3LEQA

The crystal structure of the roadblock/lc7 domain from streptomyces avermitillis to 1.85a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
102
Chain Sequence
HSQLDQLLTGLVDRVAEVDHAVVLSEDGLVVSKSTGFLRDDAERLAATASGLMSLRQALIEMGKGYLILTAAGPGAHLVVLTRQGADVGVVAYQMNMLVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structure genomics, unknown function
molecule keywords uncharacterized protein cvnB5
publication title The Crystal Structure of the Roadblock/LC7 domain from Streptomyces avermitillis to 1.85A
rcsb
source organism Streptomyces avermitilis
total genus 23
structure length 102
sequence length 115
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3leqA00
1HLUP 3T1RA 2E8JA 1CQAA 3D9YA 1J3WA 1PNEA 3CHWP 2ZL1A 2VK3A 2ZL1B 2JKFA 1SZVA 1FILA 4FUWA 1Z09A 3KYEA 5EVEA 2B95A 5EV0A 2V8CA 3LGOA 1PRQA 1ACFA 3T12B 3NULA 2PRFA 1Y4OA 1FIKA 4QWOA 4ESPA 3DAVA 2PAVP 5FEGA 1K0KA 1CJFA 1D1JA 1AWIA 3T1XA 2HZ5A 2JKGA 1VEUA 4D60A 5FEFA 2PBDP 3NECA 3UB5P 5FDSA 1A0KA 3MSHA 3L9KA 1PFLA 1YPRA 1CF0A 3L7HA 5EM1A 3LEQA 1VEUB 4FTXA 3U4LP 2BTFP 3T1SA 1F2KA 5EM0A 4X1MA 4X1LA 2ACGA 3T1QB 1VETA 3CPTA 3MS6A 1SKOA 1VETB 3CPTB 1SKOB 4X25A 1G5UA 2V8FA
chains in the Genus database with same CATH superfamily
3LFVA 3T1RA 1XJ2A 5FAPA 1T19A 4P0MA 3GSGA 2VX8A 4DN0A 3Q07A 4GB7A 1W8YA 2ZL1A 4XUXA 3VSLA 3VE3A 2ZBBA 4PKYA 4L9EA 1E3UD 3CI6A 3E2KA 3H7WB 4N9KA 2HP5A 1V9YA 5EVEA 2Y79A 3QP6A 3K3DA 3BQ8A 1KOUA 2V0WA 3LGOA 3GECA 4IEDA 3ICYA 4K08A 3IHBA 1DY6A 1V9ZA 2W1TB 3JVUA 5HX9A 1HZOA 1OT6A 2ZQ8A 3OPRA 4X6TA 2O0YA 2Q9NA 2HDUA 3A3DA 1MPLA 1PIOA 1X0OA 3BY8A 1WYCA 4OH0A 3EGDC 1L0EA 4MMNA 2EX2A 2W0NA 1DJCA 5AQ9A 3UO9A 1BLHA 4DXCA 1OTAA 4Y7PA 3A0SA 4OQIA 3LR5A 3BLSA 3MZEA 2VLGA 4NXBA 4OONA 3UB5P 3NCKA 2JE5A 3MSHA 1GHIA 3LR0A 3ZQ5A 3ZHHA 4RYEA 2WZZA 2M7VA 4R6LA 2PU2A 3VOZA 2HDRA 1LI0A 4KENB 3ULFA 1RGZA 4NXEA 3T4JA 4UAAA 1F98A 5CHMA 1E3UA 1K4FA 2XFTA 2QWSA 2BTFP 4JGQA 3CPTB 3O87A 1SKOB 5G4YA 2W1TA 3VMAA 2Y2KA 3JVVA 4CLCB 1IKGA 2VK3A 1XA1A 2JKTI 1D06A 2JKFA 3VSKA 4OOYA 4QY6A 4FUWA 4GW9A 1OTIA 4S2LA 2QJ5A 4S2MA 1C3BA 3UE1A 3EEHA 4LENA 1ERQA 4UQIS 4QPRA 4WZ4A 1S1ZA 4IJGA 1TVFA 2QHKA 2WKQA 3GMWA 1J9MA 2JCHA 4K0XA 1NRJA 5TR7A 5GLAA 3H9WA 1S66L 4EUVA 5G18A 4RQ9A 1W79A 3W8KA 4P6ZS 3LI9A 2J3WA 1KE3A 2BG1A 3BEBA 2ZM2A 4LRZE 1ES5A 3C30A 2G2UA 1T1AA 4PPRA 3NOUC 2D02A 3IHAA 3MF0A 3AGFA 3UY6A 4JXGA 3VOLA 1K56A 5KZHA 3V3SA 3B33A 3CITA 1TD5A 3IH8A 2VGLM 5M19A 3DTKA 3BYDA 1KVMA 4GS9A 3Q7VB 3TE8A 3R4KA 3IWQA 4FD8A 2ZD8A 1PW8A 3JPUA 1OTEA 1G5UA 2JBFA 3F1PA 3SOIA 3FKVA 5CTNA 1CQAA 3IS2B 4LRYC 4I39A 3UN7A 2V9AA 4ARZA 5DF8A 2INWA 3A3FA 1K55C 1PW1A 2WUQA 3MZFA 3O3VA 5EFWA 3T12B 3NULA 2MJ6A 1L0GA 3GR2A 3EQVA 1UWPX 5EOOA 4S2NA 4BL3A 3QP1A 2EFXA 2OOLA 5GHXA 4MN7A 2X01A 4U3TA 1XFNA 3T4LA 2LB9A 3HBRA 3WS2A 3TOIA 1LSWA 5F1FA 4YNRA 4IUHA 1BLCA 2BASA 1K6RA 4U0XA 4UA6A 2RCXA 5I5LA 3N4IA 2ZQ7A 3HUMA 4CJNA 3Q7VA 1TS6A 2WKIA 1ZTUA 4ETZA 2J8YA 1H8MA 1NZUA 1NY0A 4M4XA 1AXBA 5J8XA 3IXBA 3NDEA 1BUEA 4LV1A 1ODVA 2H0TA 4BBTA 2XFSA 5CXWA 3PBNA 3IS2A 1MWRA 1EW0A 2Z2LB 1YMXA 4L9GA 4KUKA 4DRTA 5TBMB 2WZXA 4QY5A 4FTXA 3BRMA 2XK1A 5FQIA 2EX9A 2L1MA 2I9VA 1S1YA 5LBRA 3G35A 3WS4A 1FR6A 3T1QB 2XLNA 1ONGA 4B4XA 2V8FA 5EVIC 1GSVA 5FI6A 3T4OA 4DDYA 2VKSA 2A49A 2WK0A 4I38A 2Y8HA 4N92A 1P9WA 4LPZA 4ZDXA 4GN2A 3SS5A 2PYPA 1UGUA 4PM9A 3KYEA 1PWDA 1M6KA 3W4PA 3F1NA 1GHPA 4LFUA 4X53A 3RH8B 5MC7A 2PT7A 2Y55A 2W3DA 3SZTA 3IF6B 1YLZA 3LR3A 3HLCA 3S7NA 2EA9A 1D7EA 1LSXA 1GA0A 1GSWA 4XT2B 3P09A 4Y13A 2Y2JA 5HDDA 3G4PA 5TBMA 1ES3A 3PTEA 