4GZBA

Crystal structure of native ampc beta-lactamase from pseudomonas aeruginosa pao1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
367
structure length
367
Chain Sequence
b'APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural insight into potent broad-spectrum inhibition with reversible recyclization mechanism: avibactam in complex with CTX-M-15 and Pseudomonas aeruginosa AmpC beta-lactamases
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 126
structure length 367
sequence length 367
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gzbA00
5CGWA 4ZBEA 5FQJA 3HLEA 4GDBA 1KVMA 3C7UA 4KG5A 5CECA 4KZ7A 5E2EA 3Q1FA 3VSKA 5FAPA 1BLHA 1HVBA 5EUAA 4U0TA 1K38A 4OPQA 3NDGA 3VOZA 1EROA 2XF3A 1H8ZA 4JF6A 1O07A 1KDWA 1KE4A 4FH2A 4GD8A 4KENB 1FCOA 3UDFA 2ZQ8A 2ZC6B 4S2MA 5CXWA 1GCEA 4BD1A 1S0WA 5EPHA 1GHPA 3LCEA 1C3BA 4LV0A 1AXBA 5DTTA 5A92A 2WKEA 3GV9A 4QY6A 4FH4A 3ZFZA 2Q9MA 2EX9A 3CMZA 4QY5A 1PZPA 4MBHA 3NI9A 2X02A 2ZM8A 4JF5A 5HAIA 3BM6A 3HLWA 5F1FA 4WZ5A 3HL9A 4WBGA 4C6YA 2E8IA 4KZ6A 3BYDA 3GMWA 3HBRA 3PBTA 2Y59A 3NDEA 4WEJA 4WEKA 4B88A 3VOYA 1WYBA 5CEBA 5FI2A 4U0XA 1ERQA 4Y0OA 5EOEA 4C75A 3SH9A 1KGGA 1QMEA 1ESUA 3ZNTA 5FQIA 2VGKA 3OZHA 1K55A 1ZKJA 3M2KA 1LL9A 1ZG6A 2Y55A 4XUZA 3DWZA 1LI9A 3Q81A 5HAQA 1S6RA 4IEDA 2J9OA 5FA7A 5G18A 5HFOA 4IBXA 4EV4A 3HUNA 1VQQA 4UA6A 1KGEA 4IVKA 1HZOA 2H0TA 3EQVA 1CEGA 5EVIC 1I2SA 2EX2A 1KVLA 2FFYA 3FKWA 3UE0A 4JXVA 2R9XA 1SDNA 1BLSA 3NIAA 2PU4A 4WYYA 1L0DA 2CC1A 2R9WA 3OCNA 1XPBA 2Y2HA 4KZ3A 5AQ9A 3C4OA 2XFSA 4OPYA 1LL5A 1ONGA 5M18A 4R3JA 1NJ4A 2DNSA 2XFTA 1YT4A 3BLSA 4ZDXA 1YLWA 1LI0A 2XGNA 3WS5A 2WAEA 1K6SA 1EI5A 3UPOA 1BTLA 3TSGA 3IF6A 3ZVTA 3JYIA 1MY8A 1MXOA 2ZQAA 4KZBA 2ZQCA 4GKUA 3WS2A 4JF4A 3S1YA 3VMAA 3ZGAB 5KMWA 1W79A 2Y2LA 5IHVA 3FYZA 1YM1A 4OQHA 1MBLA 4A5RA 4XXRA 4KZ5A 2ZM0A 2G2UA 3N7WA 2RCXA 4JXWA 5EVLA 3VP2A 2H10A 3V50A 1PW8A 1BZAA 2JCHA 5F1GA 1NY0A 2QZ6A 3BECA 3RXWA 3UE1A 4Y7PA 4JXSA 1PWCA 2Y2GA 5DF9A 5DF7A 4PM5A 3VP1A 3V3RA 3W4OA 5A90A 1VM1A 5J8XA 4MBFA 4BL2A 4EUZA 1YMSA 4R4SA 3BRMA 1EWZA 3MXSA 5HARA 4CJNA 4P87A 3IT9A 3C7VA 3ZHHA 4X55A 4JXGA 4NK3A 4MLLA 5CGXA 4S2PA 5GL9A 4KZAA 1FOFA 2WUQA 3WS4A 4Q8IA 2WGIA 1J9MA 3EQUA 5FI6A 5A93A 2WK0A 3NBLA 3ISGA 3BFCA 4MBKA 5CGSA 3VP0A 1CEFA 5FSRA 1NZOA 3MBZA 4FCFA 1Y54A 2XD5A 4P6BA 5CEDA 4BJPA 3PAEA 2HP6A 5KZHA 3DWKA 3HUMA 3TG9A 4KZ8A 1DJAA 1CI9A 4QB8A 5HL1A 1MWTA 3BLMA 1XGIA 2I72A 3N4IA 4LCMA 3IF6B 2XD1A 1Z6FA 4CPKA 3PBRA 4C3QA 5FQQA 4DXCA 5FASA 4B4ZA 3ZG5A 3FKVA 1JWVA 1BUEA 3BFFA 3W4QA 1CI8A 2XH9A 1TDGA 4U3TA 1XA1A 5GLBA 2Y4AA 4GN2A 1M6KA 1QMFA 2Y2IA 5DTKA 1K4EA 1YQSA 3ITAA 3G30A 4BD0A 4M3KA 4HBTA 4DKIA 1FQGA 3O87A 4GDNA 5AQAA 3HVFA 1PZOA 2WZXA 2EX6A 5FQKA 3A3IA 2J8YA 1SCWA 4RYEA 3I7JA 3Q07A 5CTMA 4EWFA 1K57C 4OOMA 3LY3A 4UAAA 3Q82A 3UN7A 4ID4A 2Z2MB 1OMEA 1PYYA 3IXBA 4GB7A 3PBOA 4O7DA 1W8QA 2H0YA 4HBUA 3E2LA 5FQ9A 1E3UD 1PIOA 3UDIA 3PBNA 3HLGA 3BFDA 1XGJA 4KQQA 2V20A 2WADA 1K4FA 3MZFA 1IYSA 4QD4A 2Y2KA 1RP5A 3UO9A 1TEMA 3AGDA 2ZJ9A 1IKIA 3DTMA 3IH8A 1DJBA 4WZ5C 3A3JA 2WYXA 1HTZA 3M6BA 3V5MA 2XK1A 2ZM2A 3MFDA 5L2FA 3IXGA 3CJMA 3G34A 2HP5A 5CHJA 3OPHA 4Z9QA 4DE3A 3IXDA 3W4PA 4OP5A 5HAPA 2HDRA 1SKFA 4E3JA 4XUXA 4PPRA 1TVFA 2JBFA 4X53A 2GDNA 3HLCA 2WKIA 3IWQA 4N1HA 2P9VA 2B5RA 3OPPA 1G68A 3LO7A 4OOLA 4F94A 3OCLA 4KZ4A 3N8LA 4GZBA 4R23A 1K54A 1ZC2A 4PM7A 1WYCA 1K6RA 2XQZA 3ZVWA 5D3OA 2OV5A 4OVDA 3BFGA 3O88A 5M1AA 4R1GA 4DDSA 4FSFA 4S2LA 2WZZA 5AQ7A 1L0GA 4UA7A 4KG2A 4WZ4A 1RGZA 3GSGA 4E3NA 5E2GA 3SS4A 3IHBA 1IYQA 2OLVA 1IYOA 4OONA 1KE3A 3UPPA 3VP4A 1ONHA 3W8KA 3RJUA 4OQIA 3AGFA 1YLYA 2EXAA 1Q2QA 3WS1A 1JWPA 1LHYA 1SDEA 3A3FA 2H5SA 4LV1A 4QU3A 5GLAA 3UDXA 5M19A 2HP9A 2V2FF 4S2NA 1PW1A 4ZTKA 4OLGA 2EX8A 3C4PA 2X01A 4BLMA 4YINA 2EFXA 2C6WB 3VFHA 3A3EA 1JTGA 5BOHA 3NC8A 1E4DA 5TGFA 3HLFA 3E2KA 2XEPA 2ZQDA 3MZEA 3OC2A 2QMIA 4GNUA 4KG6A 5EVID 5GHXA 4OPRA 4S2OA 3N6IA 5CTNA 1I2WA 4H8RA 1E3UA 4X6TA 4B4XA 2Z2LB 3IWOA 3TOIA 1FR1A 2P9VB 3HUOA 1BSGA 5A91A 4KQRA 1W7FA 5F83A 3NY4A 3LEZA 5CHMA 4P0MA 1XX2A 1IEMA 1FSWA 5DVAA 5EECA 3ZCZA 4DRTA 1IKGA 2OSUA 4K0XA 3UY6A 4ZJ3A 3HLBA 1CK3A 2OLUA 3FV7A 3WS0A 2VGJA 1BULA 1ES4A 4HESA 4RX2A 4E3LA 3BEBA 1L0FA 1PI4A 3ZG0A 4X68A 4OQGA 5KSCA 3G35A 2WGWA 3Q7ZA 2WAFA 3GVBA 4MEZA 4PM6A 3MKEA 4S2JA 2PU2A 4Y0TA 1PWDA 4E6XA 2BLSA 4EBNA 1O7EA 1XXMA 2ZC5B 3NCKA 1DJCA 3A3DA 4DE0A 3IXHA 2EFUA 3GR2A 4OP8A 4PM9A 2ZMAA 4DXBA 5HW3A 3WRTA 2EXBA 2X71A 3IHAA 4IVIA 2ZC7A 4NETA 1ERMA 3IQAA 5GHZA 2Y91A 4DE1A 4RA7A 4BL3A 4P85A 4PM8A 4MNRA 1IELA 4RVAA 2G2WA 2V1ZA 1BLCA 4ZJ2A 5TFQA 3P98A 1RCJA 1TDLA 2HDSA 3O3VA 3PTEA 3Q7VA 3UPNA 3GRJA 5DTSA 5CHUA 3ZNYA 4QJGA 1KDSA 3QHYA 1JTDA 3PBSA 1I5QA 1PI5A 4R4RA 1K57A 3ZG8B 4ZJ1A 2Q9NA 3QNCA 1RGYA 4E3IA 1BLPA 4K0WA 3OPLA 4YFMA 2A3UA 5HX9A 1E25A 1LLBA 4IBRA 4E3KA 5CERA 1L0EA 1Q2PA 4N1XA 1ES5A 2JE5A 3O86A 3GQZA 5GLCA 3ZG7B 4E3OA 2XDMA 3C5AA 3SOIA 4DF6A 5DF8A 3QNBA 1K56D 2RL3A 3M6HA 4OH0A 3S22A 4WMCD 5E2HA 5E43A 1GHMA 1G6AA 4R0QA 1YMXA 5FAQA 1MKIA 1M40A 1MWRA 2ZQ9A 5GLDA 1ES2A 3DW0A 3G2YA 1FSYA 4GD6A 4JBFA 2WGWB 5CRFA 3MZDA 1MPLA 1MWUA 1PWGA 4LV3A 5EVIA 4EBPA 1HD8A 5E2FA 5EOOA 5FQMA 4UA9A 1GHIA 4BQMA 3FWLA 1W8YA 3ZG9B 4BENA 3G32A 4OOYA 4PMAA 4N9LA 3SS3A 1NYYA 3CZDA 3G31A 3OPRA 3M2JA 3GTCA 1K55C 2Y2QA 2P74A 3PBQA 3S4XA 2HPBA 4EQIA 5I94A 4S2KA 1DY6A 4OKPA 3CG5A 3SH7A 5KSHA 5GHYA 2WGVA 3RXXA 1SHVA 4KQOA 1ES3A 1H8YA 3B3XA 5FAOA 1GA9A 2PBYA 3Q7VB 3VSLA 1XA7A 2A49A 1KGFA 1H5XA 4R3BA 1YLJA 2WKHA 1JVJA 3N8SA 1FCNA 3HLDA 1NXYA 4K91A 4QHCA 3N8RA 2HDQA 1ALQA 1U60A 1FR6A 1ZG4A 4OLDA 3UNWA 3ZDJA 4EBLA 2ZC4B 1K54C 4OPZA 2Y2PA 4WM9A 5JYPA 4HEFA 3V3SA 2DRWA 2XR0A 1IYPA 4OQ0A 3FZCA 1YLTA 4GOGA 3IF6C 1XKZA 3IF5A 3BFEA 4UHUA 3WWXA 2FFFB 4ZAMA 1BT5A 2IWDA 4JKTA 5EVIB 1YLPA 4LENA 4DE2A 1WE4A 2DCFA 4JPMA 3G4PA 4RX3A 1JWZA 1NRFA 3WRZA 3V39A 4Y0UA 3LY4A 2C5WB 2JC7A 3P09A 3G2ZA 4WELA 2ZLYA 4X69A 4DDYA 4E6WA 4KZ9A 4S2NC 1K56A 1L2SA 5TR7A 4WMCA 2HDUA 4X56A 3IH9A 1ESIA 2IWCA 5FDHA 2J9PA 3HREA 3AGEA 2IWBA 3SS5A 4LCLA 5FATA 5AQBA 1FCMA 5FI7A 2XLNA 2ZC3B 2Y2NA 2ZQ7A 4JLFA 2UWXA 5EE8A 4N92A 5U47A 1NYMA 3PAGA 4N9KA 2J7VA 4E3MA 1NZUA 1MWSA 1N9BA 1GA0A 1YLZA 2Y2OA 3D4FA 4L0LA 3SH8A 3VP3A 3MKFA 4FD8A 3ITBA 4LV2A 3IWIA 1K25A 5JYOA 3MXRA 1XP4A 2QPNA 3UE3A 4S2IA 2Y2JA 4D2OA 5F82A 1N4OA 2BG1A 2ZD8A 1W5DA 2Y2MA 1KE0A 3VFFA
chains in the Genus database with same CATH superfamily
