4GZBA

Crystal structure of native ampc beta-lactamase from pseudomonas aeruginosa pao1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
367
structure length
367
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into potent broad-spectrum inhibition with reversible recyclization mechanism: avibactam in complex with CTX-M-15 and Pseudomonas aeruginosa AmpC beta-lactamases
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 126
structure length 367
sequence length 367
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gzbA00
1K55C 4S2KA 5TR7A 3VSLA 3G31A 4N1HA 3NCKA 3DW0A 4R4SA 4HESA 3G35A 2GDNA 3PBQA 3DWZA 3FKVA 1K6SA 3O3VA 3UPOA 4OVDA 4OLDA 1DJBA 3CZDA 3UNWA 3SS4A 1FCMA 3O88A 3PTEA 5DF7A 2Y2GA 2Y2NA 3PBSA 5EOOA 4JLFA 1M40A 3UY6A 4EQIA 5M19A 3QNCA 4R23A 1FCNA 2H0YA 3LY4A 5KZHA 3ZVWA 1K54A 3N6IA 3O86A 4LV1A 3OPPA 1CEGA 2IWDA 2EX8A 1KDWA 2OLUA 4HBTA 1IKGA 3MXRA 3HLGA 4JPMA 4ZJ3A 3V5MA 3UE0A 1C3BA 3I7JA 4ZTKA 4WZ5C 4IBRA 5AQBA 3N8RA 4R1GA 3TSGA 5KSHA 1Z6FA 1RGZA 2X71A 1KE4A 2WUQA 4GD8A 1PIOA 1LLBA 4JF6A 1NZUA 4IEDA 4Y0TA 2PU2A 4HBUA 5FQQA 2R9XA 1BLPA 1FCOA 4WM9A 4IVIA 4OP8A 4OPYA 3IHAA 4JF4A 5E2HA 3MZFA 3ZDJA 5JYOA 1L0EA 4KENB 4OPZA 1PI5A 1IYOA 2QMIA 1QMEA 1YLZA 4KZBA 4R3JA 2J9OA 1I5QA 1ES4A 1JTDA 3AGEA 4BD1A 3IWIA 1BTLA 3Q81A 1K25A 1LL5A 3BLSA 3G30A 2ZQ7A 4PM9A 4P87A 3IXBA 5FI2A 1JWPA 4EBLA 3VMAA 2ZQCA 3LO7A 3ZG9B 1NJ4A 2H10A 1YLTA 3C5AA 2C6WB 3WRZA 3ZFZA 3ZG8B 1SHVA 2G2WA 3MKFA 1H5XA 2Y2IA 3EQUA 2ZM8A 3DTMA 4KG5A 3N4IA 3OCNA 3WS1A 1ZKJA 4U0TA 3PBRA 1SDNA 2ZQ8A 4LCMA 3ZG7B 4YFMA 3WS4A 4LCLA 3ZNYA 1O7EA 3MFDA 1K38A 4U0XA 4IBXA 1O07A 4XUXA 5FSRA 5HARA 5IHVA 2X01A 5DF9A 3HUMA 5CRFA 3S22A 3S4XA 4DXCA 3UE3A 4RA7A 3IQAA 3GTCA 2Y2LA 4PM7A 4CJNA 4S2NA 4MEZA 1W8QA 5G18A 3RXXA 1XA1A 2J7VA 3HUOA 1DY6A 5EUAA 1ONGA 4PPRA 2B5RA 4E6WA 4KQRA 3SOIA 2WK0A 1W7FA 3G32A 1YQSA 3NI9A 1XP4A 3UE1A 1E3UD 3UDFA 4E3NA 2DCFA 2E8IA 2WYXA 1MXOA 2OV5A 3E2KA 2DNSA 2WKIA 2ZJ9A 2RL3A 4K91A 4LV2A 2IWCA 1NRFA 4NK3A 5DVAA 1FQGA 1M6KA 4EV4A 4N92A 1VQQA 5CGSA 2WGWA 1K6RA 3HLFA 5CEBA 1CI8A 1BT5A 5FI6A 2XGNA 3W4QA 3IXGA 5AQ7A 4K0WA 1TEMA 3LEZA 3W4OA 2XH9A 1IYPA 4OP5A 3UPPA 2V1ZA 2P74A 1ESIA 1FR6A 1H8YA 4WEJA 3G2YA 2WGIA 5HAPA 1LL9A 1ERMA 2PBYA 4D2OA 4OLGA 2XFSA 2HP9A 1CI9A 1K55A 1YLPA 4GD6A 4DDYA 2C5WB 2EXAA 1GHPA 5A91A 3SH9A 4JXWA 4XXRA 3QHYA 3M6HA 4X68A 1GA9A 3IF6A 3HLBA 1NZOA 1E3UA 3SS3A 1JWZA 3AGDA 3NDEA 3W4PA 1BLHA 1EWZA 1K57A 1PW1A 1XGJA 2HP6A 2P9VB 5EVIC 5TFQA 4YINA 1N9BA 3BRMA 5HAIA 1MWSA 5AQ9A 4Z9QA 2OSUA 5CHJA 1L0GA 1WYCA 3D4FA 3UPNA 4DE3A 3IXHA 5HL1A 2I72A 3A3DA 4GDNA 4UA9A 1FOFA 1LI9A 1K54C 1K4FA 1IYSA 1PZPA 5FQ9A 1VM1A 2WGWB 3BLMA 3LCEA 3MBZA 3WRTA 1IYQA 3PAEA 3QNBA 3IH9A 3OPRA 1W8YA 3VOYA 4E6XA 4R0QA 3NBLA 4S2JA 2Y2HA 5M18A 1YLYA 1TDGA 4K0XA 1Y54A 5JYPA 1IELA 4QD4A 1PYYA 2Q9NA 3N8SA 3NDGA 4S2LA 3PBTA 4JF5A 4KZ5A 4WZ5A 4GNUA 4BL3A 5HW3A 3FWLA 4H8RA 1TVFA 1S6RA 4JXVA 1BZAA 2V20A 2EXBA 4MNRA 1BSGA 2Z2LB 2ZM2A 1SKFA 5EVID 1ES5A 4OOLA 4GB7A 5CTMA 3BM6A 4KQOA 3BFFA 5EECA 3GV9A 5BOHA 5E2GA 3ZNTA 2OLVA 4WEKA 4E3LA 4X53A 3M2JA 1KGFA 1FSYA 2WKEA 1EI5A 1PW8A 2CC1A 3ITBA 4GKUA 4QJGA 2XR0A 4QHCA 3RJUA 3HVFA 5CHUA 2FFFB 2Y2QA 3HBRA 1MWRA 5DTSA 3N7WA 3ISGA 5GL9A 1OMEA 1XKZA 1KE3A 3HLEA 3IH8A 1EROA 5AQAA 1NY0A 1HVBA 5GHZA 2V2FF 1H8ZA 3WS2A 3A3JA 1J9MA 2JBFA 1MPLA 4E3MA 1Q2PA 2P9VA 5E2EA 1JWVA 3Q82A 4C75A 2XDMA 2ZC6B 4S2OA 3G4PA 4KZAA 3GMWA 4FD8A 3Q7ZA 4OPQA 4OONA 4PM5A 3BFDA 2DRWA 1TDLA 4Y7PA 3C4OA 2JCHA 3JYIA 1GHIA 4OPRA 2HDUA 3BFCA 2ZC3B 3MKEA 4MLLA 2EFUA 4UA7A 4X6TA 3S1YA 4N1XA 4FSFA 4DKIA 1ES2A 1IKIA 1YLJA 2Z2MB 2IWBA 4KZ7A 1XA7A 3IWOA 4X69A 4WZ4A 5HX9A 5EPHA 4E3KA 4OQHA 1KGGA 2XFTA 3A3FA 4DDSA 4E3OA 3HUNA 4X55A 3MXSA 1YM1A 3TOIA 3ZG0A 5FAQA 4JBFA 1XXMA 3E2LA 1MY8A 3ZG5A 4XUZA 5A92A 1GCEA 1ESUA 4QB8A 4RX3A 4PM6A 4QY6A 4UHUA 4BENA 4KZ3A 5CERA 2EX6A 1RCJA 4S2IA 4GDBA 5EE8A 3UDXA 2XLNA 2QZ6A 3IWQA 3FV7A 1YMXA 3BFGA 3VFHA 4Y0UA 5CEDA 3GQZA 3Q1FA 2A49A 1K56A 3VP0A 2WAFA 1KGEA 4R4RA 1SDEA 4RX2A 3GR2A 2JC7A 1XPBA 3CMZA 2ZC4B 1ERQA 2Y2OA 3O87A 1ES3A 4ZBEA 2WGVA 4OKPA 1L0FA 5EVIB 4GZBA 1WYBA 1BULA 2WZZA 4DE2A 4HEFA 5FA7A 3W8KA 4EBPA 5GLBA 1LHYA 1KDSA 3HREA 4Y0OA 2EFXA 5HFOA 2XEPA 5GLDA 2WAEA 1RP5A 3IF6C 3SS5A 2EX9A 4LV3A 3BYDA 5U47A 2VGKA 3PBNA 1FSWA 1PWDA 1K57C 5F83A 5EVIA 3ZVTA 1MWTA 4L0LA 5I94A 3FYZA 3IT9A 3HLCA 4PM8A 4WYYA 3VP3A 2WZXA 4B4XA 4E3IA 4QU3A 5FATA 4S2MA 1WE4A 3LY3A 1K56D 3CJMA 3MZEA 1LI0A 3AGFA 5FI7A 3IHBA 1W79A 2HDRA 5DTTA 4KG6A 2WADA 5FQIA 4O7DA 4GOGA 1KVLA 4OOYA 3VSKA 1ZC2A 1BLSA 4KZ4A 4FH4A 5FQJA 3V39A 3ZGAB 1DJCA 5M1AA 5CHMA 5CTNA 4C6YA 4ZJ2A 2Y55A 1RGYA 3GVBA 3Q07A 3B3XA 3NC8A 3P98A 2HDSA 4N9LA 3CG5A 5GHYA 3HLWA 4DXBA 3RXWA 2XD1A 1W5DA 2J8YA 5GHXA 1JVJA 1ALQA 2X02A 5DF8A 3C4PA 1S0WA 4E3JA 3ZCZA 1MBLA 1KVMA 3GSGA 1GHMA 3VP4A 3WS0A 1MWUA 2Y2KA 2H0TA 4A5RA 4BLMA 4S2PA 1NXYA 3EQVA 5FASA 3TG9A 5FAOA 3M2KA 1CK3A 4WMCD 2Y2MA 2Y4AA 3ITAA 4KZ6A 4F94A 3V3RA 3OC2A 4KZ8A 5E43A 4DRTA 2HDQA 5F82A 2VGJA 3IF6B 3HLDA 2BG1A 4LENA 4DE1A 4BD0A 4PMAA 2Q9MA 5DTKA 2Y2JA 2EX2A 5F1FA 5KMWA 1L0DA 1HTZA 4JXSA 5L2FA 1CEFA 4DF6A 4MBKA 4WELA 3OPHA 3C7VA 3V3SA 4FCFA 5FQMA 4OQGA 1XGIA 5FDHA 1K4EA 3BFEA 2ZLYA 2Y2PA 1NYYA 3MZDA 1XX2A 5A90A 4BJPA 2J9PA 4BL2A 1BUEA 1PI4A 3FZCA 4UAAA 3ZHHA 3BEBA 1N4OA 3V50A 1YMSA 5EVLA 1ZG6A 5CGWA 1HD8A 3M6BA 1SCWA 3NY4A 4EBNA 2G2UA 4EWFA 1AXBA 4IVKA 2FFYA 4WMCA 3GRJA 1FR1A 3HL9A 3DWKA 2ZQDA 2Y59A 4P85A 2UWXA 4OQ0A 5E2FA 3OCLA 4BQMA 2XQZA 2ZMAA 2ZM0A 2WKHA 3NIAA 4GN2A 4RYEA 5TGFA 5KSCA 1GA0A 2XK1A 1L2SA 4CPKA 3C7UA 3G2ZA 1MKIA 4B88A 3UN7A 2Y91A 2ZQ9A 1PWCA 2RCXA 5GLAA 5HAQA 5EOEA 5F1GA 1JTGA 4KG2A 4DE0A 3IF5A 3Q7VA 3A3IA 3A3EA 1Q2QA 4MBHA 3VP1A 1KE0A 3WS5A 1DJAA 3P09A 2QPNA 1YLWA 3UDIA 4NETA 4OQIA 4C3QA 2HPBA 4LV0A 2ZD8A 1QMFA 1YT4A 3IXDA 1U60A 3OZHA 4JKTA 3OPLA 1G6AA 4S2NC 2BLSA 4Q8IA 3VP2A 4P6BA 4KQQA 1HZOA 1I2SA 4U3TA 5D3OA 5J8XA 2XF3A 4OOMA 1NYMA 5FQKA 4EUZA 3WWXA 1E25A 2H5SA 2JE5A 4QY5A 4UA6A 4JXGA 2PU4A 4FH2A 4ZJ1A 5GLCA 3FKWA 2ZC5B 2HP5A 5CXWA 3G34A 2A3UA 4WBGA 3VFFA 2XD5A 4ID4A 1PWGA 5CGXA 3N8LA 1PZOA 2ZQAA 2R9WA 4M3KA 1ONHA 3BECA 5CECA 3SH7A 4ZDXA 4MBFA 4KZ9A 5FAPA 3PBOA 3VOZA 1BLCA 3SH8A 4RVAA 4N9KA 2ZC7A 4B4ZA 4X56A 5A93A 4ZAMA 3Q7VB 1ZG4A 1I2WA 4R3BA 4P0MA 1G68A 4OH0A 1IEMA 1E4DA 3UO9A 3PAGA
chains in the Genus database with same CATH superfamily
