3LEQA

The crystal structure of the roadblock/lc7 domain from streptomyces avermitillis to 1.85a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
102
Chain Sequence
HSQLDQLLTGLVDRVAEVDHAVVLSEDGLVVSKSTGFLRDDAERLAATASGLMSLRQALIEMGKGYLILTAAGPGAHLVVLTRQGADVGVVAYQMNMLVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein cvnB5
publication title The Crystal Structure of the Roadblock/LC7 domain from Streptomyces avermitillis to 1.85A
rcsb
source organism Streptomyces avermitilis
molecule tags Structure genomics, unknown function
total genus 23
structure length 102
sequence length 115
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3leqA00
1VETB 2PBDP 5FEFA 1K0KA 1HLUP 1CQAA 1Z09A 1AWIA 3DAVA 1YPRA 1CF0A 2PAVP 3CPTB 1PNEA 1D1JA 2HZ5A 1FIKA 3KYEA 5FEGA 3CPTA 1A0KA 2JKGA 3D9YA 1G5UA 2ZL1B 3T1XA 1VETA 2V8FA 1PRQA 5EM0A 5EM1A 4X25A 1CJFA 4ESPA 2ACGA 3NULA 3T1RA 3T1QB 2B95A 3U4LP 2V8CA 4FTXA 1J3WA 2ZL1A 1SKOB 3MS6A 3L9KA 3T12B 1FILA 1SKOA 4FUWA 4X1LA 1VEUB 3LEQA 3T1SA 2PRFA 2JKFA 1Y4OA 3NECA 4QWOA 5FDSA 3LGOA 1VEUA 5EVEA 2VK3A 1ACFA 4X1MA 3UB5P 4D60A 5EV0A 1SZVA 1PFLA 2BTFP 3MSHA 3L7HA 3CHWP 1F2KA 2E8JA
chains in the Genus database with same CATH superfamily
1H0MA 4MBHA 2O9CA 3LI9A 5FL3A 5TJJA 4JKTA 3DWKA 3RXWA 5GL9A 3ZGAB 3PAEA 3C30A 5FQQA 4JGPA 1EWZA 1TVFA 3KYEA 1K57A 3F1NB 4QD4A 1XPBA 4LRZE 3MMHA 1K6SA 4B88A 4GD6A 2DMWA 2G7UA 3M2JA 2OWHA 4WMCD 4LLOB 2ZL1B 3TSGA 5HWTA 4X53A 3HLDA 2H28A 3W2ZA 5HDDA 1DP6A 4BBUA 1K38A 5AJGA 3T4OA 2EX8A 1NZUA 3JPUA 5K5BA 1LSWA 1YLWA 4NG2A 3WRZA 1K55C 1FR1A 5GHXA 4LCMA 3S7PA 5FQ9A 4KZAA 2WKHA 1BZAA 4N9KA 4JXGA 2HP6A 3PTEA 4UEYA 4ZJ2A 2Y2QA 4EBNA 5CGXA 4DJ2A 1IOUA 5E43A 1VEUB 4KZ8A 4HEFA 3CMZA 2JKFA 1G28A 1WYCA 2XFSA 1UWNX 2B5RA 2ZQAA 4X6TA 1MKIA 3EEAA 4WF0A 2ZC4B 5DTSA 4R23A 4PMAA 3UY6A 1TD5A 1W8YA 3MQQA 1W8QA 1MWUA 3T4KA 3OCNA 3V67A 1BLPA 4I3AA 5FDHA 3AGEA 2R9XA 2EFUA 2PAVP 1YSQA 2PU4A 5GLDA 5M1AA 3NBLA 1BLSA 3V5MA 2PU2A 1ZG4A 5EVIA 4EXOA 4X56A 3UMDA 3VOLA 3HUNA 4EERA 4KQQA 3TOIA 2O0YA 3Q81A 3JVUA 1OTDA 3ZVTA 4HH3A 1XKZA 4EU0A 2JHEA 1YMSA 4HH2A 4OVDA 5MC7A 1S67L 4IHQA 5EM1A 2G2UA 2O9AA 2RCXA 1IYQA 4ETZA 3N7WA 4KQRA 3C8CA 1YSPA 4DN0A 4HBTA 1PW1A 2OV5A 1LLBA 4IVIA 4KG2A 2PT7A 2HDRA 2JKRM 5FSRA 3C2WA 2J8YA 4UAAA 3OPHA 3I7JA 4F3LB 1KGFA 4Y5FA 4HJ4A 3IWOA 3BFCA 2VJWA 2V0UA 3FV7A 5GHYA 5HD3A 1ACFA 2FH5A 4YFMA 3MKEA 1H8ZA 3OCLA 3GECA 5HAQA 4S2PA 1XJ4A 3GSGA 5DJTA 3S7NA 3L7HA 1EROA 4I38A 1KVMA 2ZBBA 4R1GA 1CEFA 2W27A 2FZ0A 1K57C 1PWGA 1MPLA 2K31A 2JBFA 3IXDA 3LUQA 3PHYA 4E04A 4E3JA 2DNSA 4I39A 5FATA 1SCWA 1IFQA 5EVIB 2Y2GA 3WWXA 1K54A 4QY6A 4B4ZA 2JKRI 4ID4A 3IH8A 2M1CA 1OTBA 3HVFA 5IU1A 4WUJA 5CGWA 1MWSA 3MXSA 2X01A 5EOOA 5DKLA 2A49A 1PRQA 1EI5A 5DF8A 5G4ZA 2Y8HA 3B42A 1GHIA 2INWA 3A3DA 4GN2A 4CLCE 4PPRA 3A0VA 3MS6A 5TGFA 2FFFB 4KZ6A 2P04A 4Y7PA 4N1XA 4GDNA 4BD1A 4QY5A 3LY4A 3QP8A 4S2NA 3SH8A 4IBXA 3VSLA 4LPZA 4RX3A 2CMNA 1WE4A 5J7EA 3A3IA 3VSKA 2GX5A 2EX6A 3LCEA 2HJ9C 2EA9A 3UB5P 2C5WB 2PR5A 3MZDA 1MKMA 1BLCA 2Z6DA 2QJ5A 5KSCA 5A92A 3MSHA 1OT9A 3VP1A 1F5MA 4KG5A 3D3OA 1N9BA 1Q2PA 4R38A 5E2GA 4FSFA 3JVVA 5TBMA 2R9WA 5EE8A 4CJNA 1CF0A 5EVIC 3EQVA 3MQOA 2ZC6B 1IKGA 1CEGA 1UGUA 5IHVA 1O7EA 4BENA 1LSXA 2VV8A 4E6WA 1X0OA 2IWDA 5KIZA 3P01A 5EOEA 2XQZA 3O87A 3KYZA 5CECA 5DF9A 4MDZA 2V9AA 2PBYA 3ZHHA 4FOFA 1N4OA 2B18A 3IWIA 2ZM0A 4L9FA 1VQQA 2WAEA 3ISGA 5J4EA 2M7UA 4LV0A 3T4SA 4R0QA 3RH8B 3HUOA 3UB7A 1K56D 2ZC5B 2XROA 3SH7A 3G35A 2XD1A 1V9YA 1T1BA 2HDSA 3HLWA 5AQ7A 1Y4OA 4GDBA 5M19A 3CJMA 3IX3A 2QPNA 1MWRA 