJ9C 2Y8HA 4BJPA 4MLLA 3G2YA 1CF0A 3HL9A 3QNCA 1VQQA 5GHXA 3ZGAB 3UPPA 1ES4A 3R7WB 3SZTA 4DF6A
chains in the Genus database with same CATH topology
2PR6A 4OOMA 3LIAA 5DJTA 2K31A 2HJEA 3EQUA 2MJ6A 3E4QA 3UE6A 2O9BA 3LIBA 4FSFA 4H6JB 2D02A 1TS0A 3LICA 4WUJA 3T4JA 3EGDC 3LUQA 5DKKA 1MKMA 2W1TB 4I3AA 1S1YA 4WELA 5DKLA 1S67L 4Z1WA 4HH2A 2QJ7A 3BWLA 5DFXA 4OOLA 3RH8B 3EOIA 3V67A 1LSWA 4PKYA 4WL9A 3F1OB 2OWJA 3S7PA 4IJGA 3E0YA 3RTYA 3ZQ5A 1F98A 5HL6A 3FG8A 3BW6A 1OTDA 3ZYTA 5FL3A 3VE4A 2VLGA 3MXQA 1YKDA 3UB6A 4EERA 3MMHA 3SW1A 4L9EA 1YSPA 1ZTUA 4I3IA 1TS6A 4PAUA 4R6LA 3IBJA 5AVEA 3MQ0A 3NHQA 4KUOA 2J80A 4DMZA 5F6AA 4Q0IA 4B93A 2PR5A 2VJWA 3U2AA 1D06A 3B47A 3HJIA 4NXGA 4EXOA 2B02A 1KOUA 1XJ4A 4PKYG 2W3FA 4UQIS 2O9CA 4CLCC 5HWVA 2I9VA 3D72A 1YAXA 3LIEA 4FOFA 4CLCE 3PBNA 4GS9B 2LB9A 1T18A 4HI4A 4MN5A 3S7OA 4ARZA 3BJNA 5J3WA 3NOUC 1N9LA 2PHYA 3KYQA 2INWA 1IOUA 2HGVA 3VOLA 2H28A 2EWVA 3NOPC 3F1NB 3H82B 1DP6A 3K3CA 3F1PA 4HJ6A 4BBTA 3UE3A 2ZMVA 3KX0X 3LFVA 1TS7A 4O01A 1P0ZA 3P01A 3UB9A 3EGXC 1LSXA 2FZ0A 4F3LB 4WLAA 5J7EA 1P97A 5TJJA 2JKRM 4HJ3A 1MZUA 1GSWA 1IFQA 2A24A 3T4LA 4JGOA 1H8MA 5HD5A 1GSXA 4XT2B 4WN5A 5DFYA 2R78A 2KLIA 5AVFA 2GJ3A 4IUHA 2GNXA 2OAQ1 4Y3IA 3T4SA 5KSHA 3S7QA 1NRJA 4L9GA 2CMNA 1ZHHB 3EQVA 1N9NA 1DP9A 3LI9A 1TS8A 4G3VA 2VGLM 2XRNA 1W63Q 4HY8A 3E4OA 2O9AA 2VV7A 3OCNA 1GSVA 3PXPA 4KQOA 4LLOB 1F5MA 3LR3A 1TF1A 4WEJA 5IT5A 4DN0A 3BY9A 3OCLA 3D3OA 2XROA 3A0RA 3CAXA 4GJ4A 4P6ZM 2WKRA 3PBRA 1OTEA 5TBMB 1OT9A 3LI8A 2VX8A 4ETXA 3P7NA 4ZRRA 1ODVA 4BBVA 1XJ6A 5G4ZA 2JHEA 3TRCA 3VV4A 4EEPA 2YKHA 4YNRA 3UB8A 3ULFA 1G6OA 4CLCD 4B9OA 3BY8A 4R3AA 2JN7A 3H7WB 1VB6A 2VKSA 5DF9A 2QKPA 2XA7S 4MMNA 2ZMFA 4CLCA 3MQOA 3IS2A 1OTBA 1UGUA 2PDRA 3CWFA 4O0PA 5K5BA 5AJGA 3OBFA 2FH5A 4G3WA 2VEAA 3MJQA 2KDKA 4EU0A 4QPRA 4JGRA 3PBOA 5HDDA 4Q0JA 5F5YA 4E04A 2P7JA 4EW7A 4H6JA 3HCYA 1OJGA 4KUKA 2M1CA 3LR4A 4Y2FA 1XFQA 4I39A 1P9WA 1G28A 4O8GA 3KO6A 4HQAA 3BQ8A 2HV1A 2M7VA 2W3GA 1OPXA 1LL8A 4R70A 1LSVA 2VZWA 2IA2A 1OJ5A 2L0WA 3LIDA 4CQHA 1S4RA 2JKRI 4LRXC 3TE8A 2W3EA 5A8BA 4II7A 5HWTA 3FPVA 1XJ2A 3K3DA 4ME4A 1DRMA 2J3WA 2V1BA 2KOIA 3E98A 4NXBA 1STZA 3PBTA 3T4QA 3UMEA 5MC7A 3T4OA 2EWWA 4M4XA 2K2NA 4JGPA 3LR0A 2VA0A 3KSFA 1W63M 3BQAA 1OT6A 5G4YA 1WA9A 4ETZA 2K7SA 4HNBA 3O5YA 2EA9A 4IHQA 2WKQA 4IUKA 3H9WA 1LT0A 1DP8A 1V9ZA 1T19A 2A2LA 5HSQA 3G6OA 4GS9A 3MF0A 4ARZB 5J4EA 2Z6CA 2V1AA 4WEKA 3ICYA 1T1CA 3R7WA 1N9OA 2JKTI 3KSIA 2QYBA 1MC0A 4GHIB 5L8MA 3MR0A 4YWZA 3H82A 3F1PB 5DJUA 2BASA 4KQDA 1T1BA 1S1ZA 5IS1A 3EEHA 4HIAA 1Y28A 2VGLS 4I38A 4MN6A 3A0SA 3TW8A 4EQ1A 2O99A 4F3LA 2Z6DA 2W1TA 4AFIA 2G7UA 4GLQA 3HJKA 2ZOIA 3T50A 1T1AA 2NUPC 2W3DA 1YSQA 4XT2A 2V9AA 3FC7A 4EUVA 3F1OA 1X0OA 4P6ZS 1TD5A 1D7EA 3W2ZA 1OTIA 4NXEA 2W27A 2XA7M 3C8CA 3NJAA 3FPWA 2OWHA 2VV8A 2OAP1 2GZAA 3NOTC 1OTAA 1S4SA 1NLYA 4L9FA 1P9RA 1S66L 2PYPA 3DBAA 2HF6A 2PYRA 3KSGA 4GCZA 1UWNX 2P08A 3KYZA 2DMWA 4DJ3A 2M7UA 3B42A 2QJ5A 3VE3A 2YKFA 4L0LA 2KX6A 3PBQA 3EWKA 2QWSA 1NLZA 4K08A 2XSSA 5HZHA 4RQ9A 5TBMA 4LRZE 3OC2A 1XFNA 5KIZA 1JNUA 5IU1A 1BYWA 3PHYA 2Y79A 1H3QA 4NKPA 1EW0A 3RFBA 4Y5FA 2PD8A 2W0NA 4G3KA 3S7NA 3H7WA 2V0UA 3CUEA 3T4TA 4BMWA 4MN7A 4HH3A 3F1NA 5HPIA 5HWWA 3EEAA 4HP4A 4CLCB 4EESA 3IS2B 3JVUA 4NEED 1V9YA 1XJ3A 4HHDA 2ZOHA 1UWPX 2A24B 2LB5A 3UMDA 2J3TC 2ZBBA 2PD7A 3C2WA 4HOIA 4UEYA 3B33A 4Q0HA 4HJ4A 3OLOA 2J3TD 3E4PA 5HDCA 3MFXA 4LPZA 3C30A 3CLOA 3KSHA 3LR5A 4I5SA 4MCWA 4R38A 3GDIA 3PYPA 5HPFA 5LBRA 4MDZA 5EFWA 