1FQGA

Molecular structure of the acyl-enzyme intermediate in tem-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWNPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-1 BETA-LACTAMASE
publication title Molecular structure of the acyl-enzyme intermediate in beta-lactam hydrolysis at 1.7 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fqgA00
4GD8A 1DJBA 4U0XA 4BJPA 1XGIA 3O86A 3IHBA 4QB8A 4PM6A 3ZG9B 5GHZA 2OV5A 4WEKA 2Y4AA 4X55A 5EE8A 1IEMA 2Y2IA 4B4ZA 4E3OA 3BLSA 2ZD8A 2V1ZA 1FQGA 5AQBA 3HLBA 2XLNA 1KE4A 2B5RA 2GDNA 1IYQA 4KQRA 3ZCZA 1EROA 4Q8IA 3BFDA 5E2FA 4K0WA 2DNSA 3MXRA 4DXCA 2G2UA 3IXHA 1Z6FA 2WGWB 3RXXA 4JF4A 5E2HA 1GHPA 3LO7A 4QY6A 2XFTA 2WKHA 1K56A 3HREA 2HP9A 3DW0A 1ESUA 3GSGA 1CI8A 4ZTKA 2I72A 1LL9A 2XK1A 3LCEA 1N9BA 5A92A 1C3BA 1GA9A 4LENA 1GHIA 2OLVA 1EWZA 5EVIB 2QZ6A 1RCJA 4OQ0A 4GDBA 4KZ5A 1ES5A 4MNRA 2A3UA 3WRZA 5FQQA 3HUNA 1XX2A 4S2LA 4YFMA 5JYOA 1YQSA 5DTKA 3SOIA 1GCEA 2VGKA 4JLFA 3VMAA 4DE0A 1FR1A 3G2ZA 1EI5A 3E2LA 2WYXA 2H10A 3BFFA 1O07A 5CEBA 1RP5A 3GV9A 1ALQA 4XUXA 4PM7A 3PBSA 4WEJA 4DDYA 1KGFA 3ZG7B 1LHYA 4XXRA 4BL2A 5HAPA 1K57C 5FATA 2XDMA 1XXMA 4S2NC 2ZM0A 3OPPA 1IYPA 3WWXA 4JXSA 2J7VA 1KDWA 3D4FA 2JE5A 3PBTA 3HLDA 1L0EA 4OP5A 4S2IA 5FAPA 3A3IA 2IWBA 3S22A 4HEFA 4HESA 4X6TA 4LV1A 3Q82A 4OPQA 3Q7ZA 3ZHHA 1XA1A 5IHVA 1ERQA 3HLCA 5JYPA 1JVJA 4FH4A 3WS0A 4GD6A 3ZNTA 3Q7VA 1GA0A 3G4PA 4U0TA 2JBFA 4H8RA 3V50A 2HDRA 2ZJ9A 4FSFA 1KGEA 1K57A 1MY8A 4S2NA 3DWZA 1K4FA 2Y2JA 4ZJ1A 1ONHA 3GVBA 1K4EA 3OCNA 1YLZA 3HBRA 3I7JA 5FDHA 1TVFA 3C4PA 1WYCA 1PZPA 1GHMA 4E3LA 4UA6A 1BLHA 1PI4A 4C75A 3UPOA 2XD1A 5HW3A 3PBOA 3M6HA 5EPHA 5HAQA 4S2JA 1BSGA 4E3NA 1IYSA 2HP6A 4E3JA 3FKVA 1L0FA 4YINA 3MKEA 4HBUA 4KZ9A 3WS4A 1NY0A 4CJNA 2EXBA 3UE1A 1YLPA 2ZQ8A 3ITAA 3MFDA 1HTZA 1HZOA 3FYZA 3VSKA 5GLDA 1PWDA 5TR7A 1K6RA 5CXWA 2WADA 5FQKA 1FR6A 1I5QA 4Y0TA 2EFUA 2HP5A 1MWTA 2V20A 4N9LA 3A3EA 5EVIA 4N92A 4R4SA 3CG5A 3CZDA 4JXVA 2WUQA 3MBZA 1YMSA 3Q7VB 3ITBA 3O87A 1SCWA 2Q9MA 2XF3A 1G68A 3AGEA 3C7VA 3IHAA 4BD1A 3W8KA 1PW1A 4KZ6A 3GQZA 3VOYA 4QHCA 5F1GA 3UDFA 2VGJA 1VQQA 5F1FA 4X53A 2Y2KA 3OZHA 4MBHA 4OPYA 1YM1A 5GHYA 4OPRA 2XH9A 1IELA 4QD4A 4DDSA 5GHXA 1LI0A 2R9XA 1XA7A 3QHYA 4JBFA 2WZZA 5EECA 3UNWA 1ZKJA 1NRFA 4B88A 4P6BA 4S2PA 1CI9A 2Z2LB 3TSGA 3N7WA 4EBPA 3G2YA 3MXSA 1NYYA 2ZQDA 4PMAA 4X69A 5CGSA 5M19A 5HARA 4KG6A 3UPNA 3IQAA 3IT9A 4L0LA 2WKIA 3EQVA 4LV0A 3IF5A 2Y2OA 3BLMA 1K6SA 1LLBA 4UAAA 3SS3A 3NY4A 1E3UA 1SDEA 1XGJA 1ZG4A 1PI5A 4N1HA 4NK3A 3VSLA 3TG9A 2Y2NA 1ES3A 1E25A 3VFFA 3WS2A 5E2GA 4OQIA 4E3MA 3A3FA 4F94A 2DRWA 4BD0A 2WGVA 4DXBA 3MZDA 4Y7PA 1XKZA 5FI7A 3FZCA 3ZGAB 1FCMA 5DF7A 1MWRA 5A90A 3RJUA 5BOHA 1BLPA 3OPLA 4P85A 4WM9A 4EBNA 2X71A 2FFYA 3ZG5A 1JTDA 3MZEA 4WZ5C 5FSRA 3M6BA 3PBRA 3BM6A 3BECA 1KVLA 1OMEA 1W5DA 5FI2A 3ISGA 3O88A 5A93A 5FQMA 1ONGA 3IH9A 2G2WA 3IWOA 2EX9A 3C7UA 4BQMA 4PPRA 1TDLA 3IXGA 1MWSA 2H0TA 5GLAA 4PM8A 4Z9QA 5CECA 4S2KA 2CC1A 3Q1FA 1DJCA 4CPKA 4KQOA 2P9VA 3DTMA 4UHUA 4DKIA 2WK0A 3AGFA 3IF6C 4HBTA 5EVID 1BUEA 1N4OA 1ERMA 1FSYA 3N6IA 3NI9A 3OPRA 4BENA 2EX2A 3Q07A 2V2FF 4GZBA 4WYYA 3UO9A 3QNBA 4JXGA 2J9PA 3OCLA 4WZ5A 2RL3A 2Z2MB 3GMWA 4OP8A 4KZ3A 3V3RA 4R23A 5E43A 4KZBA 1IKGA 4LCLA 4D2OA 4OOYA 1VM1A 5AQ7A 1H5XA 3N8SA 2J8YA 1SHVA 1S6RA 4ZBEA 4ZJ2A 4KENB 2QPNA 1YLYA 3UE0A 3FKWA 3BFEA 2XGNA 3P09A 2ZQAA 3IWQA 1AXBA 2A49A 2P74A 5G18A 5CHJA 3IF6A 2C5WB 1LI9A 3A3DA 1Q2PA 1Q2QA 3V39A 4DE3A 1HD8A 3VP0A 2EX6A 1HVBA 2WZXA 2ZQ9A 4WELA 3LEZA 5M18A 3ZVWA 3WS5A 4FCFA 3UE3A 3ZG0A 1L0GA 1BZAA 1ESIA 3FV7A 4GNUA 2HPBA 4OQHA 2Y55A 4IVIA 5AQAA 3BYDA 1K56D 3V5MA 1SDNA 3OPHA 4P87A 1KE0A 2IWDA 2C6WB 1M6KA 2P9VB 5DF8A 3SH8A 1XP4A 3UDIA 2WAEA 4ZJ3A 1FCNA 3NC8A 1XPBA 4EV4A 2Y2HA 4B4XA 1K38A 5EVLA 3P98A 2ZQCA 3VP1A 1MBLA 5CERA 5FA7A 4IVKA 3EQUA 2Y2MA 2J9OA 1KVMA 4FH2A 1H8ZA 4JPMA 2H0YA 1BLCA 2ZMAA 4KG2A 4KQQA 3MKFA 4N1XA 3UY6A 5J8XA 4Y0OA 2EXAA 3BFCA 3VFHA 4PM5A 1DY6A 1PWGA 5FASA 1NXYA 1PIOA 3OC2A 3N4IA 2ZC7A 3N8LA 4KZAA 1LL5A 1M40A 2DCFA 2IWCA 5CRFA 5DTSA 5I94A 4ID4A 2E8IA 3IF6B 3SS4A 1FCOA 2HDSA 5FQIA 5TFQA 4KZ8A 5HFOA 4GOGA 4E6WA 4N9KA 3BEBA 1YMXA 5KSCA 1K54C 4OONA 4IEDA 1KGGA 4IBRA 5CGWA 1PYYA 2UWXA 4EBLA 5EOOA 1MKIA 1MPLA 1W8YA 4WMCA 3S1YA 1L2SA 2RCXA 3HL9A 3ZVTA 1H8YA 2BG1A 2FFFB 4KZ7A 4QU3A 3NCKA 3SS5A 4DF6A 4WZ4A 2XR0A 3C4OA 1IYOA 2WGIA 3MZFA 1NZOA 3VP4A 2JC7A 3HUMA 2XFSA 2XD5A 5HL1A 1BT5A 3NDGA 2HDQA 1ES2A 3IWIA 3ZDJA 2PU2A 1Y54A 4RX3A 4X68A 1K54A 1L0DA 5CHMA 4GB7A 3AGDA 4OOLA 3PTEA 4MBKA 4RX2A 1W7FA 4OKPA 4R1GA 5FAQA 2ZM8A 5KZHA 4PM9A 4JF5A 5FI6A 3O3VA 2X01A 4RA7A 4DRTA 1DJAA 4S2OA 1RGYA 4OPZA 5CTNA 5FQJA 1ZC2A 4U3TA 3W4QA 3PAGA 1KDSA 2PU4A 4OVDA 3G34A 4OQGA 3UPPA 2ZM2A 3G35A 3IH8A 5DVAA 2Y2PA 5TGFA 3PBQA 3LY4A 2OLUA 4MLLA 5F83A 5AQ9A 3A3JA 5L2FA 1G6AA 4EUZA 1MWUA 5KSHA 3HLWA 4KG5A 3DWKA 1YT4A 3C5AA 4RVAA 5CHUA 4GKUA 1J9MA 3ZFZA 1WYBA 4XUZA 2ZC5B 4QJGA 3PAEA 4LV3A 5U47A 5CEDA 1YLJA 2X02A 4MBFA 5DTTA 4S2MA 3IXBA 2H5SA 5EOEA 4X56A 4E3IA 2Y91A 3HVFA 3NBLA 5HX9A 1I2SA 3GR2A 3TOIA 1NZUA 4IBXA 3BRMA 3GTCA 3FWLA 1BTLA 4ZDXA 4WMCD 1JWVA 1I2WA 1FSWA 5F82A 1JWZA 4O7DA 4R3BA 3VP2A 3WRTA 2WKEA 4UA7A 4JXWA 5DF9A 1TEMA 1BLSA 3NIAA 1CEFA 2OSUA 1PW8A 3UN7A 4LV2A 4RYEA 1WE4A 5KMWA 5HAIA 4GDNA 4FD8A 2Q9NA 4KZ4A 4EWFA 1JTGA 3HLFA 3QNCA 3V3SA 2ZC6B 5EUAA 1KE3A 4E3KA 1RGZA 4LCMA 4K0XA 3ZG8B 3VP3A 5GLBA 1MXOA 1E3UD 3N8RA 5D3OA 5GL9A 1TDGA 4A5RA 2Y59A 2Y2GA 4R4RA 4Y0UA 4OH0A 1S0WA 2Y2QA 3CMZA 1K55C 3CJMA 4JF6A 5FQ9A 4QY5A 3RXWA 2WAFA 2ZLYA 4UA9A 1YLTA 1W79A 3PBNA 3NDEA 4C3QA 2XQZA 2R9WA 1YLWA 2JCHA 1K25A 2HDUA 2BLSA 3W4PA 4ZAMA 3W4OA 5EVIC 2ZC3B 4WBGA 3G31A 1ES4A 5CTMA 4OLGA 4R0QA 4K91A 1NYMA 2Y2LA 5FAOA 1CK3A 2QMIA 3LY3A 1FOFA 2XEPA 1QMEA 3IXDA 4GN2A 5CGXA 1O7EA 2EX8A 3Q81A 1PWCA 1K55A 5A91A 2WGWA 2EFXA 5E2EA 3VOZA 3WS1A 3GRJA 3UDXA 3S4XA 3G30A 3HLEA 4R3JA 5M1AA 1BULA 4E6XA 3M2KA 3M2JA 1ZG6A 2ZQ7A 3JYIA 3HLGA 4OOMA 4M3KA 1PZOA 4BL3A 4JKTA 4P0MA 3E2KA 1JWPA 2ZC4B 1W8QA 1U60A 3BFGA 3G32A 3SH7A 1QMFA 1E4DA 2PBYA 1SKFA 4MEZA 3ZNYA 4OLDA 4NETA 5GLCA 1NJ4A 1CEGA 3B3XA 3HUOA 3SH9A 4DE2A 4DE1A 4EQIA 4BLMA 4C6YA 1IKIA
chains in the Genus database with same CATH superfamily
