5KSCA

E166a/r274n/r276n toho-1 beta-lactamase aztreonam acyl-enzyme intermediate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
b'NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kscA00
3W8KA 4WM9A 3ISGA 4LV3A 4CPKA 2J7VA 4EBNA 1EI5A 2QMIA 5AQ7A 5FA7A 1DJCA 2I72A 3ZVTA 5F1GA 3G32A 1Z6FA 3UY6A 4OLGA 3HLWA 4S2OA 4N1XA 5F83A 3VMAA 4N9LA 4O7DA 1K56A 1C3BA 1PWDA 2Y2OA 5FI6A 1XX2A 4GD6A 5M19A 3G2YA 3IF6C 3ZG0A 3IXBA 1CEFA 3G34A 3OPLA 5CGXA 4PM8A 1G68A 1FCOA 3IF6B 3VFFA 4IVIA 4JF5A 3UNWA 1GHMA 4GD8A 5HARA 1CI8A 3FV7A 2HDRA 3MBZA 4Y0UA 1KGFA 3E2KA 3Q7VB 4KZ9A 5AQ9A 2XFTA 3M6BA 1VQQA 5CGWA 2XF3A 3HUMA 4B4XA 3OCLA 3MFDA 3LEZA 1NZUA 2BLSA 3MKFA 3SS3A 5CGSA 5FQQA 4GN2A 2V1ZA 2XQZA 2FFYA 4PM7A 3CZDA 5DTSA 4GDBA 2OLUA 1PYYA 3WS2A 2P9VA 3LY4A 4OLDA 2OV5A 4DE3A 1BSGA 2WYXA 3W4PA 3PBSA 1FR1A 4WELA 4ZJ2A 4E3IA 4JKTA 4EBPA 4JXWA 1O07A 3PAEA 2WZZA 4QY6A 4JPMA 2G2UA 2ZQDA 4KZ7A 3ZVWA 3DTMA 3C5AA 2ZM2A 3UE0A 3UO9A 4HBUA 3N4IA 1H5XA 1YLYA 1GA9A 4GB7A 5CERA 3PBQA 3V3RA 4B88A 2ZQ9A 4E3JA 2WADA 5HW3A 2PU4A 1HTZA 2Q9NA 4E3OA 4KG5A 2H5SA 3ZDJA 1CEGA 4QJGA 1W7FA 1FSYA 2ZLYA 4OQIA 3C7UA 3MXSA 3ITAA 2Y55A 5TR7A 2EXBA 4HESA 4LV2A 5GHXA 4MLLA 3TG9A 3VP0A 1E25A 1HZOA 1YQSA 3OPHA 1ZC2A 3PAGA 1KE0A 4S2LA 5AQAA 3A3EA 4BQMA 1IYPA 1WE4A 4L0LA 5GLCA 4LENA 2ZM8A 4BD0A 2PU2A 4OPQA 4OPZA 1W5DA 4WBGA 4P85A 1Y54A 3O86A 4Q8IA 3BFCA 3G31A 3C4PA 3ZCZA 3ZNYA 2RCXA 2ZC7A 4KZ4A 3SH8A 2RL3A 3QHYA 3HREA 4Y7PA 1I2WA 3IWOA 3LO7A 1L0FA 2EFXA 4DE2A 2ZQAA 1TVFA 4DE0A 3CMZA 1QMFA 4FCFA 4JXVA 4RA7A 3HLFA 3GRJA 1IYOA 5A91A 1PIOA 3UE3A 4EUZA 1H8YA 1GA0A 1FCMA 1XA1A 3BFEA 3Q81A 4PM9A 3UPNA 1NY0A 5KSHA 1K57A 5FI7A 5F1FA 5EVIB 3VSKA 1EWZA 4EWFA 5G18A 4QY5A 5A92A 1LI9A 2C5WB 2WAFA 2V2FF 5HL1A 1YMXA 1ES2A 1N4OA 2ZC5B 1KE3A 3N6IA 2A49A 3BRMA 1YLJA 1YLWA 4OOLA 1MWRA 3ZG8B 3ZG5A 3FKWA 1OMEA 2H0TA 4MEZA 2H10A 4XUXA 3BYDA 3UDIA 2JCHA 3NIAA 3BEBA 3IT9A 1WYCA 2E8IA 1IYQA 2C6WB 2Y4AA 2XD5A 1RGYA 3UN7A 4XXRA 1VM1A 3AGFA 3B3XA 4UA6A 4UHUA 4X6TA 2BG1A 2HDQA 3BLMA 3IF5A 4BLMA 2EX6A 4GNUA 5EE8A 4RVAA 3WWXA 4DF6A 4Y0TA 4K0XA 4U0XA 3WRTA 3VP3A 4S2JA 1SDEA 1NRFA 1ERMA 1YMSA 5CHMA 3HBRA 2DRWA 4KZ3A 3Q7ZA 5GL9A 1PWGA 2HP6A 4UA7A 3HL9A 2Y2GA 1I5QA 1K54C 3HLEA 4OP8A 3ZG7B 3NC8A 3GSGA 5CEBA 3WRZA 3NCKA 4E3NA 1BULA 3CJMA 3DW0A 4X69A 1YLPA 4DE1A 2OLVA 2QZ6A 3IF6A 4JXSA 1BLCA 3NBLA 4S2KA 5E43A 5A90A 5HAIA 3OPRA 4S2NC 5FI2A 5CRFA 3PBTA 4P87A 3Q7VA 3SS5A 4D2OA 3OCNA 4C6YA 3BM6A 3ZNTA 3N8LA 3HLDA 4HBTA 4LV1A 4PPRA 4WZ5C 4DXCA 4E6XA 4IEDA 3PBOA 4KZ5A 4ZJ1A 1ES4A 3I7JA 3M2JA 1XP4A 4OOYA 5CTNA 3VFHA 4LV0A 1JTDA 4OP5A 1PWCA 1IYSA 2A3UA 5HX9A 1ESUA 3IXHA 1FOFA 3OZHA 3WS0A 4DRTA 3VP2A 1JWPA 2ZC4B 4BL3A 2Y2JA 5E2GA 3ITBA 1K6RA 4GZBA 3HLGA 5DVAA 2DNSA 5CHJA 4X53A 4P6BA 1ONHA 4OQ0A 4PM6A 1BLHA 3FZCA 3BECA 1BLPA 2Z2MB 3A3FA 1LL9A 1MWTA 5FSRA 3HUOA 4E3MA 4PM5A 2WKHA 3N8RA 1XGIA 1PZOA 3AGDA 4H8RA 3A3JA 3C7VA 4WYYA 4FH2A 3QNCA 4JXGA 1GHPA 1ZKJA 2Y91A 1K38A 1KVLA 1ONGA 2XH9A 5FQ9A 5FQKA 4BJPA 3IQAA 2XR0A 3IXGA 4WEKA 3UE1A 3M6HA 4Y0OA 2OSUA 1W8QA 5GLAA 4KZAA 4Z9QA 3PBRA 5KZHA 3TSGA 4KQOA 2EXAA 2JC7A 3AGEA 4OONA 5DTTA 2EX9A 3MKEA 2WK0A 1XGJA 3S22A 5JYOA 3CG5A 5DTKA 2Y2LA 4GDNA 5CXWA 4FH4A 2VGJA 5FQIA 3E2LA 1M40A 4DDSA 4WEJA 1K4FA 1IEMA 1SKFA 4R1GA 2WGIA 3SOIA 4LCMA 5DF7A 3C4OA 5DF8A 5KSCA 2Y2QA 3FKVA 1KDSA 4ZTKA 2WGWB 3Q1FA 4KG6A 4DDYA 2ZQ8A 1K25A 3NDGA 4R0QA 4S2MA 3W4QA 4OH0A 1IELA 3IWIA 1DJAA 3UPPA 2XK1A 1K55C 3GR2A 3SH7A 1TDLA 2VGKA 2H0YA 2WZXA 3V39A 4OQHA 3FWLA 2EFUA 3LY3A 5D3OA 1TDGA 4X55A 5FASA 5EVIC 2ZQCA 3O87A 5I94A 4R4RA 4NK3A 5DF9A 1PW1A 1TEMA 2G2WA 4A5RA 1JTGA 1H8ZA 5U47A 2ZD8A 1GCEA 1CI9A 4OQGA 4F94A 2ZMAA 4UAAA 1XKZA 1PI4A 4KZ8A 1ES3A 4OOMA 3MZEA 1KGGA 4YINA 2X01A 1KDWA 3S4XA 3D4FA 3BLSA 1YM1A 4IBXA 3RJUA 4B4ZA 1RP5A 1JWZA 5EOEA 2QPNA 3GTCA 3IXDA 5EUAA 1AXBA 4ID4A 1W8YA 2HDUA 3A3IA 3NY4A 2V20A 4QU3A 2ZM0A 4R3JA 4BENA 3MXRA 1Q2PA 2HPBA 1IKIA 1CK3A 1PI5A 1L0EA 4R4SA 1ERQA 2IWCA 5FAPA 3EQVA 3M2KA 1NJ4A 4C75A 4KZ6A 3MZFA 1K54A 4MBFA 1HD8A 5L2FA 4K91A 1XA7A 2P74A 3WS5A 3IWQA 3QNBA 3P98A 1KE4A 4P0MA 4GOGA 1NXYA 4KQRA 5EVLA 5GLDA 5J8XA 1FQGA 4JBFA 4S2NA 1ES5A 1L0DA 4OPYA 5FDHA 5GHYA 4RYEA 1MWUA 2XLNA 3VP4A 2B5RA 1FCNA 4PMAA 5GHZA 4N1HA 4WZ5A 2DCFA 1YLTA 2Y2IA 3ZHHA 5HAPA 1NYYA 5E2EA 3W4OA 4WMCA 3ZGAB 4BD1A 4UA9A 3O88A 3HUNA 1SDNA 2EX8A 4EQIA 5BOHA 5JYPA 2XDMA 5TFQA 3WS4A 5FAOA 3VP1A 2J9PA 3HLBA 5EVID 3BFGA 1KVMA 1ZG6A 3SS4A 4JF4A 3UPOA 3O3VA 1DY6A 1SCWA 2HP5A 5TGFA 1MKIA 5GLBA 1O7EA 1RCJA 1JVJA 2Y2PA 4OVDA 4U3TA 1MY8A 4LCLA 2XEPA 3UDFA 4R23A 1HVBA 1M6KA 2IWDA 3G4PA 3LCEA 3FYZA 3NDEA 1S0WA 4E3LA 1K4EA 2Z2LB 4N92A 1YLZA 3NI9A 3RXWA 3VOYA 1WYBA 5IHVA 1LL5A 2WGVA 1FSWA 1J9MA 2WKEA 4DXBA 1Q2QA 4KZBA 3DWKA 4JLFA 5CEDA 5HFOA 2R9XA 3IH8A 2EX2A 1G6AA 5FAQA 1YT4A 3V5MA 2XFSA 4ZBEA 4S2IA 2Q9MA 1BT5A 4ZDXA 2J8YA 4JF6A 3ZFZA 3P09A 1JWVA 5M18A 5EOOA 2WGWA 1BZAA 2P9VB 1E3UA 5AQBA 4E6WA 2ZC6B 1W79A 4S2PA 1ESIA 2ZQ7A 4N9KA 3ZG9B 4RX2A 3GVBA 3TOIA 5CHUA 3GMWA 1BUEA 4C3QA 3WS1A 1BLSA 5FQMA 4ZAMA 2GDNA 2Y59A 3BFFA 3UDXA 2XGNA 3G35A 5E2FA 3A3DA 4EV4A 5FQJA 1K55A 1NZOA 3HLCA 3PBNA 1EROA 4WMCD 4X68A 4GKUA 3Q82A 4FSFA 1S6RA 4RX3A 1N9BA 3G2ZA 5EVIA 4M3KA 1L2SA 2JBFA 3DWZA 1SHVA 2J9OA 4ZJ3A 3GV9A 4OPRA 3OC2A 2R9WA 5KMWA 1MXOA 2X71A 5FATA 1PW8A 3S1YA 4KENB 4U0TA 1K56D 2ZC3B 1LI0A 4MNRA 3V3SA 4YFMA 2WKIA 5CECA 5A93A 1MBLA 2Y2HA 5CTMA 1MWSA 2HP9A 2JE5A 4R3BA 4CJNA 4FD8A 3IHAA 2PBYA 1U60A 4NETA 3EQUA 4MBHA 4X56A 1FR6A 3N8SA 1BTLA 5HAQA 2FFFB 3BFDA 2Y2MA 2Y2KA 1DJBA 1LLBA 2Y2NA 1IKGA 2UWXA 5E2HA 2IWBA 3V50A 1QMEA 1L0GA 4EBLA 2X02A 1LHYA 5F82A 1E4DA 3IH9A 1NYMA 1ALQA 4QD4A 4QHCA 1K57C 2CC1A 3JYIA 4IVKA 4QB8A 4DKIA 3Q07A 4E3KA 3SH9A 5M1AA 3N7WA 3MZDA 1MPLA 4WZ4A 3G30A 1K6SA 1I2SA 1XPBA 4BL2A 3PTEA 4XUZA 3RXXA 4KG2A 1RGZA 1GHIA 1PZPA 1E3UD 1XXMA 3VOZA 5EPHA 3OPPA 3VSLA 2HDSA 5EECA 2WUQA 3IHBA 4IBRA 4OKPA 4MBKA 1ZG4A 4KQQA 4HEFA 1KGEA 2WAEA 3GQZA 2XD1A 2ZJ9A 4K0WA 3HVFA
chains in the Genus database with same CATH superfamily
