1FQGA

Molecular structure of the acyl-enzyme intermediate in tem-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWNPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of the acyl-enzyme intermediate in beta-lactam hydrolysis at 1.7 A resolution.
pubmed doi rcsb
molecule keywords TEM-1 BETA-LACTAMASE
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fqgA00
1PYYA 2XFSA 4EBLA 2P74A 4PM6A 1PW8A 5HAQA 4C6YA 3BFDA 3G4PA 3IF6B 5FSRA 4FSFA 4IBXA 1CK3A 3Q07A 4P6BA 4ZJ1A 3M6HA 1QMEA 3MBZA 5AQAA 4GD8A 2Y2HA 5JYPA 4DE0A 5FAQA 2WKEA 1BUEA 3G32A 1SCWA 4A5RA 3FKWA 2JE5A 4MEZA 4B4XA 1IYSA 4S2PA 4ZBEA 1W79A 2Y91A 3G30A 1KGFA 3ZDJA 4Z9QA 5HL1A 1RP5A 3WS0A 1L2SA 1IKIA 1ES4A 1M40A 4X69A 5F82A 5U47A 3HLWA 2XK1A 5CGWA 2VGJA 1CI9A 3Q1FA 1PW1A 1QMFA 3GR2A 2Q9NA 1JWPA 3TSGA 3V3RA 4R3JA 4HBUA 1JWVA 3MZDA 3UY6A 2R9WA 3LY3A 3N4IA 4KG5A 3GQZA 4KQQA 3A3FA 1C3BA 1K54C 4N9LA 4BL3A 2IWDA 4LENA 4FH4A 5FATA 5FDHA 1TDGA 3ZG9B 4EBPA 1BZAA 4YINA 4OOLA 5FQQA 5GLBA 2ZQ8A 5F83A 5EE8A 4OOMA 3DWZA 4GOGA 5IHVA 1AXBA 3ZVTA 3V39A 4DKIA 4K0XA 4L0LA 2OSUA 2ZQ7A 3PBSA 3UDIA 3IT9A 1ERQA 1LLBA 3GVBA 3PTEA 5FI7A 4EWFA 1YLYA 2H0TA 2Z2MB 4R0QA 3JYIA 5HFOA 5J8XA 1VQQA 3ZHHA 5FQKA 3VOYA 4JXGA 4LV3A 1W7FA 1IEMA 1EROA 1O07A 3HLGA 4LV0A 2H0YA 1I2WA 1RGZA 4N1XA 4EV4A 5HW3A 3O3VA 4MLLA 4KG2A 4XUXA 3SS3A 4KZ4A 4B4ZA 4WYYA 2HP6A 4X55A 4JF4A 4GKUA 4LCLA 2RCXA 1JVJA 1CI8A 1FR1A 2CC1A 4E3KA 3IH9A 4JF6A 3WRZA 3SS4A 3I7JA 1E4DA 3ZNTA 1FR6A 4LCMA 3WS1A 2EXBA 2EX9A 3VFFA 1ESIA 1IELA 3BFGA 5DF7A 3W4OA 2EXAA 4ZDXA 5DVAA 1H5XA 5EVLA 3BLMA 2C6WB 2WAFA 2A3UA 3CMZA 4OPZA 3UNWA 3VSKA 4E3LA 5KSHA 1YM1A 4X6TA 3Q7VB 2Y2QA 3WWXA 1M6KA 2WGIA 3LEZA 1GA0A 3M2KA 2XFTA 2X01A 3WS4A 2Y2MA 5EPHA 2ZMAA 5CHUA 4DE1A 5FQJA 3D4FA 4UA6A 4R4SA 1N4OA 5E43A 1XA7A 2H10A 2EX6A 3BFFA 1MY8A 2P9VB 4KZ7A 4QU3A 1NRFA 1NYYA 1PI4A 1FCNA 3HLDA 1IYQA 5EVIB 3SS5A 3UN7A 1MXOA 5CTNA 3LCEA 3BFEA 3CG5A 4JXVA 3QNCA 3NCKA 2HPBA 5A90A 3VP4A 3G34A 1DJAA 4BENA 1MKIA 2J9PA 3W4QA 4IVIA 4FD8A 1GA9A 5DTTA 2J7VA 2J8YA 3A3EA 3IXDA 3RJUA 5CRFA 3MFDA 3Q81A 4QHCA 4FH2A 4WEJA 2JC7A 3GSGA 1MWTA 2ZC5B 1ONHA 4EUZA 5EOOA 3LO7A 5A91A 5CHMA 3VP1A 3LY4A 4PM9A 4XXRA 2WGWB 3UPNA 2Y2GA 1TDLA 2XEPA 3BECA 3PBQA 1G68A 2ZQ9A 2WAEA 3HUNA 5KMWA 3UO9A 4WBGA 1SDNA 3A3IA 4WMCD 1PZOA 4ZJ2A 1HZOA 1L0EA 4E6WA 4QJGA 3RXXA 3OC2A 3IHAA 3HLBA 3MXSA 3IQAA 4HEFA 2EX2A 4DXBA 2Y2NA 2ZLYA 4JKTA 4GN2A 3VP0A 1K55A 2X71A 3HLFA 4MBFA 4PMAA 4WZ4A 3ZCZA 3DTMA 2OV5A 4CPKA 1DJBA 2BLSA 3NI9A 4NETA 1K54A 1PI5A 2PU2A 4EQIA 1K6RA 2XF3A 1ZG6A 1IKGA 4BD1A 4PPRA 1KVMA 1O7EA 4MBHA 3NC8A 1ONGA 5GHXA 1NZUA 3C7VA 5CHJA 1K55C 3PBRA 1YLJA 1TEMA 1E3UD 1Q2QA 2DRWA 2V2FF 2WYXA 2ZD8A 3PBNA 4UA9A 3TG9A 3W4PA 1K4EA 3ZFZA 3AGEA 4IBRA 1LL5A 2Y2IA 3MKFA 3A3DA 4PM5A 4KZ8A 5FA7A 5M18A 3HBRA 1K6SA 5FAOA 5E2HA 3N6IA 4IEDA 4OP8A 3AGDA 3QNBA 3OPRA 2Y4AA 4KZ3A 3HVFA 3IXHA 5A92A 3S1YA 3IF6A 2ZJ9A 1GHIA 5CEBA 4KZAA 1XKZA 5CECA 4OKPA 3VP2A 3NIAA 4C75A 5CERA 4S2OA 2Y59A 1FCOA 4WEKA 1NYMA 3DW0A 3VFHA 4BLMA 4F94A 4WELA 2XQZA 3HUOA 1FQGA 1CEFA 4YFMA 5I94A 3G31A 1KGEA 4K0WA 2OLVA 4OPRA 1XX2A 4R4RA 4RA7A 3CJMA 3OZHA 3BYDA 4S2IA 3IF6C 1NY0A 3S22A 4WMCA 4DF6A 5GL9A 3N8RA 4JF5A 2BG1A 3E2KA 4MBKA 2WZZA 5CTMA 4KZ5A 4D2OA 1PZPA 4P85A 3SH9A 2EFUA 1FSWA 1FOFA 3HREA 2WZXA 4U0XA 4X68A 3NBLA 4QY5A 1W8YA 4S2KA 5DF9A 4DDYA 4XUZA 3ZVWA 2XD1A 3PBTA 3GTCA 4P87A 3ZG8B 3IWIA 3O87A 1SHVA 3ISGA 3IWQA 4JPMA 5EVID 5HAPA 2ZC7A 4DRTA 2WADA 3ZG7B 5AQ9A 2PU4A 5E2FA 1ALQA 4ZAMA 2ZQCA 4OP5A 3FZCA 3HUMA 2FFFB 3Q7ZA 2FFYA 1YQSA 2XD5A 3SOIA 3OPHA 1I5QA 3UE1A 4OQGA 3C5AA 1GHPA 1KGGA 2XR0A 3A3JA 1E3UA 4R1GA 1LL9A 1Z6FA 2WK0A 3GV9A 1YLTA 1KE3A 2H5SA 5EECA 4R3BA 3BLSA 5FI2A 2UWXA 3UE3A 1GHMA 1XGJA 4RX2A 4Q8IA 4OQ0A 4JXWA 4KQOA 4GNUA 4OQIA 5E2GA 1XGIA 3FV7A 4N9KA 4X56A 5AQ7A 4GZBA 2VGKA 4OH0A 1SKFA 4DE3A 1EI5A 4RX3A 3OPLA 2HDSA 1WYCA 2Y2KA 3M6BA 1RGYA 4S2NA 5EOEA 4GD6A 5L2FA 1LHYA 1ERMA 1LI0A 1CEGA 4OOYA 1K56D 3C7UA 1WYBA 4S2JA 5JYOA 1N9BA 3FKVA 4K91A 3Q7VA 2R9XA 1J9MA 4KZBA 1L0GA 1JWZA 1K57C 4OQHA 5BOHA 3Q82A 4S2MA 4S2NC 1BLHA 1IYOA 3HL9A 4OPYA 5DTKA 3V5MA 4UA7A 2EX8A 2P9VA 1S0WA 1WE4A 4X53A 3GRJA 5EVIA 2V1ZA 1VM1A 1ES5A 5CGSA 3UDFA 1K4FA 1PWCA 3UPPA 5HAIA 5FQMA 2JCHA 4BQMA 2XH9A 4PM8A 1BLCA 4KG6A 2E8IA 1ZG4A 1BULA 2Y55A 3N8SA 4EBNA 1ZKJA 2HDRA 3VOZA 3G35A 4GDNA 4E3JA 4R23A 5DTSA 2GDNA 3EQUA 2HP9A 3VMAA 5D3OA 5EVIC 5KSCA 4IVKA 3V50A 2WKIA 3VSLA 1HVBA 3C4OA 1XXMA 3PBOA 1HTZA 1YLPA 4DXCA 1KE4A 5FQ9A 1KDWA 2WGWA 1ES3A 2DCFA 3S4XA 3HLEA 5HARA 3SH7A 4ZTKA 3OPPA 4O7DA 1PIOA 4U3TA 2Y2OA 2QPNA 3OCLA 3V3SA 3W8KA 1ESUA 4KZ9A 3BFCA 1L0FA 1DY6A 3SH8A 3NDEA 3IWOA 1DJCA 4WM9A 3PAGA 1G6AA 2B5RA 1L0DA 2Q9MA 4QB8A 1JTGA 3FYZA 3ZG5A 4JLFA 3P09A 5GHYA 2ZC3B 4H8RA 4BD0A 4M3KA 1BT5A 1K56A 1NJ4A 3IXGA 4JXSA 3E2LA 2Y2JA 5DF8A 3N8LA 1RCJA 1BLPA 5FAPA 5GHZA 5GLDA 4PM7A 4WZ5A 3WS5A 2IWCA 3C4PA 1W5DA 1FCMA 4HESA 1PWDA 5EUAA 3UDXA 5G18A 1Y54A 2HDQA 4ID4A 4P0MA 4RVAA 4NK3A 1KVLA 1MPLA 1MWUA 1NZOA 2IWBA 1EWZA 3EQVA 2WKHA 2ZM2A 4Y0OA 4CJNA 1H8ZA 4ZJ3A 3VP3A 2ZQDA 1MBLA 2OLUA 3N7WA 3AGFA 2Y2LA 2ZQAA 1YMSA 3NDGA 1OMEA 4E3IA 5GLAA 3G2ZA 5CEDA 4WZ5C 3WS2A 4QD4A 2A49A 1BLSA 4BJPA 1MWRA 2QZ6A 4LV1A 1PWGA 5KZHA 4E3OA 1IYPA 2V20A 2ZM0A 4UAAA 5CXWA 2J9OA 1XA1A 5TFQA 2XLNA 1YMXA 3M2JA 1XP4A 2G2UA 4FCFA 3ZGAB 2DNSA 1NXYA 3WRTA 5M19A 1XPBA 3MZEA 4HBTA 4MNRA 1BSGA 2XGNA 3B3XA 3IF5A 1MWSA 1YLZA 2RL3A 1U60A 2XDMA 5TGFA 4S2LA 3IHBA 2PBYA 4JBFA 4Y0UA 3TOIA 4E3NA 4OLDA 1LI9A 5TR7A 3P98A 1S6RA 3QHYA 4LV2A 2Y2PA 4N1HA 3MXRA 3ITBA 2HDUA 5FASA 4Y7PA 1FSYA 3BRMA 3CZDA 2ZC6B 5FI6A 4OVDA 3O86A 4QY6A 4KZ6A 3ZG0A 3IH8A 1YT4A 2G2WA 5FQIA 5M1AA 1K57A 2Z2LB 3UPOA 5AQBA 4KENB 3MZFA 1SDEA 5F1GA 4DE2A 2C5WB 5E2EA 1I2SA 3PAEA 5GLCA 3ZNYA 4OPQA 3NY4A 3BM6A 2JBFA 3MKEA 3UE0A 3GMWA 4GDBA 4GB7A 2X02A 1YLWA 5CGXA 5HX9A 3OCNA 3O88A 1K25A 4DDSA 3FWLA 4OONA 1E25A 2ZM8A 4E6XA 3HLCA 4U0TA 4B88A 1TVFA 2QMIA 2ZC4B 2HP5A 4E3MA 4BL2A 1ES2A 1ZC2A 4Y0TA 1HD8A 1BTLA 4OLGA 3DWKA 4C3QA 1KE0A 3ITAA 1W8QA 1H8YA 2WGVA 4N92A 4KQRA 5A93A 2I72A 3G2YA 4UHUA 1GCEA 3RXWA 1JTDA 1Q2PA 1KDSA 3BEBA 3IXBA 5F1FA 4RYEA 2WUQA 1K38A 2EFXA
chains in the Genus database with same CATH superfamily