4ZBEA 2YKHA 4KG5A 3C7UA 5HWVA 2JN7A 4FUWA 1BLHA 4U0TA 3E0YA 4R6LA 2XF3A 1T1AA 4Y15A 1SZVA 4KENB 1FCOA 1TD5A 2ZQ8A 5CXWA 3QP8A 1AXBA 4QPRA 4O8GA 4QY5A 4MBHA 2X02A 2ZM8A 4JF5A 1YKDA 2JKGA 2V0UA 2E8IA 3HBRA 3NDEA 4WEKA 4B88A 1D1JA 1ERQA 3EWKA 3LUQA 2VGKA 5A8BA 4GLQA 2Y55A 1LI9A 5K5BA 4IEDA 2J9OA 5FA7A 3BQAA 4IBXA 3HUNA 3UB7A 1VQQA 4LRYC 3F1OB 2H0TA 3EQVA 5EVIC 2R9XA 2PU4A 3D9YA 1XPBA 4OPYA 1XJ6A 1ONGA 4G3KA 1NJ4A 3LR3A 1YT4A 4ZDXA 1LI0A 2V1AA 1EI5A 3UPOA 3VE4A 3MSHA 3JYIA 1P9RA 2ZQCA 5KMWA 3FYZA 3K3CA 1XFNA 4A5RA 2ZM0A 1OJGA 2G2UA 5G4ZA 2VK3A 1J3WA 4F3LB 5EVLA 3VP2A 2H10A 2QZ6A 4Y7PA 2KLIA 2G7UA 3IBRA 3V3RA 1T18A 1WA9A 4CLCB 4EUZA 4R4SA 3S7QA 3TJZC 4I3AA 4YOFA 4NK3A 4I3IA 1FOFA 2WUQA 4Q8IA 3EQUA 5F6AA 3SZTA 3ISGA 3BFCA 5CGSA 3T4QA 5FSRA 2GJ3A 1VETA 4LPZA 2XD5A 4GHIB 3PAEA 1CI9A 1MWTA 2OWJA 3K3DA 3LR0A 1XGIA 2I72A 5TBMB 4NXBA 4PHTA 3V67A 4DXCA 2HV1A 1CF0A 3BFFA 1MC0A 1CI8A 2B02A 1DP6A 1M6KA 1QMFA 2Y2IA 3BJNA 4DKIA 1VEUA 4GDNA 5FQKA 2GX5A 2JKRI 3I7JA 1PRQA 1K57C 3LY3A 4UAAA 3Q82A 1PYYA 3IXBA 4GB7A 4HHDA 5EFWA 1W8QA 3E2LA 2B95A 4K08A 2V20A 1TEMA 2W3DA 3AGDA 5DFYA 1TS8A 4WZ5C 3M6BA 2BTFP 2XK1A 3LIEA 3IXGA 3G34A 2PT7A 3IXDA 4OP5A 2W1TB 4H6JA 4XUXA 1S1YA 4ETZA 1TVFA 4N1HA 1G68A 3N8LA 1K54A 1K6RA 2XQZA 4II7A 2OV5A 3MS6A 2K2NA 4DN0A 4JGOA 3UPPA 3VP4A 1IYOA 3W8KA 3RJUA 4CLCE 3AGFA 2EXAA 3KYZA 1Q2QA 1JWPA 1LHYA 1TF1A 1SDEA 3MFXA 2J80A 5GLAA 1S66L 4S2NA 1PW1A 3C4PA 3VFHA 3A3EA 1PFLA 5TGFA 3HLFA 3IX3A 2HF6A 2XEPA 3MJQA 5GHXA 3OC2A 4GNUA 4S2OA 5CTNA 4UQIS 3UB6A 3ZYTA 4X6TA 2Z2LB 3IWOA 3TOIA 5F83A 2O9BA 2HJEA 3RFBA 3KYEA 1AWIA 3NY4A 5HL6A 3TW8A 1K0KA 4DRTA 4K0XA 3UY6A 2FZ0A 4ZJ3A 3HLBA 2OLUA 3FV7A 5F68A 4RX2A 3QP4A 3R7WA 3MQOA 3Q7ZA 4MEZA 4PM6A 2VKSA 1PWDA 1XXMA 3NCKA 1UWNX 2EFUA 4PM9A 4DXBA 4NETA 2KX6A 2MJ6A 1YAXA 2G2WA 2V1ZA 4ZJ2A 3P98A 3PTEA 3O3VA 5CHUA 3F1NB 1ZHHB 4PKYG 3RH8B 3PBSA 4R4RA 1K57A 4ZJ1A 4NXFA 1RGYA 2PD7A 4E3IA 4K0WA 3OPLA 2L4RA 2A3UA 1E25A 4IBRA 1VETB 5DF8A 1EW0A 3QNBA 1K56D 3ULFA 4WMCD 1G6AA 1YMXA 5GLDA 1MWRA 1ES2A 3G2YA 1FSYA 2QWSA 5EM1A 5E2FA 5EOOA 1S67L 5FQMA 3FWLA 3ZG9B 2W0NA 3G32A 3IBJA 4OOYA 1G6OA 2M1CA 2L1MA 1NYYA 4Y5FA 3G31A 3OPRA 3S4XA 2HPBA 4S2KA 1VB6A 1HLUP 1V9YA 3CG5A 4KQOA 1ES3A 5HSQA 3Q7VB 1XA7A 2WKRA 1H5XA 3LGOA 3N8SA 1FCNA 2V8FA 2OAP1 1ALQA 3VV4A 2ZC4B 4WF0A 4WM9A 3CPTB 5JYPA 4HEFA 3FG8A 3V3SA 1OTBA 1IYPA 3OLOA 1LSWA 2O0YA 4HY8A 3MR0A 5EVIB 3L9KA 3T1SA 4Y0UA 2O99A 4X25A 4E6WA 1K56A 1L2SA 4WMCA 4HJ4A 5FDHA 1LT0A 1FILA 5AQBA 5FI7A 2ZQ7A 4G3WA 5HPIA 2UWXA 4N92A 1NYMA 4N9KA 1NZUA 4EEUA 4Y17A 3ITBA 2I9VA 3MXRA 3S7NA 3B42A 5F82A 1N4OA 1W5DA 2Y2MA 1KE0A 5FQJA 1H0MA 2H28A 1KVMA 5E2EA 1NWZA 5EUAA 5HD5A 3NDGA 4L9EA 3T12B 4FH2A 5HDSA 1P0ZA 2ZC6B 3MF0A 1GCEA 4EU0A 4P6ZS 3ZFZA 3LYXA 5HAIA 3HL9A 3NJAA 1XJ3A 4WBGA 4BBTA 4L9GA 4C6YA 2W3GA 3BYDA 3GMWA 1G28A 4WEJA 2W3HA 1LSXA 4LLOB 2INWA 3HJKA 5FI2A 1CQAA 4U0XA 4Y0OA 4F3LA 3SH9A 1KGGA 3BY9A 1QMEA 3OZHA 3M2KA 1ZG6A 5EVEA 3DWZA 3C38A 3Q81A 1S6RA 5G18A 2P08A 1KGEA 3KSFA 1IOUA 2EX2A 3FKWA 3UE0A 4KUOA 1SKOA 1L0DA 2CC1A 1IFQA 2BASA 3IS2B 2Y2HA 4XT2B 3C4OA 2XFSA 4GHIA 1LL5A 2LB5A 5M18A 4R3JA 3BLSA 2QKPA 1BTLA 3ZVTA 1MXOA 2ZQAA 4KZBA 4GKUA 3VMAA 2V1BA 2J3TD 3E4QA 1PW8A 1NY0A 3RXWA 2VV7A 1PWCA 2Y2GA 3VP1A 4O01A 3W4OA 5A90A 5J8XA 4M4XA 2J3WA 4I3JA 3IT9A 3CLOA 3KO6A 3LICA 3ZHHA 5CGXA 2ZMVA 2WGIA 1J9MA 4HI4A 5DKLA 4HP4A 3TG9A 2AVXA 2XD1A 1Z6FA 4CPKA 2VV8A 5FASA 2W1TA 3T4TA 3ZG5A 2Q0OA 1TDGA 1XA1A 1MZUA 2Y4AA 1OTIA 2EWVA 2XSSA 1YQSA 3ITAA 3G30A 4JGRA 1FQGA 5AQAA 3HVFA 4EQ1A 2J8YA 3C30A 4EWFA 4OOMA 3T50A 3PBOA 4HBUA 4HOIA 5FQ9A 1PIOA 1XFQA 1IYSA 2Y2KA 2VJWA 3UO9A 3DTMA 1DJBA 2GNXA 3A3JA 3DBAA 3V5MA 5CHJA 4DE3A 3DAVA 2JBFA 2WKIA 2B5RA 3OPPA 1LSVA 4R23A 4PM7A 1WYCA 5HD3A 4PKYA 4ETXA 2WZZA 5AQ7A 5L07A 4EEPA 4KG2A 4WZ4A 1RGZA 4E3NA 2OLVA 3CI6A 1LL8A 4NG2A 4QU3A 3UDXA 2HP9A 3BY8A 1T1BA 2WKPA 3F1NA 3NC8A 1E4DA 1A0KA 3MZEA 2QMIA 2Y8HA 4KG6A 5EVID 4OPRA 1I2WA 5A91A 1SKOB 4KQRA 4P0MA 1XX2A 1FSWA 1IKGA 3WS0A 1CK3A 5FL3A 1BULA 1ES4A 4HESA 4HQAA 1W63M 3BEBA 1F5MA 2PRFA 4S2JA 4E6XA 2BLSA 2L0WA 5I5LA 3A3DA 2KDKA 4DE0A 3GR2A 2K7SA 4LGWA 2K31A 5HW3A 3WRTA 3IHAA 2ZC7A 4R3AA 3IQAA 5GHZA 5L8MA 4BL3A 1IELA 3A0RA 2HDSA 3Q7VA 4HH3A 1JTDA 1DP8A 3H9WA 3QNCA 1BLPA 4YFMA 2V8CA 1Q2PA 2JE5A 3ZG7B 1YSPA 3GQZA 4E3OA 3CPTA 3C5AA 4DF6A 2ZOIA 5E2HA 1GHMA 4WLAA 1MKIA 2P7JA 1OJ5A 3H7WB 3DW0A 2WGWB 3MZDA 1MWUA 5EVIA 5IU1A 1GHIA 4BQMA 3BWLA 2E8JA 4PMAA 3GTCA 1K55C 2P74A 3PBQA 1CJFA 5L10A 2PAVP 4OKPA 3FPWA 5HWWA 5GHYA 3RXXA 1SHVA 1DP9A 1H8YA 3B3XA 1GA9A 4WUJA 4MDZA 3DTEA 1YLJA 2WKHA 3LEQA 1NXYA 4QHCA 3N8RA 3ZDJA 1UWPX 1OT9A 2PHYA 1OTEA 3KYQA 4OPZA 2M7VA 3EOIA 3IX8A 4OQ0A 1YLTA 1XKZA 2WKQA 2ZL1B 3B47A 4ZAMA 1BT5A 4LENA 1JNUA 1N9NA 3G4PA 4ME4A 1JWZA 4RX3A 2JC7A 3G2ZA 4HJ6A 2JKFA 3F1PB 5IT5A 2HDUA 2XRNA 2IWBA 3G6OA 4LCLA 4Q0JA 1FCMA 2Y2NA 5U47A 1Y28A 1MWSA 2A2LA 1GA0A 3VP3A 3SH8A 3MKFA 3T4JA 4LV2A 1K25A 4S2IA 4EXOA 2BG1A 1S4RA 3UMDA 5CGWA 2OOLA 5CX7A 3HLEA 3H82B 4GDBA 3O5YA 5CECA 3D72A 4KZ7A 3Q1FA 5FAPA 1HVBA 1K38A 4KUKA 1UGUA 3MMHA 3VOZA 4JF6A 2VEAA 3LR5A 1KDWA 1KE4A 2ZBBA 3UDFA 3IS2A 4XT2A 4BD1A 4X1MA 1GHPA 3LCEA 5DTTA 5A92A 2HZ5A 3KSGA 4BBUA 3GV9A 4FH4A 3CMZA 1PZPA 3BM6A 3HLWA 4WZ5A 2Y59A 3CITA 3VOYA 1WYBA 5EOEA 1BYWA 4BMWA 1ESUA 3ZNTA 5FQIA 1K55A 5F5YA 1LL9A 1ODVA 4XUZA 2DMWA 5HAQA 2ZOHA 3LI9A 4I39A 5HFOA 2PYPA 4EV4A 3ZQ5A 5FEFA 1W63Q 3CAXA 1CEGA 1TS0A 1I2SA 2QHKA 3VOLA 1BLSA 3NIAA 1V9ZA 1GSVA 1S4SA 2R9WA 3GDIA 4KZ3A 2ZMFA 4IHQA 5AQ9A 5MC7A 4BWIA 2DNSA 3ICYA 1YLWA 3WS5A 3TSGA 1MY8A 3WS2A 3S1YA 2XROA 3ZGAB 4HJ3A 4OQHA 4RQ9A 4KZ5A 2M7UA 4E04A 3N7WA 2RCXA 3PR6A 4MMNA 1BZAA 2JCHA 3UE1A 5EV0A 5DF9A 5DF7A 4PM5A 1VM1A 4BL2A 3QP1A 1EWZA 4CJNA 4P87A 4Y2FA 3C7VA 4JXGA 3EGDC 4MLLA 1DRMA 5GL9A 2W27A 4KZAA 4AFIA 5FI6A 5A93A 3NBLA 3T1QB 4MBKA 1CEFA 1NZOA 4FCFA 3S7PA 1TS7A 5KZHA 3HUMA 4KZ8A 1DJAA 2PBDP 3P7NA 4QB8A 5HL1A 4GCZA 3BLMA 1H8MA 3N4IA 4LCMA 3IF6B 3L7HA 2PYRA 2P04A 3UMEA 3JVUA 3NOUC 1BUEA 4EUVA 4U3TA 2KOIA 5GLBA 4GS9B 1F2KA 5DTKA 3FPVA 4I38A 1K4EA 4BD0A 2Y79A 4M3KA 4HBTA 3O87A 2EX6A 2W1RA 3E4PA 3Q07A 5CTMA 4O7DA 2H0YA 2NUPC 3UDIA 3HLGA 4DJ2A 3BFDA 4KQQA 4MN5A 2WADA 1K4FA 3MZFA 4FTXA 2ZJ9A 1IKIA 4EETB 3IH8A 1FIKA 1NLZA 1HTZA 5HAPA 4E3JA 4X53A 1Z09A 2GDNA 3HLCA 4MN6A 3LO7A 4F94A 3OCLA 4KZ4A 4GZBA 3ZVWA 3BFGA 3O88A 3PXPA 3C2WA 1L0GA 4CQHA 4EW7A 3GSGA 1IYQA 4IUKA 4OONA 1KE3A 1T19A 4LFUA 4FOFA 2B18A 3A3FA 3CWFA 1PNEA 2H5SA 4LV1A 5M19A 4ZTKA 3E98A 3PHYA 2VZWA 4BLMA 5L09A 4YINA 2FH5A 2EFXA 4LRZE 2C6WB 2XA7M 3VE3A 5BOHA 2ZQDA 2LB9A 3LIDA 3T4KA 4H8RA 3R4KA 2P9VB 1BSGA 1W7FA 3LEZA 5DVAA 5EECA 1L3LA 3ZCZA 2OSUA 4R38A 1G5UA 2VGJA 1L0FA 3H7WA 3ZG0A 4X68A 3TE8A 4OQGA 5KSCA 3G35A 2WGWA 3GVBA 2HGVA 3MKEA 2PU2A 3LIAA 4EBNA 3TRCA 2ZC5B 4DJ3A 4HNBA 4R70A 3NOTC 2D01A 4IVIA 3BW6A 3UB9A 5IS1A 4P85A 2R78A 4PM8A 4WL9A 4RVAA 1BLCA 5TFQA 1RCJA 1TDLA 3GRJA 1KDSA 1PI5A 3ZG8B 4MN7A 1GSWA 3JPUA 4E3KA 1L0EA 4EESA 1ES5A 3O86A 2QJ7A 3SOIA 4OH0A 3C8CA 3S7OA 3D3OA 5E43A 5FAQA 1M40A 3PYPA 2ZL1A 4ZRRA 4GD6A 2JKTI 4JBFA 5CRFA 4ARZA 1MPLA 1PWGA 4EBPA 1HD8A 2HJ9C 1VHMA 4N9LA 5DJTA 3F1PA 3CZDA 3M2JA 2ACGA 3KSHA 5HDDA 4EQIA 1P97A 3UE6A 4GJ4A 4HP9A 2NUTC 2O9AA 2PBYA 2VA0A 1KGFA 5J7EA 4HIAA 1JVJA 3CUEC 4K91A 3EGXC 1FR6A 