2QKPA 4R6LA 4LV3A 4CPKA 1LT0A 2QMIA 2JHEA 3ZVTA 5F1GA 3G32A 1OTIA 3NOUC 3VMAA 1K56A 5M19A 5FI6A 3G2YA 1XJ4A 3G34A 1G68A 4IVIA 3KSGA 1GHMA 3FG8A 3BQAA 2O99A 3KX0X 4Y0UA 3E2KA 2EWWA 1VQQA 3GECA 5CGWA 1SKOB 3OCLA 1VEUB 5F6AA 3SS3A 2FFYA 4Y5FA 4PHTA 2P9VA 3LY4A 2WYXA 4NG2A 4E3IA 4JKTA 4EBPA 1O07A 2WZZA 4KZ7A 3C5AA 2ZM2A 4HBUA 1T1CA 2YKHA 3N4IA 4GB7A 2PRFA 4B88A 1YPRA 4E3JA 5HW3A 2PU4A 1HTZA 5L09A 4RQ9A 3NECA 4QJGA 4CLCD 1S4RA 3JPUA 4JGOA 4HIAA 5TR7A 3KYZA 3BWLA 2LB9A 3TG9A 2Q0OA 1KE0A 2J3WA 4WUJA 1WE4A 3UB7A 3IBRA 2ZM8A 4BD0A 1TS6A 4OPZA 4X1LA 1W5DA 1IFQA 4Q8IA 3BFCA 3G31A 3A0VA 4KZ4A 3IWOA 2EFXA 1TVFA 1NLYA 4FCFA 5A91A 1PIOA 3B42A 1GA0A 1XA1A 5EVIB 4QY5A 2V2FF 1ES2A 5HD3A 3ZG5A 3CUEA 3D9YA 3UDIA 4LRZE 1WYCA 2Y4AA 3AGFA 2VZWA 3RFBA 4BLMA 2JKRM 4GNUA 4NKPA 4RVAA 3PHYA 5EE8A 4K0XA 4S2JA 1SDEA 1YMSA 3HBRA 3LI8A 3ZG7B 3NCKA 1YLPA 2FZ0A 2PBDP 4DE1A 5HAIA 3OPRA 4S2NC 4BMWA 3PBTA 4P87A 3N8LA 4WZ5C 1DP8A 1VEUA 4E04A 1ES4A 3I7JA 5CTNA 3VFHA 1PWCA 1IYSA 2A3UA 3SZTA 1FOFA 4DRTA 1JWPA 5HWWA 5E2GA 1S4SA 4GZBA 4MCWA 2W1RA 3FC7A 1ONHA 1BLHA 3FZCA 2Z2MB 1A0KA 4PM5A 1XGIA 3A3JA 2I9VA 4JXGA 2XH9A 2XR0A 3IXGA 1LL8A 4WEKA 3UE1A 5GLAA 3PBRA 5KZHA 3K3DA 2EXAA 3AGEA 3HJIA 5DTTA 3S22A 5JYOA 1XGJA 2PYRA 4PKYA 4L9EA 5FQIA 3E2LA 4WEJA 1AWIA 3C30A 4JGRA 4XT2A 2WGIA 2K2NA 5DF7A 4LLOB 3C4OA 4I3IA 4R3AA 4S2MA 1IELA 2XK1A 2KOIA 1K55C 3SH7A 2VGKA 3FWLA 2EFUA 2VA0A 5D3OA 1F98A 4X55A 2M7VA 2HJEA 2ZQCA 3O87A 2QJ5A 3E4QA 1PW1A 1TEMA 2G2WA 3IX4A 2A24B 2MJ6A 4UAAA 1PI4A 3MS6A 1KDWA 3S4XA 1YM1A 3T1QB 2L1MA 1OJ5A 3QP1A 5EOEA 3GTCA 3IXDA 1AXBA 4QU3A 3D3OA 2XROA 1PI5A 1L0EA 3EQVA 2W0NA 1NJ4A 4KZ6A 4MBFA 4GW9A 3HJKA 5L2FA 4K91A 3WS5A 5EVLA 1NXYA 3T4TA 4S2NA 5G4ZA 3VP4A 1STZA 3JVUA 4KUKA 4WZ5A 2DCFA 3IS2B 4UA9A 3WS4A 3VP1A 1XFQA 1VHMA 4DMZA 1KVMA 3SS4A 3UPOA 5HPIA 1SCWA 1MKIA 3UB9A 3LFVA 1MY8A 4LCLA 1M6KA 2VJWA 2EWVA 3FYZA 4Q0JA 2Z6DA 1WYBA 4L9GA 2FH5A 1Q2QA 5TJJA 1F9IA 4EUVA 4R70A 4LFUA 1YT4A 3V5MA 3T4KA 4MN5A 3EGXC 1K0KA 2ZMFA 5AQBA 5J7EA 4N9KA 3ZG9B 4RX2A 5CHUA 1XJ6A 3GMWA 1BLSA 2PR5A 4ZAMA 3G35A 1CQAA 1K55A 3PBNA 4GKUA 1S6RA 2JBFA 4GCZA 2J9OA 2K31A 2A24A 5F68A 1PW8A 4U0TA 2ZC3B 4MNRA 3DTIA 2WKIA 5A93A 1MBLA 3F1PB 1UGUA 2JE5A 4CJNA 3E98A 3IHAA 4MBHA 4Y2FA 1S1ZA 2OOLA 2Y2MA 2ZMVA 2Y2NA 2JKRI 2UWXA 3EEHA 3SW1A 3IH9A 3LUQA 4QHCA 1K57C 1N9OA 5M1AA 3G30A 1K6SA 2PD7A 4BL2A 4XUZA 4KG2A 4EERA 3NOTC 2A2LA 3IS2A 3VV4A 1S1YA 3VSLA 1PRQA 5EECA 3IHBA 1P0ZA 5IT5A 3H7WB 1KGEA 2XD1A 4IUKA 4F3LA 3W8KA 4EBNA 2I72A 1Z6FA 4S2OA 1H3QA 2ZOIA 5F83A 1XX2A 3DBAA 3IF6C 1DRMA 3OPLA 4PM8A 3IF6B 4GD8A 3BY9A 5HARA 1CI8A 1KGFA 3Q7VB 3PXPA 4KZ9A 2WKPA 2XF3A 3HUMA 4FTXA 4B4XA 3MFDA 3LEZA 2BLSA 3MKFA 5FQQA 3F1NB 2XQZA 4PM7A 3E4PA 2OLUA 1YSPA 3GDIA 4EQ1A 3W4PA 3PBSA 1FR1A 4ETZA 4JXWA 4O01A 4JPMA 2ZQDA 5KIZA 3ZVWA 3DTMA 3UO9A 1H5XA 3V3RA 5FEGA 4ARZB 3LYXA 4YWZA 2Q9NA 1EW0A 2H5SA 4UQIM 3ZDJA 3QP2A 1W7FA 2GJ3A 4OQIA 3C7UA 2VV7A 2Y55A 4WLAA 3JVVA 4LV2A 4MLLA 1E25A 5EM1A 3F1PA 5TBMB 4Q0IA 4PAUA 2XA7S 2PU2A 2G7UA 4OPQA 1P9WA 1JNUA 4WBGA 4P85A 1Y54A 1OJGA 3O86A 2QHKA 3E0YA 1OT6A 3LO7A 2ZQAA 4II7A 4JXVA 4MN6A 3HLFA 3GRJA 3UE3A 1H8YA 4PM9A 1FCMA 3UPNA 1K57A 2PR6A 3UB6A 5F1FA 5A92A 1D06A 1LSVA 5HL1A 5F69A 2PYPA 3BRMA 4OOLA 3H7WA 1OMEA 4MEZA 2H10A 3BYDA 3IT9A 2C6WB 4YNRA 3UN7A 1RGYA 4UA6A 4X6TA 3B3XA 4UHUA 4HP9A 2EX6A 5DKLA 3WWXA 4DF6A 1ERMA 2DRWA 3Q7ZA 1XFNA 5GL9A 2Y2GA 3LEQA 2JKGA 4OP8A 3NC8A 3GSGA 5CEBA 4E3NA 1BULA 4FUWA 3CJMA 4X69A 3IF6A 2BTFP 3NHQA 3LIFA 5A90A 3K3CA 2OAP1 5CRFA 4G3KA 3EOIA 3Q7VA 3KSIA 3BM6A 3HLDA 4HBTA 2OAQ1 4E6XA 3DAVA 4KZ5A 3KSHA 3M2JA 4OOYA 3F1NA 4H6JB 4BWIA 1ESUA 5DFXA 1F2KA 1WA9A 3CWFA 3VP2A 1NRJA 3ITBA 2VLGA 3HLGA 5CHJA 5HL6A 3TE8A 1Y4OA 4PM6A 4QWOA 3A3FA 4CLCE 4ARZA 3N8RA 1PZOA 4BBUA 3AGDA 4H8RA 4WYYA 2VEAA 3QNCA 2Y91A 1K38A 2HJ9C 3IQAA 3BJNA 3M6HA 4KZAA 4Z9QA 3DTEA 4I39A 3T4SA 3LI9A 2W3DA 2JC7A 4Z1WA 3MKEA 3CG5A 5TBMA 4GDNA 4FH4A 2QJ7A 4DDSA 5DJUA 1SKFA 2L4RA 4LCMA 1V9ZA 5DF8A 5KSCA 2Y2QA 3FKVA 2NUTC 5F5YA 4DDYA 2ZQ8A 3LIEA 3NDGA 3W4QA 4OH0A 2ZOHA 1DJAA 3GR2A 1FILA 1TDLA 1OTAA 4AFIA 2VK3A 5EVIC 1KOUA 3LR5A 5DF9A 3C38A 1H8ZA 5U47A 2ZD8A 1GCEA 2DMWA 3A0SA 2ZMAA 1XKZA 3MFXA 4KZ8A 3T1SA 2VKSA 4YINA 5AVFA 4IBXA 3RJUA 4B4ZA 4MN7A 4GJ4A 2VGLS 4NXFA 3A3IA 2O9BA 3NY4A 4BENA 1PFLA 1Q2PA 2HPBA 1IKIA 5HPFA 1TS7A 1G28A 3MZFA 1HD8A 3KYQA 2VV8A 3QNBA 4P0MA 3P98A 1PNEA 5GLDA 1FQGA 4OPYA 4X25A 2XLNA 2B5RA 5GHZA 4H6JA 1SKOA 2B95A 4HJ3A 3ZHHA 5HAPA 1LSXA 5E2EA 4WMCA 4HJ4A 1SDNA 5EV0A 4EQIA 5TFQA 5FAOA 3T1XA 3BQ8A 1YAXA 5EVID 2XSSA 4NEED 4HY8A 5TGFA 3OOVA 2Y2PA 2V8FA 2AVXA 3UDFA 1S0WA 1K4EA 1LL5A 2WKRA 2WGVA 4KZBA 3DWKA 4HH2A 2R9XA 3IH8A 4HOIA 1NLZA 2XFSA 4S2IA 4ZDXA 2J8YA 3ZFZA 3P09A 1JWVA 5M18A 3W2ZA 1NWZA 1F5MA 3MXQA 3GVBA 2GDNA 3BFFA 3UDXA 4BBTA 3S7OA 4EV4A 3HLCA 4Y13A 2Y79A 2V1AA 3Q82A 4G3VA 1OTEA 5EVIA 4M3KA 4UEYA 5KMWA 3OC2A 2X71A 2GZAA 2J3TC 1Y28A 4LGWA 5CECA 2Y2HA 1MWSA 4FD8A 2PBYA 3EQUA 4X56A 5FDSA 5HAQA 2W3GA 1TD5A 3BFDA 1LLBA 5L10A 1IKGA 3V50A 1QMEA 1OT9A 1NYMA 1ALQA 2CC1A 4IVKA 4E3KA 4IJGA 3MZDA 1MPLA 1SZVA 2V0WA 3PTEA 2WUQA 4OKPA 3V67A 2WAEA 4WM9A 1EI5A 5AQ7A 5FA7A 3UMEA 3UY6A 4OLGA 4N1XA 2K7SA 4O7DA 1C3BA 2Y2OA 4GD6A 3ZG0A 2J3TD 3IXBA 1CEFA 3B47A 2D01A 5CGXA 1FCOA 4I38A 4JF5A 3UNWA 2W1TB 3FV7A 2HDRA 4EW7A 3M6BA 2H28A 3S7QA 2V9AA 4HJ6A 4LPZA 5CGSA 2V1ZA 3CZDA 5DTSA 3A0RA 3P7NA 2KX6A 1PYYA 4DE3A 4OLDA 1BSGA 4WELA 4Q0HA 3F1OB 3PAEA 2OWHA 5I5LA 3UE0A 4KUOA 1YLYA 1GA9A 3H82B 2WADA 3LIBA 2ZLYA 3MXSA 4HNBA 1YKDA 2O9AA 3CI6A 4EEUA 1HZOA 1YQSA 3OPHA 5EFWA 5AQAA 2Y8HA 4JGQA 4L0LA 5GLCA 1FIKA 3R7WB 4LENA 3VE4A 3ZCZA 3ZNYA 4Y7PA 1I2WA 4DE2A 4DE0A 3CMZA 1QMFA 1IYOA 4EUZA 4EETB 3Q81A 3BFEA 3ZYTA 1NY0A 5KSHA 1H0MA 3VSKA 1ODVA 4K08A 1EWZA 5G18A 1LI9A 2C5WB 3PYPA 1YMXA 1N4OA 2YKFA 2ZC5B 3N6IA 3T4JA 1MWRA 3B33A 3FKWA 3QP5A 2JCHA 3NIAA 1DP6A 1VM1A 3CITA 5L07A 4Y0TA 4U0XA 3VP3A 5CHMA 4KZ3A 3RH8B 2HP6A 4UA7A 1CJFA 1I5QA 1K54C 3HLEA 3DW0A 2OLVA 4S2KA 4JXSA 5E43A 3E4OA 3NBLA 5FI2A 4WN5A 3OCNA 4C6YA 4PPRA 4LV1A 5AJGA 4IEDA 4G3WA 4ZJ1A 4QPRA 1XP4A 4LV0A 1JTDA 4OP5A 3EGDC 2PHYA 3IXHA 5HDDA 3OZHA 2ZC4B 4BL3A 2Y2JA 2CMNA 2IA2A 1K6RA 2DNSA 4EEPA 4X53A 4P6BA 4OQ0A 3C8CA 3BECA 1BLPA 3H82A 1LL9A 3HUOA 3MQQA 3C7VA 4FH2A 1ACFA 5FL3A 1GHPA 5DJTA 1KVLA 1ONGA 2VV6A 2QYBA 4I3JA 3MQOA 4KQOA 3TSGA 2B02A 2NUPC 3L9KA 2WK0A 2XA7M 3CHWP 3P01A 4P6ZS 4X1MA 2Y2LA 5DTKA 3R7WA 1K4FA 1IEMA 1G5UA 5CX7A 3KO6A 3LR4A 4R1GA 4D60A 3SOIA 3UB5P 1KDSA 4ZTKA 2WGWB 4KG6A 4R0QA 2HGVA 1L3LA 3V39A 4OQHA 3LY3A 3EWKA 5I94A 4NK3A 2HZ5A 3T50A 4A5RA 4I3AA 4L9FA 5HDSA 4OQGA 2ZBBA 3MZEA 2X01A 3CPTB 3BLSA 1RP5A 1JWZA 4ID4A 5C5KA 2V20A 2ZM0A 3T1RA 2O9CA 4I5SA 4LRXC 4R4SA 3M2KA 4C75A 1K54A 3NJAA 1GSXA 2W27A 1XA7A 2P74A 3OLOA 4CQHA 3IWQA 1KE4A 4KQRA 1J3WA 2M7UA 5DKKA 3UMDA 1L0DA 5GHYA 4JGPA 4RYEA 4PMAA 5L8MA 1YLTA 2Y2IA 1NYYA 3LR3A 3W4OA 4BD1A 3ULFA 2JN7A 4CLCC 3O88A 1D1JA 2EX8A 5BOHA 5JYPA 2XDMA 2LB5A 3BFGA 1ZG6A 4CLCB 3MR0A 3O3VA 2L0WA 5EM0A 1MKMA 1O7EA 1RCJA 4OVDA 4EESA 1HVBA 