1HLUP 2PHYA 5L09A 5TR7A 4QWOA 3VSLA 3G31A 4N1HA 3NCKA 4R4SA 4HESA 2GDNA 3PBQA 3UB5P 1DJBA 2VGLS 3CZDA 3SS4A 5FEFA 2Y2GA 2Y2NA 1M40A 3UY6A 3MS6A 4R23A 1FCNA 1TS6A 1K54A 3ZVWA 3N6IA 3O86A 4IUHA 3T4OA 2IWDA 1KDWA 1D06A 4ZJ3A 3IBJA 4ESPA 3QP1A 2X71A 1KE4A 2WUQA 5FQQA 4F3LA 2Z6DA 3KO6A 2P04A 2P08A 3MZFA 1QMEA 1YLZA 3MR0A 1I5QA 3AGEA 3IWIA 3Q81A 1LL5A 3G30A 4EU0A 3RFBA 4P87A 2YKHA 3BJNA 1YLTA 1ZTUA 3WRZA 3ZG8B 3SZTA 2G2WA 3EQUA 4UEYA 1ZKJA 4U0TA 1Y28A 2ZQ8A 4LCMA 1S66L 3LFVA 3T4KA 3ZNYA 5HSQA 4IBXA 5IHVA 3HJKA 3S4XA 1TS0A 5EFWA 2G7UA 4I39A 3IQAA 2PD7A 2Y2LA 4CJNA 3E4OA 3UMDA 1W8QA 2V1AA 2A24A 3HUOA 1DY6A 5EUAA 4PPRA 3A0VA 1GSXA 1XP4A 1E3UD 3UDFA 2WYXA 3E2KA 2BTFP 2ZJ9A 4NK3A 2V0UA 4N92A 5CGSA 2WGWA 1K6RA 3HLFA 1BT5A 1OTIA 2XGNA 2A2LA 3W4OA 1IYPA 2VV8A 3UPPA 1H8YA 4WEJA 3G2YA 2WGIA 4HJ3A 1ERMA 2XFSA 1YLPA 3DBAA 5A91A 3QHYA 4X68A 1GA9A 1NZOA 3SS3A 3AGDA 3NDEA 1SKOA 3C30A 1K57A 4HHDA 4R38A 5HAIA 3QP5A 2OSUA 4MN7A 3HCYA 4DE3A 5G4ZA 2PT7A 3A3DA 1FOFA 1K54C 3BLMA 3UB9A 4E04A 3IH9A 2PR5A 2Y2HA 5M18A 1YLYA 1TDGA 4WL9A 2ZMVA 4K0XA 1Y54A 1IELA 2Q9NA 4MMNA 2M7UA 3MQQA 1XFNA 2EXBA 1BSGA 1ES5A 5CTMA 3BFFA 3GV9A 2EWWA 1LSXA 2VEAA 1FSYA 2XA7S 3T1QB 2XR0A 5DTSA 3N7WA 5GL9A 3T1XA 3H7WA 5F5YA 1EROA 3KSHA 5AQAA 1NY0A 1H8ZA 4HP4A 2OAQ1 3A3JA 1MPLA 1Q2PA 2P9VA 3T4TA 5E2EA 2ZC6B 3GMWA 2K7SA 3BFDA 3C4OA 2JCHA 3JYIA 2HDUA 3U2AA 3MKEA 3T4LA 4DKIA 2K2NA 1N9OA 4KZ7A 1XA7A 1KGGA 5DKLA 4DDSA 3TOIA 5FAQA 1MY8A 2QJ7A 2HJ9C 2QJ5A 3D72A 1ESUA 4QY6A 3KYQA 2EX6A 4S2IA 3IWQA 3FV7A 1YMXA 3VFHA 4L9EA 2WAFA 1KGEA 3T12B 2ZC4B 1ES3A 1L0FA 4MDZA 2WZZA 4HEFA 4XT2A 3W8KA 2VZWA 4LGWA 5HFOA 5GLDA 1RP5A 3IF6C 4LV3A 3E4QA 2D02A 5U47A 1OJ5A 4WF0A 1PWDA 2DMWA 4L0LA 1CQAA 3UB6A 2WZXA 1ODVA 5FATA 1OTEA 4S2MA 2W3GA 3MZEA 3GECA 1J3WA 2WADA 2WKQA 5HWWA 2INWA 4Y13A 5J3WA 1S4RA 3ZGAB 4ETZA 2OWJA 2HDSA 2Z6CA 4X1MA 3HLWA 2J3TD 3RXWA 1VB6A 4DN0A 1JVJA 2EA9A 1S0WA 3C4PA 2Y2KA 1NXYA 5FAOA 2Y2MA 3ITAA 3OC2A 4KZ8A 3HLDA 4DE1A 1D7EA 4BD0A 4PMAA 2Q9MA 5DTKA 4B9OA 2EX2A 3R4KA 1CEFA 4DF6A 3KYEA 2Y2PA 4BJPA 4EEUA 3BEBA 4LPZA 5EVLA 2PR6A 3NY4A 3FPVA 4EWFA 2FFYA 2J3TC 3GRJA 1FR1A 3A0SA 1CJFA 4P85A 2UWXA 2XQZA 2ZM0A 2PAVP 5TGFA 4ARZB 5KSCA 4MN5A 1MKIA 3O5YA 3UN7A 5GLAA 5F1GA 1JTGA 1MC0A 3A3IA 4MBHA 1DJAA 3P09A 1H3QA 4NETA 3C8CA 4C3QA 2HPBA 1V9ZA 1YT4A 3IXDA 1G6AA 4Q8IA 4P6BA 5J8XA 2XF3A 5FQKA 1E25A 2H5SA 2PBDP 2XD5A 4ID4A 2Q0OA 5AVEA 2ZQAA 3NJAA 5CECA 5HD3A 3SH7A 1OTBA 4KZ9A 5FAPA 3IX3A 1BLCA 5C5KA 2ZC7A 2YKFA 3Q7VB 4LRZE 4OH0A 4R0QA 4P6ZS 1K55C 3ZQ5A 3KYZA 3FG8A 4KUOA 2W0NA 3UB8A 2LB9A 3FKVA 4WUJA 3IX8A 1GSVA 1FCMA 2H28A 2JKTI 3PBSA 5EOOA 1F5MA 4PAUA 1W63M 3OPPA 1CEGA 1N9NA 3NECA 1AWIA 4HBTA 1IKGA 3MXRA 4JPMA 1H8MA 3UE0A 4ME4A 4WZ5C 5AQBA 3B33A 3TSGA 5KSHA 4EW7A 1RGZA 2OOLA 1LSWA 2OAP1 2PU2A 3P01A 4HBUA 4HIAA 3CHWP 1YSPA 1BLPA 3ICYA 3IHAA 3ZDJA 1L0EA 4KENB 1JTDA 2BASA 4EQ1A 3CPTB 4H6JA 1V9YA 1DP8A 5FI2A 1PFLA 4JGOA 1JWPA 4EBLA 3D9YA 1VEUA 3LO7A 3ZFZA 2R78A 2WKRA 1LT0A 2L4RA 3BQAA 1SDNA 3ZG7B 4YFMA 4LCLA 3F1PB 1OJGA 3MFDA 4XUXA 3BY9A 5FSRA 3WS4A 3L7HA 5DF9A 5CRFA 4EUVA 4RA7A 3GTCA 4JGRA 1Z09A 3TE8A 2B5RA 2WKPA 1YQSA 5HWTA 5HPIA 1D1JA 1YKDA 2WKIA 2IWCA 1ZHHB 4EV4A 3JVVA 4HP9A 2FZ0A 3MQ0A 1TEMA 2XH9A 3FC7A 3NULA 2QWSA 5HAPA 3D3OA 1LL9A 4D2OA 4O8GA 2HP9A 1K55A 2W27A 4Y5FA 3IF6A 3HLBA 1XFQA 4DMZA 2LB5A 3W4PA 3LIFA 1XGJA 1EWZA 1YAXA 2OWHA 1DP6A 2KX6A 4Z9QA 3NOPC 3D4FA 5HDDA 1IOUA 1LI9A 1PZPA 2JKRM 1MKMA 3QNBA 3OPRA 3LI8A 1OTDA 3NBLA 1JNUA 5JYPA 3S7NA 4QD4A 1PYYA 3R7WB 4WZ5A 3PBTA 4YWZA 3H9WA 1TVFA 1BZAA 4MNRA 3CUEC 5EVID 4KQOA 5J7EA 3PYPA 4KUKA 4UQIM 4YOFA 4WEKA 1G6OA 4X53A 3UE6A 4PKYA 1EI5A 1T1AA 2CC1A 3ITBA 4GKUA 4QHCA 1STZA 3RH8B 2Y2QA 3ISGA 3LGOA 1DRMA 1HVBA 1PRQA 3WS2A 1PNEA 3MQOA 2JBFA 4WLAA 2XDMA 4S2OA 1P97A 3Q7ZA 4PM5A 5FL3A 3BFCA 4MLLA 2EFUA 3S1YA 5L07A 5EV0A 1ES2A 2VX8A 3IWOA 5HX9A 5EPHA 4GCZA 5DKKA 4JBFA 1XXMA 3BY8A 3ZG5A 1GCEA 4PM6A 5CERA 3W2ZA 1VETB 4GDBA 5LBRA 4Y17A 4GJ4A 5CEDA 3Q1FA 2A49A 1CF0A 1P0ZA 3VP0A 5IU1A 4ZBEA 5EVIB 5L10A 2ZBBA 3T4JA 1LHYA 4Y0OA 5DFXA 5AVFA 2EX9A 3PBNA 4BMWA 4HJ4A 5F83A 2I9VA 3ZVTA 5I94A 2V9AA 3VP3A 5MC7A 2VK3A 3LY3A 5J4EA 3BWLA 2B95A 5FI7A 5CX7A 4PKYG 2O99A 1W79A 5DTTA 4KG6A 5FQIA 4GHIB 1KVLA 4OOYA 3IBRA 2HV1A 5HD5A 1ZC2A 1BLSA 4KZ4A 4FH4A 1DJCA 1RGYA 3NC8A 3P98A 2V8CA 1BYWA 4Q0JA 2XD1A 2VJWA 2X02A 2HJEA 5L8MA 1T19A 3WS0A 4E3IA 3VP4A 1MWUA 3EQVA 5FASA 1CK3A 2Y4AA 4F94A 3DTEA 5F82A 2VGJA 3IF6B 4LENA 4M4XA 5F1FA 1L0DA 5L2FA 4MCWA 3OPHA 3C7VA 5FQMA 4OQGA 3LIEA 4CQHA 1L3LA 3KX0X 2JKGA 4UAAA 2KDKA 1FILA 2NUPC 2P7JA 4R6LA 1YMSA 2ZL1A 3M6BA 1AXBA 4WMCA 5HWVA 2ZQDA 2L1MA 4HI4A 4OQ0A 2ZMAA 4RYEA 3F1PA 1GA0A 5HPFA 3C7UA 4B88A 1XJ3A 4XT2B 2RCXA 5KIZA 4DE0A 3Q7VA 4HOIA 1Q2QA 3DTKA 3WS5A 2W3EA 4Y2FA 2ZD8A 1U60A 3MF0A 3OPLA 2BLSA 1HZOA 4I3AA 4OOMA 1NYMA 4BBTA 4EUZA 3WWXA 1VHMA 2JE5A 4QY5A 1H0MA 1S4SA 4FH2A 4ZJ1A 2ZC5B 3C38A 2A3UA 4IHQA 3LI9A 4M3KA 1ONHA 4G3WA 3PBOA 3SH8A 1UWNX 4EERA 4N9KA 4B93A 4X56A 1T1CA 4ZAMA 2M7VA 1ZG4A 4R3BA 1IEMA 4B4XA 3UO9A 3PAGA 4S2KA 3DW0A 3FPWA 2GZAA 1K6SA 3O3VA 4OLDA 3UNWA 3O88A 2XA7M 1IFQA 2QHKA 2QKPA 4EQIA 5M19A 1FIKA 4WN5A 3LY4A 5I5LA 4LV1A 3T50A 4HJ6A 2EX8A 1VEUB 1S67L 3BW6A 3T1RA 3V5MA 4ZTKA 3MXQA 3N8RA 1Z6FA 4GD8A 4JF6A 1LLBA 1TS7A 1NZUA 4Y0TA 2R9XA 3UB7A 3CUEA 5A8BA 4I38A 4OP8A 5JYOA 4OPZA 4R3JA 2J9OA 4BD1A 2W1TB 1BTLA 1K25A 1OT6A 2ZQ7A 2NUTC 3IXBA 3T1SA 4ETXA 2GNXA 3VMAA 2ZQCA 1NJ4A 2H10A 3C5AA 1SHVA 2Y2IA 2ZM8A 4LRXC 1W63Q 1NLZA 3N4IA 3OCNA 1F98A 2HZ5A 4O01A 1O7EA 4U0XA 3HUMA 3S22A 1YSQA 3RXXA 1XA1A 2J7VA 3JVUA 4KQRA 3SOIA 2WK0A 1W7FA 3G32A 3NI9A 1T1BA 4E3NA 2DCFA 1MXOA 2DNSA 5DVAA 1NRFA 1FQGA 1M6KA 1VQQA 2ZL1B 4LFUA 4G3KA 3T4SA 2W1RA 5FI6A 1OTAA 3W4QA 3IXGA 5AQ7A 3LEZA 4OP5A 1ESIA 2J80A 2PBYA 4OLGA 1NLYA 4GD6A 4F3LB 2C5WB 2EXAA 2W3DA 3M6HA 4NKPA 1E3UA 1JWZA 2CMNA 3E0YA 4I3IA 2P9VB 3BQ8A 2HP6A 5EVIC 2FH5A 1K0KA 4YINA 1N9BA 1MWSA 4GHIA 3LR3A 3NOUC 5DFYA 3IXHA 2I72A 1IYSA 4K08A 3VV4A 4NXEA 4RQ9A 1W8YA 4E6XA 4S2JA 3H82B 5TJJA 3NDGA 4S2LA 4JF5A 4KZ5A 5HL6A 4GNUA 3FWLA 1S6RA 4HY8A 2V20A 4BWIA 3EGDC 4OOLA 3NHQA 3R7WA 5EECA 2V0WA 2OLVA 4E3LA 3M2JA 1KGFA 2Y79A 4NG2A 2WKEA 4QJGA 4EETB 2VKSA 5CHUA 1MWRA 4EESA 3CITA 1MZUA 1KE3A 3HLEA 3IH8A 2W3FA 5DJUA 3TJZC 3MSHA 1JWVA 4C75A 4LLOB 1NRJA 3MMHA 4FD8A 4OPQA 1GHIA 4UA7A 4FSFA 1IKIA 2Z2MB 3LR5A 3CLOA 4HQAA 4OQHA 2XFTA 3A3FA 3ULFA 4X55A 3MXSA 2ACGA 3QP2A 3K3CA 2XRNA 4XUZA 5A92A 1LSVA 4QB8A 4BENA 1F2KA 4KZ3A 3OLOA 5EE8A 3UDXA 2XLNA 3BFGA 3GQZA 2B02A 4HH3A 3NOTC 3GR2A 2JC7A 1XPBA 2PDRA 3CMZA 1ERQA 2Y2OA 4OKPA 4GZBA 3LUQA 3C2WA 1BULA 2L0WA 2EFXA 2XEPA 2WAEA 2JKFA 4L9GA 3BYDA 1FSWA 5EVIA 1MWTA 3IT9A 4WYYA 1WE4A 3CJMA 1LI0A 3AGFA 3MFXA 1P9WA 2HDRA 1TD5A 2PYPA 3ZYTA 4O7DA 4NXGA 3V67A 3KSGA 5CHMA 4C6YA 2VGLM 2Y55A 4CLCB 3GVBA 3B3XA 4N9LA 3CG5A 4DXBA 2J8YA 5GHXA 1ALQA 3F1OB 4EXOA 1MBLA 4BLMA 1GHMA 4IJGA 2H0TA 4R3AA 4S2PA 3M2KA 4KZ6A 3CPTA 5E43A 2BG1A 3S7PA 5KMWA 3PXPA 4MBKA 4WELA 3UMEA 2PRFA 5TBMA 1XGIA 5FDHA 1K4EA 3MJQA 2K31A 5A90A 2J9PA 4BL2A 1BUEA 3V50A 1ZG6A 5CGWA 2A24B 4QPRA 3SW1A 2VV6A 4IVKA 3HJIA 3H82A 3OCLA 4BQMA 3IX4A 3JPUA 2XK1A 4CPKA 1L2SA 1XJ4A 3A0RA 2Y91A 5HAQA 5EOEA 3IF5A 1YLWA 2IA2A 2VLGA 4DJ3A 4UQIS 4LV0A 4X1LA 4JKTA 3VP2A 4AFIA 4KQQA 1I2SA 4U3TA 2PU4A 4YNRA 2HP5A 5CXWA 