1FQGA

Molecular structure of the acyl-enzyme intermediate in tem-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWNPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-1 BETA-LACTAMASE
publication title Molecular structure of the acyl-enzyme intermediate in beta-lactam hydrolysis at 1.7 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fqgA00
1K55C 4WZ5C 5I94A 3WWXA 3BLMA 3UDIA 3IXDA 5M19A 4JKTA 4E3NA 1YMXA 2OSUA 3N6IA 4QU3A 2HP6A 4Y0UA 3G31A 1ES4A 2FFFB 5EVIC 1TDLA 3HLEA 4WBGA 5CGSA 1L0EA 1K57C 2ZC6B 2J8YA 3VP2A 1TDGA 3CJMA 4N9KA 4UA6A 5FSRA 1FQGA 1WYCA 2Y2QA 3DWKA 3ITBA 4GN2A 1W79A 4MBFA 4K0WA 4PM9A 3VSKA 4KQRA 4RVAA 4RX3A 1ESIA 1CEFA 3A3JA 1NZUA 1C3BA 2WGVA 5DF7A 1K56D 1K38A 1XGJA 3HLDA 5KZHA 3VFHA 3HL9A 3V39A 1BZAA 4JXGA 3W4OA 3Q1FA 3HUNA 5D3OA 4KZ7A 3FKWA 1ONGA 3SH7A 2IWBA 1I2SA 4IBXA 4HESA 1JVJA 4KZAA 4L0LA 3C7UA 2R9XA 3OPLA 4OPQA 2EX9A 3MZEA 1LL9A 4R4SA 1Y54A 3WRTA 2XQZA 3NCKA 3UO9A 1CEGA 3PAEA 4LV3A 3BYDA 1GA0A 5A90A 4MEZA 3G2ZA 4S2LA 5GHZA 5TFQA 2H5SA 2OLVA 4DXCA 3DWZA 3ZG5A 4E3JA 4IVKA 1L0DA 2EXAA 3HREA 4XUXA 3TG9A 3WS0A 5DTKA 1TVFA 3PBNA 4H8RA 5EVIA 1YLJA 3VFFA 3WS2A 3QHYA 3VOYA 3M2JA 3V5MA 4ZDXA 3C4OA 3Q82A 2WZXA 4HBUA 4GDNA 1VM1A 3O3VA 3NI9A 1LHYA 3A3EA 1FCOA 3ZHHA 1IEMA 2ZC7A 5TR7A 4B4XA 5F1FA 4GOGA 4JPMA 1K4EA 3BFDA 3CZDA 3ZFZA 3AGFA 2HDQA 4WMCD 5KSCA 4QY6A 3W8KA 2WYXA 2Y2KA 3A3IA 3IXBA 3SH9A 2HDSA 4JLFA 2ZC5B 3VMAA 1BULA 4S2PA 3P09A 5EOOA 5KMWA 2ZM0A 4KQOA 4R0QA 5EECA 4ZTKA 5TGFA 1Q2PA 3TOIA 3QNBA 3BFEA 2ZQ8A 4K0XA 3BEBA 1NY0A 2P74A 3MFDA 4P0MA 4BENA 1MWSA 2JC7A 3OC2A 4EUZA 1E3UD 1PWGA 1ALQA 3IT9A 4XXRA 2ZMAA 3OZHA 4X55A 2V1ZA 4FD8A 4PM8A 5FDHA 3N4IA 3HLWA 1GCEA 4OKPA 2EFUA 1KE3A 3AGEA 5CHMA 5GLAA 1HZOA 2ZC3B 4JBFA 4E3KA 3ZG7B 1LLBA 1FCNA 1JTGA 1U60A 1SKFA 1ZG4A 4FSFA 1KGGA 3HVFA 4EBLA 1Q2QA 2C6WB 3M2KA 1YLWA 3NC8A 2ZQ9A 4S2MA 1IYSA 2WZZA 4N92A 1PW1A 5E2GA 1EROA 3NDGA 1K54A 5CEBA 5G18A 2Y2IA 1KVMA 2Y59A 4U0TA 2A49A 4OVDA 3G4PA 3UN7A 1QMFA 4ID4A 4OOLA 2XF3A 3MKEA 2Y2OA 4X56A 1ZC2A 1GHMA 1LI9A 3PBTA 1LI0A 4XUZA 1PWCA 2C5WB 4DDSA 2WKIA 3UNWA 3ZVTA 2WKEA 1DJCA 1ES2A 3UPNA 3M6BA 3RXWA 2Y2MA 5M18A 5M1AA 1GA9A 2Y91A 3Q7ZA 4P85A 4KG2A 4WEJA 1IELA 4P6BA 3UPPA 1KE4A 3LY3A 2VGKA 2Q9NA 5CTNA 1MBLA 3C4PA 3MXRA 5FA7A 2XEPA 3IHBA 5E2FA 2Y2GA 1MKIA 1NYYA 3GMWA 2R9WA 5E2EA 4E3IA 4X69A 4EQIA 3OCLA 4U3TA 4X68A 4WELA 1JWVA 4BD0A 3MZFA 1G6AA 2JCHA 3PBQA 3I7JA 1L0GA 2OV5A 3ZG9B 2WGIA 4A5RA 3IF6B 4E3LA 5HAPA 3BFCA 3NDEA 3NY4A 2JBFA 5FAQA 1ERQA 5F83A 3LEZA 3GR2A 4KZ8A 3IWQA 3JYIA 2WKHA 5DVAA 1RGYA 1CK3A 1H5XA 2IWDA 3HUMA 5HAQA 2PBYA 5CHUA 4LV2A 3UE1A 1ERMA 1I5QA 1IYPA 4BQMA 1RP5A 3IQAA 2ZC4B 4UHUA 4WYYA 1LL5A 4JXSA 2J9PA 4FH2A 1NRFA 1YMSA 2Y2PA 2ZLYA 3M6HA 3P98A 3LY4A 4R4RA 4X53A 5AQ7A 1I2WA 4R3JA 3ZGAB 4OQGA 4Y0OA 2RL3A 2ZQ7A 3C7VA 1MY8A 3IXGA 3ZDJA 2CC1A 4M3KA 2P9VB 3GRJA 2IWCA 1FR1A 5A93A 2XGNA 5HFOA 3W4PA 4C75A 4GZBA 3MXSA 1EI5A 4KENB 4PM5A 4E3OA 1M40A 3ZG8B 4IVIA 1MPLA 2Y55A 4GD8A 4S2OA 2Z2LB 1BLHA 2QPNA 3SS5A 1VQQA 4QHCA 1NYMA 3B3XA 4RA7A 1FSWA 1K6RA 4R1GA 3IH8A 3IXHA 3OPPA 3IWOA 2VGJA 2XK1A 2WGWB 3IF6A 4KZ9A 2J7VA 3A3FA 3Q81A 5F1GA 1GHIA 3UE3A 5E43A 1K54C 3G35A 4B4ZA 5GHYA 1PI5A 1KE0A 5F82A 3RXXA 4RYEA 2Y2LA 2XFTA 1E4DA 4OH0A 5GLBA 2PU4A 3W4QA 1PI4A 4CPKA 4OLDA 2PU2A 4N1HA 5AQAA 1MXOA 2Y2HA 3CMZA 4GNUA 4FCFA 3S4XA 1HTZA 1XX2A 5HW3A 4O7DA 1RCJA 1W8YA 2GDNA 2X71A 1K25A 3HLFA 4PMAA 2ZQAA 4WM9A 3TSGA 4F94A 1IYQA 2ZD8A 1E25A 3A3DA 3FZCA 3ZNYA 5JYOA 1BLSA 3HUOA 3WRZA 4OP5A 3OPRA 4QD4A 2P9VA 4OOMA 5EVID 5AQBA 1MWRA 2XD1A 2ZM2A 3BFFA 5CECA 2ZQCA 3N8RA 4LV0A 1CI9A 3Q7VB 4EBPA 1FSYA 3O88A 3UDFA 1JTDA 1ONHA 5CEDA 5GLDA 1ZG6A 4E6XA 3OPHA 4OP8A 2B5RA 5CTMA 5HL1A 4LCMA 4JF6A 2XD5A 1XKZA 3IWIA 3O86A 4P87A 1NZOA 3E2LA 4DRTA 4BL2A 3BM6A 2V2FF 5FASA 2QMIA 1AXBA 4ZJ3A 2JE5A 4MBHA 4Z9QA 1BLCA 2WGWA 1YT4A 3Q07A 1SCWA 5FI6A 4KQQA 3RJUA 4OPRA 1BSGA 2A3UA 3PBRA 4N1XA 3S22A 3UDXA 3HBRA 1M6KA 2EX6A 5FQIA 4MLLA 3VSLA 3GTCA 1FR6A 3EQVA 3SH8A 4GB7A 1BLPA 4GKUA 4KG6A 2HPBA 1FCMA 3FV7A 3IF5A 4KZBA 3VP3A 2DCFA 2Z2MB 1Z6FA 3MZDA 3LO7A 4OONA 4U0XA 4YFMA 4DDYA 5GLCA 1SHVA 5EVLA 3BRMA 5FAPA 2BLSA 1PIOA 2WUQA 3MBZA 1XA1A 1JWPA 3BLSA 3E2KA 3Q7VA 5FI2A 1KDSA 4KZ6A 5J8XA 5DTTA 1DJAA 1MWTA 4GD6A 5EOEA 1S6RA 1FOFA 3AGDA 3IF6C 4LCLA 5FAOA 1YLZA 1K56A 1SDEA 1ES5A 3PTEA 4S2NA 3ZVWA 4LENA 4C6YA 5KSHA 3GSGA 4ZAMA 3S1YA 3VOZA 4IEDA 1NJ4A 2XR0A 5IHVA 4DE0A 2E8IA 4QY5A 3NBLA 1XA7A 4ZBEA 1XPBA 1BTLA 4FH4A 1ZKJA 4YINA 4OQHA 5U47A 5CRFA 4Y0TA 3GV9A 4D2OA 4EV4A 3WS4A 5DF8A 4EWFA 4X6TA 1IKIA 2RCXA 4OOYA 4NK3A 4NETA 5DTSA 1HD8A 3UPOA 3GVBA 3PBSA 1N4OA 2HP9A 4DF6A 2X01A 4EBNA 1L0FA 4S2IA 5HX9A 2H10A 3LCEA 4DE1A 4R23A 4JXWA 4WEKA 1K6SA 3ITAA 5GL9A 2FFYA 1YLYA 3HLGA 2ZJ9A 3PBOA 5E2HA 4GDBA 5DF9A 2DNSA 3GQZA 3MKFA 1PW8A 1KVLA 4RX2A 4WMCA 2UWXA 3IHAA 2ZQDA 4KZ5A 4ZJ2A 1W7FA 3WS1A 5BOHA 4N9LA 3ISGA 3NIAA 1H8ZA 1DY6A 1NXYA 1XGIA 4UA9A 2WADA 5EE8A 1PZOA 2EXBA 2HDUA 2V20A 4HEFA 1N9BA 4K91A 1JWZA 4KZ3A 5HAIA 4B88A 1QMEA 1CI8A 3VP0A 4E6WA 1K55A 1YLPA 4WZ5A 3UY6A 3FKVA 4PPRA 3FYZA 2J9OA 1E3UA 5CGWA 1W5DA 5CGXA 3BFGA 3QNCA 5A92A 1HVBA 4Y7PA 1PZPA 2EX8A 4JF4A 1O7EA 4BD1A 2BG1A 3N8LA 1K57A 3G2YA 3BECA 3WS5A 1BT5A 3V3RA 3V50A 2EFXA 1YQSA 5CXWA 4OQIA 5FQ9A 4BJPA 4DE3A 5EPHA 2Y2NA 5AQ9A 4QJGA 4UA7A 3SS3A 3SOIA 5CERA 2HP5A 5GHXA 5FI7A 3G32A 4JXVA 4DE2A 4C3QA 3DW0A 1IKGA 1WYBA 3N7WA 2H0TA 4MNRA 4MBKA 3DTMA 4OPZA 3VP4A 4KG5A 3FWLA 3G34A 2Q9MA 1YM1A 1GHPA 4S2JA 1XP4A 3OCNA 2Y2JA 4S2NC 5FQKA 5HARA 1ESUA 4JF5A 5JYPA 2Y4AA 1O07A 1PWDA 4PM7A 3ZCZA 5FQMA 1KGEA 3V3SA 1YLTA 5EUAA 3G30A 4PM6A 4QB8A 2EX2A 1TEMA 4OQ0A 5FATA 1S0WA 2DRWA 2ZM8A 2QZ6A 5L2FA 5FQJA 1W8QA 4BLMA 1WE4A 1RGZA 4ZJ1A 4UAAA 1SDNA 3VP1A 1BUEA 2WAFA 5CHJA 4OLGA 4Q8IA 1H8YA 2XFSA 3PAGA 2I72A 5A91A 2G2UA 1MWUA 2XDMA 4S2KA 1K4FA 3C5AA 3EQUA 4LV1A 3N8SA 3SS4A 3HLCA 3IH9A 1G68A 4IBRA 2OLUA 3UE0A 3ZNTA 1OMEA 4HBTA 5FQQA 1XXMA 4DXBA 4CJNA 1DJBA 4DKIA 2XLNA 3ZG0A 4OPYA 2X02A 3CG5A 2H0YA 1KGFA 2WK0A 4R3BA 2XH9A 1KDWA 2WAEA 1IYOA 1L2SA 4KZ4A 1J9MA 4WZ4A 3HLBA 3D4FA 2HDRA 5EVIB 1PYYA 4E3MA 1ES3A 1EWZA 4BL3A 2G2WA 3O87A
chains in the Genus database with same CATH superfamily