3LCEA 3NDEA 2V1BA 4MMNA 2HV1A 2GNXA 4N92A 5IHVA 2E8JA 2W3HA 4ME4A 1FSWA 3IBJA 5CEDA 5HFOA 2EX2A 1G6AA 5FAQA 4ZBEA 5J3WA 1YSQA 4JF6A 3TRCA 5AVEA 5EOOA 2WGWA 1BZAA 1E3UA 2ZC6B 1ZHHB 1W79A 4PKYG 3BY8A 2HF6A 3TOIA 4C3QA 2Y59A 1T1BA 1NZOA 1EROA 4WMCD 4X68A 4WF0A 1BYWA 4FSFA 1L2SA 1SHVA 3GV9A 4OPRA 5FATA 3S1YA 4NXEA 4KENB 3OBFA 5DFYA 3V3SA 4YFMA 2ACGA 2VGLM 3CPTA 5CTMA 4XT2B 4B9OA 2HP9A 4O0PA 1FR6A 1BTLA 2KDKA 3VOLA 1DJBA 5E2HA 2IWBA 1L0GA 4EBLA 1LHYA 4QD4A 4DKIA 3SH9A 3LIAA 3N7WA 4WZ4A 2P7JA 3MF0A 3LGOA 1LSWA 1G6OA 3RXXA 3K2NA 4YOFA 1RGZA 4Y15A 1XXMA 5EPHA 3OPPA 3RTYA 2HDSA 4O8GA 2QWSA 4MBKA 4HEFA 2ZJ9A 4CLCA 3ISGA 3PR6A 2BASA 2J7VA 3UE6A 1DJCA 4ETXA 3HLWA 5FEFA 4N9LA 1PWDA 5K5BA 4HHDA 4GHIB 3VFFA 1P97A 3MBZA 3S7PA 5AQ9A 2PAVP 2XFTA 5HZHA 1NZUA 3QP8A 3QP4A 4GN2A 2ZL1B 4LRYC 2R78A 4M4XA 1GSWA 4GDBA 1W63Q 3WS2A 2OV5A 4ZRRA 3ICYA 4ZJ2A 4QY6A 2G2UA 2M1CA 3D72A 4IHQA 4HI4A 4BBVA 5CERA 3PBQA 3TJZC 2ZQ9A 5HD5A 4E3OA 4KG5A 1P9RA 1CEGA 1T19A 1FSYA 3ITAA 2PD8A 1D7EA 2EXBA 4HESA 3TW8A 5GHXA 3VP0A 1ZC2A 3PAGA 4S2LA 4BQMA 3A3EA 1IYPA 4MDZA 4NXBA 4DJ3A 1TS0A 3C4PA 2RCXA 2ZC7A 3SH8A 2RL3A 3QHYA 3HREA 1L0FA 4RA7A 5FI7A 1HLUP 4EWFA 2JKTI 2WAFA 5IU1A 4NXGA 1KE3A 4HQAA 2A49A 3L7HA 1N9NA 1YLJA 1YLWA 3ZG8B 4B93A 1MZUA 2H0TA 4XUXA 3BEBA 2E8IA 5MC7A 1IYQA 3T4LA 4ESPA 1XJ2A 2XD5A 4XXRA 2BG1A 2HDQA 3BLMA 3IF5A 2O0YA 2P04A 3S7NA 2B18A 3WRTA 3NOPC 1NRFA 3MMHA 1PWGA 3HL9A 4GHIA 1V9YA 3WRZA 3U4LP 2QZ6A 1BLCA 3KYEA 3SS5A 4D2OA 1VETB 3ZNTA 5EVEA 4DXCA 3PBOA 1XJ3A 2P08A 2ZL1A 4GS9B 3LICA 4Y3IA 4HH3A 4F3LB 5HX9A 1X0OA 3T4QA 3WS0A 3U2AA 4HP4A 2XRNA 5DVAA 3T12B 3T4OA 2INWA 1MWTA 5FSRA 4E3MA 3G6OA 3MQ0A 2WKHA 4DN0A 3C2WA 1ZKJA 1GSVA 4BJPA 5FQ9A 4R38A 5FQKA 4IUHA 3KSFA 4Y0OA 2OSUA 1S66L 1W8QA 3VE3A 2W3EA 1VB6A 4OONA 2EX9A 2WKQA 5CXWA 4DJ2A 5J4EA 2VGJA 1M40A 2OWJA 5HWVA 3Q1FA 1K25A 1S67L 3IWIA 3UPPA 2H0YA 1H8MA 2WZXA 5A8BA 3LR0A 1TDGA 4EU0A 5FASA 1ZTUA 1TF1A 2GX5A 4R4RA 5HDCA 2V0UA 1JTGA 1OTBA 3EEAA 1CI9A 4F94A 2EA9A 5G4YA 1ES3A 4OOMA 1KGGA 1OTDA 2JKFA 3D4FA 2Z6CA 3HCYA 2QPNA 4WL9A 3FPVA 3IX8A 5EUAA 2V8CA 1W8YA 2HDUA 2UV0E 4R3JA 3MXRA 1CK3A 5FAPA 1ERQA 2IWCA 1TS8A 4EXOA 1VETA 4GOGA 5J8XA 2PT7A 4JBFA 1ES5A 2W1TA 5FDHA 1MWUA 5HSQA 1FCNA 4GS9A 1N9LA 4N1HA 2J80A 3ZGAB 3HUNA 2J9PA 3HLBA 4KQDA 4JF4A 1DY6A 3DTKA 2HP5A 5LBRA 3F1OA 5GLBA 1JVJA 4U3TA 1CF0A 2XEPA 4R23A 3G4PA 2IWDA 1DP9A 2KLIA 4E3LA 2Z2LB 1YLZA 3NI9A 3RXWA 3VOYA 4P6ZM 1J9MA 2WKEA 4DXBA 3BW6A 4JLFA 3MJQA 2D02A 1IOUA 2Q9MA 4Y17A 1BT5A 3LIDA 2P9VB 4E6WA 5IS1A 4S2PA 1ESIA 2ZQ7A 1BUEA 3WS1A 5FQMA 3ZQ5A 2XGNA 5E2FA 3A3DA 5FQJA 3H9WA 1T1AA 2VX8A 5HWTA 4RX3A 1N9BA 3G2ZA 3DWZA 4ZJ3A 1W63M 3CAXA 2R9WA 1MXOA 1UWNX 3UB8A 3MSHA 1K56D 1LI0A 4UQIS 3IX3A 3NULA 1Z09A 3R4KA 4R3BA 4NETA 1U60A 3N8SA 1T18A 2FFFB 3CLOA 4GLQA 2Y2KA 2X02A 4FOFA 5F82A 3FPWA 1E4DA 3JYIA 4QB8A 1UWPX 3Q07A 3QP6A 1MC0A 1I2SA 2W3FA 1XPBA 2JKTM 1GHIA 3CUEC 1PZPA 1E3UD 3VOZA 1OPXA 2PDRA 3O5YA 4IBRA 1ZG4A 4KQQA 3GQZA 4K0WA 3HVFA
chains in the Genus database with same CATH topology
3W8KA 4WM9A 3ISGA 4LV3A 4CPKA 2J7VA 4EBNA 1EI5A 2QMIA 5AQ7A 5FA7A 1DJCA 2I72A 3ZVTA 5F1GA 3G32A 1Z6FA 3UY6A 4OLGA 3HLWA 4S2OA 4N1XA 5F83A 3VMAA 4N9LA 4O7DA 1K56A 1C3BA 1PWDA 2Y2OA 5FI6A 1XX2A 4GD6A 5M19A 3G2YA 3IF6C 3ZG0A 3IXBA 1CEFA 3G34A 3OPLA 5CGXA 4PM8A 1G68A 1FCOA 3IF6B 3VFFA 4IVIA 4JF5A 3UNWA 1GHMA 4GD8A 5HARA 1CI8A 3FV7A 2HDRA 3MBZA 4Y0UA 1KGFA 3E2KA 3Q7VB 4KZ9A 5AQ9A 2XFTA 3M6BA 1VQQA 5CGWA 2XF3A 3HUMA 4B4XA 3OCLA 3MFDA 3LEZA 1NZUA 2BLSA 3MKFA 3SS3A 5CGSA 5FQQA 4GN2A 2V1ZA 2XQZA 2FFYA 4PM7A 3CZDA 5DTSA 4GDBA 2OLUA 1PYYA 3WS2A 2P9VA 3LY4A 4OLDA 2OV5A 4DE3A 1BSGA 2WYXA 3W4PA 3PBSA 1FR1A 4WELA 4ZJ2A 4E3IA 4JKTA 4EBPA 4JXWA 1O07A 3PAEA 2WZZA 4QY6A 4JPMA 2G2UA 2ZQDA 4KZ7A 3ZVWA 3DTMA 3C5AA 2ZM2A 3UE0A 3UO9A 4HBUA 3N4IA 1H5XA 1YLYA 1GA9A 4GB7A 5CERA 3PBQA 3V3RA 4B88A 2ZQ9A 4E3JA 2WADA 5HW3A 2PU4A 1HTZA 2Q9NA 4E3OA 4KG5A 2H5SA 3ZDJA 1CEGA 4QJGA 1W7FA 1FSYA 2ZLYA 4OQIA 3C7UA 3MXSA 3ITAA 2Y55A 5TR7A 2EXBA 4HESA 4LV2A 5GHXA 4MLLA 3TG9A 3VP0A 1E25A 1HZOA 1YQSA 3OPHA 1ZC2A 3PAGA 1KE0A 4S2LA 5AQAA 3A3EA 4BQMA 1IYPA 1WE4A 4L0LA 5GLCA 4LENA 2ZM8A 4BD0A 2PU2A 4OPQA 4OPZA 1W5DA 4WBGA 4P85A 1Y54A 3O86A 4Q8IA 3BFCA 3G31A 3C4PA 3ZCZA 3ZNYA 2RCXA 2ZC7A 4KZ4A 3SH8A 2RL3A 3QHYA 3HREA 4Y7PA 1I2WA 3IWOA 3LO7A 1L0FA 2EFXA 4DE2A 2ZQAA 1TVFA 4DE0A 3CMZA 1QMFA 4FCFA 4JXVA 4RA7A 3HLFA 3GRJA 1IYOA 5A91A 1PIOA 3UE3A 4EUZA 1H8YA 1GA0A 1FCMA 1XA1A 3BFEA 3Q81A 4PM9A 3UPNA 1NY0A 5KSHA 1K57A 5FI7A 5F1FA 5EVIB 3VSKA 1EWZA 4EWFA 5G18A 4QY5A 5A92A 1LI9A 2C5WB 2WAFA 2V2FF 5HL1A 1YMXA 1ES2A 1N4OA 2ZC5B 1KE3A 3N6IA 2A49A 3BRMA 1YLJA 1YLWA 4OOLA 1MWRA 3ZG8B 3ZG5A 3FKWA 1OMEA 2H0TA 4MEZA 2H10A 4XUXA 3BYDA 3UDIA 2JCHA 3NIAA 3BEBA 3IT9A 1WYCA 2E8IA 1IYQA 2C6WB 2Y4AA 2XD5A 1RGYA 3UN7A 4XXRA 1VM1A 3AGFA 3B3XA 4UA6A 4UHUA 4X6TA 2BG1A 2HDQA 3BLMA 3IF5A 4BLMA 2EX6A 4GNUA 5EE8A 4RVAA 3WWXA 4DF6A 4Y0TA 4K0XA 4U0XA 3WRTA 3VP3A 4S2JA 1SDEA 1NRFA 1ERMA 1YMSA 5CHMA 3HBRA 2DRWA 4KZ3A 3Q7ZA 5GL9A 1PWGA 2HP6A 4UA7A 3HL9A 2Y2GA 1I5QA 1K54C 3HLEA 4OP8A 3ZG7B 3NC8A 3GSGA 5CEBA 3WRZA 3NCKA 4E3NA 1BULA 3CJMA 3DW0A 4X69A 1YLPA 4DE1A 2OLVA 2QZ6A 3IF6A 4JXSA 1BLCA 3NBLA 4S2KA 5E43A 5A90A 5HAIA 3OPRA 4S2NC 5FI2A 5CRFA 3PBTA 4P87A 3Q7VA 3SS5A 4D2OA 3OCNA 4C6YA 3BM6A 3ZNTA 3N8LA 3HLDA 4HBTA 4LV1A 4PPRA 4WZ5C 4DXCA 4E6XA 4IEDA 3PBOA 4KZ5A 4ZJ1A 1ES4A 3I7JA 3M2JA 1XP4A 4OOYA 5CTNA 3VFHA 4LV0A 1JTDA 4OP5A 1PWCA 1IYSA 2A3UA 5HX9A 1ESUA 3IXHA 1FOFA 3OZHA 3WS0A 4DRTA 3VP2A 1JWPA 2ZC4B 4BL3A 2Y2JA 5E2GA 3ITBA 1K6RA 4GZBA 3HLGA 5DVAA 2DNSA 5CHJA 4X53A 4P6BA 1ONHA 4OQ0A 4PM6A 1BLHA 3FZCA 3BECA 1BLPA 2Z2MB 3A3FA 1LL9A 1MWTA 5FSRA 3HUOA 4E3MA 4PM5A 2WKHA 3N8RA 1XGIA 1PZOA 3AGDA 4H8RA 3A3JA 3C7VA 4WYYA 4FH2A 3QNCA 4JXGA 1GHPA 1ZKJA 2Y91A 1K38A 1KVLA 1ONGA 2XH9A 5FQ9A 5FQKA 4BJPA 3IQAA 2XR0A 3IXGA 4WEKA 3UE1A 3M6HA 4Y0OA 2OSUA 1W8QA 5GLAA 4KZAA 4Z9QA 3PBRA 5KZHA 3TSGA 4KQOA 2EXAA 2JC7A 3AGEA 4OONA 5DTTA 2EX9A 3MKEA 2WK0A 1XGJA 3S22A 5JYOA 3CG5A 5DTKA 2Y2LA 4GDNA 5CXWA 4FH4A 2VGJA 5FQIA 3E2LA 1M40A 4DDSA 4WEJA 1K4FA 1IEMA 1SKFA 4R1GA 2WGIA 3SOIA 4LCMA 5DF7A 3C4OA 5DF8A 5KSCA 2Y2QA 3FKVA 1KDSA 4ZTKA 2WGWB 3Q1FA 4KG6A 4DDYA 2ZQ8A 1K25A 3NDGA 4R0QA 4S2MA 3W4QA 4OH0A 1IELA 3IWIA 1DJAA 3UPPA 2XK1A 1K55C 3GR2A 3SH7A 1TDLA 2VGKA 2H0YA 2WZXA 3V39A 4OQHA 3FWLA 2EFUA 3LY3A 5D3OA 1TDGA 4X55A 5FASA 5EVIC 2ZQCA 3O87A 5I94A 4R4RA 4NK3A 5DF9A 1PW1A 1TEMA 2G2WA 4A5RA 1JTGA 1H8ZA 5U47A 2ZD8A 1GCEA 1CI9A 4OQGA 4F94A 2ZMAA 4UAAA 