5DVAA 4II7A 5HAPA 5J8XA 2IWBA 3IT9A 4LV3A 5EV0A 4KZ7A 3WS0A 5TBMB 1XP4A 1IYPA 3FYZA 1VETB 3QNCA 3IF6B 1GA9A 3IWQA 5FEFA 3SS5A 2EWWA 4EW7A 1K54C 3VOYA 4Z9QA 2I72A 3EQUA 1OTIA 2Z2MB 1JWVA 3ZG0A 1XX2A 3VOZA 4Q0IA 1TS7A 3IXBA 4UA7A 1XJ2A 4OH0A 1A0KA 4DJ3A 2H5SA 2ZQ9A 1P9WA 3E2KA 3E2LA 4O8GA 1K4EA 2ZM2A 1BT5A 2ZOIA 3B3XA 4QJGA 1G6OA 1FCOA 3PYPA 3QP2A 5HARA 4CLCA 5CTMA 2Y55A 5U47A 2LB5A 3IS2A 2CC1A 3CWFA 2OWJA 1I2SA 2MJ6A 2XR0A 3RXXA 2VEAA 5HD5A 4S2KA 1UWPX 5IS1A 5HX9A 3F1NA 2V8CA 3MXRA 3CG5A 1J3WA 1NRJA 2Y2PA 4S2NC 4IUKA 2ZL1A 3SS3A 1S66L 4R4SA 4OLGA 3IH9A 1KDSA 4GS9A 3PBQA 3EGDC 5EVID 3O3VA 1LI9A 5CGSA 4P85A 1ODVA 4LENA 2ZJ9A 3DTEA 4R3AA 1V9ZA 2W3GA 2LB9A 4OP5A 3Q1FA 4PM5A 2PBDP 1I2WA 3C4OA 3IQAA 1BLHA 1AWIA 2HDUA 3T50A 3NDEA 2VGJA 3PXPA 2ZMFA 4H8RA 1NZOA 2XD5A 2ZLYA 2JKGA 4KENB 1H8MA 3C38A 1G5UA 2W3HA 1Y28A 3GV9A 4IJGA 4CLCB 4DMZA 3B47A 3OOVA 2WUQA 4B9OA 1K56A 3WS5A 5I5LA 1I5QA 3IS2B 3SZTA 2ZM8A 4D2OA 3G34A 4P0MA 4RX2A 3V39A 5FASA 5EECA 5FAQA 1BULA 4X68A 4BJPA 1KVLA 1JVJA 3VP2A 3UPNA 2WKIA 3BFEA 4Y0TA 1XGJA 1XFNA 4GS9B 4CQHA 3V50A 4P6BA 5FQMA 1S6RA 3GQZA 5F69A 1F9IA 2QZ6A 3RTYA 5FI2A 4Y3IA 2JE5A 3NC8A 5EVEA 5AQ9A 3BM6A 4WEKA 4G3VA 4WELA 4DDYA 3DTMA 4BL3A 5KMWA 3W4OA 1E25A 1GSXA 2FFYA 3HLBA 1SZVA 3LEZA 4JGOA 2Y4AA 4GHIA 5DTTA 4RYEA 1LL5A 3R7WA 3ZG7B 3UPPA 4KZ5A 4F3LA 4R6LA 3ULFA 2W3EA 3FZCA 4YNRA 1D1JA 5FQKA 4EWFA 4NK3A 4EQIA 5HL1A 5C5KA 1NRFA 3HLGA 2VGKA 3ZVWA 1BTLA 5G18A 4GW9A 2H0YA 3UE6A 3BLMA 2WKQA 2XA7S 3Q07A 1XJ6A 3NY4A 3C4PA 4FCFA 5F1FA 4Q0JA 1T1AA 2GZAA 2ZMVA 4OOMA 3WS4A 2W3DA 1ALQA 2DRWA 1CJFA 3BLSA 4FD8A 2BLSA 1FSWA 1W63Q 1GHMA 1MY8A 1XFQA 2OLVA 3NOTC 1NYYA 4YINA 1NXYA 3A0RA 4EUZA 2W1TA 3L9KA 3T12B 1QMEA 4EQ1A 5GHZA 1OTEA 1F98A 2X02A 2ZQ7A 3NECA 4Y2FA 4U0TA 3UN7A 3E98A 4DXBA 3F1PA 1DP8A 2VK3A 4K08A 4BLMA 3HJKA 5L09A 2Y91A 4GHIB 3N8RA 4HQAA 3VV4A 4MBKA 4BL2A 3IHAA 3SOIA 3T4JA 3R7WB 1QMFA 4PM6A 4K0WA 5A8BA 3H82A 4WYYA 4EEPA 3G32A 5EFWA 4KUKA 1LT0A 5FAPA 1DJCA 4P6ZS 3NHQA 2XF3A 3GVBA 1K25A 3S7QA 4PKYA 1DY6A 3BFDA 4WZ5A 4M3KA 1Z6FA 5AQBA 2VA0A 2H10A 4IEDA 1KOUA 2WADA 3MF0A 1PIOA 3T1XA 4IUHA 1ZC2A 4S2JA 2WGWA 3RFBA 4ZRRA 2EFXA 1G6AA 3AGFA 3IBJA 4GLQA 4LFUA 4EESA 2V8FA 1J9MA 1VM1A 2HP5A 3DW0A 3QP1A 5DFXA 4ARZB 3VFFA 1RGZA 1OJGA 2JC7A 3FKVA 2VV6A 2Y2LA 3MFDA 3T1RA 3T1QB 4Y0UA 2W1TB 3MBZA 1ONHA 2VZWA 4FTXA 2Q9MA 1LL8A 4JBFA 5FI6A 5L2FA 1Y54A 4E3KA 3ZNTA 4HBUA 2Y2JA 3Q7VA 3FKWA 1E4DA 5M18A 2Z6CA 3F1PB 3F1OA 1STZA 2QWSA 2PDRA 4WL9A 1KE4A 1PYYA 1Q2QA 4UQIM 3BFGA 3LGOA 5CHMA 1YLTA 3W4PA 2V0WA 4X1MA 1WA9A 4MLLA 1NYMA 4RA7A 2L1MA 2O99A 1DRMA 3MKFA 1L3LA 5A93A 3BJNA 3H82B 4CLCD 2EXBA 5CERA 2PYPA 3QP6A 2D02A 4LRYC 1LL9A 2ZOHA 2XK1A 3LICA 2OLUA 2OAP1 4B93A 1IYSA 4RQ9A 4X55A 1GCEA 5E2EA 1W7FA 4AFIA 3CZDA 4JF4A 3ZNYA 2V1AA 2KLIA 2R78A 3BEBA 1FOFA 2WGWB 1TS6A 3T4LA 3D9YA 3KX0X 4X69A 2J9OA 3TG9A 3MZFA 2Y2NA 4DE2A 1YLPA 3OPLA 4R3BA 3HUMA 1VETA 4FH2A 2YKHA 3IF6A 1L0GA 5CRFA 3KSHA 4M4XA 2O9BA 3QHYA 3M2KA 2XH9A 5F82A 4X25A 2B95A 2VGLM 4ZTKA 3U4LP 4UA6A 3VE3A 3O5YA 1ZKJA 2ZC3B 4JLFA 5EPHA 5AVEA 3FPWA 3Q7VB 3CITA 4R4RA 2OOLA 3F1OB 1ESIA 4PAUA 4MN5A 1M40A 2PRFA 4E3NA 5L10A 4NXBA 4JXWA 5HPFA 1D06A 3B33A 1TS8A 3HL9A 3FPVA 5HDCA 5HZHA 3P09A 3UE1A 1TF1A 2WAFA 4HP4A 4UQIS 5E2FA 4EBLA 3A0SA 3VMAA 4XT2A 5CHUA 1RGYA 5EUAA 3NDGA 3UNWA 4FH4A 3UB9A 5DTKA 4OPYA 4L9GA 4O01A 3UDFA 3SW1A 3ZDJA 5CEBA 4Z1WA 4JXSA 5DF7A 2L0WA 1LHYA 3ITBA 3BWLA 3AGDA 5DJUA 1H8YA 1XXMA 3A3EA 4JF6A 3ZG8B 4JXVA 1IELA 3IF5A 3G6OA 4HIAA 4MN6A 3NIAA 2PR6A 3ZG9B 1K55A 3FG8A 4H6JA 4LGWA 