3UNWA 3LI8A 4EBLA 1OT6A 3EEAA 4EERA 1K54C 2V0WA 2Y2PA 3H82A 4D60A 4Q0IA 2XR0A 3DTIA 2CMNA 4GOGA 3IF6C 4JGPA 3BFEA 4JKTA 3RTYA 1YLPA 4Y3IA 1WE4A 2DCFA 1NRFA 4YWZA 3V39A 3LY4A 2C5WB 4MCWA 2ZLYA 4X69A 4DDYA 4KZ9A 4S2NC 1TS6A 1YSQA 4X56A 2IWCA 2J9PA 3HREA 5FATA 3NULA 3PAGA 4E3MA 2A24B 2VX8A 2Y2OA 3D4FA 4FD8A 3IWIA 2QPNA 3NOPC 1N9OA 2ZD8A 1F98A 3VFFA 3UB8A 3VSKA 5HPFA 3SW1A 4OPQA 1EROA 3DTKA 4Q0HA 1H8ZA 1XJ4A 3HJIA 1O07A 1KOUA 3T4OA 4GD8A 4S2MA 1S0WA 5EPHA 4LV0A 1C3BA 3OBFA 2WKEA 4O0PA 4QY6A 3U4LP 2Q9MA 2EX9A 3T1XA 1S1ZA 2EWWA 3NI9A 5F1FA 4KZ6A 4HH2A 3PBTA 3IX4A 3LFVA 2O9CA 3HCYA 4NXEA 5CEBA 4C75A 5J3WA 1ZKJA 4WN5A 5F69A 1XJ2A 4UA6A 4IVKA 1HZOA 2FFYA 1KVLA 3JVVA 3CUEA 4JXVA 1SDNA 4WYYA 3P01A 3OCNA 5HWTA 1Y4OA 2XFTA 2XGNA 2D02A 2WAEA 1ACFA 1K6SA 3KX0X 3IF6A 4PAUA 1OPXA 4JF4A 4X1LA 5TJJA 1W79A 2Y2LA 5IHVA 4ARZB 1STZA 1YM1A 4BBVA 1MBLA 4XXRA 4UQIM 4GS9A 4JXWA 3BQ8A 3V50A 4GW9A 5F1GA 4YNRA 3BECA 4JXSA 5EM0A 2V9AA 3NHQA 3T4LA 4MBFA 3T4SA 1YMSA 3BRMA 3MXSA 5HARA 4ESPA 3LIFA 5C5KA 4X55A 4S2PA 2QYBA 3WS4A 2WK0A 4NKPA 3VP0A 2PDRA 3MBZA 1Y54A 5CEDA 4P6BA 4BJPA 2HP6A 3DWKA 1OTAA 2VV6A 2OWHA 3PBRA 4C3QA 3EEHA 5FQQA 3U2AA 4B4ZA 3FKVA 1JWVA 3W4QA 2XH9A 3A0VA 5AVEA 4GN2A 1PZOA 5AVFA 2WZXA 3A3IA 1SCWA 4RYEA 3UN7A 3MXQA 4NXGA 4ID4A 2Z2MB 1OMEA 1D06A 1H3QA 5DKKA 3E4OA 2JHEA 1E3UD 3PBNA 3NECA 1XGJA 4I5SA 1T1CA 4QD4A 1RP5A 3W2ZA 1NRJA 2UV0E 2WYXA 2ZM2A 4Y13A 3MFDA 5L2FA 3CJMA 4Z9QA 2HP5A 3OPHA 4LRXC 3W4PA 1MKMA 2HDRA 1SKFA 4PPRA 3IWQA 2Z6CA 2P9VA 3QP2A 5DJUA 4OOLA 4DMZA 2PR6A 1ZC2A 5D3OA 4OVDA 5M1AA 1VEUB 3OOVA 4R1GA 4DDSA 4FSFA 4CLCC 4S2LA 4UA7A 5E2GA 3SS4A 3IHBA 1ONHA 4OQIA 4Z1WA 3CHWP 1YLYA 3WS1A 3MQQA 1N9LA 2V2FF 5KIZA 4OLGA 2EX8A 2X01A 1X0OA 1JTGA 2JKTM 3E2KA 4JGQA 1YPRA 4H6JB 3QP6A 3N6IA 1E3UA 4B4XA 5HZHA 1FR1A 3HUOA 5CHMA 3T1RA 1IEMA 4KQDA 4E3LA 5FDSA 3GECA 2VGLM 1PI4A 4CLCD 2WAFA 2VLGA 4Y0TA 2PR5A 1O7EA 5FEGA 1DJCA 3K2NA 3IXHA 4OP8A 2ZMAA 2EXBA 2X71A 1ERMA 4B93A 2Y91A 4DE1A 4RA7A 2VGLS 4MNRA 4P6ZM 3LR4A 2YKFA 3ZNYA 3F1OA 3UPNA 5DTSA 1ZTUA 4QJGA 2QJ5A 3QHYA 1I5QA 2Q9NA 1OTDA 5AJGA 5HX9A 1LLBA 5CERA 4N1XA 5GLCA 2XDMA 2GZAA 2RL3A 3M6HA 3S22A 2IA2A 1D7EA 4R0QA 2ZQ9A 3R7WB 4LV3A 2J3TC 4UA9A 3FC7A 1W8YA 4BENA 3MQ0A 3SS3A 4G3VA 2PD8A 2Y2QA 5I94A 1P9WA 1DY6A 3SH7A 5KSHA 2WGVA 2OAQ1 4CLCA 5FAOA 3UB5P 3VSLA 2A49A 2A24A 4R3BA 4QWOA 3HLDA 5J4EA 5G4YA 2HDQA 1U60A 1ZG4A 4OLDA 3A0SA 1NLYA 2Z6DA 4UEYA 4B9OA 1GSXA 2W3EA 2DRWA 2EA9A 4NEED 2W3FA 2JKRM 5TBMA 3FZCA 3IF5A 4UHUA 3WWXA 2FFFB 5DFXA 2IWDA 1F9IA 4DE2A 4IUHA 4JPMA 3QP5A 3WRZA 3KSIA 4IJGA 3P09A 4WELA 5TR7A 2XA7S 3B33A 3IH9A 1ESIA 3AGEA 3SS5A 4L9FA 2XLNA 2ZC3B 5EE8A 4JLFA 5LBRA 5HDCA 2J7VA 1N9BA 1YLZA 4L0LA 5JYOA 3UE3A 1XP4A 3LIBA 2Y2JA 4D2OA
chains in the Genus database with same CATH topology
5CGWA 4ZBEA 5FQJA 3HLEA 4GDBA 1KVMA 3C7UA 4KG5A 5CECA 4KZ7A 5E2EA 3Q1FA 3VSKA 5FAPA 1BLHA 1HVBA 5EUAA 4U0TA 1K38A 4OPQA 3NDGA 3VOZA 1EROA 2XF3A 1H8ZA 4JF6A 1O07A 1KDWA 1KE4A 4FH2A 4GD8A 4KENB 1FCOA 3UDFA 2ZQ8A 2ZC6B 4S2MA 5CXWA 1GCEA 4BD1A 1S0WA 5EPHA 1GHPA 3LCEA 1C3BA 4LV0A 1AXBA 5DTTA 5A92A 2WKEA 3GV9A 4QY6A 4FH4A 3ZFZA 2Q9MA 2EX9A 3CMZA 4QY5A 1PZPA 4MBHA 3NI9A 2X02A 2ZM8A 4JF5A 5HAIA 3BM6A 3HLWA 5F1FA 4WZ5A 3HL9A 4WBGA 4C6YA 2E8IA 4KZ6A 3BYDA 3GMWA 3HBRA 3PBTA 2Y59A 3NDEA 4WEJA 4WEKA 4B88A 3VOYA 1WYBA 5CEBA 5FI2A 4U0XA 1ERQA 4Y0OA 5EOEA 4C75A 3SH9A 1KGGA 1QMEA 1ESUA 3ZNTA 5FQIA 2VGKA 3OZHA 1K55A 1ZKJA 3M2KA 1LL9A 1ZG6A 2Y55A 4XUZA 3DWZA 1LI9A 3Q81A 5HAQA 1S6RA 4IEDA 2J9OA 5FA7A 5G18A 5HFOA 4IBXA 4EV4A 3HUNA 1VQQA 4UA6A 1KGEA 4IVKA 1HZOA 2H0TA 3EQVA 1CEGA 5EVIC 1I2SA 2EX2A 1KVLA 2FFYA 3FKWA 3UE0A 4JXVA 2R9XA 1SDNA 1BLSA 3NIAA 2PU4A 4WYYA 1L0DA 2CC1A 2R9WA 3OCNA 1XPBA 2Y2HA 4KZ3A 5AQ9A 3C4OA 2XFSA 4OPYA 1LL5A 1ONGA 5M18A 4R3JA 1NJ4A 2DNSA 2XFTA 1YT4A 3BLSA 4ZDXA 1YLWA 1LI0A 2XGNA 3WS5A 2WAEA 1K6SA 1EI5A 3UPOA 1BTLA 3TSGA 3IF6A 3ZVTA 3JYIA 1MY8A 1MXOA 2ZQAA 4KZBA 2ZQCA 4GKUA 3WS2A 4JF4A 3S1YA 3VMAA 3ZGAB 5KMWA 1W79A 2Y2LA 5IHVA 3FYZA 1YM1A 4OQHA 1MBLA 4A5RA 4XXRA 4KZ5A 2ZM0A 2G2UA 3N7WA 2RCXA 4JXWA 5EVLA 3VP2A 2H10A 3V50A 1PW8A 1BZAA 2JCHA 5F1GA 1NY0A 2QZ6A 3BECA 3RXWA 3UE1A 4Y7PA 4JXSA 1PWCA 2Y2GA 5DF9A 5DF7A 4PM5A 3VP1A 3V3RA 3W4OA 5A90A 1VM1A 5J8XA 4MBFA 4BL2A 4EUZA 1YMSA 4R4SA 3BRMA 1EWZA 3MXSA 5HARA 4CJNA 4P87A 3IT9A 3C7VA 3ZHHA 4X55A 4JXGA 4NK3A 4MLLA 5CGXA 4S2PA 5GL9A 4KZAA 1FOFA 2WUQA 3WS4A 4Q8IA 2WGIA 1J9MA 3EQUA 5FI6A 5A93A 2WK0A 3NBLA 3ISGA 3BFCA 4MBKA 5CGSA 3VP0A 1CEFA 5FSRA 1NZOA 3MBZA 4FCFA 1Y54A 2XD5A 4P6BA 5CEDA 4BJPA 3PAEA 2HP6A 5KZHA 3DWKA 3HUMA 3TG9A 4KZ8A 1DJAA 1CI9A 4QB8A 5HL1A 1MWTA 3BLMA 1XGIA 2I72A 3N4IA 4LCMA 3IF6B 2XD1A 1Z6FA 4CPKA 3PBRA 4C3QA 5FQQA 4DXCA 5FASA 4B4ZA 3ZG5A 3FKVA 1JWVA 1BUEA 3BFFA 3W4QA 1CI8A 2XH9A 1TDGA 4U3TA 1XA1A 5GLBA 2Y4AA 4GN2A 1M6KA 1QMFA 2Y2IA 5DTKA 1K4EA 1YQSA 3ITAA 3G30A 4BD0A 4M3KA 4HBTA 4DKIA 1FQGA 3O87A 4GDNA 5AQAA 3HVFA 1PZOA 2WZXA 2EX6A 5FQKA 3A3IA 2J8YA 1SCWA 4RYEA 3I7JA 3Q07A 5CTMA 4EWFA 1K57C 4OOMA 3LY3A 4UAAA 3Q82A 3UN7A 4ID4A 2Z2MB 1OMEA 1PYYA 3IXBA 4GB7A 3PBOA 4O7DA 1W8QA 2H0YA 4HBUA 3E2LA 5FQ9A 1E3UD 1PIOA 3UDIA 3PBNA 3HLGA 3BFDA 1XGJA 4KQQA 2V20A 2WADA 1K4FA 3MZFA 1IYSA 4QD4A 2Y2KA 1RP5A 3UO9A 1TEMA 3AGDA 2ZJ9A 1IKIA 3DTMA 3IH8A 1DJBA 4WZ5C 3A3JA 2WYXA 1HTZA 3M6BA 3V5MA 2XK1A 2ZM2A 3MFDA 5L2FA 3IXGA 3CJMA 3G34A 2HP5A 5CHJA 3OPHA 4Z9QA 4DE3A 3IXDA 3W4PA 4OP5A 5HAPA 2HDRA 1SKFA 4E3JA 4XUXA 4PPRA 1TVFA 2JBFA 4X53A 2GDNA 3HLCA 2WKIA 3IWQA 4N1HA 2P9VA 2B5RA 3OPPA 1G68A 3LO7A 4OOLA 4F94A 3OCLA 4KZ4A 3N8LA 4GZBA 4R23A 1K54A 1ZC2A 4PM7A 1WYCA 1K6RA 2XQZA 3ZVWA 5D3OA 2OV5A 4OVDA 3BFGA 3O88A 5M1AA 4R1GA 4DDSA 4FSFA 4S2LA 2WZZA 5AQ7A 1L0GA 4UA7A 4KG2A 4WZ4A 1RGZA 3GSGA 4E3NA 5E2GA 3SS4A 3IHBA 1IYQA 2OLVA 1IYOA 4OONA 1KE3A 3UPPA 3VP4A 1ONHA 3W8KA 3RJUA 4OQIA 3AGFA 1YLYA 2EXAA 1Q2QA 3WS1A 1JWPA 1LHYA 1SDEA 3A3FA 2H5SA 4LV1A 4QU3A 5GLAA 3UDXA 5M19A 2HP9A 2V2FF 4S2NA 1PW1A 4ZTKA 4OLGA 2EX8A 3C4PA 2X01A 4BLMA 4YINA 2EFXA 2C6WB 3VFHA 3A3EA 1JTGA 5BOHA 3NC8A 1E4DA 5TGFA 3HLFA 3E2KA 2XEPA 2ZQDA 3MZEA 3OC2A 2QMIA 4GNUA 4KG6A 5EVID 5GHXA 4OPRA 4S2OA 3N6IA 5CTNA 1I2WA 4H8RA 1E3UA 4X6TA 4B4XA 2Z2LB 3IWOA 3TOIA 1FR1A 2P9VB 3HUOA 1BSGA 5A91A 4KQRA 1W7FA 5F83A 3NY4A 3LEZA 5CHMA 4P0MA 1XX2A 1IEMA 1FSWA 5DVAA 5EECA 3ZCZA 4DRTA 1IKGA 2OSUA 4K0XA 3UY6A 4ZJ3A 3HLBA 1CK3A 2OLUA 3FV7A 3WS0A 2VGJA 1BULA 1ES4A 4HESA 4RX2A 4E3LA 3BEBA 1L0FA 1PI4A 3ZG0A 4X68A 4OQGA 5KSCA 3G35A 2WGWA 3Q7ZA 2WAFA 3GVBA 4MEZA 4PM6A 3MKEA 4S2JA 2PU2A 4Y0TA 1PWDA 4E6XA 2BLSA 4EBNA 1O7EA 1XXMA 2ZC5B 3NCKA 1DJCA 3A3DA 4DE0A 3IXHA 2EFUA 3GR2A 4OP8A 4PM9A 2ZMAA 4DXBA 5HW3A 3WRTA 2EXBA 2X71A 3IHAA 4IVIA 2ZC7A 4NETA 1ERMA 3IQAA 5GHZA 2Y91A 4DE1A 4RA7A 4BL3A 4P85A 4PM8A 4MNRA 1IELA 4RVAA 2G2WA 2V1ZA 1BLCA 4ZJ2A 5TFQA 3P98A 1RCJA 1TDLA 2HDSA 3O3VA 3PTEA 3Q7VA 