2D01A 2L4RA 3LIFA 2GX5A 2L1MA 2P04A 4NXFA 1VHMA 2QHKA 3CUEC 3C38A 3A0VA 4BBUA 4EEUA 3LYXA 3PR6A 2W3HA 5CX7A 5I5LA 2WKPA 3JVVA 4DJ2A 3R4KA 5C5KA 2NUTC 3TJZC 4YOFA 2B18A 2PT7A 3GECA 2VV6A 4PHTA 5F69A 4WF0A 3T4KA 4JGQA 2OOLA 1NWZA 4BWIA 3MQQA 3CI6A 3UB7A 2V0WA 2W1RA 3K2NA 5F68A 4EETB 3OOVA 4I3JA 2HJ9C 3CITA 2Y8HA 4BJPA 4HP9A 3PBSA 1F9IA 5HD3A 4LRYC 4UQIM 2O0YA 2JKTM 5HDSA 3IBRA 3R7WB 4GHIA 4GW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVF A;  2GJ3 A;  2V1B A;  2PR6 A;  3LIA A;  4NXB A;  5DJT A;  4L9G A;  2CMN A;  3UME A;  1EW0 A;  3UE6 A;  3E4Q A;  1N9N A;  1DP9 A;  3LI9 A;  2PD8 A;  3LIB A;  2W0N A;  4M4X A;  4JGP A;  4H6J B;  2D02 A;  1TS0 A;  3LIC A;  4WUJ A;  3H7W A;  2V0U A;  1OT6 A;  1TS8 A;  5G4Y A;  1WA9 A;  3LUQ A;  5DKK A;  4HH3 A;  3F1N A;  4I3A A;  4HY8 A;  2K7S A;  1S1Y A;  5DKL A;  4HNB A;  5HWW A;  3E4O A;  1S67 L;  4HP4 A;  4HH2 A;  2QJ7 A;  4EES A;  3IS2 B;  3BWL A;  2EA9 A;  2VV7 A;  1GSV A;  1V9Y A;  2WKQ A;  4LLO B;  3RH8 B;  1XJ3 A;  1LSW A;  4PKY A;  4WL9 A;  3H9W A;  1LT0 A;  3BY9 A;  1DP8 A;  3F1O B;  2OWJ A;  1V9Z A;  1T19 A;  5HSQ A;  4HHD A;  3G6O A;  3A0R A;  1F98 A;  2ZOH A;  3CAX A;  3FG8 A;  1UWP X;  4GS9 A;  1OTD A;  3RTY A;  3ZQ5 A;  2A24 B;  2WKR A;  5J4E A;  3UMD A;  3VE4 A;  2Z6C A;  2VLG A;  2V1A A;  2ZBB A;  5IS1 A;  2PD7 A;  3ICY A;  3MXQ A;  3UB6 A;  4EER A;  1OTE A;  3C2W A;  1T1C A;  4HOI A;  1N9O A;  1OT9 A;  5TBM B;  3B33 A;  3SW1 A;  3LI8 A;  4HJ4 A;  4L9E A;  4I3I A;  3P7N A;  4GHI B;  1TS6 A;  1ODV A;  3MR0 A;  1XJ6 A;  3OLO A;  4YWZ A;  4BBV A;  4R6L A;  3H82 A;  5AVE A;  3F1P B;  5DJU A;  3NHQ A;  5G4Z A;  2BAS A;  3E4P A;  4KQD A;  1T1B A;  1S1Z A;  2JHE A;  2J80 A;  4KUO A;  4EEP A;  5HDC A;  3EEH A;  3MFX A;  4HIA A;  5F6A A;  4LPZ A;  1Y28 A;  2YKH A;  3UB8 A;  3ULF A;  4I38 A;  4B9O A;  4MN6 A;  3A0S A;  3BY8 A;  2PR5 A;  3CLO A;  2JN7 A;  3H7W B;  4R3A A;  4EQ1 A;  4I5S A;  1VB6 A;  1D06 A;  4F3L A;  2QKP A;  2Z6D A;  3HJI A;  4R38 A;  3GDI A;  3PYP A;  4NXG A;  4EXO A;  2B02 A;  3HJK A;  2ZOI A;  2D01 A;  1T1A A;  5EFW A;  3T50 A;  1KOU A;  1XJ4 A;  2L4R A;  3IS2 A;  3LIF A;  3MQO A;  4PKY G;  2L1M A;  1OTB A;  1UGU A;  2PDR A;  3CWF A;  4GHI A;  4XT2 A;  2V9A A;  5HWV A;  4NXF A;  2I9V A;  2QHK A;  3FC7 A;  3D72 A;  3F1O A;  3LIE A;  1X0O A;  2VEA A;  3MJQ A;  2KDK A;  1D7E A;  3A0V A;  4GS9 B;  4JGR A;  1OTI A;  1T18 A;  4HI4 A;  4MN5 A;  4NXE A;  2W27 A;  5HDD A;  1JNU A;  3LYX A;  4BBU A;  5J3W A;  4EEU A;  3C8C A;  5I5L A;  5F5Y A;  2WKP A;  3NJA A;  3NOU C;  4E04 A;  2P7J A;  4EW7 A;  1N9L A;  2OWH A;  2VV8 A;  4H6J A;  4DJ2 A;  1OJG A;  2PHY A;  4KUK A;  2M1C A;  2INW A;  3NOT C;  3VOL A;  2H28 A;  1OTA A;  1S4S A;  4L9F A;  1S66 L;  1XFQ A;  3GEC A;  3F1N B;  2PYP A;  2VV6 A;  3H82 B;  1DP6 A;  3K3C A;  3NOP C;  4I39 A;  3F1P A;  1G28 A;  4HJ6 A;  5F69 A;  4WF0 A;  4BBT A;  4JGQ A;  2PYR A;  3KX0 X;  4HQA A;  4GCZ A;  1TS7 A;  2OOL A;  1UWN X;  2HV1 A;  1NWZ A;  3MQQ A;  1P0Z A;  3UB7 A;  3UB9 A;  2V0W A;  1LSX A;  1LL8 A;  4DJ3 A;  4R70 A;  4F3L B;  4WLA A;  5F68 A;  4EET B;  1LSV A;  2QJ5 A;  4I3J A;  1P97 A;  5J7E A;  3VE3 A;  4HP9 A;  4HJ3 A;  1OJ5 A;  2L0W A;  1F9I A;  1MZU A;  2YKF A;  1GSW A;  3LID A;  4LRY C;  5HD3 A;  1S4R A;  2A24 A;  2KX6 A;  4LRX C;  3EWK A;  2QWS A;  4JGO A;  4K08 A;  5HZH A;  5A8B A;  5HD5 A;  5HWT A;  5HDS A;  1GSX A;  4XT2 B;  3IBR A;  4RQ9 A;  4WN5 A;  4LRZ E;  1XJ2 A;  5TBM A;  1XFN A;  3K3D A;  5KIZ A;  2R78 A;  1DRM A;  5IU1 A;  1BYW A;  4GW9 A;  3PHY A; 