3VE4A 2XGNA 3S1YA 4OQHA 2HJEA 1PZPA 3PBNA 2ZQCA 3NULA 3ZCZA 3LO7A 3S7OA 5E2HA 3VFHA 2V1BA 4B4XA 4GB7A 2VGLS 2PD8A 2M7VA 3GR2A 3QP4A 4OP8A 3P98A 5CEDA 4GJ4A 3UMEA 4DXCA 1SKOA 2Y2IA 5F83A 1ONGA 3T1SA 3HBRA 4MCWA 1PI5A 4G3WA 4HP9A 4UA9A 1ES2A 1N9LA 3MXQA 5J3WA 2VLGA 2WGVA 1BUEA 4XT2B 3C5AA 1K6RA 5HFOA 3BFFA 3K2NA 4HJ3A 1KGGA 1DJAA 2J3TD 3V3RA 2J3WA 4Y13A 1PWDA 3H7WB 1L0FA 2PD7A 1ERQA 1Z09A 1YPRA 1GA0A 1OMEA 5FA7A 3KSFA 1FIKA 3VP0A 2GJ3A 1SHVA 3DTIA 1E3UA 5JYPA 4EETB 3IF6C 1BYWA 4GNUA 3PAGA 4XUXA 5HL6A 4E3IA 4WN5A 4H6JB 5CTNA 2YKFA 2P9VB 4PKYG 1YT4A 1HD8A 4C75A 2XA7M 4HNBA 4HOIA 4S2IA 3MQ0A 1YQSA 1OPXA 1MBLA 4YOFA 4JPMA 3PBRA 5GLBA 4GZBA 3S22A 3Q82A 1SKOB 2OAQ1 4OQIA 3WRTA 4OQGA 2XDMA 3LIAA 3UDIA 1GSWA 1FQGA 3EEHA 4NXGA 3IBRA 1GHPA 2VX8A 4KZ9A 2KDKA 1MC0A 3LFVA 3SS4A 1P0ZA 5I94A 5EVLA 3IHBA 3NOPC 4D60A 1ES5A 1N9OA 2I9VA 2V20A 4JGRA 1IKIA 3D72A 3CHWP 1IYOA 5A91A 4NKPA 4C6YA 3LR3A 3OPPA 5A90A 3M6HA 1MXOA 1K0KA 2Y2OA 3FWLA 2Y79A 4LV1A 3E0YA 4CPKA 3A3JA 2KOIA 3KSIA 3CPTA 1YLZA 4PHTA 2A24A 4P6ZM 4MN7A 4Y0OA 1ZTUA 3EOIA 1S4SA 1WYBA 1S1ZA 3IX8A 5KZHA 5HDSA 3U2AA 2HF6A 1U60A 4RVAA 3NOUC 4OPZA 4EBPA 1DJBA 1G68A 4CLCC 1NJ4A 2DCFA 2J7VA 4LV2A 2Q9NA 3ZG5A 1OTAA 2HGVA 3PBTA 2UWXA 4EV4A 4E3LA 3VP3A 2QKPA 4O0PA 3E4QA 5HAIA 2K7SA 2W0NA 4BMWA 4GOGA 1YKDA 3DBAA 1P9RA 3R4KA 2IWCA 5F68A 4ARZA 3V3SA 4BD0A 3N4IA 2KX6A 3WS1A 5HW3A 4MBFA 2PHYA 5F5YA 1HZOA 3LIBA 1NLZA 1PI4A 3O86A 1XGIA 4L9EA 3GTCA 3K3CA 2WGIA 1YLYA 1PFLA 3OLOA 2OSUA 4NXFA 4N92A 3LIDA 4BBVA 3CLOA 4MMNA 2E8JA 3G2ZA 2ZD8A 3BQAA 2Y2HA 2NUPC 1HLUP 2QMIA 1S1YA 4DDSA 4BQMA 4DRTA 4F94A 3CPTB 1LSVA 1L0DA 2A24B 5IT5A 5FQIA 1CK3A 4EEUA 3G30A 1T18A 3FC7A 4PM9A 3LIFA 1ES4A 3LYXA 2ZMAA 5FAOA 2ZQ8A 2Q0OA 3UO9A 4NXEA 3T4QA 2P7JA 4DKIA 1OT6A 4KG6A 1W79A 3DTKA 3TW8A 1C3BA 3LR4A 2ACGA 2VKSA 4G3KA 1JNUA 4R3JA 4YWZA 1H3QA 2HPBA 4ZJ3A 2A3UA 4S2MA 5GLAA 1MZUA 5TR7A 1FILA 4WMCA 4K0XA 3TJZC 4ZAMA 3PBSA 3OZHA 4HY8A 3LR0A 4HESA 4ZBEA 4HJ6A 2BG1A 2G2WA 5BOHA 5HWWA 4A5RA 3UE3A 3KYQA 3KSGA 5FI7A 2JCHA 2B02A 3MZEA 3W8KA 2K2NA 3RJUA 3UDXA 3BYDA 4LRXC 3O88A 1TDGA 4C3QA 4PM8A 2XFTA 4E3OA 2HZ5A 4E3MA 3NI9A 1TDLA 5FEGA 3MJQA 3WS2A 1JTGA 1ES3A 4N9LA 1IEMA 5AVFA 1W63M 2XRNA 3EGXC 2IA2A 3IX4A 4BWIA 1JTDA 2EXAA 1VB6A 3HLCA 1SKFA 1OJ5A 4KZBA 3ICYA 1EW0A 5EM0A 3HLFA 3K3DA 4ZDXA 2W3FA 3C7VA 4XUZA 3HLEA 2XSSA 3N8LA 3NJAA 3NCKA 4OPQA 1FSYA 3ZQ5A 3JYIA 1KE3A 1HVBA 2J3TC 1N9NA 2P74A 2QJ7A 1T1CA 1BSGA 2J80A 2EX9A 4DF6A 3C7UA 1YM1A 5F6AA 3OPRA 4KZ3A 4GCZA 1KE0A 1E3UD 4WLAA 3TE8A 1H5XA 1RP5A 5D3OA 3N6IA 3N8SA 1TEMA 3LY3A 4JF5A 3CUEA 3UB6A 1KGEA 4XXRA 4ETXA 4U3TA 1YMXA 4I5SA 3G31A 4HI4A 2Y59A 5L07A 4ZJ1A 4QU3A 1NLYA 3CAXA 4K91A 5FQJA 2L4RA 2XLNA 3QNBA 4WM9A 2BASA 1SDNA 1JWPA 2WKPA 3ZFZA 4Y15A 3OC2A 3E4OA 3DAVA 1DP9A 2JKTM 2UV0E 5AQAA 1YAXA 1ZG6A 4OOYA 3DWZA 3ITAA 1XA1A 1FR6A 4I3IA 4IVKA 4QB8A 3HREA 2D01A 1GSVA 4KUOA 1L0EA 4WZ5C 4OPRA 2QYBA 1ERMA 3BW6A 3VP4A 4DE1A 1K4FA 2JN7A 2EWVA 2WYXA 5JYOA 4S2LA 4MEZA 3OBFA 3H7WA 5GLCA 3HCYA 4JGQA 5HSQA 4Q8IA 4GD8A 5TFQA 4KZ4A 2HP9A 3H9WA 4ESPA 1YLJA 5CX7A 4KQOA 2Z2LB 1VHMA 4E6XA 2VV7A 2ZC7A 4MNRA 3QP5A 4ME4A 3T4TA 3IXGA 2JKTI 2P9VA 2XEPA 2HDQA 4OOLA 2RL3A 1LI0A 4NETA 4FUWA 1M6KA 1L2SA 3LEQA 4OONA 3Q7ZA 2WKEA 3P7NA 3S4XA 3BY8A 1HTZA 1PW8A 1W5DA 3MFXA 5HWVA 3E4PA 3G2YA 1CI8A 2GNXA 5LBRA 2A2LA 4HHDA 3W4QA 1MWTA 3LR5A 3PBOA 4GKUA 1S4RA 4KQDA 2P08A 4PM7A 4DE3A 4OKPA 1TS0A 3GMWA 4NEED 2WK0A 3A3FA 3UPOA 4P87A 4QHCA 1CQAA 1NY0A 3GRJA 2H0TA 2V2FF 1PNEA 3GDIA 2EX2A 4QPRA 3CI6A 2C6WB 2PYRA 3BQ8A 1ESUA 4BBTA 4O7DA 