3G34A 3CWFA 3EWKA 1EW0A 1PWGA 3LIDA 3B47A 5CGXA 3N8LA 4GS9A 3BECA 3B42A 4ZDXA 4MBFA 4II7A 4B4ZA 4Y15A 1I2WA 3QP8A 3EOIA 5FDSA 3S7QA 4CLCA 3G35A 3DWZA 3EEHA 3UPOA 4OVDA 1DP9A 3PTEA 5DF7A 4JLFA 3LR4A 2KLIA 3QNCA 2H0YA 5KZHA 4ARZA 3KSIA 2OLUA 1A0KA 3HLGA 1UWPX 5DJTA 1C3BA 3I7JA 4ZRRA 3CAXA 4IBRA 4R1GA 5F68A 4GLQA 3CI6A 1PIOA 4IEDA 4BBUA 4P6ZM 2XROA 3G6OA 1FCOA 4WM9A 4IVIA 4OPYA 5EM0A 5E2HA 4HNBA 4JF4A 1PI5A 1IYOA 5FEGA 2QMIA 4KZBA 1X0OA 1ES4A 4IUKA 2VV7A 3BLSA 4PM9A 2JKRI 3OBFA 4G3VA 3ZG9B 2HF6A 2C6WB 3MKFA 1H5XA 3DTMA 4KG5A 3WS1A 3PBRA 1N9LA 3P7NA 5HARA 1K38A 1O07A 2V8FA 2X01A 4DXCA 3TRCA 3UE3A 1TF1A 4PM7A 3LICA 4S2NA 4MEZA 5G18A 5AJGA 1ONGA 4E6WA 3UE1A 5EM1A 2GJ3A 2E8IA 2OV5A 4LV2A 4K91A 2RL3A 1GSWA 3K3DA 1OT9A 4CLCD 3TW8A 2M1CA 4KQDA 1CI8A 5CEBA 4O0PA 4Z1WA 1S1YA 3F1NA 4K0WA 4NEED 3VE3A 2PD8A 2V1ZA 2P74A 1FR6A 2W3HA 3L9KA 1CI9A 1T18A 4DDYA 1GHPA 4HH2A 3SH9A 4JXWA 4XXRA 2O9BA 1BLHA 1PW1A 5TFQA 1WA9A 3BRMA 1ACFA 5AQ9A 5CHJA 1L0GA 1WYCA 3UPNA 2HGVA 5HL1A 4UA9A 4GDNA 1K4FA 2QYBA 5FQ9A 1VM1A 2WGWB 3LCEA 3MBZA 3WRTA 1IYQA 3PAEA 3VOYA 1OPXA 3QP4A 3N8SA 3KSFA 1TS8A 4BL3A 5HW3A 4D60A 4H8RA 4JXVA 1Y4OA 2Z2LB 2ZM2A 1SKFA 4JGQA 4GB7A 3BM6A 1SZVA 3H7WB 3E4PA 2JN7A 5BOHA 5E2GA 3ZNTA 4NXBA 4LRYC 2D01A 3U4LP 1PW8A 5HZHA 3RJUA 3HVFA 3RTYA 2FFFB 3HBRA 4MN6A 1OMEA 1XKZA 5GHZA 2V2FF 1XJ2A 1J9MA 4E3MA 3Q82A 4H6JB 2ZOIA 3G4PA 4KZAA 4L9FA 4OONA 3EGXC 2DRWA 1TDLA 5F6AA 4Y7PA 3DAVA 4OPRA 2ZC3B 4X6TA 4N1XA 3T4QA 1YLJA 2IWBA 2UV0E 4X69A 4WZ4A 4E3KA 1KOUA 3F1NB 4E3OA 3PHYA 2W1TA 3HUNA 3ZG0A 1YM1A 4FTXA 4JGPA 3E2LA 1UGUA 3LIAA 4R70A 2GX5A 3QP6A 4RX3A 3VOLA 3VE4A 4UHUA 1RCJA 2QZ6A 4Y0UA 1YPRA 1XJ6A 2B18A 1K56A 4R4RA 4RX2A 1SDEA 2J3WA 3O87A 2WGVA 5HDCA 1WYBA 4I3JA 2XSSA 4DE2A 5FA7A 4EBPA 5GLBA 3HREA 1KDSA 3LIBA 2PYRA 3SS5A 1VETA 4PHTA 2VGKA 3GDIA 4FOFA 1K57C 4CLCE 2E8JA 3FYZA 3HLCA 4PM8A 3OOVA 4QU3A 1LL8A 5IS1A 1K56D 2O9AA 3IHBA 3S7OA 4CLCC 4GOGA 2O0YA 3VSKA 1NWZA 2Y8HA 2MJ6A 5FQJA 3V39A 5F69A 5M1AA 2JKTM 5CTNA 4ZJ2A 3Q07A 5GHYA 1W5DA 4BBVA 3K2NA 5DF8A 4NXFA 3EEAA 4E3JA 3ZCZA 1KVMA 3GSGA 4A5RA 1G5UA 3TG9A 4WMCD 3LR0A 3V3RA 2EWVA 4DRTA 2HDQA 3LYXA 2VA0A 2Y2JA 1HTZA 4JXSA 4FUWA 3V3SA 4FCFA 2ZMFA 3BFEA 2ZLYA 1NYYA 3MZDA 1XX2A 1F9IA 1PI4A 3FZCA 3ZHHA 1N4OA 1HD8A 3E98A 1SCWA 4EBNA 5K5BA 2G2UA 3HL9A 3DWKA 2O9CA 5HDSA 2Y59A 2AVXA 1S1ZA 5E2FA 5TBMB 5IT5A 2WKHA 3NIAA 4Q0IA 4Q0HA 3PR6A 3G2ZA 4GS9B 2ZQ9A 1PWCA 5G4YA 3IS2A 4KG2A 3A3EA 2ZOHA 3VP1A 1SKOB 1KE0A 2QPNA 2V1BA 4Y3IA 3UDIA 4OQIA 4DJ2A 1G28A 2JHEA 1QMFA 3OZHA 4S2NC 1P9RA 5D3OA 4EEPA 4UA6A 4JXGA 3F1OA 2KOIA 5GLCA 3FKWA 3LEQA 4GW9A 5EVEA 4WBGA 3VFFA 1PZOA 2R9WA 4X25A 3VOZA 4RVAA 3DTIA 5A93A 4P0MA 1G68A 3IS2B 4GN2A 4I5SA 1E4DA
chains in the Genus database with same CATH topology
1K55C 4S2KA 5TR7A 3VSLA 3G31A 4N1HA 3NCKA 3DW0A 4R4SA 4HESA 3G35A 2GDNA 3PBQA 3DWZA 3FKVA 1K6SA 3O3VA 3UPOA 4OVDA 4OLDA 1DJBA 3CZDA 3UNWA 3SS4A 1FCMA 3O88A 3PTEA 5DF7A 2Y2GA 2Y2NA 3PBSA 5EOOA 4JLFA 1M40A 3UY6A 4EQIA 5M19A 3QNCA 4R23A 1FCNA 2H0YA 3LY4A 5KZHA 3ZVWA 1K54A 3N6IA 3O86A 4LV1A 3OPPA 1CEGA 2IWDA 2EX8A 1KDWA 2OLUA 4HBTA 1IKGA 3MXRA 3HLGA 4JPMA 4ZJ3A 3V5MA 3UE0A 1C3BA 3I7JA 4ZTKA 4WZ5C 4IBRA 5AQBA 3N8RA 4R1GA 3TSGA 5KSHA 1Z6FA 1RGZA 2X71A 1KE4A 2WUQA 4GD8A 1PIOA 1LLBA 4JF6A 1NZUA 4IEDA 4Y0TA 2PU2A 4HBUA 5FQQA 2R9XA 1BLPA 1FCOA 4WM9A 4IVIA 4OP8A 4OPYA 3IHAA 4JF4A 5E2HA 3MZFA 3ZDJA 5JYOA 1L0EA 4KENB 4OPZA 1PI5A 1IYOA 2QMIA 1QMEA 1YLZA 4KZBA 4R3JA 2J9OA 1I5QA 1ES4A 1JTDA 3AGEA 4BD1A 3IWIA 1BTLA 3Q81A 1K25A 1LL5A 3BLSA 3G30A 2ZQ7A 4PM9A 4P87A 3IXBA 5FI2A 1JWPA 4EBLA 3VMAA 2ZQCA 3LO7A 3ZG9B 1NJ4A 2H10A 1YLTA 3C5AA 2C6WB 3WRZA 3ZFZA 3ZG8B 1SHVA 2G2WA 3MKFA 1H5XA 2Y2IA 3EQUA 2ZM8A 3DTMA 4KG5A 3N4IA 3OCNA 3WS1A 1ZKJA 4U0TA 3PBRA 1SDNA 2ZQ8A 4LCMA 3ZG7B 4YFMA 3WS4A 4LCLA 3ZNYA 1O7EA 3MFDA 1K38A 4U0XA 4IBXA 1O07A 4XUXA 5FSRA 5HARA 5IHVA 2X01A 5DF9A 3HUMA 5CRFA 3S22A 3S4XA 4DXCA 3UE3A 4RA7A 3IQAA 3GTCA 2Y2LA 4PM7A 4CJNA 4S2NA 4MEZA 1W8QA 5G18A 3RXXA 1XA1A 2J7VA 3HUOA 1DY6A 5EUAA 1ONGA 4PPRA 2B5RA 4E6WA 4KQRA 3SOIA 2WK0A 1W7FA 3G32A 1YQSA 3NI9A 1XP4A 3UE1A 1E3UD 3UDFA 4E3NA 2DCFA 2E8IA 2WYXA 1MXOA 2OV5A 3E2KA 2DNSA 2WKIA 2ZJ9A 2RL3A 4K91A 4LV2A 2IWCA 1NRFA 4NK3A 5DVAA 1FQGA 1M6KA 4EV4A 4N92A 1VQQA 5CGSA 2WGWA 1K6RA 3HLFA 5CEBA 1CI8A 1BT5A 5FI6A 2XGNA 3W4QA 3IXGA 5AQ7A 4K0WA 1TEMA 3LEZA 3W4OA 2XH9A 1IYPA 4OP5A 3UPPA 2V1ZA 2P74A 1ESIA 1FR6A 1H8YA 4WEJA 3G2YA 2WGIA 5HAPA 1LL9A 1ERMA 2PBYA 4D2OA 4OLGA 2XFSA 2HP9A 1CI9A 1K55A 1YLPA 4GD6A 4DDYA 2C5WB 2EXAA 1GHPA 5A91A 3SH9A 4JXWA 4XXRA 3QHYA 3M6HA 4X68A 1GA9A 3IF6A 3HLBA 1NZOA 1E3UA 3SS3A 1JWZA 3AGDA 3NDEA 3W4PA 1BLHA 1EWZA 1K57A 1PW1A 1XGJA 2HP6A 2P9VB 5EVIC 5TFQA 4YINA 1N9BA 3BRMA 5HAIA 1MWSA 5AQ9A 4Z9QA 2OSUA 5CHJA 1L0GA 1WYCA 3D4FA 3UPNA 4DE3A 3IXHA 5HL1A 2I72A 3A3DA 4GDNA 4UA9A 1FOFA 1LI9A 1K54C 1K4FA 1IYSA 1PZPA 5FQ9A 1VM1A 2WGWB 3BLMA 3LCEA 3MBZA 3WRTA 1IYQA 3PAEA 3QNBA 3IH9A 3OPRA 1W8YA 3VOYA 4E6XA 4R0QA 3NBLA 4S2JA 2Y2HA 5M18A 1YLYA 1TDGA 4K0XA 1Y54A 5JYPA 1IELA 4QD4A 1PYYA 2Q9NA 3N8SA 3NDGA 4S2LA 3PBTA 4JF5A 4KZ5A 4WZ5A 4GNUA 4BL3A 5HW3A 3FWLA 4H8RA 1TVFA 1S6RA 4JXVA 1BZAA 2V20A 2EXBA 4MNRA 1BSGA 2Z2LB 2ZM2A 1SKFA 5EVID 1ES5A 4OOLA 4GB7A 5CTMA 3BM6A 4KQOA 3BFFA 5EECA 3GV9A 5BOHA 5E2GA 3ZNTA 2OLVA 4WEKA 4E3LA 4X53A 3M2JA 1KGFA 1FSYA 2WKEA 1EI5A 1PW8A 2CC1A 3ITBA 4GKUA 4QJGA 2XR0A 4QHCA 3RJUA 3HVFA 5CHUA 2FFFB 2Y2QA 3HBRA 1MWRA 5DTSA 3N7WA 3ISGA 5GL9A 1OMEA 1XKZA 1KE3A 3HLEA 3IH8A 1EROA 5AQAA 1NY0A 1HVBA 5GHZA 2V2FF 1H8ZA 3WS2A 3A3JA 1J9MA 2JBFA 1MPLA 4E3MA 1Q2PA 2P9VA 5E2EA 1JWVA 3Q82A 4C75A 2XDMA 2ZC6B 4S2OA 3G4PA 4KZAA 3GMWA 4FD8A 3Q7ZA 4OPQA 4OONA 4PM5A 3BFDA 2DRWA 1TDLA 4Y7PA 3C4OA 2JCHA 3JYIA 1GHIA 4OPRA 2HDUA 3BFCA 2ZC3B 3MKEA 4MLLA 2EFUA 4UA7A 4X6TA 3S1YA 4N1XA 4FSFA 4DKIA 1ES2A 1IKIA 1YLJA 2Z2MB 2IWBA 4KZ7A 1XA7A 3IWOA 4X69A 4WZ4A 5HX9A 5EPHA 4E3KA 4OQHA 1KGGA 2XFTA 3A3FA 4DDSA 4E3OA 3HUNA 4X55A 3MXSA 1YM1A 3TOIA 3ZG0A 5FAQA 4JBFA 1XXMA 3E2LA 1MY8A 3ZG5A 4XUZA 5A92A 1GCEA 1ESUA 4QB8A 4RX3A 4PM6A 4QY6A 4UHUA 4BENA 4KZ3A 5CERA 2EX6A 1RCJA 4S2IA 4GDBA 5EE8A 3UDXA 2XLNA 2QZ6A 3IWQA 3FV7A 1YMXA 3BFGA 3VFHA 4Y0UA 5CEDA 3GQZA 3Q1FA 2A49A 1K56A 3VP0A 2WAFA 1KGEA 4R4RA 1SDEA 4RX2A 3GR2A 2JC7A 1XPBA 3CMZA 2ZC4B 1ERQA 2Y2OA 3O87A 1ES3A 4ZBEA 2WGVA 4OKPA 1L0FA 5EVIB 4GZBA 1WYBA 1BULA 2WZZA 4DE2A 4HEFA 5FA7A 3W8KA 4EBPA 5GLBA 1LHYA 1KDSA 3HREA 4Y0OA 2EFXA 5HFOA 2XEPA 5GLDA 2WAEA 1RP5A 3IF6C 3SS5A 2EX9A 4LV3A 3BYDA 5U47A 2VGKA 3PBNA 1FSWA 1PWDA 1K57C 5F83A 5EVIA 3ZVTA 1MWTA 4L0LA 5I94A 3FYZA 3IT9A 3HLCA 4PM8A 4WYYA 3VP3A 2WZXA 4B4XA 4E3IA 4QU3A 5FATA 4S2MA 1WE4A 3LY3A 1K56D 3CJMA 3MZEA 1LI0A 3AGFA 5FI7A 3IHBA 1W79A 2HDRA 5DTTA 4KG6A 2WADA 5FQIA 4O7DA 4GOGA 1KVLA 4OOYA 3VSKA 1ZC2A 1BLSA 4KZ4A 4FH4A 5FQJA 3V39A 3ZGAB 1DJCA 5M1AA 5CHMA 5CTNA 