1XKZA 1PI4A 4KZ8A 1ES3A 4OOMA 3MZEA 1KGGA 4YINA 2X01A 1KDWA 3S4XA 3D4FA 3BLSA 1YM1A 4IBXA 3RJUA 4B4ZA 1RP5A 1JWZA 5EOEA 2QPNA 3GTCA 3IXDA 5EUAA 1AXBA 4ID4A 1W8YA 2HDUA 3A3IA 3NY4A 2V20A 4QU3A 2ZM0A 4R3JA 4BENA 3MXRA 1Q2PA 2HPBA 1IKIA 1CK3A 1PI5A 1L0EA 4R4SA 1ERQA 2IWCA 5FAPA 3EQVA 3M2KA 1NJ4A 4C75A 4KZ6A 3MZFA 1K54A 4MBFA 1HD8A 5L2FA 4K91A 1XA7A 2P74A 3WS5A 3IWQA 3QNBA 3P98A 1KE4A 4P0MA 4GOGA 1NXYA 4KQRA 5EVLA 5GLDA 5J8XA 1FQGA 4JBFA 4S2NA 1ES5A 1L0DA 4OPYA 5FDHA 5GHYA 4RYEA 1MWUA 2XLNA 3VP4A 2B5RA 1FCNA 4PMAA 5GHZA 4N1HA 4WZ5A 2DCFA 1YLTA 2Y2IA 3ZHHA 5HAPA 1NYYA 5E2EA 3W4OA 4WMCA 3ZGAB 4BD1A 4UA9A 3O88A 3HUNA 1SDNA 2EX8A 4EQIA 5BOHA 5JYPA 2XDMA 5TFQA 3WS4A 5FAOA 3VP1A 2J9PA 3HLBA 5EVID 3BFGA 1KVMA 1ZG6A 3SS4A 4JF4A 3UPOA 3O3VA 1DY6A 1SCWA 2HP5A 5TGFA 1MKIA 5GLBA 1O7EA 1RCJA 1JVJA 2Y2PA 4OVDA 4U3TA 1MY8A 4LCLA 2XEPA 3UDFA 4R23A 1HVBA 1M6KA 2IWDA 3G4PA 3LCEA 3FYZA 3NDEA 1S0WA 4E3LA 1K4EA 2Z2LB 4N92A 1YLZA 3NI9A 3RXWA 3VOYA 1WYBA 5IHVA 1LL5A 2WGVA 1FSWA 1J9MA 2WKEA 4DXBA 1Q2QA 4KZBA 3DWKA 4JLFA 5CEDA 5HFOA 2R9XA 3IH8A 2EX2A 1G6AA 5FAQA 1YT4A 3V5MA 2XFSA 4ZBEA 4S2IA 2Q9MA 1BT5A 4ZDXA 2J8YA 4JF6A 3ZFZA 3P09A 1JWVA 5M18A 5EOOA 2WGWA 1BZAA 2P9VB 1E3UA 5AQBA 4E6WA 2ZC6B 1W79A 4S2PA 1ESIA 2ZQ7A 4N9KA 3ZG9B 4RX2A 3GVBA 3TOIA 5CHUA 3GMWA 1BUEA 4C3QA 3WS1A 1BLSA 5FQMA 4ZAMA 2GDNA 2Y59A 3BFFA 3UDXA 2XGNA 3G35A 5E2FA 3A3DA 4EV4A 5FQJA 1K55A 1NZOA 3HLCA 3PBNA 1EROA 4WMCD 4X68A 4GKUA 3Q82A 4FSFA 1S6RA 4RX3A 1N9BA 3G2ZA 5EVIA 4M3KA 1L2SA 2JBFA 3DWZA 1SHVA 2J9OA 4ZJ3A 3GV9A 4OPRA 3OC2A 2R9WA 5KMWA 1MXOA 2X71A 5FATA 1PW8A 3S1YA 4KENB 4U0TA 1K56D 2ZC3B 1LI0A 4MNRA 3V3SA 4YFMA 2WKIA 5CECA 5A93A 1MBLA 2Y2HA 5CTMA 1MWSA 2HP9A 2JE5A 4R3BA 4CJNA 4FD8A 3IHAA 2PBYA 1U60A 4NETA 3EQUA 4MBHA 4X56A 1FR6A 3N8SA 1BTLA 5HAQA 2FFFB 3BFDA 2Y2MA 2Y2KA 1DJBA 1LLBA 2Y2NA 1IKGA 2UWXA 5E2HA 2IWBA 3V50A 1QMEA 1L0GA 4EBLA 2X02A 1LHYA 5F82A 1E4DA 3IH9A 1NYMA 1ALQA 4QD4A 4QHCA 1K57C 2CC1A 3JYIA 4IVKA 4QB8A 4DKIA 3Q07A 4E3KA 3SH9A 5M1AA 3N7WA 3MZDA 1MPLA 4WZ4A 3G30A 1K6SA 1I2SA 1XPBA 4BL2A 3PTEA 4XUZA 3RXXA 4KG2A 1RGZA 1GHIA 1PZPA 1E3UD 1XXMA 3VOZA 5EPHA 3OPPA 3VSLA 2HDSA 5EECA 2WUQA 3IHBA 4IBRA 4OKPA 4MBKA 1ZG4A 4KQQA 4HEFA 1KGEA 2WAEA 3GQZA 2XD1A 2ZJ9A 4K0WA 3HVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8K A;  4WM9 A;  3ISG A;  4LV3 A;  4CPK A;  2J7V A;  4EBN A;  1EI5 A;  2QMI A;  5AQ7 A;  5FA7 A;  1DJC A;  2I72 A;  3ZVT A;  5F1G A;  3G32 A;  1Z6F A;  3UY6 A;  4OLG A;  3HLW A;  4S2O A;  4N1X A;  5F83 A;  3VMA A;  4N9L A;  4O7D A;  1K56 A;  1C3B A;  1PWD A;  2Y2O A;  5FI6 A;  1XX2 A;  4GD6 A;  5M19 A;  3G2Y A;  3IF6 C;  3ZG0 A;  3IXB A;  1CEF A;  3G34 A;  3OPL A;  5CGX A;  4PM8 A;  1G68 A;  1FCO A;  3IF6 B;  3VFF A;  4IVI A;  4JF5 A;  3UNW A;  1GHM A;  4GD8 A;  5HAR A;  1CI8 A;  3FV7 A;  2HDR A;  3MBZ A;  4Y0U A;  1KGF A;  3E2K A;  3Q7V B;  4KZ9 A;  5AQ9 A;  2XFT A;  3M6B A;  1VQQ A;  5CGW A;  2XF3 A;  3HUM A;  4B4X A;  3OCL A;  3MFD A;  3LEZ A;  1NZU A;  2BLS A;  3MKF A;  3SS3 A;  5CGS A;  5FQQ A;  4GN2 A;  2V1Z A;  2XQZ A;  2FFY A;  4PM7 A;  3CZD A;  5DTS A;  4GDB A;  2OLU A;  1PYY A;  3WS2 A;  2P9V A;  3LY4 A;  4OLD A;  2OV5 A;  4DE3 A;  1BSG A;  2WYX A;  3W4P A;  3PBS A;  1FR1 A;  4WEL A;  4ZJ2 A;  4E3I A;  4JKT A;  4EBP A;  4JXW A;  1O07 A;  3PAE A;  2WZZ A;  4QY6 A;  4JPM A;  2G2U A;  2ZQD A;  4KZ7 A;  3ZVW A;  3DTM A;  3C5A A;  2ZM2 A;  3UE0 A;  3UO9 A;  4HBU A;  3N4I A;  1H5X A;  1YLY A;  1GA9 A;  4GB7 A;  5CER A;  3PBQ A;  3V3R A;  4B88 A;  2ZQ9 A;  4E3J A;  2WAD A;  5HW3 A;  2PU4 A;  1HTZ A;  2Q9N A;  4E3O A;  4KG5 A;  2H5S A;  3ZDJ A;  1CEG A;  4QJG A;  1W7F A;  1FSY A;  2ZLY A;  4OQI A;  3C7U A;  3MXS A;  3ITA A;  2Y55 A;  5TR7 A;  2EXB A;  4HES A;  4LV2 A;  5GHX A;  4MLL A;  3TG9 A;  3VP0 A;  1E25 A;  1HZO A;  1YQS A;  3OPH A;  1ZC2 A;  3PAG A;  1KE0 A;  4S2L A;  5AQA A;  3A3E A;  4BQM A;  1IYP A;  1WE4 A;  4L0L A;  5GLC A;  4LEN A;  2ZM8 A;  4BD0 A;  2PU2 A;  4OPQ A;  4OPZ A;  1W5D A;  4WBG A;  4P85 A;  1Y54 A;  3O86 A;  4Q8I A;  3BFC A;  3G31 A;  3C4P A;  3ZCZ A;  3ZNY A;  2RCX A;  2ZC7 A;  4KZ4 A;  3SH8 A;  2RL3 A;  3QHY A;  3HRE A;  4Y7P A;  1I2W A;  3IWO A;  3LO7 A;  1L0F A;  2EFX A;  4DE2 A;  2ZQA A;  1TVF A;  4DE0 A;  3CMZ A;  1QMF A;  4FCF A;  4JXV A;  4RA7 A;  3HLF A;  3GRJ A;  1IYO A;  5A91 A;  1PIO A;  3UE3 A;  4EUZ A;  1H8Y A;  1GA0 A;  1FCM A;  1XA1 A;  3BFE A;  3Q81 A;  4PM9 A;  3UPN A;  1NY0 A;  5KSH A;  1K57 A;  5FI7 A;  5F1F A;  5EVI B;  3VSK A;  1EWZ A;  4EWF A;  5G18 A;  4QY5 A;  5A92 A;  1LI9 A;  2C5W B;  2WAF A;  2V2F F;  5HL1 A;  1YMX A;  1ES2 A;  1N4O A;  2ZC5 B;  1KE3 A;  3N6I A;  2A49 A;  3BRM A;  1YLJ A;  1YLW A;  4OOL A;  1MWR A;  3ZG8 B;  3ZG5 A;  3FKW A;  1OME A;  2H0T A;  4MEZ A;  2H10 A;  4XUX A;  3BYD A;  3UDI A;  2JCH A;  3NIA A;  3BEB A;  3IT9 A;  1WYC A;  2E8I A;  1IYQ A;  2C6W B;  2Y4A A;  2XD5 A;  1RGY A;  3UN7 A;  4XXR A;  1VM1 A;  3AGF A;  3B3X A;  4UA6 A;  4UHU A;  4X6T A;  2BG1 A;  2HDQ A;  3BLM A;  3IF5 A;  4BLM A;  2EX6 A;  4GNU A;  5EE8 A;  4RVA A;  3WWX A;  4DF6 A;  4Y0T A;  4K0X A;  4U0X A;  3WRT A;  3VP3 A;  4S2J A;  1SDE A;  1NRF A;  1ERM A;  1YMS A;  5CHM A;  3HBR A;  2DRW A;  4KZ3 A;  3Q7Z A;  5GL9 A;  1PWG A;  2HP6 A;  4UA7 A;  3HL9 A;  2Y2G A;  1I5Q A;  1K54 C;  3HLE A;  4OP8 A;  3ZG7 B;  3NC8 A;  3GSG A;  5CEB A;  3WRZ A;  3NCK A;  4E3N A;  1BUL A;  3CJM A;  3DW0 A;  4X69 A;  1YLP A;  4DE1 A;  2OLV A;  2QZ6 A;  3IF6 A;  4JXS A;  1BLC A;  3NBL A;  4S2K A;  5E43 A;  5A90 A;  5HAI A;  3OPR A;  4S2N C;  5FI2 A;  5CRF A;  3PBT A;  4P87 A;  3Q7V A;  3SS5 A;  4D2O A;  3OCN A;  4C6Y A;  3BM6 A;  3ZNT A;  3N8L A;  3HLD A;  4HBT A;  4LV1 A;  4PPR A;  4WZ5 C;  4DXC A;  4E6X A;  4IED A;  3PBO A;  4KZ5 A;  4ZJ1 A;  1ES4 A;  3I7J A;  3M2J A;  1XP4 A;  4OOY A;  5CTN A;  3VFH A;  4LV0 A;  1JTD A;  4OP5 A;  1PWC A;  1IYS A;  2A3U A;  5HX9 A;  1ESU A;  3IXH A;  1FOF A;  3OZH A;  3WS0 A;  4DRT A;  3VP2 A;  1JWP A;  2ZC4 B;  4BL3 A;  2Y2J A;  5E2G A;  3ITB A;  1K6R A;  4GZB A;  3HLG A;  5DVA A;  2DNS A;  5CHJ A;  4X53 A;  4P6B A;  1ONH A;  4OQ0 A;  4PM6 A;  1BLH A;  3FZC A;  3BEC A;  1BLP A;  2Z2M B;  3A3F A;  1LL9 A;  1MWT A;  5FSR A;  3HUO A;  4E3M A;  4PM5 A;  2WKH A;  3N8R A;  1XGI A;  1PZO A;  3AGD A;  4H8R A;  3A3J A;  3C7V A;  4WYY A;  4FH2 A;  3QNC A;  4JXG A;  1GHP A;  1ZKJ A;  2Y91 A;  1K38 A;  1KVL A;  1ONG A;  2XH9 A;  5FQ9 A;  5FQK A;  4BJP A;  