3NDGA 3NECA 1IEMA 1PZPA 3HLEA 1PFLA 5FASA 2XD1A 2OAP1 1BULA 2NUPC 1JVJA 4EETB 4KZ9A 4UA9A 4YINA 2BLSA 1ES4A 3ISGA 2M1CA 1OTBA 1XX2A 4KZ3A 2H10A 2WKHA 1BLSA 3W2ZA 2WGVA 2LB5A 3FPWA 4UHUA 2ZQDA 5IHVA 3P7NA 5FQ9A 3A0RA 2FFYA 2Z6CA 1MKIA 1Z6FA 1PZOA 2ZMVA 4HOIA 3N8SA 1Y28A 4FSFA 2ZC6B 3W4QA 5FL3A 3BFCA 3WS0A 1ZC2A 1N9BA 3WS5A 2Y2NA 1P0ZA 1ZKJA 2ZOIA 5CEDA 4S2IA 2XQZA 1RP5A 3S4XA 4XT2A 4DJ2A 2A24A 1OT9A 5A8BA 1G28A 4EW7A 3BFGA 3S7QA 1H3QA 1JWVA 3T4SA 4HP4A 2W3EA 3O86A 2V1ZA 2HJ9C 3IBJA 3ZFZA 1K0KA 4QD4A 4R0QA 3A3IA 4HJ4A 4EV4A 3SS4A 4L9FA 1SKFA 1XGIA 4X55A 3TSGA 1W8QA 1I2SA 1LLBA 2ZMFA 1MZUA 4X56A 4DKIA 4BENA 5HAIA 1PI4A 5AJGA 5DVAA 4BD1A 3CZDA 3P98A 4ID4A 4DF6A 2A2LA 3FPVA 3MKEA 4MN6A 2ZJ9A 4Y3IA 3M2KA 4OPZA 3VP3A 3GQZA 1LSVA 5HW3A 3HVFA 4E6WA 2HV1A 5M18A 5GL9A 4AFIA 5HL1A 2Y59A 4S2JA 5F6AA 3KSFA 2XR0A 2XH9A 1FSYA 3O88A 2P74A 4WYYA 3ITAA 2Y2GA 5JYOA 5L10A 4LRXC 4BMWA 1Z09A 2B02A 3M2JA 4B88A 4WZ5A 3GVBA 3N6IA 2V8CA 3H82A 3VOYA 1NLYA 1PRQA 3IWOA 3FV7A 4E3IA 3Q1FA 4EBPA 3ZG7B 1RGYA 5KSCA 2PHYA 3M6BA 4EQ1A 3LY3A 3UPOA 1ES2A 1Q2QA 2ZQCA 4UEYA 4B93A 5DF9A 4PM8A 4R70A 1I5QA 1YKDA 3MXSA 5C5KA 1N9NA 4N1HA 1E4DA 1WA9A 4HEFA 3E0YA 3S7OA 1ZG4A 4EEPA 2I72A 3CG5A 2HZ5A 1MY8A 2DRWA 4D60A 1KE0A 2PBDP 4PKYG 4E3NA 1L0DA 3DTIA 1ALQA 2J3TD 2X02A 1HD8A 5IS1A 1XPBA 3KO6A 5HWTA 3M6HA 4C75A 2EWWA 1XXMA 1CI8A 2CC1A 4H6JB 3HJKA 1KGFA 1VM1A 2WGWA 3UDXA 5FQKA 5F69A 2ZM0A 1TS0A 1YAXA 1G6AA 3OC2A 1F2KA 3E4QA 1NWZA 5EM0A 3VP4A 3MS6A 3BFEA 1HLUP 3P01A 2E8JA 1DP9A 3MQ0A 3KX0X 3KYZA 2Q0OA 4JXVA 3IX4A 3BFFA 5EOEA 3LIBA 3H7WA 4Y17A 4GLQA 1XKZA 5IU1A 2ZM8A 3KSIA 1N4OA 1P97A 2VGLS 5M1AA 4DJ3A 3UE0A 1IELA 1GHMA 4DXBA 3V5MA 4OOMA 5A90A 2FFFB 4QB8A 5EUAA 2XGNA 1FIKA 3VFFA 4Y0OA 4ESPA 4CLCD 2ZC5B 2XDMA 2W1RA 2H5SA 3F1OB 3PR6A 4WN5A 5F82A 3PHYA 4FH2A 2JC7A 3LEZA 4LGWA 5KIZA 4Q0HA 3NY4A 2R78A 4JGPA 4E3MA 1P9RA 2Y91A 3A3JA 3BY9A 1JNUA 1CEFA 4KZ6A 5DJUA 4WM9A 4MNRA 3BW6A 2JKGA 4FOFA 3G34A 1S4SA 1GSXA 3LY4A 2OAQ1 4JPMA 3HJIA 2P04A 1CF0A 3L7HA 1FOFA 2Y2OA 3HREA 3D4FA 1T18A 2QMIA 2IA2A 4R4RA 4RX3A 4JGRA 1MWTA 3N8LA 4R3AA 1KDWA 5G4ZA 2JKRI 1OJGA 4NKPA 3ZYTA 4WUJA 4II7A 2UWXA 3CPTA 1SKOA 4KQRA 2DCFA 1YLJA 3CUEA 1LL9A 5CGWA 4CLCA 1PNEA 4OPYA 3UB8A 3LIEA 1TDGA 2P9VB 5F1GA 1NLZA 3MR0A 1XP4A 4L0LA 2O9AA 2VGKA 3C38A 3O5YA 4WEJA 2XD5A 3UPPA 4HH3A 4NG2A 3UB7A 4WELA 4LCMA 4JKTA 3MBZA 2EX8A 2PR5A 2K2NA 3UE6A 3Q82A 5HWVA 5HPIA 2P08A 2JN7A 2PD7A 3TG9A 2GNXA 4I3JA 4GCZA 4NK3A 3E98A 2Y2IA 1SCWA 2EX6A 4GHIB 2ZC3B 4LV2A 3RXWA 3OBFA 4B4ZA 1K38A 3BJNA 3C7VA 4DDSA 1OTDA 3KYQA 3ZDJA 2HJEA 1Q2PA 2XEPA 5CGSA 1FCMA 4QU3A 1ESUA 3BM6A 2P9VA 3U4LP 3BQAA 3FG8A 4Q0IA 3RFBA 1JTDA 1W63Q 2VV7A 3OPPA 3CWFA 3IT9A 2GDNA 3LICA 2PD8A 4QHCA 5AVFA 3NOPC 4OLGA 4MEZA 1ERMA 1DJBA 5F83A 3QNCA 4BWIA 1NXYA 5J3WA 5HDCA 3UNWA 3FZCA 5KSHA 4OP8A 5EECA 3T4QA 4WZ5C 2J7VA 3V3RA 3ZVTA 1YLTA 2YKFA 4ZAMA 5GLBA 3KSHA 1MWUA 4EESA 3S1YA 4IVKA 4PMAA 4PM7A 4GDNA 4P6BA 2EXAA 2UV0E 4S2KA 5HDSA 3HLBA 3EOIA 4LCLA 3B42A 3MFXA 5HAQA 4P87A 3R7WB 1KGGA 3AGEA 2O99A 5HFOA 3DBAA 2HGVA 4OVDA 1EWZA 2E8IA 5AQBA 2W3HA 1XJ4A 1T1BA 4EWFA 4ZTKA 3PBRA 4XUZA 1BT5A 1G6OA 3T4TA 3D3OA 3L9KA 4KG2A 4BD0A 5AQ7A 4E3LA 5U47A 3T4KA 3A0VA 3PBSA 1KGEA 5HSQA 3K3CA 4KZAA 3G31A 3FKWA 5FI7A 3Q7ZA 2XF3A 4O8GA 3LI8A 1YSQA 4Q8IA 5IT5A 1VETB 4Y2FA 1UWNX 2ZC4B 1VQQA 4JF6A 5HWWA 2Y2HA 4ZJ1A 1NYMA 3CMZA 3CLOA 2QJ7A 5A92A 2ZC7A 4I5SA 1SZVA 1ONHA 3UPNA 3MKFA 1O7EA 2Y4AA 1GCEA 4E3KA 4Y5FA 1F5MA 1IOUA 3WS1A 4S2OA 1L2SA 5DJTA 3IX3A 3LIDA 4HP9A 2VA0A 3CAXA 3MZDA 4MBFA 4NXGA 3IF6A 