4C6YA 4ZJ2A 2Y55A 1RGYA 3GVBA 3Q07A 3B3XA 3NC8A 3P98A 2HDSA 4N9LA 3CG5A 5GHYA 3HLWA 4DXBA 3RXWA 2XD1A 1W5DA 2J8YA 5GHXA 1JVJA 1ALQA 2X02A 5DF8A 3C4PA 1S0WA 4E3JA 3ZCZA 1MBLA 1KVMA 3GSGA 1GHMA 3VP4A 3WS0A 1MWUA 2Y2KA 2H0TA 4A5RA 4BLMA 4S2PA 1NXYA 3EQVA 5FASA 3TG9A 5FAOA 3M2KA 1CK3A 4WMCD 2Y2MA 2Y4AA 3ITAA 4KZ6A 4F94A 3V3RA 3OC2A 4KZ8A 5E43A 4DRTA 2HDQA 5F82A 2VGJA 3IF6B 3HLDA 2BG1A 4LENA 4DE1A 4BD0A 4PMAA 2Q9MA 5DTKA 2Y2JA 2EX2A 5F1FA 5KMWA 1L0DA 1HTZA 4JXSA 5L2FA 1CEFA 4DF6A 4MBKA 4WELA 3OPHA 3C7VA 3V3SA 4FCFA 5FQMA 4OQGA 1XGIA 5FDHA 1K4EA 3BFEA 2ZLYA 2Y2PA 1NYYA 3MZDA 1XX2A 5A90A 4BJPA 2J9PA 4BL2A 1BUEA 1PI4A 3FZCA 4UAAA 3ZHHA 3BEBA 1N4OA 3V50A 1YMSA 5EVLA 1ZG6A 5CGWA 1HD8A 3M6BA 1SCWA 3NY4A 4EBNA 2G2UA 4EWFA 1AXBA 4IVKA 2FFYA 4WMCA 3GRJA 1FR1A 3HL9A 3DWKA 2ZQDA 2Y59A 4P85A 2UWXA 4OQ0A 5E2FA 3OCLA 4BQMA 2XQZA 2ZMAA 2ZM0A 2WKHA 3NIAA 4GN2A 4RYEA 5TGFA 5KSCA 1GA0A 2XK1A 1L2SA 4CPKA 3C7UA 3G2ZA 1MKIA 4B88A 3UN7A 2Y91A 2ZQ9A 1PWCA 2RCXA 5GLAA 5HAQA 5EOEA 5F1GA 1JTGA 4KG2A 4DE0A 3IF5A 3Q7VA 3A3IA 3A3EA 1Q2QA 4MBHA 3VP1A 1KE0A 3WS5A 1DJAA 3P09A 2QPNA 1YLWA 3UDIA 4NETA 4OQIA 4C3QA 2HPBA 4LV0A 2ZD8A 1QMFA 1YT4A 3IXDA 1U60A 3OZHA 4JKTA 3OPLA 1G6AA 4S2NC 2BLSA 4Q8IA 3VP2A 4P6BA 4KQQA 1HZOA 1I2SA 4U3TA 5D3OA 5J8XA 2XF3A 4OOMA 1NYMA 5FQKA 4EUZA 3WWXA 1E25A 2H5SA 2JE5A 4QY5A 4UA6A 4JXGA 2PU4A 4FH2A 4ZJ1A 5GLCA 3FKWA 2ZC5B 2HP5A 5CXWA 3G34A 2A3UA 4WBGA 3VFFA 2XD5A 4ID4A 1PWGA 5CGXA 3N8LA 1PZOA 2ZQAA 2R9WA 4M3KA 1ONHA 3BECA 5CECA 3SH7A 4ZDXA 4MBFA 4KZ9A 5FAPA 3PBOA 3VOZA 1BLCA 3SH8A 4RVAA 4N9KA 2ZC7A 4B4ZA 4X56A 5A93A 4ZAMA 3Q7VB 1ZG4A 1I2WA 4R3BA 4P0MA 1G68A 4OH0A 1IEMA 1E4DA 3UO9A 3PAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K55 C;  4S2K A;  5TR7 A;  3VSL A;  3G31 A;  4N1H A;  3NCK A;  3DW0 A;  4R4S A;  4HES A;  3G35 A;  2GDN A;  3PBQ A;  3DWZ A;  3FKV A;  1K6S A;  3O3V A;  3UPO A;  4OVD A;  4OLD A;  1DJB A;  3CZD A;  3UNW A;  3SS4 A;  1FCM A;  3O88 A;  3PTE A;  5DF7 A;  2Y2G A;  2Y2N A;  3PBS A;  5EOO A;  4JLF A;  1M40 A;  3UY6 A;  4EQI A;  5M19 A;  3QNC A;  4R23 A;  1FCN A;  2H0Y A;  3LY4 A;  5KZH A;  3ZVW A;  1K54 A;  3N6I A;  3O86 A;  4LV1 A;  3OPP A;  1CEG A;  2IWD A;  2EX8 A;  1KDW A;  2OLU A;  4HBT A;  1IKG A;  3MXR A;  3HLG A;  4JPM A;  4ZJ3 A;  3V5M A;  3UE0 A;  1C3B A;  3I7J A;  4ZTK A;  4WZ5 C;  4IBR A;  5AQB A;  3N8R A;  4R1G A;  3TSG A;  5KSH A;  1Z6F A;  1RGZ A;  2X71 A;  1KE4 A;  2WUQ A;  4GD8 A;  1PIO A;  1LLB A;  4JF6 A;  1NZU A;  4IED A;  4Y0T A;  2PU2 A;  4HBU A;  5FQQ A;  2R9X A;  1BLP A;  1FCO A;  4WM9 A;  4IVI A;  4OP8 A;  4OPY A;  3IHA A;  4JF4 A;  5E2H A;  3MZF A;  3ZDJ A;  5JYO A;  1L0E A;  4KEN B;  4OPZ A;  1PI5 A;  1IYO A;  2QMI A;  1QME A;  1YLZ A;  4KZB A;  4R3J A;  2J9O A;  1I5Q A;  1ES4 A;  1JTD A;  3AGE A;  4BD1 A;  3IWI A;  1BTL A;  3Q81 A;  1K25 A;  1LL5 A;  3BLS A;  3G30 A;  2ZQ7 A;  4PM9 A;  4P87 A;  3IXB A;  5FI2 A;  1JWP A;  4EBL A;  3VMA A;  2ZQC A;  3LO7 A;  3ZG9 B;  1NJ4 A;  2H10 A;  1YLT A;  3C5A A;  2C6W B;  3WRZ A;  3ZFZ A;  3ZG8 B;  1SHV A;  2G2W A;  3MKF A;  1H5X A;  2Y2I A;  3EQU A;  2ZM8 A;  3DTM A;  4KG5 A;  3N4I A;  3OCN A;  3WS1 A;  1ZKJ A;  4U0T A;  3PBR A;  1SDN A;  2ZQ8 A;  4LCM A;  3ZG7 B;  4YFM A;  3WS4 A;  4LCL A;  3ZNY A;  1O7E A;  3MFD A;  1K38 A;  4U0X A;  4IBX A;  1O07 A;  4XUX A;  5FSR A;  5HAR A;  5IHV A;  2X01 A;  5DF9 A;  3HUM A;  5CRF A;  3S22 A;  3S4X A;  4DXC A;  3UE3 A;  4RA7 A;  3IQA A;  3GTC A;  2Y2L A;  4PM7 A;  4CJN A;  4S2N A;  4MEZ A;  1W8Q A;  5G18 A;  3RXX A;  1XA1 A;  2J7V A;  3HUO A;  1DY6 A;  5EUA A;  1ONG A;  4PPR A;  2B5R A;  4E6W A;  4KQR A;  3SOI A;  2WK0 A;  1W7F A;  3G32 A;  1YQS A;  3NI9 A;  1XP4 A;  3UE1 A;  1E3U D;  3UDF A;  4E3N A;  2DCF A;  2E8I A;  2WYX A;  1MXO A;  2OV5 A;  3E2K A;  2DNS A;  2WKI A;  2ZJ9 A;  2RL3 A;  4K91 A;  4LV2 A;  2IWC A;  1NRF A;  4NK3 A;  5DVA A;  1FQG A;  1M6K A;  4EV4 A;  4N92 A;  1VQQ A;  5CGS A;  2WGW A;  1K6R A;  3HLF A;  5CEB A;  1CI8 A;  1BT5 A;  5FI6 A;  2XGN A;  3W4Q A;  3IXG A;  5AQ7 A;  4K0W A;  1TEM A;  3LEZ A;  3W4O A;  2XH9 A;  1IYP A;  4OP5 A;  3UPP A;  2V1Z A;  2P74 A;  1ESI A;  1FR6 A;  1H8Y A;  4WEJ A;  3G2Y A;  2WGI A;  5HAP A;  1LL9 A;  1ERM A;  2PBY A;  4D2O A;  4OLG A;  2XFS A;  2HP9 A;  1CI9 A;  1K55 A;  1YLP A;  4GD6 A;  4DDY A;  2C5W B;  2EXA A;  1GHP A;  5A91 A;  3SH9 A;  4JXW A;  4XXR A;  3QHY A;  3M6H A;  4X68 A;  1GA9 A;  3IF6 A;  3HLB A;  1NZO A;  1E3U A;  3SS3 A;  1JWZ A;  3AGD A;  3NDE A;  3W4P A;  1BLH A;  1EWZ A;  1K57 A;  1PW1 A;  1XGJ A;  2HP6 A;  2P9V B;  5EVI C;  5TFQ A;  4YIN A;  1N9B A;  3BRM A;  5HAI A;  1MWS A;  5AQ9 A;  4Z9Q A;  2OSU A;  5CHJ A;  1L0G A;  1WYC A;  3D4F A;  3UPN A;  4DE3 A;  3IXH A;  5HL1 A;  2I72 A;  3A3D A;  4GDN A;  4UA9 A;  1FOF A;  1LI9 A;  1K54 C;  1K4F A;  1IYS A;  1PZP A;  5FQ9 A;  1VM1 A;  2WGW B;  3BLM A;  3LCE A;  3MBZ A;  3WRT A;  1IYQ A;  3PAE A;  3QNB A;  3IH9 A;  3OPR A;  1W8Y A;  3VOY A;  4E6X A;  4R0Q A;  3NBL A;  4S2J A;  2Y2H A;  5M18 A;  1YLY A;  1TDG A;  4K0X A;  1Y54 A;  5JYP A;  1IEL A;  4QD4 A;  1PYY A;  2Q9N A;  3N8S A;  3NDG A;  4S2L A;  3PBT A;  4JF5 A;  4KZ5 A;  4WZ5 A;  4GNU A;  4BL3 A;  5HW3 A;  3FWL A;  4H8R A;  1TVF A;  1S6R A;  4JXV A;  1BZA A;  2V20 A;  2EXB A;  4MNR A;  1BSG A;  2Z2L B;  2ZM2 A;  1SKF A;  5EVI D;  1ES5 A;  4OOL A;  4GB7 A;  5CTM A;  3BM6 A;  4KQO A;  3BFF A;  5EEC A;  3GV9 A;  5BOH A;  5E2G A;  3ZNT A;  2OLV A;  4WEK A;  4E3L A;  4X53 A;  3M2J A;  1KGF A;  1FSY A;  2WKE A;  1EI5 A;  1PW8 A;  2CC1 A;  3ITB A;  4GKU A;  4QJG A;  2XR0 A;  4QHC A;  3RJU A;  3HVF A;  5CHU A;  2FFF B;  2Y2Q A;  3HBR A;  1MWR A;  5DTS A;  3N7W A;  3ISG A;  5GL9 A;  1OME A;  1XKZ A;  1KE3 A;  3HLE A;  3IH8 A;  1ERO A;  5AQA A;  1NY0 A;  1HVB A;  5GHZ A;  2V2F F;  1H8Z A;  3WS2 A;  3A3J A;  1J9M A;  2JBF A;  1MPL A;  4E3M A;  1Q2P A;  2P9V A;  5E2E A;  1JWV A;  3Q82 A;  4C75 A;  2XDM A;  2ZC6 B;  4S2O A;  3G4P A;  4KZA A;  3GMW A;  4FD8 A;  3Q7Z A;  4OPQ A;  4OON A;  4PM5 A;  3BFD A;  2DRW A;  1TDL A;  4Y7P A;  3C4O A;  2JCH A;  3JYI A;  1GHI A;  4OPR A;  2HDU A;  3BFC A;  2ZC3 B;  3MKE A;  4MLL A;  2EFU A;  4UA7 A;  4X6T A;  3S1Y A;  4N1X A;  4FSF A;  4DKI A;  1ES2 A;  1IKI A;  1YLJ A;  2Z2M B;  2IWB A;  4KZ7 A;  1XA7 A;  3IWO A;  4X69 A;  4WZ4 A;  5HX9 A;  5EPH A;  4E3K A;  4OQH A;  1KGG A;  2XFT A;  3A3F A;  4DDS A;  4E3O A;  3HUN A;  4X55 A;  3MXS A;  1YM1 A;  3TOI A;  3ZG0 A;  5FAQ A;  4JBF A;  1XXM A;  3E2L A;  1MY8 A;  3ZG5 A;  4XUZ A;  5A92 A;  1GCE A;  1ESU A;  4QB8 A;  4RX3 A;  4PM6 A;  4QY6 A;  4UHU A;  4BEN A;  4KZ3 A;  5CER A;  2EX6 A;  1RCJ A;  4S2I A;  4GDB A;  5EE8 A;  3UDX A;  2XLN A;  2QZ6 A;  3IWQ A;  3FV7 A;  1YMX A;  3BFG A;  3VFH A;  4Y0U A;  