3IQA A;  2XR0 A;  3IXG A;  4WEK A;  3UE1 A;  3M6H A;  4Y0O A;  2OSU A;  1W8Q A;  5GLA A;  4KZA A;  4Z9Q A;  3PBR A;  5KZH A;  3TSG A;  4KQO A;  2EXA A;  2JC7 A;  3AGE A;  4OON A;  5DTT A;  2EX9 A;  3MKE A;  2WK0 A;  1XGJ A;  3S22 A;  5JYO A;  3CG5 A;  5DTK A;  2Y2L A;  4GDN A;  5CXW A;  4FH4 A;  2VGJ A;  5FQI A;  3E2L A;  1M40 A;  4DDS A;  4WEJ A;  1K4F A;  1IEM A;  1SKF A;  4R1G A;  2WGI A;  3SOI A;  4LCM A;  5DF7 A;  3C4O A;  5DF8 A;  5KSC A;  2Y2Q A;  3FKV A;  1KDS A;  4ZTK A;  2WGW B;  3Q1F A;  4KG6 A;  4DDY A;  2ZQ8 A;  1K25 A;  3NDG A;  4R0Q A;  4S2M A;  3W4Q A;  4OH0 A;  1IEL A;  3IWI A;  1DJA A;  3UPP A;  2XK1 A;  1K55 C;  3GR2 A;  3SH7 A;  1TDL A;  2VGK A;  2H0Y A;  2WZX A;  3V39 A;  4OQH A;  3FWL A;  2EFU A;  3LY3 A;  5D3O A;  1TDG A;  4X55 A;  5FAS A;  5EVI C;  2ZQC A;  3O87 A;  5I94 A;  4R4R A;  4NK3 A;  5DF9 A;  1PW1 A;  1TEM A;  2G2W A;  4A5R A;  1JTG A;  1H8Z A;  5U47 A;  2ZD8 A;  1GCE A;  1CI9 A;  4OQG A;  4F94 A;  2ZMA A;  4UAA A;  1XKZ A;  1PI4 A;  4KZ8 A;  1ES3 A;  4OOM A;  3MZE A;  1KGG A;  4YIN A;  2X01 A;  1KDW A;  3S4X A;  3D4F A;  3BLS A;  1YM1 A;  4IBX A;  3RJU A;  4B4Z A;  1RP5 A;  1JWZ A;  5EOE A;  2QPN A;  3GTC A;  3IXD A;  5EUA A;  1AXB A;  4ID4 A;  1W8Y A;  2HDU A;  3A3I A;  3NY4 A;  2V20 A;  4QU3 A;  2ZM0 A;  4R3J A;  4BEN A;  3MXR A;  1Q2P A;  2HPB A;  1IKI A;  1CK3 A;  1PI5 A;  1L0E A;  4R4S A;  1ERQ A;  2IWC A;  5FAP A;  3EQV A;  3M2K A;  1NJ4 A;  4C75 A;  4KZ6 A;  3MZF A;  1K54 A;  4MBF A;  1HD8 A;  5L2F A;  4K91 A;  1XA7 A;  2P74 A;  3WS5 A;  3IWQ A;  3QNB A;  3P98 A;  1KE4 A;  4P0M A;  4GOG A;  1NXY A;  4KQR A;  5EVL A;  5GLD A;  5J8X A;  1FQG A;  4JBF A;  4S2N A;  1ES5 A;  1L0D A;  4OPY A;  5FDH A;  5GHY A;  4RYE A;  1MWU A;  2XLN A;  3VP4 A;  2B5R A;  1FCN A;  4PMA A;  5GHZ A;  4N1H A;  4WZ5 A;  2DCF A;  1YLT A;  2Y2I A;  3ZHH A;  5HAP A;  1NYY A;  5E2E A;  3W4O A;  4WMC A;  3ZGA B;  4BD1 A;  4UA9 A;  3O88 A;  3HUN A;  1SDN A;  2EX8 A;  4EQI A;  5BOH A;  5JYP A;  2XDM A;  5TFQ A;  3WS4 A;  5FAO A;  3VP1 A;  2J9P A;  3HLB A;  5EVI D;  3BFG A;  1KVM A;  1ZG6 A;  3SS4 A;  4JF4 A;  3UPO A;  3O3V A;  1DY6 A;  1SCW A;  2HP5 A;  5TGF A;  1MKI A;  5GLB A;  1O7E A;  1RCJ A;  1JVJ A;  2Y2P A;  4OVD A;  4U3T A;  1MY8 A;  4LCL A;  2XEP A;  3UDF A;  4R23 A;  1HVB A;  1M6K A;  2IWD A;  3G4P A;  3LCE A;  3FYZ A;  3NDE A;  1S0W A;  4E3L A;  1K4E A;  2Z2L B;  4N92 A;  1YLZ A;  3NI9 A;  3RXW A;  3VOY A;  1WYB A;  5IHV A;  1LL5 A;  2WGV A;  1FSW A;  1J9M A;  2WKE A;  4DXB A;  1Q2Q A;  4KZB A;  3DWK A;  4JLF A;  5CED A;  5HFO A;  2R9X A;  3IH8 A;  2EX2 A;  1G6A A;  5FAQ A;  1YT4 A;  3V5M A;  2XFS A;  4ZBE A;  4S2I A;  2Q9M A;  1BT5 A;  4ZDX A;  2J8Y A;  4JF6 A;  3ZFZ A;  3P09 A;  1JWV A;  5M18 A;  5EOO A;  2WGW A;  1BZA A;  2P9V B;  1E3U A;  5AQB A;  4E6W A;  2ZC6 B;  1W79 A;  4S2P A;  1ESI A;  2ZQ7 A;  4N9K A;  3ZG9 B;  4RX2 A;  3GVB A;  3TOI A;  5CHU A;  3GMW A;  1BUE A;  4C3Q A;  3WS1 A;  1BLS A;  5FQM A;  4ZAM A;  2GDN A;  2Y59 A;  3BFF A;  3UDX A;  2XGN A;  3G35 A;  5E2F A;  3A3D A;  4EV4 A;  5FQJ A;  1K55 A;  1NZO A;  3HLC A;  3PBN A;  1ERO A;  4WMC D;  4X68 A;  4GKU A;  3Q82 A;  4FSF A;  1S6R A;  4RX3 A;  1N9B A;  3G2Z A;  5EVI A;  4M3K A;  1L2S A;  2JBF A;  3DWZ A;  1SHV A;  2J9O A;  4ZJ3 A;  3GV9 A;  4OPR A;  3OC2 A;  2R9W A;  5KMW A;  1MXO A;  2X71 A;  5FAT A;  1PW8 A;  3S1Y A;  4KEN B;  4U0T A;  1K56 D;  2ZC3 B;  1LI0 A;  4MNR A;  3V3S A;  4YFM A;  2WKI A;  5CEC A;  5A93 A;  1MBL A;  2Y2H A;  5CTM A;  1MWS A;  2HP9 A;  2JE5 A;  4R3B A;  4CJN A;  4FD8 A;  3IHA A;  2PBY A;  1U60 A;  4NET A;  3EQU A;  4MBH A;  4X56 A;  1FR6 A;  3N8S A;  1BTL A;  5HAQ A;  2FFF B;  3BFD A;  2Y2M A;  2Y2K A;  1DJB A;  1LLB A;  2Y2N A;  1IKG A;  2UWX A;  5E2H A;  2IWB A;  3V50 A;  1QME A;  1L0G A;  4EBL A;  2X02 A;  1LHY A;  5F82 A;  1E4D A;  3IH9 A;  1NYM A;  1ALQ A;  4QD4 A;  4QHC A;  1K57 C;  2CC1 A;  3JYI A;  4IVK A;  4QB8 A;  4DKI A;  3Q07 A;  4E3K A;  3SH9 A;  5M1A A;  3N7W A;  3MZD A;  1MPL A;  4WZ4 A;  3G30 A;  1K6S A;  1I2S A;  1XPB A;  4BL2 A;  3PTE A;  4XUZ A;  3RXX A;  4KG2 A;  1RGZ A;  1GHI A;  1PZP A;  1E3U D;  1XXM A;  3VOZ A;  5EPH A;  3OPP A;  3VSL A;  2HDS A;  5EEC A;  2WUQ A;  3IHB A;  4IBR A;  4OKP A;  4MBK A;  1ZG4 A;  4KQQ A;  4HEF A;  1KGE A;  2WAE A;  3GQZ A;  2XD1 A;  2ZJ9 A;  4K0W A;  3HVF A; 
#chains in the Genus database with same CATH topology
 2QKP A;  4R6L A;  4LV3 A;  4CPK A;  1LT0 A;  2QMI A;  2JHE A;  3ZVT A;  5F1G A;  3G32 A;  1OTI A;  3NOU C;  3VMA A;  1K56 A;  5M19 A;  5FI6 A;  3G2Y A;  1XJ4 A;  3G34 A;  1G68 A;  4IVI A;  3KSG A;  1GHM A;  3FG8 A;  3BQA A;  2O99 A;  3KX0 X;  4Y0U A;  3E2K A;  2EWW A;  1VQQ A;  3GEC A;  5CGW A;  1SKO B;  3OCL A;  1VEU B;  5F6A A;  3SS3 A;  2FFY A;  4Y5F A;  4PHT A;  2P9V A;  3LY4 A;  2WYX A;  4NG2 A;  4E3I A;  4JKT A;  4EBP A;  1O07 A;  2WZZ A;  4KZ7 A;  3C5A A;  2ZM2 A;  4HBU A;  1T1C A;  2YKH A;  3N4I A;  4GB7 A;  2PRF A;  4B88 A;  1YPR A;  4E3J A;  5HW3 A;  2PU4 A;  1HTZ A;  5L09 A;  4RQ9 A;  3NEC A;  4QJG A;  4CLC D;  1S4R A;  3JPU A;  4JGO A;  4HIA A;  5TR7 A;  3KYZ A;  3BWL A;  2LB9 A;  3TG9 A;  2Q0O A;  1KE0 A;  2J3W A;  4WUJ A;  1WE4 A;  3UB7 A;  3IBR A;  2ZM8 A;  4BD0 A;  1TS6 A;  4OPZ A;  4X1L A;  1W5D A;  1IFQ A;  4Q8I A;  3BFC A;  3G31 A;  3A0V A;  4KZ4 A;  3IWO A;  2EFX A;  1TVF A;  1NLY A;  4FCF A;  5A91 A;  1PIO A;  3B42 A;  1GA0 A;  1XA1 A;  5EVI B;  4QY5 A;  2V2F F;  1ES2 A;  5HD3 A;  3ZG5 A;  3CUE A;  3D9Y A;  3UDI A;  4LRZ E;  1WYC A;  2Y4A A;  3AGF A;  2VZW A;  3RFB A;  4BLM A;  2JKR M;  4GNU A;  4NKP A;  4RVA A;  3PHY A;  5EE8 A;  4K0X A;  4S2J A;  1SDE A;  1YMS A;  3HBR A;  3LI8 A;  3ZG7 B;  3NCK A;  1YLP A;  2FZ0 A;  2PBD P;  4DE1 A;  5HAI A;  3OPR A;  4S2N C;  4BMW A;  3PBT A;  4P87 A;  3N8L A;  4WZ5 C;  1DP8 A;  1VEU A;  4E04 A;  1ES4 A;  3I7J A;  5CTN A;  3VFH A;  1PWC A;  1IYS A;  2A3U A;  3SZT A;  1FOF A;  4DRT A;  1JWP A;  5HWW A;  5E2G A;  1S4S A;  4GZB A;  4MCW A;  2W1R A;  3FC7 A;  1ONH A;  1BLH A;  3FZC A;  2Z2M B;  1A0K A;  4PM5 A;  1XGI A;  3A3J A;  2I9V A;  4JXG A;  2XH9 A;  2XR0 A;  3IXG A;  1LL8 A;  4WEK A;  3UE1 A;  5GLA A;  3PBR A;  5KZH A;  3K3D A;  2EXA A;  3AGE A;  3HJI A;  5DTT A;  3S22 A;  5JYO A;  1XGJ A;  2PYR A;  4PKY A;  4L9E A;  5FQI A;  3E2L A;  4WEJ A;  1AWI A;  3C30 A;  4JGR A;  4XT2 A;  2WGI A;  2K2N A;  5DF7 A;  4LLO B;  3C4O A;  4I3I A;  4R3A