4S2OA 3ZYTA 3LI8A 3KO6A 5CHJA 4OQ0A 2Y2MA 4L0LA 2AVXA 3IXHA 1XA7A 4I3JA 2WZZA 5HPIA 2X71A 1S0WA 4IBRA 4U0XA 3G4PA 2QHKA 3HJIA 2Y2KA 5G4YA 1CI9A 3PR6A 1FCMA 5DKKA 1NWZA 3D4FA 4N1HA 2J9PA 2NUTC 2W1RA 2WKRA 3MR0A 2V1ZA 1PZOA 4Y17A 3BRMA 1D7EA 1PWCA 1O07A 1SDEA 5L8MA 4WZ4A 4EUVA 3BECA 3CUEC 4X1LA 1P97A 3SH9A 1KDWA 2ZQDA 5KSHA 1RCJA 4OLDA 3UB8A 3BY9A 4QWOA 3TRCA 1AXBA 2HV1A 5FDSA 2WZXA 1JWZA 4LCLA 1VEUA 5F1GA 4R70A 4WEJA 1FCNA 1XJ3A 5CXWA 5DFYA 4UHUA 4DE0A 3UE0A 1ZHHB 2BTFP 3EWKA 2E8IA 1T19A 4Q0HA 4WBGA 3M6BA 1F2KA 2GDNA 3LIEA
chains in the Genus database with same CATH topology
1VETB 2PBDP 5FEFA 1K0KA 1HLUP 1CQAA 1Z09A 1AWIA 3DAVA 1YPRA 1CF0A 2PAVP 3CPTB 1PNEA 1D1JA 2HZ5A 1FIKA 3KYEA 5FEGA 3CPTA 1A0KA 2JKGA 3D9YA 1G5UA 2ZL1B 3T1XA 1VETA 2V8FA 1PRQA 5EM0A 5EM1A 4X25A 1CJFA 4ESPA 2ACGA 3NULA 3T1RA 3T1QB 2B95A 3U4LP 2V8CA 4FTXA 1J3WA 2ZL1A 1SKOB 3MS6A 3L9KA 3T12B 1FILA 1SKOA 4FUWA 4X1LA 1VEUB 3LEQA 3T1SA 2PRFA 2JKFA 1Y4OA 3NECA 4QWOA 5FDSA 3LGOA 1VEUA 5EVEA 2VK3A 1ACFA 4X1MA 3UB5P 4D60A 5EV0A 1SZVA 1PFLA 2BTFP 3MSHA 3L7HA 3CHWP 1F2KA 2E8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VET B;  2PBD P;  5FEF A;  1K0K A;  1HLU P;  1CQA A;  1Z09 A;  1AWI A;  3DAV A;  1YPR A;  1CF0 A;  2PAV P;  3CPT B;  1PNE A;  1D1J A;  2HZ5 A;  1FIK A;  3KYE A;  5FEG A;  3CPT A;  1A0K A;  2JKG A;  3D9Y A;  1G5U A;  2ZL1 B;  3T1X A;  1VET A;  2V8F A;  1PRQ A;  5EM0 A;  5EM1 A;  4X25 A;  1CJF A;  4ESP A;  2ACG A;  3NUL A;  3T1R A;  3T1Q B;  2B95 A;  3U4L P;  2V8C A;  4FTX A;  1J3W A;  2ZL1 A;  1SKO B;  3MS6 A;  3L9K A;  3T12 B;  1FIL A;  1SKO A;  4FUW A;  4X1L A;  1VEU B;  3LEQ A;  3T1S A;  2PRF A;  2JKF A;  1Y4O A;  3NEC A;  4QWO A;  5FDS A;  3LGO A;  1VEU A;  5EVE A;  2VK3 A;  1ACF A;  4X1M A;  3UB5 P;  4D60 A;  5EV0 A;  1SZV A;  1PFL A;  2BTF P;  3MSH A;  3L7H A;  3CHW P;  1F2K A;  2E8J A; 
#chains in the Genus database with same CATH topology
 1H0M A;  4MBH A;  2O9C A;  3LI9 A;  5FL3 A;  5TJJ A;  4JKT A;  3DWK A;  3RXW A;  5GL9 A;  3ZGA B;  3PAE A;  3C30 A;  5FQQ A;  4JGP A;  1EWZ A;  1TVF A;  3KYE A;  1K57 A;  3F1N B;  4QD4 A;  1XPB A;  4LRZ E;  3MMH A;  1K6S A;  4B88 A;  4GD6 A;  2DMW A;  2G7U A;  3M2J A;  2OWH A;  4WMC D;  4LLO B;  2ZL1 B;  3TSG A;  5HWT A;  4X53 A;  3HLD A;  2H28 A;  3W2Z A;  5HDD A;  1DP6 A;  4BBU A;  1K38 A;  5AJG A;  3T4O A;  2EX8 A;  1NZU A;  3JPU A;  5K5B A;  1LSW A;  1YLW A;  4NG2 A;  3WRZ A;  1K55 C;  1FR1 A;  5GHX A;  4LCM A;  3S7P A;  5FQ9 A;  4KZA A;  2WKH A;  1BZA A;  4N9K A;  4JXG A;  2HP6 A;  3PTE A;  4UEY A;  4ZJ2 A;  2Y2Q A;  4EBN A;  5CGX A;  4DJ2 A;  1IOU A;  5E43 A;  1VEU B;  4KZ8 A;  4HEF A;  3CMZ A;  2JKF A;  1G28 A;  1WYC A;  2XFS A;  1UWN X;  2B5R A;  2ZQA A;  4X6T A;  1MKI A;  3EEA A;  4WF0 A;  2ZC4 B;  5DTS A;  4R23 A;  4PMA A;  3UY6 A;  1TD5 A;  1W8Y A;  3MQQ A;  1W8Q A;  1MWU A;  3T4K A;  3OCN A;  3V67 A;  1BLP A;  4I3A A;  5FDH A;  3AGE A;  2R9X A;  2EFU A;  2PAV P;  1YSQ A;  2PU4 A;  5GLD A;  5M1A A;  3NBL A;  1BLS A;  3V5M A;  2PU2 A;  1ZG4 A;  5EVI A;  4EXO A;  4X56 A;  3UMD A;  3VOL A;  3HUN A;  4EER A;  4KQQ A;  3TOI A;  2O0Y A;  3Q81 A;  3JVU A;  1OTD A;  3ZVT A;  4HH3 A;  1XKZ A;  4EU0 A;  2JHE A;  1YMS A;  4HH2 A;  4OVD A;  5MC7 A;  1S67 L;  4IHQ A;  5EM1 A;  2G2U A;  2O9A A;  2RCX A;  1IYQ A;  4ETZ A;  3N7W A;  4KQR A;  3C8C A;  1YSP A;  4DN0 A;  4HBT A;  1PW1 A;  2OV5 A;  1LLB A;  4IVI A;  4KG2 A;  2PT7 A;  2HDR A;  2JKR M;  5FSR A;  3C2W A;  2J8Y A;  4UAA A;  3OPH A;  3I7J A;  4F3L B;  