5CED A;  3GQZ A;  3Q1F A;  2A49 A;  1K56 A;  3VP0 A;  2WAF A;  1KGE A;  4R4R A;  1SDE A;  4RX2 A;  3GR2 A;  2JC7 A;  1XPB A;  3CMZ A;  2ZC4 B;  1ERQ A;  2Y2O A;  3O87 A;  1ES3 A;  4ZBE A;  2WGV A;  4OKP A;  1L0F A;  5EVI B;  4GZB A;  1WYB A;  1BUL A;  2WZZ A;  4DE2 A;  4HEF A;  5FA7 A;  3W8K A;  4EBP A;  5GLB A;  1LHY A;  1KDS A;  3HRE A;  4Y0O A;  2EFX A;  5HFO A;  2XEP A;  5GLD A;  2WAE A;  1RP5 A;  3IF6 C;  3SS5 A;  2EX9 A;  4LV3 A;  3BYD A;  5U47 A;  2VGK A;  3PBN A;  1FSW A;  1PWD A;  1K57 C;  5F83 A;  5EVI A;  3ZVT A;  1MWT A;  4L0L A;  5I94 A;  3FYZ A;  3IT9 A;  3HLC A;  4PM8 A;  4WYY A;  3VP3 A;  2WZX A;  4B4X A;  4E3I A;  4QU3 A;  5FAT A;  4S2M A;  1WE4 A;  3LY3 A;  1K56 D;  3CJM A;  3MZE A;  1LI0 A;  3AGF A;  5FI7 A;  3IHB A;  1W79 A;  2HDR A;  5DTT A;  4KG6 A;  2WAD A;  5FQI A;  4O7D A;  4GOG A;  1KVL A;  4OOY A;  3VSK A;  1ZC2 A;  1BLS A;  4KZ4 A;  4FH4 A;  5FQJ A;  3V39 A;  3ZGA B;  1DJC A;  5M1A A;  5CHM A;  5CTN A;  4C6Y A;  4ZJ2 A;  2Y55 A;  1RGY A;  3GVB A;  3Q07 A;  3B3X A;  3NC8 A;  3P98 A;  2HDS A;  4N9L A;  3CG5 A;  5GHY A;  3HLW A;  4DXB A;  3RXW A;  2XD1 A;  1W5D A;  2J8Y A;  5GHX A;  1JVJ A;  1ALQ A;  2X02 A;  5DF8 A;  3C4P A;  1S0W A;  4E3J A;  3ZCZ A;  1MBL A;  1KVM A;  3GSG A;  1GHM A;  3VP4 A;  3WS0 A;  1MWU A;  2Y2K A;  2H0T A;  4A5R A;  4BLM A;  4S2P A;  1NXY A;  3EQV A;  5FAS A;  3TG9 A;  5FAO A;  3M2K A;  1CK3 A;  4WMC D;  2Y2M A;  2Y4A A;  3ITA A;  4KZ6 A;  4F94 A;  3V3R A;  3OC2 A;  4KZ8 A;  5E43 A;  4DRT A;  2HDQ A;  5F82 A;  2VGJ A;  3IF6 B;  3HLD A;  2BG1 A;  4LEN A;  4DE1 A;  4BD0 A;  4PMA A;  2Q9M A;  5DTK A;  2Y2J A;  2EX2 A;  5F1F A;  5KMW A;  1L0D A;  1HTZ A;  4JXS A;  5L2F A;  1CEF A;  4DF6 A;  4MBK A;  4WEL A;  3OPH A;  3C7V A;  3V3S A;  4FCF A;  5FQM A;  4OQG A;  1XGI A;  5FDH A;  1K4E A;  3BFE A;  2ZLY A;  2Y2P A;  1NYY A;  3MZD A;  1XX2 A;  5A90 A;  4BJP A;  2J9P A;  4BL2 A;  1BUE A;  1PI4 A;  3FZC A;  4UAA A;  3ZHH A;  3BEB A;  1N4O A;  3V50 A;  1YMS A;  5EVL A;  1ZG6 A;  5CGW A;  1HD8 A;  3M6B A;  1SCW A;  3NY4 A;  4EBN A;  2G2U A;  4EWF A;  1AXB A;  4IVK A;  2FFY A;  4WMC A;  3GRJ A;  1FR1 A;  3HL9 A;  3DWK A;  2ZQD A;  2Y59 A;  4P85 A;  2UWX A;  4OQ0 A;  5E2F A;  3OCL A;  4BQM A;  2XQZ A;  2ZMA A;  2ZM0 A;  2WKH A;  3NIA A;  4GN2 A;  4RYE A;  5TGF A;  5KSC A;  1GA0 A;  2XK1 A;  1L2S A;  4CPK A;  3C7U A;  3G2Z A;  1MKI A;  4B88 A;  3UN7 A;  2Y91 A;  2ZQ9 A;  1PWC A;  2RCX A;  5GLA A;  5HAQ A;  5EOE A;  5F1G A;  1JTG A;  4KG2 A;  4DE0 A;  3IF5 A;  3Q7V A;  3A3I A;  3A3E A;  1Q2Q A;  4MBH A;  3VP1 A;  1KE0 A;  3WS5 A;  1DJA A;  3P09 A;  2QPN A;  1YLW A;  3UDI A;  4NET A;  4OQI A;  4C3Q A;  2HPB A;  4LV0 A;  2ZD8 A;  1QMF A;  1YT4 A;  3IXD A;  1U60 A;  3OZH A;  4JKT A;  3OPL A;  1G6A A;  4S2N C;  2BLS A;  4Q8I A;  3VP2 A;  4P6B A;  4KQQ A;  1HZO A;  1I2S A;  4U3T A;  5D3O A;  5J8X A;  2XF3 A;  4OOM A;  1NYM A;  5FQK A;  4EUZ A;  3WWX A;  1E25 A;  2H5S A;  2JE5 A;  4QY5 A;  4UA6 A;  4JXG A;  2PU4 A;  4FH2 A;  4ZJ1 A;  5GLC A;  3FKW A;  2ZC5 B;  2HP5 A;  5CXW A;  3G34 A;  2A3U A;  4WBG A;  3VFF A;  2XD5 A;  4ID4 A;  1PWG A;  5CGX A;  3N8L A;  1PZO A;  2ZQA A;  2R9W A;  4M3K A;  1ONH A;  3BEC A;  5CEC A;  3SH7 A;  4ZDX A;  4MBF A;  4KZ9 A;  5FAP A;  3PBO A;  3VOZ A;  1BLC A;  3SH8 A;  4RVA A;  4N9K A;  2ZC7 A;  4B4Z A;  4X56 A;  5A93 A;  4ZAM A;  3Q7V B;  1ZG4 A;  1I2W A;  4R3B A;  4P0M A;  1G68 A;  4OH0 A;  1IEM A;  1E4D A;  3UO9 A;  3PAG A; 
#chains in the Genus database with same CATH topology
 1HLU P;  2PHY A;  5L09 A;  5TR7 A;  4QWO A;  3VSL A;  3G31 A;  4N1H A;  3NCK A;  4R4S A;  4HES A;  2GDN A;  3PBQ A;  3UB5 P;  1DJB A;  2VGL S;  3CZD A;  3SS4 A;  5FEF A;  2Y2G A;  2Y2N A;  1M40 A;  3UY6 A;  3MS6 A;  4R23 A;  1FCN A;  1TS6 A;  1K54 A;  3ZVW A;  3N6I A;  3O86 A;  4IUH A;  3T4O A;  2IWD A;  1KDW A;  1D06 A;  4ZJ3 A;  3IBJ A;  4ESP A;  3QP1 A;  2X71 A;  1KE4 A;  2WUQ A;  5FQQ A;  4F3L A;  2Z6D A;  3KO6 A;  2P04 A;  2P08 A;  3MZF A;  1QME A;  1YLZ A;  3MR0 A;  1I5Q A;  3AGE A;  3IWI A;  3Q81 A;  1LL5 A;  3G30 A;  4EU0 A;  3RFB A;  4P87 A;  2YKH A;  3BJN A;  1YLT A;  1ZTU A;  3WRZ A;  3ZG8 B;  3SZT A;  2G2W A;  3EQU A;  4UEY A;  1ZKJ A;  4U0T A;  1Y28 A;  2ZQ8 A;  4LCM A;  1S66 L;  3LFV A;  3T4K A;  3ZNY A;  5HSQ A;  4IBX A;  5IHV A;  3HJK A;  3S4X A;  1TS0 A;  5EFW A;  2G7U A;  4I39 A;  3IQA A;  2PD7 A;  2Y2L A;  4CJN A;  3E4O A;  3UMD A;  1W8Q A;  2V1A A;  2A24 A;  3HUO A;  1DY6 A;  5EUA A;  4PPR A;  3A0V A;  1GSX A;  1XP4 A;  1E3U D;  3UDF A;  2WYX A;  3E2K A;  2BTF P;  2ZJ9 A;  4NK3 A;  2V0U A;  4N92 A;  5CGS A;  2WGW A;  1K6R A;  3HLF A;  1BT5 A;  1OTI A;  2XGN A;  2A2L A;  3W4O A;  1IYP A;  2VV8 A;  3UPP A;  1H8Y A;  4WEJ A;  3G2Y A;  2WGI A;  4HJ3 A;  1ERM A;  2XFS A;  1YLP A;  3DBA A;  5A91 A;  3QHY A;  4X68 A;  1GA9 A;  1NZO A;  3SS3 A;  3AGD A;  3NDE A;  1SKO A;  3C30 A;  1K57 A;  4HHD A;  4R38 A;  5HAI A;  3QP5 A;  2OSU A;  4MN7 A;  3HCY A;  4DE3 A;  5G4Z A;  2PT7 A;  3A3D A;  1FOF A;  1K54 C;  3BLM A;  3UB9 A;  4E04 A;  3IH9 A;  2PR5 A;  2Y2H A;  5M18 A;  1YLY A;  1TDG A;  4WL9 A;  2ZMV A;  4K0X A;  1Y54 A;  1IEL A;  2Q9N A;  4MMN A;  2M7U A;  3MQQ A;  1XFN A;  2EXB A;  1BSG A;  1ES5 A;  5CTM A;  3BFF A;  3GV9 A;  2EWW A;  1LSX A;  2VEA A;  1FSY A;  2XA7 S;  3T1Q B;  2XR0 A;  5DTS A;  3N7W A;  5GL9 A;  3T1X A;  3H7W A;  5F5Y A;  1ERO A;  3KSH A;  5AQA A;  1NY0 A;  1H8Z A;  4HP4 A;  2OAQ 1;  3A3J A;  1MPL A;  1Q2P A;  2P9V A;  3T4T A;  5E2E A;  2ZC6 B;  3GMW A;  2K7S A;  3BFD A;  3C4O A;  2JCH A;  3JYI A;  2HDU A;  3U2A A;  3MKE A;  3T4L A;  4DKI A;  2K2N A;  1N9O A;  4KZ7 A;  1XA7 A;  1KGG A;  5DKL A;  4DDS A;  3TOI A;  5FAQ A;  1MY8 A;  2QJ7 A;  2HJ9 C;  2QJ5 A;  3D72 A;  1ESU A;  4QY6 A;  3KYQ A;  2EX6 A;  4S2I A;  3IWQ A;  3FV7 A;  1YMX A;  3VFH A;  4L9E A;  2WAF A;  1KGE A;  3T12 B;  2ZC4 B;  1ES3 A;  1L0F A;  4MDZ A;  2WZZ A;  4HEF A;  4XT2 A;  3W8K A;  2VZW A;  4LGW A;  5HFO A;  5GLD A;  1RP5 A;  3IF6 C;  4LV3 A;  3E4Q A;  2D02 A;  5U47 A;  1OJ5 A;  4WF0 A;  1PWD A;  2DMW A;  4L0L A;  1CQA A;  3UB6 A;  2WZX A;  1ODV A;  5FAT A;  1OTE A;  4S2M A;  2W3G A;  3MZE A;  3GEC A;  1J3W A;  2WAD A;  2WKQ A;  5HWW A;  2INW A;  4Y13 A;  5J3W A;  1S4R A;  3ZGA B;  4ETZ A;  2OWJ A;  2HDS A;  2Z6C A;  4X1M A;  3HLW A;  2J3T D;  3RXW A;  1VB6 A;  4DN0 A;  1JVJ A;  2EA9 A;  1S0W A;  3C4P A;  2Y2K A;  1NXY A;  5FAO A;  2Y2M A;  3ITA A;  3OC2 A;  4KZ8 A;  3HLD A;  4DE1 A;  1D7E A;  4BD0 A;  4PMA A;  2Q9M A;  5DTK A;  4B9O A;  2EX2 A;  3R4K A;  1CEF A;  4DF6 A;  3KYE A;  2Y2P A;  4BJP A;  4EEU A;  3BEB A;  4LPZ A;  5EVL A;  2PR6 A;  3NY4 A;  3FPV A;  4EWF A;  2FFY A;  2J3T C;  3GRJ A;  1FR1 A;  3A0S A;  1CJF A;  4P85 A;  