2XFSA 4LRZE 1PW8A 3BFDA 5FSRA 4FSFA 4IBXA 3DTIA 3ICYA 4P6BA 4ZJ1A 3E4PA 3M6HA 3MBZA 5AQAA 4Y17A 3KYQA 4A5RA 1F2KA 4B4XA 3U2AA 4UQIM 4ZBEA 2XA7S 1KGFA 4JGQA 3ZDJA 1IKIA 2V0UA 4X69A 2VA0A 3JVVA 1QMFA 4EXOA 4R3JA 2R9WA 4KQQA 4B93A 3FC7A 3GQZA 4N9LA 1K54C 4IUHA 1TS0A 4GS9A 4LENA 4FH4A 5L09A 3DWZA 5IHVA 3ZVTA 1MKMA 2OSUA 3MXQA 1ERQA 2B95A 2JKFA 4R0QA 3ZHHA 3DTKA 3EGDC 3T4QA 4LV0A 5HW3A 4MLLA 4KG2A 4Y2FA 1FR1A 4E3KA 3I7JA 5G4YA 4D60A 1TS8A 3VFFA 3BFGA 2EXAA 2V8CA 5DVAA 1H5XA 2C6WB 3UNWA 3VSKA 2PAVP 4E3LA 5KSHA 3OOVA 1NWZA 4QPRA 3UB7A 1GA0A 3M2KA 2XFTA 2X01A 2V0WA 5EPHA 4DE1A 5FQJA 3D4FA 2PRFA 3T50A 4KZ7A 4MMNA 1FCNA 3HLDA 3SS5A 4BBVA 4Y13A 5HPIA 4JXVA 3QNCA 3T12B 2VK3A 5A90A 3VP4A 1GA9A 5FEFA 4JGRA 2J7VA 3BJNA 2J8YA 3Q81A 4QHCA 2ZOIA 3GSGA 4NKPA 2VZWA 2ZC5B 5A91A 3VP1A 2PYPA 5IS1A 3UPNA 2Y2GA 1G68A 3HUNA 3BW6A 4WBGA 3A3IA 1L0EA 4QJGA 4R70A 3HLBA 4HEFA 2M7VA 5AVEA 2Y2NA 2ZLYA 4GN2A 4WZ4A 3DTMA 3NOUC 3IX4A 4NETA 1K54A 2XF3A 5AJGA 1IKGA 1DP9A 3K2NA 4PPRA 1O7EA 1XJ3A 1NZUA 2JKTM 3PBRA 2V2FF 2WYXA 3PBNA 1K4EA 5HPFA 4Q0IA 4PM5A 3MFXA 4IEDA 4OP8A 4Q0HA 4X1LA 3OPRA 2V1BA 2M7UA 4WF0A 3IF6A 2ZJ9A 2NUPC 5DJUA 5CECA 4OKPA 3VP2A 3NIAA 5CERA 2W1RA 1G5UA 1FCOA 1OT6A 3VFHA 2XQZA 3LIEA 4YFMA 2OLVA 2XSSA 1P9WA 4S2IA 3S22A 1NY0A 4JGOA 3N8RA 2BG1A 3O5YA 2EFUA 1Z09A 2GX5A 1XJ6A 2WZXA 3NBLA 3QP5A 3PBTA 3GTCA 4P87A 5EVID 4ME4A 2WADA 2ZBBA 2ZMFA 3HUMA 2P7JA 1YQSA 2W0NA 2XD5A 3SOIA 5HDSA 1KGGA 1Z6FA 3GV9A 1YLTA 2UWXA 3UE3A 3KSFA 3PYPA 4FUWA 4OQ0A 4JXWA 3LGOA 4GNUA 1XGIA 3FV7A 4N9KA 4X56A 3VE3A 5AQ7A 5HD3A 2VGKA 4LRXC 1EI5A 3OPLA 1WYCA 3QP1A 2Y2KA 1GSXA 3NOTC 1RGYA 4EEUA 3CAXA 1LHYA 1ERMA 1LI0A 3MSHA 1OTDA 1WYBA 2MJ6A 1DP6A 3FKVA 5LBRA 4S2MA 1IYOA 5DTKA 5KIZA 3V5MA 4H6JA 2EX8A 2BASA 3PR6A 1DP8A 5HAIA 1BULA 2P04A 2V1AA 3IS2B 2W3GA 5D3OA 5EVIC 5KSCA 4IVKA 2WKIA 2WKQA 1YLPA 2DCFA 3SH7A 3L7HA 1PNEA 3V3SA 1NLZA 3BFCA 1DY6A 4WM9A 1G6AA 5FL3A 2Q9MA 5IT5A 5GHYA 4H8RA 1BT5A 1K56A 2V8FA 3A0VA 3C2WA 4PM7A 4WZ5A 1FCMA 3T1RA 4Y5FA 4I39A 3UDXA 1Y54A 2HDQA 4ID4A 3IS2A 1MWUA 1NZOA 4Y0OA 1JNUA 2ZM2A 4CJNA 4ZJ3A 4O0PA 3UB5P 1YMSA 3K3CA 1T19A 1LSVA 4QD4A 2V20A 1XA1A 4B9OA 4FCFA 1VETB 1D7EA 1YLZA 2XDMA 4Y0UA 3IHBA 5HDCA 3P98A 1S6RA 3QHYA 3CPTB 4N1HA 5FASA 2QKPA 4Y7PA 3CZDA 1SKOB 4BBTA 4QY6A 3S7PA 3L9KA 5AQBA 4KENB 4DE2A 1SDEA 2C5WB 5E2EA 3PAEA 5GLCA 3FG8A 3GMWA 4GDBA 3O88A 4CLCA 1K25A 4DDSA 1VHMA 4ESPA 1ZHHB 3HLCA 2VGLM 4MN7A 2ZC4B 2L1MA 3UB9A 1ZC2A 4R6LA 3DWKA 3ITAA 1GCEA 2XRNA 3RXWA 3BEBA 4RYEA 2EFXA 1STZA 3LIDA 2P74A 4HQAA 5HAQA 4C6YA 3G4PA 3UE6A 4UQIS 4EERA 2Y2HA 5JYPA 5FAQA 2KX6A 3E4QA 1SCWA 3FKWA 2JE5A 3F1PA 1W63Q 1IYSA 4S2PA 1FIKA 2Y91A 5EVEA 3WS0A 1L2SA 2OOLA 4NG2A 1ES4A 1KOUA 3HLWA 5CGWA 1CI9A 4DMZA 4KG5A 1C3BA 2IWDA 5FATA 4EBPA 1BZAA 4XT2A 4OOLA 2YKHA 5EE8A 3V39A 4DKIA 4L0LA 3PBSA 3UDIA 3PTEA 5FI7A 1YLYA 2H0TA 4LFUA 3JYIA 5HFOA 2PDRA 2PHYA 1VQQA 5J8XA 3CLOA 4L9GA 4JXGA 3HLGA 1IOUA 2QYBA 5HWVA 4X55A 1JVJA 4JF6A 3WRZA 3JVUA 4EETB 3WS1A 2HGVA 2EX9A 4UEYA 4P6ZM 4ZDXA 4HI4A 4WUJA 4NXGA 3Q7VB 2Y2QA 1M6KA 4MDZA 2WGIA 3H9WA 2VJWA 5CHUA 5K5BA 3R7WB 5E43A 1HLUP 2EX6A 3BFFA 2P9VB 3F1NA 4ZRRA 1NYYA 5EV0A 2Y8HA 3LR4A 4NXBA 2HPBA 1MKIA 2J9PA 4IVIA 2K2NA 3DTEA 3MFDA 2O9CA 4FH2A 5FDSA 3T4LA 1S66L 1ONHA 4EUZA 5EOOA 3LO7A 4GJ4A 5CHMA 4PM9A 2XEPA 2WAEA 1YKDA 2QWSA 1PZOA 1VEUB 1HZOA 4E6WA 3IHAA 4DXBA 3VP0A 3ZCZA 2X71A 1DJBA 5CX7A 3NI9A 1PI5A 2PU2A 4EQIA 5DKKA 1KVMA 2QHKA 3NC8A 1ONGA 4KUKA 5CHJA 1TEMA 2DRWA 1Q2QA 2ZD8A 2YKFA 3AGEA 5TBMA 1OTBA 3MKFA 5EM0A 4KZ8A 3D72A 5M18A 5E2HA 3N6IA 4KZ3A 4DJ2A 5A92A 5CEBA 1GHIA 2M1CA 3JPUA 4S2OA 3NJAA 4IHQA 4WELA 5HSQA 1FQGA 3G31A 4HHDA 1KGEA 3DAVA 4HJ4A 4I38A 3OZHA 3BYDA 3IF6C 2L4RA 2WZZA 5CTMA 1YPRA 3BWLA 3ZVWA 3MMHA 3IWIA 1SHVA 4HOIA 3B47A 5E2FA 4ZAMA 4OP5A 2PYRA 4KUOA 2EWWA 1XFNA 4ETZA 2FFYA 3OPHA 4OQGA 3C5AA 1E3UA 4R1GA 2WK0A 3E4OA 3BLSA 4Q8IA 3LR3A 5EM1A 4L9EA 5E2GA 4G3WA 3QP8A 2W3EA 4GZBA 3FPVA 4RX3A 1S1ZA 3PHYA 4GD6A 1CEGA 1K56D 2QJ5A 2INWA 4KZBA 1L0GA 1K57C 2I9VA 5BOHA 3IX3A 4EEPA 4OPYA 3NHQA 1VM1A 3CWFA 3UPPA 5FQMA 2JCHA 3VE4A 2XH9A 5C5KA 2Y55A 1YSQA 5F69A 5F5YA 4GDNA 3R4KA 1UWNX 4YNRA 1HVBA 1HTZA 5I5LA 3F1OB 5HARA 1V9ZA 1OTAA 2QPNA 3LEQA 3OCLA 1ESUA 4KZ9A 4O01A 3NDEA 3OLOA 4QB8A 3UB8A 2ZC3B 4EQ1A 2GNXA 1AWIA 2XA7M 3N8LA 4HY8A 4ETXA 1N9NA 3LIAA 3WS5A 2V9AA 4CLCD 2IWCA 1P0ZA 2VKSA 4NK3A 5J4EA 4PKYA 3EQVA 1H8ZA 2ZQDA 2OLUA 2ZQAA 3NDGA 4M4XA 1OMEA 4E3IA 5GLAA 5CEDA 1XFQA 4WZ5C 3WS2A 3PXPA 1BLSA 4BJPA 1MWRA 4MN5A 1PWGA 5KZHA 4E3OA 2ZM0A 2XLNA 3T4TA 3M2JA 1NXYA 5M19A 3MZEA 4MNRA 2UV0E 3IF5A 2P08A 5DFXA 3TOIA 4JBFA 4FTXA 3LIBA 5TR7A 3BQ8A 1DRMA 2Y2PA 3CUEA 3ITBA 1F5MA 1FSYA 1P9RA 3IH8A 1K57A 1GSWA 1I2SA 3HCYA 3NECA 3NY4A 5L07A 3EWKA 2VX8A 1E25A 2LB5A 3TE8A 4E6XA 1NRJA 1TVFA 2QMIA 1ES2A 1HD8A 2A2LA 4CLCC 1FILA 5A93A 3A0RA 5HD5A 2PD7A 3IXBA 5F1FA 1K38A 1PYYA 4EBLA 4PM6A 4RQ9A 1CK3A 1QMEA 2FZ0A 1H0MA 4DE0A 2WKEA 1BUEA 3KX0X 1L3LA 3G32A 5EFWA 3QP2A 3S7QA 3W2ZA 4HH3A 1SZVA 1W79A 5L10A 5HL1A 2QJ7A 1RP5A 1UGUA 5F82A 4EW7A 2PBDP 2VGJA 3Q1FA 1PW1A 2Q9NA 1JWPA 3TSGA 1JWVA 3LY3A 2D02A 3A3FA 4BL3A 5DFYA 5GLBA 2ZQ8A 5F83A 2HF6A 4I3JA 2ZQ7A 3IT9A 3GVBA 4EWFA 2Z2MB 3G6OA 4Q0JA 5FQKA 1IEMA 1EROA 1O07A 1RGZA 4XUXA 1PRQA 4B4ZA 4P6ZS 2HP6A 4JF4A 2RCXA 2CC1A 3SS4A 2HV1A 4Y15A 1OTIA 1ESIA 1IELA 3W4OA 5HL6A 2W1TB 3BLMA 2WAFA 4OPZA 2A24B 5TJJA 3E0YA 3T4KA 3WWXA 2J80A 2W3DA 4PHTA 3WS4A 2Y2MA 2ZMAA 3C38A 4UA6A 2O9AA 1MY8A 3K3DA 2JKRM 4NEED 3IBRA 1PI4A 1IYQA 5EVIB 1MXOA 1NLYA 5CTNA 5F68A 1OPXA 3G34A 3RH8B 3W4QA 1VETA 5DTTA 3S7NA 3VV4A 3A3EA 3IXDA 2JN7A 1S4RA 4WEJA 4F3LB 1MWTA 4NXFA 3V67A 2JHEA 3LY4A 1GSVA 3LYXA 2WGWB 2A24A 3CPTA 1TDLA 1ACFA 3BECA 3PBQA 3LICA 5KMWA 1SKOA 3KSGA 1TD5A 3IQAA 2EX2A 4JKTA 1K55A 1UWPX 2ZL1B 2OV5A 3KSHA 2OAQ1 1K6RA 1ZG6A 3SW1A 1G6OA 4MBHA 5GHXA 3C7VA 4WLAA 1S1YA 1E3UD 4UA9A 2IA2A 4IBRA 3IBJA 1LL5A 4MCWA 2Y2IA 2PR6A 3A3DA 5FA7A 3HJKA 4HP4A 3HVFA 1BYWA 3IXHA 1XJ4A 1XKZA 3GECA 4C75A 2JKRI 2ZL1A 4WEKA 3DW0A 3C8CA 4X1MA 1CEFA 4K0WA 1XX2A 3CJMA 4DF6A 4WMCA 5GL9A 4JF5A 4MBKA 3E2KA 4D2OA 1PZPA 4P85A 3SH9A 2HJEA 1FOFA 4U0XA 4QY5A 5DF9A 4DDYA 4XUZA 3ZG8B 3O87A 3ISGA 3IWQA 2ZC7A 2PU4A 1ALQA 2ZQCA 1CF0A 2VV8A 3FZCA 3KYZA 1OJ5A 3A3JA 2XR0A 3H7WB 1LL9A 2H5SA 5EECA 4R3BA 5FI2A 4ARZB 3T1XA 1XGJA 4RX2A 3MQOA 4KQOA 4OQIA 2VV6A 2FH5A 2O0YA 1S67L 4OH0A 1SKFA 2HDSA 2K31A 2KOIA 5J3WA 1LSWA 4QWOA 4S2NA 5MC7A 5EOEA 1IFQA 4OOYA 3LI9A 3C7UA 3E98A 1N9BA 4K91A 3Q7VA 2R9XA 1J9MA 4PKYG 3CI6A 4OQHA 3MS6A 3R7WA 4KQDA 2WKRA 1BLHA 3H7WA 3HL9A 4UA7A 2P9VA 3EEHA 4HIAA 1S0WA 1WE4A 2V1ZA 4GS9B 4GLQA 4BQMA 1BLCA 1N9LA 3MF0A 1ZG4A 4FOFA 3N8SA 4EBNA 2JKGA 2HDRA 2J3TC 3G35A 1G28A 3IX8A 4E3JA 3U4LP 5DTSA 3EQUA 2HP9A 3VMAA 4WN5A 3V50A 1OT9A 3C4OA 4DXCA 1KE4A 4EESA 2KDKA 2HZ5A 1ES3A 4U3TA 2Y2OA 3W8KA 3UMEA 1L0FA 2PD8A 1VEUA 1DJCA 3PAGA 3T4JA 3P09A 4BD0A 1NJ4A 3IXGA 5DF8A 3E2LA 5FAPA 1MC0A 3T1SA 1W5DA 4HESA 1V9YA 5EUAA 5G18A 4P0MA 1X0OA 3P01A 4DJ3A 4Y3IA 1TS6A 3RFBA 1TF1A 3VP3A 2Y2LA 3G2ZA 2HJ9C 5FEGA 2KLIA 2QZ6A 5CXWA 5TFQA 1Y4OA 1K0KA 2Y79A 3WRTA 1XPBA 3MJQA 4HBTA 1BSGA 1MWSA 2RL3A 1U60A 5TGFA 2PBYA 4E3NA 4OLDA 1XJ2A 4LV2A 2GJ3A 2HDUA 4NXEA 2NUTC 4HJ6A 3BRMA 3P7NA 2ZC6B 4GCZA 4OVDA 3O86A 4KZ6A 3ZG0A 2G2WA 5FQIA 5M1AA 3LI8A 1T1BA 3KSIA 3MKEA 3UE0A 3CUEC 2PT7A 3FPWA 4GB7A 5HX9A 2ACGA 3OCNA 2R78A 4OONA 4U0TA 2HP5A 4BL2A 4LLOB 4Y0TA 3LFVA 3TW8A 2Z6DA 1W8QA 1H8YA 3G2YA 3ZYTA 1JTDA 1KDSA 5AVFA 