3UPNA 3GRJA 5DTSA 5CHUA 3ZNYA 4QJGA 1KDSA 3QHYA 1JTDA 3PBSA 1I5QA 1PI5A 4R4RA 1K57A 3ZG8B 4ZJ1A 2Q9NA 3QNCA 1RGYA 4E3IA 1BLPA 4K0WA 3OPLA 4YFMA 2A3UA 5HX9A 1E25A 1LLBA 4IBRA 4E3KA 5CERA 1L0EA 1Q2PA 4N1XA 1ES5A 2JE5A 3O86A 3GQZA 5GLCA 3ZG7B 4E3OA 2XDMA 3C5AA 3SOIA 4DF6A 5DF8A 3QNBA 1K56D 2RL3A 3M6HA 4OH0A 3S22A 4WMCD 5E2HA 5E43A 1GHMA 1G6AA 4R0QA 1YMXA 5FAQA 1MKIA 1M40A 1MWRA 2ZQ9A 5GLDA 1ES2A 3DW0A 3G2YA 1FSYA 4GD6A 4JBFA 2WGWB 5CRFA 3MZDA 1MPLA 1MWUA 1PWGA 4LV3A 5EVIA 4EBPA 1HD8A 5E2FA 5EOOA 5FQMA 4UA9A 1GHIA 4BQMA 3FWLA 1W8YA 3ZG9B 4BENA 3G32A 4OOYA 4PMAA 4N9LA 3SS3A 1NYYA 3CZDA 3G31A 3OPRA 3M2JA 3GTCA 1K55C 2Y2QA 2P74A 3PBQA 3S4XA 2HPBA 4EQIA 5I94A 4S2KA 1DY6A 4OKPA 3CG5A 3SH7A 5KSHA 5GHYA 2WGVA 3RXXA 1SHVA 4KQOA 1ES3A 1H8YA 3B3XA 5FAOA 1GA9A 2PBYA 3Q7VB 3VSLA 1XA7A 2A49A 1KGFA 1H5XA 4R3BA 1YLJA 2WKHA 1JVJA 3N8SA 1FCNA 3HLDA 1NXYA 4K91A 4QHCA 3N8RA 2HDQA 1ALQA 1U60A 1FR6A 1ZG4A 4OLDA 3UNWA 3ZDJA 4EBLA 2ZC4B 1K54C 4OPZA 2Y2PA 4WM9A 5JYPA 4HEFA 3V3SA 2DRWA 2XR0A 1IYPA 4OQ0A 3FZCA 1YLTA 4GOGA 3IF6C 1XKZA 3IF5A 3BFEA 4UHUA 3WWXA 2FFFB 4ZAMA 1BT5A 2IWDA 4JKTA 5EVIB 1YLPA 4LENA 4DE2A 1WE4A 2DCFA 4JPMA 3G4PA 4RX3A 1JWZA 1NRFA 3WRZA 3V39A 4Y0UA 3LY4A 2C5WB 2JC7A 3P09A 3G2ZA 4WELA 2ZLYA 4X69A 4DDYA 4E6WA 4KZ9A 4S2NC 1K56A 1L2SA 5TR7A 4WMCA 2HDUA 4X56A 3IH9A 1ESIA 2IWCA 5FDHA 2J9PA 3HREA 3AGEA 2IWBA 3SS5A 4LCLA 5FATA 5AQBA 1FCMA 5FI7A 2XLNA 2ZC3B 2Y2NA 2ZQ7A 4JLFA 2UWXA 5EE8A 4N92A 5U47A 1NYMA 3PAGA 4N9KA 2J7VA 4E3MA 1NZUA 1MWSA 1N9BA 1GA0A 1YLZA 2Y2OA 3D4FA 4L0LA 3SH8A 3VP3A 3MKFA 4FD8A 3ITBA 4LV2A 3IWIA 1K25A 5JYOA 3MXRA 1XP4A 2QPNA 3UE3A 4S2IA 2Y2JA 4D2OA 5F82A 1N4OA 2BG1A 2ZD8A 1W5DA 2Y2MA 1KE0A 3VFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CGW A;  4ZBE A;  5FQJ A;  3HLE A;  4GDB A;  1KVM A;  3C7U A;  4KG5 A;  5CEC A;  4KZ7 A;  5E2E A;  3Q1F A;  3VSK A;  5FAP A;  1BLH A;  1HVB A;  5EUA A;  4U0T A;  1K38 A;  4OPQ A;  3NDG A;  3VOZ A;  1ERO A;  2XF3 A;  1H8Z A;  4JF6 A;  1O07 A;  1KDW A;  1KE4 A;  4FH2 A;  4GD8 A;  4KEN B;  1FCO A;  3UDF A;  2ZQ8 A;  2ZC6 B;  4S2M A;  5CXW A;  1GCE A;  4BD1 A;  1S0W A;  5EPH A;  1GHP A;  3LCE A;  1C3B A;  4LV0 A;  1AXB A;  5DTT A;  5A92 A;  2WKE A;  3GV9 A;  4QY6 A;  4FH4 A;  3ZFZ A;  2Q9M A;  2EX9 A;  3CMZ A;  4QY5 A;  1PZP A;  4MBH A;  3NI9 A;  2X02 A;  2ZM8 A;  4JF5 A;  5HAI A;  3BM6 A;  3HLW A;  5F1F A;  4WZ5 A;  3HL9 A;  4WBG A;  4C6Y A;  2E8I A;  4KZ6 A;  3BYD A;  3GMW A;  3HBR A;  3PBT A;  2Y59 A;  3NDE A;  4WEJ A;  4WEK A;  4B88 A;  3VOY A;  1WYB A;  5CEB A;  5FI2 A;  4U0X A;  1ERQ A;  4Y0O A;  5EOE A;  4C75 A;  3SH9 A;  1KGG A;  1QME A;  1ESU A;  3ZNT A;  5FQI A;  2VGK A;  3OZH A;  1K55 A;  1ZKJ A;  3M2K A;  1LL9 A;  1ZG6 A;  2Y55 A;  4XUZ A;  3DWZ A;  1LI9 A;  3Q81 A;  5HAQ A;  1S6R A;  4IED A;  2J9O A;  5FA7 A;  5G18 A;  5HFO A;  4IBX A;  4EV4 A;  3HUN A;  1VQQ A;  4UA6 A;  1KGE A;  4IVK A;  1HZO A;  2H0T A;  3EQV A;  1CEG A;  5EVI C;  1I2S A;  2EX2 A;  1KVL A;  2FFY A;  3FKW A;  3UE0 A;  4JXV A;  2R9X A;  1SDN A;  1BLS A;  3NIA A;  2PU4 A;  4WYY A;  1L0D A;  2CC1 A;  2R9W A;  3OCN A;  1XPB A;  2Y2H A;  4KZ3 A;  5AQ9 A;  3C4O A;  2XFS A;  4OPY A;  1LL5 A;  1ONG A;  5M18 A;  4R3J A;  1NJ4 A;  2DNS A;  2XFT A;  1YT4 A;  3BLS A;  4ZDX A;  1YLW A;  1LI0 A;  2XGN A;  3WS5 A;  2WAE A;  1K6S A;  1EI5 A;  3UPO A;  1BTL A;  3TSG A;  3IF6 A;  3ZVT A;  3JYI A;  1MY8 A;  1MXO A;  2ZQA A;  4KZB A;  2ZQC A;  4GKU A;  3WS2 A;  4JF4 A;  3S1Y A;  3VMA A;  3ZGA B;  5KMW A;  1W79 A;  2Y2L A;  5IHV A;  3FYZ A;  1YM1 A;  4OQH A;  1MBL A;  4A5R A;  4XXR A;  4KZ5 A;  2ZM0 A;  2G2U A;  3N7W A;  2RCX A;  4JXW A;  5EVL A;  3VP2 A;  2H10 A;  3V50 A;  1PW8 A;  1BZA A;  2JCH A;  5F1G A;  1NY0 A;  2QZ6 A;  3BEC A;  3RXW A;  3UE1 A;  4Y7P A;  4JXS A;  1PWC A;  2Y2G A;  5DF9 A;  5DF7 A;  4PM5 A;  3VP1 A;  3V3R A;  3W4O A;  5A90 A;  1VM1 A;  5J8X A;  4MBF A;  4BL2 A;  4EUZ A;  1YMS A;  4R4S A;  3BRM A;  1EWZ A;  3MXS A;  5HAR A;  4CJN A;  4P87 A;  3IT9 A;  3C7V A;  3ZHH A;  4X55 A;  4JXG A;  4NK3 A;  4MLL A;  5CGX A;  4S2P A;  5GL9 A;  4KZA A;  1FOF A;  2WUQ A;  3WS4 A;  4Q8I A;  2WGI A;  1J9M A;  3EQU A;  5FI6 A;  5A93 A;  2WK0 A;  3NBL A;  3ISG A;  3BFC A;  4MBK A;  5CGS A;  3VP0 A;  1CEF A;  5FSR A;  1NZO A;  3MBZ A;  4FCF A;  1Y54 A;  2XD5 A;  4P6B A;  5CED A;  4BJP A;  3PAE A;  2HP6 A;  5KZH A;  3DWK A;  3HUM A;  3TG9 A;  4KZ8 A;  1DJA A;  1CI9 A;  4QB8 A;  5HL1 A;  1MWT A;  3BLM A;  1XGI A;  2I72 A;  3N4I A;  4LCM A;  3IF6 B;  2XD1 A;  1Z6F A;  4CPK A;  3PBR A;  4C3Q A;  5FQQ A;  4DXC A;  5FAS A;  4B4Z A;  3ZG5 A;  3FKV A;  1JWV A;  1BUE A;  3BFF A;  3W4Q A;  1CI8 A;  2XH9 A;  1TDG A;  4U3T A;  1XA1 A;  5GLB A;  2Y4A A;  4GN2 A;  1M6K A;  1QMF A;  2Y2I A;  5DTK A;  1K4E A;  1YQS A;  3ITA A;  3G30 A;  4BD0 A;  4M3K A;  4HBT A;  4DKI A;  1FQG A;  3O87 A;  4GDN A;  5AQA A;  3HVF A;  1PZO A;  2WZX A;  2EX6 A;  5FQK A;  3A3I A;  2J8Y A;  1SCW A;  4RYE A;  3I7J A;  3Q07 A;  5CTM A;  4EWF A;  1K57 C;  4OOM A;  3LY3 A;  4UAA A;  3Q82 A;  3UN7 A;  4ID4 A;  2Z2M B;  1OME A;  1PYY A;  3IXB A;  4GB7 A;  3PBO A;  4O7D A;  1W8Q A;  2H0Y A;  4HBU A;  3E2L A;  5FQ9 A;  1E3U D;  1PIO A;  3UDI A;  3PBN A;  3HLG A;  3BFD A;  1XGJ A;  4KQQ A;  2V20 A;  2WAD A;  1K4F A;  3MZF A;  1IYS A;  4QD4 A;  2Y2K A;  1RP5 A;  3UO9 A;  1TEM A;  3AGD A;  2ZJ9 A;  1IKI A;  3DTM A;  3IH8 A;  1DJB A;  4WZ5 C;  3A3J A;  2WYX A;  1HTZ A;  3M6B A;  3V5M A;  2XK1 A;  2ZM2 A;  3MFD A;  5L2F A;  3IXG A;  3CJM A;  3G34 A;  2HP5 A;  5CHJ A;  3OPH A;  4Z9Q A;  4DE3 A;  3IXD A;  3W4P A;  4OP5 A;  5HAP A;  2HDR A;  1SKF A;  4E3J A;  4XUX A;  4PPR A;  1TVF A;  2JBF A;  4X53 A;  2GDN A;  3HLC A;  2WKI A;  3IWQ A;  4N1H A;  2P9V A;  2B5R A;  3OPP A;  1G68 A;  3LO7 A;  4OOL A;  4F94 A;  3OCL A;  4KZ4 A;  3N8L A;  4GZB A;  4R23 A;  1K54 A;  1ZC2 A;  4PM7 A;  1WYC A;  1K6R A;  2XQZ A;  3ZVW A;  5D3O A;  2OV5 A;  4OVD A;  3BFG A;  3O88 A;  5M1A A;  4R1G A;  4DDS A;  4FSF A;  4S2L A;  2WZZ A;  5AQ7 A;  1L0G A;  4UA7 A;  4KG2 A;  4WZ4 A;  1RGZ A;  3GSG A;  4E3N A;  5E2G A;  3SS4 A;  3IHB A;  1IYQ A;  2OLV A;  1IYO A;  4OON A;  1KE3 A;  3UPP A;  3VP4 A;  1ONH A;  3W8K A;  3RJU A;  4OQI A;  3AGF A;  1YLY A;  2EXA A;  1Q2Q A;  3WS1 A;  1JWP A;  1LHY A;  1SDE A;  3A3F A;  2H5S A;  4LV1 A;  4QU3 A;  5GLA A;  3UDX A;  5M19 A;  2HP9 A;  2V2F F;  4S2N A;  1PW1 A;  4ZTK A;  4OLG A;  2EX8 A;  3C4P A;  2X01 A;  4BLM A;  4YIN A;  2EFX A;  2C6W B;  3VFH A;  3A3E A;  1JTG A;  5BOH A;  3NC8 A;  1E4D A;  5TGF A;  3HLF A;  3E2K A;  2XEP A;  2ZQD A;  3MZE A;  3OC2 A;  2QMI A;  4GNU A;  4KG6 A;  5EVI D;  5GHX A;  4OPR A;  4S2O A;  3N6I A;  5CTN A;  1I2W A;  4H8R A;  1E3U A;  4X6T A;  4B4X A;  2Z2L B;  3IWO A;  3TOI A;  1FR1 