2UWX A;  2XQZ A;  2ZM0 A;  2PAV P;  5TGF A;  4ARZ B;  5KSC A;  4MN5 A;  1MKI A;  3O5Y A;  3UN7 A;  5GLA A;  5F1G A;  1JTG A;  1MC0 A;  3A3I A;  4MBH A;  1DJA A;  3P09 A;  1H3Q A;  4NET A;  3C8C A;  4C3Q A;  2HPB A;  1V9Z A;  1YT4 A;  3IXD A;  1G6A A;  4Q8I A;  4P6B A;  5J8X A;  2XF3 A;  5FQK A;  1E25 A;  2H5S A;  2PBD P;  2XD5 A;  4ID4 A;  2Q0O A;  5AVE A;  2ZQA A;  3NJA A;  5CEC A;  5HD3 A;  3SH7 A;  1OTB A;  4KZ9 A;  5FAP A;  3IX3 A;  1BLC A;  5C5K A;  2ZC7 A;  2YKF A;  3Q7V B;  4LRZ E;  4OH0 A;  4R0Q A;  4P6Z S;  1K55 C;  3ZQ5 A;  3KYZ A;  3FG8 A;  4KUO A;  2W0N A;  3UB8 A;  2LB9 A;  3FKV A;  4WUJ A;  3IX8 A;  1GSV A;  1FCM A;  2H28 A;  2JKT I;  3PBS A;  5EOO A;  1F5M A;  4PAU A;  1W63 M;  3OPP A;  1CEG A;  1N9N A;  3NEC A;  1AWI A;  4HBT A;  1IKG A;  3MXR A;  4JPM A;  1H8M A;  3UE0 A;  4ME4 A;  4WZ5 C;  5AQB A;  3B33 A;  3TSG A;  5KSH A;  4EW7 A;  1RGZ A;  2OOL A;  1LSW A;  2OAP 1;  2PU2 A;  3P01 A;  4HBU A;  4HIA A;  3CHW P;  1YSP A;  1BLP A;  3ICY A;  3IHA A;  3ZDJ A;  1L0E A;  4KEN B;  1JTD A;  2BAS A;  4EQ1 A;  3CPT B;  4H6J A;  1V9Y A;  1DP8 A;  5FI2 A;  1PFL A;  4JGO A;  1JWP A;  4EBL A;  3D9Y A;  1VEU A;  3LO7 A;  3ZFZ A;  2R78 A;  2WKR A;  1LT0 A;  2L4R A;  3BQA A;  1SDN A;  3ZG7 B;  4YFM A;  4LCL A;  3F1P B;  1OJG A;  3MFD A;  4XUX A;  3BY9 A;  5FSR A;  3WS4 A;  3L7H A;  5DF9 A;  5CRF A;  4EUV A;  4RA7 A;  3GTC A;  4JGR A;  1Z09 A;  3TE8 A;  2B5R A;  2WKP A;  1YQS A;  5HWT A;  5HPI A;  1D1J A;  1YKD A;  2WKI A;  2IWC A;  1ZHH B;  4EV4 A;  3JVV A;  4HP9 A;  2FZ0 A;  3MQ0 A;  1TEM A;  2XH9 A;  3FC7 A;  3NUL A;  2QWS A;  5HAP A;  3D3O A;  1LL9 A;  4D2O A;  4O8G A;  2HP9 A;  1K55 A;  2W27 A;  4Y5F A;  3IF6 A;  3HLB A;  1XFQ A;  4DMZ A;  2LB5 A;  3W4P A;  3LIF A;  1XGJ A;  1EWZ A;  1YAX A;  2OWH A;  1DP6 A;  2KX6 A;  4Z9Q A;  3NOP C;  3D4F A;  5HDD A;  1IOU A;  1LI9 A;  1PZP A;  2JKR M;  1MKM A;  3QNB A;  3OPR A;  3LI8 A;  1OTD A;  3NBL A;  1JNU A;  5JYP A;  3S7N A;  4QD4 A;  1PYY A;  3R7W B;  4WZ5 A;  3PBT A;  4YWZ A;  3H9W A;  1TVF A;  1BZA A;  4MNR A;  3CUE C;  5EVI D;  4KQO A;  5J7E A;  3PYP A;  4KUK A;  4UQI M;  4YOF A;  4WEK A;  1G6O A;  4X53 A;  3UE6 A;  4PKY A;  1EI5 A;  1T1A A;  2CC1 A;  3ITB A;  4GKU A;  4QHC A;  1STZ A;  3RH8 B;  2Y2Q A;  3ISG A;  3LGO A;  1DRM A;  1HVB A;  1PRQ A;  3WS2 A;  1PNE A;  3MQO A;  2JBF A;  4WLA A;  2XDM A;  4S2O A;  1P97 A;  3Q7Z A;  4PM5 A;  5FL3 A;  3BFC A;  4MLL A;  2EFU A;  3S1Y A;  5L07 A;  5EV0 A;  1ES2 A;  2VX8 A;  3IWO A;  5HX9 A;  5EPH A;  4GCZ A;  5DKK A;  4JBF A;  1XXM A;  3BY8 A;  3ZG5 A;  1GCE A;  4PM6 A;  5CER A;  3W2Z A;  1VET B;  4GDB A;  5LBR A;  4Y17 A;  4GJ4 A;  5CED A;  3Q1F A;  2A49 A;  1CF0 A;  1P0Z A;  3VP0 A;  5IU1 A;  4ZBE A;  5EVI B;  5L10 A;  2ZBB A;  3T4J A;  1LHY A;  4Y0O A;  5DFX A;  5AVF A;  2EX9 A;  3PBN A;  4BMW A;  4HJ4 A;  5F83 A;  2I9V A;  3ZVT A;  5I94 A;  2V9A A;  3VP3 A;  5MC7 A;  2VK3 A;  3LY3 A;  5J4E A;  3BWL A;  2B95 A;  5FI7 A;  5CX7 A;  4PKY G;  2O99 A;  1W79 A;  5DTT A;  4KG6 A;  5FQI A;  4GHI B;  1KVL A;  4OOY A;  3IBR A;  2HV1 A;  5HD5 A;  1ZC2 A;  1BLS A;  4KZ4 A;  4FH4 A;  1DJC A;  1RGY A;  3NC8 A;  3P98 A;  2V8C A;  1BYW A;  4Q0J A;  2XD1 A;  2VJW A;  2X02 A;  2HJE A;  5L8M A;  1T19 A;  3WS0 A;  4E3I A;  3VP4 A;  1MWU A;  3EQV A;  5FAS A;  1CK3 A;  2Y4A A;  4F94 A;  3DTE A;  5F82 A;  2VGJ A;  3IF6 B;  4LEN A;  4M4X A;  5F1F A;  1L0D A;  5L2F A;  4MCW A;  3OPH A;  3C7V A;  5FQM A;  4OQG A;  3LIE A;  4CQH A;  1L3L A;  3KX0 X;  2JKG A;  4UAA A;  2KDK A;  1FIL A;  2NUP C;  2P7J A;  4R6L A;  1YMS A;  2ZL1 A;  3M6B A;  1AXB A;  4WMC A;  5HWV A;  2ZQD A;  2L1M A;  4HI4 A;  4OQ0 A;  2ZMA A;  4RYE A;  3F1P A;  1GA0 A;  5HPF A;  3C7U A;  4B88 A;  1XJ3 A;  4XT2 B;  2RCX A;  5KIZ A;  4DE0 A;  3Q7V A;  4HOI A;  1Q2Q A;  3DTK A;  3WS5 A;  2W3E A;  4Y2F A;  2ZD8 A;  1U60 A;  3MF0 A;  3OPL A;  2BLS A;  1HZO A;  4I3A A;  4OOM A;  1NYM A;  4BBT A;  4EUZ A;  3WWX A;  1VHM A;  2JE5 A;  4QY5 A;  1H0M A;  1S4S A;  4FH2 A;  4ZJ1 A;  2ZC5 B;  3C38 A;  2A3U A;  4IHQ A;  3LI9 A;  4M3K A;  1ONH A;  4G3W A;  3PBO A;  3SH8 A;  1UWN X;  4EER A;  4N9K A;  4B93 A;  4X56 A;  1T1C A;  4ZAM A;  2M7V A;  1ZG4 A;  4R3B A;  1IEM A;  4B4X A;  3UO9 A;  3PAG A;  4S2K A;  3DW0 A;  3FPW A;  2GZA A;  1K6S A;  3O3V A;  4OLD A;  3UNW A;  3O88 A;  2XA7 M;  1IFQ A;  2QHK A;  2QKP A;  4EQI A;  5M19 A;  1FIK A;  4WN5 A;  3LY4 A;  5I5L A;  4LV1 A;  3T50 A;  4HJ6 A;  2EX8 A;  1VEU B;  1S67 L;  3BW6 A;  3T1R A;  3V5M A;  4ZTK A;  3MXQ A;  3N8R A;  1Z6F A;  4GD8 A;  4JF6 A;  1LLB A;  1TS7 A;  1NZU A;  4Y0T A;  2R9X A;  3UB7 A;  3CUE A;  5A8B A;  4I38 A;  4OP8 A;  5JYO A;  4OPZ A;  4R3J A;  2J9O A;  4BD1 A;  2W1T B;  1BTL A;  1K25 A;  1OT6 A;  2ZQ7 A;  2NUT C;  3IXB A;  3T1S A;  4ETX A;  2GNX A;  3VMA A;  2ZQC A;  1NJ4 A;  2H10 A;  3C5A A;  1SHV A;  2Y2I A;  2ZM8 A;  4LRX C;  1W63 Q;  1NLZ A;  3N4I A;  3OCN A;  1F98 A;  2HZ5 A;  4O01 A;  1O7E A;  4U0X A;  3HUM A;  3S22 A;  1YSQ A;  3RXX A;  1XA1 A;  2J7V A;  3JVU A;  4KQR A;  3SOI A;  2WK0 A;  1W7F A;  3G32 A;  3NI9 A;  1T1B A;  4E3N A;  2DCF A;  1MXO A;  2DNS A;  5DVA A;  1NRF A;  1FQG A;  1M6K A;  1VQQ A;  2ZL1 B;  4LFU A;  4G3K A;  3T4S A;  2W1R A;  5FI6 A;  1OTA A;  3W4Q A;  3IXG A;  5AQ7 A;  3LEZ A;  4OP5 A;  1ESI A;  2J80 A;  2PBY A;  4OLG A;  1NLY A;  4GD6 A;  4F3L B;  2C5W B;  2EXA A;  2W3D A;  3M6H A;  4NKP A;  1E3U A;  1JWZ A;  2CMN A;  3E0Y A;  4I3I A;  2P9V B;  3BQ8 A;  2HP6 A;  5EVI C;  2FH5 A;  1K0K A;  4YIN A;  1N9B A;  1MWS A;  4GHI A;  3LR3 A;  3NOU C;  5DFY A;  3IXH A;  2I72 A;  1IYS A;  4K08 A;  3VV4 A;  4NXE A;  4RQ9 A;  1W8Y A;  4E6X A;  4S2J A;  3H82 B;  5TJJ A;  3NDG A;  4S2L A;  4JF5 A;  4KZ5 A;  5HL6 A;  4GNU A;  3FWL A;  1S6R A;  4HY8 A;  2V20 A;  4BWI A;  3EGD C;  4OOL A;  3NHQ A;  3R7W A;  5EEC A;  2V0W A;  2OLV A;  4E3L A;  3M2J A;  1KGF A;  2Y79 A;  4NG2 A;  2WKE A;  4QJG A;  4EET B;  2VKS A;  5CHU A;  1MWR A;  4EES A;  3CIT A;  1MZU A;  1KE3 A;  3HLE A;  3IH8 A;  2W3F A;  5DJU A;  3TJZ C;  3MSH A;  1JWV A;  4C75 A;  4LLO B;  1NRJ A;  3MMH A;  4FD8 A;  4OPQ A;  1GHI A;  4UA7 A;  4FSF A;  1IKI A;  2Z2M B;  3LR5 A;  3CLO A;  4HQA A;  4OQH A;  2XFT A;  3A3F A;  3ULF A;  4X55 A;  3MXS A;  2ACG A;  3QP2 A;  3K3C A;  2XRN A;  4XUZ A;  5A92 A;  1LSV A;  4QB8 A;  4BEN A;  1F2K A;  4KZ3 A;  3OLO A;  5EE8 A;  3UDX A;  2XLN A;  3BFG A;  3GQZ A;  2B02 A;  4HH3 A;  3NOT C;  3GR2 A;  2JC7 A;  1XPB A;  2PDR A;  3CMZ A;  1ERQ A;  2Y2O A;  4OKP A;  4GZB A;  3LUQ A;  3C2W A;  1BUL A;  2L0W A;  2EFX A;  2XEP A;  2WAE A;  2JKF A;  4L9G A;  3BYD A;  1FSW A;  5EVI A;  1MWT A;  3IT9 A;  4WYY A;  1WE4 A;  3CJM A;  1LI0 A;  3AGF A;  3MFX A;  1P9W A;  2HDR A;  1TD5 A;  