3HUOA 2R9XA 1K57A 1S6RA 3D72A 1TDLA 2XA7M 1CJFA 2PYRA 4CQHA 4E04A 1LL5A 4G3WA 3PAGA 1K6SA 3TJZC 2PDRA 4HQAA 3QNBA 4H8RA 2JHEA 4U0TA 3PBQA 5FDSA 4WEKA 1YQSA 3NJAA 4O0PA 4EUZA 1T1CA 4HJ3A 2VZWA 3DW0A 4DE2A 1LI9A 4PHTA 4KZBA 4N1XA 4C6YA 4WBGA 5D3OA 1VHMA 2WGIA 1FQGA 3EEAA 3C2WA 3MXQA 1PI5A 5DKKA 4WF0A 4OLDA 4GOGA 5E2EA 1IKIA 3ZG8B 1NJ4A 3FWLA 4X1MA 1K55A 4IBXA 2ACGA 5DFXA 4X25A 4XXRA 5EVIB 5EVID 3NOTC 4N9LA 3CUEC 5CERA 3DTEA 3FC7A 4X68A 4F94A 2OWJA 1YLPA 2VV6A 3LIAA 2ZL1B 1N9LA 5HPFA 5A91A 4Y0TA 1FILA 1HTZA 5CHJA 3OCNA 3MFDA 5FDHA 2G2WA 4KQOA 4KZ4A 2D01A 1YMSA 4ME4A 4DE1A 2W3GA 1ESIA 4QWOA 2A3UA 5CEBA 3B47A 1MXOA 3DAVA 4OQHA 4BBUA 2QYBA 4A5RA 2XROA 5FEGA 3ZCZA 4LV3A 3T50A 3LUQA 5DTTA 3NBLA 3ZVWA 4R4SA 3VE4A 1DJAA 3NIAA 3DTMA 5FEFA 3EQUA 4S2NC 3HLDA 3IX8A 3A3EA 4GD6A 3LR4A 1K54A 3HCYA 3ZGAB 5FA7A 4JF4A 2H28A 1G68A 3IXHA 2H0YA 3MXRA 5GLCA 2JKRM 3IBRA 3HLGA 3QP2A 2AVXA 3IXGA 3C7UA 5E2FA 4CPKA 1XJ6A 4MBHA 3DWZA 2VGJA 3HUNA 3KSGA 2ZLYA 1DP8A 4WLAA 5DF7A 4X1LA 5FATA 4ZBEA 3V50A 2OLUA 4BJPA 3D9YA 3DWKA 4GKUA 3BLMA 1CEGA 1OMEA 2HP6A 4YOFA 2GZAA 4DE0A 4RA7A 1YT4A 1W63M 3RXXA 2FH5A 4R1GA 5CGXA 5HD3A 1YLWA 4HBUA 4Q0JA 4YFMA 2ZQAA 2RL3A 4BLMA 5FQQA 4OOLA 1ACFA 1H8YA 4PAUA 2GJ3A 1YLYA 5DKLA 5DTSA 5FQJA 3N7WA 3NHQA 3UMDA 4JLFA 3W4OA 4MDZA 4EQIA 5DFYA 3VP1A 3OZHA 2KX6A 2Y2QA 1DP6A 4MN5A 4EBNA 2R9WA 4NETA 2QPNA 3TW8A 2XSSA 5HARA 2EXBA 3LIFA 4JXSA 1WE4A 2V20A 3V67A 2OV5A 3IF5A 3GV9A 1WYBA 5AVEA 3RJUA 4EEUA 5KMWA 5CX7A 1H8ZA 4EERA 1K56D 1QMFA 2OSUA 1IYQA 4H6JA 5K5BA 2WKEA 2ZQ9A 5BOHA 2YKHA 4Z1WA 1VEUB 4I3IA 1OJ5A 4GS9B 3OLOA 5A93A 1RCJA 4O7DA 3G2YA 3Q81A 2WYXA 2J9PA 5F5YA 3S22A 3WRZA 5TJJA 3F1PB 4RX2A 3BWLA 2VJWA 3UB6A 4JGOA 4LV0A 3CHWP 1IYSA 3HLWA 5EPHA 2CMNA 4GD8A 1LL8A 4MLLA 5DTKA 2WKPA 4ARZB 4IVIA 3G32A 3AGDA 4KG5A 1U60A 4KQDA 3GTCA 4KZ8A 1LT0A 1F9IA 3IH9A 3EGXC 4IBRA 3OPLA 5L2FA 3G6OA 3WWXA 1IFQA 4LLOB 2EWVA 3MQQA 3F1OA 3IF6C 4ZJ3A 2Z2MB 1Y54A 1H0MA 5F68A 5FI2A 1K57C 1CI9A 4B9OA 4WMCD 2HPBA 4PM5A 3OCLA 1SDNA 4R23A 3VFHA 3ZG0A 1FCOA 1VEUA 3I7JA 2QKPA 1TS7A 2Y2PA 1NRFA 1MWSA 3NC8A 3BECA 2O9BA 4KG6A 1A0KA 3IWIA 3E4OA 4HY8A 2C6WB 3MQOA 1YPRA 4JF5A 2XRNA 3VP2A 2HDSA 5L07A 4FCFA 2DMWA 5EM1A 4HI4A 5L8MA 4K0WA 3VV4A 1H5XA 4ETXA 3LEQA 1BLPA 5E2GA 4UQIM 4BL2A 2WADA 5HAPA 3HLFA 3T1SA 3ZNTA 4G3VA 3GRJA 3WRTA 2X71A 1E25A 4Y0UA 2PR6A 5AQAA 4IHQA 2WAFA 2J9OA 3CJMA 1XA7A 1VB6A 5FAOA 1MBLA 2ZOHA 2NUTC 4R38A 4P6ZM 5GHYA 4HH2A 5I94A 4GNUA 4WMCA 3QP5A 2OWHA 2P7JA 4BQMA 3UDIA 1L0FA 1XGJA 3U2AA 2C5WB 2HF6A 3G30A 1K4EA 1Y4OA 3F1NB 3G2ZA 4MCWA 2B5RA 3B3XA 4OQGA 5FSRA 1GA9A 5EE8A 1N9OA 2FZ0A 1S67L 2PAVP 4GDBA 4PM6A 2V0UA 4KZ7A 1JWZA 5CECA 2EFUA 3ZG9B 1IYPA 2KDKA 2IWBA 1BYWA 5TFQA 3PBTA 3SH7A 3HL9A 3N8RA 1FR1A 1BZAA 5EVLA 1MKMA 5E2HA 4C3QA 4HJ6A 2J80A 2WKRA 2PBYA 4WL9A 2L0WA 1I2WA 4GHIA 4DE3A 1LHYA 2HP9A 5GHZA 1K54C 4OP5A 1L3LA 1YSPA 1SDEA 3OOVA 2PU4A 2WAEA 3C8CA 2Z6DA 4P85A 4F3LB 3V39A 2XA7S 4HHDA 2Q9MA 4EU0A 3LYXA 2IWCA 3GDIA 4G3KA 3ZNYA 4KQQA 4QJGA 3NI9A 1J3WA 1EI5A 2O9CA 1XFQA 3QHYA 3SS3A 4R3BA 4EBLA 2VV8A 1NZOA 4KUOA 4ZJ2A 3UDFA 4E3JA 4R3JA 2B95A 4K91A 2A24B 2Y2MA 1SHVA 3FYZA 3MJQA 2PRFA 4KZ5A 2IWDA 3QP4A 1XJ3A 3C5AA 1MC0A 2ZMAA 1W7FA 4O01A 5GLDA 4X69A 5CRFA 3UMEA 2QZ6A 3VP0A 5FAQA 5FQMA 3PYPA 3RTYA 2V1BA 4RVAA 1K25A 4YWZA 4OQ0A 3R7WA 4E6XA 1D1JA 5JYPA 1S0WA 1PWCA 1ZHHB 3SW1A 1TS8A 1EROA 4F3LA 1FSWA 3ZG5A 4S2PA 4D2OA 1DRMA 4BBVA 2J3TC 3MMHA 2Y2LA 3IQAA 4GJ4A 5J7EA 4ZRRA 3ITBA 4Z9QA 3EWKA 2K7SA 1O07A 3JYIA 4JBFA 2KLIA 2GX5A 3PXPA 5J4EA 4I3AA 3PBOA 3UE3A 3E4PA 2KOIA 