1D1JA 3O5YA 3IHBA 2XRNA 5GHZA 2YKFA 2Y2IA 4L9GA 5AQBA 1KE4A 2B5RA 1IYQA 3MXRA 3IXHA 1Z6FA 2FH5A 4QY6A 2XFTA 2WKHA 2JKGA 3DW0A 1ESUA 2I72A 1LL9A 3KYZA 5A92A 2QZ6A 1RCJA 4GDBA 4KZ5A 1ES5A 4MNRA 5L10A 4O8GA 1YQSA 3SOIA 1CQAA 2JN7A 4D60A 2H10A 4XUXA 3OOVA 3EOIA 3K3DA 5HAPA 2XDMA 2R78A 5AVFA 2P04A 3D4FA 3HLDA 1X0OA 1OTAA 3QP6A 4OPQA 3Q7ZA 3ZHHA 4U0TA 2HDRA 2ZJ9A 4FSFA 4KUOA 2Y2JA 4ETXA 4E3LA 4S2JA 3K3CA 5AVEA 1L0FA 3MKEA 4HBUA 3WS4A 1NY0A 4CJNA 2EXBA 4DN0A 3UE1A 2PT7A 2ZQ8A 3ITAA 3CITA 1HZOA 2OOLA 1K6RA 2PR6A 5CXWA 2WADA 3TRCA 4Y0TA 2EFUA 1MWTA 5J3WA 4N9LA 3LIDA 4N92A 3CG5A 3C2WA 3Q7VB 3O87A 4QPRA 2Q9MA 3AGEA 1OJGA 1JNUA 3IHAA 3W8KA 1PW1A 3LGOA 3R4KA 1VQQA 2Y2KA 4OPYA 5GHYA 3PHYA 1IELA 1LI0A 1ZTUA 3NHQA 5EECA 1ZKJA 1NRFA 2VKSA 3MXSA 5M19A 4KG6A 3IQAA 3EQVA 2Y2OA 4UAAA 3NY4A 1E3UA 1ZG4A 3IBRA 1PI5A 2OAQ1 1E25A 4B9OA 4Y13A 4BD0A 1P9WA 4DMZA 1TS0A 1XKZA 3RJUA 5BOHA 4HH2A 4WM9A 1Y4OA 4P85A 5HPIA 5IS1A 4EBNA 1JTDA 4WZ5C 3BM6A 4II7A 3O88A 5A93A 5FQMA 3OLOA 3IWOA 2EX9A 3C7UA 4PPRA 1TDLA 3IXGA 2QYBA 5GLAA 3ZYTA 2CC1A 1OTDA 2WKRA 3BY8A 4KQOA 2P9VA 4GCZA 1GSVA 3N6IA 5DKKA 2G7UA 4HIAA 4EETB 2V2FF 4WZ5A 2RL3A 1P9RA 1LSXA 5E43A 4D2OA 1VM1A 5AQ7A 1H5XA 3JVUA 4ZJ2A 1S6RA 1PRQA 4ZBEA 4HNBA 1YLYA 3UE0A 3FKWA 3HJIA 3P09A 3IWQA 2A49A 3NECA 5CHJA 2V1BA 1LI9A 4DE3A 1HD8A 1V9ZA 3VP0A 1HVBA 2WZXA 4WELA 3WS5A 4G3KA 2OWJA 3FV7A 2HPBA 4R70A 3T4QA 3V5MA 2W3GA 3SH8A 1XP4A 4ZJ3A 3VOLA 3KSIA 3NC8A 3EGDC 4EV4A 2ZQCA 2XSSA 3VP1A 4IVKA 3EQUA 1H8ZA 4JPMA 1J3WA 1BLCA 3MKFA 1DP9A 2EXAA 3BFCA 2EWVA 3N4IA 2ZC7A 2DCFA 4ID4A 5EV0A 1LSWA 2V1AA 4E6WA 4QWOA 3BEBA 4IEDA 2P08A 1YPRA 2HF6A 1W8YA 2EA9A 1H8YA 3H82B 4KZ7A 5EFWA 3LIAA 3F1PB 3MZFA 2WGIA 1LSVA 5DKLA 2XFSA 4XT2B 1BT5A 3IWIA 3ZDJA 3S7NA 5HZHA 2PD7A 4MCWA 3B42A 3B47A 2O0YA 4MBKA 2GZAA 1L3LA 1VETA 2ZM8A 4X1LA 4OPZA 3PAGA 1MZUA 3CPTA 2HV1A 2GNXA 3A3JA 1MWUA 4PKYG 3DTIA 3HLWA 1DRMA 4KG5A 1YT4A 3C5AA 4BBUA 4Q0HA 2ZL1A 1GSXA 1J9MA 1CF0A 2O99A 1WYBA 4XUZA 2ZC5B 1V9YA 4LV3A 5U47A 1YLJA 3L9KA 5DTTA 3QP8A 2J80A 1D06A 1H8MA 3GR2A 3GTCA 1BTLA 2W3EA 3D3OA 1CEFA 1T1CA 3C30A 3LIFA 3R7WA 4KZ4A 5HDSA 3DTKA 3V3SA 3ZG8B 3CI6A 5GL9A 2Y59A 4Y0UA 3UB7A 3LUQA 1S0WA 1K55C 4MN6A 3RXWA 3U2AA 2WAFA 2ZLYA 4LGWA 1WA9A 4C3QA 3F1OA 1YLWA 4AFIA 4IJGA 3UB9A 2HDUA 4EU0A 3W4OA 1EW0A 5EVIC 1S4RA 5CTMA 4R0QA 2E8JA 5FAOA 3LY3A 4E04A 3KYEA 2L0WA 2XEPA 4GN2A 3IXDA 1O7EA 1K55A 2EFXA 3WS1A 1D7EA 3GRJA 3FC7A 3S4XA 3G30A 2Z6CA 3HLEA 4R3JA 4RQ9A 3GECA 3JYIA 3HLGA 4M3KA 1PZOA 3T4OA 4BL3A 1S66L 4MMNA 2HJ9C 3E2KA 2ZC4B 1W8QA 1OTEA 2VA0A 1OTBA 2PBYA 4MEZA 4DE2A 4DE1A 1G6OA 4GD8A 2KOIA 4I38A 4QB8A 3ZG9B 2NUPC 4WEKA 4X55A 4B4ZA 3IX8A 2OAP1 2ZD8A 4PKYA 1FQGA 1XFQA 4KQRA 3EGXC 5FL3A 4CLCC 4DXCA 2G2UA 2WGWB 4HOIA 1H3QA 5E2HA 3MF0A 3HREA 1VEUB 1OT9A 3PYPA 2XK1A 2HZ5A 4WLAA 3IX4A 2Q0OA 3WRZA 2W3HA 3HUNA 2VLGA 4CLCA 4Q0JA 4JLFA 1FR1A 2QJ5A 2WYXA 3UB6A 3BFFA 1RP5A 3GV9A 1STZA 1ALQA 1IFQA 3K2NA 4WEJA 3ZG7B 1LHYA 1K57C 5FATA 1P97A 1XXMA 5EVEA 2J7VA 1KDWA 3PBTA 4S2IA 5FAPA 4LRZE 1SKOB 2IWBA 4HEFA 4LV1A 1XJ4A 2B95A 3Q82A 1F98A 3CWFA 3HLCA 4FH4A 1YSQA 2PBDP 1GA0A 4H6JB 2JBFA 2K31A 1K57A 4LLOB 3OCNA 3I7JA 1WYCA 3UPOA 1PI4A 4IUKA 5MC7A 3M6HA 3T4TA 1BSGA 3T1QB 5FEFA 4KZ9A 3JVVA 3T1XA 2JKFA 3FYZA 3MMHA 4CLCD 2DMWA 2HP5A 3RH8B 2WUQA 5TBMA 4KZ6A 3GQZA 3VOYA 2VGJA 3UE6A 3OZHA 4MBHA 1YM1A 4LRXC 2XH9A 4DDSA 4GHIB 2M7VA 3MQQA 1XA7A 2B02A 3QHYA 4B88A 3IS2B 3N7WA 3G2YA 4X69A 3IT9A 4L0LA 4LV0A 3A0SA 2A2LA 2VJWA 3SS3A 1UGUA 3LR5A 3VSLA 4N1HA 4O01A 3TG9A 1ES3A 3WS2A 4ME4A 4E3MA 3MZDA 5FI7A 5G4YA 5A90A 4GW9A 1BLPA 3OPLA 2JKTI 4KUKA 2PYPA 4DJ3A 5FI2A 4MDZA 4ARZB 3A0VA 1ONGA 4BQMA 2VX8A 4I3IA 4Z9QA 3Q1FA 4CPKA 2ZMVA 5LBRA 4DKIA 4X25A 3IF6C 1BUEA 3NI9A 3OPRA 3UMDA 4WYYA 3UO9A 2EWWA 4JXGA 2Z2MB 3GMWA 4I39A 1IKGA 1OPXA 4KENB 2XGNA 2V0UA 1AXBA 5G18A 3BWLA 3IF6A 1XFNA 2ACGA 2EX6A 2XROA 3T50A 1ESIA 4NEED 2Y55A 5AQAA 2K7SA 1SDNA 2D01A 2IWDA 3G6OA 1M6KA 1BYWA 1FCNA 1XPBA 5CERA 2J9OA 2H0YA 3FPVA 4GS9A 4EQ1A 1DY6A 4HI4A 5L09A 3CLOA 4KZAA 4JGRA 1LL5A 1M40A 2IWCA 5CRFA 5HL6A 1K0KA 3OBFA 3SS4A 1FCOA 5TFQA 4KZ8A 4N9KA 2A24B 1YMXA 1K54C 1PNEA 4G3WA 1KGGA 5CGWA 2UWXA 5EOOA 1MKIA 3S1YA 2QJ7A 5HD5A 2FFFB 5I5LA 3SS5A 2P7JA 1KOUA 2O9CA 2XD5A 5L07A 4R3AA 2INWA 4RX3A 1K54A 2W0NA 3DAVA 4F3LA 4GB7A 3KSFA 3F1NA 4HQAA 4RX2A 2CMNA 2QHKA 4PM9A 3O3VA 3QP2A 4HJ6A 4DRTA 1DJAA 4S2OA 1KDSA 2PU4A 3UMEA 2ZM2A 2Y2PA 3TE8A 3LY4A 2OLUA 4CLCE 3H7WA 5L2FA 3D9YA 4GLQA 3DWKA 1F5MA 4RVAA 4GKUA 3T4JA 3ZFZA 3U4LP 4NXGA 2X02A 2VV7A 3IXBA 2H5SA 4X56A 4E3IA 5HX9A 4GJ4A 3VE3A 3TOIA 3BRMA 3FWLA 3LR0A 5F82A 3T4LA 5TJJA 3NOTC 1BLSA 2OSUA 4LV2A 4RYEA 1WE4A 5HAIA 3FPWA 4GDNA 4FD8A 3HLFA 2ZC6B 5EUAA 5GLBA 1E3UD 3N8RA 3MQOA 1PFLA 1TDGA 4NG2A 4R4RA 3MSHA 3CMZA 4JF6A 2IA2A 5FQ9A 4UA9A 1YLTA 1W79A 4P6ZS 3LI9A 3H9WA 3E4QA 4JGPA 4ZAMA 1DP8A 3BJNA 3LR4A 1NYMA 1FOFA 2EX8A 5A91A 4HH3A 1TD5A 3UDXA 1BULA 2W1TB 2KLIA 4OOMA 3V67A 4JKTA 1JWPA 1U60A 3BFGA 4X1MA 2O9AA 3SH7A 1E4DA 3HUOA 5G4ZA 1DJBA 4PHTA 2OV5A 2PR5A 3KO6A 2Y4AA 1IEMA 2W1RA 3HLBA 2XLNA 2GDNA 3ZCZA 3BFDA 5E2FA 4K0WA 3TW8A 3RXXA 4JF4A 1W63Q 1GHPA 2B18A 2W27A 3LO7A 1N9OA 1K56A 4CQHA 2HP9A 3GSGA 1CI8A 4ZTKA 1N9BA 1C3BA 2OLVA 4IUHA 1XX2A 4YFMA 3LICA 5JYOA 2VGKA 4DE0A 3VMAA 3IX3A 4EEUA 5K5BA 1O07A 2PDRA 4BWIA 3PBSA 1KGFA 1OJ5A 4BL2A 5FDSA 1S1ZA 3OPPA 1IYPA 3WWXA 4JXSA 1Y28A 2JE5A 1L0EA 3BY9A 4OP5A 4HESA 4X6TA 2VV8A 3T1SA 5IHVA 3MR0A 5JYPA 3WS0A 3Q7VA 3SZTA 1KGEA 4UQIS 3DWZA 4ZJ1A 4NXFA 3GVBA 1K4EA 3HBRA 1NRJA 3C4PA 4UA6A 1BLHA 4C75A 1FILA 1GSWA 5EPHA 5HAQA 1IYSA 4E3JA 3FKVA 2V0WA 5F6AA 1YLPA 3MFDA 1HTZA 5HD3A 3VSKA 5GLDA 1PWDA 5TR7A 4HP4A 1I5QA 1N9LA 2UV0E 1XJ2A 2JKTM 3A3EA 5EVIA 3CZDA 4JXVA 3MBZA 1YMSA 4Y3IA 3ITBA 1SCWA 2HGVA 2XF3A 1G68A 3C7VA 3QP4A 1OTIA 3NOUC 5F1FA 4X53A 4FUWA 2GX5A 4OPRA 4QD4A 5GHXA 3P01A 3UNWA 4P6BA 4YNRA 1CI9A 2Z2LB 5CX7A 3TSGA 4PMAA 1NYYA 2ZQDA 5CGSA 5HARA 3UPNA 1OT6A 3NULA 3E0YA 3IF5A 3NJAA 3BLMA 1SDEA 4NK3A 2Y2NA 5IT5A 1VHMA 4F94A 2WGVA 4DXBA 3LYXA 3FZCA 5EM1A 1MWRA 4ZRRA 4JGOA 3ZG5A 3MZEA 4HHDA 5FSRA 3M6BA 3PBRA 5C5KA 1W5DA 3ISGA 3QP1A 3LIEA 1T18A 2G2WA 3VE4A 1MWSA 2ZOHA 4EESA 3DTMA 5DFXA 4HBTA 5EVID 1FSYA 5F68A 2EX2A 3ULFA 4BENA 4GZBA 3OCLA 3V3RA 4R23A 4O0PA 4Z1WA 1SHVA 2QPNA 3C38A 3LEQA 4PAUA 2P74A 3RTYA 2C5WB 2QKPA 3A3DA 1Q2QA 3LEZA 1T1BA 1F2KA 1UWPX 4FCFA 3UE3A 1L0GA 4HJ4A 1BZAA 3H82A 2LB9A 4IVIA 3F1PA 3BYDA 2D02A 4P87A 1KE0A 1Z09A 2C6WB 4XT2A 2P9VB 5DF8A 2WAEA 3LFVA 3LI8A 4ESPA 4B4XA 5EVLA 3P98A 1MBLA 3T1RA 2Y2MA 1KVMA 2FZ0A 3QP5A 4KG2A 4KQQA 3S7QA 3UY6A 4EXOA 1PWGA 4FTXA 5EM0A 2YKHA 3N8LA 5DTSA 3E4PA 2XA7S 5I94A 3MFXA 5FQIA 5HFOA 3E98A 4GOGA 5KSCA 2JKRM 4WMCA 1CJFA 4QU3A 4K08A 2XR0A 3T4SA 1NZOA 3VP4A 2JC7A 3A0RA 3HUMA 1FIKA 1ES2A 4BMWA 1LT0A 2PU2A 4Y5FA 5CHMA 2VK3A 3AGDA 4OOLA 4OKPA 3KSHA 2V9AA 5FI6A 2X01A 4RA7A 5DJTA 1ZC2A 4U3TA 1DP6A 4OVDA 3G34A 5DVAA 4ETZA 3PBQA 4MLLA 1NLYA 1G6AA 2VGLS 4EUZA 3CHWP 5CHUA 4WF0A 3EWKA 3HCYA 2MJ6A 2M7UA 4HP9A 3HVFA 3NBLA 4ZDXA 4WMCD 3VP2A 1FSWA 2V8FA 3WRTA 4O7DA 4R3BA 4EERA 1VETB 4UA7A 1VB6A 1TEMA 3NIAA 2KX6A 5KMWA 2ZBBA 2Q9NA 1P0ZA 4EWFA 1JTGA 3QNCA 3CPTB 1KE3A 1RGZA 4K0XA 2JHEA 1LL8A 2Y2QA 1T19A 4Y2FA 2ZL1B 4FOFA 1A0KA 1ZHHB 2NUTC 3PBNA 3NDEA 2XQZA 4EEPA 2JCHA 1K25A 3W4PA 2QWSA 4Y15A 1ES4A 4OLGA 4K91A 2Y2LA 1QMEA 3Q81A 1PWCA 2WGWA 3VOZA 5E2EA 2AVXA 5M1AA 3M2KA 1VEUA 3T4KA 1ZG6A 4HY8A 3R7WB 4P6ZM 3G32A 2ZOIA 1S1YA 1SKFA 4MN5A 4OLDA 1NJ4A 1CEGA 