#chains in the Genus database with same CATH topology
 1E25 A;  3NCK A;  2PR6 A;  2G2U A;  2FFF B;  2K31 A;  2HJE A;  3EQU A;  3E4Q A;  3VP2 A;  1IYP A;  4FSF A;  4H6J B;  1NXY A;  2ZQ9 A;  3T4J A;  3NY4 A;  5GHZ A;  2J8Y A;  1S1Y A;  3N8R A;  2UV0 E;  3IWQ A;  1S67 L;  5DFX A;  3ZG0 A;  3NBL A;  4OOL A;  1LSW A;  3WS4 A;  2OWJ A;  3S7P A;  4DE2 A;  1W7F A;  2ZC3 B;  2Y59 A;  3ZQ5 A;  3FG8 A;  2GDN A;  5FL3 A;  5M18 A;  3SW1 A;  1NY0 A;  4FTX A;  3N7W A;  4PAU A;  4JXG A;  3VFF A;  3NHQ A;  2J80 A;  5EPH A;  2WGW B;  2PR5 A;  2VJW A;  4IVI A;  2J7V A;  5E43 A;  4IBX A;  2PBY A;  1PWC A;  1E3U A;  1KOU A;  1AXB A;  3JYI A;  5KZH A;  2I9V A;  4MEZ A;  3IX3 A;  5EVI B;  3S7O A;  5J3W A;  4LV3 A;  1N9L A;  2PAV P;  2ZC5 B;  3F1N B;  1MWT A;  3K3C A;  3F1P A;  2ZMV A;  4O01 A;  1P0Z A;  1ZG4 A;  4DE1 A;  3SOI A;  3FYZ A;  4HJ3 A;  3BM6 A;  2A24 A;  2HPB A;  2Z2L B;  3P09 A;  4X55 A;  5HD5 A;  5DFY A;  3Q7V B;  2R78 A;  2KLI A;  4QWO A;  4IUH A;  4Y3I A;  1NRJ A;  1BLC A;  4KZ7 A;  1N9N A;  1KE4 A;  4RX2 A;  2IWD A;  4X53 A;  3NC8 A;  1TS8 A;  3UB5 P;  3UN7 A;  3E2K A;  1W63 Q;  3FV7 A;  5FAQ A;  4E3L A;  2PU2 A;  2O9A A;  4GOG A;  3PXP A;  1F5M A;  3LR3 A;  1MPL A;  2XRO A;  5IHV A;  3CAX A;  2JKG A;  4KG6 A;  1OTE A;  5TBM B;  3LI8 A;  4E6W A;  4ETX A;  4R3B A;  2JHE A;  3VV4 A;  3UB8 A;  1G6O A;  3ZVW A;  1XX2 A;  3FKV A;  4R3A A;  3H7W B;  1LL5 A;  5E2G A;  2HZ5 A;  4NET A;  1W79 A;  3GSG A;  1PNE A;  1S0W A;  4Q8I A;  4O0P A;  4OQ0 A;  3CWF A;  5AJG A;  2XFS A;  2ZLY A;  5TR7 A;  4CJN A;  2P7J A;  4KZ5 A;  4H6J A;  4R3J A;  1MWR A;  2R9X A;  4HBT A;  5FI2 A;  5EM0 A;  2M7V A;  1OPX A;  4UA6 A;  3LEQ A;  4QY6 A;  2R9W A;  1RGY A;  1Y4O A;  4LRX C;  4LCM A;  2EXB A;  5CGX A;  4EWF A;  4S2I A;  5CTM A;  4ME4 A;  1BLS A;  1STZ A;  5MC7 A;  3T4O A;  3BFE A;  2EWW A;  1JWP A;  4M4X A;  4ESP A;  1N4O A;  3CPT B;  1OT6 A;  2K7S A;  2XD5 A;  3GRJ A;  4WM9 A;  4IHQ A;  3IXB A;  2WKQ A;  2EXA A;  1DP8 A;  1V9Z A;  2EX9 A;  2BG1 A;  4BL3 A;  4UAA A;  1XGI A;  3OPL A;  1YLJ A;  2VGJ A;  4JF4 A;  3HLB A;  1N9O A;  2H10 A;  5FAP A;  1MC0 A;  4KG5 A;  1H8Y A;  4S2N C;  4C3Q A;  5GLB A;  5DJU A;  3QP4 A;  2OLV A;  5FQK A;  4OLG A;  2VGL S;  4I38 A;  2O99 A;  4AFI A;  3T50 A;  2ZOI A;  3UPO A;  1DJC A;  2Q9M A;  4XT2 A;  2V9A A;  4GDN A;  3FC7 A;  1K57 A;  1X0O A;  4P6Z S;  2HDU A;  1D7E A;  3FPW A;  2OWH A;  2WAF A;  1NLY A;  4H8R A;  2Y2K A;  2P08 A;  4PM6 A;  2M7U A;  1W5D A;  3VE3 A;  1GCE A;  2DCF A;  4WZ4 A;  3WRZ A;  2YKF A;  4L0L A;  4DE0 A;  2KX6 A;  4NG2 A;  1XA7 A;  2XSS A;  4X69 A;  1KGE A;  2B95 A;  5GLC A;  4RQ9 A;  4BD1 A;  4X6T A;  2ZM0 A;  1BYW A;  3PHY A;  2Y79 A;  4JXV A;  1PI5 A;  2ZQ8 A;  2ZMA A;  4WMC D;  3RFB A;  4LFU A;  2XD1 A;  3S7N A;  1VEU B;  4IBR A;  3H7W A;  3CUE A;  2Y2O A;  1JVJ A;  5FI7 A;  5HPI A;  1CQA A;  5HWW A;  3Q1F A;  4U3T A;  1TVF A;  3A3D A;  3AGD A;  3OPP A;  3VFH A;  5GHY A;  1UWP X;  5CGW A;  3UMD A;  2JC7 A;  2PD7 A;  3AGF A;  3C2W A;  1GHI A;  1L0D A;  4S2J A;  5BOH A;  1ES3 A;  3OLO A;  4LCL A;  2Y2M A;  5HDC A;  3MFX A;  2ZQA A;  3DTK A;  2JE5 A;  4I5S A;  4KZB A;  4MCW A;  3VP0 A;  3PAG A;  5HPF A;  4N9L A;  1KVM A;  1IYQ A;  2D01 A;  4D60 A;  2L4R A;  3LIF A;  4K0W A;  2L1M A;  2DNS A;  2VGK A;  1NJ4 A;  3CUE C;  