3BLMA 4JKTA 1YMXA 3H82B 4QU3A 1MKMA 1OJGA 1FQGA 1WYCA 4NKPA 1OJ5A 3VSKA 1ESIA 1C3BA 3LICA 1K38A 5KZHA 1BZAA 3W4OA 2IA2A 1VEUB 2IWBA 1JVJA 4LRYC 3P01A 1LL9A 3LR0A 1KOUA 5DFXA 3DWZA 3ZG5A 5LBRA 4IVKA 2EXAA 3HREA 3WS0A 3LI8A 5DTKA 1TVFA 3ZYTA 4H8RA 3VFFA 3WS2A 3VOYA 1OTDA 2WZXA 1VM1A 3FC7A 4GOGA 4R70A 2W3DA 3BFDA 3ZFZA 2D02A 4WMCD 2WYXA 2Y2KA 2HDSA 4JLFA 3VMAA 1BULA 5F68A 3P09A 4ZTKA 5TGFA 3QNBA 1NY0A 3OC2A 4LFUA 1PWGA 4XXRA 3MQ0A 5FDHA 3N4IA 4OKPA 1GCEA 4R3AA 5CHMA 1HZOA 1D7EA 1JTGA 4EEUA 3HVFA 4EBLA 2EA9A 1Q2QA 2WKRA 1EROA 3T1SA 2A49A 3UN7A 4OOLA 3QP5A 1GHMA 2HJ9C 4KUKA 1LI0A 4XUZA 3R7WB 2J3TC 5TBMB 3HCYA 4DDSA 2WKIA 3M6BA 2O9CA 4R6LA 4P85A 4WEJA 2VGKA 1MBLA 1ZHHB 1XFNA 3VE3A 3OCLA 2M1CA 4BD0A 1G6AA 1L0GA 2OV5A 1OT9A 1YKDA 3BFCA 3LEZA 3GR2A 1VHMA 5DVAA 1CK3A 1H5XA 3HUMA 3UE1A 2V0WA 2V0UA 4BQMA 4UHUA 4X1LA 2ZLYA 4R4RA 4IHQA 5AQ7A 1I2WA 3KYEA 3ZGAB 4Y0OA 3C7VA 2ZQ7A 3CPTA 3IXGA 3ZDJA 3IX3A 2IWCA 5A93A 3W4PA 3O5YA 3E98A 3F1PB 4E3OA 3MF0A 4IVIA 1BLHA 3TE8A 2A24A 4MN5A 1FSWA 3DTKA 1K6RA 4YNRA 4FUWA 3IH8A 1MZUA 4HQAA 1V9YA 3Q81A 1P9RA 4B4ZA 2YKFA 3T50A 3RXXA 4GJ4A 4RYEA 3UMEA 4F3LB 2XFTA 2VV8A 4NXFA 5GLBA 1LSWA 5HDCA 4JGPA 4CPKA 4N1HA 1MXOA 2Y2HA 1UWPX 2VKSA 1XX2A 2X71A 4WM9A 4I3JA 2ZQAA 2ZD8A 3IS2A 3E4OA 4OP5A 3LR4A 3OPRA 5EVID 3HJKA 1MWRA 3BFFA 2VJWA 5CEDA 3OPHA 1G28A 3KSIA 3BQ8A 1XKZA 4ARZA 1AXBA 3NHQA 3E4QA 4LRZE 1W63Q 4EXOA 4LLOB 2A3UA 3S22A 3HJIA 2M7VA 1P97A 3ICYA 3GECA 4MLLA 3SH8A 4GB7A 5G4YA 4GKUA 4KG6A 2HPBA 1Z6FA 5L8MA 3MZDA 1P9WA 4OONA 4P6ZS 5DFYA 3BRMA 4I3AA 3R4KA 3MBZA 2PD7A 3FPWA 3Q7VA 5DTTA 3LFVA 4GD6A 1Z09A 4GS9A 3MMHA 3MQOA 1FILA 1XJ4A 2FZ0A 4C6YA 1YSPA 5J3WA 4HNBA 4X25A 2XR0A 5IHVA 1XA7A 1H8MA 4GCZA 1XPBA 1T1BA 1ZKJA 4OQHA 5EFWA 4Y0TA 1HD8A 3V67A 4DF6A 1FIKA 4EBNA 2KLIA 1L0FA 4WEKA 2ZJ9A 2DNSA 1PW8A 1KVLA 2ZQDA 5BOHA 4X1MA 3ISGA 5HZHA 2V1BA 2VV7A 1H8ZA 4HEFA 1JWZA 4E6WA 1YLPA 4WZ5A 3UY6A 3FKVA 2XA7S 2J9OA 4EQ1A 4Y7PA 4JF4A 3D9YA 2BG1A 3LIBA 1BT5A 3A0SA 3V3RA 1YQSA 2W27A 3LUQA 4DE3A 2ZL1B 4HP9A 2Y2NA 5AQ9A 5IU1A 3SS3A 5CERA 5GHXA 4C3QA 5IT5A 3N7WA 4OPZA 1G5UA 4LPZA 3FWLA 1GSWA 1YM1A 3OCNA 2Y2JA 4S2NC 5F5YA 1ESUA 1PWDA 1N9LA 4IJGA 2PD8A 2NUPC 4OQ0A 4Y2FA 1MC0A 2DRWA 2QZ6A 5FQJA 3UB6A 4NXBA 4O0PA 1SDNA 3VP1A 2WAFA 3SZTA 4OLGA 1H8YA 5HL6A 3PAGA 2I72A 5A91A 2XDMA 4S2KA 1OTAA 4IBRA 1OMEA 4HBTA 4Y3IA 1HLUP 4CJNA 4DKIA 3H9WA 3CG5A 2J3WA 1IYOA 1PYYA 1S1YA 3O87A 1K55C 5I94A 3WWXA 3UDIA 3N6IA 2HP6A 3G31A 1ES4A 2FFFB 4G3WA 1TDLA 3HLEA 4UA6A 4N9KA 4HH3A 5FSRA 1T19A 2VGLM 2Y2QA 4GN2A 4MBFA 4CLCA 4RVAA 4EUVA 1CEFA 1K56D 1H0MA 1OTEA 2P08A 1OPXA 3HUNA 5D3OA 4IBXA 4NEED 4L0LA 3C7UA 2R9XA 3CITA 3NCKA 3UO9A 4LV3A 3LR3A 1GA0A 5A90A 1S67L 5TFQA 2H5SA 2OLVA 1ZTUA 3T1RA 5HWWA 3OOVA 3M2JA 5AJGA 3Q82A 3U4LP 4G3VA 3O3VA 1LHYA 3K3DA 5EM1A 5HPIA 1IEMA 4B4XA 4JPMA 1YAXA 4UEYA 3AGFA 3C8CA 2HDQA 1W63M 5KSCA 4QY6A 3W8KA 3IXBA 3SH9A 4S2PA 5EOOA 4KQOA 3NOTC 2PAVP 1Q2PA 2G7UA 3S7NA 2ZQ8A 3MFDA 2DMWA 1PFLA 1MWSA 4BENA 2OOLA 3OZHA 4X55A 1JNUA 2V1ZA 4PKYG 3QP8A 1KE3A 3AGEA 4E3KA 4DJ2A 1LLBA 1FCNA 2C6WB 1YLWA 3NC8A 2JKRM 4N92A 1TS0A 1K54A 2Y59A 3VV4A 4OVDA 2FH5A 2XF3A 3PYPA 2EWWA 4IUHA 3OLOA 4HOIA 1LI9A 3PBTA 3CPTB 2C5WB 3UNWA 3UPNA 2Y2MA 5M1AA 1GA9A 1L3LA 2VZWA 4KG2A 4P6BA 3MSHA 4I5SA 3T4QA 5FA7A 5E2FA 1XJ3A 3GMWA 5E2EA 4E3IA 4X69A 2A24B 3UMDA 4MDZA 4BBUA 2W3FA 2JCHA 3RH8B 3ZG9B 4A5RA 2OAQ1 2JBFA 1ERQA 3FG8A 3IWQA 4HHDA 3F1OB 1RGYA 2IWDA 5CX7A 4WF0A 2PBYA 5CHUA 3CAXA 1V9ZA 1RP5A 2ZC4B 4HP4A 4JXSA 2Y2PA 3CWFA 1LL8A 4R3JA 3IS2B 2RL3A 4M3KA 2XGNA 4KENB 4EESA 3ZG8B 1MPLA 1J3WA 5HDSA 3SS5A 1VQQA 3KSHA 2J3TD 4R1GA 3FPVA 2VGJA 2XK1A 3IF6A 4KZ9A 2J7VA 3A3FA 3UE3A 3G35A 5GHYA 5F82A 4OH0A 4H6JA 2PU4A 1PI4A 3LR5A 4GNUA 2JKFA 3S4XA 1HTZA 3TRCA 4NG2A 1IYQA 3KSFA 3FZCA 3ZNYA 4QD4A 2P9VA 4OOMA 5HDDA 5AQBA 3CUEA 3Q7VB 2KDKA 1JTDA 3UDFA 1ZG6A 4E6XA 3QP6A 1OT6A 4GS9B 5HL1A 4JF6A 4GLQA 3IWIA 1NZOA 5FASA 1F2KA 1UGUA 5J4EA 3Q07A 1SCWA 4L9GA 4OPRA 4IUKA 1M6KA 3GTCA 3EQVA 3KO6A 2PYRA 3FV7A 3VP3A 2DCFA 3LO7A 5G4ZA 4DDYA 5EVLA 3KYQA 4CQHA 3DAVA 5FAPA 2BLSA 2WUQA 1XA1A 4HJ3A 5FDSA 5A8BA 3NJAA 5J8XA 4O01A 5EOEA 3T4KA 5TJJA 5FAOA 1NRJA 1SDEA 1ES5A 3ZVWA 5KSHA 3C30A 4IEDA 1NJ4A 2QYBA 3ULFA 4DE0A 2E8IA 1WA9A 2PR5A 1IFQA 2D01A 4ETZA 2Y79A 4EV4A 4ME4A 3WS4A 1SZVA 4NK3A 4NETA 5DTSA 2J80A 2PT7A 3UPOA 4EU0A 3MXQA 3LCEA 4R23A 1VETA 4ETXA 4GDBA 5DF9A 3JPUA 5I5LA 4WMCA 5MC7A 1W7FA 1BYWA 4UA9A 1NXYA 3F1NA 2VK3A 2WADA 3LYXA 2EXBA 2V20A 5HAIA 1N9BA 4B88A 3VP0A 1CI8A 1OTIA 5CGXA 4PHTA 1O7EA 4BD1A 3N8LA 1K57A 2BTFP 3B42A 3WS5A 4Q0JA 2VV6A 2JKTI 2EFXA 5CXWA 4HJ6A 5C5KA 4OQIA 5DKLA 5FQ9A 3IX4A 3EEAA 4QJGA 2XRNA 3QP2A 3G32A 4JXVA 4DE2A 3DW0A 1IKGA 1WYBA 2H0TA 4HIAA 4KG5A 2AVXA 5AVEA 3T4TA 4S2JA 1YPRA 4JF5A 1O07A 3ZCZA 4GHIA 3V3SA 1YLTA 3KYZA 4B9OA 1NLYA 3G30A 2WKQA 2K31A 5L2FA 2XA7M 4CLCB 1RGZA 4ZJ1A 4WLAA 4II7A 5K5BA 4HH2A 5EM0A 5FEGA 2G2UA 1MWUA 1K4FA 4LV1A 3HLCA 3UE0A 3ZNTA 3L9KA 5FQQA 4DXBA 3EGXC 1DP6A 1T18A 2XLNA 3ZG0A 3LEQA 1KGFA 4JGOA 2XH9A 1KDWA 2KOIA 4KZ4A 4LGWA 4U3TA 4BL3A 3V39A 4WZ5C 2W0NA 5F6AA 2ZMVA 3CLOA 5M19A 4E3NA 3T4LA 2VLGA 5EVIC 4EW7A 3VP2A 1TDGA 1X0OA 3ITBA 3DWKA 3EEHA 1W79A 3C38A 4PM9A 4R38A 3H7WA 4RX3A 5DF7A 2V8CA 3HL9A 4KZ7A 3SH7A 4HESA 3OPLA 3BJNA 3MZEA 4R4SA 4HI4A 1Y54A 1SKOA 3PAEA 1VB6A 4MEZA 3G2ZA 4DXCA 4E3JA 4JGRA 1L0DA 4XUXA 5EVIA 3V5MA 4ZDXA 3C4OA 4HBUA 1NLZA 4FTXA 2ZC7A 2ZC5B 2ZM0A 3BFEA 4K0XA 3BEBA 2P04A 4P0MA 2KX6A 4EUZA 3LIEA 1E3UD 3T1XA 3T1QB 3IT9A 1LSXA 4FD8A 5HD3A 4G3KA 3HLWA 5GLAA 3F1PA 4JBFA 3ZG7B 2PHYA 1U60A 1S4SA 1TS7A 1SKFA 4FSFA 2PR6A 3T4OA 1S66L 2ZQ9A 4S2MA 2A2LA 1PW1A 1LT0A 5IS1A 3NECA 1QMFA 4ID4A 3MKEA 2JHEA 2O9BA 4KQDA 1PWCA 3UB8A 1DJCA 4CLCC 1ES2A 1H3QA 5M18A 1N9NA 4F3LA 3Q7ZA 1IELA 2HZ5A 3LY3A 5CTNA 3C4PA 2O9AA 3IHBA 2Y2GA 1NYYA 2R9WA 3BY8A 2GX5A 4WELA 3MZFA 5EVEA 3I7JA 2WGIA 3IF6B 3MR0A 3RFBA 5HAPA 3IX8A 4WN5A 3NDEA 5F83A 4KZ8A 3JYIA 2WKHA 2W3GA 1Y28A 1LSVA 1I5QA 1IYPA 4H6JB 4FH2A 1F9IA 1K0KA 1NRFA 1YMSA 2QKPA 3LY4A 3T12B 2R78A 2P9VB 3GRJA 1DP8A 2HV1A 1FR1A 5HFOA 1T1CA 3MXSA 4PM5A 5HPFA 1M40A 5FL3A 3MS6A 1GSXA 2Y55A 4S2OA 2BASA 3VE4A 4QHCA 4RA7A 1UWNX 2O0YA 3OPPA 4ZRRA 3UB9A 2W3EA 2QJ7A 3OBFA 5DJTA 1GHIA 1TS8A 5E43A 2L1MA 1K54C 1PI5A 1KE0A 4D60A 2EWVA 1DRMA 4XT2A 1E4DA 4O8GA 3W4QA 4OLDA 5AQAA 4PAUA 4FCFA 3TW8A 5HW3A 4O7DA 1RCJA 1W8YA 3HLFA 4PMAA 5F69A 3TSGA 1E25A 3A3DA 1BLSA 3HUOA 3WRZA 3LIDA 1TS6A 2XD1A 4WL9A 3N8RA 4BWIA 1ONHA 5GLDA 5CTMA 3GDIA 4LCMA 3RTYA 1S1ZA 2NUTC 2XD5A 2Z6CA 2XROA 3KSGA 4DRTA 4BL2A 3BM6A 2V2FF 2JE5A 4MBHA 1BLCA 2WGWA 2ZBBA 5HSQA 1YT4A 1G6OA 1XFQA 3RJUA 2PRFA 5FEFA 1BSGA 5L10A 4N1XA 4I39A 4Q0IA 4CLCE 3A0RA 1BLPA 1VETB 2H28A 1FCMA 3IF5A 4KZBA 2Z2MB 4YFMA 2UV0E 1ODVA 5HWVA 1YSQA 4KUOA 1EW0A 4ESPA 1JWPA 1F5MA 4KZ6A 3F1NB 1DJAA 1MWTA 4NXGA 4BBVA 1FOFA 4EETB 3IF6C 1YLZA 1K56A 4LENA 3VOZA 4Y13A 2M7UA 4ZBEA 2INWA 4YINA 5U47A 3GV9A 3D3OA 2V9AA 5DF8A 2VA0A 4OOYA 3K3CA 3PBSA 1N4OA 2HP9A 4E04A 5HX9A 5L07A 2H10A 4K08A 3ITAA 3CUEC 5GL9A 4ARZB 3GQZA 2UWXA 3IHAA 4ZJ2A 4KZ5A 3WS1A 1XGIA 1DY6A 5EE8A 5HWTA 2HDUA 3KX0X 4GHIB 1P0ZA 3NOPC 4PPRA 1N9OA 1W5DA 3BFGA 3NOUC 3QNCA 2EX8A 3G2YA 3BECA 2OAP1 3DTIA 3V50A 2VX8A 4UQIS 2ZMFA 4UA7A 4RQ9A 2HP5A 3UE6A 3MQQA 4MNRA 2B02A 3VP4A 3E4PA 1GHPA 5FQKA 3LIAA 5JYPA 2Y4AA 5DKKA 4PM7A 2XSSA 1KGEA 5EUAA 1TEMA 5FATA 2ZM8A 1W8QA 4BLMA 3H7WB 4UAAA 1BUEA 5CHJA 4B93A 3D72A 3T4JA 3UB5P 3C5AA 3EQUA 3WRTA 2B18A 2W1TA 3S7PA 