A;  2P9V B;  3HUO A;  1BSG A;  5A91 A;  4KQR A;  1W7F A;  5F83 A;  3NY4 A;  3LEZ A;  5CHM A;  4P0M A;  1XX2 A;  1IEM A;  1FSW A;  5DVA A;  5EEC A;  3ZCZ A;  4DRT A;  1IKG A;  2OSU A;  4K0X A;  3UY6 A;  4ZJ3 A;  3HLB A;  1CK3 A;  2OLU A;  3FV7 A;  3WS0 A;  2VGJ A;  1BUL A;  1ES4 A;  4HES A;  4RX2 A;  4E3L A;  3BEB A;  1L0F A;  1PI4 A;  3ZG0 A;  4X68 A;  4OQG A;  5KSC A;  3G35 A;  2WGW A;  3Q7Z A;  2WAF A;  3GVB A;  4MEZ A;  4PM6 A;  3MKE A;  4S2J A;  2PU2 A;  4Y0T A;  1PWD A;  4E6X A;  2BLS A;  4EBN A;  1O7E A;  1XXM A;  2ZC5 B;  3NCK A;  1DJC A;  3A3D A;  4DE0 A;  3IXH A;  2EFU A;  3GR2 A;  4OP8 A;  4PM9 A;  2ZMA A;  4DXB A;  5HW3 A;  3WRT A;  2EXB A;  2X71 A;  3IHA A;  4IVI A;  2ZC7 A;  4NET A;  1ERM A;  3IQA A;  5GHZ A;  2Y91 A;  4DE1 A;  4RA7 A;  4BL3 A;  4P85 A;  4PM8 A;  4MNR A;  1IEL A;  4RVA A;  2G2W A;  2V1Z A;  1BLC A;  4ZJ2 A;  5TFQ A;  3P98 A;  1RCJ A;  1TDL A;  2HDS A;  3O3V A;  3PTE A;  3Q7V A;  3UPN A;  3GRJ A;  5DTS A;  5CHU A;  3ZNY A;  4QJG A;  1KDS A;  3QHY A;  1JTD A;  3PBS A;  1I5Q A;  1PI5 A;  4R4R A;  1K57 A;  3ZG8 B;  4ZJ1 A;  2Q9N A;  3QNC A;  1RGY A;  4E3I A;  1BLP A;  4K0W A;  3OPL A;  4YFM A;  2A3U A;  5HX9 A;  1E25 A;  1LLB A;  4IBR A;  4E3K A;  5CER A;  1L0E A;  1Q2P A;  4N1X A;  1ES5 A;  2JE5 A;  3O86 A;  3GQZ A;  5GLC A;  3ZG7 B;  4E3O A;  2XDM A;  3C5A A;  3SOI A;  4DF6 A;  5DF8 A;  3QNB A;  1K56 D;  2RL3 A;  3M6H A;  4OH0 A;  3S22 A;  4WMC D;  5E2H A;  5E43 A;  1GHM A;  1G6A A;  4R0Q A;  1YMX A;  5FAQ A;  1MKI A;  1M40 A;  1MWR A;  2ZQ9 A;  5GLD A;  1ES2 A;  3DW0 A;  3G2Y A;  1FSY A;  4GD6 A;  4JBF A;  2WGW B;  5CRF A;  3MZD A;  1MPL A;  1MWU A;  1PWG A;  4LV3 A;  5EVI A;  4EBP A;  1HD8 A;  5E2F A;  5EOO A;  5FQM A;  4UA9 A;  1GHI A;  4BQM A;  3FWL A;  1W8Y A;  3ZG9 B;  4BEN A;  3G32 A;  4OOY A;  4PMA A;  4N9L A;  3SS3 A;  1NYY A;  3CZD A;  3G31 A;  3OPR A;  3M2J A;  3GTC A;  1K55 C;  2Y2Q A;  2P74 A;  3PBQ A;  3S4X A;  2HPB A;  4EQI A;  5I94 A;  4S2K A;  1DY6 A;  4OKP A;  3CG5 A;  3SH7 A;  5KSH A;  5GHY A;  2WGV A;  3RXX A;  1SHV A;  4KQO A;  1ES3 A;  1H8Y A;  3B3X A;  5FAO A;  1GA9 A;  2PBY A;  3Q7V B;  3VSL A;  1XA7 A;  2A49 A;  1KGF A;  1H5X A;  4R3B A;  1YLJ A;  2WKH A;  1JVJ A;  3N8S A;  1FCN A;  3HLD A;  1NXY A;  4K91 A;  4QHC A;  3N8R A;  2HDQ A;  1ALQ A;  1U60 A;  1FR6 A;  1ZG4 A;  4OLD A;  3UNW A;  3ZDJ A;  4EBL A;  2ZC4 B;  1K54 C;  4OPZ A;  2Y2P A;  4WM9 A;  5JYP A;  4HEF A;  3V3S A;  2DRW A;  2XR0 A;  1IYP A;  4OQ0 A;  3FZC A;  1YLT A;  4GOG A;  3IF6 C;  1XKZ A;  3IF5 A;  3BFE A;  4UHU A;  3WWX A;  2FFF B;  4ZAM A;  1BT5 A;  2IWD A;  4JKT A;  5EVI B;  1YLP A;  4LEN A;  4DE2 A;  1WE4 A;  2DCF A;  4JPM A;  3G4P A;  4RX3 A;  1JWZ A;  1NRF A;  3WRZ A;  3V39 A;  4Y0U A;  3LY4 A;  2C5W B;  2JC7 A;  3P09 A;  3G2Z A;  4WEL A;  2ZLY A;  4X69 A;  4DDY A;  4E6W A;  4KZ9 A;  4S2N C;  1K56 A;  1L2S A;  5TR7 A;  4WMC A;  2HDU A;  4X56 A;  3IH9 A;  1ESI A;  2IWC A;  5FDH A;  2J9P A;  3HRE A;  3AGE A;  2IWB A;  3SS5 A;  4LCL A;  5FAT A;  5AQB A;  1FCM A;  5FI7 A;  2XLN A;  2ZC3 B;  2Y2N A;  2ZQ7 A;  4JLF A;  2UWX A;  5EE8 A;  4N92 A;  5U47 A;  1NYM A;  3PAG A;  4N9K A;  2J7V A;  4E3M A;  1NZU A;  1MWS A;  1N9B A;  1GA0 A;  1YLZ A;  2Y2O A;  3D4F A;  4L0L A;  3SH8 A;  3VP3 A;  3MKF A;  4FD8 A;  3ITB A;  4LV2 A;  3IWI A;  1K25 A;  5JYO A;  3MXR A;  1XP4 A;  2QPN A;  3UE3 A;  4S2I A;  2Y2J A;  4D2O A;  5F82 A;  1N4O A;  2BG1 A;  2ZD8 A;  1W5D A;  2Y2M A;  1KE0 A;  3VFF A; 
#chains in the Genus database with same CATH topology
 4ZBE A;  2YKH A;  4KG5 A;  3C7U A;  5HWV A;  2JN7 A;  4FUW A;  1BLH A;  4U0T A;  3E0Y A;  4R6L A;  2XF3 A;  1T1A A;  4Y15 A;  1SZV A;  4KEN B;  1FCO A;  1TD5 A;  2ZQ8 A;  5CXW A;  3QP8 A;  1AXB A;  4QPR A;  4O8G A;  4QY5 A;  4MBH A;  2X02 A;  2ZM8 A;  4JF5 A;  1YKD A;  2JKG A;  2V0U A;  2E8I A;  3HBR A;  3NDE A;  4WEK A;  4B88 A;  1D1J A;  1ERQ A;  3EWK A;  3LUQ A;  2VGK A;  5A8B A;  4GLQ A;  2Y55 A;  1LI9 A;  5K5B A;  4IED A;  2J9O A;  5FA7 A;  3BQA A;  4IBX A;  3HUN A;  3UB7 A;  1VQQ A;  4LRY C;  3F1O B;  2H0T A;  3EQV A;  5EVI C;  2R9X A;  2PU4 A;  3D9Y A;  1XPB A;  4OPY A;  1XJ6 A;  1ONG A;  4G3K A;  1NJ4 A;  3LR3 A;  1YT4 A;  4ZDX A;  1LI0 A;  2V1A A;  1EI5 A;  3UPO A;  3VE4 A;  3MSH A;  3JYI A;  1P9R A;  2ZQC A;  5KMW A;  3FYZ A;  3K3C A;  1XFN A;  4A5R A;  2ZM0 A;  1OJG A;  2G2U A;  5G4Z A;  2VK3 A;  1J3W A;  4F3L B;  5EVL A;  3VP2 A;  2H10 A;  2QZ6 A;  4Y7P A;  2KLI A;  2G7U A;  3IBR A;  3V3R A;  1T18 A;  1WA9 A;  4CLC B;  4EUZ A;  4R4S A;  3S7Q A;  3TJZ C;  4I3A A;  4YOF A;  4NK3 A;  4I3I A;  1FOF A;  2WUQ A;  4Q8I A;  3EQU A;  5F6A A;  3SZT A;  3ISG A;  3BFC A;  5CGS A;  3T4Q A;  5FSR A;  2GJ3 A;  1VET A;  4LPZ A;  2XD5 A;  4GHI B;  3PAE A;  1CI9 A;  1MWT A;  2OWJ A;  3K3D A;  3LR0 A;  1XGI A;  2I72 A;  5TBM B;  4NXB A;  4PHT A;  3V67 A;  4DXC A;  2HV1 A;  1CF0 A;  3BFF A;  1MC0 A;  1CI8 A;  2B02 A;  1DP6 A;  1M6K A;  1QMF A;  2Y2I A;  3BJN A;  4DKI A;  1VEU A;  4GDN A;  5FQK A;  2GX5 A;  2JKR I;  3I7J A;  1PRQ A;  1K57 C;  3LY3 A;  4UAA A;  3Q82 A;  1PYY A;  3IXB A;  4GB7 A;  4HHD A;  5EFW A;  1W8Q A;  3E2L A;  2B95 A;  4K08 A;  2V20 A;  1TEM A;  2W3D A;  3AGD A;  5DFY A;  1TS8 A;  4WZ5 C;  3M6B A;  2BTF P;  2XK1 A;  3LIE A;  3IXG A;  3G34 A;  2PT7 A;  3IXD A;  4OP5 A;  2W1T B;  4H6J A;  4XUX A;  1S1Y A;  4ETZ A;  1TVF A;  4N1H A;  1G68 A;  3N8L A;  1K54 A;  1K6R A;  2XQZ A;  4II7 A;  2OV5 A;  3MS6 A;  2K2N A;  4DN0 A;  4JGO A;  3UPP A;  3VP4 A;  1IYO A;  3W8K A;  3RJU A;  4CLC E;  3AGF A;  2EXA A;  3KYZ A;  1Q2Q A;  1JWP A;  1LHY A;  1TF1 A;  1SDE A;  3MFX A;  2J80 A;  5GLA A;  1S66 L;  4S2N A;  1PW1 A;  3C4P A;  3VFH A;  3A3E A;  1PFL A;  5TGF A;  3HLF A;  3IX3 A;  2HF6 A;  2XEP A;  3MJQ A;  5GHX A;  3OC2 A;  4GNU A;  4S2O A;  5CTN A;  4UQI S;  3UB6 A;  3ZYT A;  4X6T A;  2Z2L B;  3IWO A;  3TOI A;  5F83 A;  2O9B A;  2HJE A;  3RFB A;  3KYE A;  1AWI A;  3NY4 A;  5HL6 A;  3TW8 A;  1K0K A;  4DRT A;  4K0X A;  3UY6 A;  2FZ0 A;  4ZJ3 A;  3HLB A;  2OLU A;  3FV7 A;  5F68 A;  4RX2 A;  3QP4 A;  3R7W A;  3MQO A;  3Q7Z A;  4MEZ A;  4PM6 A;  2VKS A;  1PWD A;  1XXM A;  3NCK A;  1UWN X;  2EFU A;  4PM9 A;  4DXB A;  4NET A;  2KX6 A;  2MJ6 A;  1YAX A;  2G2W A;  2V1Z A;  4ZJ2 A;  3P98 A;  3PTE A;  3O3V A;  5CHU A;  3F1N B;  1ZHH B;  4PKY G;  3RH8 B;  3PBS A;  4R4R A;  1K57 A;  4ZJ1 A;  4NXF A;  1RGY A;  2PD7 A;  4E3I A;  4K0W A;  3OPL A;  2L4R A;  2A3U A;  1E25 A;  4IBR A;  1VET B;  5DF8 A;  1EW0 A;  3QNB A;  1K56 D;  3ULF A;  4WMC D;  1G6A A;  1YMX A;  5GLD A;  1MWR A;  1ES2 A;  3G2Y A;  1FSY A;  2QWS A;  5EM1 A;  5E2F A;  5EOO A;  1S67 L;  5FQM A;  3FWL A;  3ZG9 B;  2W0N A;  3G32 A;  3IBJ A;  4OOY A;  1G6O A;  2M1C A;  2L1M