3KYEA 1H8MA 4LPZA 4R38A 3IF6B 1W63M 3MQQA 3Q07A 2OWHA 4GD8A 4MEZA 5DKLA 3G30A 4Z9QA 1M40A 5U47A 4I3IA 2XK1A 3GR2A 1J3WA 3V3RA 4HBUA 3MZDA 3UY6A 3N4IA 3D9YA 3QP4A 2E8JA 2VEAA 4HJ3A 5FDHA 1TDGA 3ZG9B 4YINA 5FQQA 4OOMA 4GOGA 1AXBA 4K0XA 1LLBA 2B02A 2XROA 2ZMVA 3OBFA 4R3AA 3LIFA 3VOYA 4LV3A 1W7FA 2H0YA 1I2WA 4N1XA 4DN0A 4EV4A 3O3VA 1ODVA 3F1OA 3SS3A 4KZ4A 4WYYA 1YAXA 3HJIA 4GKUA 4LCLA 1CI8A 4GHIB 3IH9A 3S7OA 1E4DA 3VOLA 3ZNTA 1FR6A 4LCMA 2EXBA 5DF7A 2LB9A 5EVLA 3BY8A 3CMZA 2A3UA 4O8GA 1YM1A 4X6TA 3EGXC 1P97A 3LEZA 1CJFA 3CHWP 1N9OA 4K08A 4CLCE 4R4SA 1N4OA 1XA7A 2H10A 4H6JB 4QU3A 3UMDA 1NRFA 3UN7A 1TS7A 2J3WA 2VGLS 3BY9A 3LCEA 3BFEA 3CG5A 3KO6A 3NCKA 2W27A 1DJAA 3QP6A 4LGWA 4BENA 2D01A 4FD8A 4GHIA 1WA9A 2JKTI 1S4SA 3RJUA 4BMWA 5CRFA 2JC7A 3EEAA 4XXRA 3T4OA 1MZUA 2VLGA 2ZQ9A 3GDIA 3UO9A 4E04A 1SDNA 4WMCD 4ZJ2A 3RXXA 3OC2A 3RTYA 3MXSA 2AVXA 3HLFA 4MBFA 3NOPC 4PMAA 4CPKA 2BLSA 5A8BA 4HNBA 4EU0A 4BD1A 3LR5A 5L8MA 1K55C 1YLJA 1D06A 2O99A 3TG9A 3W4PA 3ZFZA 3T4SA 1LL8A 3A0SA 3HBRA 1K6SA 5FAOA 4CQHA 3AGDA 3QNBA 3TRCA 2Y4AA 3C30A 3S1YA 4KZAA 4YOFA 1OTEA 2Y59A 1NYMA 4JGPA 4BLMA 4F94A 3HUOA 5I94A 4OPRA 2BTFP 4HH2A 3B42A 4R4RA 4RA7A 3MQ0A 2DMWA 3LR0A 4HP9A 4KZ5A 5IU1A 1T18A 1FSWA 3HREA 4X68A 4L9FA 2PR5A 1W8YA 4S2KA 4LRYC 2XD1A 1T1CA 2O9BA 4JPMA 5HAPA 4DRTA 3ZG7B 5AQ9A 4CLCB 3MR0A 3Q7ZA 2FFFB 5HDDA 1I5QA 3UE1A 1GHPA 1KE3A 4I3AA 4GW9A 1OJGA 3T1QB 3LUQA 1GHMA 1H3QA 4G3VA 2W3FA 4DE3A 3D3OA 3M6BA 1PFLA 4PAUA 5L2FA 4G3KA 1LT0A 5HZHA 2W1TA 3F1PB 4S2JA 5JYOA 4MN6A 5DJTA 1VB6A 2G7UA 1JWZA 3Q82A 2W3HA 4S2NC 2OWJA 2K7SA 2CMNA 3TJZC 4X53A 3GRJA 5EVIA 1ES5A 1EW0A 5J7EA 5CGSA 3UDFA 1K4FA 1PWCA 4I5SA 4Z1WA 4XT2B 4PM8A 4KG6A 2E8IA 2EWVA 1ZKJA 3ZQ5A 1D1JA 3VOZA 1YSPA 4R23A 2GDNA 3UB6A 4F3LA 4YWZA 3VSLA 1XXMA 3PBOA 5FQ9A 1KDWA 2WGWA 3S4XA 3HLEA 4ZTKA 3OPPA 4O7DA 1PIOA 3SZTA 2Q0OA 1CQAA 3SH8A 4IJGA 3IWOA 2WKPA 2GZAA 2B5RA 1L0DA 4II7A 1JTGA 3FYZA 3ZG5A 4JLFA 4M3KA 4JXSA 2Y2JA 1RCJA 1BLPA 2OAP1 5GHZA 5GLDA 5HWWA 4EUVA 3C4PA 1PWDA 4X25A 4RVAA 1KVLA 1MPLA 5G4ZA 2IWBA 2J3TD 1EWZA 1LSXA 2WKHA 2VV7A 1F98A 1MBLA 3F1NB 3N7WA 3AGFA 2A49A 1F9IA 4LV1A 2ZOHA 1IYPA 4UAAA 2J9OA 1YMXA 5HWTA 1XP4A 2G2UA 3ZGAB 3CITA 4BBUA 2DNSA 3H82B 3NULA 2Z6CA 3B33A 2XGNA 3B3XA 4S2LA 1LI9A 4AFIA 3MXRA 1ZTUA 4WL9A 5FI6A 3BQAA 3EOIA 1YT4A 1T1AA 2Z2LB 3UPOA 3MZFA 5F1GA 3ZNYA 4OPQA 3DBAA 3BM6A 2JBFA 2X02A 4IUKA 1YLWA 5CGXA 4BWIA 2EA9A 3FWLA 2ZM8A 1A0KA 4B88A 3H82A 4E3MA 1BTLA 4OLGA 4C3QA 5F6AA 1KE0A 5TBMB 3ULFA 2WGVA 4N92A 2B18A 4KQRA 2I72A 4UHUA 1Y28A 4ARZA 2L0WA 2H28A 1Q2PA 2WUQA
chains in the Genus database with same CATH topology
1PYYA 2XFSA 4EBLA 2P74A 4PM6A 1PW8A 5HAQA 4C6YA 3BFDA 3G4PA 3IF6B 5FSRA 4FSFA 4IBXA 1CK3A 3Q07A 4P6BA 4ZJ1A 3M6HA 1QMEA 3MBZA 5AQAA 4GD8A 2Y2HA 5JYPA 4DE0A 5FAQA 2WKEA 1BUEA 3G32A 1SCWA 4A5RA 3FKWA 2JE5A 4MEZA 4B4XA 1IYSA 4S2PA 4ZBEA 1W79A 2Y91A 3G30A 1KGFA 3ZDJA 4Z9QA 5HL1A 1RP5A 3WS0A 1L2SA 1IKIA 1ES4A 1M40A 4X69A 5F82A 5U47A 3HLWA 2XK1A 5CGWA 2VGJA 1CI9A 3Q1FA 1PW1A 1QMFA 3GR2A 2Q9NA 1JWPA 3TSGA 3V3RA 4R3JA 4HBUA 1JWVA 3MZDA 3UY6A 2R9WA 3LY3A 3N4IA 4KG5A 3GQZA 4KQQA 3A3FA 1C3BA 1K54C 4N9LA 4BL3A 2IWDA 4LENA 4FH4A 5FATA 5FDHA 1TDGA 3ZG9B 4EBPA 1BZAA 4YINA 4OOLA 5FQQA 5GLBA 2ZQ8A 5F83A 5EE8A 4OOMA 3DWZA 4GOGA 5IHVA 1AXBA 3ZVTA 3V39A 4DKIA 4K0XA 4L0LA 2OSUA 2ZQ7A 3PBSA 3UDIA 3IT9A 1ERQA 1LLBA 3GVBA 3PTEA 5FI7A 4EWFA 1YLYA 2H0TA 2Z2MB 4R0QA 3JYIA 5HFOA 5J8XA 1VQQA 3ZHHA 5FQKA 3VOYA 4JXGA 4LV3A 1W7FA 1IEMA 1EROA 1O07A 3HLGA 4LV0A 2H0YA 1I2WA 1RGZA 4N1XA 4EV4A 5HW3A 3O3VA 4MLLA 4KG2A 4XUXA 3SS3A 4KZ4A 4B4ZA 4WYYA 2HP6A 4X55A 4JF4A 4GKUA 4LCLA 2RCXA 1JVJA 1CI8A 1FR1A 2CC1A 4E3KA 3IH9A 4JF6A 3WRZA 3SS4A 3I7JA 1E4DA 3ZNTA 1FR6A 4LCMA 3WS1A 2EXBA 2EX9A 3VFFA 1ESIA 1IELA 3BFGA 5DF7A 3W4OA 2EXAA 4ZDXA 5DVAA 1H5XA 5EVLA 3BLMA 2C6WB 2WAFA 2A3UA 3CMZA 4OPZA 3UNWA 3VSKA 4E3LA 5KSHA 1YM1A 4X6TA 3Q7VB 2Y2QA 3WWXA 1M6KA 2WGIA 3LEZA 1GA0A 3M2KA 2XFTA 2X01A 3WS4A 2Y2MA 5EPHA 2ZMAA 5CHUA 4DE1A 5FQJA 3D4FA 4UA6A 4R4SA 1N4OA 5E43A 1XA7A 2H10A 2EX6A 3BFFA 1MY8A 2P9VB 4KZ7A 4QU3A 1NRFA 1NYYA 1PI4A 1FCNA 3HLDA 1IYQA 5EVIB 3SS5A 3UN7A 1MXOA 5CTNA 3LCEA 3BFEA 3CG5A 4JXVA 3QNCA 3NCKA 2HPBA 5A90A 3VP4A 3G34A 1DJAA 4BENA 1MKIA 2J9PA 3W4QA 4IVIA 4FD8A 1GA9A 5DTTA 2J7VA 2J8YA 3A3EA 3IXDA 3RJUA 5CRFA 3MFDA 3Q81A 4QHCA 4FH2A 4WEJA 2JC7A 3GSGA 1MWTA 2ZC5B 1ONHA 4EUZA 5EOOA 3LO7A 5A91A 5CHMA 3VP1A 3LY4A 4PM9A 4XXRA 2WGWB 3UPNA 2Y2GA 1TDLA 2XEPA 3BECA 3PBQA 1G68A 2ZQ9A 2WAEA 3HUNA 5KMWA 3UO9A 4WBGA 1SDNA 3A3IA 4WMCD 1PZOA 4ZJ2A 1HZOA 1L0EA 4E6WA 4QJGA 3RXXA 3OC2A 3IHAA 3HLBA 3MXSA 3IQAA 4HEFA 2EX2A 4DXBA 2Y2NA 2ZLYA 4JKTA 4GN2A 3VP0A 1K55A 2X71A 3HLFA 4MBFA 4PMAA 4WZ4A 3ZCZA 3DTMA 2OV5A 4CPKA 1DJBA 2BLSA 3NI9A 4NETA 1K54A 1PI5A 2PU2A 4EQIA 1K6RA 2XF3A 1ZG6A 1IKGA 4BD1A 4PPRA 1KVMA 1O7EA 4MBHA 3NC8A 1ONGA 5GHXA 1NZUA 3C7VA 5CHJA 1K55C 3PBRA 1YLJA 1TEMA 1E3UD 1Q2QA 2DRWA 2V2FF 2WYXA 2ZD8A 3PBNA 4UA9A 3TG9A 3W4PA 1K4EA 3ZFZA 3AGEA 4IBRA 1LL5A 2Y2IA 3MKFA 3A3DA 4PM5A 4KZ8A 5FA7A 5M18A 3HBRA 1K6SA 5FAOA 5E2HA 3N6IA 4IEDA 4OP8A 3AGDA 3QNBA 3OPRA 2Y4AA 4KZ3A 3HVFA 3IXHA 5A92A 3S1YA 3IF6A 2ZJ9A 1GHIA 5CEBA 4KZAA 1XKZA 5CECA 4OKPA 3VP2A 3NIAA 4C75A 5CERA 4S2OA 2Y59A 1FCOA 4WEKA 1NYMA 3DW0A 3VFHA 4BLMA 4F94A 4WELA 2XQZA 3HUOA 1FQGA 1CEFA 4YFMA 5I94A 3G31A 1KGEA 4K0WA 2OLVA 4OPRA 1XX2A 4R4RA 4RA7A 3CJMA 3OZHA 3BYDA 4S2IA 3IF6C 1NY0A 3S22A 4WMCA 4DF6A 5GL9A 3N8RA 4JF5A 2BG1A 3E2KA 4MBKA 2WZZA 5CTMA 4KZ5A 4D2OA 1PZPA 4P85A 3SH9A 2EFUA 1FSWA 1FOFA 3HREA 2WZXA 4U0XA 4X68A 3NBLA 4QY5A 1W8YA 4S2KA 5DF9A 4DDYA 4XUZA 3ZVWA 2XD1A 3PBTA 3GTCA 4P87A 3ZG8B 3IWIA 3O87A 1SHVA 3ISGA 3IWQA 4JPMA 5EVID 5HAPA 2ZC7A 4DRTA 2WADA 3ZG7B 5AQ9A 2PU4A 5E2FA 1ALQA 4ZAMA 2ZQCA 4OP5A 3FZCA 3HUMA 2FFFB 3Q7ZA 2FFYA 1YQSA 2XD5A 3SOIA 3OPHA 1I5QA 3UE1A 4OQGA 3C5AA 1GHPA 1KGGA 2XR0A 3A3JA 1E3UA 4R1GA 1LL9A 1Z6FA 2WK0A 3GV9A 1YLTA 1KE3A 2H5SA 5EECA 4R3BA 3BLSA 5FI2A 2UWXA 3UE3A 1GHMA 1XGJA 4RX2A 4Q8IA 4OQ0A 4JXWA 4KQOA 4GNUA 4OQIA 5E2GA 1XGIA 3FV7A 4N9KA 4X56A 5AQ7A 4GZBA 2VGKA 4OH0A 1SKFA 4DE3A 1EI5A 4RX3A 3OPLA 2HDSA 1WYCA 2Y2KA 3M6BA 1RGYA 4S2NA 5EOEA 4GD6A 5L2FA 1LHYA 1ERMA 1LI0A 1CEGA 4OOYA 1K56D 3C7UA 1WYBA 4S2JA 5JYOA 1N9BA 3FKVA 4K91A 3Q7VA 2R9XA 1J9MA 4KZBA 1L0GA 1JWZA 1K57C 4OQHA 5BOHA 3Q82A 4S2MA 4S2NC 1BLHA 1IYOA 3HL9A 4OPYA 5DTKA 3V5MA 4UA7A 2EX8A 2P9VA 1S0WA 1WE4A 4X53A 3GRJA 5EVIA 2V1ZA 1VM1A 1ES5A 5CGSA 3UDFA 1K4FA 1PWCA 3UPPA 5HAIA 5FQMA 2JCHA 4BQMA 2XH9A 4PM8A 1BLCA 4KG6A 2E8IA 1ZG4A 1BULA 2Y55A 3N8SA 4EBNA 1ZKJA 2HDRA 3VOZA 3G35A 4GDNA 4E3JA 4R23A 5DTSA 2GDNA 3EQUA 2HP9A 3VMAA 5D3OA 5EVIC 5KSCA 4IVKA 3V50A 2WKIA 3VSLA 1HVBA 3C4OA 1XXMA 3PBOA 1HTZA 1YLPA 4DXCA 1KE4A 5FQ9A 1KDWA 2WGWA 1ES3A 2DCFA 3S4XA 3HLEA 5HARA 3SH7A 4ZTKA 3OPPA 4O7DA 1PIOA 4U3TA 