1SKOB 1XXMA 3IBRA 5HD5A 4OPYA 2Y8HA 2H0YA 2WK0A 4R3BA 2WAEA 3CHWP 3HLBA 5EVIB 4E3MA 1ES3A 1EWZA 2G2WA 3CI6A 3IXDA 4HJ4A 2OSUA 3LIFA 4Y0UA 4WBGA 5CGSA 1L0EA 1K57C 2ZC6B 2J8YA 3CJMA 4K0WA 1D1JA 2GZAA 3TJZC 4KQRA 3A3JA 1NZUA 3JVVA 2WGVA 1XGJA 3HLDA 3VFHA 2GJ3A 5EV0A 4JXGA 3Q1FA 3FKWA 2JKTM 3P7NA 1ONGA 4P6ZM 2Q0OA 1I2SA 4KZAA 3QP4A 2QWSA 4OPQA 2EX9A 1NWZA 2LB9A 2XQZA 1CEGA 3BYDA 3T4SA 4S2LA 5GHZA 4YOFA 3TG9A 3W2ZA 3PBNA 4MN7A 1YLJA 3QHYA 4GDNA 3NI9A 4I38A 3A3EA 3H82A 1FCOA 3ZHHA 5TR7A 5F1FA 3PHYA 3B33A 3F1OA 1K4EA 3CZDA 1XJ2A 2HF6A 3NULA 3A3IA 3LI9A 2OWHA 5KMWA 4R0QA 5EECA 3TOIA 2V8FA 2P74A 1IOUA 2JC7A 1VEUA 1ALQA 2ZMAA 4PM8A 3BY9A 2EFUA 2ZC3B 3S7QA 1ZG4A 1KGGA 1TF1A 3M2KA 2JN7A 1IYSA 2HJEA 2WZZA 3EGDC 5E2GA 3NDGA 5CEBA 4Q0HA 5G18A 2Y2IA 1KVMA 4U0TA 3G4PA 4WUJA 2Y2OA 4X56A 1S4RA 1ZC2A 2PDRA 4AFIA 2L4RA 1STZA 3SW1A 2YKHA 3BW6A 3ZVTA 2WKEA 3A0VA 3RXWA 3LGOA 4DJ3A 3B47A 2Y91A 3UPPA 1KE4A 2Q9NA 3MXRA 2XEPA 2MJ6A 1MKIA 4HY8A 4MCWA 4EQIA 4M4XA 2Z6DA 4X68A 1JWVA 4L9FA 2B95A 3PBQA 4E3LA 3NY4A 5FAQA 5HAQA 3C2WA 3QP1A 3JVUA 4LV2A 1ERMA 4XT2B 3IQAA 4WYYA 1LL5A 1ACFA 2J9PA 3M6HA 2ZOHA 3P98A 4YWZA 4X53A 5J7EA 3G6OA 4OQGA 2ACGA 3R7WA 5TBMA 1XJ6A 3EOIA 1MY8A 2CC1A 3PR6A 1D06A 4C75A 3U2AA 4GZBA 1EI5A 2JKGA 2OWJA 4GD8A 2Z2LB 2QPNA 2GNXA 1NYMA 3B3XA 2QJ5A 3MJQA 4GW9A 2HGVA 2L0WA 3IXHA 2ZOIA 3IWOA 4CLCD 1F98A 2WGWB 4MMNA 5F1GA 3MFXA 2Y2LA 5AVFA 1T1AA 2PU2A 3CMZA 2GDNA 1K25A 4F94A 5JYOA 3DTEA 2ZM2A 5CECA 2ZQCA 4LV0A 1CI9A 4EBPA 1FSYA 3O88A 2W3HA 3S7OA 2VEAA 4OP8A 2B5RA 1A0KA 2P7JA 1Y4OA 3O86A 3ZQ5A 4P87A 3E2LA 2QMIA 4ZJ3A 4Z9QA 3IBJA 5FI6A 4KQQA 4QPRA 4DMZA 3PBRA 3UDXA 3HBRA 4Y5FA 2EX6A 5FQIA 3VOLA 3VSLA 4JGQA 1FR6A 2K2NA 3EWKA 4U0XA 2V1AA 5GLCA 3BWLA 1SHVA 1PIOA 3E2KA 3BLSA 5FI2A 1KDSA 1PRQA 1CQAA 3E0YA 4QWOA 1S6RA 3AGDA 3BQAA 4LCLA 4BBTA 3PTEA 4S2NA 3GSGA 4ZAMA 3S1YA 2I9VA 4BMWA 4NXEA 2QHKA 4QY5A 3NBLA 4DN0A 2K7SA 1TD5A 1BTLA 4FH4A 5DJUA 5CRFA 4D2OA 4EWFA 4X6TA 1IKIA 2RCXA 5KIZA 3GVBA 5L09A 1CF0A 2X01A 4S2IA 3K2NA 4DE1A 4JXWA 1K6SA 2PBDP 2FFYA 1YLYA 3HLGA 3PBOA 4LRXC 5E2HA 1CJFA 3MKFA 4RX2A 4N9LA 3NIAA 4EERA 1PZOA 4K91A 2CMNA 4KZ3A 1QMEA 1PNEA 1K55A 3FYZA 1E3UA 5CGWA 5A92A 1HVBA 1PZPA 4I3IA 2O99A 4BJPA 2W1TB 5EPHA 4L9EA 2PYPA 3SOIA 4FOFA 5FI7A 2W1RA 4Y17A 4MN6A 4MBKA 2WKPA 3DTMA 3L7HA 3G34A 2Q9MA 1GSVA 1XP4A 5HARA 5FQMA 2VGLS 4PM6A 4QB8A 2EX2A 1S0WA 1WE4A 4Z1WA 4PKYA 4Y15A 2LB5A 1OTBA 4Q8IA 1AWIA 2XFSA 3DBAA 4EEPA 3SS4A 3N8SA 3IH9A 1G68A 2OLUA 2ZL1A 3UB7A 3PXPA 4UQIM 1DJBA 2X02A 2E8JA 2JKRI 1DP9A 1L2SA 1J9MA 4WZ4A 3D4FA 2HDRA
chains in the Genus database with same CATH topology
1K55C 4WZ5C 5I94A 3WWXA 3BLMA 3UDIA 3IXDA 5M19A 4JKTA 4E3NA 1YMXA 2OSUA 3N6IA 4QU3A 2HP6A 4Y0UA 3G31A 1ES4A 2FFFB 5EVIC 1TDLA 3HLEA 4WBGA 5CGSA 1L0EA 1K57C 2ZC6B 2J8YA 3VP2A 1TDGA 3CJMA 4N9KA 4UA6A 5FSRA 1FQGA 1WYCA 2Y2QA 3DWKA 3ITBA 4GN2A 1W79A 4MBFA 4K0WA 4PM9A 3VSKA 4KQRA 4RVAA 4RX3A 1ESIA 1CEFA 3A3JA 1NZUA 1C3BA 2WGVA 5DF7A 1K56D 1K38A 1XGJA 3HLDA 5KZHA 3VFHA 3HL9A 3V39A 1BZAA 4JXGA 3W4OA 3Q1FA 3HUNA 5D3OA 4KZ7A 3FKWA 1ONGA 3SH7A 2IWBA 1I2SA 4IBXA 4HESA 1JVJA 4KZAA 4L0LA 3C7UA 2R9XA 3OPLA 4OPQA 2EX9A 3MZEA 1LL9A 4R4SA 1Y54A 3WRTA 2XQZA 3NCKA 3UO9A 1CEGA 3PAEA 4LV3A 3BYDA 1GA0A 5A90A 4MEZA 3G2ZA 4S2LA 5GHZA 5TFQA 2H5SA 2OLVA 4DXCA 3DWZA 3ZG5A 4E3JA 4IVKA 1L0DA 2EXAA 3HREA 4XUXA 3TG9A 3WS0A 5DTKA 1TVFA 3PBNA 4H8RA 5EVIA 1YLJA 3VFFA 3WS2A 3QHYA 3VOYA 3M2JA 3V5MA 4ZDXA 3C4OA 3Q82A 2WZXA 4HBUA 4GDNA 1VM1A 3O3VA 3NI9A 1LHYA 3A3EA 1FCOA 3ZHHA 1IEMA 2ZC7A 5TR7A 4B4XA 5F1FA 4GOGA 4JPMA 1K4EA 3BFDA 3CZDA 3ZFZA 3AGFA 2HDQA 4WMCD 5KSCA 4QY6A 3W8KA 2WYXA 2Y2KA 3A3IA 3IXBA 3SH9A 2HDSA 4JLFA 2ZC5B 3VMAA 1BULA 4S2PA 3P09A 5EOOA 5KMWA 2ZM0A 4KQOA 4R0QA 5EECA 4ZTKA 5TGFA 1Q2PA 3TOIA 3QNBA 3BFEA 2ZQ8A 4K0XA 3BEBA 1NY0A 2P74A 3MFDA 4P0MA 4BENA 1MWSA 2JC7A 3OC2A 4EUZA 1E3UD 1PWGA 1ALQA 3IT9A 4XXRA 2ZMAA 3OZHA 4X55A 2V1ZA 4FD8A 4PM8A 5FDHA 3N4IA 3HLWA 1GCEA 4OKPA 2EFUA 1KE3A 3AGEA 5CHMA 5GLAA 1HZOA 2ZC3B 4JBFA 4E3KA 3ZG7B 1LLBA 1FCNA 1JTGA 1U60A 1SKFA 1ZG4A 4FSFA 1KGGA 3HVFA 4EBLA 1Q2QA 2C6WB 3M2KA 1YLWA 3NC8A 2ZQ9A 4S2MA 1IYSA 2WZZA 4N92A 1PW1A 5E2GA 1EROA 3NDGA 1K54A 5CEBA 5G18A 2Y2IA 1KVMA 2Y59A 4U0TA 2A49A 4OVDA 3G4PA 3UN7A 1QMFA 4ID4A 4OOLA 2XF3A 3MKEA 2Y2OA 4X56A 1ZC2A 1GHMA 1LI9A 3PBTA 1LI0A 4XUZA 1PWCA 2C5WB 4DDSA 2WKIA 3UNWA 3ZVTA 2WKEA 1DJCA 1ES2A 3UPNA 3M6BA 3RXWA 2Y2MA 5M18A 5M1AA 1GA9A 2Y91A 3Q7ZA 4P85A 4KG2A 4WEJA 1IELA 4P6BA 3UPPA 1KE4A 3LY3A 2VGKA 2Q9NA 5CTNA 1MBLA 3C4PA 3MXRA 5FA7A 2XEPA 3IHBA 5E2FA 2Y2GA 1MKIA 1NYYA 3GMWA 2R9WA 5E2EA 4E3IA 4X69A 4EQIA 3OCLA 4U3TA 4X68A 4WELA 1JWVA 4BD0A 3MZFA 1G6AA 2JCHA 3PBQA 3I7JA 1L0GA 2OV5A 3ZG9B 2WGIA 4A5RA 3IF6B 4E3LA 5HAPA 3BFCA 3NDEA 3NY4A 2JBFA 5FAQA 1ERQA 5F83A 3LEZA 3GR2A 4KZ8A 3IWQA 3JYIA 2WKHA 5DVAA 1RGYA 1CK3A 1H5XA 2IWDA 3HUMA 5HAQA 2PBYA 5CHUA 4LV2A 3UE1A 1ERMA 1I5QA 1IYPA 4BQMA 1RP5A 3IQAA 2ZC4B 4UHUA 4WYYA 1LL5A 4JXSA 2J9PA 4FH2A 1NRFA 1YMSA 2Y2PA 2ZLYA 3M6HA 3P98A 3LY4A 4R4RA 4X53A 5AQ7A 1I2WA 4R3JA 3ZGAB 4OQGA 4Y0OA 2RL3A 2ZQ7A 3C7VA 1MY8A 3IXGA 3ZDJA 2CC1A 4M3KA 2P9VB 3GRJA 2IWCA 1FR1A 5A93A 2XGNA 5HFOA 3W4PA 4C75A 4GZBA 3MXSA 1EI5A 4KENB 4PM5A 4E3OA 1M40A 3ZG8B 4IVIA 1MPLA 2Y55A 4GD8A 4S2OA 2Z2LB 1BLHA 2QPNA 3SS5A 1VQQA 4QHCA 1NYMA 3B3XA 4RA7A 1FSWA 1K6RA 4R1GA 3IH8A 3IXHA 3OPPA 3IWOA 2VGJA 2XK1A 2WGWB 3IF6A 4KZ9A 2J7VA 3A3FA 3Q81A 5F1GA 1GHIA 3UE3A 5E43A 1K54C 3G35A 4B4ZA 5GHYA 1PI5A 1KE0A 5F82A 3RXXA 4RYEA 2Y2LA 2XFTA 1E4DA 4OH0A 5GLBA 2PU4A 3W4QA 1PI4A 4CPKA 4OLDA 2PU2A 4N1HA 5AQAA 1MXOA 2Y2HA 3CMZA 4GNUA 4FCFA 3S4XA 1HTZA 1XX2A 5HW3A 4O7DA 1RCJA 1W8YA 2GDNA 2X71A 1K25A 3HLFA 4PMAA 2ZQAA 4WM9A 3TSGA 4F94A 1IYQA 2ZD8A 1E25A 3A3DA 3FZCA 3ZNYA 5JYOA 1BLSA 3HUOA 3WRZA 4OP5A 3OPRA 4QD4A 2P9VA 4OOMA 5EVID 5AQBA 1MWRA 2XD1A 2ZM2A 3BFFA 5CECA 2ZQCA 3N8RA 4LV0A 1CI9A 3Q7VB 4EBPA 1FSYA 3O88A 3UDFA 1JTDA 1ONHA 5CEDA 5GLDA 1ZG6A 4E6XA 3OPHA 4OP8A 2B5RA 5CTMA 5HL1A 4LCMA 4JF6A 2XD5A 1XKZA 3IWIA 3O86A 4P87A 1NZOA 3E2LA 4DRTA 4BL2A 3BM6A 2V2FF 5FASA 2QMIA 1AXBA 4ZJ3A 2JE5A 4MBHA 4Z9QA 1BLCA 2WGWA 1YT4A 3Q07A 1SCWA 5FI6A 4KQQA 3RJUA 4OPRA 1BSGA 2A3UA 3PBRA 4N1XA 3S22A 3UDXA 3HBRA 1M6KA 2EX6A 5FQIA 4MLLA 3VSLA 3GTCA 1FR6A 3EQVA 3SH8A 4GB7A 1BLPA 4GKUA 4KG6A 2HPBA 1FCMA 3FV7A 3IF5A 4KZBA 3VP3A 2DCFA 2Z2MB 1Z6FA 3MZDA 3LO7A 4OONA 4U0XA 4YFMA 4DDYA 5GLCA 1SHVA 5EVLA 3BRMA 5FAPA 2BLSA 1PIOA 2WUQA 3MBZA 1XA1A 1JWPA 3BLSA 3E2KA 3Q7VA 5FI2A 1KDSA 4KZ6A 5J8XA 5DTTA 1DJAA 1MWTA 4GD6A 5EOEA 1S6RA 1FOFA 3AGDA 3IF6C 4LCLA 5FAOA 1YLZA 1K56A 1SDEA 1ES5A 3PTEA 4S2NA 3ZVWA 4LENA 4C6YA 5KSHA 3GSGA 4ZAMA 3S1YA 3VOZA 4IEDA 1NJ4A 2XR0A 5IHVA 4DE0A 2E8IA 4QY5A 3NBLA 1XA7A 4ZBEA 1XPBA 1BTLA 4FH4A 1ZKJA 4YINA 4OQHA 5U47A 5CRFA 4Y0TA 3GV9A 4D2OA 4EV4A 3WS4A 5DF8A 4EWFA 4X6TA 