A;  1NYY A;  4Y5F A;  3G31 A;  3OPR A;  3S4X A;  2HPB A;  4S2K A;  1VB6 A;  1HLU P;  1V9Y A;  3CG5 A;  4KQO A;  1ES3 A;  5HSQ A;  3Q7V B;  1XA7 A;  2WKR A;  1H5X A;  3LGO A;  3N8S A;  1FCN A;  2V8F A;  2OAP 1;  1ALQ A;  3VV4 A;  2ZC4 B;  4WF0 A;  4WM9 A;  3CPT B;  5JYP A;  4HEF A;  3FG8 A;  3V3S A;  1OTB A;  1IYP A;  3OLO A;  1LSW A;  2O0Y A;  4HY8 A;  3MR0 A;  5EVI B;  3L9K A;  3T1S A;  4Y0U A;  2O99 A;  4X25 A;  4E6W A;  1K56 A;  1L2S A;  4WMC A;  4HJ4 A;  5FDH A;  1LT0 A;  1FIL A;  5AQB A;  5FI7 A;  2ZQ7 A;  4G3W A;  5HPI A;  2UWX A;  4N92 A;  1NYM A;  4N9K A;  1NZU A;  4EEU A;  4Y17 A;  3ITB A;  2I9V A;  3MXR A;  3S7N A;  3B42 A;  5F82 A;  1N4O A;  1W5D A;  2Y2M A;  1KE0 A;  5FQJ A;  1H0M A;  2H28 A;  1KVM A;  5E2E A;  1NWZ A;  5EUA A;  5HD5 A;  3NDG A;  4L9E A;  3T12 B;  4FH2 A;  5HDS A;  1P0Z A;  2ZC6 B;  3MF0 A;  1GCE A;  4EU0 A;  4P6Z S;  3ZFZ A;  3LYX A;  5HAI A;  3HL9 A;  3NJA A;  1XJ3 A;  4WBG A;  4BBT A;  4L9G A;  4C6Y A;  2W3G A;  3BYD A;  3GMW A;  1G28 A;  4WEJ A;  2W3H A;  1LSX A;  4LLO B;  2INW A;  3HJK A;  5FI2 A;  1CQA A;  4U0X A;  4Y0O A;  4F3L A;  3SH9 A;  1KGG A;  3BY9 A;  1QME A;  3OZH A;  3M2K A;  1ZG6 A;  5EVE A;  3DWZ A;  3C38 A;  3Q81 A;  1S6R A;  5G18 A;  2P08 A;  1KGE A;  3KSF A;  1IOU A;  2EX2 A;  3FKW A;  3UE0 A;  4KUO A;  1SKO A;  1L0D A;  2CC1 A;  1IFQ A;  2BAS A;  3IS2 B;  2Y2H A;  4XT2 B;  3C4O A;  2XFS A;  4GHI A;  1LL5 A;  2LB5 A;  5M18 A;  4R3J A;  3BLS A;  2QKP A;  1BTL A;  3ZVT A;  1MXO A;  2ZQA A;  4KZB A;  4GKU A;  3VMA A;  2V1B A;  2J3T D;  3E4Q A;  1PW8 A;  1NY0 A;  3RXW A;  2VV7 A;  1PWC A;  2Y2G A;  3VP1 A;  4O01 A;  3W4O A;  5A90 A;  5J8X A;  4M4X A;  2J3W A;  4I3J A;  3IT9 A;  3CLO A;  3KO6 A;  3LIC A;  3ZHH A;  5CGX A;  2ZMV A;  2WGI A;  1J9M A;  4HI4 A;  5DKL A;  4HP4 A;  3TG9 A;  2AVX A;  2XD1 A;  1Z6F A;  4CPK A;  2VV8 A;  5FAS A;  2W1T A;  3T4T A;  3ZG5 A;  2Q0O A;  1TDG A;  1XA1 A;  1MZU A;  2Y4A A;  1OTI A;  2EWV A;  2XSS A;  1YQS A;  3ITA A;  3G30 A;  4JGR A;  1FQG A;  5AQA A;  3HVF A;  4EQ1 A;  2J8Y A;  3C30 A;  4EWF A;  4OOM A;  3T50 A;  3PBO A;  4HBU A;  4HOI A;  5FQ9 A;  1PIO A;  1XFQ A;  1IYS A;  2Y2K A;  2VJW A;  3UO9 A;  3DTM A;  1DJB A;  2GNX A;  3A3J A;  3DBA A;  3V5M A;  5CHJ A;  4DE3 A;  3DAV A;  2JBF A;  2WKI A;  2B5R A;  3OPP A;  1LSV A;  4R23 A;  4PM7 A;  1WYC A;  5HD3 A;  4PKY A;  4ETX A;  2WZZ A;  5AQ7 A;  5L07 A;  4EEP A;  4KG2 A;  4WZ4 A;  1RGZ A;  4E3N A;  2OLV A;  3CI6 A;  1LL8 A;  4NG2 A;  4QU3 A;  3UDX A;  2HP9 A;  3BY8 A;  1T1B A;  2WKP A;  3F1N A;  3NC8 A;  1E4D A;  1A0K A;  3MZE A;  2QMI A;  2Y8H A;  4KG6 A;  5EVI D;  4OPR A;  1I2W A;  5A91 A;  1SKO B;  4KQR A;  4P0M A;  1XX2 A;  1FSW A;  1IKG A;  3WS0 A;  1CK3 A;  5FL3 A;  1BUL A;  1ES4 A;  4HES A;  4HQA A;  1W63 M;  3BEB A;  1F5M A;  2PRF A;  4S2J A;  4E6X A;  2BLS A;  2L0W A;  5I5L A;  3A3D A;  2KDK A;  4DE0 A;  3GR2 A;  2K7S A;  4LGW A;  2K31 A;  5HW3 A;  3WRT A;  3IHA A;  2ZC7 A;  4R3A A;  3IQA A;  5GHZ A;  5L8M A;  4BL3 A;  1IEL A;  3A0R A;  2HDS A;  3Q7V A;  4HH3 A;  1JTD A;  1DP8 A;  3H9W A;  3QNC A;  1BLP A;  4YFM A;  2V8C A;  1Q2P A;  2JE5 A;  3ZG7 B;  1YSP A;  3GQZ A;  4E3O A;  3CPT A;  3C5A A;  4DF6 A;  2ZOI A;  5E2H A;  1GHM A;  4WLA A;  1MKI A;  2P7J A;  1OJ5 A;  3H7W B;  3DW0 A;  2WGW B;  3MZD A;  1MWU A;  5EVI A;  5IU1 A;  1GHI A;  4BQM A;  3BWL A;  2E8J A;  4PMA A;  3GTC A;  1K55 C;  2P74 A;  3PBQ A;  1CJF A;  5L10 A;  2PAV P;  4OKP A;  3FPW A;  5HWW A;  5GHY A;  3RXX A;  1SHV A;  1DP9 A;  1H8Y A;  3B3X A;  1GA9 A;  4WUJ A;  4MDZ A;  3DTE A;  1YLJ A;  2WKH A;  3LEQ A;  1NXY A;  4QHC A;  3N8R A;  3ZDJ A;  1UWP X;  1OT9 A;  2PHY A;  1OTE A;  3KYQ A;  4OPZ A;  2M7V A;  3EOI A;  3IX8 A;  4OQ0 A;  1YLT A;  1XKZ A;  2WKQ A;  2ZL1 B;  3B47 A;  4ZAM A;  1BT5 A;  4LEN A;  1JNU A;  1N9N A;  3G4P A;  4ME4 A;  1JWZ A;  4RX3 A;  2JC7 A;  3G2Z A;  4HJ6 A;  2JKF A;  3F1P B;  5IT5 A;  2HDU A;  2XRN A;  2IWB A;  3G6O A;  4LCL A;  4Q0J A;  1FCM A;  2Y2N A;  5U47 A;  1Y28 A;  1MWS A;  2A2L A;  1GA0 A;  3VP3 A;  3SH8 A;  3MKF A;  3T4J A;  4LV2 A;  1K25 A;  4S2I A;  4EXO A;  2BG1 A;  1S4R A;  3UMD A;  5CGW A;  2OOL A;  5CX7 A;  3HLE A;  3H82 B;  4GDB A;  3O5Y A;  5CEC A;  3D72 A;  4KZ7 A;  3Q1F A;  5FAP A;  1HVB A;  1K38 A;  4KUK A;  1UGU A;  3MMH A;  3VOZ A;  4JF6 A;  2VEA A;  3LR5 A;  1KDW A;  1KE4 A;  2ZBB A;  3UDF A;  3IS2 A;  4XT2 A;  4BD1 A;  4X1M A;  1GHP A;  3LCE A;  5DTT A;  5A92 A;  2HZ5 A;  3KSG A;  4BBU A;  3GV9 A;  4FH4 A;  3CMZ A;  1PZP A;  3BM6 A;  3HLW A;  4WZ5 A;  2Y59 A;  3CIT A;  3VOY A;  1WYB A;  5EOE A;  1BYW A;  4BMW A;  1ESU A;  3ZNT A;  5FQI A;  1K55 A;  5F5Y A;  1LL9 A;  1ODV A;  4XUZ A;  2DMW A;  5HAQ A;  2ZOH A;  3LI9 A;  4I39 A;  5HFO A;  2PYP A;  4EV4 A;  3ZQ5 A;  5FEF A;  1W63 Q;  3CAX A;  1CEG A;  1TS0 A;  1I2S A;  2QHK A;  3VOL A;  1BLS A;  3NIA A;  1V9Z A;  1GSV A;  1S4S A;  2R9W A;  3GDI A;  4KZ3 A;  2ZMF A;  4IHQ A;  5AQ9 A;  5MC7 A;  4BWI A;  2DNS A;  3ICY A;  1YLW A;  3WS5 A;  3TSG A;  1MY8 A;  3WS2 A;  3S1Y A;  2XRO A;  3ZGA B;  4HJ3 A;  4OQH A;  4RQ9 A;  4KZ5 A;  2M7U A;  4E04 A;  3N7W A;  2RCX A;  3PR6 A;  4MMN A;  1BZA A;  2JCH A;  3UE1 A;  5EV0 A;  5DF9 A;  5DF7 A;  4PM5 A;  1VM1 A;  4BL2 A;  3QP1 A;  1EWZ A;  4CJN A;  4P87 A;  4Y2F A;  3C7V A;  4JXG A;  3EGD C;  4MLL A;  1DRM A;  5GL9 A;  2W27 A;  4KZA A;  4AFI A;  5FI6 A;  5A93 A;  3NBL A;  3T1Q B;  4MBK A;  1CEF A;  1NZO A;  4FCF A;  3S7P A;  1TS7 A;  5KZH A;  3HUM A;  4KZ8 A;  1DJA A;  2PBD P;  3P7N A;  4QB8 A;  5HL1 A;  4GCZ A;  3BLM A;  1H8M A;  3N4I A;  4LCM A;  3IF6 B;  3L7H A;  2PYR A;  2P04 A;  3UME A;  3JVU A;  3NOU C;  1BUE A;  4EUV A;  4U3T A;  2KOI A;  5GLB A;  4GS9 B;  1F2K A;  5DTK A;  3FPV A;  4I38 A;  1K4E A;  4BD0 A;  2Y79 A;  4M3K A;  4HBT A;  3O87 A;  2EX6 A;  2W1R A;  3E4P A;  3Q07 A;  5CTM A;  4O7D A;  2H0Y A;  2NUP C;  3UDI A;  3HLG A;  4DJ2 A;  3BFD A;  4KQQ A;  4MN5 A;  2WAD A;  1K4F A;  3MZF A;  4FTX A;  2ZJ9 A;  1IKI A;  4EET B;  3IH8 A;  1FIK A;  1NLZ A;  1HTZ A;  5HAP A;  4E3J A;  4X53 A;  1Z09 A;  2GDN A;  3HLC A;  4MN6 A;  3LO7 A;  4F94 A;  3OCL A;  4KZ4 A;  4GZB A;  3ZVW A;  3BFG A;  3O88 A;  3PXP A;  3C2W A;  1L0G A;  4CQH A;  4EW7 A;  3GSG A;  1IYQ A;  4IUK A;  4OON A;  1KE3 A;  1T19 A;  4LFU A;  4FOF A;  2B18 A;  3A3F A;  3CWF A;  1PNE A;  2H5S A;  4LV1 A;  5M19 A;  4ZTK A;  3E98 A;  3PHY A;  2VZW A;  4BLM A;  5L09 A;  4YIN A;  2FH5 A;  2EFX A;  4LRZ E;  2C6W B;  2XA7 M;  3VE3 A;  5BOH A;  2ZQD A;  2LB9 A;  3LID A;  3T4K A;  4H8R A;  3R4K A;  2P9V B;  1BSG A;  1W7F A;  3LEZ A;  5DVA A;  5EEC A;  1L3L A;  3ZCZ A;  2OSU A;  4R38 A;  1G5U A;  2VGJ A;  1L0F A;  3H7W A;  3ZG0 A;  4X68 A;  3TE8 A;  4OQG A;  5KSC A;  3G35 A;  