2W3FA 3BFDA 2V2FF 1STZA 1VETA 1TF1A 4HBTA 4OKPA 2HDQA 4EXOA 1W5DA 1CK3A 1S4RA 3OPHA 4NXFA 4HESA 2OLVA 3LCEA 4HNBA 1TEMA 3SH8A 2L4RA 2W27A 1QMEA 4OPRA 1KDSA 3C4PA 3S7PA 1BTLA 5L09A 5EV0A 3K2NA 3H82B 4GZBA 1YM1A 1NYYA 4Y15A 3C4OA 4CLCE 2B18A 1HVBA 5HL6A 4CLCC 3LO7A 5E43A 3E2LA 1KVLA 1KE4A 5HZHA 2DNSA 3TRCA 4E3OA 1AWIA 2M7UA 5TGFA 4FH4A 3SH9A 1JWPA 3T1XA 2V1AA 4MBKA 2VEAA 4JXWA 4M3KA 4HIAA 1OPXA 1PWGA 4NEED 3IXDA 4IUKA 1ZG6A 3UB9A 2JKTM 1BSGA 1PYYA 5CTMA 2K31A 4OPQA 5CHUA 5HD5A 2G7UA 2WGWB 1FCNA 4UA7A 3PAEA 1M40A 1IYOA 4DMZA 3QP8A 5EVIA 1JTGA
chains in the Genus database with same CATH topology
1HLUP 3T1RA 2E8JA 1CQAA 3D9YA 1J3WA 1PNEA 3CHWP 2ZL1A 2VK3A 2ZL1B 2JKFA 1SZVA 1FILA 4FUWA 1Z09A 3KYEA 5EVEA 2B95A 5EV0A 2V8CA 3LGOA 1PRQA 1ACFA 3T12B 3NULA 2PRFA 1Y4OA 1FIKA 4QWOA 4ESPA 3DAVA 2PAVP 5FEGA 1K0KA 1CJFA 1D1JA 1AWIA 3T1XA 2HZ5A 2JKGA 1VEUA 4D60A 5FEFA 2PBDP 3NECA 3UB5P 5FDSA 1A0KA 3MSHA 3L9KA 1PFLA 1YPRA 1CF0A 3L7HA 5EM1A 3LEQA 1VEUB 4FTXA 3U4LP 2BTFP 3T1SA 1F2KA 5EM0A 4X1MA 4X1LA 2ACGA 3T1QB 1VETA 3CPTA 3MS6A 1SKOA 1VETB 3CPTB 1SKOB 4X25A 1G5UA 2V8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLU P;  3T1R A;  2E8J A;  1CQA A;  3D9Y A;  1J3W A;  1PNE A;  3CHW P;  2ZL1 A;  2VK3 A;  2ZL1 B;  2JKF A;  1SZV A;  1FIL A;  4FUW A;  1Z09 A;  3KYE A;  5EVE A;  2B95 A;  5EV0 A;  2V8C A;  3LGO A;  1PRQ A;  1ACF A;  3T12 B;  3NUL A;  2PRF A;  1Y4O A;  1FIK A;  4QWO A;  4ESP A;  3DAV A;  2PAV P;  5FEG A;  1K0K A;  1CJF A;  1D1J A;  1AWI A;  3T1X A;  2HZ5 A;  2JKG A;  1VEU A;  4D60 A;  5FEF A;  2PBD P;  3NEC A;  3UB5 P;  5FDS A;  1A0K A;  3MSH A;  3L9K A;  1PFL A;  1YPR A;  1CF0 A;  3L7H A;  5EM1 A;  3LEQ A;  1VEU B;  4FTX A;  3U4L P;  2BTF P;  3T1S A;  1F2K A;  5EM0 A;  4X1M A;  4X1L A;  2ACG A;  3T1Q B;  1VET A;  3CPT A;  3MS6 A;  1SKO A;  1VET B;  3CPT B;  1SKO B;  4X25 A;  1G5U A;  2V8F A; 
#chains in the Genus database with same CATH topology
 3LFV A;  3T1R A;  1XJ2 A;  5FAP A;  1T19 A;  4P0M A;  3GSG A;  2VX8 A;  4DN0 A;  3Q07 A;  4GB7 A;  1W8Y A;  2ZL1 A;  4XUX A;  3VSL A;  3VE3 A;  2ZBB A;  4PKY A;  4L9E A;  1E3U D;  3CI6 A;  3E2K A;  3H7W B;  4N9K A;  2HP5 A;  1V9Y A;  5EVE A;  2Y79 A;  3QP6 A;  3K3D A;  3BQ8 A;  1KOU A;  2V0W A;  3LGO A;  3GEC A;  4IED A;  3ICY A;  4K08 A;  3IHB A;  1DY6 A;  1V9Z A;  2W1T B;  3JVU A;  5HX9 A;  1HZO A;  1OT6 A;  2ZQ8 A;  3OPR A;  4X6T A;  2O0Y A;  2Q9N A;  2HDU A;  3A3D A;  1MPL A;  1PIO A;  1X0O A;  3BY8 A;  1WYC A;  4OH0 A;  3EGD C;  1L0E A;  4MMN A;  2EX2 A;  2W0N A;  1DJC A;  5AQ9 A;  3UO9 A;  1BLH A;  4DXC A;  1OTA A;  4Y7P A;  3A0S A;  4OQI A;  3LR5 A;  3BLS A;  3MZE A;  2VLG A;  4NXB A;  4OON A;  3UB5 P;  3NCK A;  2JE5 A;  3MSH A;  1GHI A;  3LR0 A;  3ZQ5 A;  3ZHH A;  4RYE A;  2WZZ A;  2M7V A;  4R6L A;  2PU2 A;  3VOZ A;  2HDR A;  1LI0 A;  4KEN B;  3ULF A;  1RGZ A;  4NXE A;  3T4J A;  4UAA A;  1F98 A;  5CHM A;  1E3U A;  1K4F A;  2XFT A;  2QWS A;  2BTF P;  4JGQ A;  3CPT B;  3O87 A;  1SKO B;  5G4Y A;  2W1T A;  3VMA A;  2Y2K A;  3JVV A;  4CLC B;  1IKG A;  2VK3 A;  1XA1 A;  2JKT I;  1D06 A;  2JKF A;  3VSK A;  4OOY A;  4QY6 A;  4FUW A;  4GW9 A;  1OTI A;  4S2L A;  2QJ5 A;  4S2M A;  1C3B A;  3UE1 A;  3EEH A;  4LEN A;  1ERQ A;  4UQI S;  4QPR A;  4WZ4 A;  1S1Z A;  4IJG A;  1TVF A;  2QHK A;  2WKQ A;  3GMW A;  1J9M A;  2JCH A;  4K0X A;  1NRJ A;  5TR7 A;  5GLA A;  3H9W A;  1S66 L;  4EUV A;  5G18 A;  4RQ9 A;  1W79 A;  3W8K A;  4P6Z S;  3LI9 A;  2J3W A;  1KE3 A;  2BG1 A;  3BEB A;  2ZM2 A;  4LRZ E;  1ES5 