1IKIA 2RCXA 4OOYA 4NK3A 4NETA 5DTSA 1HD8A 3UPOA 3GVBA 3PBSA 1N4OA 2HP9A 4DF6A 2X01A 4EBNA 1L0FA 4S2IA 5HX9A 2H10A 3LCEA 4DE1A 4R23A 4JXWA 4WEKA 1K6SA 3ITAA 5GL9A 2FFYA 1YLYA 3HLGA 2ZJ9A 3PBOA 5E2HA 4GDBA 5DF9A 2DNSA 3GQZA 3MKFA 1PW8A 1KVLA 4RX2A 4WMCA 2UWXA 3IHAA 2ZQDA 4KZ5A 4ZJ2A 1W7FA 3WS1A 5BOHA 4N9LA 3ISGA 3NIAA 1H8ZA 1DY6A 1NXYA 1XGIA 4UA9A 2WADA 5EE8A 1PZOA 2EXBA 2HDUA 2V20A 4HEFA 1N9BA 4K91A 1JWZA 4KZ3A 5HAIA 4B88A 1QMEA 1CI8A 3VP0A 4E6WA 1K55A 1YLPA 4WZ5A 3UY6A 3FKVA 4PPRA 3FYZA 2J9OA 1E3UA 5CGWA 1W5DA 5CGXA 3BFGA 3QNCA 5A92A 1HVBA 4Y7PA 1PZPA 2EX8A 4JF4A 1O7EA 4BD1A 2BG1A 3N8LA 1K57A 3G2YA 3BECA 3WS5A 1BT5A 3V3RA 3V50A 2EFXA 1YQSA 5CXWA 4OQIA 5FQ9A 4BJPA 4DE3A 5EPHA 2Y2NA 5AQ9A 4QJGA 4UA7A 3SS3A 3SOIA 5CERA 2HP5A 5GHXA 5FI7A 3G32A 4JXVA 4DE2A 4C3QA 3DW0A 1IKGA 1WYBA 3N7WA 2H0TA 4MNRA 4MBKA 3DTMA 4OPZA 3VP4A 4KG5A 3FWLA 3G34A 2Q9MA 1YM1A 1GHPA 4S2JA 1XP4A 3OCNA 2Y2JA 4S2NC 5FQKA 5HARA 1ESUA 4JF5A 5JYPA 2Y4AA 1O07A 1PWDA 4PM7A 3ZCZA 5FQMA 1KGEA 3V3SA 1YLTA 5EUAA 3G30A 4PM6A 4QB8A 2EX2A 1TEMA 4OQ0A 5FATA 1S0WA 2DRWA 2ZM8A 2QZ6A 5L2FA 5FQJA 1W8QA 4BLMA 1WE4A 1RGZA 4ZJ1A 4UAAA 1SDNA 3VP1A 1BUEA 2WAFA 5CHJA 4OLGA 4Q8IA 1H8YA 2XFSA 3PAGA 2I72A 5A91A 2G2UA 1MWUA 2XDMA 4S2KA 1K4FA 3C5AA 3EQUA 4LV1A 3N8SA 3SS4A 3HLCA 3IH9A 1G68A 4IBRA 2OLUA 3UE0A 3ZNTA 1OMEA 4HBTA 5FQQA 1XXMA 4DXBA 4CJNA 1DJBA 4DKIA 2XLNA 3ZG0A 4OPYA 2X02A 3CG5A 2H0YA 1KGFA 2WK0A 4R3BA 2XH9A 1KDWA 2WAEA 1IYOA 1L2SA 4KZ4A 1J9MA 4WZ4A 3HLBA 3D4FA 2HDRA 5EVIB 1PYYA 4E3MA 1ES3A 1EWZA 4BL3A 2G2WA 3O87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K55 C;  4WZ5 C;  5I94 A;  3WWX A;  3BLM A;  3UDI A;  3IXD A;  5M19 A;  4JKT A;  4E3N A;  1YMX A;  2OSU A;  3N6I A;  4QU3 A;  2HP6 A;  4Y0U A;  3G31 A;  1ES4 A;  2FFF B;  5EVI C;  1TDL A;  3HLE A;  4WBG A;  5CGS A;  1L0E A;  1K57 C;  2ZC6 B;  2J8Y A;  3VP2 A;  1TDG A;  3CJM A;  4N9K A;  4UA6 A;  5FSR A;  1FQG A;  1WYC A;  2Y2Q A;  3DWK A;  3ITB A;  4GN2 A;  1W79 A;  4MBF A;  4K0W A;  4PM9 A;  3VSK A;  4KQR A;  4RVA A;  4RX3 A;  1ESI A;  1CEF A;  3A3J A;  1NZU A;  1C3B A;  2WGV A;  5DF7 A;  1K56 D;  1K38 A;  1XGJ A;  3HLD A;  5KZH A;  3VFH A;  3HL9 A;  3V39 A;  1BZA A;  4JXG A;  3W4O A;  3Q1F A;  3HUN A;  5D3O A;  4KZ7 A;  3FKW A;  1ONG A;  3SH7 A;  2IWB A;  1I2S A;  4IBX A;  4HES A;  1JVJ A;  4KZA A;  4L0L A;  3C7U A;  2R9X A;  3OPL A;  4OPQ A;  2EX9 A;  3MZE A;  1LL9 A;  4R4S A;  1Y54 A;  3WRT A;  2XQZ A;  3NCK A;  3UO9 A;  1CEG A;  3PAE A;  4LV3 A;  3BYD A;  1GA0 A;  5A90 A;  4MEZ A;  3G2Z A;  4S2L A;  5GHZ A;  5TFQ A;  2H5S A;  2OLV A;  4DXC A;  3DWZ A;  3ZG5 A;  4E3J A;  4IVK A;  1L0D A;  2EXA A;  3HRE A;  4XUX A;  3TG9 A;  3WS0 A;  5DTK A;  1TVF A;  3PBN A;  4H8R A;  5EVI A;  1YLJ A;  3VFF A;  3WS2 A;  3QHY A;  3VOY A;  3M2J A;  3V5M A;  4ZDX A;  3C4O A;  3Q82 A;  2WZX A;  4HBU A;  4GDN A;  1VM1 A;  3O3V A;  3NI9 A;  1LHY A;  3A3E A;  1FCO A;  3ZHH A;  1IEM A;  2ZC7 A;  5TR7 A;  4B4X A;  5F1F A;  4GOG A;  4JPM A;  1K4E A;  3BFD A;  3CZD A;  3ZFZ A;  3AGF A;  2HDQ A;  4WMC D;  5KSC A;  4QY6 A;  3W8K A;  2WYX A;  2Y2K A;  3A3I A;  3IXB A;  3SH9 A;  2HDS A;  4JLF A;  2ZC5 B;  3VMA A;  1BUL A;  4S2P A;  3P09 A;  5EOO A;  5KMW A;  2ZM0 A;  4KQO A;  4R0Q A;  5EEC A;  4ZTK A;  5TGF A;  1Q2P A;  3TOI A;  3QNB A;  3BFE A;  2ZQ8 A;  4K0X A;  3BEB A;  1NY0 A;  2P74 A;  3MFD A;  4P0M A;  4BEN A;  1MWS A;  2JC7 A;  3OC2 A;  4EUZ A;  1E3U D;  1PWG A;  1ALQ A;  3IT9 A;  4XXR A;  2ZMA A;  3OZH A;  4X55 A;  2V1Z A;  4FD8 A;  4PM8 A;  5FDH A;  3N4I A;  3HLW A;  1GCE A;  4OKP A;  2EFU A;  1KE3 A;  3AGE A;  5CHM A;  5GLA A;  1HZO A;  2ZC3 B;  4JBF A;  4E3K A;  3ZG7 B;  1LLB A;  1FCN A;  1JTG A;  1U60 A;  1SKF A;  1ZG4 A;  4FSF A;  1KGG A;  3HVF A;  4EBL A;  1Q2Q A;  2C6W B;  3M2K A;  1YLW A;  3NC8 A;  2ZQ9 A;  4S2M A;  1IYS A;  2WZZ A;  4N92 A;  1PW1 A;  5E2G A;  1ERO A;  3NDG A;  1K54 A;  5CEB A;  5G18 A;  2Y2I A;  1KVM A;  2Y59 A;  4U0T A;  2A49 A;  4OVD A;  3G4P A;  3UN7 A;  1QMF A;  4ID4 A;  4OOL A;  2XF3 A;  3MKE A;  2Y2O A;  4X56 A;  1ZC2 A;  1GHM A;  1LI9 A;  3PBT A;  1LI0 A;  4XUZ A;  1PWC A;  2C5W B;  4DDS A;  2WKI A;  3UNW A;  3ZVT A;  2WKE A;  1DJC A;  1ES2 A;  3UPN A;  3M6B A;  3RXW A;  2Y2M A;  5M18 A;  5M1A A;  1GA9 A;  2Y91 A;  3Q7Z A;  4P85 A;  4KG2 A;  4WEJ A;  1IEL A;  4P6B A;  3UPP A;  1KE4 A;  3LY3 A;  2VGK A;  2Q9N A;  5CTN A;  1MBL A;  3C4P A;  3MXR A;  5FA7 A;  2XEP A;  3IHB A;  5E2F A;  2Y2G A;  1MKI A;  1NYY A;  3GMW A;  2R9W A;  5E2E A;  4E3I A;  4X69 A;  4EQI A;  3OCL A;  4U3T A;  4X68 A;  4WEL A;  1JWV A;  4BD0 A;  3MZF A;  1G6A A;  2JCH A;  3PBQ A;  3I7J A;  1L0G A;  2OV5 A;  3ZG9 B;  2WGI A;  4A5R A;  3IF6 B;  4E3L A;  5HAP A;  3BFC A;  3NDE A;  3NY4 A;  2JBF A;  5FAQ A;  1ERQ A;  5F83 A;  3LEZ A;  3GR2 A;  4KZ8 A;  3IWQ A;  3JYI A;  2WKH A;  5DVA A;  1RGY A;  1CK3 A;  1H5X A;  2IWD A;  3HUM A;  5HAQ A;  2PBY A;  5CHU A;  4LV2 A;  3UE1 A;  1ERM A;  1I5Q A;  1IYP A;  4BQM A;  1RP5 A;  3IQA A;  2ZC4 B;  4UHU A;  4WYY A;  1LL5 A;  4JXS A;  2J9P A;  4FH2 A;  1NRF A;  1YMS A;  2Y2P A;  2ZLY A;  3M6H A;  3P98 A;  3LY4 A;  4R4R A;  4X53 A;  5AQ7 A;  1I2W A;  4R3J A;  3ZGA B;  4OQG A;  4Y0O A;  2RL3 A;  2ZQ7 A;  3C7V A;  1MY8 A;  3IXG A;  3ZDJ A;  2CC1 A;  4M3K A;  2P9V B;  3GRJ A;  2IWC A;  1FR1 A;  5A93 A;  2XGN A;  5HFO A;  3W4P A;  4C75 A;  4GZB A;  3MXS A;  1EI5 A;  4KEN B;  4PM5 A;  4E3O A;  1M40 A;  3ZG8 B;  4IVI A;  1MPL A;  2Y55 A;  4GD8 A;  4S2O A;  2Z2L B;  1BLH A;  2QPN A;  3SS5 A;  1VQQ A;  4QHC A;  1NYM A;  3B3X A;  4RA7 A;  1FSW A;  1K6R A;  4R1G A;  3IH8 A;  3IXH A;  3OPP A;  3IWO A;  2VGJ A;  2XK1 A;  2WGW B;  3IF6 A;  4KZ9 A;  2J7V A;  3A3F A;  3Q81 A;  5F1G A;  1GHI A;  3UE3 A;  5E43 A;  1K54 C;  3G35 A;  4B4Z A;  5GHY A;  1PI5 A;  1KE0 A;  5F82 A;  3RXX A;  4RYE A;  2Y2L A;  2XFT A;  1E4D A;  4OH0 A;  5GLB A;  2PU4 A;  3W4Q A;  1PI4 A;  4CPK A;  4OLD A;  2PU2 A;  4N1H A;  5AQA A;  1MXO A;  2Y2H A;  3CMZ A;  4GNU A;  4FCF A;  3S4X A;  1HTZ A;  1XX2 A;  5HW3 A;  4O7D A;  1RCJ A;  1W8Y A;  2GDN A;  2X71 A;  1K25 A;  3HLF A;  4PMA A;  2ZQA A;  4WM9 A;  3TSG A;  4F94 A;  1IYQ A;  2ZD8 A;  1E25 A;  3A3D A;  3FZC A;  3ZNY A;  5JYO A;  1BLS A;  3HUO A;  3WRZ A;  4OP5 A;  3OPR A;  4QD4 A;  2P9V A;  4OOM A;  5EVI D;  5AQB A;  1MWR A;  2XD1 A;  2ZM2 A;  3BFF A;  5CEC A;  2ZQC A;  3N8R A;  4LV0 A;  1CI9 A;  3Q7V B;  4EBP A;  1FSY A;  3O88 A;  3UDF A;  1JTD A;  1ONH A;  5CED A;  5GLD A;  1ZG6 A;  4E6X A;  3OPH A;  4OP8 A;  2B5R A;  5CTM A;  5HL1 A;  4LCM A;  4JF6 A;  2XD5 A;  1XKZ A;  3IWI A;  3O86 A;  4P87 A;  1NZO A;  3E2L A;  4DRT A;  4BL2 A;  3BM6 A;  2V2F F;  5FAS A;  2QMI A;  1AXB A;  4ZJ3 A;  2JE5 A;  4MBH A;  4Z9Q