A;  4S2M A;  1IEL A;  2XK1 A;  2KOI A;  1K55 C;  3SH7 A;  2VGK A;  3FWL A;  2EFU A;  2VA0 A;  5D3O A;  1F98 A;  4X55 A;  2M7V A;  2HJE A;  2ZQC A;  3O87 A;  2QJ5 A;  3E4Q A;  1PW1 A;  1TEM A;  2G2W A;  3IX4 A;  2A24 B;  2MJ6 A;  4UAA A;  1PI4 A;  3MS6 A;  1KDW A;  3S4X A;  1YM1 A;  3T1Q B;  2L1M A;  1OJ5 A;  3QP1 A;  5EOE A;  3GTC A;  3IXD A;  1AXB A;  4QU3 A;  3D3O A;  2XRO A;  1PI5 A;  1L0E A;  3EQV A;  2W0N A;  1NJ4 A;  4KZ6 A;  4MBF A;  4GW9 A;  3HJK A;  5L2F A;  4K91 A;  3WS5 A;  5EVL A;  1NXY A;  3T4T A;  4S2N A;  5G4Z A;  3VP4 A;  1STZ A;  3JVU A;  4KUK A;  4WZ5 A;  2DCF A;  3IS2 B;  4UA9 A;  3WS4 A;  3VP1 A;  1XFQ A;  1VHM A;  4DMZ A;  1KVM A;  3SS4 A;  3UPO A;  5HPI A;  1SCW A;  1MKI A;  3UB9 A;  3LFV A;  1MY8 A;  4LCL A;  1M6K A;  2VJW A;  2EWV A;  3FYZ A;  4Q0J A;  2Z6D A;  1WYB A;  4L9G A;  2FH5 A;  1Q2Q A;  5TJJ A;  1F9I A;  4EUV A;  4R70 A;  4LFU A;  1YT4 A;  3V5M A;  3T4K A;  4MN5 A;  3EGX C;  1K0K A;  2ZMF A;  5AQB A;  5J7E A;  4N9K A;  3ZG9 B;  4RX2 A;  5CHU A;  1XJ6 A;  3GMW A;  1BLS A;  2PR5 A;  4ZAM A;  3G35 A;  1CQA A;  1K55 A;  3PBN A;  4GKU A;  1S6R A;  2JBF A;  4GCZ A;  2J9O A;  2K31 A;  2A24 A;  5F68 A;  1PW8 A;  4U0T A;  2ZC3 B;  4MNR A;  3DTI A;  2WKI A;  5A93 A;  1MBL A;  3F1P B;  1UGU A;  2JE5 A;  4CJN A;  3E98 A;  3IHA A;  4MBH A;  4Y2F A;  1S1Z A;  2OOL A;  2Y2M A;  2ZMV A;  2Y2N A;  2JKR I;  2UWX A;  3EEH A;  3SW1 A;  3IH9 A;  3LUQ A;  4QHC A;  1K57 C;  1N9O A;  5M1A A;  3G30 A;  1K6S A;  2PD7 A;  4BL2 A;  4XUZ A;  4KG2 A;  4EER A;  3NOT C;  2A2L A;  3IS2 A;  3VV4 A;  1S1Y A;  3VSL A;  1PRQ A;  5EEC A;  3IHB A;  1P0Z A;  5IT5 A;  3H7W B;  1KGE A;  2XD1 A;  4IUK A;  4F3L A;  3W8K A;  4EBN A;  2I72 A;  1Z6F A;  4S2O A;  1H3Q A;  2ZOI A;  5F83 A;  1XX2 A;  3DBA A;  3IF6 C;  1DRM A;  3OPL A;  4PM8 A;  3IF6 B;  4GD8 A;  3BY9 A;  5HAR A;  1CI8 A;  1KGF A;  3Q7V B;  3PXP A;  4KZ9 A;  2WKP A;  2XF3 A;  3HUM A;  4FTX A;  4B4X A;  3MFD A;  3LEZ A;  2BLS A;  3MKF A;  5FQQ A;  3F1N B;  2XQZ A;  4PM7 A;  3E4P A;  2OLU A;  1YSP A;  3GDI A;  4EQ1 A;  3W4P A;  3PBS A;  1FR1 A;  4ETZ A;  4JXW A;  4O01 A;  4JPM A;  2ZQD A;  5KIZ A;  3ZVW A;  3DTM A;  3UO9 A;  1H5X A;  3V3R A;  5FEG A;  4ARZ B;  3LYX A;  4YWZ A;  2Q9N A;  1EW0 A;  2H5S A;  4UQI M;  3ZDJ A;  3QP2 A;  1W7F A;  2GJ3 A;  4OQI A;  3C7U A;  2VV7 A;  2Y55 A;  4WLA A;  3JVV A;  4LV2 A;  4MLL A;  1E25 A;  5EM1 A;  3F1P A;  5TBM B;  4Q0I A;  4PAU A;  2XA7 S;  2PU2 A;  2G7U A;  4OPQ A;  1P9W A;  1JNU A;  4WBG A;  4P85 A;  1Y54 A;  1OJG A;  3O86 A;  2QHK A;  3E0Y A;  1OT6 A;  3LO7 A;  2ZQA A;  4II7 A;  4JXV A;  4MN6 A;  3HLF A;  3GRJ A;  3UE3 A;  1H8Y A;  4PM9 A;  1FCM A;  3UPN A;  1K57 A;  2PR6 A;  3UB6 A;  5F1F A;  5A92 A;  1D06 A;  1LSV A;  5HL1 A;  5F69 A;  2PYP A;  3BRM A;  4OOL A;  3H7W A;  1OME A;  4MEZ A;  2H10 A;  3BYD A;  3IT9 A;  2C6W B;  4YNR A;  3UN7 A;  1RGY A;  4UA6 A;  4X6T A;  3B3X A;  4UHU A;  4HP9 A;  2EX6 A;  5DKL A;  3WWX A;  4DF6 A;  1ERM A;  2DRW A;  3Q7Z A;  1XFN A;  5GL9 A;  2Y2G A;  3LEQ A;  2JKG A;  4OP8 A;  3NC8 A;  3GSG A;  5CEB A;  4E3N A;  1BUL A;  4FUW A;  3CJM A;  4X69 A;  3IF6 A;  2BTF P;  3NHQ A;  3LIF A;  5A90 A;  3K3C A;  2OAP 1;  5CRF A;  4G3K A;  3EOI A;  3Q7V A;  3KSI A;  3BM6 A;  3HLD A;  4HBT A;  2OAQ 1;  4E6X A;  3DAV A;  4KZ5 A;  3KSH A;  3M2J A;  4OOY A;  3F1N A;  4H6J B;  4BWI A;  1ESU A;  5DFX A;  1F2K A;  1WA9 A;  3CWF A;  3VP2 A;  1NRJ A;  3ITB A;  2VLG A;  3HLG A;  5CHJ A;  5HL6 A;  3TE8 A;  1Y4O A;  4PM6 A;  4QWO A;  3A3F A;  4CLC E;  4ARZ A;  3N8R A;  1PZO A;  4BBU A;  3AGD A;  4H8R A;  4WYY A;  2VEA A;  3QNC A;  2Y91 A;  1K38 A;  2HJ9 C;  3IQA A;  3BJN A;  3M6H A;  4KZA A;  4Z9Q A;  3DTE A;  4I39 A;  3T4S A;  3LI9 A;  2W3D A;  2JC7 A;  4Z1W A;  3MKE A;  3CG5 A;  5TBM A;  4GDN A;  4FH4 A;  2QJ7 A;  4DDS A;  5DJU A;  1SKF A;  2L4R A;  4LCM A;  1V9Z A;  5DF8 A;  5KSC A;  2Y2Q A;  3FKV A;  2NUT C;  5F5Y A;  4DDY A;  2ZQ8 A;  3LIE A;  3NDG A;  3W4Q A;  4OH0 A;  2ZOH A;  1DJA A;  3GR2 A;  1FIL A;  1TDL A;  1OTA A;  4AFI A;  2VK3 A;  5EVI C;  1KOU A;  3LR5 A;  5DF9 A;  3C38 A;  1H8Z A;  5U47 A;  2ZD8 A;  1GCE A;  2DMW A;  3A0S A;  2ZMA A;  1XKZ A;  3MFX A;  4KZ8 A;  3T1S A;  2VKS A;  4YIN A;  5AVF A;  4IBX A;  3RJU A;  4B4Z A;  4MN7 A;  4GJ4 A;  2VGL S;  4NXF A;  3A3I A;  2O9B A;  3NY4 A;  4BEN A;  1PFL A;  1Q2P A;  2HPB A;  1IKI A;  5HPF A;  1TS7 A;  1G28 A;  3MZF A;  1HD8 A;  3KYQ A;  2VV8 A;  3QNB A;  4P0M A;  3P98 A;  1PNE A;  5GLD A;  1FQG A;  4OPY A;  4X25 A;  2XLN A;  2B5R A;  5GHZ A;  4H6J A;  1SKO A;  2B95 A;  4HJ3 A;  3ZHH A;  5HAP A;  1LSX A;  5E2E A;  4WMC A;  4HJ4 A;  1SDN A;  5EV0 A;  4EQI A;  5TFQ A;  5FAO A;  3T1X A;  3BQ8 A;  1YAX A;  5EVI D;  2XSS A;  4NEE D;  4HY8 A;  5TGF A;  3OOV A;  2Y2P A;  2V8F A;  2AVX A;  3UDF A;  1S0W A;  1K4E A;  1LL5 A;  2WKR A;  2WGV A;  4KZB A;  3DWK A;  4HH2 A;  2R9X A;  3IH8 A;  4HOI A;  1NLZ A;  2XFS A;  4S2I A;  4ZDX A;  2J8Y A;  3ZFZ A;  3P09 A;  1JWV A;  5M18 A;  3W2Z A;  1NWZ A;  1F5M A;  3MXQ A;  3GVB A;  2GDN A;  3BFF A;  3UDX A;  4BBT A;  3S7O A;  4EV4 A;  3HLC A;  4Y13 A;  2Y79 A;  2V1A A;  3Q82 A;  4G3V A;  1OTE A;  5EVI A;  4M3K A;  4UEY A;  5KMW A;  3OC2 A;  2X71 A;  2GZA A;  2J3T C;  1Y28 A;  4LGW A;  5CEC A;  2Y2H A;  1MWS A;  4FD8 A;  2PBY A;  3EQU A;  4X56 A;  5FDS A;  5HAQ A;  2W3G A;  1TD5 A;  3BFD A;  1LLB A;  5L10 A;  1IKG A;  3V50 A;  1QME A;  1OT9 A;  1NYM A;  1ALQ A;  2CC1 A;  4IVK A;  4E3K A;  4IJG A;  3MZD A;  1MPL A;  1SZV A;  2V0W A;  3PTE A;  2WUQ A;  4OKP A;  3V67 A;  2WAE A;  4WM9 A;  1EI5 A;  5AQ7 A;  5FA7 A;  3UME A;  3UY6 A;  4OLG A;  4N1X A;  2K7S A;  4O7D A;  1C3B A;  2Y2O A;  4GD6 A;  3ZG0 A;  2J3T D;  3IXB A;  1CEF A;  3B47 A;  2D01 A;  5CGX A;  1FCO A;  4I38 A;  4JF5 A;  3UNW A;  2W1T B;  3FV7 A;  2HDR A;  4EW7 A;  3M6B A;  2H28 A;  3S7Q A;  2V9A A;  4HJ6 A;  4LPZ A;  5CGS A;  2V1Z A;  3CZD A;  5DTS A;  3A0R A;  3P7N A;  2KX6 A;  1PYY A;  4DE3 A;  4OLD A;  1BSG A;  4WEL A;  4Q0H A;  3F1O B;  3PAE A;  2OWH A;  5I5L A;  3UE0 A;  4KUO A;  1YLY A;  1GA9 A;  3H82 B;  2WAD A;  3LIB A;  2ZLY A;  3MXS A;  4HNB A;  1YKD A;  2O9A A;  3CI6 A;  4EEU A;  1HZO A;  1YQS A;  3OPH A;  5EFW A;  5AQA A;  2Y8H A;  4JGQ A;  4L0L A;  5GLC A;  1FIK A;  3R7W B;  4LEN A;  3VE4 A;  3ZCZ A;  3ZNY A;  4Y7P A;  1I2W A;  4DE2 A;  4DE0 A;  3CMZ A;  1QMF A;  1IYO A;  4EUZ A;  4EET B;  3Q81 A;  3BFE A;  