3B3XA 3SH9A 4BLMA 4C6YA 3LIBA 4U0XA 4BJPA 1XGIA 3F1OB 1ACFA 3O86A 5FEGA 4PM6A 1F9IA 5EE8A 4E3OA 2PYRA 3BLSA 2V1ZA 1EROA 4Q8IA 4LFUA 2L4RA 2DNSA 3W2ZA 3D72A 1SKOA 5F69A 4KQDA 2PAVP 3LCEA 1GA9A 4LENA 1GHIA 1EWZA 5EVIB 4OQ0A 4H6JA 2A3UA 2JKRI 5FQQA 4S2LA 5DTKA 1GCEA 2Y79A 3G2ZA 4LRYC 2J3TC 1EI5A 3KYQA 3E2LA 4WUJA 5CEBA 4PM7A 4DDYA 4XXRA 2I9VA 4S2NC 5HPFA 2ZM0A 4WN5A 3KSGA 2PRFA 3A3IA 4NKPA 3S22A 4EUVA 4R38A 3NOPC 1XA1A 1ERQA 2PHYA 1JVJA 4GD6A 3ZNTA 3G4PA 4H8RA 3V50A 2Z6DA 3MJQA 4Q0IA 1MY8A 4Y17A 4S2NA 1K4FA 1ONHA 3KX0X 4CLCB 1YLZA 5FDHA 1TVFA 1PZPA 1GHMA 4GHIA 2XD1A 3UB5P 1H0MA 5HW3A 3PBOA 4E3NA 2HP6A 4YINA 3IS2A 4L9FA 5HWTA 3ICYA 5FQKA 5HDCA 1N9NA 1FR6A 4UEYA 4UQIM 2V20A 2V8CA 1TF1A 4R4SA 1SZVA 4BD1A 2ZMFA 4QHCA 5F1GA 3UDFA 2W3FA 4ARZA 4HJ3A 3TJZC 5HSQA 3PXPA 2R9XA 2J3TD 3DBAA 4JBFA 2WZZA 4S2PA 4EBPA 1S4SA 2WKIA 2OWHA 3JPUA 1K6SA 1LLBA 1XGJA 1S67L 3E4OA 3VFFA 5E2GA 4G3VA 4OQIA 4I5SA 3S7PA 3A3FA 1TS6A 2DRWA 4Y7PA 3ZGAB 1FCMA 5DF7A 5TBMB 2VZWA 2X71A 2FFYA 3UB8A 3BECA 1KVLA 1OMEA 2PD8A 3IH9A 2HJEA 4NXBA 2H0TA 4PM8A 3CUEC 5CECA 4S2KA 1DJCA 5AJGA 4UHUA 2WK0A 3AGFA 1N4OA 1ERMA 3Q07A 1YSPA 3QNBA 2J9PA 4I3AA 3LR3A 4OP8A 4KZ3A 4KZBA 4LCLA 4OOYA 3N8SA 2J8YA 1MC0A 3CUEA 3BFEA 5HWWA 2ZQAA 2L1MA 1Q2PA 3V39A 1W63M 2A24A 2O9BA 2ZQ9A 5M18A 3ZVWA 4NXEA 3ZG0A 4OQHA 4GNUA 2Y8HA 1K56D 3OPHA 3UDIA 1NLZA 4LPZA 2Y2HA 1K38A 5FA7A 3BQAA 4FH2A 2ZMAA 2W3DA 1TS8A 3VV4A 4N1XA 5J8XA 4Y0OA 3VFHA 4PM5A 5FASA 1NXYA 1PIOA 3OC2A 4EW7A 2E8IA 3IF6B 5A8BA 2HDSA 1HLUP 4BBTA 4OONA 4IBRA 1PYYA 2VV6A 4EBLA 1MPLA 1L2SA 2RCXA 3HL9A 3S7OA 3ZVTA 1ODVA 2BG1A 3NCKA 4DF6A 4WZ4A 3C4OA 1IYOA 2KDKA 3P7NA 5KIZA 5HL1A 3NDGA 2HDQA 4I3JA 5DFYA 1Y54A 3L7HA 4R6LA 4BBVA 4X68A 2XA7M 2H28A 1L0DA 1YAXA 3DTEA 4GS9B 3PTEA 1W7FA 4R1GA 5FAQA 2LB5A 5KZHA 3MXQA 4JF5A 3GDIA 2VEAA 1RGYA 3SW1A 3FG8A 5CTNA 5FQJA 3W4QA 1AWIA 4OQGA 3UPPA 3G35A 4DJ2A 3IH8A 5TGFA 4MN7A 5F83A 5AQ9A 5KSHA 3EEAA 3MS6A 1XJ6A 3T12B 3CAXA 4QJGA 3PAEA 2J3WA 5CEDA 4MBFA 4S2MA 2K2NA 1TS7A 5EOEA 5HDDA 1YKDA 3B33A 2Y91A 3PR6A 4F3LB 1I2SA 1NZUA 3F1NB 4IBXA 1IOUA 1JWVA 1I2WA 1JWZA 4B93A 2WKEA 1T1AA 4JXWA 5L8MA 5DF9A 3UN7A 1PW8A 1NWZA 2VGLM 1XJ3A 1G28A 2W1TA 3BQ8A 4E3KA 4LCMA 3VP3A 5J4EA 3H7WB 2BTFP 1MXOA 5D3OA 2WKPA 4A5RA 2Y2GA 4OH0A 3ZQ5A 3CJMA 4WL9A 5F5YA 5IU1A 4QY5A 3C8CA 2WKQA 2R9WA 1UWNX 3MQ0A 2BLSA 2GJ3A 5J7EA 2ZC3B 4WBGA 3G31A 5DJUA 1CK3A 2QMIA 2BASA 5CGXA 5HWVA 4IHQA 4E6XA 3HJKA 3M2JA 2ZQ7A 3RFBA 2M1CA 3BW6A 4YOFA 4YWZA 4M4XA 4P0MA 1MKMA 1G5UA 3EEHA 1QMFA 4L9EA 3IBJA 3ZNYA 5GLCA 4NETA 4JGQA 4EQIA 1IKIA
chains in the Genus database with same CATH topology
4GD8A 1DJBA 4U0XA 4BJPA 1XGIA 3O86A 3IHBA 4QB8A 4PM6A 3ZG9B 5GHZA 2OV5A 4WEKA 2Y4AA 4X55A 5EE8A 1IEMA 2Y2IA 4B4ZA 4E3OA 3BLSA 2ZD8A 2V1ZA 1FQGA 5AQBA 3HLBA 2XLNA 1KE4A 2B5RA 2GDNA 1IYQA 4KQRA 3ZCZA 1EROA 4Q8IA 3BFDA 5E2FA 4K0WA 2DNSA 3MXRA 4DXCA 2G2UA 3IXHA 1Z6FA 2WGWB 3RXXA 4JF4A 5E2HA 1GHPA 3LO7A 4QY6A 2XFTA 2WKHA 1K56A 3HREA 2HP9A 3DW0A 1ESUA 3GSGA 1CI8A 4ZTKA 2I72A 1LL9A 2XK1A 3LCEA 1N9BA 5A92A 1C3BA 1GA9A 4LENA 1GHIA 2OLVA 1EWZA 5EVIB 2QZ6A 1RCJA 4OQ0A 4GDBA 4KZ5A 1ES5A 4MNRA 2A3UA 3WRZA 5FQQA 3HUNA 1XX2A 4S2LA 4YFMA 5JYOA 1YQSA 5DTKA 3SOIA 1GCEA 2VGKA 4JLFA 3VMAA 4DE0A 1FR1A 3G2ZA 1EI5A 3E2LA 2WYXA 2H10A 3BFFA 1O07A 5CEBA 1RP5A 3GV9A 1ALQA 4XUXA 4PM7A 3PBSA 4WEJA 4DDYA 1KGFA 3ZG7B 1LHYA 4XXRA 4BL2A 5HAPA 1K57C 5FATA 2XDMA 1XXMA 4S2NC 2ZM0A 3OPPA 1IYPA 3WWXA 4JXSA 2J7VA 1KDWA 3D4FA 2JE5A 3PBTA 3HLDA 1L0EA 4OP5A 4S2IA 5FAPA 3A3IA 2IWBA 3S22A 4HEFA 4HESA 4X6TA 4LV1A 3Q82A 4OPQA 3Q7ZA 3ZHHA 1XA1A 5IHVA 1ERQA 3HLCA 5JYPA 1JVJA 4FH4A 3WS0A 4GD6A 3ZNTA 3Q7VA 1GA0A 3G4PA 4U0TA 2JBFA 4H8RA 3V50A 2HDRA 2ZJ9A 4FSFA 1KGEA 1K57A 1MY8A 4S2NA 3DWZA 1K4FA 2Y2JA 4ZJ1A 1ONHA 3GVBA 1K4EA 3OCNA 1YLZA 3HBRA 3I7JA 5FDHA 1TVFA 3C4PA 1WYCA 1PZPA 1GHMA 4E3LA 4UA6A 1BLHA 1PI4A 4C75A 3UPOA 2XD1A 5HW3A 3PBOA 3M6HA 5EPHA 5HAQA 4S2JA 1BSGA 4E3NA 1IYSA 2HP6A 4E3JA 3FKVA 1L0FA 4YINA 3MKEA 4HBUA 4KZ9A 3WS4A 1NY0A 4CJNA 2EXBA 3UE1A 1YLPA 2ZQ8A 3ITAA 3MFDA 1HTZA 1HZOA 3FYZA 3VSKA 5GLDA 1PWDA 5TR7A 1K6RA 5CXWA 2WADA 5FQKA 1FR6A 1I5QA 4Y0TA 2EFUA 2HP5A 1MWTA 2V20A 4N9LA 3A3EA 5EVIA 4N92A 4R4SA 3CG5A 3CZDA 4JXVA 2WUQA 3MBZA 1YMSA 3Q7VB 3ITBA 3O87A 1SCWA 2Q9MA 2XF3A 1G68A 3AGEA 3C7VA 3IHAA 4BD1A 3W8KA 1PW1A 4KZ6A 3GQZA 3VOYA 4QHCA 5F1GA 3UDFA 2VGJA 1VQQA 5F1FA 4X53A 2Y2KA 3OZHA 4MBHA 4OPYA 1YM1A 5GHYA 4OPRA 2XH9A 1IELA 4QD4A 4DDSA 5GHXA 1LI0A 2R9XA 1XA7A 3QHYA 4JBFA 2WZZA 5EECA 3UNWA 1ZKJA 1NRFA 4B88A 4P6BA 4S2PA 1CI9A 2Z2LB 3TSGA 3N7WA 4EBPA 3G2YA 3MXSA 1NYYA 2ZQDA 4PMAA 4X69A 5CGSA 5M19A 5HARA 4KG6A 3UPNA 3IQAA 3IT9A 4L0LA 2WKIA 3EQVA 4LV0A 3IF5A 2Y2OA 3BLMA 1K6SA 1LLBA 4UAAA 3SS3A 3NY4A 1E3UA 1SDEA 1XGJA 1ZG4A 1PI5A 4N1HA 4NK3A 3VSLA 3TG9A 2Y2NA 1ES3A 1E25A 3VFFA 3WS2A 5E2GA 4OQIA 4E3MA 3A3FA 4F94A 2DRWA 4BD0A 2WGVA 4DXBA 3MZDA 4Y7PA 1XKZA 5FI7A 3FZCA 3ZGAB 1FCMA 5DF7A 1MWRA 5A90A 3RJUA 5BOHA 1BLPA 3OPLA 4P85A 4WM9A 4EBNA 2X71A 2FFYA 3ZG5A 1JTDA 3MZEA 4WZ5C 5FSRA 3M6BA 3PBRA 3BM6A 3BECA 1KVLA 1OMEA 1W5DA 5FI2A 3ISGA 3O88A 5A93A 5FQMA 1ONGA 3IH9A 2G2WA 3IWOA 2EX9A 3C7UA 4BQMA 4PPRA 1TDLA 3IXGA 1MWSA 2H0TA 5GLAA 4PM8A 4Z9QA 5CECA 4S2KA 2CC1A 3Q1FA 1DJCA 4CPKA 4KQOA 2P9VA 3DTMA 4UHUA 4DKIA 2WK0A 3AGFA 3IF6C 4HBTA 5EVID 1BUEA 1N4OA 1ERMA 1FSYA 3N6IA 3NI9A 3OPRA 4BENA 2EX2A 3Q07A 2V2FF 4GZBA 4WYYA 3UO9A 3QNBA 4JXGA 2J9PA 3OCLA 4WZ5A 2RL3A 2Z2MB 3GMWA 4OP8A 4KZ3A 3V3RA 4R23A 5E43A 4KZBA 1IKGA 4LCLA 4D2OA 4OOYA 1VM1A 5AQ7A 1H5XA 3N8SA 2J8YA 1SHVA 1S6RA 4ZBEA 4ZJ2A 4KENB 2QPNA 1YLYA 3UE0A 3FKWA 3BFEA 2XGNA 3P09A 2ZQAA 3IWQA 1AXBA 2A49A 2P74A 5G18A 5CHJA 3IF6A 2C5WB 1LI9A 3A3DA 1Q2PA 1Q2QA 3V39A 4DE3A 1HD8A 3VP0A 2EX6A 1HVBA 2WZXA 2ZQ9A 4WELA 3LEZA 5M18A 3ZVWA 3WS5A 4FCFA 3UE3A 3ZG0A 1L0GA 1BZAA 1ESIA 3FV7A 4GNUA 2HPBA 4OQHA 2Y55A 4IVIA 5AQAA 3BYDA 1K56D 3V5MA 1SDNA 3OPHA 4P87A 1KE0A 2IWDA 2C6WB 1M6KA 2P9VB 5DF8A 3SH8A 1XP4A 3UDIA 2WAEA 4ZJ3A 1FCNA 3NC8A 1XPBA 4EV4A 2Y2HA 4B4XA 1K38A 5EVLA 3P98A 2ZQCA 3VP1A 1MBLA 5CERA 5FA7A 4IVKA 3EQUA 2Y2MA 2J9OA 1KVMA 4FH2A 1H8ZA 4JPMA 2H0YA 1BLCA 2ZMAA 4KG2A 4KQQA 3MKFA 4N1XA 3UY6A 5J8XA 4Y0OA 2EXAA 3BFCA 3VFHA 4PM5A 1DY6A 1PWGA 5FASA 1NXYA 1PIOA 3OC2A 3N4IA 2ZC7A 3N8LA 4KZAA 1LL5A 1M40A 2DCFA 2IWCA 5CRFA 5DTSA 5I94A 4ID4A 2E8IA 3IF6B 3SS4A 1FCOA 2HDSA 5FQIA 5TFQA 4KZ8A 5HFOA 4GOGA 4E6WA 4N9KA 3BEBA 1YMXA 5KSCA 1K54C 4OONA 4IEDA 1KGGA 4IBRA 5CGWA 1PYYA 2UWXA 4EBLA 5EOOA 1MKIA 1MPLA 1W8YA 4WMCA 3S1YA 1L2SA 2RCXA 3HL9A 3ZVTA 1H8YA 2BG1A 2FFFB 4KZ7A 4QU3A 3NCKA 3SS5A 4DF6A 4WZ4A 2XR0A 3C4OA 1IYOA 2WGIA 3MZFA 1NZOA 3VP4A 2JC7A 3HUMA 2XFSA 2XD5A 5HL1A 1BT5A 3NDGA 2HDQA 1ES2A 3IWIA 3ZDJA 2PU2A 1Y54A 4RX3A 4X68A 1K54A 1L0DA 5CHMA 4GB7A 3AGDA 4OOLA 3PTEA 4MBKA 4RX2A 1W7FA 4OKPA 4R1GA 5FAQA 2ZM8A 5KZHA 