A;  1BLC A;  2WGW A;  1YT4 A;  3Q07 A;  1SCW A;  5FI6 A;  4KQQ A;  3RJU A;  4OPR A;  1BSG A;  2A3U A;  3PBR A;  4N1X A;  3S22 A;  3UDX A;  3HBR A;  1M6K A;  2EX6 A;  5FQI A;  4MLL A;  3VSL A;  3GTC A;  1FR6 A;  3EQV A;  3SH8 A;  4GB7 A;  1BLP A;  4GKU A;  4KG6 A;  2HPB A;  1FCM A;  3FV7 A;  3IF5 A;  4KZB A;  3VP3 A;  2DCF A;  2Z2M B;  1Z6F A;  3MZD A;  3LO7 A;  4OON A;  4U0X A;  4YFM A;  4DDY A;  5GLC A;  1SHV A;  5EVL A;  3BRM A;  5FAP A;  2BLS A;  1PIO A;  2WUQ A;  3MBZ A;  1XA1 A;  1JWP A;  3BLS A;  3E2K A;  3Q7V A;  5FI2 A;  1KDS A;  4KZ6 A;  5J8X A;  5DTT A;  1DJA A;  1MWT A;  4GD6 A;  5EOE A;  1S6R A;  1FOF A;  3AGD A;  3IF6 C;  4LCL A;  5FAO A;  1YLZ A;  1K56 A;  1SDE A;  1ES5 A;  3PTE A;  4S2N A;  3ZVW A;  4LEN A;  4C6Y A;  5KSH A;  3GSG A;  4ZAM A;  3S1Y A;  3VOZ A;  4IED A;  1NJ4 A;  2XR0 A;  5IHV A;  4DE0 A;  2E8I A;  4QY5 A;  3NBL A;  1XA7 A;  4ZBE A;  1XPB A;  1BTL A;  4FH4 A;  1ZKJ A;  4YIN A;  4OQH A;  5U47 A;  5CRF A;  4Y0T A;  3GV9 A;  4D2O A;  4EV4 A;  3WS4 A;  5DF8 A;  4EWF A;  4X6T A;  1IKI A;  2RCX A;  4OOY A;  4NK3 A;  4NET A;  5DTS A;  1HD8 A;  3UPO A;  3GVB A;  3PBS A;  1N4O A;  2HP9 A;  4DF6 A;  2X01 A;  4EBN A;  1L0F A;  4S2I A;  5HX9 A;  2H10 A;  3LCE A;  4DE1 A;  4R23 A;  4JXW A;  4WEK A;  1K6S A;  3ITA A;  5GL9 A;  2FFY A;  1YLY A;  3HLG A;  2ZJ9 A;  3PBO A;  5E2H A;  4GDB A;  5DF9 A;  2DNS A;  3GQZ A;  3MKF A;  1PW8 A;  1KVL A;  4RX2 A;  4WMC A;  2UWX A;  3IHA A;  2ZQD A;  4KZ5 A;  4ZJ2 A;  1W7F A;  3WS1 A;  5BOH A;  4N9L A;  3ISG A;  3NIA A;  1H8Z A;  1DY6 A;  1NXY A;  1XGI A;  4UA9 A;  2WAD A;  5EE8 A;  1PZO A;  2EXB A;  2HDU A;  2V20 A;  4HEF A;  1N9B A;  4K91 A;  1JWZ A;  4KZ3 A;  5HAI A;  4B88 A;  1QME A;  1CI8 A;  3VP0 A;  4E6W A;  1K55 A;  1YLP A;  4WZ5 A;  3UY6 A;  3FKV A;  4PPR A;  3FYZ A;  2J9O A;  1E3U A;  5CGW A;  1W5D A;  5CGX A;  3BFG A;  3QNC A;  5A92 A;  1HVB A;  4Y7P A;  1PZP A;  2EX8 A;  4JF4 A;  1O7E A;  4BD1 A;  2BG1 A;  3N8L A;  1K57 A;  3G2Y A;  3BEC A;  3WS5 A;  1BT5 A;  3V3R A;  3V50 A;  2EFX A;  1YQS A;  5CXW A;  4OQI A;  5FQ9 A;  4BJP A;  4DE3 A;  5EPH A;  2Y2N A;  5AQ9 A;  4QJG A;  4UA7 A;  3SS3 A;  3SOI A;  5CER A;  2HP5 A;  5GHX A;  5FI7 A;  3G32 A;  4JXV A;  4DE2 A;  4C3Q A;  3DW0 A;  1IKG A;  1WYB A;  3N7W A;  2H0T A;  4MNR A;  4MBK A;  3DTM A;  4OPZ A;  3VP4 A;  4KG5 A;  3FWL A;  3G34 A;  2Q9M A;  1YM1 A;  1GHP A;  4S2J A;  1XP4 A;  3OCN A;  2Y2J A;  4S2N C;  5FQK A;  5HAR A;  1ESU A;  4JF5 A;  5JYP A;  2Y4A A;  1O07 A;  1PWD A;  4PM7 A;  3ZCZ A;  5FQM A;  1KGE A;  3V3S A;  1YLT A;  5EUA A;  3G30 A;  4PM6 A;  4QB8 A;  2EX2 A;  1TEM A;  4OQ0 A;  5FAT A;  1S0W A;  2DRW A;  2ZM8 A;  2QZ6 A;  5L2F A;  5FQJ A;  1W8Q A;  4BLM A;  1WE4 A;  1RGZ A;  4ZJ1 A;  4UAA A;  1SDN A;  3VP1 A;  1BUE A;  2WAF A;  5CHJ A;  4OLG A;  4Q8I A;  1H8Y A;  2XFS A;  3PAG A;  2I72 A;  5A91 A;  2G2U A;  1MWU A;  2XDM A;  4S2K A;  1K4F A;  3C5A A;  3EQU A;  4LV1 A;  3N8S A;  3SS4 A;  3HLC A;  3IH9 A;  1G68 A;  4IBR A;  2OLU A;  3UE0 A;  3ZNT A;  1OME A;  4HBT A;  5FQQ A;  1XXM A;  4DXB A;  4CJN A;  1DJB A;  4DKI A;  2XLN A;  3ZG0 A;  4OPY A;  2X02 A;  3CG5 A;  2H0Y A;  1KGF A;  2WK0 A;  4R3B A;  2XH9 A;  1KDW A;  2WAE A;  1IYO A;  1L2S A;  4KZ4 A;  1J9M A;  4WZ4 A;  3HLB A;  3D4F A;  2HDR A;  5EVI B;  1PYY A;  4E3M A;  1ES3 A;  1EWZ A;  4BL3 A;  2G2W A;  3O87 A; 
#chains in the Genus database with same CATH topology
 3BLM A;  4JKT A;  1YMX A;  3H82 B;  4QU3 A;  1MKM A;  1OJG A;  1FQG A;  1WYC A;  4NKP A;  1OJ5 A;  3VSK A;  1ESI A;  1C3B A;  3LIC A;  1K38 A;  5KZH A;  1BZA A;  3W4O A;  2IA2 A;  1VEU B;  2IWB A;  1JVJ A;  4LRY C;  3P01 A;  1LL9 A;  3LR0 A;  1KOU A;  5DFX A;  3DWZ A;  3ZG5 A;  5LBR A;  4IVK A;  2EXA A;  3HRE A;  3WS0 A;  3LI8 A;  5DTK A;  1TVF A;  3ZYT A;  4H8R A;  3VFF A;  3WS2 A;  3VOY A;  1OTD A;  2WZX A;  1VM1 A;  3FC7 A;  4GOG A;  4R70 A;  2W3D A;  3BFD A;  3ZFZ A;  2D02 A;  4WMC D;  2WYX A;  2Y2K A;  2HDS A;  4JLF A;  3VMA A;  1BUL A;  5F68 A;  3P09 A;  4ZTK A;  5TGF A;  3QNB A;  1NY0 A;  3OC2 A;  4LFU A;  1PWG A;  4XXR A;  3MQ0 A;  5FDH A;  3N4I A;  4OKP A;  1GCE A;  4R3A A;  5CHM A;  1HZO A;  1D7E A;  1JTG A;  4EEU A;  3HVF A;  4EBL A;  2EA9 A;  1Q2Q A;  2WKR A;  1ERO A;  3T1S A;  2A49 A;  3UN7 A;  4OOL A;  3QP5 A;  1GHM A;  2HJ9 C;  4KUK A;  1LI0 A;  4XUZ A;  3R7W B;  2J3T C;  5TBM B;  3HCY A;  4DDS A;  2WKI A;  3M6B A;  2O9C A;  4R6L A;  4P85 A;  4WEJ A;  2VGK A;  1MBL A;  1ZHH B;  1XFN A;  3VE3 A;  3OCL A;  2M1C A;  4BD0 A;  1G6A A;  1L0G A;  2OV5 A;  1OT9 A;  1YKD A;  3BFC A;  3LEZ A;  3GR2 A;  1VHM A;  5DVA A;  1CK3 A;  1H5X A;  3HUM A;  3UE1 A;  2V0W A;  2V0U A;  4BQM A;  4UHU A;  4X1L A;  2ZLY A;  4R4R A;  4IHQ A;  5AQ7 A;  1I2W A;  3KYE A;  3ZGA B;  4Y0O A;  3C7V A;  2ZQ7 A;  3CPT A;  3IXG A;  3ZDJ A;  3IX3 A;  2IWC A;  5A93 A;  3W4P A;  3O5Y A;  3E98 A;  3F1P B;  4E3O A;  3MF0 A;  4IVI A;  1BLH A;  3TE8 A;  2A24 A;  4MN5 A;  1FSW A;  3DTK A;  1K6R A;  4YNR A;  4FUW A;  3IH8 A;  1MZU A;  4HQA A;  1V9Y A;  3Q81 A;  1P9R A;  4B4Z A;  2YKF A;  3T50 A;  3RXX A;  4GJ4 A;  4RYE A;  3UME A;  4F3L B;  2XFT A;  2VV8 A;  4NXF A;  5GLB A;  1LSW A;  5HDC A;  4JGP A;  4CPK A;  4N1H A;  1MXO A;  2Y2H A;  1UWP X;  2VKS A;  1XX2 A;  2X71 A;  4WM9 A;  4I3J A;  2ZQA A;  2ZD8 A;  3IS2 A;  3E4O A;  4OP5 A;  3LR4 A;  3OPR A;  5EVI D;  3HJK A;  1MWR A;  3BFF A;  2VJW A;  5CED A;  3OPH A;  1G28 A;  3KSI A;  3BQ8 A;  1XKZ A;  4ARZ A;  1AXB A;  3NHQ A;  3E4Q A;  4LRZ E;  1W63 Q;  4EXO A;  4LLO B;  2A3U A;  3S22 A;  3HJI A;  2M7V A;  1P97 A;  3ICY A;  3GEC A;  4MLL A;  3SH8 A;  4GB7 A;  5G4Y A;  4GKU A;  4KG6 A;  2HPB A;  1Z6F A;  5L8M A;  3MZD A;  1P9W A;  4OON A;  4P6Z S;  5DFY A;  3BRM A;  4I3A A;  3R4K A;  3MBZ A;  2PD7 A;  3FPW A;  3Q7V A;  5DTT A;  3LFV A;  4GD6 A;  1Z09 A;  4GS9 A;  3MMH A;  3MQO A;  1FIL A;  1XJ4 A;  2FZ0 A;  4C6Y A;  1YSP A;  5J3W A;  4HNB A;  4X25 A;  2XR0 A;  5IHV A;  1XA7 A;  1H8M A;  4GCZ A;  1XPB A;  1T1B A;  1ZKJ A;  4OQH A;  5EFW A;  4Y0T A;  1HD8 A;  3V67 A;  4DF6 A;  1FIK A;  4EBN A;  2KLI A;  1L0F A;  4WEK A;  2ZJ9 A;  2DNS A;  1PW8 A;  1KVL A;  2ZQD A;  5BOH A;  4X1M A;  3ISG A;  5HZH A;  2V1B A;  2VV7 A;  1H8Z A;  4HEF A;  1JWZ A;  4E6W A;  1YLP A;  4WZ5 A;  3UY6 A;  3FKV A;  2XA7 S;  2J9O A;  4EQ1 A;  4Y7P A;  4JF4 A;  3D9Y A;  2BG1 A;  3LIB A;  1BT5 A;  3A0S A;  3V3R A;  1YQS A;  2W27 A;  3LUQ A;  4DE3 A;  2ZL1 B;  4HP9 A;  2Y2N A;  5AQ9 A;  5IU1 A;  3SS3 A;  5CER A;  5GHX A;  4C3Q A;  5IT5 A;  3N7W A;  4OPZ A;  1G5U A;  4LPZ A;  3FWL A;  1GSW A;  1YM1 A;  3OCN A;  2Y2J A;  4S2N C;  5F5Y A;  1ESU A;  1PWD A;  1N9L A;  4IJG A;  2PD8 A;  2NUP C;  4OQ0 A;  4Y2F A;  1MC0 