2WGW A;  3GVB A;  2HGV A;  3MKE A;  2PU2 A;  3LIA A;  4EBN A;  3TRC A;  2ZC5 B;  4DJ3 A;  4HNB A;  4R70 A;  3NOT C;  2D01 A;  4IVI A;  3BW6 A;  3UB9 A;  5IS1 A;  4P85 A;  2R78 A;  4PM8 A;  4WL9 A;  4RVA A;  1BLC A;  5TFQ A;  1RCJ A;  1TDL A;  3GRJ A;  1KDS A;  1PI5 A;  3ZG8 B;  4MN7 A;  1GSW A;  3JPU A;  4E3K A;  1L0E A;  4EES A;  1ES5 A;  3O86 A;  2QJ7 A;  3SOI A;  4OH0 A;  3C8C A;  3S7O A;  3D3O A;  5E43 A;  5FAQ A;  1M40 A;  3PYP A;  2ZL1 A;  4ZRR A;  4GD6 A;  2JKT I;  4JBF A;  5CRF A;  4ARZ A;  1MPL A;  1PWG A;  4EBP A;  1HD8 A;  2HJ9 C;  1VHM A;  4N9L A;  5DJT A;  3F1P A;  3CZD A;  3M2J A;  2ACG A;  3KSH A;  5HDD A;  4EQI A;  1P97 A;  3UE6 A;  4GJ4 A;  4HP9 A;  2NUT C;  2O9A A;  2PBY A;  2VA0 A;  1KGF A;  5J7E A;  4HIA A;  1JVJ A;  3CUE C;  4K91 A;  3EGX C;  1FR6 A;  3UNW A;  3LI8 A;  4EBL A;  1OT6 A;  3EEA A;  4EER A;  1K54 C;  2V0W A;  2Y2P A;  3H82 A;  4D60 A;  4Q0I A;  2XR0 A;  3DTI A;  2CMN A;  4GOG A;  3IF6 C;  4JGP A;  3BFE A;  4JKT A;  3RTY A;  1YLP A;  4Y3I A;  1WE4 A;  2DCF A;  1NRF A;  4YWZ A;  3V39 A;  3LY4 A;  2C5W B;  4MCW A;  2ZLY A;  4X69 A;  4DDY A;  4KZ9 A;  4S2N C;  1TS6 A;  1YSQ A;  4X56 A;  2IWC A;  2J9P A;  3HRE A;  5FAT A;  3NUL A;  3PAG A;  4E3M A;  2A24 B;  2VX8 A;  2Y2O A;  3D4F A;  4FD8 A;  3IWI A;  2QPN A;  3NOP C;  1N9O A;  2ZD8 A;  1F98 A;  3VFF A;  3UB8 A;  3VSK A;  5HPF A;  3SW1 A;  4OPQ A;  1ERO A;  3DTK A;  4Q0H A;  1H8Z A;  1XJ4 A;  3HJI A;  1O07 A;  1KOU A;  3T4O A;  4GD8 A;  4S2M A;  1S0W A;  5EPH A;  4LV0 A;  1C3B A;  3OBF A;  2WKE A;  4O0P A;  4QY6 A;  3U4L P;  2Q9M A;  2EX9 A;  3T1X A;  1S1Z A;  2EWW A;  3NI9 A;  5F1F A;  4KZ6 A;  4HH2 A;  3PBT A;  3IX4 A;  3LFV A;  2O9C A;  3HCY A;  4NXE A;  5CEB A;  4C75 A;  5J3W A;  1ZKJ A;  4WN5 A;  5F69 A;  1XJ2 A;  4UA6 A;  4IVK A;  1HZO A;  2FFY A;  1KVL A;  3JVV A;  3CUE A;  4JXV A;  1SDN A;  4WYY A;  3P01 A;  3OCN A;  5HWT A;  1Y4O A;  2XFT A;  2XGN A;  2D02 A;  2WAE A;  1ACF A;  1K6S A;  3KX0 X;  3IF6 A;  4PAU A;  1OPX A;  4JF4 A;  4X1L A;  5TJJ A;  1W79 A;  2Y2L A;  5IHV A;  4ARZ B;  1STZ A;  1YM1 A;  4BBV A;  1MBL A;  4XXR A;  4UQI M;  4GS9 A;  4JXW A;  3BQ8 A;  3V50 A;  4GW9 A;  5F1G A;  4YNR A;  3BEC A;  4JXS A;  5EM0 A;  2V9A A;  3NHQ A;  3T4L A;  4MBF A;  3T4S A;  1YMS A;  3BRM A;  3MXS A;  5HAR A;  4ESP A;  3LIF A;  5C5K A;  4X55 A;  4S2P A;  2QYB A;  3WS4 A;  2WK0 A;  4NKP A;  3VP0 A;  2PDR A;  3MBZ A;  1Y54 A;  5CED A;  4P6B A;  4BJP A;  2HP6 A;  3DWK A;  1OTA A;  2VV6 A;  2OWH A;  3PBR A;  4C3Q A;  3EEH A;  5FQQ A;  3U2A A;  4B4Z A;  3FKV A;  1JWV A;  3W4Q A;  2XH9 A;  3A0V A;  5AVE A;  4GN2 A;  1PZO A;  5AVF A;  2WZX A;  3A3I A;  1SCW A;  4RYE A;  3UN7 A;  3MXQ A;  4NXG A;  4ID4 A;  2Z2M B;  1OME A;  1D06 A;  1H3Q A;  5DKK A;  3E4O A;  2JHE A;  1E3U D;  3PBN A;  3NEC A;  1XGJ A;  4I5S A;  1T1C A;  4QD4 A;  1RP5 A;  3W2Z A;  1NRJ A;  2UV0 E;  2WYX A;  2ZM2 A;  4Y13 A;  3MFD A;  5L2F A;  3CJM A;  4Z9Q A;  2HP5 A;  3OPH A;  4LRX C;  3W4P A;  1MKM A;  2HDR A;  1SKF A;  4PPR A;  3IWQ A;  2Z6C A;  2P9V A;  3QP2 A;  5DJU A;  4OOL A;  4DMZ A;  2PR6 A;  1ZC2 A;  5D3O A;  4OVD A;  5M1A A;  1VEU B;  3OOV A;  4R1G A;  4DDS A;  4FSF A;  4CLC C;  4S2L A;  4UA7 A;  5E2G A;  3SS4 A;  3IHB A;  1ONH A;  4OQI A;  4Z1W A;  3CHW P;  1YLY A;  3WS1 A;  3MQQ A;  1N9L A;  2V2F F;  5KIZ A;  4OLG A;  2EX8 A;  2X01 A;  1X0O A;  1JTG A;  2JKT M;  3E2K A;  4JGQ A;  1YPR A;  4H6J B;  3QP6 A;  3N6I A;  1E3U A;  4B4X A;  5HZH A;  1FR1 A;  3HUO A;  5CHM A;  3T1R A;  1IEM A;  4KQD A;  4E3L A;  5FDS A;  3GEC A;  2VGL M;  1PI4 A;  4CLC D;  2WAF A;  2VLG A;  4Y0T A;  2PR5 A;  1O7E A;  5FEG A;  1DJC A;  3K2N A;  3IXH A;  4OP8 A;  2ZMA A;  2EXB A;  2X71 A;  1ERM A;  4B93 A;  2Y91 A;  4DE1 A;  4RA7 A;  2VGL S;  4MNR A;  4P6Z M;  3LR4 A;  2YKF A;  3ZNY A;  3F1O A;  3UPN A;  5DTS A;  1ZTU A;  4QJG A;  2QJ5 A;  3QHY A;  1I5Q A;  2Q9N A;  1OTD A;  5AJG A;  5HX9 A;  1LLB A;  5CER A;  4N1X A;  5GLC A;  2XDM A;  2GZA A;  2RL3 A;  3M6H A;  3S22 A;  2IA2 A;  1D7E A;  4R0Q A;  2ZQ9 A;  3R7W B;  4LV3 A;  2J3T C;  4UA9 A;  3FC7 A;  1W8Y A;  4BEN A;  3MQ0 A;  3SS3 A;  4G3V A;  2PD8 A;  2Y2Q A;  5I94 A;  1P9W A;  1DY6 A;  3SH7 A;  5KSH A;  2WGV A;  2OAQ 1;  4CLC A;  5FAO A;  3UB5 P;  3VSL A;  2A49 A;  2A24 A;  4R3B A;  4QWO A;  3HLD A;  5J4E A;  5G4Y A;  2HDQ A;  1U60 A;  1ZG4 A;  4OLD A;  3A0S A;  1NLY A;  2Z6D A;  4UEY A;  4B9O A;  1GSX A;  2W3E A;  2DRW A;  2EA9 A;  4NEE D;  2W3F A;  2JKR M;  5TBM A;  3FZC A;  3IF5 A;  4UHU A;  3WWX A;  2FFF B;  5DFX A;  2IWD A;  1F9I A;  4DE2 A;  4IUH A;  4JPM A;  3QP5 A;  3WRZ A;  3KSI A;  4IJG A;  3P09 A;  4WEL A;  5TR7 A;  2XA7 S;  3B33 A;  3IH9 A;  1ESI A;  3AGE A;  3SS5 A;  4L9F A;  2XLN A;  2ZC3 B;  5EE8 A;  4JLF A;  5LBR A;  5HDC A;  2J7V A;  1N9B A;  1YLZ A;  4L0L A;  5JYO A;  3UE3 A;  1XP4 A;  3LIB A;  2Y2J A;  4D2O A; 
#chains in the Genus database with same CATH homology
 5CGW A;  4ZBE A;  5FQJ A;  3HLE A;  4GDB A;  1KVM A;  3C7U A;  4KG5 A;  5CEC A;  4KZ7 A;  5E2E A;  3Q1F A;  3VSK A;  5FAP A;  1BLH A;  1HVB A;  5EUA A;  4U0T A;  1K38 A;  4OPQ A;  3NDG A;  3VOZ A;  1ERO A;  2XF3 A;  1H8Z A;  4JF6 A;  1O07 A;  1KDW A;  1KE4 A;  4FH2 A;  4GD8 A;  4KEN B;  1FCO A;  3UDF A;  2ZQ8 A;  2ZC6 B;  4S2M A;  5CXW A;  1GCE A;  4BD1 A;  1S0W A;  5EPH A;  1GHP A;  3LCE A;  1C3B A;  4LV0 A;  1AXB A;  5DTT A;  5A92 A;  2WKE A;  3GV9 A;  4QY6 A;  4FH4 A;  3ZFZ A;  2Q9M A;  2EX9 A;  3CMZ A;  4QY5 A;  1PZP A;  4MBH A;  3NI9 A;  2X02 A;  2ZM8 A;  4JF5 A;  5HAI A;  3BM6 A;  3HLW A;  5F1F A;  4WZ5 A;  3HL9 A;  4WBG A;  4C6Y A;  2E8I A;  4KZ6 A;  3BYD A;  3GMW A;  3HBR A;  3PBT A;  2Y59 A;  3NDE A;  4WEJ A;  4WEK A;  4B88 A;  3VOY A;  1WYB A;  5CEB A;  5FI2 A;  4U0X A;  1ERQ A;  4Y0O A;  5EOE A;  4C75 A;  3SH9 A;  1KGG A;  1QME A;  1ESU A;  3ZNT A;  5FQI A;  2VGK A;  3OZH A;  1K55 A;  1ZKJ A;  3M2K A;  1LL9 A;  1ZG6 A;  2Y55 A;  4XUZ A;  3DWZ A;  1LI9 A;  3Q81 A;  5HAQ A;  1S6R A;  4IED A;  2J9O A;  5FA7 A;  5G18 A;  5HFO A;  4IBX A;  4EV4 A;  3HUN A;  1VQQ A;  4UA6 A;  1KGE A;  4IVK A;  1HZO A;  2H0T A;  3EQV A;  1CEG A;  5EVI C;  1I2S A;  2EX2 A;  1KVL A;  2FFY A;  3FKW A;  3UE0 A;  4JXV A;  2R9X A;  1SDN A;  1BLS A;  3NIA A;  2PU4 A;  4WYY A;  1L0D A;  2CC1 A;  2R9W A;  3OCN A;  1XPB A;  2Y2H A;  4KZ3 A;  5AQ9 A;  3C4O A;  2XFS A;  4OPY A;  1LL5 A;  1ONG A;  5M18 A;  4R3J A;  1NJ4 A;  2DNS A;  2XFT A;  1YT4 A;  3BLS A;  4ZDX A;  1YLW A;  1LI0 A;  2XGN A;  3WS5 A;  2WAE A;  1K6S A;  1EI5 A;  3UPO A;  1BTL A;  3TSG A;  3IF6 A;  3ZVT A;  3JYI A;  1MY8 A;  1MXO A;  2ZQA A;  4KZB A;  2ZQC A;  4GKU A;  3WS2 A;  4JF4 A;  3S1Y A;  3VMA A;  3ZGA B;  5KMW A;  1W79 A;  2Y2L A;  5IHV A;  3FYZ A;  1YM1 A;  