A;  3C30 A;  2G2U A;  1T1A A;  4PPR A;  3NOU C;  2D02 A;  3IHA A;  3MF0 A;  3AGF A;  3UY6 A;  4JXG A;  3VOL A;  1K56 A;  5KZH A;  3V3S A;  3B33 A;  3CIT A;  1TD5 A;  3IH8 A;  2VGL M;  5M19 A;  3DTK A;  3BYD A;  1KVM A;  4GS9 A;  3Q7V B;  3TE8 A;  3R4K A;  3IWQ A;  4FD8 A;  2ZD8 A;  1PW8 A;  3JPU A;  1OTE A;  1G5U A;  2JBF A;  3F1P A;  3SOI A;  3FKV A;  5CTN A;  1CQA A;  3IS2 B;  4LRY C;  4I39 A;  3UN7 A;  2V9A A;  4ARZ A;  5DF8 A;  2INW A;  3A3F A;  1K55 C;  1PW1 A;  2WUQ A;  3MZF A;  3O3V A;  5EFW A;  3T12 B;  3NUL A;  2MJ6 A;  1L0G A;  3GR2 A;  3EQV A;  1UWP X;  5EOO A;  4S2N A;  4BL3 A;  3QP1 A;  2EFX A;  2OOL A;  5GHX A;  4MN7 A;  2X01 A;  4U3T A;  1XFN A;  3T4L A;  2LB9 A;  3HBR A;  3WS2 A;  3TOI A;  1LSW A;  5F1F A;  4YNR A;  4IUH A;  1BLC A;  2BAS A;  1K6R A;  4U0X A;  4UA6 A;  2RCX A;  5I5L A;  3N4I A;  2ZQ7 A;  3HUM A;  4CJN A;  3Q7V A;  1TS6 A;  2WKI A;  1ZTU A;  4ETZ A;  2J8Y A;  1H8M A;  1NZU A;  1NY0 A;  4M4X A;  1AXB A;  5J8X A;  3IXB A;  3NDE A;  1BUE A;  4LV1 A;  1ODV A;  2H0T A;  4BBT A;  2XFS A;  5CXW A;  3PBN A;  3IS2 A;  1MWR A;  1EW0 A;  2Z2L B;  1YMX A;  4L9G A;  4KUK A;  4DRT A;  5TBM B;  2WZX A;  4QY5 A;  4FTX A;  3BRM A;  2XK1 A;  5FQI A;  2EX9 A;  2L1M A;  2I9V A;  1S1Y A;  5LBR A;  3G35 A;  3WS4 A;  1FR6 A;  3T1Q B;  2XLN A;  1ONG A;  4B4X A;  2V8F A;  5EVI C;  1GSV A;  5FI6 A;  3T4O A;  4DDY A;  2VKS A;  2A49 A;  2WK0 A;  4I38 A;  2Y8H A;  4N92 A;  1P9W A;  4LPZ A;  4ZDX A;  4GN2 A;  3SS5 A;  2PYP A;  1UGU A;  4PM9 A;  3KYE A;  1PWD A;  1M6K A;  3W4P A;  3F1N A;  1GHP A;  4LFU A;  4X53 A;  3RH8 B;  5MC7 A;  2PT7 A;  2Y55 A;  2W3D A;  3SZT A;  3IF6 B;  1YLZ A;  3LR3 A;  3HLC A;  3S7N A;  2EA9 A;  1D7E A;  1LSX A;  1GA0 A;  1GSW A;  4XT2 B;  3P09 A;  4Y13 A;  2Y2J A;  5HDD A;  3G4P A;  5TBM A;  1ES3 A;  3PTE A;  3NDG A;  3NEC A;  1IEM A;  1PZP A;  3HLE A;  1PFL A;  5FAS A;  2XD1 A;  2OAP 1;  1BUL A;  2NUP C;  1JVJ A;  4EET B;  4KZ9 A;  4UA9 A;  4YIN A;  2BLS A;  1ES4 A;  3ISG A;  2M1C A;  1OTB A;  1XX2 A;  4KZ3 A;  2H10 A;  2WKH A;  1BLS A;  3W2Z A;  2WGV A;  2LB5 A;  3FPW A;  4UHU A;  2ZQD A;  5IHV A;  3P7N A;  5FQ9 A;  3A0R A;  2FFY A;  2Z6C A;  1MKI A;  1Z6F A;  1PZO A;  2ZMV A;  4HOI A;  3N8S A;  1Y28 A;  4FSF A;  2ZC6 B;  3W4Q A;  5FL3 A;  3BFC A;  3WS0 A;  1ZC2 A;  1N9B A;  3WS5 A;  2Y2N A;  1P0Z A;  1ZKJ A;  2ZOI A;  5CED A;  4S2I A;  2XQZ A;  1RP5 A;  3S4X A;  4XT2 A;  4DJ2 A;  2A24 A;  1OT9 A;  5A8B A;  1G28 A;  4EW7 A;  3BFG A;  3S7Q A;  1H3Q A;  1JWV A;  3T4S A;  4HP4 A;  2W3E A;  3O86 A;  2V1Z A;  2HJ9 C;  3IBJ A;  3ZFZ A;  1K0K A;  4QD4 A;  4R0Q A;  3A3I A;  4HJ4 A;  4EV4 A;  3SS4 A;  4L9F A;  1SKF A;  1XGI A;  4X55 A;  3TSG A;  1W8Q A;  1I2S A;  1LLB A;  2ZMF A;  1MZU A;  4X56 A;  4DKI A;  4BEN A;  5HAI A;  1PI4 A;  5AJG A;  5DVA A;  4BD1 A;  3CZD A;  3P98 A;  4ID4 A;  4DF6 A;  2A2L A;  3FPV A;  3MKE A;  4MN6 A;  2ZJ9 A;  4Y3I A;  3M2K A;  4OPZ A;  3VP3 A;  3GQZ A;  1LSV A;  5HW3 A;  3HVF A;  4E6W A;  2HV1 A;  5M18 A;  5GL9 A;  4AFI A;  5HL1 A;  2Y59 A;  4S2J A;  5F6A A;  3KSF A;  2XR0 A;  2XH9 A;  1FSY A;  3O88 A;  2P74 A;  4WYY A;  3ITA A;  2Y2G A;  5JYO A;  5L10 A;  4LRX C;  4BMW A;  1Z09 A;  2B02 A;  3M2J A;  4B88 A;  4WZ5 A;  3GVB A;  3N6I A;  2V8C A;  3H82 A;  3VOY A;  1NLY A;  1PRQ A;  3IWO A;  3FV7 A;  4E3I A;  3Q1F A;  4EBP A;  3ZG7 B;  1RGY A;  5KSC A;  2PHY A;  3M6B A;  4EQ1 A;  3LY3 A;  3UPO A;  1ES2 A;  1Q2Q A;  2ZQC A;  4UEY A;  4B93 A;  5DF9 A;  4PM8 A;  4R70 A;  1I5Q A;  