1KGF A;  4Y5F A;  4HJ4 A;  3IWO A;  3BFC A;  2VJW A;  2V0U A;  3FV7 A;  5GHY A;  5HD3 A;  1ACF A;  2FH5 A;  4YFM A;  3MKE A;  1H8Z A;  3OCL A;  3GEC A;  5HAQ A;  4S2P A;  1XJ4 A;  3GSG A;  5DJT A;  3S7N A;  3L7H A;  1ERO A;  4I38 A;  1KVM A;  2ZBB A;  4R1G A;  1CEF A;  2W27 A;  2FZ0 A;  1K57 C;  1PWG A;  1MPL A;  2K31 A;  2JBF A;  3IXD A;  3LUQ A;  3PHY A;  4E04 A;  4E3J A;  2DNS A;  4I39 A;  5FAT A;  1SCW A;  1IFQ A;  5EVI B;  2Y2G A;  3WWX A;  1K54 A;  4QY6 A;  4B4Z A;  2JKR I;  4ID4 A;  3IH8 A;  2M1C A;  1OTB A;  3HVF A;  5IU1 A;  4WUJ A;  5CGW A;  1MWS A;  3MXS A;  2X01 A;  5EOO A;  5DKL A;  2A49 A;  1PRQ A;  1EI5 A;  5DF8 A;  5G4Z A;  2Y8H A;  3B42 A;  1GHI A;  2INW A;  3A3D A;  4GN2 A;  4CLC E;  4PPR A;  3A0V A;  3MS6 A;  5TGF A;  2FFF B;  4KZ6 A;  2P04 A;  4Y7P A;  4N1X A;  4GDN A;  4BD1 A;  4QY5 A;  3LY4 A;  3QP8 A;  4S2N A;  3SH8 A;  4IBX A;  3VSL A;  4LPZ A;  4RX3 A;  2CMN A;  1WE4 A;  5J7E A;  3A3I A;  3VSK A;  2GX5 A;  2EX6 A;  3LCE A;  2HJ9 C;  2EA9 A;  3UB5 P;  2C5W B;  2PR5 A;  3MZD A;  1MKM A;  1BLC A;  2Z6D A;  2QJ5 A;  5KSC A;  5A92 A;  3MSH A;  1OT9 A;  3VP1 A;  1F5M A;  4KG5 A;  3D3O A;  1N9B A;  1Q2P A;  4R38 A;  5E2G A;  4FSF A;  3JVV A;  5TBM A;  2R9W A;  5EE8 A;  4CJN A;  1CF0 A;  5EVI C;  3EQV A;  3MQO A;  2ZC6 B;  1IKG A;  1CEG A;  1UGU A;  5IHV A;  1O7E A;  4BEN A;  1LSX A;  2VV8 A;  4E6W A;  1X0O A;  2IWD A;  5KIZ A;  3P01 A;  5EOE A;  2XQZ A;  3O87 A;  3KYZ A;  5CEC A;  5DF9 A;  4MDZ A;  2V9A A;  2PBY A;  3ZHH A;  4FOF A;  1N4O A;  2B18 A;  3IWI A;  2ZM0 A;  4L9F A;  1VQQ A;  2WAE A;  3ISG A;  5J4E A;  2M7U A;  4LV0 A;  3T4S A;  4R0Q A;  3RH8 B;  3HUO A;  3UB7 A;  1K56 D;  2ZC5 B;  2XRO A;  3SH7 A;  3G35 A;  2XD1 A;  1V9Y A;  1T1B A;  2HDS A;  3HLW A;  5AQ7 A;  1Y4O A;  4GDB A;  5M19 A;  3CJM A;  3IX3 A;  2QPN A;  1MWR A;  5DVA A;  4II7 A;  5HAP A;  5J8X A;  2IWB A;  3IT9 A;  4LV3 A;  5EV0 A;  4KZ7 A;  3WS0 A;  5TBM B;  1XP4 A;  1IYP A;  3FYZ A;  1VET B;  3QNC A;  3IF6 B;  1GA9 A;  3IWQ A;  5FEF A;  3SS5 A;  2EWW A;  4EW7 A;  1K54 C;  3VOY A;  4Z9Q A;  2I72 A;  3EQU A;  1OTI A;  2Z2M B;  1JWV A;  3ZG0 A;  1XX2 A;  3VOZ A;  4Q0I A;  1TS7 A;  3IXB A;  4UA7 A;  1XJ2 A;  4OH0 A;  1A0K A;  4DJ3 A;  2H5S A;  2ZQ9 A;  1P9W A;  3E2K A;  3E2L A;  4O8G A;  1K4E A;  2ZM2 A;  1BT5 A;  2ZOI A;  3B3X A;  4QJG A;  1G6O A;  1FCO A;  3PYP A;  3QP2 A;  5HAR A;  4CLC A;  5CTM A;  2Y55 A;  5U47 A;  2LB5 A;  3IS2 A;  2CC1 A;  3CWF A;  2OWJ A;  1I2S A;  2MJ6 A;  2XR0 A;  3RXX A;  2VEA A;  5HD5 A;  4S2K A;  1UWP X;  5IS1 A;  5HX9 A;  3F1N A;  2V8C A;  3MXR A;  3CG5 A;  1J3W A;  1NRJ A;  2Y2P A;  4S2N C;  4IUK A;  2ZL1 A;  3SS3 A;  1S66 L;  4R4S A;  4OLG A;  3IH9 A;  1KDS A;  4GS9 A;  3PBQ A;  3EGD C;  5EVI D;  3O3V A;  1LI9 A;  5CGS A;  4P85 A;  1ODV A;  4LEN A;  2ZJ9 A;  3DTE A;  4R3A A;  1V9Z A;  2W3G A;  2LB9 A;  4OP5 A;  3Q1F A;  4PM5 A;  2PBD P;  1I2W A;  3C4O A;  3IQA A;  1BLH A;  1AWI A;  2HDU A;  3T50 A;  3NDE A;  2VGJ A;  3PXP A;  2ZMF A;  4H8R A;  1NZO A;  2XD5 A;  2ZLY A;  2JKG A;  4KEN B;  1H8M A;  3C38 A;  1G5U A;  2W3H A;  1Y28 A;  3GV9 A;  4IJG A;  4CLC B;  4DMZ A;  3B47 A;  3OOV A;  2WUQ A;  4B9O A;  1K56 A;  3WS5 A;  5I5L A;  1I5Q A;  3IS2 B;  3SZT A;  2ZM8 A;  4D2O A;  3G34 A;  4P0M A;  4RX2 A;  3V39 A;  5FAS A;  5EEC A;  5FAQ A;  1BUL A;  4X68 A;  4BJP A;  1KVL A;  1JVJ A;  3VP2 A;  3UPN A;  2WKI A;  3BFE A;  4Y0T A;  1XGJ A;  1XFN A;  4GS9 B;  4CQH A;  3V50 A;  4P6B A;  5FQM A;  1S6R A;  3GQZ A;  