3ZYT A;  1NY0 A;  5KSH A;  1H0M A;  3VSK A;  1ODV A;  4K08 A;  1EWZ A;  5G18 A;  1LI9 A;  2C5W B;  3PYP A;  1YMX A;  1N4O A;  2YKF A;  2ZC5 B;  3N6I A;  3T4J A;  1MWR A;  3B33 A;  3FKW A;  3QP5 A;  2JCH A;  3NIA A;  1DP6 A;  1VM1 A;  3CIT A;  5L07 A;  4Y0T A;  4U0X A;  3VP3 A;  5CHM A;  4KZ3 A;  3RH8 B;  2HP6 A;  4UA7 A;  1CJF A;  1I5Q A;  1K54 C;  3HLE A;  3DW0 A;  2OLV A;  4S2K A;  4JXS A;  5E43 A;  3E4O A;  3NBL A;  5FI2 A;  4WN5 A;  3OCN A;  4C6Y A;  4PPR A;  4LV1 A;  5AJG A;  4IED A;  4G3W A;  4ZJ1 A;  4QPR A;  1XP4 A;  4LV0 A;  1JTD A;  4OP5 A;  3EGD C;  2PHY A;  3IXH A;  5HDD A;  3OZH A;  2ZC4 B;  4BL3 A;  2Y2J A;  2CMN A;  2IA2 A;  1K6R A;  2DNS A;  4EEP A;  4X53 A;  4P6B A;  4OQ0 A;  3C8C A;  3BEC A;  1BLP A;  3H82 A;  1LL9 A;  3HUO A;  3MQQ A;  3C7V A;  4FH2 A;  1ACF A;  5FL3 A;  1GHP A;  5DJT A;  1KVL A;  1ONG A;  2VV6 A;  2QYB A;  4I3J A;  3MQO A;  4KQO A;  3TSG A;  2B02 A;  2NUP C;  3L9K A;  2WK0 A;  2XA7 M;  3CHW P;  3P01 A;  4P6Z S;  4X1M A;  2Y2L A;  5DTK A;  3R7W A;  1K4F A;  1IEM A;  1G5U A;  5CX7 A;  3KO6 A;  3LR4 A;  4R1G A;  4D60 A;  3SOI A;  3UB5 P;  1KDS A;  4ZTK A;  2WGW B;  4KG6 A;  4R0Q A;  2HGV A;  1L3L A;  3V39 A;  4OQH A;  3LY3 A;  3EWK A;  5I94 A;  4NK3 A;  2HZ5 A;  3T50 A;  4A5R A;  4I3A A;  4L9F A;  5HDS A;  4OQG A;  2ZBB A;  3MZE A;  2X01 A;  3CPT B;  3BLS A;  1RP5 A;  1JWZ A;  4ID4 A;  5C5K A;  2V20 A;  2ZM0 A;  3T1R A;  2O9C A;  4I5S A;  4LRX C;  4R4S A;  3M2K A;  4C75 A;  1K54 A;  3NJA A;  1GSX A;  2W27 A;  1XA7 A;  2P74 A;  3OLO A;  4CQH A;  3IWQ A;  1KE4 A;  4KQR A;  1J3W A;  2M7U A;  5DKK A;  3UMD A;  1L0D A;  5GHY A;  4JGP A;  4RYE A;  4PMA A;  5L8M A;  1YLT A;  2Y2I A;  1NYY A;  3LR3 A;  3W4O A;  4BD1 A;  3ULF A;  2JN7 A;  4CLC C;  3O88 A;  1D1J A;  2EX8 A;  5BOH A;  5JYP A;  2XDM A;  2LB5 A;  3BFG A;  1ZG6 A;  4CLC B;  3MR0 A;  3O3V A;  2L0W A;  5EM0 A;  1MKM A;  1O7E A;  1RCJ A;  4OVD A;  4EES A;  1HVB A;  3LCE A;  3NDE A;  2V1B A;  4MMN A;  2HV1 A;  2GNX A;  4N92 A;  5IHV A;  2E8J A;  2W3H A;  4ME4 A;  1FSW A;  3IBJ A;  5CED A;  5HFO A;  2EX2 A;  1G6A A;  5FAQ A;  4ZBE A;  5J3W A;  1YSQ A;  4JF6 A;  3TRC A;  5AVE A;  5EOO A;  2WGW A;  1BZA A;  1E3U A;  2ZC6 B;  1ZHH B;  1W79 A;  4PKY G;  3BY8 A;  2HF6 A;  3TOI A;  4C3Q A;  2Y59 A;  1T1B A;  1NZO A;  1ERO A;  4WMC D;  4X68 A;  4WF0 A;  1BYW A;  4FSF A;  1L2S A;  1SHV A;  3GV9 A;  4OPR A;  5FAT A;  3S1Y A;  4NXE A;  4KEN B;  3OBF A;  5DFY A;  3V3S A;  4YFM A;  2ACG A;  2VGL M;  3CPT A;  5CTM A;  4XT2 B;  4B9O A;  2HP9 A;  4O0P A;  1FR6 A;  1BTL A;  2KDK A;  3VOL A;  1DJB A;  5E2H A;  2IWB A;  1L0G A;  4EBL A;  1LHY A;  4QD4 A;  4DKI A;  3SH9 A;  3LIA A;  3N7W A;  4WZ4 A;  2P7J A;  3MF0 A;  3LGO A;  1LSW A;  1G6O A;  3RXX A;  3K2N A;  4YOF A;  1RGZ A;  4Y15 A;  1XXM A;  5EPH A;  3OPP A;  3RTY A;  2HDS A;  4O8G A;  2QWS A;  4MBK A;  4HEF A;  2ZJ9 A;  4CLC A;  3ISG A;  3PR6 A;  2BAS A;  2J7V A;  3UE6 A;  1DJC A;  4ETX A;  3HLW A;  5FEF A;  4N9L A;  1PWD A;  5K5B A;  4HHD A;  4GHI B;  3VFF A;  1P97 A;  3MBZ A;  3S7P A;  5AQ9 A;  2PAV P;  2XFT A;  5HZH A;  1NZU A;  3QP8 A;  3QP4 A;  4GN2 A;  2ZL1 B;  4LRY C;  2R78 A;  4M4X A;  1GSW A;  4GDB A;  1W63 Q;  3WS2 A;  2OV5 A;  4ZRR A;  3ICY A;  4ZJ2 A;  4QY6 A;  2G2U A;  2M1C A;  3D72 A;  4IHQ A;  4HI4 A;  4BBV A;  5CER A;  3PBQ A;  3TJZ C;  2ZQ9 A;  5HD5 A;  4E3O A;  4KG5 A;  1P9R A;  1CEG A;  1T19 A;  1FSY A;  3ITA A;  2PD8 A;  1D7E A;  2EXB A;  4HES A;  3TW8 A;  5GHX A;  3VP0 A;  1ZC2 A;  3PAG A;  4S2L A;  4BQM A;  3A3E A;  1IYP A;  4MDZ A;  4NXB A;  4DJ3 A;  1TS0 A;  3C4P A;  2RCX A;  2ZC7 A;  3SH8 A;  2RL3 A;  3QHY A;  3HRE A;  1L0F A;  4RA7 A;  5FI7 A;  1HLU P;  4EWF A;  2JKT I;  2WAF A;  5IU1 A;  4NXG A;  1KE3 A;  4HQA A;  2A49 A;  3L7H A;  1N9N A;  1YLJ A;  1YLW A;  3ZG8 B;  4B93 A;  1MZU A;  2H0T A;  4XUX A;  3BEB A;  2E8I A;  5MC7 A;  1IYQ A;  3T4L A;  4ESP A;  1XJ2 A;  2XD5 A;  4XXR A;  2BG1 A;  2HDQ A;  3BLM A;  3IF5 A;  2O0Y A;  2P04 A;  3S7N A;  2B18 A;  3WRT A;  3NOP C;  1NRF A;  3MMH A;  1PWG A;  3HL9 A;  4GHI A;  1V9Y A;  3WRZ A;  3U4L P;  2QZ6 A;  1BLC A;  3KYE A;  3SS5 A;  4D2O A;  1VET B;  3ZNT A;  5EVE A;  4DXC A;  3PBO A;  1XJ3 A;  2P08 A;  2ZL1 A;  4GS9 B;  3LIC A;  4Y3I A;  4HH3 A;  4F3L B;  5HX9 A;  1X0O A;  3T4Q A;  3WS0 A;  3U2A A;  4HP4 A;  2XRN A;  5DVA A;  3T12 B;  3T4O A;  2INW A;  1MWT A;  5FSR A;  4E3M A;  3G6O A;  3MQ0 A;  2WKH A;  4DN0 A;  3C2W A;  1ZKJ A;  1GSV A;  4BJP A;  5FQ9 A;  4R38 A;  5FQK A;  4IUH A;  3KSF A;  4Y0O A;  2OSU A;  1S66 L;  1W8Q A;  3VE3 A;  2W3E A;  1VB6 A;  4OON A;  2EX9 A;  2WKQ A;  5CXW A;  4DJ2 A;  5J4E A;  2VGJ A;  1M40 A;  2OWJ A;  5HWV A;  3Q1F A;  1K25 A;  1S67 L;  3IWI A;  3UPP A;  2H0Y A;  1H8M A;  2WZX A;  5A8B A;  3LR0 A;  1TDG A;  4EU0 A;  5FAS A;  1ZTU A;  1TF1 A;  2GX5 A;  4R4R A;  5HDC A;  2V0U A;  1JTG A;  1OTB A;  3EEA A;  1CI9 A;  4F94 A;  2EA9 A;  5G4Y A;  1ES3 A;  4OOM A;  1KGG A;  1OTD A;  2JKF A;  3D4F A;  2Z6C A;  3HCY A;  2QPN A;  4WL9 A;  3FPV A;  3IX8 A;  5EUA A;  2V8C A;  1W8Y A;  2HDU A;  2UV0 E;  4R3J A;  3MXR A;  1CK3 A;  5FAP A;  1ERQ A;  2IWC A;  1TS8 A;  4EXO A;  1VET A;  4GOG A;  5J8X A;  2PT7 A;  4JBF A;  1ES5 A;  2W1T A;  5FDH A;  1MWU A;  5HSQ A;  1FCN A;  4GS9 A;  1N9L A;  4N1H A;  2J80 A;  3ZGA B;  3HUN A;  2J9P A;  3HLB A;  4KQD A;  4JF4 A;  1DY6 A;  3DTK A;  2HP5 A;  5LBR A;  3F1O A;  5GLB A;  1JVJ A;  4U3T A;  1CF0 A;  2XEP A;  4R23 A;  3G4P A;  2IWD A;  1DP9 A;  2KLI A;  4E3L A;  2Z2L B;  1YLZ A;  3NI9 A;  3RXW A;  3VOY A;  4P6Z M;  1J9M A;  2WKE A;  4DXB A;  3BW6 A;  4JLF A;  3MJQ A;  2D02 A;  1IOU A;  2Q9M A;  4Y17 A;  1BT5 A;  3LID A;  2P9V B;  4E6W A;  5IS1 A;  4S2P A;  1ESI A;  2ZQ7 A;  1BUE A;  3WS1 A;  5FQM A;  3ZQ5 A;  2XGN A;  5E2F A;  3A3D A;  5FQJ A;  3H9W A;  1T1A A;  2VX8 A;  5HWT A;  4RX3 A;  1N9B A;  3G2Z A;  3DWZ A;  4ZJ3 A;  1W63 M;  3CAX A;  2R9W A;  1MXO A;  1UWN X;  3UB8 A;  3MSH A;  1K56 D;  1LI0 A;  4UQI S;  3IX3 A;  3NUL A;  1Z09 A;  3R4K A;  4R3B A;  4NET A;  1U60 A;  3N8S A;  1T18 A;  2FFF B;  3CLO A;  4GLQ A;  2Y2K A;  2X02 A;  4FOF A;  5F82 A;  3FPW A;  1E4D A;  3JYI A;  4QB8 A;  1UWP X;  3Q07 A;  3QP6 A;  1MC0 A;  1I2S A;  2W3F A;  1XPB A;  2JKT M;  1GHI A;  3CUE C;  1PZP A;  1E3U D;  3VOZ A;  1OPX A;  2PDR A;  3O5Y A;  4IBR A;  1ZG4 A;  4KQQ A;  3GQZ A;  4K0W A;  3HVF A; 
#chains in the Genus database with same CATH homology