1YKD A;  3MXS A;  5C5K A;  1N9N A;  4N1H A;  1E4D A;  1WA9 A;  4HEF A;  3E0Y A;  3S7O A;  1ZG4 A;  4EEP A;  2I72 A;  3CG5 A;  2HZ5 A;  1MY8 A;  2DRW A;  4D60 A;  1KE0 A;  2PBD P;  4PKY G;  4E3N A;  1L0D A;  3DTI A;  1ALQ A;  2J3T D;  2X02 A;  1HD8 A;  5IS1 A;  1XPB A;  3KO6 A;  5HWT A;  3M6H A;  4C75 A;  2EWW A;  1XXM A;  1CI8 A;  2CC1 A;  4H6J B;  3HJK A;  1KGF A;  1VM1 A;  2WGW A;  3UDX A;  5FQK A;  5F69 A;  2ZM0 A;  1TS0 A;  1YAX A;  1G6A A;  3OC2 A;  1F2K A;  3E4Q A;  1NWZ A;  5EM0 A;  3VP4 A;  3MS6 A;  3BFE A;  1HLU P;  3P01 A;  2E8J A;  1DP9 A;  3MQ0 A;  3KX0 X;  3KYZ A;  2Q0O A;  4JXV A;  3IX4 A;  3BFF A;  5EOE A;  3LIB A;  3H7W A;  4Y17 A;  4GLQ A;  1XKZ A;  5IU1 A;  2ZM8 A;  3KSI A;  1N4O A;  1P97 A;  2VGL S;  5M1A A;  4DJ3 A;  3UE0 A;  1IEL A;  1GHM A;  4DXB A;  3V5M A;  4OOM A;  5A90 A;  2FFF B;  4QB8 A;  5EUA A;  2XGN A;  1FIK A;  3VFF A;  4Y0O A;  4ESP A;  4CLC D;  2ZC5 B;  2XDM A;  2W1R A;  2H5S A;  3F1O B;  3PR6 A;  4WN5 A;  5F82 A;  3PHY A;  4FH2 A;  2JC7 A;  3LEZ A;  4LGW A;  5KIZ A;  4Q0H A;  3NY4 A;  2R78 A;  4JGP A;  4E3M A;  1P9R A;  2Y91 A;  3A3J A;  3BY9 A;  1JNU A;  1CEF A;  4KZ6 A;  5DJU A;  4WM9 A;  4MNR A;  3BW6 A;  2JKG A;  4FOF A;  3G34 A;  1S4S A;  1GSX A;  3LY4 A;  2OAQ 1;  4JPM A;  3HJI A;  2P04 A;  1CF0 A;  3L7H A;  1FOF A;  2Y2O A;  3HRE A;  3D4F A;  1T18 A;  2QMI A;  2IA2 A;  4R4R A;  4RX3 A;  4JGR A;  1MWT A;  3N8L A;  4R3A A;  1KDW A;  5G4Z A;  2JKR I;  1OJG A;  4NKP A;  3ZYT A;  4WUJ A;  4II7 A;  2UWX A;  3CPT A;  1SKO A;  4KQR A;  2DCF A;  1YLJ A;  3CUE A;  1LL9 A;  5CGW A;  4CLC A;  1PNE A;  4OPY A;  3UB8 A;  3LIE A;  1TDG A;  2P9V B;  5F1G A;  1NLZ A;  3MR0 A;  1XP4 A;  4L0L A;  2O9A A;  2VGK A;  3C38 A;  3O5Y A;  4WEJ A;  2XD5 A;  3UPP A;  4HH3 A;  4NG2 A;  3UB7 A;  4WEL A;  4LCM A;  4JKT A;  3MBZ A;  2EX8 A;  2PR5 A;  2K2N A;  3UE6 A;  3Q82 A;  5HWV A;  5HPI A;  2P08 A;  2JN7 A;  2PD7 A;  3TG9 A;  2GNX A;  4I3J A;  4GCZ A;  4NK3 A;  3E98 A;  2Y2I A;  1SCW A;  2EX6 A;  4GHI B;  2ZC3 B;  4LV2 A;  3RXW A;  3OBF A;  4B4Z A;  1K38 A;  3BJN A;  3C7V A;  4DDS A;  1OTD A;  3KYQ A;  3ZDJ A;  2HJE A;  1Q2P A;  2XEP A;  5CGS A;  1FCM A;  4QU3 A;  1ESU A;  3BM6 A;  2P9V A;  3U4L P;  3BQA A;  3FG8 A;  4Q0I A;  3RFB A;  1JTD A;  1W63 Q;  2VV7 A;  3OPP A;  3CWF A;  3IT9 A;  2GDN A;  3LIC A;  2PD8 A;  4QHC A;  5AVF A;  3NOP C;  4OLG A;  4MEZ A;  1ERM A;  1DJB A;  5F83 A;  3QNC A;  4BWI A;  1NXY A;  5J3W A;  5HDC A;  3UNW A;  3FZC A;  5KSH A;  4OP8 A;  5EEC A;  3T4Q A;  4WZ5 C;  2J7V A;  3V3R A;  3ZVT A;  1YLT A;  2YKF A;  4ZAM A;  5GLB A;  3KSH A;  1MWU A;  4EES A;  3S1Y A;  4IVK A;  4PMA A;  4PM7 A;  4GDN A;  4P6B A;  2EXA A;  2UV0 E;  4S2K A;  5HDS A;  3HLB A;  3EOI A;  4LCL A;  3B42 A;  3MFX A;  5HAQ A;  4P87 A;  3R7W B;  1KGG A;  3AGE A;  2O99 A;  5HFO A;  3DBA A;  2HGV A;  4OVD A;  1EWZ A;  2E8I A;  5AQB A;  2W3H A;  1XJ4 A;  1T1B A;  4EWF A;  4ZTK A;  3PBR A;  4XUZ A;  1BT5 A;  1G6O A;  3T4T A;  3D3O A;  3L9K A;  4KG2 A;  4BD0 A;  5AQ7 A;  4E3L A;  5U47 A;  3T4K A;  3A0V A;  3PBS A;  1KGE A;  5HSQ A;  3K3C A;  4KZA A;  3G31 A;  3FKW A;  5FI7 A;  3Q7Z A;  2XF3 A;  4O8G A;  3LI8 A;  1YSQ A;  4Q8I A;  5IT5 A;  1VET B;  4Y2F A;  1UWN X;  2ZC4 B;  1VQQ A;  4JF6 A;  5HWW A;  2Y2H A;  4ZJ1 A;  1NYM A;  3CMZ A;  3CLO A;  2QJ7 A;  5A92 A;  2ZC7 A;  4I5S A;  1SZV A;  1ONH A;  3UPN A;  3MKF A;  1O7E A;  2Y4A A;  1GCE A;  4E3K A;  4Y5F A;  1F5M A;  1IOU A;  3WS1 A;  4S2O A;  1L2S A;  5DJT A;  3IX3 A;  3LID