A;  2DRW A;  2QZ6 A;  5FQJ A;  3UB6 A;  4NXB A;  4O0P A;  1SDN A;  3VP1 A;  2WAF A;  3SZT A;  4OLG A;  1H8Y A;  5HL6 A;  3PAG A;  2I72 A;  5A91 A;  2XDM A;  4S2K A;  1OTA A;  4IBR A;  1OME A;  4HBT A;  4Y3I A;  1HLU P;  4CJN A;  4DKI A;  3H9W A;  3CG5 A;  2J3W A;  1IYO A;  1PYY A;  1S1Y A;  3O87 A;  1K55 C;  5I94 A;  3WWX A;  3UDI A;  3N6I A;  2HP6 A;  3G31 A;  1ES4 A;  2FFF B;  4G3W A;  1TDL A;  3HLE A;  4UA6 A;  4N9K A;  4HH3 A;  5FSR A;  1T19 A;  2VGL M;  2Y2Q A;  4GN2 A;  4MBF A;  4CLC A;  4RVA A;  4EUV A;  1CEF A;  1K56 D;  1H0M A;  1OTE A;  2P08 A;  1OPX A;  3HUN A;  5D3O A;  4IBX A;  4NEE D;  4L0L A;  3C7U A;  2R9X A;  3CIT A;  3NCK A;  3UO9 A;  4LV3 A;  3LR3 A;  1GA0 A;  5A90 A;  1S67 L;  5TFQ A;  2H5S A;  2OLV A;  1ZTU A;  3T1R A;  5HWW A;  3OOV A;  3M2J A;  5AJG A;  3Q82 A;  3U4L P;  4G3V A;  3O3V A;  1LHY A;  3K3D A;  5EM1 A;  5HPI A;  1IEM A;  4B4X A;  4JPM A;  1YAX A;  4UEY A;  3AGF A;  3C8C A;  2HDQ A;  1W63 M;  5KSC A;  4QY6 A;  3W8K A;  3IXB A;  3SH9 A;  4S2P A;  5EOO A;  4KQO A;  3NOT C;  2PAV P;  1Q2P A;  2G7U A;  3S7N A;  2ZQ8 A;  3MFD A;  2DMW A;  1PFL A;  1MWS A;  4BEN A;  2OOL A;  3OZH A;  4X55 A;  1JNU A;  2V1Z A;  4PKY G;  3QP8 A;  1KE3 A;  3AGE A;  4E3K A;  4DJ2 A;  1LLB A;  1FCN A;  2C6W B;  1YLW A;  3NC8 A;  2JKR M;  4N92 A;  1TS0 A;  1K54 A;  2Y59 A;  3VV4 A;  4OVD A;  2FH5 A;  2XF3 A;  3PYP A;  2EWW A;  4IUH A;  3OLO A;  4HOI A;  1LI9 A;  3PBT A;  3CPT B;  2C5W B;  3UNW A;  3UPN A;  2Y2M A;  5M1A A;  1GA9 A;  1L3L A;  2VZW A;  4KG2 A;  4P6B A;  3MSH A;  4I5S A;  3T4Q A;  5FA7 A;  5E2F A;  1XJ3 A;  3GMW A;  5E2E A;  4E3I A;  4X69 A;  2A24 B;  3UMD A;  4MDZ A;  4BBU A;  2W3F A;  2JCH A;  3RH8 B;  3ZG9 B;  4A5R A;  2OAQ 1;  2JBF A;  1ERQ A;  3FG8 A;  3IWQ A;  4HHD A;  3F1O B;  1RGY A;  2IWD A;  5CX7 A;  4WF0 A;  2PBY A;  5CHU A;  3CAX A;  1V9Z A;  1RP5 A;  2ZC4 B;  4HP4 A;  4JXS A;  2Y2P A;  3CWF A;  1LL8 A;  4R3J A;  3IS2 B;  2RL3 A;  4M3K A;  2XGN A;  4KEN B;  4EES A;  3ZG8 B;  1MPL A;  1J3W A;  5HDS A;  3SS5 A;  1VQQ A;  3KSH A;  2J3T D;  4R1G A;  3FPV A;  2VGJ A;  2XK1 A;  3IF6 A;  4KZ9 A;  2J7V A;  3A3F A;  3UE3 A;  3G35 A;  5GHY A;  5F82 A;  4OH0 A;  4H6J A;  2PU4 A;  1PI4 A;  3LR5 A;  4GNU A;  2JKF A;  3S4X A;  1HTZ A;  3TRC A;  4NG2 A;  1IYQ A;  3KSF A;  3FZC A;  3ZNY A;  4QD4 A;  2P9V A;  4OOM A;  5HDD A;  5AQB A;  3CUE A;  3Q7V B;  2KDK A;  1JTD A;  3UDF A;  1ZG6 A;  4E6X A;  3QP6 A;  1OT6 A;  4GS9 B;  5HL1 A;  4JF6 A;  4GLQ A;  3IWI A;  1NZO A;  5FAS A;  1F2K A;  1UGU A;  5J4E A;  3Q07 A;  1SCW A;  4L9G A;  4OPR A;  4IUK A;  1M6K A;  3GTC A;  3EQV A;  3KO6 A;  2PYR A;  3FV7 A;  3VP3 A;  2DCF A;  3LO7 A;  5G4Z A;  4DDY A;  5EVL A;  3KYQ A;  4CQH A;  3DAV A;  5FAP A;  2BLS A;  2WUQ A;  1XA1 A;  4HJ3 A;  5FDS A;  5A8B A;  3NJA A;  5J8X A;  4O01 A;  5EOE A;  3T4K A;  5TJJ A;  5FAO A;  1NRJ A;  1SDE A;  1ES5 A;  3ZVW A;  5KSH A;  3C30 A;  4IED A;  1NJ4 A;  2QYB A;  3ULF A;  4DE0 A;  2E8I A;  1WA9 A;  2PR5 A;  1IFQ A;  2D01 A;  4ETZ A;  2Y79 A;  4EV4 A;  4ME4 A;  3WS4 A;  1SZV A;  4NK3 A;  4NET A;  5DTS A;  2J80 A;  2PT7 A;  3UPO A;  4EU0 A;  3MXQ A;  3LCE A;  4R23 A;  1VET A;  4ETX A;  4GDB A;  5DF9 A;  3JPU A;  5I5L A;  4WMC A;  5MC7 A;  1W7F A;  1BYW A;  4UA9 A;  1NXY A;  3F1N A;  2VK3 A;  2WAD A;  3LYX A;  2EXB A;  2V20 A;  5HAI A;  1N9B A;  4B88 A;  3VP0 A;  1CI8 A;  1OTI A;  5CGX A;  4PHT A;  1O7E A;  4BD1 A;  3N8L A;  1K57 A;  2BTF P;  3B42 A;  3WS5 A;  4Q0J A;  2VV6 A;  2JKT I;  2EFX A;  5CXW A;  4HJ6 A;  5C5K A;  4OQI A;  5DKL A;  5FQ9 A;  3IX4 A;  3EEA A;  4QJG A;  2XRN A;  3QP2 A;  3G32 A;  4JXV A;  4DE2 A;  3DW0 A;  1IKG A;  1WYB A;  2H0T A;  4HIA A;  4KG5 A;  2AVX A;  5AVE A;  3T4T A;  4S2J A;  1YPR A;  4JF5 A;  1O07 A;  3ZCZ A;  4GHI A;  3V3S A;  1YLT A;  3KYZ A;  4B9O A;  1NLY A;  3G30 A;  2WKQ A;  2K31 A;  5L2F A;  2XA7 M;  4CLC B;  1RGZ A;  4ZJ1 A;  4WLA A;  4II7 A;  5K5B A;  4HH2 A;  5EM0 A;  5FEG A;  2G2U A;  1MWU A;  1K4F A;  4LV1 A;  3HLC A;  3UE0 A;  3ZNT A;  3L9K A;  5FQQ A;  4DXB A;  3EGX C;  1DP6 A;  1T18 A;  2XLN A;  3ZG0 A;  3LEQ A;  1KGF A;  4JGO A;  2XH9 A;  1KDW A;  2KOI A;  4KZ4 A;  4LGW A;  4U3T A;  4BL3 A;  3V39 A;  4WZ5 C;  2W0N A;  5F6A A;  2ZMV A;  3CLO A;  5M19 A;  4E3N A;  3T4L A;  2VLG A;  5EVI C;  4EW7 A;  3VP2 A;  1TDG A;  1X0O A;  3ITB A;  3DWK A;  3EEH A;  1W79 A;  3C38 A;  4PM9 A;  4R38 A;  3H7W A;  4RX3 A;  5DF7 A;  2V8C A;  3HL9 A;  4KZ7 A;  3SH7 A;  4HES A;  3OPL A;  3BJN A;  3MZE A;  4R4S A;  4HI4 A;  1Y54 A;  1SKO A;  3PAE A;  1VB6 A;  4MEZ A;  3G2Z A;  4DXC A;  4E3J A;  4JGR A;  1L0D A;  4XUX A;  5EVI A;  3V5M A;  4ZDX A;  3C4O A;  4HBU A;  1NLZ A;  4FTX A;  2ZC7 A;  2ZC5 B;  2ZM0 A;  3BFE A;  4K0X A;  3BEB A;  2P04 A;  4P0M A;  2KX6 A;  4EUZ A;  3LIE A;  1E3U D;  3T1X A;  3T1Q B;  3IT9 A;  1LSX A;  4FD8 A;  5HD3 A;  4G3K A;  3HLW A;  5GLA A;  3F1P A;  4JBF A;  3ZG7 B;  2PHY A;  1U60 A;  1S4S A;  1TS7 A;  1SKF A;  4FSF A;  2PR6 A;  3T4O A;  1S66 L;  2ZQ9 A;  4S2M A;  2A2L A;  1PW1 A;  1LT0 A;  5IS1 A;  3NEC A;  1QMF A;  4ID4 A;  3MKE A;  2JHE A;  2O9B A;  4KQD A;  1PWC A;  3UB8 A;  1DJC A;  4CLC C;  1ES2 A;  1H3Q A;  5M18 A;  1N9N A;  4F3L A;  3Q7Z A;  1IEL A;  2HZ5 A;  3LY3 A;  5CTN A;  3C4P A;  2O9A A;  3IHB A;  2Y2G A;  1NYY A;  2R9W A;  3BY8 A;  2GX5 A;  4WEL A;  3MZF A;  5EVE A;  3I7J A;  2WGI A;  3IF6 B;  3MR0 A;  3RFB A;  5HAP A;  3IX8 A;  4WN5 A;  3NDE A;  5F83 A;  4KZ8 A;  3JYI A;  2WKH A;  2W3G A;  1Y28 A;  1LSV A;  1I5Q A;  1IYP A;  4H6J B;  4FH2 A;  1F9I A;  1K0K A;  1NRF A;  1YMS A;  2QKP A;  3LY4 A;  3T12 B;  2R78 A;  2P9V B;  3GRJ A;  1DP8 A;  2HV1 A;  1FR1 A;  5HFO A;  1T1C A;  3MXS A;  4PM5 A;  5HPF A;  1M40 A;  5FL3 A;  3MS6 A;  1GSX A;  2Y55 A;  4S2O A;  2BAS A;  3VE4 A;  4QHC A;  4RA7 A;  1UWN X;  2O0Y A;  3OPP A;  4ZRR A;  3UB9 A;  2W3E A;  2QJ7 A;  3OBF A;  5DJT A;  1GHI A;  1TS8 A;  5E43 A;  2L1M A;  1K54 C;  1PI5 A;  1KE0 A;  4D60 A;  2EWV A;  1DRM A;  4XT2 A;  1E4D A;  4O8G A;  3W4Q A;  4OLD A;  5AQA A;  4PAU A;  4FCF A;  3TW8 A;  5HW3 A;  4O7D A;  1RCJ A;  1W8Y A;  3HLF A;  4PMA A;  5F69 A;  3TSG A;  1E25 A;  3A3D A;  1BLS A;  3HUO A;  3WRZ A;  3LID A;  1TS6 A;  2XD1 A;  4WL9 A;  3N8R A;  4BWI A;  1ONH A;  5GLD A;  5CTM A;  3GDI A;  4LCM A;  3RTY A;  1S1Z A;  2NUT C;  2XD5 A;  2Z6C A;  2XRO A;  3KSG A;  4DRT A;  4BL2 A;  3BM6 A;  2V2F F;  2JE5 A;  4MBH A;  1BLC A;  2WGW A;  2ZBB A;  5HSQ A;  1YT4 A;  1G6O A;  1XFQ A;  3RJU A;  2PRF A;  5FEF A;  1BSG A;  5L10 A;  4N1X A;  4I39 A;  4Q0I A;  4CLC E;  3A0R A;  1BLP A;  1VET B;  2H28 A;  1FCM A;  3IF5 A;  4KZB A;  2Z2M B;  4YFM A;  2UV0 E;  1ODV A;  5HWV A;  1YSQ A;  4KUO A;  1EW0 A;  4ESP A;  