3A0V A;  2A49 A;  1K4E A;  3LYX A;  3HLE A;  1K55 A;  5FQQ A;  2J9O A;  3JVV A;  5F1F A;  3VP4 A;  4PPR A;  3R4K A;  5C5K A;  3TJZ C;  3CPT A;  4YOF A;  1FSY A;  5F69 A;  1DJA A;  2OOL A;  3IXG A;  3CI6 A;  3IH9 A;  2W1R A;  3K2N A;  3NIA A;  5F68 A;  2ZC7 A;  5E2E A;  4EET B;  4OH0 A;  1F9I A;  4EBN A;  3MBZ A;  3Q81 A;  1FQG A;  1K0K A;  4WMC A;  3GQZ A;  4GHI A;  1E3U D;  1O7E A;  2J9P A;  4OOM A;  3S22 A;  5DJT A;  1XPB A;  3UE6 A;  3LIB A;  1CI8 A;  1TS0 A;  1YMX A;  4WUJ A;  3EGD C;  4B4X A;  5HX9 A;  4X68 A;  5DKK A;  1MKM A;  2W1T B;  1G6A A;  4I3A A;  4WEL A;  5DKL A;  5DF7 A;  2OSU A;  3VP3 A;  4GKU A;  4Z1W A;  3BWL A;  4ZDX A;  2WUQ A;  3V67 A;  3V5M A;  3M6H A;  3F1O B;  2H0Y A;  4R4R A;  4R1G A;  4U0T A;  5CEB A;  1PZP A;  4EER A;  1EWZ A;  1K56 A;  1Z6F A;  4R6L A;  3MQ0 A;  4FUW A;  4KUO A;  4N1X A;  4OQI A;  3WS1 A;  4B93 A;  4EBP A;  4DE3 A;  3B47 A;  3HJI A;  2W3F A;  4X25 A;  4UQI S;  2O9C A;  1JWZ A;  2XGN A;  3D72 A;  4KZ8 A;  4FOF A;  4CLC E;  3PBN A;  3V50 A;  4ARZ A;  3BJN A;  1IYS A;  3KYE A;  2Q0O A;  2OLU A;  3HLF A;  3KYQ A;  2INW A;  2H28 A;  1H8Z A;  3H82 B;  2V20 A;  1DP6 A;  3OPR A;  4DDS A;  3UE3 A;  3EGX C;  1MWS A;  4F3L B;  4WLA A;  2JKR M;  1MZU A;  1IYO A;  2E8J A;  3T4L A;  4JGO A;  1H8M A;  4DRT A;  3TG9 A;  5AVF A;  4ZJ1 A;  2GNX A;  2OAQ 1;  3S7Q A;  2PU4 A;  1MKI A;  3QP8 A;  1CJF A;  3LI9 A;  4P0M A;  1FR6 A;  4G3V A;  5CED A;  2VGL M;  4N9K A;  5EUA A;  3E4O A;  1AWI A;  2Y4A A;  3OCN A;  4KQO A;  4LLO B;  5IT5 A;  4DN0 A;  3BY9 A;  3OCL A;  3A0R A;  1K38 A;  4P6Z M;  4DDY A;  2WKR A;  2VX8 A;  1ODV A;  4BBV A;  1XJ6 A;  5G4Z A;  4OPQ A;  3TRC A;  2YKH A;  3ULF A;  4CLC D;  4B9O A;  1VB6 A;  1FOF A;  3IWI A;  4ZBE A;  3FZC A;  3MFD A;  4WBG A;  3SS5 A;  1CK3 A;  1ERM A;  2WKH A;  4OPZ A;  1Y54 A;  1CEG A;  4D2O A;  2KDK A;  1IKI A;  4QPR A;  5A92 A;  3MS6 A;  3DTM A;  1L0G A;  1FIL A;  4OPY A;  4E04 A;  1LI9 A;  3MKF A;  1OJG A;  4KUK A;  4UA7 A;  4Y2F A;  1XFQ A;  4I39 A;  4FH4 A;  1LLB A;  1K54 A;  2XK1 A;  3P98 A;  2IA2 A;  3M6B A;  3LID A;  4CQH A;  1FSW A;  3HLD A;  3TE8 A;  3HLC A;  2Y2I A;  5EM1 A;  5EVE A;  5HWT A;  5FDS A;  3L7H A;  3CG5 A;  1XJ2 A;  3DTE A;  2V1B A;  3E2L A;  4NXB A;  3B3X A;  1PI4 A;  2IWB A;  3PBT A;  3V3S A;  4EV4 A;  3LR0 A;  2VA0 A;  3FKW A;  5G4Y A;  4ETZ A;  3NEC A;  3GTC A;  3MZE A;  3HRE A;  5FEG A;  1PWG A;  4IUK A;  3H9W A;  3CZD A;  3BRM A;  1IEM A;  2A2L A;  2JBF A;  2EX6 A;  3G6O A;  4GZB A;  3MF0 A;  1XXM A;  4ARZ B;  1KDW A;  2Z6C A;  2V1A A;  4WEK A;  3KSI A;  4OP8 A;  2QYB A;  3V39 A;  3MR0 A;  3IWO A;  4HES A;  4MBH A;  3H82 A;  1YLT A;  2HDR A;  1PYY A;  3F1P B;  2BAS A;  1T1B A;  1S1Z A;  3T1R A;  5IS1 A;  3EEH A;  3ITB A;  1ZC2 A;  4MN6 A;  3A0S A;  4F3L A;  2Z6D A;  5DVA A;  4HBU A;  4UA9 A;  4S2K A;  3PAE A;  3UDI A;  3RJU A;  1SCW A;  2W3D A;  1WE4 A;  3Q7V A;  4E3M A;  1U60 A;  1I2S A;  1TDG A;  4JKT A;  5HAQ A;  1ES2 A;  2HDQ A;  1TDL A;  1PFL A;  2OAP 1;  4WZ5 A;  3W4O A;  2PYP A;  3G4P A;  4QB8 A;  2PYR A;  3KSG A;  4GCZ A;  1UWN X;  2PBD P;  3KYZ A;  2DMW A;  2Z2M B;  3B42 A;  1ONG A;  3OZH A;  4Y15 A;  3T1S A;  5HZH A;  4QY5 A;  3ZG8 B;  1GHP A;  1N9B A;  5TBM A;  4LRZ E;  5KIZ A;  1JNU A;  4IVK A;  4KZ3 A;  4BEN A;  2DRW A;  4DKI A;  5CTN A;  2W0N A;  4G3K A;  3UO9 A;  4OPR A;  1MBL A;  1YMS A;  3T4T A;  1K57 C;  3N8L A;  4LV1 A;  1ESU A;  3EEA