4PM9A 4JF5A 5FI6A 3O3VA 2X01A 4RA7A 4DRTA 1DJAA 4S2OA 1RGYA 4OPZA 5CTNA 5FQJA 1ZC2A 4U3TA 3W4QA 3PAGA 1KDSA 2PU4A 4OVDA 3G34A 4OQGA 3UPPA 2ZM2A 3G35A 3IH8A 5DVAA 2Y2PA 5TGFA 3PBQA 3LY4A 2OLUA 4MLLA 5F83A 5AQ9A 3A3JA 5L2FA 1G6AA 4EUZA 1MWUA 5KSHA 3HLWA 4KG5A 3DWKA 1YT4A 3C5AA 4RVAA 5CHUA 4GKUA 1J9MA 3ZFZA 1WYBA 4XUZA 2ZC5B 4QJGA 3PAEA 4LV3A 5U47A 5CEDA 1YLJA 2X02A 4MBFA 5DTTA 4S2MA 3IXBA 2H5SA 5EOEA 4X56A 4E3IA 2Y91A 3HVFA 3NBLA 5HX9A 1I2SA 3GR2A 3TOIA 1NZUA 4IBXA 3BRMA 3GTCA 3FWLA 1BTLA 4ZDXA 4WMCD 1JWVA 1I2WA 1FSWA 5F82A 1JWZA 4O7DA 4R3BA 3VP2A 3WRTA 2WKEA 4UA7A 4JXWA 5DF9A 1TEMA 1BLSA 3NIAA 1CEFA 2OSUA 1PW8A 3UN7A 4LV2A 4RYEA 1WE4A 5KMWA 5HAIA 4GDNA 4FD8A 2Q9NA 4KZ4A 4EWFA 1JTGA 3HLFA 3QNCA 3V3SA 2ZC6B 5EUAA 1KE3A 4E3KA 1RGZA 4LCMA 4K0XA 3ZG8B 3VP3A 5GLBA 1MXOA 1E3UD 3N8RA 5D3OA 5GL9A 1TDGA 4A5RA 2Y59A 2Y2GA 4R4RA 4Y0UA 4OH0A 1S0WA 2Y2QA 3CMZA 1K55C 3CJMA 4JF6A 5FQ9A 4QY5A 3RXWA 2WAFA 2ZLYA 4UA9A 1YLTA 1W79A 3PBNA 3NDEA 4C3QA 2XQZA 2R9WA 1YLWA 2JCHA 1K25A 2HDUA 2BLSA 3W4PA 4ZAMA 3W4OA 5EVIC 2ZC3B 4WBGA 3G31A 1ES4A 5CTMA 4OLGA 4R0QA 4K91A 1NYMA 2Y2LA 5FAOA 1CK3A 2QMIA 3LY3A 1FOFA 2XEPA 1QMEA 3IXDA 4GN2A 5CGXA 1O7EA 2EX8A 3Q81A 1PWCA 1K55A 5A91A 2WGWA 2EFXA 5E2EA 3VOZA 3WS1A 3GRJA 3UDXA 3S4XA 3G30A 3HLEA 4R3JA 5M1AA 1BULA 4E6XA 3M2KA 3M2JA 1ZG6A 2ZQ7A 3JYIA 3HLGA 4OOMA 4M3KA 1PZOA 4BL3A 4JKTA 4P0MA 3E2KA 1JWPA 2ZC4B 1W8QA 1U60A 3BFGA 3G32A 3SH7A 1QMFA 1E4DA 2PBYA 1SKFA 4MEZA 3ZNYA 4OLDA 4NETA 5GLCA 1NJ4A 1CEGA 3B3XA 3HUOA 3SH9A 4DE2A 4DE1A 4EQIA 4BLMA 4C6YA 1IKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GD8 A;  1DJB A;  4U0X A;  4BJP A;  1XGI A;  3O86 A;  3IHB A;  4QB8 A;  4PM6 A;  3ZG9 B;  5GHZ A;  2OV5 A;  4WEK A;  2Y4A A;  4X55 A;  5EE8 A;  1IEM A;  2Y2I A;  4B4Z A;  4E3O A;  3BLS A;  2ZD8 A;  2V1Z A;  1FQG A;  5AQB A;  3HLB A;  2XLN A;  1KE4 A;  2B5R A;  2GDN A;  1IYQ A;  4KQR A;  3ZCZ A;  1ERO A;  4Q8I A;  3BFD A;  5E2F A;  4K0W A;  2DNS A;  3MXR A;  4DXC A;  2G2U A;  3IXH A;  1Z6F A;  2WGW B;  3RXX A;  4JF4 A;  5E2H A;  1GHP A;  3LO7 A;  4QY6 A;  2XFT A;  2WKH A;  1K56 A;  3HRE A;  2HP9 A;  3DW0 A;  1ESU A;  3GSG A;  1CI8 A;  4ZTK A;  2I72 A;  1LL9 A;  2XK1 A;  3LCE A;  1N9B A;  5A92 A;  1C3B A;  1GA9 A;  4LEN A;  1GHI A;  2OLV A;  1EWZ A;  5EVI B;  2QZ6 A;  1RCJ A;  4OQ0 A;  4GDB A;  4KZ5 A;  1ES5 A;  4MNR A;  2A3U A;  3WRZ A;  5FQQ A;  3HUN A;  1XX2 A;  4S2L A;  4YFM A;  5JYO A;  1YQS A;  5DTK A;  3SOI A;  1GCE A;  2VGK A;  4JLF A;  3VMA A;  4DE0 A;  1FR1 A;  3G2Z A;  1EI5 A;  3E2L A;  2WYX A;  2H10 A;  3BFF A;  1O07 A;  5CEB A;  1RP5 A;  3GV9 A;  1ALQ A;  4XUX A;  4PM7 A;  3PBS A;  4WEJ A;  4DDY A;  1KGF A;  3ZG7 B;  1LHY A;  4XXR A;  4BL2 A;  5HAP A;  1K57 C;  5FAT A;  2XDM A;  1XXM A;  4S2N C;  2ZM0 A;  3OPP A;  1IYP A;  3WWX A;  4JXS A;  2J7V A;  1KDW A;  3D4F A;  2JE5 A;  3PBT A;  3HLD A;  1L0E A;  4OP5 A;  4S2I A;  5FAP A;  3A3I A;  2IWB A;  3S22 A;  4HEF A;  4HES A;  4X6T A;  4LV1 A;  3Q82 A;  4OPQ A;  3Q7Z A;  3ZHH A;  1XA1 A;  5IHV A;  1ERQ A;  3HLC A;  5JYP A;  1JVJ A;  4FH4 A;  3WS0 A;  4GD6 A;  3ZNT A;  3Q7V A;  1GA0 A;  3G4P A;  4U0T A;  2JBF A;  4H8R A;  3V50 A;  2HDR A;  2ZJ9 A;  4FSF A;  1KGE A;  1K57 A;  1MY8 A;  4S2N A;  3DWZ A;  1K4F A;  2Y2J A;  4ZJ1 A;  1ONH A;  3GVB A;  1K4E A;  3OCN A;  1YLZ A;  3HBR A;  3I7J A;  5FDH A;  1TVF A;  3C4P A;  1WYC A;  1PZP A;  1GHM A;  4E3L A;  4UA6 A;  1BLH A;  1PI4 A;  4C75 A;  3UPO A;  2XD1 A;  5HW3 A;  3PBO A;  3M6H A;  5EPH A;  5HAQ A;  4S2J A;  1BSG A;  4E3N A;  1IYS A;  2HP6 A;  4E3J A;  3FKV A;  1L0F A;  4YIN A;  3MKE A;  4HBU A;  4KZ9 A;  3WS4 A;  1NY0 A;  4CJN A;  2EXB A;  3UE1 A;  1YLP A;  2ZQ8 A;  3ITA A;  3MFD A;  1HTZ A;  1HZO A;  3FYZ A;  3VSK A;  5GLD A;  1PWD A;  5TR7 A;  1K6R A;  5CXW A;  2WAD A;  5FQK A;  1FR6 A;  1I5Q A;  4Y0T A;  2EFU A;  2HP5 A;  1MWT A;  2V20 A;  4N9L A;  3A3E A;  5EVI A;  4N92 A;  4R4S A;  3CG5 A;  3CZD A;  4JXV A;  2WUQ A;  3MBZ A;  1YMS A;  3Q7V B;  3ITB A;  3O87 A;  1SCW A;  2Q9M A;  2XF3 A;  1G68 A;  3AGE A;  3C7V A;  3IHA A;  4BD1 A;  3W8K A;  1PW1 A;  4KZ6 A;  3GQZ A;  3VOY A;  4QHC A;  5F1G A;  3UDF A;  2VGJ A;  1VQQ A;  5F1F A;  4X53 A;  2Y2K A;  3OZH A;  4MBH A;  4OPY A;  1YM1 A;  5GHY A;  4OPR A;  2XH9 A;  1IEL A;  4QD4 A;  4DDS A;  5GHX A;  1LI0 A;  2R9X A;  1XA7 A;  3QHY A;  4JBF A;  2WZZ A;  5EEC A;  3UNW A;  1ZKJ A;  1NRF A;  4B88 A;  4P6B A;  4S2P A;  1CI9 A;  2Z2L B;  3TSG A;  3N7W A;  4EBP A;  3G2Y A;  3MXS A;  1NYY A;  2ZQD A;  4PMA A;  4X69 A;  5CGS A;  5M19 A;  5HAR A;  4KG6 A;  3UPN A;  3IQA A;  3IT9 A;  4L0L A;  2WKI A;  3EQV A;  4LV0 A;  3IF5 A;  2Y2O A;  3BLM A;  1K6S A;  1LLB A;  4UAA A;  3SS3 A;  3NY4 A;  1E3U A;  1SDE A;  1XGJ A;  1ZG4 A;  1PI5 A;  4N1H A;  4NK3 A;  3VSL A;  3TG9 A;  2Y2N A;  1ES3 A;  1E25 A;  3VFF A;  3WS2 A;  5E2G A;  4OQI A;  4E3M A;  3A3F A;  4F94 A;  2DRW A;  4BD0 A;  2WGV A;  4DXB A;  3MZD A;  4Y7P A;  1XKZ A;  5FI7 A;  3FZC A;  3ZGA B;  1FCM A;  5DF7 A;  1MWR A;  5A90 A;  3RJU A;  5BOH A;  1BLP A;  3OPL A;  4P85 A;  4WM9 A;  4EBN A;  2X71 A;  2FFY A;  3ZG5 A;  1JTD A;  3MZE A;  4WZ5 C;  5FSR A;  3M6B A;  3PBR A;  3BM6 A;  3BEC A;  1KVL A;  1OME A;  1W5D A;  5FI2 A;  3ISG A;  3O88 A;  5A93 A;  5FQM A;  1ONG A;  3IH9 A;  2G2W A;  3IWO A;  2EX9 A;  3C7U A;  4BQM A;  4PPR A;  1TDL A;  3IXG A;  1MWS A;  2H0T A;  5GLA A;  4PM8 A;  4Z9Q A;  5CEC A;  4S2K A;  2CC1 A;  3Q1F A;  1DJC A;  4CPK A;  4KQO A;  2P9V A;  3DTM A;  4UHU A;  4DKI A;  2WK0 A;  3AGF A;  3IF6 C;  4HBT A;  5EVI D;  1BUE A;  1N4O A;  1ERM A;  1FSY A;  3N6I A;  3NI9 A;  3OPR A;  4BEN A;  2EX2 A;  3Q07 A;  2V2F F;  4GZB A;  4WYY A;  3UO9 A;  3QNB A;  4JXG A;  2J9P A;  3OCL A;  4WZ5 A;  2RL3 A;  2Z2M B;  3GMW A;  4OP8 A;  4KZ3 A;  3V3R A;  4R23 A;  5E43 A;  4KZB A;  1IKG A;  4LCL A;  4D2O A;  4OOY A;  1VM1 A;  5AQ7 A;  1H5X A;  3N8S A;  2J8Y A;  1SHV A;  1S6R A;  4ZBE A;  4ZJ2 A;  4KEN B;  2QPN A;  1YLY A;  3UE0 A;  3FKW A;  3BFE A;  2XGN A;  3P09 A;  2ZQA A;  3IWQ A;  1AXB A;  2A49 A;  2P74 A;  5G18 A;  5CHJ A;  3IF6 A;  2C5W B;  1LI9 A;  3A3D A;  1Q2P A;  1Q2Q A;  3V39 A;  4DE3 A;  1HD8 A;  3VP0 A;  2EX6 A;  1HVB A;  2WZX A;  2ZQ9 A;  4WEL A;  3LEZ A;  5M18 A;  3ZVW A;  3WS5 A;  4FCF A;  3UE3 A;  3ZG0 A;  1L0G A;  1BZA A;  1ESI A;  3FV7 A;  4GNU A;  2HPB A;  4OQH A;  2Y55 A;  4IVI A;  5AQA A;  3BYD A;  1K56 D;  3V5M A;  1SDN A;  3OPH A;  4P87 A;  1KE0 A;  2IWD A;  2C6W B;  1M6K A;  2P9V B;  5DF8 A;  3SH8 A;  1XP4 A;  3UDI A;  2WAE A;  4ZJ3 A;  1FCN A;  3NC8 A;  1XPB A;  4EV4 A;  2Y2H A;  4B4X A;  1K38 A;  5EVL A;  3P98 A;  2ZQC A;  3VP1 A;  1MBL A;  5CER A;  5FA7 A;  4IVK A;  3EQU A;  2Y2M A;  2J9O A;  1KVM A;  4FH2 A;  1H8Z