2Y2OA 2QPNA 3OCLA 3V3SA 3W8KA 1ESUA 4KZ9A 3BFCA 1L0FA 1DY6A 3SH8A 3NDEA 3IWOA 1DJCA 4WM9A 3PAGA 1G6AA 2B5RA 1L0DA 2Q9MA 4QB8A 1JTGA 3FYZA 3ZG5A 4JLFA 3P09A 5GHYA 2ZC3B 4H8RA 4BD0A 4M3KA 1BT5A 1K56A 1NJ4A 3IXGA 4JXSA 3E2LA 2Y2JA 5DF8A 3N8LA 1RCJA 1BLPA 5FAPA 5GHZA 5GLDA 4PM7A 4WZ5A 3WS5A 2IWCA 3C4PA 1W5DA 1FCMA 4HESA 1PWDA 5EUAA 3UDXA 5G18A 1Y54A 2HDQA 4ID4A 4P0MA 4RVAA 4NK3A 1KVLA 1MPLA 1MWUA 1NZOA 2IWBA 1EWZA 3EQVA 2WKHA 2ZM2A 4Y0OA 4CJNA 1H8ZA 4ZJ3A 3VP3A 2ZQDA 1MBLA 2OLUA 3N7WA 3AGFA 2Y2LA 2ZQAA 1YMSA 3NDGA 1OMEA 4E3IA 5GLAA 3G2ZA 5CEDA 4WZ5C 3WS2A 4QD4A 2A49A 1BLSA 4BJPA 1MWRA 2QZ6A 4LV1A 1PWGA 5KZHA 4E3OA 1IYPA 2V20A 2ZM0A 4UAAA 5CXWA 2J9OA 1XA1A 5TFQA 2XLNA 1YMXA 3M2JA 1XP4A 2G2UA 4FCFA 3ZGAB 2DNSA 1NXYA 3WRTA 5M19A 1XPBA 3MZEA 4HBTA 4MNRA 1BSGA 2XGNA 3B3XA 3IF5A 1MWSA 1YLZA 2RL3A 1U60A 2XDMA 5TGFA 4S2LA 3IHBA 2PBYA 4JBFA 4Y0UA 3TOIA 4E3NA 4OLDA 1LI9A 5TR7A 3P98A 1S6RA 3QHYA 4LV2A 2Y2PA 4N1HA 3MXRA 3ITBA 2HDUA 5FASA 4Y7PA 1FSYA 3BRMA 3CZDA 2ZC6B 5FI6A 4OVDA 3O86A 4QY6A 4KZ6A 3ZG0A 3IH8A 1YT4A 2G2WA 5FQIA 5M1AA 1K57A 2Z2LB 3UPOA 5AQBA 4KENB 3MZFA 1SDEA 5F1GA 4DE2A 2C5WB 5E2EA 1I2SA 3PAEA 5GLCA 3ZNYA 4OPQA 3NY4A 3BM6A 2JBFA 3MKEA 3UE0A 3GMWA 4GDBA 4GB7A 2X02A 1YLWA 5CGXA 5HX9A 3OCNA 3O88A 1K25A 4DDSA 3FWLA 4OONA 1E25A 2ZM8A 4E6XA 3HLCA 4U0TA 4B88A 1TVFA 2QMIA 2ZC4B 2HP5A 4E3MA 4BL2A 1ES2A 1ZC2A 4Y0TA 1HD8A 1BTLA 4OLGA 3DWKA 4C3QA 1KE0A 3ITAA 1W8QA 1H8YA 2WGVA 4N92A 4KQRA 5A93A 2I72A 3G2YA 4UHUA 1GCEA 3RXWA 1JTDA 1Q2PA 1KDSA 3BEBA 3IXBA 5F1FA 4RYEA 2WUQA 1K38A 2EFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYY A;  2XFS A;  4EBL A;  2P74 A;  4PM6 A;  1PW8 A;  5HAQ A;  4C6Y A;  3BFD A;  3G4P A;  3IF6 B;  5FSR A;  4FSF A;  4IBX A;  1CK3 A;  3Q07 A;  4P6B A;  4ZJ1 A;  3M6H A;  1QME A;  3MBZ A;  5AQA A;  4GD8 A;  2Y2H A;  5JYP A;  4DE0 A;  5FAQ A;  2WKE A;  1BUE A;  3G32 A;  1SCW A;  4A5R A;  3FKW A;  2JE5 A;  4MEZ A;  4B4X A;  1IYS A;  4S2P A;  4ZBE A;  1W79 A;  2Y91 A;  3G30 A;  1KGF A;  3ZDJ A;  4Z9Q A;  5HL1 A;  1RP5 A;  3WS0 A;  1L2S A;  1IKI A;  1ES4 A;  1M40 A;  4X69 A;  5F82 A;  5U47 A;  3HLW A;  2XK1 A;  5CGW A;  2VGJ A;  1CI9 A;  3Q1F A;  1PW1 A;  1QMF A;  3GR2 A;  2Q9N A;  1JWP A;  3TSG A;  3V3R A;  4R3J A;  4HBU A;  1JWV A;  3MZD A;  3UY6 A;  2R9W A;  3LY3 A;  3N4I A;  4KG5 A;  3GQZ A;  4KQQ A;  3A3F A;  1C3B A;  1K54 C;  4N9L A;  4BL3 A;  2IWD A;  4LEN A;  4FH4 A;  5FAT A;  5FDH A;  1TDG A;  3ZG9 B;  4EBP A;  1BZA A;  4YIN A;  4OOL A;  5FQQ A;  5GLB A;  2ZQ8 A;  5F83 A;  5EE8 A;  4OOM A;  3DWZ A;  4GOG A;  5IHV A;  1AXB A;  3ZVT A;  3V39 A;  4DKI A;  4K0X A;  4L0L A;  2OSU A;  2ZQ7 A;  3PBS A;  3UDI A;  3IT9 A;  1ERQ A;  1LLB A;  3GVB A;  3PTE A;  5FI7 A;  4EWF A;  1YLY A;  2H0T A;  2Z2M B;  4R0Q A;  3JYI A;  5HFO A;  5J8X A;  1VQQ A;  3ZHH A;  5FQK A;  3VOY A;  4JXG A;  4LV3 A;  1W7F A;  1IEM A;  1ERO A;  1O07 A;  3HLG A;  4LV0 A;  2H0Y A;  1I2W A;  1RGZ A;  4N1X A;  4EV4 A;  5HW3 A;  3O3V A;  4MLL A;  4KG2 A;  4XUX A;  3SS3 A;  4KZ4 A;  4B4Z A;  4WYY A;  2HP6 A;  4X55 A;  4JF4 A;  4GKU A;  4LCL A;  2RCX A;  1JVJ A;  1CI8 A;  1FR1 A;  2CC1 A;  4E3K A;  3IH9 A;  4JF6 A;  3WRZ A;  3SS4 A;  3I7J A;  1E4D A;  3ZNT A;  1FR6 A;  4LCM A;  3WS1 A;  2EXB A;  2EX9 A;  3VFF A;  1ESI A;  1IEL A;  3BFG A;  5DF7 A;  3W4O A;  2EXA A;  4ZDX A;  5DVA A;  1H5X A;  5EVL A;  3BLM A;  2C6W B;  2WAF A;  2A3U A;  3CMZ A;  4OPZ A;  3UNW A;  3VSK A;  4E3L A;  5KSH A;  1YM1 A;  4X6T A;  3Q7V B;  2Y2Q A;  3WWX A;  1M6K A;  2WGI A;  3LEZ A;  1GA0 A;  3M2K A;  2XFT A;  2X01 A;  3WS4 A;  2Y2M A;  5EPH A;  2ZMA A;  5CHU A;  4DE1 A;  5FQJ A;  3D4F A;  4UA6 A;  4R4S A;  1N4O A;  5E43 A;  1XA7 A;  2H10 A;  2EX6 A;  3BFF A;  1MY8 A;  2P9V B;  4KZ7 A;  4QU3 A;  1NRF A;  1NYY A;  1PI4 A;  1FCN A;  3HLD A;  1IYQ A;  5EVI B;  3SS5 A;  3UN7 A;  1MXO A;  5CTN A;  3LCE A;  3BFE A;  3CG5 A;  4JXV A;  3QNC A;  3NCK A;  2HPB A;  5A90 A;  3VP4 A;  3G34 A;  1DJA A;  4BEN A;  1MKI A;  2J9P A;  3W4Q A;  4IVI A;  4FD8 A;  1GA9 A;  5DTT A;  2J7V A;  2J8Y A;  3A3E A;  3IXD A;  3RJU A;  5CRF A;  3MFD A;  3Q81 A;  4QHC A;  4FH2 A;  4WEJ A;  2JC7 A;  3GSG A;  1MWT A;  2ZC5 B;  1ONH A;  4EUZ A;  5EOO A;  3LO7 A;  5A91 A;  5CHM A;  3VP1 A;  3LY4 A;  4PM9 A;  4XXR A;  2WGW B;  3UPN A;  2Y2G A;  1TDL A;  2XEP A;  3BEC A;  3PBQ A;  1G68 A;  2ZQ9 A;  2WAE A;  3HUN A;  5KMW A;  3UO9 A;  4WBG A;  1SDN A;  3A3I A;  4WMC D;  1PZO A;  4ZJ2 A;  1HZO A;  1L0E A;  4E6W A;  4QJG A;  3RXX A;  3OC2 A;  3IHA A;  3HLB A;  3MXS A;  3IQA A;  4HEF A;  2EX2 A;  4DXB A;  2Y2N A;  2ZLY A;  4JKT A;  4GN2 A;  3VP0 A;  1K55 A;  2X71 A;  3HLF A;  4MBF A;  4PMA A;  4WZ4 A;  3ZCZ A;  3DTM A;  2OV5 A;  4CPK A;  1DJB A;  2BLS A;  3NI9 A;  4NET A;  1K54 A;  1PI5 A;  2PU2 A;  4EQI A;  1K6R A;  2XF3 A;  1ZG6 A;  1IKG A;  4BD1 A;  4PPR A;  1KVM A;  1O7E A;  4MBH A;  3NC8 A;  1ONG A;  5GHX A;  1NZU A;  3C7V A;  5CHJ A;  1K55 C;  3PBR A;  1YLJ A;  1TEM A;  1E3U D;  1Q2Q A;  2DRW A;  2V2F F;  2WYX A;  2ZD8 A;  3PBN A;  4UA9 A;  3TG9 A;  3W4P A;  1K4E A;  3ZFZ A;  3AGE A;  4IBR A;  1LL5 A;  2Y2I A;  3MKF A;  3A3D A;  4PM5 A;  4KZ8 A;  5FA7 A;  5M18 A;  3HBR A;  1K6S A;  5FAO A;  5E2H A;  3N6I A;  4IED A;  4OP8 A;  3AGD A;  3QNB A;  3OPR A;  2Y4A A;  4KZ3 A;  3HVF A;  3IXH A;  5A92 A;  3S1Y A;  3IF6 A;  2ZJ9 A;  1GHI A;  5CEB A;  4KZA A;  1XKZ A;  5CEC A;  4OKP A;  3VP2 A;  3NIA A;  4C75 A;  5CER A;  4S2O A;  2Y59 A;  1FCO A;  4WEK A;  1NYM A;  3DW0 A;  3VFH A;  4BLM A;  4F94 A;  4WEL A;  2XQZ A;  3HUO A;  1FQG A;  1CEF A;  4YFM A;  5I94 A;  3G31 A;  1KGE A;  4K0W A;  2OLV A;  4OPR A;  1XX2 A;  4R4R A;  4RA7 A;  3CJM A;  3OZH A;  3BYD A;  4S2I A;  3IF6 C;  1NY0 A;  3S22 A;  4WMC A;  4DF6 A;  5GL9 A;  3N8R A;  4JF5 A;  2BG1 A;  3E2K A;  4MBK A;  2WZZ A;  5CTM A;  4KZ5 A;  4D2O A;  1PZP A;  4P85 A;  3SH9 A;  2EFU A;  1FSW A;  1FOF A;  3HRE A;  2WZX A;  4U0X A;  4X68 A;  3NBL A;  4QY5 A;  1W8Y A;  4S2K A;  5DF9 A;  4DDY A;  4XUZ A;  3ZVW A;  2XD1 A;  3PBT A;  3GTC A;  4P87 A;  3ZG8 B;  3IWI A;  3O87 A;  1SHV A;  3ISG A;  3IWQ A;  4JPM A;  5EVI D;  5HAP A;  2ZC7 A;  4DRT A;  2WAD A;  3ZG7 B;  5AQ9 A;  2PU4 A;  5E2F A;  1ALQ A;  4ZAM A;  2ZQC A;  4OP5 A;  3FZC A;  3HUM A;  2FFF B;  3Q7Z A;  2FFY A;  1YQS A;  2XD5 A;  3SOI A;  3OPH A;  1I5Q A;  3UE1 A;  4OQG A;  3C5A A;  1GHP A;  1KGG A;  2XR0 A;  3A3J A;  1E3U A;  4R1G A;  1LL9 A;  1Z6F A;  2WK0 A;  3GV9 A;  1YLT A;  1KE3 A;  2H5S A;  5EEC A;  4R3B A;  3BLS A;  5FI2 A;  2UWX A;  3UE3 A;  1GHM A;  1XGJ A;  4RX2 A;  4Q8I A;  4OQ0 A;  4JXW A;  4KQO A;  4GNU A;  4OQI A;  5E2G A;  1XGI A;  3FV7 A;  4N9K A;  4X56 A;  5AQ7 A;  4GZB A;  2VGK A;  4OH0 A;  1SKF A;  4DE3 A;  1EI5 A;  