A;  4HP4 A;  4EES A;  4Z9Q A;  1V9Y A;  2XEP A;  3C5A A;  1SHV A;  5EVI C;  1LI0 A;  4P85 A;  2WGV A;  1YLW A;  4UEY A;  5L07 A;  4PM9 A;  1A0K A;  5EVI D;  4QJG A;  2ZM2 A;  1BSG A;  2E8I A;  5DTT A;  2J3T D;  3E4P A;  3DW0 A;  4PM7 A;  4KEN B;  3C30 A;  3KSH A;  3LR5 A;  4R38 A;  3SH7 A;  1OME A;  5EEC A;  4KZA A;  4MDZ A;  3ZVT A;  2P04 A;  1VHM A;  2QHK A;  1YT4 A;  2ACG A;  4QHC A;  4BBU A;  3ZHH A;  2XR0 A;  4KZ9 A;  4JXW A;  1JWV A;  3PR6 A;  5I5L A;  2WKP A;  3TOI A;  3QNB A;  3LY3 A;  4S2P A;  3GEC A;  1HD8 A;  2WGI A;  1I2W A;  1ZKJ A;  3UB7 A;  5CER A;  5FQM A;  3OOV A;  4HP9 A;  1L0F A;  4LRY C;  3A3E A;  3LGO A;  2P74 A;  5FSR A;  3I7J A;  2O0Y A;  1JTD A;  3NUL A;  4B4Z A;  3QP5 A;  5HDS A;  2JKT M;  2P9V B;  3BYD A;  4R4S A;  4GW9 A;  4JLF A;  3LIA A;  1F2K A;  2O9B A;  1PZO A;  2D02 A;  3HUO A;  3GR2 A;  4GD8 A;  3LUQ A;  5HAR A;  5A93 A;  4OLD A;  1PIO A;  1RGZ A;  2Y55 A;  3RXW A;  1JTG A;  4E3K A;  3RH8 B;  3EOI A;  5AQA A;  4WL9 A;  4BLM A;  5HAP A;  1IEL A;  1YLY A;  3E0Y A;  3OPH A;  1M6K A;  2WAD A;  3MXQ A;  3IF6 C;  4C75 A;  3MMH A;  3NDE A;  1SKO A;  3N4I A;  4L9E A;  3PTE A;  1YSP A;  1ZTU A;  4I3I A;  1TS6 A;  2ZJ9 A;  5AVE A;  1KDS A;  3IF6 A;  4DMZ A;  4Y17 A;  5F6A A;  5FAT A;  2ZQC A;  5A90 A;  2C6W B;  1YPR A;  4Q0I A;  3U2A A;  1D06 A;  3N6I A;  2ZC4 B;  3O3V A;  4E3I A;  2B02 A;  1XJ4 A;  3A3J A;  4CLC C;  3G34 A;  3MSH A;  1YAX A;  3LIE A;  5L2F A;  4HI4 A;  3IXD A;  1HZO A;  3NOU C;  1CEF A;  4NK3 A;  2PHY A;  3BFF A;  1IOU A;  2HGV A;  2WKI A;  2ZQ7 A;  4S2O A;  2EWV A;  4ZAM A;  3HBR A;  2WK0 A;  3KX0 X;  4UHU A;  1TS7 A;  1VM1 A;  2RCX A;  3UB9 A;  4U0X A;  1LSX A;  2HP6 A;  1P97 A;  5TJJ A;  4OOY A;  1IFQ A;  2X02 A;  3HVF A;  3T1Q B;  3CHW P;  4WN5 A;  1PRQ A;  5EV0 A;  1WYB A;  2GJ3 A;  1J9M A;  2CMN A;  3EQV A;  3Q07 A;  4OKP A;  3ZNT A;  3MXS A;  2WZZ A;  4FH2 A;  1YQS A;  4MBF A;  4RX3 A;  4HY8 A;  5EE8 A;  2VK3 A;  3T1X A;  4WEJ A;  2H5S A;  5AQB A;  1H0M A;  5CRF A;  5FI6 A;  1M40 A;  2C5W B;  3P7N A;  5AQ9 A;  5F1G A;  2XFT A;  3O88 A;  4WZ5 C;  3VSL A;  4EEP A;  1K55 C;  4YNR A;  3G32 A;  3BY8 A;  2V2F F;  4BL2 A;  3UE1 A;  5CHJ A;  2QKP A;  4RYE A;  3SS3 A;  3M2J A;  4MMN A;  3MQO A;  3IS2 A;  1QME A;  1OTB A;  1UGU A;  2FH5 A;  2Y2G A;  3MJQ A;  2WAE A;  4EU0 A;  4X56 A;  5F5Y A;  2XDM A;  4EW7 A;  3QP1 A;  1ONH A;  3IT9 A;  3HCY A;  3GV9 A;  4A5R A;  3VP1 A;  1P9W A;  1G28 A;  2JKF A;  4O8G A;  3KO6 A;  3HUN A;  2Y2Q A;  2HV1 A;  2W3G A;  1KE3 A;  1NYY A;  4R70 A;  1LSV A;  2VZW A;  4Y13 A;  1ERO A;  2L0W A;  3M2K A;  2W3E A;  1H5X A;  4II7 A;  3FPV A;  3VSK A;  1SKO B;  4OP5 A;  3K3D A;  4OQH A;  1DRM A;  5AQ7 A;  2KOI A;  4JXS A;  3UME A;  5JYP A;  4JGP A;  2ZL1 A;  4QD4 A;  1W63 M;  3BQA A;  2UWX A;  4YIN A;  1GA9 A;  3O5Y A;  3HLW A;  2EA9 A;  5FQI A;  1LT0 A;  3CMZ A;  5GLD A;  3C7V A;  3ZDJ A;  3ZCZ A;  3ICY A;  1T1C A;  1ZG6 A;  4JPM A;  4PM8 A;  4XUX A;  5L8M A;  4OVD A;  2HDS A;  4PM5 A;  4RA7 A;  3TW8 A;  4EQ1 A;  5KSC A;  1FCM A;  3L9K A;  3Q82 A;  4S2M A;  1L0E A;  2EX8 A;  5EVL A;  3VOY A;  1W8Y A;  3W2Z A;  4ZTK A;  2ZM8 A;  3ISG A;  5D3O A;  3C8C A;  3NJA A;  1ESI A;  1C3B A;  3NOT C;  1G68 A;  2BLS A;  1GA0 A;  4JBF A;  2V1Z A;  4S2N A;  5GL9 A;  1S4S A;  2ZC6 B;  1S66 L;  5EOE A;  1VET B;  3DBA A;  2HF6 A;  5E2H A;  5U47 A;  2WGW A;  1WYC A;  1SDE A;  2QJ5 A;  5FQJ A;  1ERQ A;  4ZJ2 