A;  4JPM A;  2H0Y A;  1BLC A;  2ZMA A;  4KG2 A;  4KQQ A;  3MKF A;  4N1X A;  3UY6 A;  5J8X A;  4Y0O A;  2EXA A;  3BFC A;  3VFH A;  4PM5 A;  1DY6 A;  1PWG A;  5FAS A;  1NXY A;  1PIO A;  3OC2 A;  3N4I A;  2ZC7 A;  3N8L A;  4KZA A;  1LL5 A;  1M40 A;  2DCF A;  2IWC A;  5CRF A;  5DTS A;  5I94 A;  4ID4 A;  2E8I A;  3IF6 B;  3SS4 A;  1FCO A;  2HDS A;  5FQI A;  5TFQ A;  4KZ8 A;  5HFO A;  4GOG A;  4E6W A;  4N9K A;  3BEB A;  1YMX A;  5KSC A;  1K54 C;  4OON A;  4IED A;  1KGG A;  4IBR A;  5CGW A;  1PYY A;  2UWX A;  4EBL A;  5EOO A;  1MKI A;  1MPL A;  1W8Y A;  4WMC A;  3S1Y A;  1L2S A;  2RCX A;  3HL9 A;  3ZVT A;  1H8Y A;  2BG1 A;  2FFF B;  4KZ7 A;  4QU3 A;  3NCK A;  3SS5 A;  4DF6 A;  4WZ4 A;  2XR0 A;  3C4O A;  1IYO A;  2WGI A;  3MZF A;  1NZO A;  3VP4 A;  2JC7 A;  3HUM A;  2XFS A;  2XD5 A;  5HL1 A;  1BT5 A;  3NDG A;  2HDQ A;  1ES2 A;  3IWI A;  3ZDJ A;  2PU2 A;  1Y54 A;  4RX3 A;  4X68 A;  1K54 A;  1L0D A;  5CHM A;  4GB7 A;  3AGD A;  4OOL A;  3PTE A;  4MBK A;  4RX2 A;  1W7F A;  4OKP A;  4R1G A;  5FAQ A;  2ZM8 A;  5KZH A;  4PM9 A;  4JF5 A;  5FI6 A;  3O3V A;  2X01 A;  4RA7 A;  4DRT A;  1DJA A;  4S2O A;  1RGY A;  4OPZ A;  5CTN A;  5FQJ A;  1ZC2 A;  4U3T A;  3W4Q A;  3PAG A;  1KDS A;  2PU4 A;  4OVD A;  3G34 A;  4OQG A;  3UPP A;  2ZM2 A;  3G35 A;  3IH8 A;  5DVA A;  2Y2P A;  5TGF A;  3PBQ A;  3LY4 A;  2OLU A;  4MLL A;  5F83 A;  5AQ9 A;  3A3J A;  5L2F A;  1G6A A;  4EUZ A;  1MWU A;  5KSH A;  3HLW A;  4KG5 A;  3DWK A;  1YT4 A;  3C5A A;  4RVA A;  5CHU A;  4GKU A;  1J9M A;  3ZFZ A;  1WYB A;  4XUZ A;  2ZC5 B;  4QJG A;  3PAE A;  4LV3 A;  5U47 A;  5CED A;  1YLJ A;  2X02 A;  4MBF A;  5DTT A;  4S2M A;  3IXB A;  2H5S A;  5EOE A;  4X56 A;  4E3I A;  2Y91 A;  3HVF A;  3NBL A;  5HX9 A;  1I2S A;  3GR2 A;  3TOI A;  1NZU A;  4IBX A;  3BRM A;  3GTC A;  3FWL A;  1BTL A;  4ZDX A;  4WMC D;  1JWV A;  1I2W A;  1FSW A;  5F82 A;  1JWZ A;  4O7D A;  4R3B A;  3VP2 A;  3WRT A;  2WKE A;  4UA7 A;  4JXW A;  5DF9 A;  1TEM A;  1BLS A;  3NIA A;  1CEF A;  2OSU A;  1PW8 A;  3UN7 A;  4LV2 A;  4RYE A;  1WE4 A;  5KMW A;  5HAI A;  4GDN A;  4FD8 A;  2Q9N A;  4KZ4 A;  4EWF A;  1JTG A;  3HLF A;  3QNC A;  3V3S A;  2ZC6 B;  5EUA A;  1KE3 A;  4E3K A;  1RGZ A;  4LCM A;  4K0X A;  3ZG8 B;  3VP3 A;  5GLB A;  1MXO A;  1E3U D;  3N8R A;  5D3O A;  5GL9 A;  1TDG A;  4A5R A;  2Y59 A;  2Y2G A;  4R4R A;  4Y0U A;  4OH0 A;  1S0W A;  2Y2Q A;  3CMZ A;  1K55 C;  3CJM A;  4JF6 A;  5FQ9 A;  4QY5 A;  3RXW A;  2WAF A;  2ZLY A;  4UA9 A;  1YLT A;  1W79 A;  3PBN A;  3NDE A;  4C3Q A;  2XQZ A;  2R9W A;  1YLW A;  2JCH A;  1K25 A;  2HDU A;  2BLS A;  3W4P A;  4ZAM A;  3W4O A;  5EVI C;  2ZC3 B;  4WBG A;  3G31 A;  1ES4 A;  5CTM A;  4OLG A;  4R0Q A;  4K91 A;  1NYM A;  2Y2L A;  5FAO A;  1CK3 A;  2QMI A;  3LY3 A;  1FOF A;  2XEP A;  1QME A;  3IXD A;  4GN2 A;  5CGX A;  1O7E A;  2EX8 A;  3Q81 A;  1PWC A;  1K55 A;  5A91 A;  2WGW A;  2EFX A;  5E2E A;  3VOZ A;  3WS1 A;  3GRJ A;  3UDX A;  3S4X A;  3G30 A;  3HLE A;  4R3J A;  5M1A A;  1BUL A;  4E6X A;  3M2K A;  3M2J A;  1ZG6 A;  2ZQ7 A;  3JYI A;  3HLG A;  4OOM A;  4M3K A;  1PZO A;  4BL3 A;  4JKT A;  4P0M A;  3E2K A;  1JWP A;  2ZC4 B;  1W8Q A;  1U60 A;  3BFG A;  3G32 A;  3SH7 A;  1QMF A;  1E4D A;  2PBY A;  1SKF A;  4MEZ A;  3ZNY A;  4OLD A;  4NET A;  5GLC A;  1NJ4 A;  1CEG A;  3B3X A;  3HUO A;  3SH9 A;  4DE2 A;  4DE1 A;  4EQI A;  4BLM A;  4C6Y A;  1IKI A; 
#chains in the Genus database with same CATH topology
 1D1J A;  3O5Y A;  3IHB A;  2XRN A;  5GHZ A;  2YKF A;  2Y2I A;  4L9G A;  5AQB A;  1KE4 A;  2B5R A;  1IYQ A;  3MXR A;  3IXH A;  1Z6F A;  2FH5 A;  4QY6 A;  2XFT A;  2WKH A;  2JKG A;  3DW0 A;  1ESU A;  2I72 A;  1LL9 A;  3KYZ A;  5A92 A;  2QZ6 A;  1RCJ A;  4GDB A;  4KZ5 A;  1ES5 A;  4MNR A;  5L10 A;  4O8G A;  1YQS A;  3SOI A;  1CQA A;  2JN7 A;  4D60 A;  2H10 A;  4XUX A;  3OOV A;  3EOI A;  3K3D A;  5HAP A;  2XDM A;  2R78 A;  5AVF A;  2P04 A;  3D4F A;  3HLD A;  1X0O A;  1OTA A;  3QP6 A;  4OPQ A;  3Q7Z A;  3ZHH A;  4U0T A;  2HDR A;  2ZJ9 A;  4FSF A;  4KUO A;  2Y2J A;  4ETX A;  4E3L A;  4S2J A;  3K3C A;  5AVE A;  1L0F A;  3MKE A;  4HBU A;  3WS4 A;  1NY0 A;  4CJN A;  2EXB A;  4DN0 A;  3UE1 A;  2PT7 A;  2ZQ8 A;  3ITA A;  3CIT A;  1HZO A;  2OOL A;  1K6R A;  2PR6 A;  5CXW A;  2WAD A;  3TRC A;  4Y0T A;  2EFU A;  1MWT A;  5J3W A;  4N9L A;  3LID A;  4N92 A;  3CG5 A;  3C2W A;  3Q7V B;  3O87 A;  4QPR A;  2Q9M A;  3AGE A;  1OJG A;  1JNU A;  3IHA A;  3W8K A;  1PW1 A;  3LGO A;  3R4K A;  1VQQ A;  2Y2K A;  4OPY A;  5GHY A;  3PHY A;  1IEL A;  1LI0 A;  1ZTU A;  3NHQ A;  5EEC A;  1ZKJ A;  1NRF A;  2VKS A;  3MXS A;  5M19 A;  4KG6 A;  3IQA A;  3EQV A;  2Y2O A;  4UAA A;  3NY4 A;  1E3U A;  1ZG4 A;  3IBR A;  1PI5 A;  2OAQ 1;  1E25 A;  4B9O A;  4Y13 A;  4BD0 A;  1P9W A;  4DMZ A;  1TS0 A;  1XKZ A;  3RJU A;  5BOH A;  4HH2 A;  4WM9 A;  1Y4O A;  4P85 A;  5HPI A;  5IS1 A;  4EBN A;  1JTD A;  4WZ5 C;  3BM6 A;  4II7 A;  3O88 A;  5A93 A;  5FQM A;  3OLO A;  3IWO A;  2EX9 A;  3C7U A;  4PPR A;  1TDL A;  3IXG A;  2QYB A;  5GLA A;  3ZYT A;  2CC1 A;  1OTD A;  2WKR A;  3BY8 A;  4KQO A;  2P9V A;  4GCZ A;  1GSV A;  3N6I A;  5DKK A;  2G7U A;  4HIA A;  4EET B;  2V2F F;  4WZ5 A;  2RL3 A;  1P9R A;  1LSX A;  5E43 A;  4D2O A;  1VM1 A;  5AQ7 A;  1H5X A;  3JVU A;  4ZJ2 A;  1S6R A;  1PRQ A;  4ZBE A;  4HNB A;  1YLY A;  3UE0 A;  3FKW A;  3HJI A;  3P09 A;  3IWQ A;  2A49 A;  3NEC A;  5CHJ A;  2V1B A;  1LI9 A;  4DE3 A;  1HD8 A;  1V9Z A;  3VP0 A;  1HVB A;  2WZX A;  4WEL A;  3WS5 A;  4G3K A;  2OWJ A;  3FV7 A;  2HPB A;  4R70 A;  3T4Q A;  3V5M A;  2W3G A;  3SH8 A;  1XP4 A;  4ZJ3 A;  3VOL A;  3KSI A;  3NC8 A;  3EGD C;  4EV4 A;  2ZQC A;  2XSS A;  3VP1 A;  4IVK A;  3EQU A;  1H8Z A;  4JPM A;  1J3W A;  1BLC A;  3MKF A;  1DP9 A;  2EXA A;  3BFC A;  2EWV A;  3N4I A;  2ZC7 A;  2DCF A;  4ID4 A;  5EV0 A;  1LSW A;  2V1A A;  4E6W A;  4QWO A;  3BEB A;  4IED A;  2P08 A;  1YPR A;  2HF6 A;  1W8Y A;  2EA9 A;  1H8Y A;  3H82 B;  4KZ7 A;  5EFW A;  3LIA A;  3F1P B;  3MZF A;  2WGI A;  1LSV A;  5DKL A;  2XFS A;  4XT2 B;  1BT5 A;  3IWI A;  3ZDJ A;  3S7N A;  5HZH A;  2PD7 A;  4MCW A;  3B42 A;  3B47 A;  2O0Y A;  4MBK A;  2GZA A;  1L3L A;  1VET A;  2ZM8 A;  4X1L A;  4OPZ A;  3PAG A;  1MZU A;  3CPT A;  2HV1 A;  2GNX A;  3A3J A;  1MWU A;  4PKY G;  3DTI A;  3HLW A;  1DRM A;  4KG5 A;  1YT4 A;  3C5A A;  4BBU A;  4Q0H A;  2ZL1 A;  1GSX A;  1J9M A;  1CF0 A;  2O99 A;  1WYB A;  4XUZ A;  2ZC5 B;  1V9Y A;  4LV3 A;  5U47 A;  1YLJ A;  3L9K A;  5DTT A;  3QP8 A;  2J80 A;  1D06 A;  1H8M A;  3GR2 A;  3GTC A;  1BTL A;  2W3E A;  3D3O A;  1CEF A;  1T1C A;  3C30 A;  3LIF A;  3R7W A;  4KZ4 A;  5HDS A;  3DTK A;  3V3S A;  3ZG8 B;  3CI6 A;  5GL9 A;  2Y59 A;  4Y0U A;  3UB7 A;  3LUQ A;  1S0W A;  1K55 C;  4MN6 A;  3RXW