2PYP A;  3ZYT A;  4O7D A;  4NXG A;  3V67 A;  3KSG A;  5CHM A;  4C6Y A;  2VGL M;  2Y55 A;  4CLC B;  3GVB A;  3B3X A;  4N9L A;  3CG5 A;  4DXB A;  2J8Y A;  5GHX A;  1ALQ A;  3F1O B;  4EXO A;  1MBL A;  4BLM A;  1GHM A;  4IJG A;  2H0T A;  4R3A A;  4S2P A;  3M2K A;  4KZ6 A;  3CPT A;  5E43 A;  2BG1 A;  3S7P A;  5KMW A;  3PXP A;  4MBK A;  4WEL A;  3UME A;  2PRF A;  5TBM A;  1XGI A;  5FDH A;  1K4E A;  3MJQ A;  2K31 A;  5A90 A;  2J9P A;  4BL2 A;  1BUE A;  3V50 A;  1ZG6 A;  5CGW A;  2A24 B;  4QPR A;  3SW1 A;  2VV6 A;  4IVK A;  3HJI A;  3H82 A;  3OCL A;  4BQM A;  3IX4 A;  3JPU A;  2XK1 A;  4CPK A;  1L2S A;  1XJ4 A;  3A0R A;  2Y91 A;  5HAQ A;  5EOE A;  3IF5 A;  1YLW A;  2IA2 A;  2VLG A;  4DJ3 A;  4UQI S;  4LV0 A;  4X1L A;  4JKT A;  3VP2 A;  4AFI A;  4KQQ A;  1I2S A;  4U3T A;  2PU4 A;  4YNR A;  2HP5 A;  5CXW A;  3G34 A;  3CWF A;  3EWK A;  1EW0 A;  1PWG A;  3LID A;  3B47 A;  5CGX A;  3N8L A;  4GS9 A;  3BEC A;  3B42 A;  4ZDX A;  4MBF A;  4II7 A;  4B4Z A;  4Y15 A;  1I2W A;  3QP8 A;  3EOI A;  5FDS A;  3S7Q A;  4CLC A;  3G35 A;  3DWZ A;  3EEH A;  3UPO A;  4OVD A;  1DP9 A;  3PTE A;  5DF7 A;  4JLF A;  3LR4 A;  2KLI A;  3QNC A;  2H0Y A;  5KZH A;  4ARZ A;  3KSI A;  2OLU A;  1A0K A;  3HLG A;  1UWP X;  5DJT A;  1C3B A;  3I7J A;  4ZRR A;  3CAX A;  4IBR A;  4R1G A;  5F68 A;  4GLQ A;  3CI6 A;  1PIO A;  4IED A;  4BBU A;  4P6Z M;  2XRO A;  3G6O A;  1FCO A;  4WM9 A;  4IVI A;  4OPY A;  5EM0 A;  5E2H A;  4HNB A;  4JF4 A;  1PI5 A;  1IYO A;  5FEG A;  2QMI A;  4KZB A;  1X0O A;  1ES4 A;  4IUK A;  2VV7 A;  3BLS A;  4PM9 A;  2JKR I;  3OBF A;  4G3V A;  3ZG9 B;  2HF6 A;  2C6W B;  3MKF A;  1H5X A;  3DTM A;  4KG5 A;  3WS1 A;  3PBR A;  1N9L A;  3P7N A;  5HAR A;  1K38 A;  1O07 A;  2V8F A;  2X01 A;  4DXC A;  3TRC A;  3UE3 A;  1TF1 A;  4PM7 A;  3LIC A;  4S2N A;  4MEZ A;  5G18 A;  5AJG A;  1ONG A;  4E6W A;  3UE1 A;  5EM1 A;  2GJ3 A;  2E8I A;  2OV5 A;  4LV2 A;  4K91 A;  2RL3 A;  1GSW A;  3K3D A;  1OT9 A;  4CLC D;  3TW8 A;  2M1C A;  4KQD A;  1CI8 A;  5CEB A;  4O0P A;  4Z1W A;  1S1Y A;  3F1N A;  4K0W A;  4NEE D;  3VE3 A;  2PD8 A;  2V1Z A;  2P74 A;  1FR6 A;  2W3H A;  3L9K A;  1CI9 A;  1T18 A;  4DDY A;  1GHP A;  4HH2 A;  3SH9 A;  4JXW A;  4XXR A;  2O9B A;  1BLH A;  1PW1 A;  5TFQ A;  1WA9 A;  3BRM A;  1ACF A;  5AQ9 A;  5CHJ A;  1L0G A;  1WYC A;  3UPN A;  2HGV A;  5HL1 A;  4UA9 A;  4GDN A;  1K4F A;  2QYB A;  5FQ9 A;  1VM1 A;  2WGW B;  3LCE A;  3MBZ A;  3WRT A;  1IYQ A;  3PAE A;  3VOY A;  1OPX A;  3QP4 A;  3N8S A;  3KSF A;  1TS8 A;  4BL3 A;  5HW3 A;  4D60 A;  4H8R A;  4JXV A;  1Y4O A;  2Z2L B;  2ZM2 A;  1SKF A;  4JGQ A;  4GB7 A;  3BM6 A;  1SZV A;  3H7W B;  3E4P A;  2JN7 A;  5BOH A;  5E2G A;  3ZNT A;  4NXB A;  4LRY C;  2D01 A;  3U4L P;  1PW8 A;  5HZH A;  3RJU A;  3HVF A;  3RTY A;  2FFF B;  3HBR A;  4MN6 A;  1OME A;  1XKZ A;  5GHZ A;  2V2F F;  1XJ2 A;  1J9M A;  4E3M A;  3Q82 A;  4H6J B;  2ZOI A;  3G4P A;  4KZA A;  4L9F A;  4OON A;  3EGX C;  2DRW A;  1TDL A;  5F6A A;  4Y7P A;  3DAV A;  4OPR A;  2ZC3 B;  4X6T A;  4N1X A;  3T4Q A;  1YLJ A;  2IWB A;  2UV0 E;  4X69 A;  4WZ4 A;  4E3K A;  1KOU A;  3F1N B;  4E3O A;  3PHY A;  2W1T A;  3HUN A;  3ZG0 A;  1YM1 A;  4FTX A;  4JGP A;  3E2L A;  1UGU A;  3LIA A;  4R70 A;  2GX5 A;  3QP6 A;  4RX3 A;  3VOL A;  3VE4 A;  4UHU A;  1RCJ A;  2QZ6 A;  4Y0U A;  1YPR A;  1XJ6 A;  2B18 A;  1K56 A;  4R4R A;  4RX2 A;  1SDE A;  2J3W A;  3O87 A;  2WGV A;  5HDC A;  1WYB A;  4I3J A;  2XSS A;  4DE2 A;  5FA7 A;  4EBP A;  5GLB A;  3HRE A;  1KDS A;  3LIB A;  2PYR A;  3SS5 A;  1VET A;  4PHT A;  2VGK A;  3GDI A;  4FOF A;  1K57 C;  4CLC E;  2E8J A;  3FYZ A;  3HLC A;  4PM8 A;  3OOV A;  4QU3 A;  1LL8 A;  5IS1 A;  1K56 D;  2O9A A;  3IHB A;  3S7O A;  4CLC C;  4GOG A;  2O0Y A;  3VSK A;  1NWZ A;  2Y8H A;  2MJ6 A;  5FQJ A;  3V39 A;  5F69 A;  5M1A A;  2JKT M;  5CTN A;  4ZJ2 A;  3Q07 A;  5GHY A;  1W5D A;  4BBV A;  3K2N A;  5DF8 A;  4NXF A;  3EEA A;  4E3J A;  3ZCZ A;  1KVM A;  3GSG A;  4A5R A;  1G5U A;  3TG9 A;  4WMC D;  3LR0 A;  3V3R A;  2EWV A;  4DRT A;  2HDQ A;  3LYX A;  2VA0 A;  2Y2J A;  1HTZ A;  4JXS A;  4FUW A;  3V3S A;  4FCF A;  2ZMF A;  3BFE A;  2ZLY A;  1NYY A;  3MZD A;  1XX2 A;  1F9I A;  1PI4 A;  3FZC A;  3ZHH A;  1N4O A;  1HD8 A;  3E98 A;  1SCW A;  4EBN A;  5K5B A;  2G2U A;  3HL9 A;  3DWK A;  2O9C A;  5HDS A;  2Y59 A;  2AVX A;  1S1Z A;  5E2F A;  5TBM B;  5IT5 A;  2WKH A;  3NIA A;  4Q0I A;  4Q0H A;  3PR6 A;  3G2Z A;  4GS9 B;  2ZQ9 A;  1PWC A;  5G4Y A;  3IS2 A;  4KG2 A;  3A3E A;  2ZOH A;  3VP1 A;  1SKO B;  1KE0 A;  2QPN A;  2V1B A;  4Y3I A;  3UDI A;  4OQI A;  4DJ2 A;  1G28 A;  2JHE A;  1QMF A;  3OZH A;  4S2N C;  1P9R A;  5D3O A;  4EEP A;  4UA6 A;  4JXG A;  3F1O A;  2KOI A;  5GLC A;  3FKW A;  3LEQ A;  4GW9 A;  5EVE A;  4WBG A;  3VFF A;  1PZO A;  2R9W A;  4X25 A;  3VOZ A;  4RVA A;  3DTI A;  5A93 A;  4P0M A;  1G68 A;  3IS2 B;  4GN2 A;  4I5S A;  1E4D A; 
#chains in the Genus database with same CATH homology
 1K55 C;  4S2K A;  5TR7 A;  3VSL A;  3G31 A;  4N1H A;  3NCK A;  3DW0 A;  4R4S A;  4HES A;  3G35 A;  2GDN A;  3PBQ A;  3DWZ A;  3FKV A;  1K6S A;  3O3V A;  3UPO A;  4OVD A;  4OLD A;  1DJB A;  3CZD A;  3UNW A;  3SS4 A;  1FCM A;  3O88 A;  3PTE A;  5DF7 A;  2Y2G A;  2Y2N A;  3PBS A;  5EOO A;  4JLF A;  1M40 A;  3UY6 A;  4EQI A;  5M19 A;  3QNC A;  4R23 A;  1FCN A;  2H0Y A;  3LY4 A;  5KZH A;  3ZVW A;  1K54 A;  3N6I A;  3O86 A;  4LV1 A;  3OPP A;  1CEG A;  2IWD A;  2EX8 A;  1KDW A;  2OLU A;  4HBT A;  1IKG A;  3MXR A;  3HLG A;  4JPM A;  4ZJ3 A;  3V5M A;  3UE0 A;  1C3B A;  3I7J A;  4ZTK A;  4WZ5 C;  4IBR A;  5AQB A;  3N8R A;  4R1G A;  3TSG A;  5KSH A;  1Z6F A;  1RGZ A;  2X71 A;  1KE4 A;  2WUQ A;  4GD8 A;  1PIO A;  1LLB A;  4JF6 A;  1NZU A;  4IED A;  4Y0T A;  2PU2 A;  4HBU A;  5FQQ A;  2R9X A;  1BLP A;  1FCO A;  4WM9 A;  4IVI A;  4OP8 A;  4OPY A;  3IHA A;  4JF4 A;  5E2H A;  3MZF A;  3ZDJ A;  5JYO A;  1L0E A;  4KEN B;  4OPZ A;  1PI5 A;  1IYO A;  2QMI A;  1QME A;  1YLZ A;  4KZB A;  4R3J A;  2J9O A;  1I5Q A;  1ES4 A;  1JTD A;  3AGE A;  4BD1 A;  3IWI A;  1BTL A;  3Q81 A;  1K25 A;  1LL5 A;  3BLS A;  3G30 A;  2ZQ7 A;  4PM9 A;  4P87 A;  3IXB A;  5FI2 A;  1JWP A;  4EBL A;  3VMA A;  2ZQC A;  3LO7 A;  3ZG9 B;  1NJ4 A;  2H10 A;  1YLT A;  3C5A A;  2C6W B;  3WRZ A;  3ZFZ A;  3ZG8 B;  1SHV A;  2G2W A;  3MKF A;  1H5X A;  2Y2I A;  3EQU A;  2ZM8 A;  3DTM A;  4KG5 A;  3N4I A;  3OCN A;  3WS1 A;  1ZKJ A;  4U0T A;  3PBR A;  1SDN A;  2ZQ8 A;  4LCM A;  3ZG7 B;  4YFM A;  3WS4 A;  4LCL A;  3ZNY A;  1O7E A;  3MFD A;  1K38 A;  4U0X A;  4IBX A;  1O07 A;  4XUX A;  5FSR A;  5HAR A;  5IHV A;  2X01 A;  5DF9 A;  3HUM A;  5CRF A;  3S22 A;  3S4X A;  4DXC A;  3UE3 A;  4RA7 A;  3IQA A;  3GTC A;  2Y2L A;  4PM7 A;  4CJN A;  4S2N A;  4MEZ A;  1W8Q A;  5G18 A;  3RXX