4OQH A;  1MBL A;  4A5R A;  4XXR A;  4KZ5 A;  2ZM0 A;  2G2U A;  3N7W A;  2RCX A;  4JXW A;  5EVL A;  3VP2 A;  2H10 A;  3V50 A;  1PW8 A;  1BZA A;  2JCH A;  5F1G A;  1NY0 A;  2QZ6 A;  3BEC A;  3RXW A;  3UE1 A;  4Y7P A;  4JXS A;  1PWC A;  2Y2G A;  5DF9 A;  5DF7 A;  4PM5 A;  3VP1 A;  3V3R A;  3W4O A;  5A90 A;  1VM1 A;  5J8X A;  4MBF A;  4BL2 A;  4EUZ A;  1YMS A;  4R4S A;  3BRM A;  1EWZ A;  3MXS A;  5HAR A;  4CJN A;  4P87 A;  3IT9 A;  3C7V A;  3ZHH A;  4X55 A;  4JXG A;  4NK3 A;  4MLL A;  5CGX A;  4S2P A;  5GL9 A;  4KZA A;  1FOF A;  2WUQ A;  3WS4 A;  4Q8I A;  2WGI A;  1J9M A;  3EQU A;  5FI6 A;  5A93 A;  2WK0 A;  3NBL A;  3ISG A;  3BFC A;  4MBK A;  5CGS A;  3VP0 A;  1CEF A;  5FSR A;  1NZO A;  3MBZ A;  4FCF A;  1Y54 A;  2XD5 A;  4P6B A;  5CED A;  4BJP A;  3PAE A;  2HP6 A;  5KZH A;  3DWK A;  3HUM A;  3TG9 A;  4KZ8 A;  1DJA A;  1CI9 A;  4QB8 A;  5HL1 A;  1MWT A;  3BLM A;  1XGI A;  2I72 A;  3N4I A;  4LCM A;  3IF6 B;  2XD1 A;  1Z6F A;  4CPK A;  3PBR A;  4C3Q A;  5FQQ A;  4DXC A;  5FAS A;  4B4Z A;  3ZG5 A;  3FKV A;  1JWV A;  1BUE A;  3BFF A;  3W4Q A;  1CI8 A;  2XH9 A;  1TDG A;  4U3T A;  1XA1 A;  5GLB A;  2Y4A A;  4GN2 A;  1M6K A;  1QMF A;  2Y2I A;  5DTK A;  1K4E A;  1YQS A;  3ITA A;  3G30 A;  4BD0 A;  4M3K A;  4HBT A;  4DKI A;  1FQG A;  3O87 A;  4GDN A;  5AQA A;  3HVF A;  1PZO A;  2WZX A;  2EX6 A;  5FQK A;  3A3I A;  2J8Y A;  1SCW A;  4RYE A;  3I7J A;  3Q07 A;  5CTM A;  4EWF A;  1K57 C;  4OOM A;  3LY3 A;  4UAA A;  3Q82 A;  3UN7 A;  4ID4 A;  2Z2M B;  1OME A;  1PYY A;  3IXB A;  4GB7 A;  3PBO A;  4O7D A;  1W8Q A;  2H0Y A;  4HBU A;  3E2L A;  5FQ9 A;  1E3U D;  1PIO A;  3UDI A;  3PBN A;  3HLG A;  3BFD A;  1XGJ A;  4KQQ A;  2V20 A;  2WAD A;  1K4F A;  3MZF A;  1IYS A;  4QD4 A;  2Y2K A;  1RP5 A;  3UO9 A;  1TEM A;  3AGD A;  2ZJ9 A;  1IKI A;  3DTM A;  3IH8 A;  1DJB A;  4WZ5 C;  3A3J A;  2WYX A;  1HTZ A;  3M6B A;  3V5M A;  2XK1 A;  2ZM2 A;  3MFD A;  5L2F A;  3IXG A;  3CJM A;  3G34 A;  2HP5 A;  5CHJ A;  3OPH A;  4Z9Q A;  4DE3 A;  3IXD A;  3W4P A;  4OP5 A;  5HAP A;  2HDR A;  1SKF A;  4E3J A;  4XUX A;  4PPR A;  1TVF A;  2JBF A;  4X53 A;  2GDN A;  3HLC A;  2WKI A;  3IWQ A;  4N1H A;  2P9V A;  2B5R A;  3OPP A;  1G68 A;  3LO7 A;  4OOL A;  4F94 A;  3OCL A;  4KZ4 A;  3N8L A;  4GZB A;  4R23 A;  1K54 A;  1ZC2 A;  4PM7 A;  1WYC A;  1K6R A;  2XQZ A;  3ZVW A;  5D3O A;  2OV5 A;  4OVD A;  3BFG A;  3O88 A;  5M1A A;  4R1G A;  4DDS A;  4FSF A;  4S2L A;  2WZZ A;  5AQ7 A;  1L0G A;  4UA7 A;  4KG2 A;  4WZ4 A;  1RGZ A;  3GSG A;  4E3N A;  5E2G A;  3SS4 A;  3IHB A;  1IYQ A;  2OLV A;  1IYO A;  4OON A;  1KE3 A;  3UPP A;  3VP4 A;  1ONH A;  3W8K A;  3RJU A;  4OQI A;  3AGF A;  1YLY A;  2EXA A;  1Q2Q A;  3WS1 A;  1JWP A;  1LHY A;  1SDE A;  3A3F A;  2H5S A;  4LV1 A;  4QU3 A;  5GLA A;  3UDX A;  5M19 A;  2HP9 A;  2V2F F;  4S2N A;  1PW1 A;  4ZTK A;  4OLG A;  2EX8 A;  3C4P A;  2X01 A;  4BLM A;  4YIN A;  2EFX A;  2C6W B;  3VFH A;  3A3E A;  1JTG A;  5BOH A;  3NC8 A;  1E4D A;  5TGF A;  3HLF A;  3E2K A;  2XEP A;  2ZQD A;  3MZE A;  3OC2 A;  2QMI A;  4GNU A;  4KG6 A;  5EVI D;  5GHX A;  4OPR A;  4S2O A;  3N6I A;  5CTN A;  1I2W A;  4H8R A;  1E3U A;  4X6T A;  4B4X A;  2Z2L B;  3IWO A;  3TOI A;  1FR1 A;  2P9V B;  3HUO A;  1BSG A;  5A91 A;  4KQR A;  1W7F A;  5F83 A;  3NY4 A;  3LEZ A;  5CHM A;  4P0M A;  1XX2 A;  1IEM A;  1FSW A;  5DVA A;  5EEC A;  3ZCZ A;  4DRT A;  1IKG A;  2OSU A;  4K0X A;  3UY6 A;  4ZJ3 A;  3HLB A;  1CK3 A;  2OLU A;  3FV7 A;  3WS0 A;  2VGJ A;  1BUL A;  1ES4 A;  4HES A;  4RX2 A;  4E3L A;  3BEB A;  1L0F A;  1PI4 A;  3ZG0 A;  4X68 A;  4OQG A;  5KSC A;  3G35 A;  2WGW A;  3Q7Z A;  2WAF A;  3GVB A;  4MEZ A;  4PM6 A;  3MKE A;  4S2J A;  2PU2 A;  4Y0T A;  1PWD A;  4E6X A;  2BLS A;  4EBN A;  1O7E A;  1XXM A;  2ZC5 B;  3NCK A;  1DJC A;  3A3D A;  4DE0 A;  3IXH A;  2EFU A;  3GR2 A;  4OP8 A;  4PM9 A;  2ZMA A;  4DXB A;  5HW3 A;  3WRT A;  2EXB A;  2X71 A;  3IHA A;  4IVI A;  2ZC7 A;  4NET A;  1ERM A;  3IQA A;  5GHZ A;  2Y91 A;  4DE1 A;  4RA7 A;  4BL3 A;  4P85 A;  4PM8 A;  4MNR A;  1IEL A;  4RVA A;  2G2W A;  2V1Z A;  1BLC A;  4ZJ2 A;  5TFQ A;  3P98 A;  1RCJ A;  1TDL A;  2HDS A;  3O3V A;  3PTE A;  3Q7V A;  3UPN A;  3GRJ A;  5DTS A;  5CHU A;  3ZNY A;  4QJG A;  1KDS A;  3QHY A;  1JTD A;  3PBS A;  1I5Q A;  1PI5 A;  4R4R A;  1K57 A;  3ZG8 B;  4ZJ1 A;  2Q9N A;  3QNC A;  1RGY A;  4E3I A;  1BLP A;  4K0W A;  3OPL A;  4YFM A;  2A3U A;  5HX9 A;  1E25 A;  1LLB A;  4IBR A;  4E3K A;  5CER A;  1L0E A;  1Q2P A;  4N1X A;  1ES5 A;  2JE5 A;  3O86 A;  3GQZ A;  5GLC A;  3ZG7 B;  4E3O A;  2XDM A;  3C5A A;  3SOI A;  4DF6 A;  5DF8 A;  3QNB A;  1K56 D;  2RL3 A;  3M6H A;  4OH0 A;  3S22 A;  4WMC D;  5E2H A;  5E43 A;  1GHM A;  1G6A A;  4R0Q A;  1YMX A;  5FAQ A;  1MKI A;  1M40 A;  1MWR A;  2ZQ9 A;  5GLD A;  1ES2 A;  3DW0 A;  3G2Y A;  1FSY A;  4GD6 A;  4JBF A;  2WGW B;  5CRF A;  3MZD A;  1MPL A;  1MWU A;  1PWG A;  4LV3 A;  5EVI A;  4EBP A;  1HD8 A;  5E2F A;  5EOO A;  5FQM A;  4UA9 A;  1GHI A;  4BQM A;  3FWL A;  1W8Y A;  3ZG9 B;  4BEN A;  3G32 A;  4OOY A;  4PMA A;  4N9L A;  3SS3 A;  1NYY A;  3CZD A;  3G31 A;  3OPR A;  3M2J A;  3GTC A;  1K55 C;  2Y2Q A;  2P74 A;  3PBQ A;  3S4X A;  2HPB A;  4EQI A;  5I94 A;  4S2K A;  1DY6 A;  4OKP A;  3CG5 A;  3SH7 A;  5KSH A;  5GHY A;  2WGV A;  3RXX A;  1SHV A;  4KQO A;  1ES3 A;  1H8Y A;  3B3X A;  5FAO A;  1GA9 A;  2PBY A;  3Q7V B;  3VSL A;  1XA7 A;  2A49 A;  1KGF A;  1H5X A;  4R3B A;  1YLJ A;  2WKH A;  1JVJ A;  3N8S A;  1FCN A;  3HLD A;  1NXY A;  4K91 A;  4QHC A;  3N8R A;  2HDQ A;  1ALQ A;  1U60 A;  1FR6 A;  1ZG4 A;  4OLD A;  3UNW A;  3ZDJ A;  4EBL A;  2ZC4 B;  1K54 C;  4OPZ A;  2Y2P A;  4WM9 A;  5JYP A;  4HEF A;  3V3S A;  2DRW A;  2XR0 A;  1IYP A;  4OQ0 A;  3FZC A;  1YLT A;  4GOG A;  3IF6 C;  1XKZ A;  3IF5 A;  3BFE A;  4UHU A;  3WWX A;  2FFF B;  4ZAM A;  1BT5 A;  2IWD A;  4JKT A;  5EVI B;  1YLP A;  4LEN A;  4DE2 A;  1WE4 A;  2DCF A;  4JPM A;  3G4P A;  4RX3 A;  1JWZ A;  1NRF A;  3WRZ A;  3V39 A;  4Y0U A;  3LY4 A;  2C5W B;  2JC7 A;  3P09 A;  3G2Z A;  4WEL A;  2ZLY A;  4X69 A;  4DDY A;  4E6W A;  4KZ9 A;  4S2N C;  1K56 A;  1L2S A;  5TR7 A;  4WMC A;  2HDU A;  4X56 A;  3IH9 A;  1ESI A;  2IWC A;  5FDH A;  2J9P A;  3HRE A;  3AGE A;  2IWB A;  3SS5 A;  4LCL A;  5FAT A;  5AQB A;  1FCM A;  5FI7 A;  2XLN A;  2ZC3 B;  2Y2N A;  2ZQ7 A;  4JLF A;  2UWX A;  5EE8 A;  4N92 A;  5U47 A;  1NYM A;  3PAG A;  4N9K A;  2J7V A;  4E3M A;  1NZU A;  1MWS A;  1N9B A;  1GA0 A;  1YLZ A;  2Y2O A;  3D4F A;  4L0L A;  3SH8 A;  3VP3 A;  3MKF A;  4FD8 A;  3ITB A;  4LV2 A;  3IWI A;  1K25 A;  5JYO A;  3MXR A;  1XP4 A;  2QPN A;  3UE3 A;  4S2I A;  2Y2J A;  4D2O A;  5F82 A;  1N4O A;  2BG1 A;  2ZD8 A;  1W5D A;  2Y2M A;  1KE0 A;  3VFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...