A;  3DAV A;  3PBQ A;  3MZF A;  2QWS A;  4K08 A;  3C7U A;  3IH8 A;  4KZ6 A;  4E3N A;  1XFN A;  2Y2L A;  5G18 A;  1NYM A;  5EVI A;  1H3Q A;  4EQI A;  4Y5F A;  2PD8 A;  5L09 A;  4GD6 A;  3O86 A;  4GDB A;  3JVU A;  2ZQD A;  3LY4 A;  1XJ3 A;  3S4X A;  3G30 A;  3D9Y A;  1D1J A;  5DTS A;  2FFY A;  2ZOH A;  5HAI A;  3QP2 A;  2J3T C;  3MKE A;  2ZBB A;  2QZ6 A;  2G2W A;  3DWK A;  4O7D A;  4Q0H A;  4ZJ3 A;  1K25 A;  2QPN A;  1KGG A;  4LV0 A;  2XQZ A;  1HVB A;  3UNW A;  4Y0U A;  2Y2N A;  3GDI A;  5LBR A;  2GX5 A;  1O07 A;  4GB7 A;  4IED A;  3C38 A;  5CEC A;  1DJB A;  4EEU A;  2W3H A;  5CX7 A;  5M19 A;  3S1Y A;  1LHY A;  2AVX A;  3WWX A;  2VV6 A;  4PHT A;  4WF0 A;  3T4K A;  4JGQ A;  1NWZ A;  3MQQ A;  4N1H A;  1PWD A;  1GHM A;  3SH9 A;  3CIT A;  1MXO A;  3PBS A;  1FCN A;  3IX4 A;  5HD3 A;  3GMW A;  4UQI M;  3NDG A;  3WRT A;  1S6R A;  3IBR A;  3Q7Z A;  5DTK A;  1ACF A;  4N92 A;  3O87 A;  1FR1 A;  2I72 A;  2WKE A;  3DWZ A;  5JYO A;  2MJ6 A;  2XH9 A;  4X1L A;  5I94 A;  3LIC A;  4K91 A;  2V8C A;  3UDX A;  4HH2 A;  2QJ7 A;  4P6B A;  5GLA A;  4PKY A;  3HUM A;  4IJG A;  2QMI A;  4BQM A;  3RTY A;  1F98 A;  5HL6 A;  4OON A;  3BW6 A;  1OTD A;  3ZYT A;  3IXH A;  3VE4 A;  2PRF A;  2VLG A;  2Y2P A;  1KVL A;  1YKD A;  3UB6 A;  1PW1 A;  3G2Z A;  2JCH A;  5HFO A;  1E4D A;  3IBJ A;  1VET A;  1NRF A;  3DTI A;  1BZA A;  5DF8 A;  2H0T A;  2Y2J A;  4EUZ A;  1I5Q A;  4NXG A;  4EXO A;  2EX2 A;  4PKY G;  4QU3 A;  2CC1 A;  5HWV A;  5TFQ A;  3GVB A;  4GS9 B;  3W4Q A;  2LB9 A;  1T18 A;  4MN5 A;  1Q2P A;  5J8X A;  1IKG A;  1LL9 A;  2IWC A;  3HLG A;  2Q9N A;  3VOL A;  2X01 A;  3WS5 A;  3NOP C;  4ID4 A;  4HJ6 A;  4BBT A;  5FAS A;  3LFV A;  4M3K A;  1YLZ A;  3P01 A;  3TSG A;  2FZ0 A;  2X71 A;  5J7E A;  1K4F A;  2BTF P;  1NZO A;  4P87 A;  1GSW A;  1GSX A;  4XT2 B;  4R23 A;  3W4P A;  3T4S A;  5KSH A;  3G35 A;  4L9G A;  5HW3 A;  1ZHH B;  2WYX A;  1KE0 A;  1DP9 A;  4E3O A;  2XRN A;  3SH8 A;  3ZG5 A;  3BFC A;  2VV7 A;  4B88 A;  1BTL A;  1BT5 A;  1GSV A;  1TF1 A;  1L3L A;  2WZX A;  3IQA A;  3D3O A;  4GJ4 A;  5FEF A;  2Y91 A;  1K54 C;  3PBR A;  1OT9 A;  2XLN A;  4ZRR A;  4WYY A;  1ES5 A;  3MZD A;  4C6Y A;  4LEN A;  2Y2H A;  3QHY A;  4DXC A;  1VEU A;  3D4F A;  2JN7 A;  3N8S A;  2VKS A;  5DF9 A;  3FWL A;  4LGW A;  2XA7 S;  1MWU A;  2ZMF A;  3ITA A;  3BEB A;  4CLC A;  5FAO A;  2EFU A;  2PDR A;  5K5B A;  1TEM A;  2P9V A;  3OBF A;  4Y7P A;  4G3W A;  2VEA A;  4JGR A;  3PBO A;  5HDD A;  4Q0J A;  4DXB A;  1BLP A;  2M1C A;  3LR4 A;  4GN2 A;  4KQR A;  3C4P A;  5TGF A;  3UY6 A;  4PMA A;  4JF6 A;  4HQA A;  3BQ8 A;  3ZG9 B;  3AGE A;  1K6S A;  1LL8 A;  3V3R A;  3A3F A;  3WS0 A;  1OJ5 A;  1EI5 A;  2RL3 A;  1L2S A;  1S4R A;  2JKR I;  4EBL A;  4E3J A;  5A8B A;  1FIK A;  1G5U A;  2J3W A;  4KZ4 A;  3E98 A;  1ALQ A;  5M1A A;  3T4Q A;  3IF6 B;  3UDF A;  5CXW A;  2K2N A;  5CHU A;  3KSF A;  4HEF A;  1WA9 A;  5CGS A;  4HNB A;  3T12 B;  3WS2 A;  3SS4 A;  5EOO A;  1W8Q A;  3RXX A;  1FCO A;  1T19 A;  3MXR A;  5HSQ A;  4GS9 A;  4R0Q A;  5J4E A;  4JF5 A;  1RCJ A;  3R7W A;  1J3W A;  2JKT I;  3LCE A;  4GHI B;  4YWZ A;  3VMA A;  1XKZ A;  4KQD A;  2V8F A;  3A3I A;  5L10 A;  4HIA A;  4LV2 A;  1Y28 A;  5E2F A;  4FD8 A;  3IX8 A;  4E6X A;  2W1T A;  4KQQ A;  4FCF A;  2G7U A;  4S2L A;  4GLQ A;  3HJK A;  1T1A A;  2HP5 A;  2NUP C;  3ZG7 B;  1K6R A;  1PW8 A;  1XGJ A;  1YSQ A;  1HLU P;  4Y0O A;  2HP9 A;  3F1O A;  4EUV A;  1TD5 A;  3JPU A;  5A91 