A;  3U2A A;  2WAF A;  2ZLY A;  4LGW A;  1WA9 A;  4C3Q A;  3F1O A;  1YLW A;  4AFI A;  4IJG A;  3UB9 A;  2HDU A;  4EU0 A;  3W4O A;  1EW0 A;  5EVI C;  1S4R A;  5CTM A;  4R0Q A;  2E8J A;  5FAO A;  3LY3 A;  4E04 A;  3KYE A;  2L0W A;  2XEP A;  4GN2 A;  3IXD A;  1O7E A;  1K55 A;  2EFX A;  3WS1 A;  1D7E A;  3GRJ A;  3FC7 A;  3S4X A;  3G30 A;  2Z6C A;  3HLE A;  4R3J A;  4RQ9 A;  3GEC A;  3JYI A;  3HLG A;  4M3K A;  1PZO A;  3T4O A;  4BL3 A;  1S66 L;  4MMN A;  2HJ9 C;  3E2K A;  2ZC4 B;  1W8Q A;  1OTE A;  2VA0 A;  1OTB A;  2PBY A;  4MEZ A;  4DE2 A;  4DE1 A;  1G6O A;  4GD8 A;  2KOI A;  4I38 A;  4QB8 A;  3ZG9 B;  2NUP C;  4WEK A;  4X55 A;  4B4Z A;  3IX8 A;  2OAP 1;  2ZD8 A;  4PKY A;  1FQG A;  1XFQ A;  4KQR A;  3EGX C;  5FL3 A;  4CLC C;  4DXC A;  2G2U A;  2WGW B;  4HOI A;  1H3Q A;  5E2H A;  3MF0 A;  3HRE A;  1VEU B;  1OT9 A;  3PYP A;  2XK1 A;  2HZ5 A;  4WLA A;  3IX4 A;  2Q0O A;  3WRZ A;  2W3H A;  3HUN A;  2VLG A;  4CLC A;  4Q0J A;  4JLF A;  1FR1 A;  2QJ5 A;  2WYX A;  3UB6 A;  3BFF A;  1RP5 A;  3GV9 A;  1STZ A;  1ALQ A;  1IFQ A;  3K2N A;  4WEJ A;  3ZG7 B;  1LHY A;  1K57 C;  5FAT A;  1P97 A;  1XXM A;  5EVE A;  2J7V A;  1KDW A;  3PBT A;  4S2I A;  5FAP A;  4LRZ E;  1SKO B;  2IWB A;  4HEF A;  4LV1 A;  1XJ4 A;  2B95 A;  3Q82 A;  1F98 A;  3CWF A;  3HLC A;  4FH4 A;  1YSQ A;  2PBD P;  1GA0 A;  4H6J B;  2JBF A;  2K31 A;  1K57 A;  4LLO B;  3OCN A;  3I7J A;  1WYC A;  3UPO A;  1PI4 A;  4IUK A;  5MC7 A;  3M6H A;  3T4T A;  1BSG A;  3T1Q B;  5FEF A;  4KZ9 A;  3JVV A;  3T1X A;  2JKF A;  3FYZ A;  3MMH A;  4CLC D;  2DMW A;  2HP5 A;  3RH8 B;  2WUQ A;  5TBM A;  4KZ6 A;  3GQZ A;  3VOY A;  2VGJ A;  3UE6 A;  3OZH A;  4MBH A;  1YM1 A;  4LRX C;  2XH9 A;  4DDS A;  4GHI B;  2M7V A;  3MQQ A;  1XA7 A;  2B02 A;  3QHY A;  4B88 A;  3IS2 B;  3N7W A;  3G2Y A;  4X69 A;  3IT9 A;  4L0L A;  4LV0 A;  3A0S A;  2A2L A;  2VJW A;  3SS3 A;  1UGU A;  3LR5 A;  3VSL A;  4N1H A;  4O01 A;  3TG9 A;  1ES3 A;  3WS2 A;  4ME4 A;  4E3M A;  3MZD A;  5FI7 A;  5G4Y A;  5A90 A;  4GW9 A;  1BLP A;  3OPL A;  2JKT I;  4KUK A;  2PYP A;  4DJ3 A;  5FI2 A;  4MDZ A;  4ARZ B;  3A0V A;  1ONG A;  4BQM A;  2VX8 A;  4I3I A;  4Z9Q A;  3Q1F A;  4CPK A;  2ZMV A;  5LBR A;  4DKI A;  4X25 A;  3IF6 C;  1BUE A;  3NI9 A;  3OPR A;  3UMD A;  4WYY A;  3UO9 A;  2EWW A;  4JXG A;  2Z2M B;  3GMW A;  4I39 A;  1IKG A;  1OPX A;  4KEN B;  2XGN A;  2V0U A;  1AXB A;  5G18 A;  3BWL A;  3IF6 A;  1XFN A;  2ACG A;  2EX6 A;  2XRO A;  3T50 A;  1ESI A;  4NEE D;  2Y55 A;  5AQA A;  2K7S A;  1SDN A;  2D01 A;  2IWD A;  3G6O A;  1M6K A;  1BYW A;  1FCN A;  1XPB A;  5CER A;  2J9O A;  2H0Y A;  3FPV A;  4GS9 A;  4EQ1 A;  1DY6 A;  4HI4 A;  5L09 A;  3CLO A;  4KZA A;  4JGR A;  1LL5 A;  1M40 A;  2IWC A;  5CRF A;  5HL6 A;  1K0K A;  3OBF A;  3SS4 A;  1FCO A;  5TFQ A;  4KZ8 A;  4N9K A;  2A24 B;  1YMX A;  1K54 C;  1PNE A;  4G3W A;  1KGG A;  5CGW A;  2UWX A;  5EOO A;  1MKI A;  3S1Y A;  2QJ7 A;  5HD5 A;  2FFF B;  5I5L A;  3SS5 A;  2P7J A;  1KOU A;  2O9C A;  2XD5 A;  5L07 A;  4R3A A;  2INW A;  4RX3 A;  1K54 A;  2W0N A;  3DAV A;  4F3L A;  4GB7 A;  3KSF A;  3F1N A;  4HQA A;  4RX2 A;  2CMN A;  2QHK A;  4PM9 A;  3O3V A;  3QP2 A;  4HJ6 A;  4DRT A;  1DJA A;  4S2O A;  1KDS A;  2PU4 A;  3UME A;  2ZM2 A;  2Y2P A;  3TE8 A;  3LY4 A;  2OLU A;  4CLC E;  3H7W A;  5L2F A;  3D9Y A;  4GLQ A;  3DWK A;  1F5M A;  4RVA A;  4GKU A;  3T4J A;  3ZFZ A;  3U4L P;  4NXG A;  2X02 A;  2VV7 A;  3IXB A;  2H5S A;  4X56 A;  4E3I A;  5HX9 A;  4GJ4 A;  3VE3 A;  3TOI A;  3BRM A;  3FWL A;  3LR0 A;  5F82 A;  3T4L A;  5TJJ A;  3NOT C;  1BLS A;  2OSU A;  4LV2 A;  4RYE A;  1WE4 A;  5HAI A;  3FPW A;  4GDN A;  4FD8 A;  3HLF A;  2ZC6 B;  5EUA A;  5GLB A;  1E3U D;  3N8R A;  3MQO A;  1PFL A;  1TDG A;  4NG2 A;  4R4R A;  3MSH A;  3CMZ A;  4JF6 A;  2IA2 A;  5FQ9 A;  4UA9 A;  1YLT A;  1W79 A;  4P6Z S;  3LI9 A;  3H9W A;  3E4Q A;  4JGP A;  4ZAM A;  1DP8 A;  3BJN A;  3LR4 A;  1NYM A;  1FOF A;  2EX8 A;  5A91 A;  4HH3 A;  1TD5 A;  3UDX A;  1BUL A;  2W1T B;  2KLI A;  4OOM A;  3V67 A;  4JKT A;  1JWP A;  1U60 A;  3BFG A;  4X1M A;  2O9A A;  3SH7 A;  1E4D A;  3HUO A;  5G4Z A;  1DJB A;  4PHT A;  2OV5 A;  2PR5 A;  3KO6 A;  2Y4A A;  1IEM A;  2W1R A;  3HLB A;  2XLN A;  2GDN A;  3ZCZ A;  3BFD A;  5E2F A;  4K0W A;  3TW8 A;  3RXX A;  4JF4 A;  1W63 Q;  1GHP A;  2B18 A;  2W27 A;  3LO7 A;  1N9O A;  1K56 A;  4CQH A;  2HP9 A;  3GSG A;  1CI8 A;  4ZTK A;  1N9B A;  1C3B A;  2OLV A;  4IUH A;  1XX2 A;  4YFM A;  3LIC A;  5JYO A;  2VGK A;  4DE0 A;  3VMA A;  3IX3 A;  4EEU A;  5K5B A;  1O07 A;  2PDR A;  4BWI A;  3PBS A;  1KGF A;  1OJ5 A;  4BL2 A;  5FDS A;  1S1Z A;  3OPP A;  1IYP A;  3WWX A;  4JXS A;  1Y28 A;  2JE5 A;  1L0E A;  3BY9 A;  4OP5 A;  4HES A;  4X6T A;  2VV8 A;  3T1S A;  5IHV A;  3MR0 A;  5JYP A;  3WS0 A;  3Q7V A;  3SZT A;  1KGE A;  4UQI S;  3DWZ A;  4ZJ1 A;  4NXF A;  3GVB A;  1K4E A;  3HBR A;  1NRJ A;  3C4P A;  4UA6 A;  1BLH A;  4C75 A;  1FIL A;  1GSW A;  5EPH A;  5HAQ A;  1IYS A;  4E3J A;  3FKV A;  2V0W A;  5F6A A;  1YLP A;  3MFD A;  1HTZ A;  5HD3 A;  3VSK A;  5GLD A;  1PWD A;  5TR7 A;  4HP4 A;  1I5Q A;  1N9L A;  2UV0 E;  1XJ2 A;  2JKT M;  3A3E A;  5EVI A;  3CZD A;  4JXV A;  3MBZ A;  1YMS A;  4Y3I A;  3ITB A;  1SCW A;  2HGV A;  2XF3 A;  1G68 A;  3C7V A;  3QP4 A;  1OTI A;  3NOU C;  5F1F A;  4X53 A;  4FUW A;  2GX5 A;  4OPR A;  4QD4 A;  5GHX A;  3P01 A;  3UNW A;  4P6B A;  4YNR A;  1CI9 A;  2Z2L B;  5CX7 A;  3TSG A;  4PMA A;  1NYY A;  2ZQD A;  5CGS A;  5HAR A;  3UPN A;  1OT6 A;  3NUL A;  3E0Y A;  3IF5 A;  3NJA A;  3BLM A;  1SDE A;  4NK3 A;  2Y2N A;  5IT5 A;  1VHM A;  4F94 A;  2WGV A;  4DXB A;  3LYX A;  3FZC A;  5EM1 A;  1MWR A;  4ZRR A;  4JGO A;  3ZG5 A;  3MZE A;  4HHD A;  5FSR A;  3M6B A;  3PBR A;  5C5K A;  1W5D A;  3ISG A;  3QP1 A;  3LIE A;  1T18 A;  2G2W A;  3VE4 A;  1MWS A;  2ZOH A;  4EES A;  3DTM A;  5DFX A;  4HBT A;  5EVI D;  1FSY A;  5F68 A;  2EX2 A;  3ULF A;  4BEN A;  4GZB A;  3OCL A;  3V3R A;  4R23 A;  4O0P A;  4Z1W A;  1SHV A;  2QPN A;  3C38 A;  3LEQ A;  4PAU A;  2P74 A;  3RTY A;  2C5W B;  2QKP A;  3A3D A;  1Q2Q A;  3LEZ A;  1T1B A;  1F2K A;  1UWP X;  4FCF A;  3UE3 A;  1L0G A;  4HJ4 A;  1BZA A;  3H82 A;  2LB9 A;  4IVI A;  3F1P A;  3BYD A;  2D02 A;  4P87 A;  1KE0 A;  1Z09 A;  2C6W B;  4XT2 A;  2P9V B;  5DF8 A;  2WAE A;  3LFV A;  3LI8 A;  4ESP A;  4B4X A;  5EVL A;  3P98 A;  1MBL A;  3T1R A;  2Y2M A;  1KVM A;  2FZ0 A;  3QP5 A;  4KG2 A;  4KQQ A;  3S7Q A;  3UY6 A;  4EXO A;  1PWG A;  4FTX A;  5EM0 A;  2YKH A;  3N8L A;  5DTS A;  3E4P A;  2XA7 S;  5I94 A;  3MFX A;  5FQI A;  5HFO A;  3E98 A;  4GOG A;  5KSC A;  2JKR M;  4WMC A;  1CJF A;  4QU3 A;  4K08 A;  2XR0 A;  3T4S A;  1NZO A;  3VP4 A;  2JC7 A;  3A0R A;  3HUM A;  1FIK A;  1ES2 A;  4BMW A;  1LT0 A;  