5F69 A;  1F9I A;  2QZ6 A;  3RTY A;  5FI2 A;  4Y3I A;  2JE5 A;  3NC8 A;  5EVE A;  5AQ9 A;  3BM6 A;  4WEK A;  4G3V A;  4WEL A;  4DDY A;  3DTM A;  4BL3 A;  5KMW A;  3W4O A;  1E25 A;  1GSX A;  2FFY A;  3HLB A;  1SZV A;  3LEZ A;  4JGO A;  2Y4A A;  4GHI A;  5DTT A;  4RYE A;  1LL5 A;  3R7W A;  3ZG7 B;  3UPP A;  4KZ5 A;  4F3L A;  4R6L A;  3ULF A;  2W3E A;  3FZC A;  4YNR A;  1D1J A;  5FQK A;  4EWF A;  4NK3 A;  4EQI A;  5HL1 A;  5C5K A;  1NRF A;  3HLG A;  2VGK A;  3ZVW A;  1BTL A;  5G18 A;  4GW9 A;  2H0Y A;  3UE6 A;  3BLM A;  2WKQ A;  2XA7 S;  3Q07 A;  1XJ6 A;  3NY4 A;  3C4P A;  4FCF A;  5F1F A;  4Q0J A;  1T1A A;  2GZA A;  2ZMV A;  4OOM A;  3WS4 A;  2W3D A;  1ALQ A;  2DRW A;  1CJF A;  3BLS A;  4FD8 A;  2BLS A;  1FSW A;  1W63 Q;  1GHM A;  1MY8 A;  1XFQ A;  2OLV A;  3NOT C;  1NYY A;  4YIN A;  1NXY A;  3A0R A;  4EUZ A;  2W1T A;  3L9K A;  3T12 B;  1QME A;  4EQ1 A;  5GHZ A;  1OTE A;  1F98 A;  2X02 A;  2ZQ7 A;  3NEC A;  4Y2F A;  4U0T A;  3UN7 A;  3E98 A;  4DXB A;  3F1P A;  1DP8 A;  2VK3 A;  4K08 A;  4BLM A;  3HJK A;  5L09 A;  2Y91 A;  4GHI B;  3N8R A;  4HQA A;  3VV4 A;  4MBK A;  4BL2 A;  3IHA A;  3SOI A;  3T4J A;  3R7W B;  1QMF A;  4PM6 A;  4K0W A;  5A8B A;  3H82 A;  4WYY A;  4EEP A;  3G32 A;  5EFW A;  4KUK A;  1LT0 A;  5FAP A;  1DJC A;  4P6Z S;  3NHQ A;  2XF3 A;  3GVB A;  1K25 A;  3S7Q A;  4PKY A;  1DY6 A;  3BFD A;  4WZ5 A;  4M3K A;  1Z6F A;  5AQB A;  2VA0 A;  2H10 A;  4IED A;  1KOU A;  2WAD A;  3MF0 A;  1PIO A;  3T1X A;  4IUH A;  1ZC2 A;  4S2J A;  2WGW A;  3RFB A;  4ZRR A;  2EFX A;  1G6A A;  3AGF A;  3IBJ A;  4GLQ A;  4LFU A;  4EES A;  2V8F A;  1J9M A;  1VM1 A;  2HP5 A;  3DW0 A;  3QP1 A;  5DFX A;  4ARZ B;  3VFF A;  1RGZ A;  1OJG A;  2JC7 A;  3FKV A;  2VV6 A;  2Y2L A;  3MFD A;  3T1R A;  3T1Q B;  4Y0U A;  2W1T B;  3MBZ A;  1ONH A;  2VZW A;  4FTX A;  2Q9M A;  1LL8 A;  4JBF A;  5FI6 A;  5L2F A;  1Y54 A;  4E3K A;  3ZNT A;  4HBU A;  2Y2J A;  3Q7V A;  3FKW A;  1E4D A;  5M18 A;  2Z6C A;  3F1P B;  3F1O A;  1STZ A;  2QWS A;  2PDR A;  4WL9 A;  1KE4 A;  1PYY A;  1Q2Q A;  4UQI M;  3BFG A;  3LGO A;  5CHM A;  1YLT A;  3W4P A;  2V0W A;  4X1M A;  1WA9 A;  4MLL A;  1NYM A;  4RA7 A;  2L1M A;  2O99 A;  1DRM A;  3MKF A;  1L3L A;  5A93 A;  3BJN A;  3H82 B;  4CLC D;  2EXB A;  5CER A;  2PYP A;  3QP6 A;  2D02 A;  4LRY C;  1LL9 A;  2ZOH A;  2XK1 A;  3LIC A;  2OLU A;  2OAP 1;  4B93 A;  1IYS A;  4RQ9 A;  4X55 A;  1GCE A;  5E2E A;  1W7F A;  4AFI A;  3CZD A;  4JF4 A;  3ZNY A;  2V1A A;  2KLI A;  2R78 A;  3BEB A;  1FOF A;  2WGW B;  1TS6 A;  3T4L A;  3D9Y A;  3KX0 X;  4X69 A;  2J9O A;  3TG9 A;  3MZF A;  2Y2N A;  4DE2 A;  1YLP A;  3OPL A;  4R3B A;  3HUM A;  1VET A;  4FH2 A;  2YKH A;  3IF6 A;  1L0G A;  5CRF A;  3KSH A;  4M4X A;  2O9B A;  3QHY A;  3M2K A;  2XH9 A;  5F82 A;  4X25 A;  2B95 A;  2VGL M;  4ZTK A;  3U4L P;  4UA6 A;  3VE3 A;  3O5Y A;  1ZKJ A;  2ZC3 B;  4JLF A;  5EPH A;  5AVE A;  3FPW A;  3Q7V B;  3CIT A;  4R4R A;  2OOL A;  3F1O B;  1ESI A;  4PAU A;  4MN5 A;  1M40 A;  2PRF A;  4E3N A;  5L10 A;  4NXB A;  4JXW A;  5HPF A;  1D06 A;  3B33 A;  1TS8 A;  3HL9 A;  3FPV A;  5HDC A;  5HZH A;  3P09 A;  3UE1 A;  1TF1 A;  2WAF A;  4HP4 A;  4UQI S;  5E2F A;  4EBL A;  3A0S A;  3VMA A;  4XT2 A;  5CHU A;  1RGY A;  5EUA A;  3NDG A;  3UNW A;  4FH4 A;  3UB9 A;  5DTK A;  4OPY A;  4L9G A;  4O01 A;  3UDF A;  3SW1 A;  3ZDJ A;  5CEB A;  4Z1W A;  4JXS A;  5DF7 A;  2L0W A;  1LHY A;  3ITB A;  3BWL A;  3AGD A;  5DJU A;  1H8Y A;  1XXM A;  3A3E A;  4JF6 A;  3ZG8 B;  4JXV A;  1IEL A;  3IF5 A;  