4RX3 A;  3OPL A;  2HDS A;  1WYC A;  2Y2K A;  3M6B A;  1RGY A;  4S2N A;  5EOE A;  4GD6 A;  5L2F A;  1LHY A;  1ERM A;  1LI0 A;  1CEG A;  4OOY A;  1K56 D;  3C7U A;  1WYB A;  4S2J A;  5JYO A;  1N9B A;  3FKV A;  4K91 A;  3Q7V A;  2R9X A;  1J9M A;  4KZB A;  1L0G A;  1JWZ A;  1K57 C;  4OQH A;  5BOH A;  3Q82 A;  4S2M A;  4S2N C;  1BLH A;  1IYO A;  3HL9 A;  4OPY A;  5DTK A;  3V5M A;  4UA7 A;  2EX8 A;  2P9V A;  1S0W A;  1WE4 A;  4X53 A;  3GRJ A;  5EVI A;  2V1Z A;  1VM1 A;  1ES5 A;  5CGS A;  3UDF A;  1K4F A;  1PWC A;  3UPP A;  5HAI A;  5FQM A;  2JCH A;  4BQM A;  2XH9 A;  4PM8 A;  1BLC A;  4KG6 A;  2E8I A;  1ZG4 A;  1BUL A;  2Y55 A;  3N8S A;  4EBN A;  1ZKJ A;  2HDR A;  3VOZ A;  3G35 A;  4GDN A;  4E3J A;  4R23 A;  5DTS A;  2GDN A;  3EQU A;  2HP9 A;  3VMA A;  5D3O A;  5EVI C;  5KSC A;  4IVK A;  3V50 A;  2WKI A;  3VSL A;  1HVB A;  3C4O A;  1XXM A;  3PBO A;  1HTZ A;  1YLP A;  4DXC A;  1KE4 A;  5FQ9 A;  1KDW A;  2WGW A;  1ES3 A;  2DCF A;  3S4X A;  3HLE A;  5HAR A;  3SH7 A;  4ZTK A;  3OPP A;  4O7D A;  1PIO A;  4U3T A;  2Y2O A;  2QPN A;  3OCL A;  3V3S A;  3W8K A;  1ESU A;  4KZ9 A;  3BFC A;  1L0F A;  1DY6 A;  3SH8 A;  3NDE A;  3IWO A;  1DJC A;  4WM9 A;  3PAG A;  1G6A A;  2B5R A;  1L0D A;  2Q9M A;  4QB8 A;  1JTG A;  3FYZ A;  3ZG5 A;  4JLF A;  3P09 A;  5GHY A;  2ZC3 B;  4H8R A;  4BD0 A;  4M3K A;  1BT5 A;  1K56 A;  1NJ4 A;  3IXG A;  4JXS A;  3E2L A;  2Y2J A;  5DF8 A;  3N8L A;  1RCJ A;  1BLP A;  5FAP A;  5GHZ A;  5GLD A;  4PM7 A;  4WZ5 A;  3WS5 A;  2IWC A;  3C4P A;  1W5D A;  1FCM A;  4HES A;  1PWD A;  5EUA A;  3UDX A;  5G18 A;  1Y54 A;  2HDQ A;  4ID4 A;  4P0M A;  4RVA A;  4NK3 A;  1KVL A;  1MPL A;  1MWU A;  1NZO A;  2IWB A;  1EWZ A;  3EQV A;  2WKH A;  2ZM2 A;  4Y0O A;  4CJN A;  1H8Z A;  4ZJ3 A;  3VP3 A;  2ZQD A;  1MBL A;  2OLU A;  3N7W A;  3AGF A;  2Y2L A;  2ZQA A;  1YMS A;  3NDG A;  1OME A;  4E3I A;  5GLA A;  3G2Z A;  5CED A;  4WZ5 C;  3WS2 A;  4QD4 A;  2A49 A;  1BLS A;  4BJP A;  1MWR A;  2QZ6 A;  4LV1 A;  1PWG A;  5KZH A;  4E3O A;  1IYP A;  2V20 A;  2ZM0 A;  4UAA A;  5CXW A;  2J9O A;  1XA1 A;  5TFQ A;  2XLN A;  1YMX A;  3M2J A;  1XP4 A;  2G2U A;  4FCF A;  3ZGA B;  2DNS A;  1NXY A;  3WRT A;  5M19 A;  1XPB A;  3MZE A;  4HBT A;  4MNR A;  1BSG A;  2XGN A;  3B3X A;  3IF5 A;  1MWS A;  1YLZ A;  2RL3 A;  1U60 A;  2XDM A;  5TGF A;  4S2L A;  3IHB A;  2PBY A;  4JBF A;  4Y0U A;  3TOI A;  4E3N A;  4OLD A;  1LI9 A;  5TR7 A;  3P98 A;  1S6R A;  3QHY A;  4LV2 A;  2Y2P A;  4N1H A;  3MXR A;  3ITB A;  2HDU A;  5FAS A;  4Y7P A;  1FSY A;  3BRM A;  3CZD A;  2ZC6 B;  5FI6 A;  4OVD A;  3O86 A;  4QY6 A;  4KZ6 A;  3ZG0 A;  3IH8 A;  1YT4 A;  2G2W A;  5FQI A;  5M1A A;  1K57 A;  2Z2L B;  3UPO A;  5AQB A;  4KEN B;  3MZF A;  1SDE A;  5F1G A;  4DE2 A;  2C5W B;  5E2E A;  1I2S A;  3PAE A;  5GLC A;  3ZNY A;  4OPQ A;  3NY4 A;  3BM6 A;  2JBF A;  3MKE A;  3UE0 A;  3GMW A;  4GDB A;  4GB7 A;  2X02 A;  1YLW A;  5CGX A;  5HX9 A;  3OCN A;  3O88 A;  1K25 A;  4DDS A;  3FWL A;  4OON A;  1E25 A;  2ZM8 A;  4E6X A;  3HLC A;  4U0T A;  4B88 A;  1TVF A;  2QMI A;  2ZC4 B;  2HP5 A;  4E3M A;  4BL2 A;  1ES2 A;  1ZC2 A;  4Y0T A;  1HD8 A;  1BTL A;  4OLG A;  3DWK A;  4C3Q A;  1KE0 A;  3ITA A;  1W8Q A;  1H8Y A;  2WGV A;  4N92 A;  4KQR A;  5A93 A;  2I72 A;  3G2Y A;  4UHU A;  1GCE A;  3RXW A;  1JTD A;  1Q2P A;  1KDS A;  3BEB A;  3IXB A;  5F1F A;  4RYE A;  2WUQ A;  1K38 A;  2EFX A; 
#chains in the Genus database with same CATH topology
 2XFS A;  4LRZ E;  1PW8 A;  3BFD A;  5FSR A;  4FSF A;  4IBX A;  3DTI A;  3ICY A;  4P6B A;  4ZJ1 A;  3E4P A;  3M6H A;  3MBZ A;  5AQA A;  4Y17 A;  3KYQ A;  4A5R A;  1F2K A;  4B4X A;  3U2A A;  4UQI M;  4ZBE A;  2XA7 S;  1KGF A;  4JGQ A;  3ZDJ A;  1IKI A;  2V0U A;  4X69 A;  2VA0 A;  3JVV A;  1QMF A;  4EXO A;  4R3J A;  2R9W A;  4KQQ A;  4B93 A;  3FC7 A;  3GQZ A;  4N9L A;  1K54 C;  4IUH A;  1TS0 A;  4GS9 A;  4LEN A;  4FH4 A;  5L09 A;  3DWZ A;  5IHV A;  3ZVT A;  1MKM A;  2OSU A;  3MXQ A;  1ERQ A;  2B95 A;  2JKF A;  4R0Q A;  3ZHH A;  3DTK A;  3EGD C;  3T4Q A;  4LV0 A;  5HW3 A;  4MLL A;  4KG2 A;  4Y2F A;  1FR1 A;  4E3K A;  3I7J A;  5G4Y A;  4D60 A;  1TS8 A;  3VFF A;  3BFG A;  2EXA A;  2V8C A;  5DVA A;  1H5X A;  2C6W B;  3UNW A;  3VSK A;  2PAV P;  4E3L A;  5KSH A;  3OOV A;  1NWZ A;  4QPR A;  3UB7 A;  1GA0 A;  3M2K A;  2XFT A;  2X01 A;  2V0W A;  5EPH A;  4DE1 A;  5FQJ A;  3D4F A;  2PRF A;  3T50 A;  4KZ7 A;  4MMN A;  1FCN A;  3HLD A;  3SS5 A;  4BBV A;  4Y13 A;  5HPI A;  4JXV A;  3QNC A;  3T12 B;  2VK3 A;  5A90 A;  3VP4 A;  1GA9 A;  5FEF A;  4JGR A;  2J7V A;  3BJN A;  2J8Y A;  3Q81 A;  4QHC A;  2ZOI A;  3GSG A;  4NKP A;  2VZW A;  2ZC5 B;  5A91 A;  3VP1 A;  2PYP A;  5IS1 A;  3UPN A;  2Y2G A;  1G68 A;  3HUN A;  3BW6 A;  4WBG A;  3A3I A;  1L0E A;  4QJG A;  4R70 A;  3HLB A;  4HEF A;  2M7V A;  5AVE A;  2Y2N A;  2ZLY A;  4GN2 A;  4WZ4 A;  3DTM A;  3NOU C;  3IX4 A;  4NET A;  1K54 A;  2XF3 A;  5AJG A;  1IKG A;  1DP9 A;  3K2N A;  4PPR A;  1O7E A;  1XJ3 A;  1NZU A;  2JKT M;  3PBR A;  2V2F F;  2WYX A;  3PBN A;  1K4E A;  5HPF A;  4Q0I A;  4PM5 A;  3MFX A;  4IED A;  4OP8 A;  4Q0H A;  4X1L A;  3OPR A;  2V1B A;  2M7U A;  4WF0 A;  3IF6 A;  2ZJ9 A;  2NUP C;  5DJU A;  5CEC A;  4OKP A;  3VP2 A;  3NIA A;  5CER A;  2W1R A;  1G5U A;  1FCO A;  1OT6 A;  3VFH A;  2XQZ A;  3LIE A;  4YFM A;  2OLV A;  2XSS A;  1P9W A;  4S2I A;  3S22 A;  1NY0 A;  4JGO A;  3N8R A;  2BG1 A;  3O5Y A;  2EFU A;  1Z09 A;  2GX5 A;  1XJ6 A;  2WZX A;  3NBL A;  3QP5 A;  3PBT A;  3GTC A;  4P87 A;  5EVI D;  4ME4 A;  2WAD A;  2ZBB A;  2ZMF A;  3HUM A;  2P7J A;  1YQS A;  2W0N A;  2XD5 A;  3SOI A;  5HDS A;  1KGG A;  1Z6F A;  3GV9 A;  1YLT A;  2UWX A;  3UE3 A;  3KSF A;  3PYP A;  4FUW A;  4OQ0 A;  4JXW A;  3LGO A;  4GNU A;  1XGI A;  3FV7 A;  4N9K A;  4X56 A;  3VE3 A;  5AQ7 A;  5HD3 A;  2VGK A;  4LRX C;  1EI5 A;  3OPL A;  1WYC A;  3QP1 A;  2Y2K A;  1GSX A;  3NOT C;  1RGY A;  4EEU A;  3CAX A;  1LHY A;  1ERM A;  1LI0 A;  3MSH A;  1OTD A;  1WYB A;  2MJ6 A;  1DP6 A;  3FKV A;  5LBR A;  4S2M A;  1IYO A;  5DTK A;  5KIZ A;  3V5M A;  4H6J A;  2EX8 A;  2BAS A;  3PR6 A;  1DP8 A;  5HAI A;  1BUL A;  2P04 A;  2V1A A;  3IS2 B;  2W3G A;  5D3O A;  5EVI C;  5KSC A;  4IVK A;  2WKI A;  2WKQ A;  1YLP A;  2DCF A;  3SH7 A;  3L7H A;  1PNE A;  3V3S A;  1NLZ A;  3BFC A;  1DY6 A;  4WM9 A;  1G6A A;  5FL3 A;  2Q9M A;  5IT5 A;  5GHY A;  4H8R A;  1BT5 A;  1K56 A;  2V8F A;  3A0V A;  3C2W A;  4PM7 A;  4WZ5 A;  1FCM A;  3T1R A;  4Y5F A;  4I39 A;  3UDX A;  1Y54 A;  2HDQ A;  4ID4 A;  3IS2 A;  1MWU A;  1NZO A;  4Y0O A;  1JNU A;  2ZM2 A;  4CJN A;  4ZJ3 A;  4O0P A;  3UB5 P;  1YMS A;  3K3C A;  1T19 A;  1LSV A;  4QD4 A;  2V20 A;  1XA1 A;  4B9O A;  4FCF A;  1VET B;  1D7E A;  1YLZ A;  2XDM A;  4Y0U A;  3IHB A;  