2PU2 A;  4Y5F A;  5CHM A;  2VK3 A;  3AGD A;  4OOL A;  4OKP A;  3KSH A;  2V9A A;  5FI6 A;  2X01 A;  4RA7 A;  5DJT A;  1ZC2 A;  4U3T A;  1DP6 A;  4OVD A;  3G34 A;  5DVA A;  4ETZ A;  3PBQ A;  4MLL A;  1NLY A;  1G6A A;  2VGL S;  4EUZ A;  3CHW P;  5CHU A;  4WF0 A;  3EWK A;  3HCY A;  2MJ6 A;  2M7U A;  4HP9 A;  3HVF A;  3NBL A;  4ZDX A;  4WMC D;  3VP2 A;  1FSW A;  2V8F A;  3WRT A;  4O7D A;  4R3B A;  4EER A;  1VET B;  4UA7 A;  1VB6 A;  1TEM A;  3NIA A;  2KX6 A;  5KMW A;  2ZBB A;  2Q9N A;  1P0Z A;  4EWF A;  1JTG A;  3QNC A;  3CPT B;  1KE3 A;  1RGZ A;  4K0X A;  2JHE A;  1LL8 A;  2Y2Q A;  1T19 A;  4Y2F A;  2ZL1 B;  4FOF A;  1A0K A;  1ZHH B;  2NUT C;  3PBN A;  3NDE A;  2XQZ A;  4EEP A;  2JCH A;  1K25 A;  3W4P A;  2QWS A;  4Y15 A;  1ES4 A;  4OLG A;  4K91 A;  2Y2L A;  1QME A;  3Q81 A;  1PWC A;  2WGW A;  3VOZ A;  5E2E A;  2AVX A;  5M1A A;  3M2K A;  1VEU A;  3T4K A;  1ZG6 A;  4HY8 A;  3R7W B;  4P6Z M;  3G32 A;  2ZOI A;  1S1Y A;  1SKF A;  4MN5 A;  4OLD A;  1NJ4 A;  1CEG A;  3B3X A;  3SH9 A;  4BLM A;  4C6Y A;  3LIB A;  4U0X A;  4BJP A;  1XGI A;  3F1O B;  1ACF A;  3O86 A;  5FEG A;  4PM6 A;  1F9I A;  5EE8 A;  4E3O A;  2PYR A;  3BLS A;  2V1Z A;  1ERO A;  4Q8I A;  4LFU A;  2L4R A;  2DNS A;  3W2Z A;  3D72 A;  1SKO A;  5F69 A;  4KQD A;  2PAV P;  3LCE A;  1GA9 A;  4LEN A;  1GHI A;  1EWZ A;  5EVI B;  4OQ0 A;  4H6J A;  2A3U A;  2JKR I;  5FQQ A;  4S2L A;  5DTK A;  1GCE A;  2Y79 A;  3G2Z A;  4LRY C;  2J3T C;  1EI5 A;  3KYQ A;  3E2L A;  4WUJ A;  5CEB A;  4PM7 A;  4DDY A;  4XXR A;  2I9V A;  4S2N C;  5HPF A;  2ZM0 A;  4WN5 A;  3KSG A;  2PRF A;  3A3I A;  4NKP A;  3S22 A;  4EUV A;  4R38 A;  3NOP C;  1XA1 A;  1ERQ A;  2PHY A;  1JVJ A;  4GD6 A;  3ZNT A;  3G4P A;  4H8R A;  3V50 A;  2Z6D A;  3MJQ A;  4Q0I A;  1MY8 A;  4Y17 A;  4S2N A;  1K4F A;  1ONH A;  3KX0 X;  4CLC B;  1YLZ A;  5FDH A;  1TVF A;  1PZP A;  1GHM A;  4GHI A;  2XD1 A;  3UB5 P;  1H0M A;  5HW3 A;  3PBO A;  4E3N A;  2HP6 A;  4YIN A;  3IS2 A;  4L9F A;  5HWT A;  3ICY A;  5FQK A;  5HDC A;  1N9N A;  1FR6 A;  4UEY A;  4UQI M;  2V20 A;  2V8C A;  1TF1 A;  4R4S A;  1SZV A;  4BD1 A;  2ZMF A;  4QHC A;  5F1G A;  3UDF A;  2W3F A;  4ARZ A;  4HJ3 A;  3TJZ C;  5HSQ A;  3PXP A;  2R9X A;  2J3T D;  3DBA A;  4JBF A;  2WZZ A;  4S2P A;  4EBP A;  1S4S A;  2WKI A;  2OWH A;  3JPU A;  1K6S A;  1LLB A;  1XGJ A;  1S67 L;  3E4O A;  3VFF A;  5E2G A;  4G3V A;  4OQI A;  4I5S A;  3S7P A;  3A3F A;  1TS6 A;  2DRW A;  4Y7P A;  3ZGA B;  1FCM A;  5DF7 A;  5TBM B;  2VZW A;  2X71 A;  2FFY A;  3UB8 A;  3BEC A;  1KVL A;  1OME A;  2PD8 A;  3IH9 A;  2HJE A;  4NXB A;  2H0T A;  4PM8 A;  3CUE C;  5CEC A;  4S2K A;  1DJC A;  5AJG A;  4UHU A;  2WK0 A;  3AGF A;  1N4O A;  1ERM A;  3Q07 A;  1YSP A;  3QNB A;  2J9P A;  4I3A A;  3LR3 A;  4OP8 A;  4KZ3 A;  4KZB A;  4LCL A;  4OOY A;  3N8S A;  2J8Y A;  1MC0 A;  3CUE A;  3BFE A;  5HWW A;  2ZQA A;  2L1M A;  1Q2P A;  3V39 A;  1W63 M;  2A24 A;  2O9B A;  2ZQ9 A;  5M18 A;  3ZVW A;  4NXE A;  3ZG0 A;  4OQH A;  4GNU A;  2Y8H A;  1K56 D;  3OPH A;  3UDI A;  1NLZ A;  4LPZ A;  2Y2H A;  1K38 A;  5FA7 A;  3BQA A;  4FH2 A;  2ZMA A;  2W3D A;  1TS8 A;  3VV4 A;  4N1X A;  5J8X A;  4Y0O A;  3VFH A;  4PM5 A;  5FAS A;  1NXY A;  1PIO A;  3OC2 A;  4EW7 A;  2E8I A;  3IF6 B;  5A8B A;  2HDS A;  1HLU P;  4BBT A;  4OON A;  4IBR A;  1PYY A;  2VV6 A;  4EBL A;  1MPL A;  1L2S A;  2RCX A;  3HL9 A;  3S7O A;  3ZVT A;  1ODV A;  2BG1 A;  3NCK A;  4DF6 A;  4WZ4 A;  3C4O A;  1IYO A;  2KDK A;  3P7N A;  5KIZ A;  5HL1 A;  3NDG A;  2HDQ A;  4I3J A;  5DFY A;  1Y54 A;  3L7H A;  4R6L A;  4BBV A;  4X68 A;  2XA7 M;  2H28 A;  1L0D A;  1YAX A;  3DTE A;  4GS9 B;  3PTE A;  1W7F A;  4R1G A;  5FAQ A;  2LB5 A;  5KZH A;  3MXQ A;  4JF5 A;  3GDI A;  2VEA A;  1RGY A;  3SW1 A;  3FG8 A;  5CTN A;  5FQJ A;  3W4Q A;  1AWI A;  4OQG A;  3UPP A;  3G35 A;  4DJ2 A;  3IH8 A;  5TGF A;  4MN7 A;  5F83 A;  5AQ9 A;  5KSH A;  3EEA A;  3MS6 A;  1XJ6 A;  3T12 B;  3CAX A;  4QJG A;  3PAE A;  2J3W A;  5CED A;  4MBF A;  4S2M A;  2K2N A;  1TS7 A;  5EOE A;  5HDD A;  1YKD A;  3B33 A;  2Y91 A;  3PR6 A;  4F3L B;  1I2S A;  1NZU A;  3F1N B;  4IBX A;  1IOU A;  1JWV A;  1I2W A;  1JWZ A;  4B93 A;  2WKE A;  1T1A A;  4JXW A;  5L8M A;  5DF9 A;  3UN7 A;  1PW8 A;  1NWZ A;  2VGL M;  1XJ3 A;  1G28 A;  2W1T A;  3BQ8 A;  4E3K A;  4LCM A;  3VP3 A;  5J4E A;  3H7W B;  2BTF P;  1MXO A;  5D3O A;  2WKP A;  4A5R A;  2Y2G A;  4OH0 A;  3ZQ5 A;  3CJM A;  4WL9 A;  5F5Y A;  5IU1 A;  4QY5 A;  3C8C A;  2WKQ A;  2R9W A;  1UWN X;  3MQ0 A;  2BLS A;  2GJ3 A;  5J7E A;  2ZC3 B;  4WBG A;  3G31 A;  5DJU A;  1CK3 A;  2QMI A;  2BAS A;  5CGX A;  5HWV A;  4IHQ A;  4E6X A;  3HJK A;  3M2J A;  2ZQ7 A;  3RFB A;  2M1C A;  3BW6 A;  4YOF A;  4YWZ A;  4M4X A;  4P0M A;  1MKM A;  1G5U A;  3EEH A;  1QMF A;  4L9E A;  3IBJ A;  3ZNY A;  5GLC A;  4NET A;  4JGQ A;  4EQI A;  1IKI A; 
#chains in the Genus database with same CATH homology
 4GD8 A;  1DJB A;  4U0X A;  4BJP A;  1XGI A;  3O86 A;  3IHB A;  4QB8 A;  4PM6 A;  3ZG9 B;  5GHZ A;  2OV5 A;  4WEK A;  2Y4A A;  4X55 A;  5EE8 A;  1IEM A;  2Y2I A;  4B4Z A;  4E3O A;  3BLS A;  2ZD8 A;  2V1Z A;  1FQG A;  5AQB A;  3HLB A;  2XLN A;  1KE4 A;  2B5R A;  2GDN A;  1IYQ A;  4KQR A;  3ZCZ A;  1ERO A;  4Q8I A;  3BFD A;  5E2F A;  4K0W A;  2DNS A;  3MXR A;  4DXC A;  2G2U A;  3IXH A;  1Z6F A;  2WGW B;  3RXX A;  4JF4 A;  5E2H A;  1GHP A;  3LO7 A;  4QY6 A;  2XFT A;  2WKH A;  1K56 A;  3HRE A;  2HP9 A;  3DW0 A;  1ESU A;  3GSG A;  1CI8 A;  4ZTK A;  2I72 A;  1LL9 A;  2XK1 A;  3LCE A;  1N9B A;  5A92 A;  1C3B A;  1GA9 A;  4LEN A;  1GHI A;  2OLV A;  1EWZ A;  5EVI B;  2QZ6 A;  1RCJ A;  4OQ0 A;  4GDB A;  4KZ5 A;  1ES5 A;  4MNR A;  2A3U A;  3WRZ A;  5FQQ A;  3HUN A;  1XX2 A;  4S2L A;  4YFM A;  5JYO A;  1YQS A;  5DTK A;  3SOI A;  1GCE A;  2VGK A;  4JLF A;  3VMA A;  4DE0 A;  1FR1 A;  3G2Z A;  1EI5 A;  3E2L A;  2WYX A;  2H10 A;  3BFF A;  1O07 A;  5CEB A;  1RP5 A;  3GV9 A;  1ALQ A;  4XUX A;  4PM7 A;  3PBS A;  4WEJ A;  4DDY A;  1KGF A;  3ZG7 B;  1LHY A;  4XXR A;  4BL2 A;  5HAP A;  1K57 C;  5FAT A;  2XDM A;  1XXM A;  4S2N C;  2ZM0 A;  3OPP A;  1IYP A;  3WWX A;  4JXS A;  2J7V A;  1KDW A;  3D4F A;  2JE5 A;  3PBT A;  3HLD A;  1L0E A;  4OP5 A;  4S2I A;  5FAP A;  3A3I A;  2IWB A;  3S22 A;  4HEF A;  4HES A;  4X6T A;  4LV1 A;  3Q82 A;  4OPQ A;  3Q7Z A;  3ZHH A;  1XA1 A;  5IHV A;  1ERQ A;  3HLC A;  5JYP A;  1JVJ A;  4FH4 A;  3WS0 A;  4GD6 A;  3ZNT A;  3Q7V A;  1GA0 A;  3G4P A;  4U0T A;  2JBF A;  4H8R A;  3V50 A;  2HDR A;  2ZJ9 A;  4FSF A;  1KGE A;  1K57 A;  1MY8 A;  4S2N A;  3DWZ A;  1K4F A;  2Y2J A;  4ZJ1 A;  1ONH A;  3GVB A;  1K4E A;  3OCN A;  1YLZ A;  3HBR A;  3I7J A;  5FDH A;  1TVF A;  3C4P A;  1WYC A;  1PZP A;  1GHM A;  4E3L A;  4UA6 A;  1BLH A;  1PI4 A;  