3G6O A;  4HIA A;  4MN6 A;  3NIA A;  2PR6 A;  3ZG9 B;  1K55 A;  3FG8 A;  4H6J A;  4LGW A;  3VE4 A;  2XGN A;  3S1Y A;  4OQH A;  2HJE A;  1PZP A;  3PBN A;  2ZQC A;  3NUL A;  3ZCZ A;  3LO7 A;  3S7O A;  5E2H A;  3VFH A;  2V1B A;  4B4X A;  4GB7 A;  2VGL S;  2PD8 A;  2M7V A;  3GR2 A;  3QP4 A;  4OP8 A;  3P98 A;  5CED A;  4GJ4 A;  3UME A;  4DXC A;  1SKO A;  2Y2I A;  5F83 A;  1ONG A;  3T1S A;  3HBR A;  4MCW A;  1PI5 A;  4G3W A;  4HP9 A;  4UA9 A;  1ES2 A;  1N9L A;  3MXQ A;  5J3W A;  2VLG A;  2WGV A;  1BUE A;  4XT2 B;  3C5A A;  1K6R A;  5HFO A;  3BFF A;  3K2N A;  4HJ3 A;  1KGG A;  1DJA A;  2J3T D;  3V3R A;  2J3W A;  4Y13 A;  1PWD A;  3H7W B;  1L0F A;  2PD7 A;  1ERQ A;  1Z09 A;  1YPR A;  1GA0 A;  1OME A;  5FA7 A;  3KSF A;  1FIK A;  3VP0 A;  2GJ3 A;  1SHV A;  3DTI A;  1E3U A;  5JYP A;  4EET B;  3IF6 C;  1BYW A;  4GNU A;  3PAG A;  4XUX A;  5HL6 A;  4E3I A;  4WN5 A;  4H6J B;  5CTN A;  2YKF A;  2P9V B;  4PKY G;  1YT4 A;  1HD8 A;  4C75 A;  2XA7 M;  4HNB A;  4HOI A;  4S2I A;  3MQ0 A;  1YQS A;  1OPX A;  1MBL A;  4YOF A;  4JPM A;  3PBR A;  5GLB A;  4GZB A;  3S22 A;  3Q82 A;  1SKO B;  2OAQ 1;  4OQI A;  3WRT A;  4OQG A;  2XDM A;  3LIA A;  3UDI A;  1GSW A;  1FQG A;  3EEH A;  4NXG A;  3IBR A;  1GHP A;  2VX8 A;  4KZ9 A;  2KDK A;  1MC0 A;  3LFV A;  3SS4 A;  1P0Z A;  5I94 A;  5EVL A;  3IHB A;  3NOP C;  4D60 A;  1ES5 A;  1N9O A;  2I9V A;  2V20 A;  4JGR A;  1IKI A;  3D72 A;  3CHW P;  1IYO A;  5A91 A;  4NKP A;  4C6Y A;  3LR3 A;  3OPP A;  5A90 A;  3M6H A;  1MXO A;  1K0K A;  2Y2O A;  3FWL A;  2Y79 A;  4LV1 A;  3E0Y A;  4CPK A;  3A3J A;  2KOI A;  3KSI A;  3CPT A;  1YLZ A;  4PHT A;  2A24 A;  4P6Z M;  4MN7 A;  4Y0O A;  1ZTU A;  3EOI A;  1S4S A;  1WYB A;  1S1Z A;  3IX8 A;  5KZH A;  5HDS A;  3U2A A;  2HF6 A;  1U60 A;  4RVA A;  3NOU C;  4OPZ A;  4EBP A;  1DJB A;  1G68 A;  4CLC C;  1NJ4 A;  2DCF A;  2J7V A;  4LV2 A;  2Q9N A;  3ZG5 A;  1OTA A;  2HGV A;  3PBT A;  2UWX A;  4EV4 A;  4E3L A;  3VP3 A;  2QKP A;  4O0P A;  3E4Q A;  5HAI A;  2K7S A;  2W0N A;  4BMW A;  4GOG A;  1YKD A;  3DBA A;  1P9R A;  3R4K A;  2IWC A;  5F68 A;  4ARZ A;  3V3S A;  4BD0 A;  3N4I A;  2KX6 A;  3WS1 A;  5HW3 A;  4MBF A;  2PHY A;  5F5Y A;  1HZO A;  3LIB A;  1NLZ A;  1PI4 A;  3O86 A;  1XGI A;  4L9E A;  3GTC A;  3K3C A;  2WGI A;  1YLY A;  1PFL A;  3OLO A;  2OSU A;  4NXF A;  4N92 A;  3LID A;  4BBV A;  3CLO A;  4MMN A;  2E8J A;  3G2Z A;  2ZD8 A;  3BQA A;  2Y2H A;  2NUP C;  1HLU P;  2QMI A;  1S1Y A;  4DDS A;  4BQM A;  4DRT A;  4F94 A;  3CPT B;  1LSV A;  1L0D A;  2A24 B;  5IT5 A;  5FQI A;  1CK3 A;  4EEU A;  3G30 A;  1T18 A;  3FC7 A;  4PM9 A;  3LIF A;  1ES4 A;  3LYX A;  2ZMA A;  5FAO A;  2ZQ8 A;  2Q0O A;  3UO9 A;  4NXE A;  3T4Q A;  2P7J A;  4DKI A;  1OT6 A;  4KG6 A;  1W79 A;  3DTK A;  3TW8 A;  1C3B A;  3LR4 A;  2ACG A;  2VKS A;  4G3K A;  1JNU A;  4R3J A;  4YWZ A;  1H3Q A;  2HPB A;  4ZJ3 A;  2A3U A;  4S2M A;  5GLA A;  1MZU A;  5TR7 A;  1FIL A;  4WMC A;  4K0X A;  3TJZ C;  4ZAM A;  3PBS A;  3OZH A;  4HY8 A;  3LR0 A;  4HES A;  4ZBE A;  4HJ6 A;  2BG1 A;  2G2W A;  5BOH A;  5HWW A;  4A5R A;  3UE3 A;  3KYQ A;  3KSG A;  5FI7 A;  2JCH A;  2B02 A;  3MZE A;  3W8K A;  2K2N A;  3RJU A;  3UDX A;  3BYD A;  4LRX C;  3O88 A;  1TDG A;  4C3Q A;  4PM8 A;  2XFT A;  4E3O A;  2HZ5 A;  4E3M A;  3NI9 A;  1TDL A;  5FEG A;  3MJQ A;  3WS2 A;  1JTG A;  1ES3 A;  4N9L A;  1IEM A;  5AVF A;  1W63 M;  2XRN A;  3EGX C;  2IA2 A;  3IX4 A;  4BWI A;  1JTD A;  2EXA A;  1VB6 A;  3HLC A;  1SKF A;  1OJ5 A;  4KZB A;  3ICY A;  1EW0 A;  5EM0 A;  3HLF