A;  4HP9 A;  2VA0 A;  3CAX A;  3MZD A;  4MBF A;  4NXG A;  3IF6 A;  3HUO A;  2R9X A;  1K57 A;  1S6R A;  3D72 A;  1TDL A;  2XA7 M;  1CJF A;  2PYR A;  4CQH A;  4E04 A;  1LL5 A;  4G3W A;  3PAG A;  1K6S A;  3TJZ C;  2PDR A;  4HQA A;  3QNB A;  4H8R A;  2JHE A;  4U0T A;  3PBQ A;  5FDS A;  4WEK A;  1YQS A;  3NJA A;  4O0P A;  4EUZ A;  1T1C A;  4HJ3 A;  2VZW A;  3DW0 A;  4DE2 A;  1LI9 A;  4PHT A;  4KZB A;  4N1X A;  4C6Y A;  4WBG A;  5D3O A;  1VHM A;  2WGI A;  1FQG A;  3EEA A;  3C2W A;  3MXQ A;  1PI5 A;  5DKK A;  4WF0 A;  4OLD A;  4GOG A;  5E2E A;  1IKI A;  3ZG8 B;  1NJ4 A;  3FWL A;  4X1M A;  1K55 A;  4IBX A;  2ACG A;  5DFX A;  4X25 A;  4XXR A;  5EVI B;  5EVI D;  3NOT C;  4N9L A;  3CUE C;  5CER A;  3DTE A;  3FC7 A;  4X68 A;  4F94 A;  2OWJ A;  1YLP A;  2VV6 A;  3LIA A;  2ZL1 B;  1N9L A;  5HPF A;  5A91 A;  4Y0T A;  1FIL A;  1HTZ A;  5CHJ A;  3OCN A;  3MFD A;  5FDH A;  2G2W A;  4KQO A;  4KZ4 A;  2D01 A;  1YMS A;  4ME4 A;  4DE1 A;  2W3G A;  1ESI A;  4QWO A;  2A3U A;  5CEB A;  3B47 A;  1MXO A;  3DAV A;  4OQH A;  4BBU A;  2QYB A;  4A5R A;  2XRO A;  5FEG A;  3ZCZ A;  4LV3 A;  3T50 A;  3LUQ A;  5DTT A;  3NBL A;  3ZVW A;  4R4S A;  3VE4 A;  1DJA A;  3NIA A;  3DTM A;  5FEF A;  3EQU A;  4S2N C;  3HLD A;  3IX8 A;  3A3E A;  4GD6 A;  3LR4 A;  1K54 A;  3HCY A;  3ZGA B;  5FA7 A;  4JF4 A;  2H28 A;  1G68 A;  3IXH A;  2H0Y A;  3MXR A;  5GLC A;  2JKR M;  3IBR A;  3HLG A;  3QP2 A;  2AVX A;  3IXG A;  3C7U A;  5E2F A;  4CPK A;  1XJ6 A;  4MBH A;  3DWZ A;  2VGJ A;  3HUN A;  3KSG A;  2ZLY A;  1DP8 A;  4WLA A;  5DF7 A;  4X1L A;  5FAT A;  4ZBE A;  3V50 A;  2OLU A;  4BJP A;  3D9Y A;  3DWK A;  4GKU A;  3BLM A;  1CEG A;  1OME A;  2HP6 A;  4YOF A;  2GZA A;  4DE0 A;  4RA7 A;  1YT4 A;  1W63 M;  3RXX A;  2FH5 A;  4R1G A;  5CGX A;  5HD3 A;  1YLW A;  4HBU A;  4Q0J A;  4YFM A;  2ZQA A;  2RL3 A;  4BLM A;  5FQQ A;  4OOL A;  1ACF A;  1H8Y A;  4PAU A;  2GJ3 A;  1YLY A;  5DKL A;  5DTS A;  5FQJ A;  3N7W A;  3NHQ A;  3UMD A;  4JLF A;  3W4O A;  4MDZ A;  4EQI A;  5DFY A;  3VP1 A;  3OZH A;  2KX6 A;  2Y2Q A;  1DP6 A;  4MN5 A;  4EBN A;  2R9W A;  4NET A;  2QPN A;  3TW8 A;  2XSS A;  5HAR A;  2EXB A;  3LIF A;  4JXS A;  1WE4 A;  2V20 A;  3V67 A;  2OV5 A;  3IF5 A;  3GV9 A;  1WYB A;  5AVE A;  3RJU A;  4EEU A;  5KMW A;  5CX7 A;  1H8Z A;  4EER A;  1K56 D;  1QMF A;  2OSU A;  1IYQ A;  4H6J A;  5K5B A;  2WKE A;  2ZQ9 A;  5BOH A;  2YKH A;  4Z1W A;  1VEU B;  4I3I A;  1OJ5 A;  4GS9 B;  3OLO A;  5A93 A;  1RCJ A;  4O7D A;  3G2Y A;  3Q81 A;  2WYX A;  2J9P A;  5F5Y A;  3S22 A;  3WRZ A;  5TJJ A;  3F1P B;  4RX2 A;  3BWL A;  2VJW A;  3UB6 A;  4JGO A;  4LV0 A;  3CHW P;  1IYS A;  3HLW A;  5EPH A;  2CMN A;  4GD8 A;  1LL8 A;  4MLL A;  5DTK A;  2WKP A;  4ARZ B;  4IVI A;  3G32 A;  3AGD A;  4KG5 A;  1U60 A;  4KQD A;  3GTC A;  4KZ8 A;  1LT0 A;  1F9I A;  3IH9 A;  3EGX C;  4IBR A;  3OPL A;  5L2F A;  3G6O A;  3WWX A;  1IFQ A;  4LLO B;  2EWV A;  3MQQ A;  3F1O A;  3IF6 C;  4ZJ3 A;  2Z2M B;  1Y54 A;  1H0M A;  5F68 A;  5FI2 A;  1K57 C;  1CI9 A;  4B9O A;  4WMC D;  2HPB A;  4PM5 A;  3OCL A;  1SDN A;  4R23 A;  3VFH A;  3ZG0 A;  1FCO A;  1VEU A;  3I7J A;  2QKP A;  1TS7 A;  2Y2P A;  1NRF A;  1MWS A;  3NC8 A;  3BEC A;  2O9B A;  4KG6 A;  1A0K A;  3IWI A;  3E4O A;  4HY8 A;  2C6W B;  3MQO A;  1YPR A;  4JF5 A;  2XRN A;  3VP2 A;  2HDS A;  5L07 A;  4FCF A;  2DMW A;  5EM1 A;  4HI4 A;  5L8M A;  4K0W A;  3VV4 A;  1H5X A;  4ETX A;  3LEQ A;  1BLP A;  5E2G A;  4UQI M;  4BL2 A;  2WAD A;  5HAP A;  3HLF A;  3T1S A;  3ZNT A;  4G3V A;  3GRJ A;  