A;  1OTI A;  4NXE A;  2W27 A;  4KG2 A;  2XA7 M;  2VV8 A;  2GZA A;  2OV5 A;  4K0X A;  1OTA A;  1MY8 A;  1Q2Q A;  4GNU A;  1P9R A;  4L9F A;  3G31 A;  4F94 A;  3LO7 A;  1HTZ A;  1CI9 A;  5FA7 A;  4DJ3 A;  3CJM A;  3BLM A;  4CPK A;  3BLS A;  1SZV A;  1BUE A;  3EWK A;  1NLZ A;  1BLH A;  5F82 A;  2B5R A;  3C4O A;  4MNR A;  3OC2 A;  5IU1 A;  3QP6 A;  4BD0 A;  5F83 A;  4MBK A;  4NKP A;  1EW0 A;  3UPN A;  1SDN A;  3LEZ A;  4RVA A;  2V0U A;  1YM1 A;  1RP5 A;  4BMW A;  4MN7 A;  4HH3 A;  3F1N A;  3UE0 A;  1DY6 A;  3U4L P;  4CLC B;  1SKF A;  3IS2 B;  3ZNY A;  4NEE D;  3BEC A;  1K56 D;  4HHD A;  5CHM A;  5KMW A;  2A3U A;  5HL1 A;  2A24 B;  2LB5 A;  3BFD A;  4HOI A;  3B33 A;  4HJ4 A;  2XF3 A;  2ZD8 A;  1XA1 A;  4LPZ A;  1XP4 A;  1BUL A;  5FQ9 A;  3CLO A;  3NI9 A;  1KGF A;  5FDH A;  3PYP A;  5EFW A;  3VOZ A;  1QMF A;  4NXF A;  3IHB A;  4XUZ A;  4XXR A;  1YLP A;  1Z09 A;  4X1M A;  1NZU A;  4DJ2 A;  2ZL1 B;  3BFG A;  2NUT C;  4OQG A;  2B18 A;  2PT7 A;  4Y0T A;  2EFX A;  3IHA A;  3IF5 A;  4YFM A;  3W8K A;  3ZFZ A;  4BWI A;  2V0W A;  4I3J A;  2HJ9 C;  2Y8H A;  4BJP A;  4MLL A;  3G2Y A;  1CF0 A;  3HL9 A;  3QNC A;  1VQQ A;  5GHX A;  3ZGA B;  3UPP A;  1ES4 A;  3R7W B;  3SZT A;  4DF6 A; 
#chains in the Genus database with same CATH homology
 2PR6 A;  4OOM A;  3LIA A;  5DJT A;  2K31 A;  2HJE A;  3EQU A;  2MJ6 A;  3E4Q A;  3UE6 A;  2O9B A;  3LIB A;  4FSF A;  4H6J B;  2D02 A;  1TS0 A;  3LIC A;  4WUJ A;  3T4J A;  3EGD C;  3LUQ A;  5DKK A;  1MKM A;  2W1T B;  4I3A A;  1S1Y A;  4WEL A;  5DKL A;  1S67 L;  4Z1W A;  4HH2 A;  2QJ7 A;  3BWL A;  5DFX A;  4OOL A;  3RH8 B;  3EOI A;  3V67 A;  1LSW A;  4PKY A;  4WL9 A;  3F1O B;  2OWJ A;  3S7P A;  4IJG A;  3E0Y A;  3RTY A;  3ZQ5 A;  1F98 A;  5HL6 A;  3FG8 A;  3BW6 A;  1OTD A;  3ZYT A;  5FL3 A;  3VE4 A;  2VLG A;  3MXQ A;  1YKD A;  3UB6 A;  4EER A;  3MMH A;  3SW1 A;  4L9E A;  1YSP A;  1ZTU A;  4I3I A;  1TS6 A;  4PAU A;  4R6L A;  3IBJ A;  5AVE A;  3MQ0 A;  3NHQ A;  4KUO A;  2J80 A;  4DMZ A;  5F6A A;  4Q0I A;  4B93 A;  2PR5 A;  2VJW A;  3U2A A;  1D06 A;  3B47 A;  3HJI A;  4NXG A;  4EXO A;  2B02 A;  1KOU A;  1XJ4 A;  4PKY G;  2W3F A;  4UQI S;  2O9C A;  4CLC C;  5HWV A;  2I9V A;  3D72 A;  1YAX A;  3LIE A;  4FOF A;  4CLC E;  3PBN A;  4GS9 B;  2LB9 A;  1T18 A;  4HI4 A;  4MN5 A;  3S7O A;  4ARZ A;  3BJN A;  5J3W A;  3NOU C;  1N9L A;  2PHY A;  3KYQ A;  2INW A;  1IOU A;  2HGV A;  3VOL A;  2H28 A;  2EWV A;  3NOP C;  3F1N B;  3H82 B;  1DP6 A;  3K3C A;  3F1P A;  4HJ6 A;  4BBT A;  3UE3 A;  2ZMV A;  3KX0 X;  3LFV A;  1TS7 A;  4O01 A;  1P0Z A;  3P01 A;  3UB9 A;  3EGX C;  1LSX A;  2FZ0 A;  4F3L B;  4WLA A;  5J7E A;  1P97 A;  5TJJ A;  2JKR M;  4HJ3 A;  1MZU A;  1GSW A;  1IFQ A;  2A24 A;  3T4L A;  4JGO A;  1H8M A;  5HD5 A;  1GSX A;  4XT2 B;  4WN5 A;  5DFY A;  2R78 A;  2KLI A;  5AVF A;  2GJ3 A;  4IUH A;  2GNX A;  2OAQ 1;  4Y3I A;  3T4S A;  5KSH A;  3S7Q A;  1NRJ A;  4L9G A;  2CMN A;  1ZHH B;  3EQV A;  1N9N A;  1DP9 A;  3LI9 A;  1TS8 A;  4G3V A;  2VGL M;  2XRN A;  1W63 Q;  4HY8 A;  3E4O A;  2O9A A;  2VV7 A;  3OCN A;  1GSV A;  3PXP A;  4KQO A;  4LLO B;  1F5M A;  3LR3 A;  1TF1 A;  4WEJ A;  5IT5 A;  4DN0 A;  3BY9 A;  3OCL A;  3D3O A;  2XRO A;  3A0R A;  3CAX A;  4GJ4 A;  4P6Z M;  2WKR A;  3PBR A;  1OTE A;  5TBM B;  1OT9 A;  3LI8 A;  2VX8 A;  4ETX A;  3P7N A;  4ZRR A;  1ODV A;  4BBV A;  1XJ6 A;  5G4Z A;  2JHE A;  3TRC A;  3VV4 A;  4EEP A;  2YKH A;  4YNR A;  3UB8 A;  3ULF