1JWP A;  1F5M A;  4KZ6 A;  3F1N B;  1DJA A;  1MWT A;  4NXG A;  4BBV A;  1FOF A;  4EET B;  3IF6 C;  1YLZ A;  1K56 A;  4LEN A;  3VOZ A;  4Y13 A;  2M7U A;  4ZBE A;  2INW A;  4YIN A;  5U47 A;  3GV9 A;  3D3O A;  2V9A A;  5DF8 A;  2VA0 A;  4OOY A;  3K3C A;  3PBS A;  1N4O A;  2HP9 A;  4E04 A;  5HX9 A;  5L07 A;  2H10 A;  4K08 A;  3ITA A;  3CUE C;  5GL9 A;  4ARZ B;  3GQZ A;  2UWX A;  3IHA A;  4ZJ2 A;  4KZ5 A;  3WS1 A;  1XGI A;  1DY6 A;  5EE8 A;  5HWT A;  2HDU A;  3KX0 X;  4GHI B;  1P0Z A;  3NOP C;  4PPR A;  1N9O A;  1W5D A;  3BFG A;  3NOU C;  3QNC A;  2EX8 A;  3G2Y A;  3BEC A;  2OAP 1;  3DTI A;  3V50 A;  2VX8 A;  4UQI S;  2ZMF A;  4UA7 A;  4RQ9 A;  2HP5 A;  3UE6 A;  3MQQ A;  4MNR A;  2B02 A;  3VP4 A;  3E4P A;  1GHP A;  5FQK A;  3LIA A;  5JYP A;  2Y4A A;  5DKK A;  4PM7 A;  2XSS A;  1KGE A;  5EUA A;  1TEM A;  5FAT A;  2ZM8 A;  1W8Q A;  4BLM A;  3H7W B;  4UAA A;  1BUE A;  5CHJ A;  4B93 A;  3D72 A;  3T4J A;  3UB5 P;  3C5A A;  3EQU A;  3WRT A;  2B18 A;  2W1T A;  3S7P A;  1SKO B;  1XXM A;  3IBR A;  5HD5 A;  4OPY A;  2Y8H A;  2H0Y A;  2WK0 A;  4R3B A;  2WAE A;  3CHW P;  3HLB A;  5EVI B;  4E3M A;  1ES3 A;  1EWZ A;  2G2W A;  3CI6 A;  3IXD A;  4HJ4 A;  2OSU A;  3LIF A;  4Y0U A;  4WBG A;  5CGS A;  1L0E A;  1K57 C;  2ZC6 B;  2J8Y A;  3CJM A;  4K0W A;  1D1J A;  2GZA A;  3TJZ C;  4KQR A;  3A3J A;  1NZU A;  3JVV A;  2WGV A;  1XGJ A;  3HLD A;  3VFH A;  2GJ3 A;  5EV0 A;  4JXG A;  3Q1F A;  3FKW A;  2JKT M;  3P7N A;  1ONG A;  4P6Z M;  2Q0O A;  1I2S A;  4KZA A;  3QP4 A;  2QWS A;  4OPQ A;  2EX9 A;  1NWZ A;  2LB9 A;  2XQZ A;  1CEG A;  3BYD A;  3T4S A;  4S2L A;  5GHZ A;  4YOF A;  3TG9 A;  3W2Z A;  3PBN A;  4MN7 A;  1YLJ A;  3QHY A;  4GDN A;  3NI9 A;  4I38 A;  3A3E A;  3H82 A;  1FCO A;  3ZHH A;  5TR7 A;  5F1F A;  3PHY A;  3B33 A;  3F1O A;  1K4E A;  3CZD A;  1XJ2 A;  2HF6 A;  3NUL A;  3A3I A;  3LI9 A;  2OWH A;  5KMW A;  4R0Q A;  5EEC A;  3TOI A;  2V8F A;  2P74 A;  1IOU A;  2JC7 A;  1VEU A;  1ALQ A;  2ZMA A;  4PM8 A;  3BY9 A;  2EFU A;  2ZC3 B;  3S7Q A;  1ZG4 A;  1KGG A;  1TF1 A;  3M2K A;  2JN7 A;  1IYS A;  2HJE A;  2WZZ A;  3EGD C;  5E2G A;  3NDG A;  5CEB A;  4Q0H A;  5G18 A;  2Y2I A;  1KVM A;  4U0T A;  3G4P A;  4WUJ A;  2Y2O A;  4X56 A;  1S4R A;  1ZC2 A;  2PDR A;  4AFI A;  2L4R A;  1STZ A;  3SW1 A;  2YKH A;  3BW6 A;  3ZVT A;  2WKE A;  3A0V A;  3RXW A;  3LGO A;  4DJ3 A;  3B47 A;  2Y91 A;  3UPP A;  1KE4 A;  2Q9N A;  3MXR A;  2XEP A;  2MJ6 A;  1MKI A;  4HY8 A;  4MCW A;  4EQI A;  4M4X A;  2Z6D A;  4X68 A;  1JWV A;  4L9F A;  2B95 A;  3PBQ A;  4E3L A;  3NY4 A;  5FAQ A;  5HAQ A;  3C2W A;  3QP1 A;  3JVU A;  4LV2 A;  1ERM A;  4XT2 B;  3IQA A;  4WYY A;  1LL5 A;  1ACF A;  2J9P A;  3M6H A;  2ZOH A;  3P98 A;  4YWZ A;  4X53 A;  5J7E A;  3G6O A;  4OQG A;  2ACG A;  3R7W A;  5TBM A;  1XJ6 A;  3EOI A;  1MY8 A;  2CC1 A;  3PR6 A;  1D06 A;  4C75 A;  3U2A A;  4GZB A;  1EI5 A;  2JKG A;  2OWJ A;  4GD8 A;  2Z2L B;  2QPN A;  2GNX A;  1NYM A;  3B3X A;  2QJ5 A;  3MJQ A;  4GW9 A;  2HGV A;  2L0W A;  3IXH A;  2ZOI A;  3IWO A;  4CLC D;  1F98 A;  2WGW B;  4MMN A;  5F1G A;  3MFX A;  2Y2L A;  5AVF A;  1T1A A;  2PU2 A;  3CMZ A;  2GDN A;  1K25 A;  4F94 A;  5JYO A;  3DTE A;  2ZM2 A;  5CEC A;  2ZQC A;  4LV0 A;  1CI9 A;  4EBP A;  1FSY A;  3O88 A;  2W3H A;  3S7O A;  2VEA A;  4OP8 A;  2B5R A;  1A0K A;  2P7J A;  1Y4O A;  3O86 A;  3ZQ5 A;  4P87 A;  3E2L A;  2QMI A;  4ZJ3 A;  4Z9Q A;  3IBJ A;  5FI6 A;  4KQQ A;  4QPR A;  4DMZ A;  3PBR A;  3UDX A;  3HBR A;  4Y5F A;  2EX6 A;  5FQI A;  3VOL A;  3VSL A;  4JGQ A;  1FR6 A;  2K2N A;  3EWK A;  4U0X A;  2V1A A;  5GLC A;  3BWL A;  1SHV A;  1PIO A;  3E2K A;  3BLS A;  5FI2 A;  1KDS A;  1PRQ A;  1CQA A;  3E0Y A;  4QWO A;  1S6R A;  3AGD A;  3BQA A;  4LCL A;  4BBT A;  3PTE A;  4S2N A;  3GSG A;  4ZAM A;  3S1Y A;  2I9V A;  4BMW A;  4NXE A;  2QHK A;  4QY5 A;  3NBL A;  4DN0 A;  2K7S A;  1TD5 A;  1BTL A;  4FH4 A;  5DJU A;  5CRF A;  4D2O A;  4EWF A;  4X6T A;  1IKI A;  2RCX A;  5KIZ A;  3GVB A;  5L09 A;  1CF0 A;  2X01 A;  4S2I A;  3K2N A;  4DE1 A;  4JXW A;  1K6S A;  2PBD P;  2FFY A;  1YLY A;  3HLG A;  3PBO A;  4LRX C;  5E2H A;  1CJF A;  3MKF A;  4RX2 A;  4N9L A;  3NIA A;  4EER A;  1PZO A;  4K91 A;  2CMN A;  4KZ3 A;  1QME A;  1PNE A;  1K55 A;  3FYZ A;  1E3U A;  5CGW A;  5A92 A;  1HVB A;  1PZP A;  4I3I A;  2O99 A;  4BJP A;  2W1T B;  5EPH A;  4L9E A;  2PYP A;  3SOI A;  4FOF A;  5FI7 A;  2W1R A;  4Y17 A;  4MN6 A;  4MBK A;  2WKP A;  3DTM A;  3L7H A;  3G34 A;  2Q9M A;  1GSV A;  1XP4 A;  5HAR A;  5FQM A;  2VGL S;  4PM6 A;  4QB8 A;  2EX2 A;  1S0W A;  1WE4 A;  4Z1W A;  4PKY A;  4Y15 A;  2LB5 A;  1OTB A;  4Q8I A;  1AWI A;  2XFS A;  3DBA A;  4EEP A;  3SS4 A;  3N8S A;  3IH9 A;  1G68 A;  2OLU A;  2ZL1 A;  3UB7 A;  3PXP A;  4UQI M;  1DJB A;  2X02 A;  2E8J A;  2JKR I;  1DP9 A;  1L2S A;  1J9M A;  4WZ4 A;  3D4F A;  2HDR A; 
#chains in the Genus database with same CATH homology
 1K55 C;  4WZ5 C;  5I94 A;  3WWX A;  3BLM A;  3UDI A;  3IXD A;  5M19 A;  4JKT A;  4E3N A;  1YMX A;  2OSU A;  3N6I A;  4QU3 A;  2HP6 A;  4Y0U A;  3G31 A;  1ES4 A;  2FFF B;  5EVI C;  1TDL A;  3HLE A;  4WBG A;  5CGS A;  1L0E A;  1K57 C;  2ZC6 B;  2J8Y A;  3VP2 A;  1TDG A;  3CJM A;  4N9K A;  4UA6 A;  5FSR A;  1FQG A;  1WYC A;  2Y2Q A;  3DWK A;  3ITB A;  4GN2 A;  1W79 A;  4MBF A;  4K0W A;  4PM9 A;  3VSK A;  4KQR A;  4RVA A;  4RX3 A;  1ESI A;  1CEF A;  3A3J A;  1NZU A;  1C3B A;  2WGV A;  5DF7 A;  1K56 D;  1K38 A;  1XGJ A;  3HLD A;  5KZH A;  3VFH A;  3HL9 A;  3V39 A;  1BZA A;  4JXG A;  3W4O A;  3Q1F A;  3HUN A;  5D3O A;  4KZ7 A;  3FKW A;  1ONG A;  3SH7 A;  2IWB A;  1I2S A;  4IBX A;  4HES A;  1JVJ A;  4KZA A;  4L0L A;  3C7U A;  2R9X A;  3OPL A;  4OPQ A;  2EX9 A;  3MZE A;  1LL9 A;  4R4S A;  1Y54 A;  3WRT A;  2XQZ A;  3NCK A;  3UO9 A;  1CEG A;  3PAE A;  4LV3 A;  3BYD A;  1GA0 A;  5A90 A;  4MEZ A;  3G2Z A;  4S2L A;  5GHZ A;  5TFQ A;  2H5S A;  2OLV A;  4DXC A;  3DWZ A;  3ZG5 A;  4E3J A;  4IVK A;  1L0D A;  2EXA A;  3HRE A;  4XUX A;  3TG9 A;  3WS0 A;  5DTK A;  1TVF A;  3PBN A;  4H8R A;  5EVI A;  1YLJ A;  3VFF A;  3WS2 A;  3QHY A;  3VOY A;  3M2J A;  3V5M A;  4ZDX A;  3C4O A;  3Q82 A;  2WZX A;  4HBU A;  4GDN A;  1VM1 A;  3O3V A;  3NI9 A;  1LHY A;  3A3E A;  1FCO A;  3ZHH A;  1IEM A;  2ZC7 A;  5TR7 A;  4B4X A;  5F1F A;  4GOG A;  4JPM A;  1K4E A;  3BFD A;  3CZD A;  3ZFZ A;  3AGF A;  2HDQ A;  4WMC D;  5KSC A;  4QY6 A;  3W8K A;  2WYX A;  2Y2K A;  3A3I A;  3IXB A;  3SH9 A;  2HDS A;  4JLF A;  2ZC5 B;  3VMA A;  1BUL A;  4S2P A;  3P09 A;  5EOO A;  5KMW A;  2ZM0 A;  4KQO A;  4R0Q A;  5EEC A;  4ZTK A;  5TGF A;  1Q2P A;  3TOI A;  3QNB A;  3BFE A;  2ZQ8 A;  4K0X A;  3BEB A;  1NY0 A;  2P74 A;  3MFD A;  4P0M A;  4BEN A;  1MWS A;  2JC7 A;  3OC2 A;  4EUZ A;  1E3U D;  1PWG