3WRT A;  2X71 A;  1E25 A;  4Y0U A;  2PR6 A;  5AQA A;  4IHQ A;  2WAF A;  2J9O A;  3CJM A;  1XA7 A;  1VB6 A;  5FAO A;  1MBL A;  2ZOH A;  2NUT C;  4R38 A;  4P6Z M;  5GHY A;  4HH2 A;  5I94 A;  4GNU A;  4WMC A;  3QP5 A;  2OWH A;  2P7J A;  4BQM A;  3UDI A;  1L0F A;  1XGJ A;  3U2A A;  2C5W B;  2HF6 A;  3G30 A;  1K4E A;  1Y4O A;  3F1N B;  3G2Z A;  4MCW A;  2B5R A;  3B3X A;  4OQG A;  5FSR A;  1GA9 A;  5EE8 A;  1N9O A;  2FZ0 A;  1S67 L;  2PAV P;  4GDB A;  4PM6 A;  2V0U A;  4KZ7 A;  1JWZ A;  5CEC A;  2EFU A;  3ZG9 B;  1IYP A;  2KDK A;  2IWB A;  1BYW A;  5TFQ A;  3PBT A;  3SH7 A;  3HL9 A;  3N8R A;  1FR1 A;  1BZA A;  5EVL A;  1MKM A;  5E2H A;  4C3Q A;  4HJ6 A;  2J80 A;  2WKR A;  2PBY A;  4WL9 A;  2L0W A;  1I2W A;  4GHI A;  4DE3 A;  1LHY A;  2HP9 A;  5GHZ A;  1K54 C;  4OP5 A;  1L3L A;  1YSP A;  1SDE A;  3OOV A;  2PU4 A;  2WAE A;  3C8C A;  2Z6D A;  4P85 A;  4F3L B;  3V39 A;  2XA7 S;  4HHD A;  2Q9M A;  4EU0 A;  3LYX A;  2IWC A;  3GDI A;  4G3K A;  3ZNY A;  4KQQ A;  4QJG A;  3NI9 A;  1J3W A;  1EI5 A;  2O9C A;  1XFQ A;  3QHY A;  3SS3 A;  4R3B A;  4EBL A;  2VV8 A;  1NZO A;  4KUO A;  4ZJ2 A;  3UDF A;  4E3J A;  4R3J A;  2B95 A;  4K91 A;  2A24 B;  2Y2M A;  1SHV A;  3FYZ A;  3MJQ A;  2PRF A;  4KZ5 A;  2IWD A;  3QP4 A;  1XJ3 A;  3C5A A;  1MC0 A;  2ZMA A;  1W7F A;  4O01 A;  5GLD A;  4X69 A;  5CRF A;  3UME A;  2QZ6 A;  3VP0 A;  5FAQ A;  5FQM A;  3PYP A;  3RTY A;  2V1B A;  4RVA A;  1K25 A;  4YWZ A;  4OQ0 A;  3R7W A;  4E6X A;  1D1J A;  5JYP A;  1S0W A;  1PWC A;  1ZHH B;  3SW1 A;  1TS8 A;  1ERO A;  4F3L A;  1FSW A;  3ZG5 A;  4S2P A;  4D2O A;  1DRM A;  4BBV A;  2J3T C;  3MMH A;  2Y2L A;  3IQA A;  4GJ4 A;  5J7E A;  4ZRR A;  3ITB A;  4Z9Q A;  3EWK A;  2K7S A;  1O07 A;  3JYI A;  4JBF A;  2KLI A;  2GX5 A;  3PXP A;  5J4E A;  4I3A A;  3PBO A;  3UE3 A;  3E4P A;  2KOI A;  2W3F A;  3BFD A;  2V2F F;  1STZ A;  1VET A;  1TF1 A;  4HBT A;  4OKP A;  2HDQ A;  4EXO A;  1W5D A;  1CK3 A;  1S4R A;  3OPH A;  4NXF A;  4HES A;  2OLV A;  3LCE A;  4HNB A;  1TEM A;  3SH8 A;  2L4R A;  2W27 A;  1QME A;  4OPR A;  1KDS A;  3C4P A;  3S7P A;  1BTL A;  5L09 A;  5EV0 A;  3K2N A;  3H82 B;  4GZB A;  1YM1 A;  1NYY A;  4Y15 A;  3C4O A;  4CLC E;  2B18 A;  1HVB A;  5HL6 A;  4CLC C;  3LO7 A;  5E43 A;  3E2L A;  1KVL A;  1KE4 A;  5HZH A;  2DNS A;  3TRC A;  4E3O A;  1AWI A;  2M7U A;  5TGF A;  4FH4 A;  3SH9 A;  1JWP A;  3T1X A;  2V1A A;  4MBK A;  2VEA A;  4JXW A;  4M3K A;  4HIA A;  1OPX A;  1PWG A;  4NEE D;  3IXD A;  4IUK A;  1ZG6 A;  3UB9 A;  2JKT M;  1BSG A;  1PYY A;  5CTM A;  2K31 A;  4OPQ A;  5CHU A;  5HD5 A;  2G7U A;  2WGW B;  1FCN A;  4UA7 A;  3PAE A;  1M40 A;  1IYO A;  4DMZ A;  3QP8 A;  5EVI A;  1JTG A; 
#chains in the Genus database with same CATH homology
 1HLU P;  3T1R A;  2E8J A;  1CQA A;  3D9Y A;  1J3W A;  1PNE A;  3CHW P;  2ZL1 A;  2VK3 A;  2ZL1 B;  2JKF A;  1SZV A;  1FIL A;  4FUW A;  1Z09 A;  3KYE A;  5EVE A;  2B95 A;  5EV0 A;  2V8C A;  3LGO A;  1PRQ A;  1ACF A;  3T12 B;  3NUL A;  2PRF A;  1Y4O A;  1FIK A;  4QWO A;  4ESP A;  3DAV A;  2PAV P;  5FEG A;  1K0K A;  1CJF A;  1D1J A;  1AWI A;  3T1X A;  2HZ5 A;  2JKG A;  1VEU A;  4D60 A;  5FEF A;  2PBD P;  3NEC A;  3UB5 P;  5FDS A;  1A0K A;  3MSH A;  3L9K A;  1PFL A;  1YPR A;  1CF0 A;  3L7H A;  5EM1 A;  3LEQ A;  1VEU B;  4FTX A;  3U4L P;  2BTF P;  3T1S A;  1F2K A;  5EM0 A;  4X1M A;  4X1L A;  2ACG A;  3T1Q B;  1VET A;  3CPT A;  3MS6 A;  1SKO A;  1VET B;  3CPT B;  1SKO B;  4X25 A;  1G5U A;  2V8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...