5HDC A;  3P98 A;  1S6R A;  3QHY A;  3CPT B;  4N1H A;  5FAS A;  2QKP A;  4Y7P A;  3CZD A;  1SKO B;  4BBT A;  4QY6 A;  3S7P A;  3L9K A;  5AQB A;  4KEN B;  4DE2 A;  1SDE A;  2C5W B;  5E2E A;  3PAE A;  5GLC A;  3FG8 A;  3GMW A;  4GDB A;  3O88 A;  4CLC A;  1K25 A;  4DDS A;  1VHM A;  4ESP A;  1ZHH B;  3HLC A;  2VGL M;  4MN7 A;  2ZC4 B;  2L1M A;  3UB9 A;  1ZC2 A;  4R6L A;  3DWK A;  3ITA A;  1GCE A;  2XRN A;  3RXW A;  3BEB A;  4RYE A;  2EFX A;  1STZ A;  3LID A;  2P74 A;  4HQA A;  5HAQ A;  4C6Y A;  3G4P A;  3UE6 A;  4UQI S;  4EER A;  2Y2H A;  5JYP A;  5FAQ A;  2KX6 A;  3E4Q A;  1SCW A;  3FKW A;  2JE5 A;  3F1P A;  1W63 Q;  1IYS A;  4S2P A;  1FIK A;  2Y91 A;  5EVE A;  3WS0 A;  1L2S A;  2OOL A;  4NG2 A;  1ES4 A;  1KOU A;  3HLW A;  5CGW A;  1CI9 A;  4DMZ A;  4KG5 A;  1C3B A;  2IWD A;  5FAT A;  4EBP A;  1BZA A;  4XT2 A;  4OOL A;  2YKH A;  5EE8 A;  3V39 A;  4DKI A;  4L0L A;  3PBS A;  3UDI A;  3PTE A;  5FI7 A;  1YLY A;  2H0T A;  4LFU A;  3JYI A;  5HFO A;  2PDR A;  2PHY A;  1VQQ A;  5J8X A;  3CLO A;  4L9G A;  4JXG A;  3HLG A;  1IOU A;  2QYB A;  5HWV A;  4X55 A;  1JVJ A;  4JF6 A;  3WRZ A;  3JVU A;  4EET B;  3WS1 A;  2HGV A;  2EX9 A;  4UEY A;  4P6Z M;  4ZDX A;  4HI4 A;  4WUJ A;  4NXG A;  3Q7V B;  2Y2Q A;  1M6K A;  4MDZ A;  2WGI A;  3H9W A;  2VJW A;  5CHU A;  5K5B A;  3R7W B;  5E43 A;  1HLU P;  2EX6 A;  3BFF A;  2P9V B;  3F1N A;  4ZRR A;  1NYY A;  5EV0 A;  2Y8H A;  3LR4 A;  4NXB A;  2HPB A;  1MKI A;  2J9P A;  4IVI A;  2K2N A;  3DTE A;  3MFD A;  2O9C A;  4FH2 A;  5FDS A;  3T4L A;  1S66 L;  1ONH A;  4EUZ A;  5EOO A;  3LO7 A;  4GJ4 A;  5CHM A;  4PM9 A;  2XEP A;  2WAE A;  1YKD A;  2QWS A;  1PZO A;  1VEU B;  1HZO A;  4E6W A;  3IHA A;  4DXB A;  3VP0 A;  3ZCZ A;  2X71 A;  1DJB A;  5CX7 A;  3NI9 A;  1PI5 A;  2PU2 A;  4EQI A;  5DKK A;  1KVM A;  2QHK A;  3NC8 A;  1ONG A;  4KUK A;  5CHJ A;  1TEM A;  2DRW A;  1Q2Q A;  2ZD8 A;  2YKF A;  3AGE A;  5TBM A;  1OTB A;  3MKF A;  5EM0 A;  4KZ8 A;  3D72 A;  5M18 A;  5E2H A;  3N6I A;  4KZ3 A;  4DJ2 A;  5A92 A;  5CEB A;  1GHI A;  2M1C A;  3JPU A;  4S2O A;  3NJA A;  4IHQ A;  4WEL A;  5HSQ A;  1FQG A;  3G31 A;  4HHD A;  1KGE A;  3DAV A;  4HJ4 A;  4I38 A;  3OZH A;  3BYD A;  3IF6 C;  2L4R A;  2WZZ A;  5CTM A;  1YPR A;  3BWL A;  3ZVW A;  3MMH A;  3IWI A;  1SHV A;  4HOI A;  3B47 A;  5E2F A;  4ZAM A;  4OP5 A;  2PYR A;  4KUO A;  2EWW A;  1XFN A;  4ETZ A;  2FFY A;  3OPH A;  4OQG A;  3C5A A;  1E3U A;  4R1G A;  2WK0 A;  3E4O A;  3BLS A;  4Q8I A;  3LR3 A;  5EM1 A;  4L9E A;  5E2G A;  4G3W A;  3QP8 A;  2W3E A;  4GZB A;  3FPV A;  4RX3 A;  1S1Z A;  3PHY A;  4GD6 A;  1CEG A;  1K56 D;  2QJ5 A;  2INW A;  4KZB A;  1L0G A;  1K57 C;  2I9V A;  5BOH A;  3IX3 A;  4EEP A;  4OPY A;  3NHQ A;  1VM1 A;  3CWF A;  3UPP A;  5FQM A;  2JCH A;  3VE4 A;  2XH9 A;  5C5K A;  2Y55 A;  1YSQ A;  5F69 A;  5F5Y A;  4GDN A;  3R4K A;  1UWN X;  4YNR A;  1HVB A;  1HTZ A;  5I5L A;  3F1O B;  5HAR A;  1V9Z A;  1OTA A;  2QPN A;  3LEQ A;  3OCL A;  1ESU A;  4KZ9 A;  4O01 A;  3NDE A;  3OLO A;  4QB8 A;  3UB8 A;  2ZC3 B;  4EQ1 A;  2GNX A;  1AWI A;  2XA7 M;  3N8L A;  4HY8 A;  4ETX A;  1N9N A;  3LIA A;  3WS5 A;  2V9A A;  4CLC D;  2IWC A;  1P0Z A;  2VKS A;  4NK3 A;  5J4E A;  4PKY A;  3EQV A;  1H8Z A;  2ZQD A;  2OLU A;  2ZQA A;  3NDG A;  4M4X A;  1OME A;  4E3I A;  5GLA A;  5CED A;  1XFQ A;  4WZ5 C;  3WS2 A;  3PXP A;  1BLS A;  4BJP A;  1MWR A;  4MN5 A;  1PWG A;  5KZH A;  4E3O A;  2ZM0 A;  2XLN A;  3T4T A;  3M2J A;  1NXY A;  5M19 A;  3MZE A;  4MNR A;  2UV0 E;  3IF5 A;  2P08 A;  5DFX A;  3TOI A;  4JBF A;  4FTX A;  3LIB A;  5TR7 A;  3BQ8 A;  1DRM A;  2Y2P A;  3CUE A;  3ITB A;  1F5M A;  1FSY A;  1P9R A;  3IH8 A;  1K57 A;  1GSW A;  1I2S A;  3HCY A;  3NEC A;  3NY4 A;  5L07 A;  3EWK A;  2VX8 A;  1E25 A;  2LB5 A;  3TE8 A;  4E6X A;  1NRJ A;  1TVF A;  2QMI A;  1ES2 A;  1HD8 A;  2A2L A;  4CLC C;  1FIL A;  5A93 A;  3A0R A;  5HD5 A;  2PD7 A;  3IXB A;  5F1F A;  1K38 A;  1PYY A;  4EBL A;  4PM6 A;  4RQ9 A;  1CK3 A;  1QME A;  2FZ0 A;  1H0M A;  4DE0 A;  2WKE A;  1BUE A;  3KX0 X;  1L3L A;  3G32 A;  5EFW A;  3QP2 A;  3S7Q A;  3W2Z A;  4HH3 A;  1SZV A;  1W79 A;  5L10 A;  5HL1 A;  2QJ7 A;  1RP5 A;  1UGU A;  5F82 A;  4EW7 A;  2PBD P;  2VGJ A;  3Q1F A;  1PW1 A;  2Q9N A;  1JWP A;  3TSG A;  1JWV A;  3LY3 A;  2D02 A;  3A3F A;  4BL3 A;  5DFY A;  5GLB A;  2ZQ8 A;  5F83 A;  2HF6 A;  4I3J A;  2ZQ7 A;  3IT9 A;  3GVB A;  4EWF A;  2Z2M B;  3G6O A;  4Q0J A;  5FQK A;  1IEM A;  1ERO A;  1O07 A;  1RGZ A;  4XUX A;  1PRQ A;  4B4Z A;  4P6Z S;  2HP6 A;  4JF4 A;  2RCX A;  2CC1 A;  3SS4 A;  2HV1 A;  4Y15 A;  1OTI A;  1ESI A;  1IEL A;  3W4O A;  5HL6 A;  2W1T B;  3BLM A;  2WAF A;  4OPZ A;  2A24 B;  5TJJ A;  3E0Y A;  3T4K A;  3WWX A;  2J80 A;  2W3D A;  4PHT A;  3WS4 A;  2Y2M A;  2ZMA A;  3C38 A;  4UA6 A;  2O9A A;  1MY8 A;  3K3D A;  2JKR M;  4NEE D;  3IBR A;  1PI4 A;  1IYQ A;  5EVI B;  1MXO A;  1NLY A;  5CTN A;  5F68 A;  1OPX A;  3G34 A;  3RH8 B;  3W4Q A;  1VET A;  5DTT A;  3S7N A;  3VV4 A;  3A3E A;  3IXD A;  2JN7 A;  1S4R A;  4WEJ A;  4F3L B;  1MWT A;  4NXF A;  3V67 A;  2JHE A;  3LY4 A;  1GSV A;  3LYX A;  2WGW B;  2A24 A;  3CPT A;  1TDL A;  1ACF A;  3BEC A;  3PBQ A;  3LIC A;  5KMW A;  1SKO A;  3KSG A;  1TD5 A;  3IQA A;  2EX2 A;  4JKT A;  1K55 A;  1UWP X;  2ZL1 B;  2OV5 A;  3KSH A;  2OAQ 1;  1K6R A;  1ZG6 A;  3SW1 A;  1G6O A;  4MBH A;  5GHX A;  3C7V A;  4WLA A;  1S1Y A;  1E3U D;  4UA9 A;  2IA2 A;  4IBR A;  3IBJ A;  1LL5 A;  4MCW A;  2Y2I A;  2PR6 A;  3A3D A;  5FA7 A;  3HJK A;  4HP4 A;  3HVF A;  1BYW A;  3IXH A;  1XJ4 A;  1XKZ A;  3GEC A;  4C75 A;  2JKR I;  2ZL1 A;  4WEK A;  3DW0 A;  3C8C A;  4X1M A;  1CEF A;  4K0W A;  1XX2 A;  3CJM A;  4DF6 A;  4WMC A;  5GL9 A;  4JF5 A;  4MBK A;  3E2K A;  4D2O A;  1PZP A;  4P85 A;  3SH9 A;  2HJE A;  1FOF A;  4U0X A;  4QY5 A;  5DF9 A;  4DDY A;  4XUZ A;  3ZG8 B;  3O87 A;  3ISG A;  3IWQ A;  2ZC7 A;  2PU4 A;  1ALQ A;  2ZQC A;  1CF0 A;  2VV8 A;  3FZC A;  3KYZ A;  1OJ5 A;  3A3J A;  2XR0 A;  3H7W B;  1LL9 A;  2H5S A;  5EEC A;  4R3B A;  5FI2 A;  4ARZ B;  3T1X A;  1XGJ A;  4RX2 A;  3MQO A;  4KQO A;  4OQI A;  2VV6 A;  2FH5 A;  2O0Y A;  1S67 L;  4OH0 A;  1SKF A;  2HDS A;  2K31 A;  2KOI A;  5J3W A;  1LSW A;  4QWO A;  4S2N A;  5MC7 A;  5EOE A;  1IFQ A;  4OOY A;  3LI9 A;  3C7U A;  3E98 A;  1N9B A;  4K91 A;  3Q7V A;  2R9X A;  1J9M A;  4PKY G;  3CI6 A;  4OQH A;  3MS6 A;  3R7W A;  4KQD A;  2WKR A;  1BLH A;  3H7W A;  3HL9 A;  4UA7 A;  2P9V A;  3EEH A;  4HIA A;  1S0W A;  1WE4 A;  2V1Z A;  4GS9 B;  4GLQ A;  4BQM A;  1BLC A;  1N9L A;  3MF0 A;  1ZG4 A;  4FOF A;  3N8S A;  4EBN A;  2JKG A;  2HDR A;  2J3T C;  3G35 A;  1G28 A;  3IX8 A;  4E3J A;  3U4L P;  5DTS A;  3EQU A;  2HP9 A;  3VMA A;  4WN5 A;  3V50 A;  1OT9 A;  3C4O A;  4DXC A;  1KE4 