A;  3K3D A;  4ZDX A;  2W3F A;  3C7V A;  4XUZ A;  3HLE A;  2XSS A;  3N8L A;  3NJA A;  3NCK A;  4OPQ A;  1FSY A;  3ZQ5 A;  3JYI A;  1KE3 A;  1HVB A;  2J3T C;  1N9N A;  2P74 A;  2QJ7 A;  1T1C A;  1BSG A;  2J80 A;  2EX9 A;  4DF6 A;  3C7U A;  1YM1 A;  5F6A A;  3OPR A;  4KZ3 A;  4GCZ A;  1KE0 A;  1E3U D;  4WLA A;  3TE8 A;  1H5X A;  1RP5 A;  5D3O A;  3N6I A;  3N8S A;  1TEM A;  3LY3 A;  4JF5 A;  3CUE A;  3UB6 A;  1KGE A;  4XXR A;  4ETX A;  4U3T A;  1YMX A;  4I5S A;  3G31 A;  4HI4 A;  2Y59 A;  5L07 A;  4ZJ1 A;  4QU3 A;  1NLY A;  3CAX A;  4K91 A;  5FQJ A;  2L4R A;  2XLN A;  3QNB A;  4WM9 A;  2BAS A;  1SDN A;  1JWP A;  2WKP A;  3ZFZ A;  4Y15 A;  3OC2 A;  3E4O A;  3DAV A;  1DP9 A;  2JKT M;  2UV0 E;  5AQA A;  1YAX A;  1ZG6 A;  4OOY A;  3DWZ A;  3ITA A;  1XA1 A;  1FR6 A;  4I3I A;  4IVK A;  4QB8 A;  3HRE A;  2D01 A;  1GSV A;  4KUO A;  1L0E A;  4WZ5 C;  4OPR A;  2QYB A;  1ERM A;  3BW6 A;  3VP4 A;  4DE1 A;  1K4F A;  2JN7 A;  2EWV A;  2WYX A;  5JYO A;  4S2L A;  4MEZ A;  3OBF A;  3H7W A;  5GLC A;  3HCY A;  4JGQ A;  5HSQ A;  4Q8I A;  4GD8 A;  5TFQ A;  4KZ4 A;  2HP9 A;  3H9W A;  4ESP A;  1YLJ A;  5CX7 A;  4KQO A;  2Z2L B;  1VHM A;  4E6X A;  2VV7 A;  2ZC7 A;  4MNR A;  3QP5 A;  4ME4 A;  3T4T A;  3IXG A;  2JKT I;  2P9V A;  2XEP A;  2HDQ A;  4OOL A;  2RL3 A;  1LI0 A;  4NET A;  4FUW A;  1M6K A;  1L2S A;  3LEQ A;  4OON A;  3Q7Z A;  2WKE A;  3P7N A;  3S4X A;  3BY8 A;  1HTZ A;  1PW8 A;  1W5D A;  3MFX A;  5HWV A;  3E4P A;  3G2Y A;  1CI8 A;  2GNX A;  5LBR A;  2A2L A;  4HHD A;  3W4Q A;  1MWT A;  3LR5 A;  3PBO A;  4GKU A;  1S4R A;  4KQD A;  2P08 A;  4PM7 A;  4DE3 A;  4OKP A;  1TS0 A;  3GMW A;  4NEE D;  2WK0 A;  3A3F A;  3UPO A;  4P87 A;  4QHC A;  1CQA A;  1NY0 A;  3GRJ A;  2H0T A;  2V2F F;  1PNE A;  3GDI A;  2EX2 A;  4QPR A;  3CI6 A;  2C6W B;  2PYR A;  3BQ8 A;  1ESU A;  4BBT A;  4O7D A;  4S2O A;  3ZYT A;  3LI8 A;  3KO6 A;  5CHJ A;  4OQ0 A;  2Y2M A;  4L0L A;  2AVX A;  3IXH A;  1XA7 A;  4I3J A;  2WZZ A;  5HPI A;  2X71 A;  1S0W A;  4IBR A;  4U0X A;  3G4P A;  2QHK A;  3HJI A;  2Y2K A;  5G4Y A;  1CI9 A;  3PR6 A;  1FCM A;  5DKK A;  1NWZ A;  3D4F A;  4N1H A;  2J9P A;  2NUT C;  2W1R A;  2WKR A;  3MR0 A;  2V1Z A;  1PZO A;  4Y17 A;  3BRM A;  1D7E A;  1PWC A;  1O07 A;  1SDE A;  5L8M A;  4WZ4 A;  4EUV A;  3BEC A;  3CUE C;  4X1L A;  1P97 A;  3SH9 A;  1KDW A;  2ZQD A;  5KSH A;  1RCJ A;  4OLD A;  3UB8 A;  3BY9 A;  4QWO A;  3TRC A;  1AXB A;  2HV1 A;  5FDS A;  2WZX A;  1JWZ A;  4LCL A;  1VEU A;  5F1G A;  4R70 A;  4WEJ A;  1FCN A;  1XJ3 A;  5CXW A;  5DFY A;  4UHU A;  4DE0 A;  3UE0 A;  1ZHH B;  2BTF P;  3EWK A;  2E8I A;  1T19 A;  4Q0H A;  4WBG A;  3M6B A;  1F2K A;  2GDN A;  3LIE A; 
#chains in the Genus database with same CATH homology
 1VET B;  2PBD P;  5FEF A;  1K0K A;  1HLU P;  1CQA A;  1Z09 A;  1AWI A;  3DAV A;  1YPR A;  1CF0 A;  2PAV P;  3CPT B;  1PNE A;  1D1J A;  2HZ5 A;  1FIK A;  3KYE A;  5FEG A;  3CPT A;  1A0K A;  2JKG A;  3D9Y A;  1G5U A;  2ZL1 B;  3T1X A;  1VET A;  2V8F A;  1PRQ A;  5EM0 A;  5EM1 A;  4X25 A;  1CJF A;  4ESP A;  2ACG A;  3NUL A;  3T1R A;  3T1Q B;  2B95 A;  3U4L P;  2V8C A;  4FTX A;  1J3W A;  2ZL1 A;  1SKO B;  3MS6 A;  3L9K A;  3T12 B;  1FIL A;  1SKO A;  4FUW A;  4X1L A;  1VEU B;  3LEQ A;  3T1S A;  2PRF A;  2JKF A;  1Y4O A;  3NEC A;  4QWO A;  5FDS A;  3LGO A;  1VEU A;  5EVE A;  2VK3 A;  1ACF A;  4X1M A;  3UB5 P;  4D60 A;  5EV0 A;  1SZV A;  1PFL A;  2BTF P;  3MSH A;  3L7H A;  3CHW P;  1F2K A;  2E8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...