A;  1ALQ A;  3IT9 A;  4XXR A;  2ZMA A;  3OZH A;  4X55 A;  2V1Z A;  4FD8 A;  4PM8 A;  5FDH A;  3N4I A;  3HLW A;  1GCE A;  4OKP A;  2EFU A;  1KE3 A;  3AGE A;  5CHM A;  5GLA A;  1HZO A;  2ZC3 B;  4JBF A;  4E3K A;  3ZG7 B;  1LLB A;  1FCN A;  1JTG A;  1U60 A;  1SKF A;  1ZG4 A;  4FSF A;  1KGG A;  3HVF A;  4EBL A;  1Q2Q A;  2C6W B;  3M2K A;  1YLW A;  3NC8 A;  2ZQ9 A;  4S2M A;  1IYS A;  2WZZ A;  4N92 A;  1PW1 A;  5E2G A;  1ERO A;  3NDG A;  1K54 A;  5CEB A;  5G18 A;  2Y2I A;  1KVM A;  2Y59 A;  4U0T A;  2A49 A;  4OVD A;  3G4P A;  3UN7 A;  1QMF A;  4ID4 A;  4OOL A;  2XF3 A;  3MKE A;  2Y2O A;  4X56 A;  1ZC2 A;  1GHM A;  1LI9 A;  3PBT A;  1LI0 A;  4XUZ A;  1PWC A;  2C5W B;  4DDS A;  2WKI A;  3UNW A;  3ZVT A;  2WKE A;  1DJC A;  1ES2 A;  3UPN A;  3M6B A;  3RXW A;  2Y2M A;  5M18 A;  5M1A A;  1GA9 A;  2Y91 A;  3Q7Z A;  4P85 A;  4KG2 A;  4WEJ A;  1IEL A;  4P6B A;  3UPP A;  1KE4 A;  3LY3 A;  2VGK A;  2Q9N A;  5CTN A;  1MBL A;  3C4P A;  3MXR A;  5FA7 A;  2XEP A;  3IHB A;  5E2F A;  2Y2G A;  1MKI A;  1NYY A;  3GMW A;  2R9W A;  5E2E A;  4E3I A;  4X69 A;  4EQI A;  3OCL A;  4U3T A;  4X68 A;  4WEL A;  1JWV A;  4BD0 A;  3MZF A;  1G6A A;  2JCH A;  3PBQ A;  3I7J A;  1L0G A;  2OV5 A;  3ZG9 B;  2WGI A;  4A5R A;  3IF6 B;  4E3L A;  5HAP A;  3BFC A;  3NDE A;  3NY4 A;  2JBF A;  5FAQ A;  1ERQ A;  5F83 A;  3LEZ A;  3GR2 A;  4KZ8 A;  3IWQ A;  3JYI A;  2WKH A;  5DVA A;  1RGY A;  1CK3 A;  1H5X A;  2IWD A;  3HUM A;  5HAQ A;  2PBY A;  5CHU A;  4LV2 A;  3UE1 A;  1ERM A;  1I5Q A;  1IYP A;  4BQM A;  1RP5 A;  3IQA A;  2ZC4 B;  4UHU A;  4WYY A;  1LL5 A;  4JXS A;  2J9P A;  4FH2 A;  1NRF A;  1YMS A;  2Y2P A;  2ZLY A;  3M6H A;  3P98 A;  3LY4 A;  4R4R A;  4X53 A;  5AQ7 A;  1I2W A;  4R3J A;  3ZGA B;  4OQG A;  4Y0O A;  2RL3 A;  2ZQ7 A;  3C7V A;  1MY8 A;  3IXG A;  3ZDJ A;  2CC1 A;  4M3K A;  2P9V B;  3GRJ A;  2IWC A;  1FR1 A;  5A93 A;  2XGN A;  5HFO A;  3W4P A;  4C75 A;  4GZB A;  3MXS A;  1EI5 A;  4KEN B;  4PM5 A;  4E3O A;  1M40 A;  3ZG8 B;  4IVI A;  1MPL A;  2Y55 A;  4GD8 A;  4S2O A;  2Z2L B;  1BLH A;  2QPN A;  3SS5 A;  1VQQ A;  4QHC A;  1NYM A;  3B3X A;  4RA7 A;  1FSW A;  1K6R A;  4R1G A;  3IH8 A;  3IXH A;  3OPP A;  3IWO A;  2VGJ A;  2XK1 A;  2WGW B;  3IF6 A;  4KZ9 A;  2J7V A;  3A3F A;  3Q81 A;  5F1G A;  1GHI A;  3UE3 A;  5E43 A;  1K54 C;  3G35 A;  4B4Z A;  5GHY A;  1PI5 A;  1KE0 A;  5F82 A;  3RXX A;  4RYE A;  2Y2L A;  2XFT A;  1E4D A;  4OH0 A;  5GLB A;  2PU4 A;  3W4Q A;  1PI4 A;  4CPK A;  4OLD A;  2PU2 A;  4N1H A;  5AQA A;  1MXO A;  2Y2H A;  3CMZ A;  4GNU A;  4FCF A;  3S4X A;  1HTZ A;  1XX2 A;  5HW3 A;  4O7D A;  1RCJ A;  1W8Y A;  2GDN A;  2X71 A;  1K25 A;  3HLF A;  4PMA A;  2ZQA A;  4WM9 A;  3TSG A;  4F94 A;  1IYQ A;  2ZD8 A;  1E25 A;  3A3D A;  3FZC A;  3ZNY A;  5JYO A;  1BLS A;  3HUO A;  3WRZ A;  4OP5 A;  3OPR A;  4QD4 A;  2P9V A;  4OOM A;  5EVI D;  5AQB A;  1MWR A;  2XD1 A;  2ZM2 A;  3BFF A;  5CEC A;  2ZQC A;  3N8R A;  4LV0 A;  1CI9 A;  3Q7V B;  4EBP A;  1FSY A;  3O88 A;  3UDF A;  1JTD A;  1ONH A;  5CED A;  5GLD A;  1ZG6 A;  4E6X A;  3OPH A;  4OP8 A;  2B5R A;  5CTM A;  5HL1 A;  4LCM A;  4JF6 A;  2XD5 A;  1XKZ A;  3IWI A;  3O86 A;  4P87 A;  1NZO A;  3E2L A;  4DRT A;  4BL2 A;  3BM6 A;  2V2F F;  5FAS A;  2QMI A;  1AXB A;  4ZJ3 A;  2JE5 A;  4MBH A;  4Z9Q A;  1BLC A;  2WGW A;  1YT4 A;  3Q07 A;  1SCW A;  5FI6 A;  4KQQ A;  3RJU A;  4OPR A;  1BSG A;  2A3U A;  3PBR A;  4N1X A;  3S22 A;  3UDX A;  3HBR A;  1M6K A;  2EX6 A;  5FQI A;  4MLL A;  3VSL A;  3GTC A;  1FR6 A;  3EQV A;  3SH8 A;  4GB7 A;  1BLP A;  4GKU A;  4KG6 A;  2HPB A;  1FCM A;  3FV7 A;  3IF5 A;  4KZB A;  3VP3 A;  2DCF A;  2Z2M B;  1Z6F A;  3MZD A;  3LO7 A;  4OON A;  4U0X A;  4YFM A;  4DDY A;  5GLC A;  1SHV A;  5EVL A;  3BRM A;  5FAP A;  2BLS A;  1PIO A;  2WUQ A;  3MBZ A;  1XA1 A;  1JWP A;  3BLS A;  3E2K A;  3Q7V A;  5FI2 A;  1KDS A;  4KZ6 A;  5J8X A;  5DTT A;  1DJA A;  1MWT A;  4GD6 A;  5EOE A;  1S6R A;  1FOF A;  3AGD A;  3IF6 C;  4LCL A;  5FAO A;  1YLZ A;  1K56 A;  1SDE A;  1ES5 A;  3PTE A;  4S2N A;  3ZVW A;  4LEN A;  4C6Y A;  5KSH A;  3GSG A;  4ZAM A;  3S1Y A;  3VOZ A;  4IED A;  1NJ4 A;  2XR0 A;  5IHV A;  4DE0 A;  2E8I A;  4QY5 A;  3NBL A;  1XA7 A;  4ZBE A;  1XPB A;  1BTL A;  4FH4 A;  1ZKJ A;  4YIN A;  4OQH A;  5U47 A;  5CRF A;  4Y0T A;  3GV9 A;  4D2O A;  4EV4 A;  3WS4 A;  5DF8 A;  4EWF A;  4X6T A;  1IKI A;  2RCX A;  4OOY A;  4NK3 A;  4NET A;  5DTS A;  1HD8 A;  3UPO A;  3GVB A;  3PBS A;  1N4O A;  2HP9 A;  4DF6 A;  2X01 A;  4EBN A;  1L0F A;  4S2I A;  5HX9 A;  2H10 A;  3LCE A;  4DE1 A;  4R23 A;  4JXW A;  4WEK A;  1K6S A;  3ITA A;  5GL9 A;  2FFY A;  1YLY A;  3HLG A;  2ZJ9 A;  3PBO A;  5E2H A;  4GDB A;  5DF9 A;  2DNS A;  3GQZ A;  3MKF A;  1PW8 A;  1KVL A;  4RX2 A;  4WMC A;  2UWX A;  3IHA A;  2ZQD A;  4KZ5 A;  4ZJ2 A;  1W7F A;  3WS1 A;  5BOH A;  4N9L A;  3ISG A;  3NIA A;  1H8Z A;  1DY6 A;  1NXY A;  1XGI A;  4UA9 A;  2WAD A;  5EE8 A;  1PZO A;  2EXB A;  2HDU A;  2V20 A;  4HEF A;  1N9B A;  4K91 A;  1JWZ A;  4KZ3 A;  5HAI A;  4B88 A;  1QME A;  1CI8 A;  3VP0 A;  4E6W A;  1K55 A;  1YLP A;  4WZ5 A;  3UY6 A;  3FKV A;  4PPR A;  3FYZ A;  2J9O A;  1E3U A;  5CGW A;  1W5D A;  5CGX A;  3BFG A;  3QNC A;  5A92 A;  1HVB A;  4Y7P A;  1PZP A;  2EX8 A;  4JF4 A;  1O7E A;  4BD1 A;  2BG1 A;  3N8L A;  1K57 A;  3G2Y A;  3BEC A;  3WS5 A;  1BT5 A;  3V3R A;  3V50 A;  2EFX A;  1YQS A;  5CXW A;  4OQI A;  5FQ9 A;  4BJP A;  4DE3 A;  5EPH A;  2Y2N A;  5AQ9 A;  4QJG A;  4UA7 A;  3SS3 A;  3SOI A;  5CER A;  2HP5 A;  5GHX A;  5FI7 A;  3G32 A;  4JXV A;  4DE2 A;  4C3Q A;  3DW0 A;  1IKG A;  1WYB A;  3N7W A;  2H0T A;  4MNR A;  4MBK A;  3DTM A;  4OPZ A;  3VP4 A;  4KG5 A;  3FWL A;  3G34 A;  2Q9M A;  1YM1 A;  1GHP A;  4S2J A;  1XP4 A;  3OCN A;  2Y2J A;  4S2N C;  5FQK A;  5HAR A;  1ESU A;  4JF5 A;  5JYP A;  2Y4A A;  1O07 A;  1PWD A;  4PM7 A;  3ZCZ A;  5FQM A;  1KGE A;  3V3S A;  1YLT A;  5EUA A;  3G30 A;  4PM6 A;  4QB8 A;  2EX2 A;  1TEM A;  4OQ0 A;  5FAT A;  1S0W A;  2DRW A;  2ZM8 A;  2QZ6 A;  5L2F A;  5FQJ A;  1W8Q A;  4BLM A;  1WE4 A;  1RGZ A;  4ZJ1 A;  4UAA A;  1SDN A;  3VP1 A;  1BUE A;  2WAF A;  5CHJ A;  4OLG A;  4Q8I A;  1H8Y A;  2XFS A;  3PAG A;  2I72 A;  5A91 A;  2G2U A;  1MWU A;  2XDM A;  4S2K A;  1K4F A;  3C5A A;  3EQU A;  4LV1 A;  3N8S A;  3SS4 A;  3HLC A;  3IH9 A;  1G68 A;  4IBR A;  2OLU A;  3UE0 A;  3ZNT A;  1OME A;  4HBT A;  5FQQ A;  1XXM A;  4DXB A;  4CJN A;  1DJB A;  4DKI A;  2XLN A;  3ZG0 A;  4OPY A;  2X02 A;  3CG5 A;  2H0Y A;  1KGF A;  2WK0 A;  4R3B A;  2XH9 A;  1KDW A;  2WAE A;  1IYO A;  1L2S A;  4KZ4 A;  1J9M A;  4WZ4 A;  3HLB A;  3D4F A;  2HDR A;  5EVI B;  1PYY A;  4E3M A;  1ES3 A;  1EWZ A;  4BL3 A;  2G2W A;  3O87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...