A;  1G6O A;  4CLC D;  4B9O A;  3BY8 A;  4R3A A;  2JN7 A;  3H7W B;  1VB6 A;  2VKS A;  5DF9 A;  2QKP A;  2XA7 S;  4MMN A;  2ZMF A;  4CLC A;  3MQO A;  3IS2 A;  1OTB A;  1UGU A;  2PDR A;  3CWF A;  4O0P A;  5K5B A;  5AJG A;  3OBF A;  2FH5 A;  4G3W A;  2VEA A;  3MJQ A;  2KDK A;  4EU0 A;  4QPR A;  4JGR A;  3PBO A;  5HDD A;  4Q0J A;  5F5Y A;  4E04 A;  2P7J A;  4EW7 A;  4H6J A;  3HCY A;  1OJG A;  4KUK A;  2M1C A;  3LR4 A;  4Y2F A;  1XFQ A;  4I39 A;  1P9W A;  1G28 A;  4O8G A;  3KO6 A;  4HQA A;  3BQ8 A;  2HV1 A;  2M7V A;  2W3G A;  1OPX A;  1LL8 A;  4R70 A;  1LSV A;  2VZW A;  2IA2 A;  1OJ5 A;  2L0W A;  3LID A;  4CQH A;  1S4R A;  2JKR I;  4LRX C;  3TE8 A;  2W3E A;  5A8B A;  4II7 A;  5HWT A;  3FPV A;  1XJ2 A;  3K3D A;  4ME4 A;  1DRM A;  2J3W A;  2V1B A;  2KOI A;  3E98 A;  4NXB A;  1STZ A;  3PBT A;  3T4Q A;  3UME A;  5MC7 A;  3T4O A;  2EWW A;  4M4X A;  2K2N A;  4JGP A;  3LR0 A;  2VA0 A;  3KSF A;  1W63 M;  3BQA A;  1OT6 A;  5G4Y A;  1WA9 A;  4ETZ A;  2K7S A;  4HNB A;  3O5Y A;  2EA9 A;  4IHQ A;  2WKQ A;  4IUK A;  3H9W A;  1LT0 A;  1DP8 A;  1V9Z A;  1T19 A;  2A2L A;  5HSQ A;  3G6O A;  4GS9 A;  3MF0 A;  4ARZ B;  5J4E A;  2Z6C A;  2V1A A;  4WEK A;  3ICY A;  1T1C A;  3R7W A;  1N9O A;  2JKT I;  3KSI A;  2QYB A;  1MC0 A;  4GHI B;  5L8M A;  3MR0 A;  4YWZ A;  3H82 A;  3F1P B;  5DJU A;  2BAS A;  4KQD A;  1T1B A;  1S1Z A;  5IS1 A;  3EEH A;  4HIA A;  1Y28 A;  2VGL S;  4I38 A;  4MN6 A;  3A0S A;  3TW8 A;  4EQ1 A;  2O99 A;  4F3L A;  2Z6D A;  2W1T A;  4AFI A;  2G7U A;  4GLQ A;  3HJK A;  2ZOI A;  3T50 A;  1T1A A;  2NUP C;  2W3D A;  1YSQ A;  4XT2 A;  2V9A A;  3FC7 A;  4EUV A;  3F1O A;  1X0O A;  4P6Z S;  1TD5 A;  1D7E A;  3W2Z A;  1OTI A;  4NXE A;  2W27 A;  2XA7 M;  3C8C A;  3NJA A;  3FPW A;  2OWH A;  2VV8 A;  2OAP 1;  2GZA A;  3NOT C;  1OTA A;  1S4S A;  1NLY A;  4L9F A;  1P9R A;  1S66 L;  2PYP A;  3DBA A;  2HF6 A;  2PYR A;  3KSG A;  4GCZ A;  1UWN X;  2P08 A;  3KYZ A;  2DMW A;  4DJ3 A;  2M7U A;  3B42 A;  2QJ5 A;  3VE3 A;  2YKF A;  4L0L A;  2KX6 A;  3PBQ A;  3EWK A;  2QWS A;  1NLZ A;  4K08 A;  2XSS A;  5HZH A;  4RQ9 A;  5TBM A;  4LRZ E;  3OC2 A;  1XFN A;  5KIZ A;  1JNU A;  5IU1 A;  1BYW A;  3PHY A;  2Y79 A;  1H3Q A;  4NKP A;  1EW0 A;  3RFB A;  4Y5F A;  2PD8 A;  2W0N A;  4G3K A;  3S7N A;  3H7W A;  2V0U A;  3CUE A;  3T4T A;  4BMW A;  4MN7 A;  4HH3 A;  3F1N A;  5HPI A;  5HWW A;  3EEA A;  4HP4 A;  4CLC B;  4EES A;  3IS2 B;  3JVU A;  4NEE D;  1V9Y A;  1XJ3 A;  4HHD A;  2ZOH A;  1UWP X;  2A24 B;  2LB5 A;  3UMD A;  2J3T C;  2ZBB A;  2PD7 A;  3C2W A;  4HOI A;  4UEY A;  3B33 A;  4Q0H A;  4HJ4 A;  3OLO A;  2J3T D;  3E4P A;  5HDC A;  3MFX A;  4LPZ A;  3C30 A;  3CLO A;  3KSH A;  3LR5 A;  4I5S A;  4MCW A;  4R38 A;  3GDI A;  3PYP A;  5HPF A;  5LBR A;  4MDZ A;  5EFW A;  2D01 A;  2L4R A;  3LIF A;  2GX5 A;  2L1M A;  2P04 A;  4NXF A;  1VHM A;  2QHK A;  3CUE C;  3C38 A;  3A0V A;  4BBU A;  4EEU A;  3LYX A;  3PR6 A;  2W3H A;  5CX7 A;  5I5L A;  2WKP A;  3JVV A;  4DJ2 A;  3R4K A;  5C5K A;  2NUT C;  3TJZ C;  4YOF A;  2B18 A;  2PT7 A;  3GEC A;  2VV6 A;  4PHT A;  5F69 A;  4WF0 A;  3T4K A;  4JGQ A;  2OOL A;  1NWZ A;  4BWI A;  3MQQ A;  3CI6 A;  3UB7 A;  2V0W A;  2W1R A;  3K2N A;  5F68 A;  4EET B;  3OOV A;  4I3J A;  2HJ9 C;  3CIT A;  2Y8H A;  4BJP A;  4HP9 A;  3PBS A;  1F9I A;  5HD3 A;  4LRY C;  4UQI M;  2O0Y A;  2JKT M;  5HDS A;  3IBR A;  3R7W B;  4GHI A;  4GW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...