A;  4EES A;  2KDK A;  2HZ5 A;  1ES3 A;  4U3T A;  2Y2O A;  3W8K A;  3UME A;  1L0F A;  2PD8 A;  1VEU A;  1DJC A;  3PAG A;  3T4J A;  3P09 A;  4BD0 A;  1NJ4 A;  3IXG A;  5DF8 A;  3E2L A;  5FAP A;  1MC0 A;  3T1S A;  1W5D A;  4HES A;  1V9Y A;  5EUA A;  5G18 A;  4P0M A;  1X0O A;  3P01 A;  4DJ3 A;  4Y3I A;  1TS6 A;  3RFB A;  1TF1 A;  3VP3 A;  2Y2L A;  3G2Z A;  2HJ9 C;  5FEG A;  2KLI A;  2QZ6 A;  5CXW A;  5TFQ A;  1Y4O A;  1K0K A;  2Y79 A;  3WRT A;  1XPB A;  3MJQ A;  4HBT A;  1BSG A;  1MWS A;  2RL3 A;  1U60 A;  5TGF A;  2PBY A;  4E3N A;  4OLD A;  1XJ2 A;  4LV2 A;  2GJ3 A;  2HDU A;  4NXE A;  2NUT C;  4HJ6 A;  3BRM A;  3P7N A;  2ZC6 B;  4GCZ A;  4OVD A;  3O86 A;  4KZ6 A;  3ZG0 A;  2G2W A;  5FQI A;  5M1A A;  3LI8 A;  1T1B A;  3KSI A;  3MKE A;  3UE0 A;  3CUE C;  2PT7 A;  3FPW A;  4GB7 A;  5HX9 A;  2ACG A;  3OCN A;  2R78 A;  4OON A;  4U0T A;  2HP5 A;  4BL2 A;  4LLO B;  4Y0T A;  3LFV A;  3TW8 A;  2Z6D A;  1W8Q A;  1H8Y A;  3G2Y A;  3ZYT A;  1JTD A;  1KDS A;  5AVF A;  3KYE A;  1H8M A;  4LPZ A;  4R38 A;  3IF6 B;  1W63 M;  3MQQ A;  3Q07 A;  2OWH A;  4GD8 A;  4MEZ A;  5DKL A;  3G30 A;  4Z9Q A;  1M40 A;  5U47 A;  4I3I A;  2XK1 A;  3GR2 A;  1J3W A;  3V3R A;  4HBU A;  3MZD A;  3UY6 A;  3N4I A;  3D9Y A;  3QP4 A;  2E8J A;  2VEA A;  4HJ3 A;  5FDH A;  1TDG A;  3ZG9 B;  4YIN A;  5FQQ A;  4OOM A;  4GOG A;  1AXB A;  4K0X A;  1LLB A;  2B02 A;  2XRO A;  2ZMV A;  3OBF A;  4R3A A;  3LIF A;  3VOY A;  4LV3 A;  1W7F A;  2H0Y A;  1I2W A;  4N1X A;  4DN0 A;  4EV4 A;  3O3V A;  1ODV A;  3F1O A;  3SS3 A;  4KZ4 A;  4WYY A;  1YAX A;  3HJI A;  4GKU A;  4LCL A;  1CI8 A;  4GHI B;  3IH9 A;  3S7O A;  1E4D A;  3VOL A;  3ZNT A;  1FR6 A;  4LCM A;  2EXB A;  5DF7 A;  2LB9 A;  5EVL A;  3BY8 A;  3CMZ A;  2A3U A;  4O8G A;  1YM1 A;  4X6T A;  3EGX C;  1P97 A;  3LEZ A;  1CJF A;  3CHW P;  1N9O A;  4K08 A;  4CLC E;  4R4S A;  1N4O A;  1XA7 A;  2H10 A;  4H6J B;  4QU3 A;  3UMD A;  1NRF A;  3UN7 A;  1TS7 A;  2J3W A;  2VGL S;  3BY9 A;  3LCE A;  3BFE A;  3CG5 A;  3KO6 A;  3NCK A;  2W27 A;  1DJA A;  3QP6 A;  4LGW A;  4BEN A;  2D01 A;  4FD8 A;  4GHI A;  1WA9 A;  2JKT I;  1S4S A;  3RJU A;  4BMW A;  5CRF A;  2JC7 A;  3EEA A;  4XXR A;  3T4O A;  1MZU A;  2VLG A;  2ZQ9 A;  3GDI A;  3UO9 A;  4E04 A;  1SDN A;  4WMC D;  4ZJ2 A;  3RXX A;  3OC2 A;  3RTY A;  3MXS A;  2AVX A;  3HLF A;  4MBF A;  3NOP C;  4PMA A;  4CPK A;  2BLS A;  5A8B A;  4HNB A;  4EU0 A;  4BD1 A;  3LR5 A;  5L8M A;  1K55 C;  1YLJ A;  1D06 A;  2O99 A;  3TG9 A;  3W4P A;  3ZFZ A;  3T4S A;  1LL8 A;  3A0S A;  3HBR A;  1K6S A;  5FAO A;  4CQH A;  3AGD A;  3QNB A;  3TRC A;  2Y4A A;  3C30 A;  3S1Y A;  4KZA A;  4YOF A;  1OTE A;  2Y59 A;  1NYM A;  4JGP A;  4BLM A;  4F94 A;  3HUO A;  5I94 A;  4OPR A;  2BTF P;  4HH2 A;  3B42 A;  4R4R A;  4RA7 A;  3MQ0 A;  2DMW A;  3LR0 A;  4HP9 A;  4KZ5 A;  5IU1 A;  1T18 A;  1FSW A;  3HRE A;  4X68 A;  4L9F A;  2PR5 A;  1W8Y A;  4S2K A;  4LRY C;  2XD1 A;  1T1C A;  2O9B A;  4JPM A;  5HAP A;  4DRT A;  3ZG7 B;  5AQ9 A;  4CLC B;  3MR0 A;  3Q7Z A;  2FFF B;  5HDD A;  1I5Q A;  3UE1 A;  1GHP A;  1KE3 A;  4I3A A;  4GW9 A;  1OJG A;  3T1Q B;  3LUQ A;  1GHM A;  1H3Q A;  4G3V A;  2W3F A;  4DE3 A;  3D3O A;  3M6B A;  1PFL A;  4PAU A;  5L2F A;  4G3K A;  1LT0 A;  5HZH A;  2W1T A;  3F1P B;  4S2J A;  5JYO A;  4MN6 A;  5DJT A;  1VB6 A;  2G7U A;  1JWZ A;  3Q82 A;  2W3H A;  4S2N C;  2OWJ A;  2K7S A;  2CMN A;  3TJZ C;  4X53 A;  3GRJ A;  5EVI A;  1ES5 A;  1EW0 A;  5J7E A;  5CGS A;  3UDF A;  1K4F A;  1PWC A;  4I5S A;  4Z1W A;  4XT2 B;  4PM8 A;  4KG6 A;  2E8I A;  2EWV A;  1ZKJ A;  3ZQ5 A;  1D1J A;  3VOZ A;  1YSP A;  4R23 A;  2GDN A;  3UB6 A;  4F3L A;  4YWZ A;  3VSL A;  1XXM A;  3PBO A;  5FQ9 A;  1KDW A;  2WGW A;  3S4X A;  3HLE A;  4ZTK A;  3OPP A;  4O7D A;  1PIO A;  3SZT A;  2Q0O A;  1CQA A;  3SH8 A;  4IJG A;  3IWO A;  2WKP A;  2GZA A;  2B5R A;  1L0D A;  4II7 A;  1JTG A;  3FYZ A;  3ZG5 A;  4JLF A;  4M3K A;  4JXS A;  2Y2J A;  1RCJ A;  1BLP A;  2OAP 1;  5GHZ A;  5GLD A;  5HWW A;  4EUV A;  3C4P A;  1PWD A;  4X25 A;  4RVA A;  1KVL A;  1MPL A;  5G4Z A;  2IWB A;  2J3T D;  1EWZ A;  1LSX A;  2WKH A;  2VV7 A;  1F98 A;  1MBL A;  3F1N B;  3N7W A;  3AGF A;  2A49 A;  1F9I A;  4LV1 A;  2ZOH A;  1IYP A;  4UAA A;  2J9O A;  1YMX A;  5HWT A;  1XP4 A;  2G2U A;  3ZGA B;  3CIT A;  4BBU A;  2DNS A;  3H82 B;  3NUL A;  2Z6C A;  3B33 A;  2XGN A;  3B3X A;  4S2L A;  1LI9 A;  4AFI A;  3MXR A;  1ZTU A;  4WL9 A;  5FI6 A;  3BQA A;  3EOI A;  1YT4 A;  1T1A A;  2Z2L B;  3UPO A;  3MZF A;  5F1G A;  3ZNY A;  4OPQ A;  3DBA A;  3BM6 A;  2JBF A;  2X02 A;  4IUK A;  1YLW A;  5CGX A;  4BWI A;  2EA9 A;  3FWL A;  2ZM8 A;  1A0K A;  4B88 A;  3H82 A;  4E3M A;  1BTL A;  4OLG A;  4C3Q A;  5F6A A;  1KE0 A;  5TBM B;  3ULF A;  2WGV A;  4N92 A;  2B18 A;  4KQR A;  2I72 A;  4UHU A;  1Y28 A;  4ARZ A;  2L0W A;  2H28 A;  1Q2P A;  2WUQ A; 
#chains in the Genus database with same CATH homology
 1PYY A;  2XFS A;  4EBL A;  2P74 A;  4PM6 A;  1PW8 A;  5HAQ A;  4C6Y A;  3BFD A;  3G4P A;  3IF6 B;  5FSR A;  4FSF A;  4IBX A;  1CK3 A;  3Q07 A;  4P6B A;  4ZJ1 A;  3M6H A;  1QME A;  3MBZ A;  5AQA A;  4GD8 A;  2Y2H A;  5JYP A;  4DE0 A;  5FAQ A;  2WKE A;  1BUE A;  3G32 A;  1SCW A;  4A5R A;  3FKW A;  2JE5 A;  4MEZ A;  4B4X A;  1IYS A;  4S2P A;  4ZBE A;  1W79 A;  2Y91 A;  3G30 A;  1KGF A;  3ZDJ A;  4Z9Q A;  5HL1 A;  1RP5 A;  3WS0 A;  1L2S A;  1IKI A;  1ES4 A;  1M40 A;  4X69 A;  5F82 A;  5U47 A;  3HLW A;  2XK1 A;  5CGW A;  2VGJ A;  1CI9 A;  3Q1F A;  1PW1 A;  1QMF A;  3GR2 A;  2Q9N A;  1JWP A;  3TSG A;  3V3R A;  4R3J A;  4HBU A;  1JWV A;  3MZD A;  3UY6 A;  2R9W A;  3LY3 A;  3N4I A;  4KG5 A;  3GQZ A;  4KQQ A;  3A3F A;  1C3B A;  1K54 C;  4N9L A;  4BL3 A;  2IWD A;  4LEN A;  4FH4 A;  5FAT A;  5FDH A;  1TDG A;  3ZG9 B;  4EBP A;  1BZA A;  4YIN A;  4OOL A;  5FQQ A;  5GLB A;  2ZQ8 A;  5F83 A;  5EE8 A;  4OOM A;  3DWZ A;  4GOG A;  5IHV A;  1AXB A;  3ZVT A;  3V39 A;  4DKI A;  4K0X A;  4L0L A;  2OSU A;  2ZQ7 A;  3PBS A;  3UDI A;  3IT9 A;  1ERQ A;  1LLB A;  3GVB A;  3PTE A;  5FI7 A;  4EWF A;  1YLY A;  2H0T A;  2Z2M B;  4R0Q A;  3JYI A;  5HFO A;  5J8X A;  1VQQ A;  3ZHH A;  5FQK A;  3VOY A;  4JXG A;  4LV3 A;  1W7F A;  1IEM A;  1ERO A;  1O07 A;  3HLG A;  4LV0 A;  2H0Y A;  1I2W A;  1RGZ A;  4N1X A;  4EV4 A;  5HW3 A;  3O3V A;  4MLL A;  4KG2 A;  4XUX A;  3SS3 A;  4KZ4 A;  4B4Z A;  4WYY A;  2HP6 A;  4X55 A;  4JF4 A;  4GKU A;  4LCL A;  2RCX A;  1JVJ A;  1CI8 A;  1FR1 A;  2CC1 A;  4E3K A;  3IH9 A;  4JF6 A;  3WRZ A;  3SS4 A;  3I7J A;  1E4D A;  3ZNT A;  1FR6 A;  4LCM A;  3WS1 A;  2EXB A;  2EX9 A;  3VFF A;  1ESI A;  1IEL A;  3BFG A;  5DF7 A;  3W4O A;  2EXA A;  4ZDX A;  5DVA A;  1H5X A;  5EVL A;  3BLM A;  2C6W B;  2WAF A;  2A3U A;  3CMZ A;  4OPZ A;  3UNW A;  3VSK A;  