A;  1XA1 A;  2J7V A;  3HUO A;  1DY6 A;  5EUA A;  1ONG A;  4PPR A;  2B5R A;  4E6W A;  4KQR A;  3SOI A;  2WK0 A;  1W7F A;  3G32 A;  1YQS A;  3NI9 A;  1XP4 A;  3UE1 A;  1E3U D;  3UDF A;  4E3N A;  2DCF A;  2E8I A;  2WYX A;  1MXO A;  2OV5 A;  3E2K A;  2DNS A;  2WKI A;  2ZJ9 A;  2RL3 A;  4K91 A;  4LV2 A;  2IWC A;  1NRF A;  4NK3 A;  5DVA A;  1FQG A;  1M6K A;  4EV4 A;  4N92 A;  1VQQ A;  5CGS A;  2WGW A;  1K6R A;  3HLF A;  5CEB A;  1CI8 A;  1BT5 A;  5FI6 A;  2XGN A;  3W4Q A;  3IXG A;  5AQ7 A;  4K0W A;  1TEM A;  3LEZ A;  3W4O A;  2XH9 A;  1IYP A;  4OP5 A;  3UPP A;  2V1Z A;  2P74 A;  1ESI A;  1FR6 A;  1H8Y A;  4WEJ A;  3G2Y A;  2WGI A;  5HAP A;  1LL9 A;  1ERM A;  2PBY A;  4D2O A;  4OLG A;  2XFS A;  2HP9 A;  1CI9 A;  1K55 A;  1YLP A;  4GD6 A;  4DDY A;  2C5W B;  2EXA A;  1GHP A;  5A91 A;  3SH9 A;  4JXW A;  4XXR A;  3QHY A;  3M6H A;  4X68 A;  1GA9 A;  3IF6 A;  3HLB A;  1NZO A;  1E3U A;  3SS3 A;  1JWZ A;  3AGD A;  3NDE A;  3W4P A;  1BLH A;  1EWZ A;  1K57 A;  1PW1 A;  1XGJ A;  2HP6 A;  2P9V B;  5EVI C;  5TFQ A;  4YIN A;  1N9B A;  3BRM A;  5HAI A;  1MWS A;  5AQ9 A;  4Z9Q A;  2OSU A;  5CHJ A;  1L0G A;  1WYC A;  3D4F A;  3UPN A;  4DE3 A;  3IXH A;  5HL1 A;  2I72 A;  3A3D A;  4GDN A;  4UA9 A;  1FOF A;  1LI9 A;  1K54 C;  1K4F A;  1IYS A;  1PZP A;  5FQ9 A;  1VM1 A;  2WGW B;  3BLM A;  3LCE A;  3MBZ A;  3WRT A;  1IYQ A;  3PAE A;  3QNB A;  3IH9 A;  3OPR A;  1W8Y A;  3VOY A;  4E6X A;  4R0Q A;  3NBL A;  4S2J A;  2Y2H A;  5M18 A;  1YLY A;  1TDG A;  4K0X A;  1Y54 A;  5JYP A;  1IEL A;  4QD4 A;  1PYY A;  2Q9N A;  3N8S A;  3NDG A;  4S2L A;  3PBT A;  4JF5 A;  4KZ5 A;  4WZ5 A;  4GNU A;  4BL3 A;  5HW3 A;  3FWL A;  4H8R A;  1TVF A;  1S6R A;  4JXV A;  1BZA A;  2V20 A;  2EXB A;  4MNR A;  1BSG A;  2Z2L B;  2ZM2 A;  1SKF A;  5EVI D;  1ES5 A;  4OOL A;  4GB7 A;  5CTM A;  3BM6 A;  4KQO A;  3BFF A;  5EEC A;  3GV9 A;  5BOH A;  5E2G A;  3ZNT A;  2OLV A;  4WEK A;  4E3L A;  4X53 A;  3M2J A;  1KGF A;  1FSY A;  2WKE A;  1EI5 A;  1PW8 A;  2CC1 A;  3ITB A;  4GKU A;  4QJG A;  2XR0 A;  4QHC A;  3RJU A;  3HVF A;  5CHU A;  2FFF B;  2Y2Q A;  3HBR A;  1MWR A;  5DTS A;  3N7W A;  3ISG A;  5GL9 A;  1OME A;  1XKZ A;  1KE3 A;  3HLE A;  3IH8 A;  1ERO A;  5AQA A;  1NY0 A;  1HVB A;  5GHZ A;  2V2F F;  1H8Z A;  3WS2 A;  3A3J A;  1J9M A;  2JBF A;  1MPL A;  4E3M A;  1Q2P A;  2P9V A;  5E2E A;  1JWV A;  3Q82 A;  4C75 A;  2XDM A;  2ZC6 B;  4S2O A;  3G4P A;  4KZA A;  3GMW A;  4FD8 A;  3Q7Z A;  4OPQ A;  4OON A;  4PM5 A;  3BFD A;  2DRW A;  1TDL A;  4Y7P A;  3C4O A;  2JCH A;  3JYI A;  1GHI A;  4OPR A;  2HDU A;  3BFC A;  2ZC3 B;  3MKE A;  4MLL A;  2EFU A;  4UA7 A;  4X6T A;  3S1Y A;  4N1X A;  4FSF A;  4DKI A;  1ES2 A;  1IKI A;  1YLJ A;  2Z2M B;  2IWB A;  4KZ7 A;  1XA7 A;  3IWO A;  4X69 A;  4WZ4 A;  5HX9 A;  5EPH A;  4E3K A;  4OQH A;  1KGG A;  2XFT A;  3A3F A;  4DDS A;  4E3O A;  3HUN A;  4X55 A;  3MXS A;  1YM1 A;  3TOI A;  3ZG0 A;  5FAQ A;  4JBF A;  1XXM A;  3E2L A;  1MY8 A;  3ZG5 A;  4XUZ A;  5A92 A;  1GCE A;  1ESU A;  4QB8 A;  4RX3 A;  4PM6 A;  4QY6 A;  4UHU A;  4BEN A;  4KZ3 A;  5CER A;  2EX6 A;  1RCJ A;  4S2I A;  4GDB A;  5EE8 A;  3UDX A;  2XLN A;  2QZ6 A;  3IWQ A;  3FV7 A;  1YMX A;  3BFG A;  3VFH A;  4Y0U A;  5CED A;  3GQZ A;  3Q1F A;  2A49 A;  1K56 A;  3VP0 A;  2WAF A;  1KGE A;  4R4R A;  1SDE A;  4RX2 A;  3GR2 A;  2JC7 A;  1XPB A;  3CMZ A;  2ZC4 B;  1ERQ A;  2Y2O A;  3O87 A;  1ES3 A;  4ZBE A;  2WGV A;  4OKP A;  1L0F A;  5EVI B;  4GZB A;  1WYB A;  1BUL A;  2WZZ A;  4DE2 A;  4HEF A;  5FA7 A;  3W8K A;  4EBP A;  5GLB A;  1LHY A;  1KDS A;  3HRE A;  4Y0O A;  2EFX A;  5HFO A;  2XEP A;  5GLD A;  2WAE A;  1RP5 A;  3IF6 C;  3SS5 A;  2EX9 A;  4LV3 A;  3BYD A;  5U47 A;  2VGK A;  3PBN A;  1FSW A;  1PWD A;  1K57 C;  5F83 A;  5EVI A;  3ZVT A;  1MWT A;  4L0L A;  5I94 A;  3FYZ A;  3IT9 A;  3HLC A;  4PM8 A;  4WYY A;  3VP3 A;  2WZX A;  4B4X A;  4E3I A;  4QU3 A;  5FAT A;  4S2M A;  1WE4 A;  3LY3 A;  1K56 D;  3CJM A;  3MZE A;  1LI0 A;  3AGF A;  5FI7 A;  3IHB A;  1W79 A;  2HDR A;  5DTT A;  4KG6 A;  2WAD A;  5FQI A;  4O7D A;  4GOG A;  1KVL A;  4OOY A;  3VSK A;  1ZC2 A;  1BLS A;  4KZ4 A;  4FH4 A;  5FQJ A;  3V39 A;  3ZGA B;  1DJC A;  5M1A A;  5CHM A;  5CTN A;  4C6Y A;  4ZJ2 A;  2Y55 A;  1RGY A;  3GVB A;  3Q07 A;  3B3X A;  3NC8 A;  3P98 A;  2HDS A;  4N9L A;  3CG5 A;  5GHY A;  3HLW A;  4DXB A;  3RXW A;  2XD1 A;  1W5D A;  2J8Y A;  5GHX A;  1JVJ A;  1ALQ A;  2X02 A;  5DF8 A;  3C4P A;  1S0W A;  4E3J A;  3ZCZ A;  1MBL A;  1KVM A;  3GSG A;  1GHM A;  3VP4 A;  3WS0 A;  1MWU A;  2Y2K A;  2H0T A;  4A5R A;  4BLM A;  4S2P A;  1NXY A;  3EQV A;  5FAS A;  3TG9 A;  5FAO A;  3M2K A;  1CK3 A;  4WMC D;  2Y2M A;  2Y4A A;  3ITA A;  4KZ6 A;  4F94 A;  3V3R A;  3OC2 A;  4KZ8 A;  5E43 A;  4DRT A;  2HDQ A;  5F82 A;  2VGJ A;  3IF6 B;  3HLD A;  2BG1 A;  4LEN A;  4DE1 A;  4BD0 A;  4PMA A;  2Q9M A;  5DTK A;  2Y2J A;  2EX2 A;  5F1F A;  5KMW A;  1L0D A;  1HTZ A;  4JXS A;  5L2F A;  1CEF A;  4DF6 A;  4MBK A;  4WEL A;  3OPH A;  3C7V A;  3V3S A;  4FCF A;  5FQM A;  4OQG A;  1XGI A;  5FDH A;  1K4E A;  3BFE A;  2ZLY A;  2Y2P A;  1NYY A;  3MZD A;  1XX2 A;  5A90 A;  4BJP A;  2J9P A;  4BL2 A;  1BUE A;  1PI4 A;  3FZC A;  4UAA A;  3ZHH A;  3BEB A;  1N4O A;  3V50 A;  1YMS A;  5EVL A;  1ZG6 A;  5CGW A;  1HD8 A;  3M6B A;  1SCW A;  3NY4 A;  4EBN A;  2G2U A;  4EWF A;  1AXB A;  4IVK A;  2FFY A;  4WMC A;  3GRJ A;  1FR1 A;  3HL9 A;  3DWK A;  2ZQD A;  2Y59 A;  4P85 A;  2UWX A;  4OQ0 A;  5E2F A;  3OCL A;  4BQM A;  2XQZ A;  2ZMA A;  2ZM0 A;  2WKH A;  3NIA A;  4GN2 A;  4RYE A;  5TGF A;  5KSC A;  1GA0 A;  2XK1 A;  1L2S A;  4CPK A;  3C7U A;  3G2Z A;  1MKI A;  4B88 A;  3UN7 A;  2Y91 A;  2ZQ9 A;  1PWC A;  2RCX A;  5GLA A;  5HAQ A;  5EOE A;  5F1G A;  1JTG A;  4KG2 A;  4DE0 A;  3IF5 A;  3Q7V A;  3A3I A;  3A3E A;  1Q2Q A;  4MBH A;  3VP1 A;  1KE0 A;  3WS5 A;  1DJA A;  3P09 A;  2QPN A;  1YLW A;  3UDI A;  4NET A;  4OQI A;  4C3Q A;  2HPB A;  4LV0 A;  2ZD8 A;  1QMF A;  1YT4 A;  3IXD A;  1U60 A;  3OZH A;  4JKT A;  3OPL A;  1G6A A;  4S2N C;  2BLS A;  4Q8I A;  3VP2 A;  4P6B A;  4KQQ A;  1HZO A;  1I2S A;  4U3T A;  5D3O A;  5J8X A;  2XF3 A;  4OOM A;  1NYM A;  5FQK A;  4EUZ A;  3WWX A;  1E25 A;  2H5S A;  2JE5 A;  4QY5 A;  4UA6 A;  4JXG A;  2PU4 A;  4FH2 A;  4ZJ1 A;  5GLC A;  3FKW A;  2ZC5 B;  2HP5 A;  5CXW A;  3G34 A;  2A3U A;  4WBG A;  3VFF A;  2XD5 A;  4ID4 A;  1PWG A;  5CGX A;  3N8L A;  1PZO A;  2ZQA A;  2R9W A;  4M3K A;  1ONH A;  3BEC A;  5CEC A;  3SH7 A;  4ZDX A;  4MBF A;  4KZ9 A;  5FAP A;  3PBO A;  3VOZ A;  1BLC A;  3SH8 A;  4RVA A;  4N9K A;  2ZC7 A;  4B4Z A;  4X56 A;  5A93 A;  4ZAM A;  3Q7V B;  1ZG4 A;  1I2W A;  4R3B A;  4P0M A;  1G68 A;  4OH0 A;  1IEM A;  1E4D A;  3UO9 A;  3PAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...