4C75 A;  3UPO A;  2XD1 A;  5HW3 A;  3PBO A;  3M6H A;  5EPH A;  5HAQ A;  4S2J A;  1BSG A;  4E3N A;  1IYS A;  2HP6 A;  4E3J A;  3FKV A;  1L0F A;  4YIN A;  3MKE A;  4HBU A;  4KZ9 A;  3WS4 A;  1NY0 A;  4CJN A;  2EXB A;  3UE1 A;  1YLP A;  2ZQ8 A;  3ITA A;  3MFD A;  1HTZ A;  1HZO A;  3FYZ A;  3VSK A;  5GLD A;  1PWD A;  5TR7 A;  1K6R A;  5CXW A;  2WAD A;  5FQK A;  1FR6 A;  1I5Q A;  4Y0T A;  2EFU A;  2HP5 A;  1MWT A;  2V20 A;  4N9L A;  3A3E A;  5EVI A;  4N92 A;  4R4S A;  3CG5 A;  3CZD A;  4JXV A;  2WUQ A;  3MBZ A;  1YMS A;  3Q7V B;  3ITB A;  3O87 A;  1SCW A;  2Q9M A;  2XF3 A;  1G68 A;  3AGE A;  3C7V A;  3IHA A;  4BD1 A;  3W8K A;  1PW1 A;  4KZ6 A;  3GQZ A;  3VOY A;  4QHC A;  5F1G A;  3UDF A;  2VGJ A;  1VQQ A;  5F1F A;  4X53 A;  2Y2K A;  3OZH A;  4MBH A;  4OPY A;  1YM1 A;  5GHY A;  4OPR A;  2XH9 A;  1IEL A;  4QD4 A;  4DDS A;  5GHX A;  1LI0 A;  2R9X A;  1XA7 A;  3QHY A;  4JBF A;  2WZZ A;  5EEC A;  3UNW A;  1ZKJ A;  1NRF A;  4B88 A;  4P6B A;  4S2P A;  1CI9 A;  2Z2L B;  3TSG A;  3N7W A;  4EBP A;  3G2Y A;  3MXS A;  1NYY A;  2ZQD A;  4PMA A;  4X69 A;  5CGS A;  5M19 A;  5HAR A;  4KG6 A;  3UPN A;  3IQA A;  3IT9 A;  4L0L A;  2WKI A;  3EQV A;  4LV0 A;  3IF5 A;  2Y2O A;  3BLM A;  1K6S A;  1LLB A;  4UAA A;  3SS3 A;  3NY4 A;  1E3U A;  1SDE A;  1XGJ A;  1ZG4 A;  1PI5 A;  4N1H A;  4NK3 A;  3VSL A;  3TG9 A;  2Y2N A;  1ES3 A;  1E25 A;  3VFF A;  3WS2 A;  5E2G A;  4OQI A;  4E3M A;  3A3F A;  4F94 A;  2DRW A;  4BD0 A;  2WGV A;  4DXB A;  3MZD A;  4Y7P A;  1XKZ A;  5FI7 A;  3FZC A;  3ZGA B;  1FCM A;  5DF7 A;  1MWR A;  5A90 A;  3RJU A;  5BOH A;  1BLP A;  3OPL A;  4P85 A;  4WM9 A;  4EBN A;  2X71 A;  2FFY A;  3ZG5 A;  1JTD A;  3MZE A;  4WZ5 C;  5FSR A;  3M6B A;  3PBR A;  3BM6 A;  3BEC A;  1KVL A;  1OME A;  1W5D A;  5FI2 A;  3ISG A;  3O88 A;  5A93 A;  5FQM A;  1ONG A;  3IH9 A;  2G2W A;  3IWO A;  2EX9 A;  3C7U A;  4BQM A;  4PPR A;  1TDL A;  3IXG A;  1MWS A;  2H0T A;  5GLA A;  4PM8 A;  4Z9Q A;  5CEC A;  4S2K A;  2CC1 A;  3Q1F A;  1DJC A;  4CPK A;  4KQO A;  2P9V A;  3DTM A;  4UHU A;  4DKI A;  2WK0 A;  3AGF A;  3IF6 C;  4HBT A;  5EVI D;  1BUE A;  1N4O A;  1ERM A;  1FSY A;  3N6I A;  3NI9 A;  3OPR A;  4BEN A;  2EX2 A;  3Q07 A;  2V2F F;  4GZB A;  4WYY A;  3UO9 A;  3QNB A;  4JXG A;  2J9P A;  3OCL A;  4WZ5 A;  2RL3 A;  2Z2M B;  3GMW A;  4OP8 A;  4KZ3 A;  3V3R A;  4R23 A;  5E43 A;  4KZB A;  1IKG A;  4LCL A;  4D2O A;  4OOY A;  1VM1 A;  5AQ7 A;  1H5X A;  3N8S A;  2J8Y A;  1SHV A;  1S6R A;  4ZBE A;  4ZJ2 A;  4KEN B;  2QPN A;  1YLY A;  3UE0 A;  3FKW A;  3BFE A;  2XGN A;  3P09 A;  2ZQA A;  3IWQ A;  1AXB A;  2A49 A;  2P74 A;  5G18 A;  5CHJ A;  3IF6 A;  2C5W B;  1LI9 A;  3A3D A;  1Q2P A;  1Q2Q A;  3V39 A;  4DE3 A;  1HD8 A;  3VP0 A;  2EX6 A;  1HVB A;  2WZX A;  2ZQ9 A;  4WEL A;  3LEZ A;  5M18 A;  3ZVW A;  3WS5 A;  4FCF A;  3UE3 A;  3ZG0 A;  1L0G A;  1BZA A;  1ESI A;  3FV7 A;  4GNU A;  2HPB A;  4OQH A;  2Y55 A;  4IVI A;  5AQA A;  3BYD A;  1K56 D;  3V5M A;  1SDN A;  3OPH A;  4P87 A;  1KE0 A;  2IWD A;  2C6W B;  1M6K A;  2P9V B;  5DF8 A;  3SH8 A;  1XP4 A;  3UDI A;  2WAE A;  4ZJ3 A;  1FCN A;  3NC8 A;  1XPB A;  4EV4 A;  2Y2H A;  4B4X A;  1K38 A;  5EVL A;  3P98 A;  2ZQC A;  3VP1 A;  1MBL A;  5CER A;  5FA7 A;  4IVK A;  3EQU A;  2Y2M A;  2J9O A;  1KVM A;  4FH2 A;  1H8Z A;  4JPM A;  2H0Y A;  1BLC A;  2ZMA A;  4KG2 A;  4KQQ A;  3MKF A;  4N1X A;  3UY6 A;  5J8X A;  4Y0O A;  2EXA A;  3BFC A;  3VFH A;  4PM5 A;  1DY6 A;  1PWG A;  5FAS A;  1NXY A;  1PIO A;  3OC2 A;  3N4I A;  2ZC7 A;  3N8L A;  4KZA A;  1LL5 A;  1M40 A;  2DCF A;  2IWC A;  5CRF A;  5DTS A;  5I94 A;  4ID4 A;  2E8I A;  3IF6 B;  3SS4 A;  1FCO A;  2HDS A;  5FQI A;  5TFQ A;  4KZ8 A;  5HFO A;  4GOG A;  4E6W A;  4N9K A;  3BEB A;  1YMX A;  5KSC A;  1K54 C;  4OON A;  4IED A;  1KGG A;  4IBR A;  5CGW A;  1PYY A;  2UWX A;  4EBL A;  5EOO A;  1MKI A;  1MPL A;  1W8Y A;  4WMC A;  3S1Y A;  1L2S A;  2RCX A;  3HL9 A;  3ZVT A;  1H8Y A;  2BG1 A;  2FFF B;  4KZ7 A;  4QU3 A;  3NCK A;  3SS5 A;  4DF6 A;  4WZ4 A;  2XR0 A;  3C4O A;  1IYO A;  2WGI A;  3MZF A;  1NZO A;  3VP4 A;  2JC7 A;  3HUM A;  2XFS A;  2XD5 A;  5HL1 A;  1BT5 A;  3NDG A;  2HDQ A;  1ES2 A;  3IWI A;  3ZDJ A;  2PU2 A;  1Y54 A;  4RX3 A;  4X68 A;  1K54 A;  1L0D A;  5CHM A;  4GB7 A;  3AGD A;  4OOL A;  3PTE A;  4MBK A;  4RX2 A;  1W7F A;  4OKP A;  4R1G A;  5FAQ A;  2ZM8 A;  5KZH A;  4PM9 A;  4JF5 A;  5FI6 A;  3O3V A;  2X01 A;  4RA7 A;  4DRT A;  1DJA A;  4S2O A;  1RGY A;  4OPZ A;  5CTN A;  5FQJ A;  1ZC2 A;  4U3T A;  3W4Q A;  3PAG A;  1KDS A;  2PU4 A;  4OVD A;  3G34 A;  4OQG A;  3UPP A;  2ZM2 A;  3G35 A;  3IH8 A;  5DVA A;  2Y2P A;  5TGF A;  3PBQ A;  3LY4 A;  2OLU A;  4MLL A;  5F83 A;  5AQ9 A;  3A3J A;  5L2F A;  1G6A A;  4EUZ A;  1MWU A;  5KSH A;  3HLW A;  4KG5 A;  3DWK A;  1YT4 A;  3C5A A;  4RVA A;  5CHU A;  4GKU A;  1J9M A;  3ZFZ A;  1WYB A;  4XUZ A;  2ZC5 B;  4QJG A;  3PAE A;  4LV3 A;  5U47 A;  5CED A;  1YLJ A;  2X02 A;  4MBF A;  5DTT A;  4S2M A;  3IXB A;  2H5S A;  5EOE A;  4X56 A;  4E3I A;  2Y91 A;  3HVF A;  3NBL A;  5HX9 A;  1I2S A;  3GR2 A;  3TOI A;  1NZU A;  4IBX A;  3BRM A;  3GTC A;  3FWL A;  1BTL A;  4ZDX A;  4WMC D;  1JWV A;  1I2W A;  1FSW A;  5F82 A;  1JWZ A;  4O7D A;  4R3B A;  3VP2 A;  3WRT A;  2WKE A;  4UA7 A;  4JXW A;  5DF9 A;  1TEM A;  1BLS A;  3NIA A;  1CEF A;  2OSU A;  1PW8 A;  3UN7 A;  4LV2 A;  4RYE A;  1WE4 A;  5KMW A;  5HAI A;  4GDN A;  4FD8 A;  2Q9N A;  4KZ4 A;  4EWF A;  1JTG A;  3HLF A;  3QNC A;  3V3S A;  2ZC6 B;  5EUA A;  1KE3 A;  4E3K A;  1RGZ A;  4LCM A;  4K0X A;  3ZG8 B;  3VP3 A;  5GLB A;  1MXO A;  1E3U D;  3N8R A;  5D3O A;  5GL9 A;  1TDG A;  4A5R A;  2Y59 A;  2Y2G A;  4R4R A;  4Y0U A;  4OH0 A;  1S0W A;  2Y2Q A;  3CMZ A;  1K55 C;  3CJM A;  4JF6 A;  5FQ9 A;  4QY5 A;  3RXW A;  2WAF A;  2ZLY A;  4UA9 A;  1YLT A;  1W79 A;  3PBN A;  3NDE A;  4C3Q A;  2XQZ A;  2R9W A;  1YLW A;  2JCH A;  1K25 A;  2HDU A;  2BLS A;  3W4P A;  4ZAM A;  3W4O A;  5EVI C;  2ZC3 B;  4WBG A;  3G31 A;  1ES4 A;  5CTM A;  4OLG A;  4R0Q A;  4K91 A;  1NYM A;  2Y2L A;  5FAO A;  1CK3 A;  2QMI A;  3LY3 A;  1FOF A;  2XEP A;  1QME A;  3IXD A;  4GN2 A;  5CGX A;  1O7E A;  2EX8 A;  3Q81 A;  1PWC A;  1K55 A;  5A91 A;  2WGW A;  2EFX A;  5E2E A;  3VOZ A;  3WS1 A;  3GRJ A;  3UDX A;  3S4X A;  3G30 A;  3HLE A;  4R3J A;  5M1A A;  1BUL A;  4E6X A;  3M2K A;  3M2J A;  1ZG6 A;  2ZQ7 A;  3JYI A;  3HLG A;  4OOM A;  4M3K A;  1PZO A;  4BL3 A;  4JKT A;  4P0M A;  3E2K A;  1JWP A;  2ZC4 B;  1W8Q A;  1U60 A;  3BFG A;  3G32 A;  3SH7 A;  1QMF A;  1E4D A;  2PBY A;  1SKF A;  4MEZ A;  3ZNY A;  4OLD A;  4NET A;  5GLC A;  1NJ4 A;  1CEG A;  3B3X A;  3HUO A;  3SH9 A;  4DE2 A;  4DE1 A;  4EQI A;  4BLM A;  4C6Y A;  1IKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...