4E3L A;  5KSH A;  1YM1 A;  4X6T A;  3Q7V B;  2Y2Q A;  3WWX A;  1M6K A;  2WGI A;  3LEZ A;  1GA0 A;  3M2K A;  2XFT A;  2X01 A;  3WS4 A;  2Y2M A;  5EPH A;  2ZMA A;  5CHU A;  4DE1 A;  5FQJ A;  3D4F A;  4UA6 A;  4R4S A;  1N4O A;  5E43 A;  1XA7 A;  2H10 A;  2EX6 A;  3BFF A;  1MY8 A;  2P9V B;  4KZ7 A;  4QU3 A;  1NRF A;  1NYY A;  1PI4 A;  1FCN A;  3HLD A;  1IYQ A;  5EVI B;  3SS5 A;  3UN7 A;  1MXO A;  5CTN A;  3LCE A;  3BFE A;  3CG5 A;  4JXV A;  3QNC A;  3NCK A;  2HPB A;  5A90 A;  3VP4 A;  3G34 A;  1DJA A;  4BEN A;  1MKI A;  2J9P A;  3W4Q A;  4IVI A;  4FD8 A;  1GA9 A;  5DTT A;  2J7V A;  2J8Y A;  3A3E A;  3IXD A;  3RJU A;  5CRF A;  3MFD A;  3Q81 A;  4QHC A;  4FH2 A;  4WEJ A;  2JC7 A;  3GSG A;  1MWT A;  2ZC5 B;  1ONH A;  4EUZ A;  5EOO A;  3LO7 A;  5A91 A;  5CHM A;  3VP1 A;  3LY4 A;  4PM9 A;  4XXR A;  2WGW B;  3UPN A;  2Y2G A;  1TDL A;  2XEP A;  3BEC A;  3PBQ A;  1G68 A;  2ZQ9 A;  2WAE A;  3HUN A;  5KMW A;  3UO9 A;  4WBG A;  1SDN A;  3A3I A;  4WMC D;  1PZO A;  4ZJ2 A;  1HZO A;  1L0E A;  4E6W A;  4QJG A;  3RXX A;  3OC2 A;  3IHA A;  3HLB A;  3MXS A;  3IQA A;  4HEF A;  2EX2 A;  4DXB A;  2Y2N A;  2ZLY A;  4JKT A;  4GN2 A;  3VP0 A;  1K55 A;  2X71 A;  3HLF A;  4MBF A;  4PMA A;  4WZ4 A;  3ZCZ A;  3DTM A;  2OV5 A;  4CPK A;  1DJB A;  2BLS A;  3NI9 A;  4NET A;  1K54 A;  1PI5 A;  2PU2 A;  4EQI A;  1K6R A;  2XF3 A;  1ZG6 A;  1IKG A;  4BD1 A;  4PPR A;  1KVM A;  1O7E A;  4MBH A;  3NC8 A;  1ONG A;  5GHX A;  1NZU A;  3C7V A;  5CHJ A;  1K55 C;  3PBR A;  1YLJ A;  1TEM A;  1E3U D;  1Q2Q A;  2DRW A;  2V2F F;  2WYX A;  2ZD8 A;  3PBN A;  4UA9 A;  3TG9 A;  3W4P A;  1K4E A;  3ZFZ A;  3AGE A;  4IBR A;  1LL5 A;  2Y2I A;  3MKF A;  3A3D A;  4PM5 A;  4KZ8 A;  5FA7 A;  5M18 A;  3HBR A;  1K6S A;  5FAO A;  5E2H A;  3N6I A;  4IED A;  4OP8 A;  3AGD A;  3QNB A;  3OPR A;  2Y4A A;  4KZ3 A;  3HVF A;  3IXH A;  5A92 A;  3S1Y A;  3IF6 A;  2ZJ9 A;  1GHI A;  5CEB A;  4KZA A;  1XKZ A;  5CEC A;  4OKP A;  3VP2 A;  3NIA A;  4C75 A;  5CER A;  4S2O A;  2Y59 A;  1FCO A;  4WEK A;  1NYM A;  3DW0 A;  3VFH A;  4BLM A;  4F94 A;  4WEL A;  2XQZ A;  3HUO A;  1FQG A;  1CEF A;  4YFM A;  5I94 A;  3G31 A;  1KGE A;  4K0W A;  2OLV A;  4OPR A;  1XX2 A;  4R4R A;  4RA7 A;  3CJM A;  3OZH A;  3BYD A;  4S2I A;  3IF6 C;  1NY0 A;  3S22 A;  4WMC A;  4DF6 A;  5GL9 A;  3N8R A;  4JF5 A;  2BG1 A;  3E2K A;  4MBK A;  2WZZ A;  5CTM A;  4KZ5 A;  4D2O A;  1PZP A;  4P85 A;  3SH9 A;  2EFU A;  1FSW A;  1FOF A;  3HRE A;  2WZX A;  4U0X A;  4X68 A;  3NBL A;  4QY5 A;  1W8Y A;  4S2K A;  5DF9 A;  4DDY A;  4XUZ A;  3ZVW A;  2XD1 A;  3PBT A;  3GTC A;  4P87 A;  3ZG8 B;  3IWI A;  3O87 A;  1SHV A;  3ISG A;  3IWQ A;  4JPM A;  5EVI D;  5HAP A;  2ZC7 A;  4DRT A;  2WAD A;  3ZG7 B;  5AQ9 A;  2PU4 A;  5E2F A;  1ALQ A;  4ZAM A;  2ZQC A;  4OP5 A;  3FZC A;  3HUM A;  2FFF B;  3Q7Z A;  2FFY A;  1YQS A;  2XD5 A;  3SOI A;  3OPH A;  1I5Q A;  3UE1 A;  4OQG A;  3C5A A;  1GHP A;  1KGG A;  2XR0 A;  3A3J A;  1E3U A;  4R1G A;  1LL9 A;  1Z6F A;  2WK0 A;  3GV9 A;  1YLT A;  1KE3 A;  2H5S A;  5EEC A;  4R3B A;  3BLS A;  5FI2 A;  2UWX A;  3UE3 A;  1GHM A;  1XGJ A;  4RX2 A;  4Q8I A;  4OQ0 A;  4JXW A;  4KQO A;  4GNU A;  4OQI A;  5E2G A;  1XGI A;  3FV7 A;  4N9K A;  4X56 A;  5AQ7 A;  4GZB A;  2VGK A;  4OH0 A;  1SKF A;  4DE3 A;  1EI5 A;  4RX3 A;  3OPL A;  2HDS A;  1WYC A;  2Y2K A;  3M6B A;  1RGY A;  4S2N A;  5EOE A;  4GD6 A;  5L2F A;  1LHY A;  1ERM A;  1LI0 A;  1CEG A;  4OOY A;  1K56 D;  3C7U A;  1WYB A;  4S2J A;  5JYO A;  1N9B A;  3FKV A;  4K91 A;  3Q7V A;  2R9X A;  1J9M A;  4KZB A;  1L0G A;  1JWZ A;  1K57 C;  4OQH A;  5BOH A;  3Q82 A;  4S2M A;  4S2N C;  1BLH A;  1IYO A;  3HL9 A;  4OPY A;  5DTK A;  3V5M A;  4UA7 A;  2EX8 A;  2P9V A;  1S0W A;  1WE4 A;  4X53 A;  3GRJ A;  5EVI A;  2V1Z A;  1VM1 A;  1ES5 A;  5CGS A;  3UDF A;  1K4F A;  1PWC A;  3UPP A;  5HAI A;  5FQM A;  2JCH A;  4BQM A;  2XH9 A;  4PM8 A;  1BLC A;  4KG6 A;  2E8I A;  1ZG4 A;  1BUL A;  2Y55 A;  3N8S A;  4EBN A;  1ZKJ A;  2HDR A;  3VOZ A;  3G35 A;  4GDN A;  4E3J A;  4R23 A;  5DTS A;  2GDN A;  3EQU A;  2HP9 A;  3VMA A;  5D3O A;  5EVI C;  5KSC A;  4IVK A;  3V50 A;  2WKI A;  3VSL A;  1HVB A;  3C4O A;  1XXM A;  3PBO A;  1HTZ A;  1YLP A;  4DXC A;  1KE4 A;  5FQ9 A;  1KDW A;  2WGW A;  1ES3 A;  2DCF A;  3S4X A;  3HLE A;  5HAR A;  3SH7 A;  4ZTK A;  3OPP A;  4O7D A;  1PIO A;  4U3T A;  2Y2O A;  2QPN A;  3OCL A;  3V3S A;  3W8K A;  1ESU A;  4KZ9 A;  3BFC A;  1L0F A;  1DY6 A;  3SH8 A;  3NDE A;  3IWO A;  1DJC A;  4WM9 A;  3PAG A;  1G6A A;  2B5R A;  1L0D A;  2Q9M A;  4QB8 A;  1JTG A;  3FYZ A;  3ZG5 A;  4JLF A;  3P09 A;  5GHY A;  2ZC3 B;  4H8R A;  4BD0 A;  4M3K A;  1BT5 A;  1K56 A;  1NJ4 A;  3IXG A;  4JXS A;  3E2L A;  2Y2J A;  5DF8 A;  3N8L A;  1RCJ A;  1BLP A;  5FAP A;  5GHZ A;  5GLD A;  4PM7 A;  4WZ5 A;  3WS5 A;  2IWC A;  3C4P A;  1W5D A;  1FCM A;  4HES A;  1PWD A;  5EUA A;  3UDX A;  5G18 A;  1Y54 A;  2HDQ A;  4ID4 A;  4P0M A;  4RVA A;  4NK3 A;  1KVL A;  1MPL A;  1MWU A;  1NZO A;  2IWB A;  1EWZ A;  3EQV A;  2WKH A;  2ZM2 A;  4Y0O A;  4CJN A;  1H8Z A;  4ZJ3 A;  3VP3 A;  2ZQD A;  1MBL A;  2OLU A;  3N7W A;  3AGF A;  2Y2L A;  2ZQA A;  1YMS A;  3NDG A;  1OME A;  4E3I A;  5GLA A;  3G2Z A;  5CED A;  4WZ5 C;  3WS2 A;  4QD4 A;  2A49 A;  1BLS A;  4BJP A;  1MWR A;  2QZ6 A;  4LV1 A;  1PWG A;  5KZH A;  4E3O A;  1IYP A;  2V20 A;  2ZM0 A;  4UAA A;  5CXW A;  2J9O A;  1XA1 A;  5TFQ A;  2XLN A;  1YMX A;  3M2J A;  1XP4 A;  2G2U A;  4FCF A;  3ZGA B;  2DNS A;  1NXY A;  3WRT A;  5M19 A;  1XPB A;  3MZE A;  4HBT A;  4MNR A;  1BSG A;  2XGN A;  3B3X A;  3IF5 A;  1MWS A;  1YLZ A;  2RL3 A;  1U60 A;  2XDM A;  5TGF A;  4S2L A;  3IHB A;  2PBY A;  4JBF A;  4Y0U A;  3TOI A;  4E3N A;  4OLD A;  1LI9 A;  5TR7 A;  3P98 A;  1S6R A;  3QHY A;  4LV2 A;  2Y2P A;  4N1H A;  3MXR A;  3ITB A;  2HDU A;  5FAS A;  4Y7P A;  1FSY A;  3BRM A;  3CZD A;  2ZC6 B;  5FI6 A;  4OVD A;  3O86 A;  4QY6 A;  4KZ6 A;  3ZG0 A;  3IH8 A;  1YT4 A;  2G2W A;  5FQI A;  5M1A A;  1K57 A;  2Z2L B;  3UPO A;  5AQB A;  4KEN B;  3MZF A;  1SDE A;  5F1G A;  4DE2 A;  2C5W B;  5E2E A;  1I2S A;  3PAE A;  5GLC A;  3ZNY A;  4OPQ A;  3NY4 A;  3BM6 A;  2JBF A;  3MKE A;  3UE0 A;  3GMW A;  4GDB A;  4GB7 A;  2X02 A;  1YLW A;  5CGX A;  5HX9 A;  3OCN A;  3O88 A;  1K25 A;  4DDS A;  3FWL A;  4OON A;  1E25 A;  2ZM8 A;  4E6X A;  3HLC A;  4U0T A;  4B88 A;  1TVF A;  2QMI A;  2ZC4 B;  2HP5 A;  4E3M A;  4BL2 A;  1ES2 A;  1ZC2 A;  4Y0T A;  1HD8 A;  1BTL A;  4OLG A;  3DWK A;  4C3Q A;  1KE0 A;  3ITA A;  1W8Q A;  1H8Y A;  2WGV A;  4N92 A;  4KQR A;  5A93 A;  2I72 A;  3G2Y A;  4UHU A;  1GCE A;  3RXW A;  1JTD A;  1Q2P A;  1KDS A;  3BEB A;  3IXB A;  5F1F A;  4RYE A;  2WUQ A;  1K38 A;  2EFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...