 3W8K A;  4WM9 A;  3ISG A;  4LV3 A;  4CPK A;  2J7V A;  4EBN A;  1EI5 A;  2QMI A;  5AQ7 A;  5FA7 A;  1DJC A;  2I72 A;  3ZVT A;  5F1G A;  3G32 A;  1Z6F A;  3UY6 A;  4OLG A;  3HLW A;  4S2O A;  4N1X A;  5F83 A;  3VMA A;  4N9L A;  4O7D A;  1K56 A;  1C3B A;  1PWD A;  2Y2O A;  5FI6 A;  1XX2 A;  4GD6 A;  5M19 A;  3G2Y A;  3IF6 C;  3ZG0 A;  3IXB A;  1CEF A;  3G34 A;  3OPL A;  5CGX A;  4PM8 A;  1G68 A;  1FCO A;  3IF6 B;  3VFF A;  4IVI A;  4JF5 A;  3UNW A;  1GHM A;  4GD8 A;  5HAR A;  1CI8 A;  3FV7 A;  2HDR A;  3MBZ A;  4Y0U A;  1KGF A;  3E2K A;  3Q7V B;  4KZ9 A;  5AQ9 A;  2XFT A;  3M6B A;  1VQQ A;  5CGW A;  2XF3 A;  3HUM A;  4B4X A;  3OCL A;  3MFD A;  3LEZ A;  1NZU A;  2BLS A;  3MKF A;  3SS3 A;  5CGS A;  5FQQ A;  4GN2 A;  2V1Z A;  2XQZ A;  2FFY A;  4PM7 A;  3CZD A;  5DTS A;  4GDB A;  2OLU A;  1PYY A;  3WS2 A;  2P9V A;  3LY4 A;  4OLD A;  2OV5 A;  4DE3 A;  1BSG A;  2WYX A;  3W4P A;  3PBS A;  1FR1 A;  4WEL A;  4ZJ2 A;  4E3I A;  4JKT A;  4EBP A;  4JXW A;  1O07 A;  3PAE A;  2WZZ A;  4QY6 A;  4JPM A;  2G2U A;  2ZQD A;  4KZ7 A;  3ZVW A;  3DTM A;  3C5A A;  2ZM2 A;  3UE0 A;  3UO9 A;  4HBU A;  3N4I A;  1H5X A;  1YLY A;  1GA9 A;  4GB7 A;  5CER A;  3PBQ A;  3V3R A;  4B88 A;  2ZQ9 A;  4E3J A;  2WAD A;  5HW3 A;  2PU4 A;  1HTZ A;  2Q9N A;  4E3O A;  4KG5 A;  2H5S A;  3ZDJ A;  1CEG A;  4QJG A;  1W7F A;  1FSY A;  2ZLY A;  4OQI A;  3C7U A;  3MXS A;  3ITA A;  2Y55 A;  5TR7 A;  2EXB A;  4HES A;  4LV2 A;  5GHX A;  4MLL A;  3TG9 A;  3VP0 A;  1E25 A;  1HZO A;  1YQS A;  3OPH A;  1ZC2 A;  3PAG A;  1KE0 A;  4S2L A;  5AQA A;  3A3E A;  4BQM A;  1IYP A;  1WE4 A;  4L0L A;  5GLC A;  4LEN A;  2ZM8 A;  4BD0 A;  2PU2 A;  4OPQ A;  4OPZ A;  1W5D A;  4WBG A;  4P85 A;  1Y54 A;  3O86 A;  4Q8I A;  3BFC A;  3G31 A;  3C4P A;  3ZCZ A;  3ZNY A;  2RCX A;  2ZC7 A;  4KZ4 A;  3SH8 A;  2RL3 A;  3QHY A;  3HRE A;  4Y7P A;  1I2W A;  3IWO A;  3LO7 A;  1L0F A;  2EFX A;  4DE2 A;  2ZQA A;  1TVF A;  4DE0 A;  3CMZ A;  1QMF A;  4FCF A;  4JXV A;  4RA7 A;  3HLF A;  3GRJ A;  1IYO A;  5A91 A;  1PIO A;  3UE3 A;  4EUZ A;  1H8Y A;  1GA0 A;  1FCM A;  1XA1 A;  3BFE A;  3Q81 A;  4PM9 A;  3UPN A;  1NY0 A;  5KSH A;  1K57 A;  5FI7 A;  5F1F A;  5EVI B;  3VSK A;  1EWZ A;  4EWF A;  5G18 A;  4QY5 A;  5A92 A;  1LI9 A;  2C5W B;  2WAF A;  2V2F F;  5HL1 A;  1YMX A;  1ES2 A;  1N4O A;  2ZC5 B;  1KE3 A;  3N6I A;  2A49 A;  3BRM A;  1YLJ A;  1YLW A;  4OOL A;  1MWR A;  3ZG8 B;  3ZG5 A;  3FKW A;  1OME A;  2H0T A;  4MEZ A;  2H10 A;  4XUX A;  3BYD A;  3UDI A;  2JCH A;  3NIA A;  3BEB A;  3IT9 A;  1WYC A;  2E8I A;  1IYQ A;  2C6W B;  2Y4A A;  2XD5 A;  1RGY A;  3UN7 A;  4XXR A;  1VM1 A;  3AGF A;  3B3X A;  4UA6 A;  4UHU A;  4X6T A;  2BG1 A;  2HDQ A;  3BLM A;  3IF5 A;  4BLM A;  2EX6 A;  4GNU A;  5EE8 A;  4RVA A;  3WWX A;  4DF6 A;  4Y0T A;  4K0X A;  4U0X A;  3WRT A;  3VP3 A;  4S2J A;  1SDE A;  1NRF A;  1ERM A;  1YMS A;  5CHM A;  3HBR A;  2DRW A;  4KZ3 A;  3Q7Z A;  5GL9 A;  1PWG A;  2HP6 A;  4UA7 A;  3HL9 A;  2Y2G A;  1I5Q A;  1K54 C;  3HLE A;  4OP8 A;  3ZG7 B;  3NC8 A;  3GSG A;  5CEB A;  3WRZ A;  3NCK A;  4E3N A;  1BUL A;  3CJM A;  3DW0 A;  4X69 A;  1YLP A;  4DE1 A;  2OLV A;  2QZ6 A;  3IF6 A;  4JXS A;  1BLC A;  3NBL A;  4S2K A;  5E43 A;  5A90 A;  5HAI A;  3OPR A;  4S2N C;  5FI2 A;  5CRF A;  3PBT A;  4P87 A;  3Q7V A;  3SS5 A;  4D2O A;  3OCN A;  4C6Y A;  3BM6 A;  3ZNT A;  3N8L A;  3HLD A;  4HBT A;  4LV1 A;  4PPR A;  4WZ5 C;  4DXC A;  4E6X A;  4IED A;  3PBO A;  4KZ5 A;  4ZJ1 A;  1ES4 A;  3I7J A;  3M2J A;  1XP4 A;  4OOY A;  5CTN A;  3VFH A;  4LV0 A;  1JTD A;  4OP5 A;  1PWC A;  1IYS A;  2A3U A;  5HX9 A;  1ESU A;  3IXH A;  1FOF A;  3OZH A;  3WS0 A;  4DRT A;  3VP2 A;  1JWP A;  2ZC4 B;  4BL3 A;  2Y2J A;  5E2G A;  3ITB A;  1K6R A;  4GZB A;  3HLG A;  5DVA A;  2DNS A;  5CHJ A;  4X53 A;  4P6B A;  1ONH A;  4OQ0 A;  4PM6 A;  1BLH A;  3FZC A;  3BEC A;  1BLP A;  2Z2M B;  3A3F A;  1LL9 A;  1MWT A;  5FSR A;  3HUO A;  4E3M A;  4PM5 A;  2WKH A;  3N8R A;  1XGI A;  1PZO A;  3AGD A;  4H8R A;  3A3J A;  3C7V A;  4WYY A;  4FH2 A;  3QNC A;  4JXG A;  1GHP A;  1ZKJ A;  2Y91 A;  1K38 A;  1KVL A;  1ONG A;  2XH9 A;  5FQ9 A;  5FQK A;  4BJP A;  3IQA A;  2XR0 A;  3IXG A;  4WEK A;  3UE1 A;  3M6H A;  4Y0O A;  2OSU A;  1W8Q A;  5GLA A;  4KZA A;  4Z9Q A;  3PBR A;  5KZH A;  3TSG A;  4KQO A;  2EXA A;  2JC7 A;  3AGE A;  4OON A;  5DTT A;  2EX9 A;  3MKE A;  2WK0 A;  1XGJ A;  3S22 A;  5JYO A;  3CG5 A;  5DTK A;  2Y2L A;  4GDN A;  5CXW A;  4FH4 A;  2VGJ A;  5FQI A;  3E2L A;  1M40 A;  4DDS A;  4WEJ A;  1K4F A;  1IEM A;  1SKF A;  4R1G A;  2WGI A;  3SOI A;  4LCM A;  5DF7 A;  3C4O A;  5DF8 A;  5KSC A;  2Y2Q A;  3FKV A;  1KDS A;  4ZTK A;  2WGW B;  3Q1F A;  4KG6 A;  4DDY A;  2ZQ8 A;  1K25 A;  3NDG A;  4R0Q A;  4S2M A;  3W4Q A;  4OH0 A;  1IEL A;  3IWI A;  1DJA A;  3UPP A;  2XK1 A;  1K55 C;  3GR2 A;  3SH7 A;  1TDL A;  2VGK A;  2H0Y A;  2WZX A;  3V39 A;  4OQH A;  3FWL A;  2EFU A;  3LY3 A;  5D3O A;  1TDG A;  4X55 A;  5FAS A;  5EVI C;  2ZQC A;  3O87 A;  5I94 A;  4R4R A;  4NK3 A;  5DF9 A;  1PW1 A;  1TEM A;  2G2W A;  4A5R A;  1JTG A;  1H8Z A;  5U47 A;  2ZD8 A;  1GCE A;  1CI9 A;  4OQG A;  4F94 A;  2ZMA A;  4UAA A;  1XKZ A;  1PI4 A;  4KZ8 A;  1ES3 A;  4OOM A;  3MZE A;  1KGG A;  4YIN A;  2X01 A;  1KDW A;  3S4X A;  3D4F A;  3BLS A;  1YM1 A;  4IBX A;  3RJU A;  4B4Z A;  1RP5 A;  1JWZ A;  5EOE A;  2QPN A;  3GTC A;  3IXD A;  5EUA A;  1AXB A;  4ID4 A;  1W8Y A;  2HDU A;  3A3I A;  3NY4 A;  2V20 A;  4QU3 A;  2ZM0 A;  4R3J A;  4BEN A;  3MXR A;  1Q2P A;  2HPB A;  1IKI A;  1CK3 A;  1PI5 A;  1L0E A;  4R4S A;  1ERQ A;  2IWC A;  5FAP A;  3EQV A;  3M2K A;  1NJ4 A;  4C75 A;  4KZ6 A;  3MZF A;  1K54 A;  4MBF A;  1HD8 A;  5L2F A;  4K91 A;  1XA7 A;  2P74 A;  3WS5 A;  3IWQ A;  3QNB A;  3P98 A;  1KE4 A;  4P0M A;  4GOG A;  1NXY A;  4KQR A;  5EVL A;  5GLD A;  5J8X A;  1FQG A;  4JBF A;  4S2N A;  1ES5 A;  1L0D A;  4OPY A;  5FDH A;  5GHY A;  4RYE A;  1MWU A;  2XLN A;  3VP4 A;  2B5R A;  1FCN A;  4PMA A;  5GHZ A;  4N1H A;  4WZ5 A;  2DCF A;  1YLT A;  2Y2I A;  3ZHH A;  5HAP A;  1NYY A;  5E2E A;  3W4O A;  4WMC A;  3ZGA B;  4BD1 A;  4UA9 A;  3O88 A;  3HUN A;  1SDN A;  2EX8 A;  4EQI A;  5BOH A;  5JYP A;  2XDM A;  5TFQ A;  3WS4 A;  5FAO A;  3VP1 A;  2J9P A;  3HLB A;  5EVI D;  3BFG A;  1KVM A;  1ZG6 A;  3SS4 A;  4JF4 A;  3UPO A;  3O3V A;  1DY6 A;  1SCW A;  2HP5 A;  5TGF A;  1MKI A;  5GLB A;  1O7E A;  1RCJ A;  1JVJ A;  2Y2P A;  4OVD A;  4U3T A;  1MY8 A;  4LCL A;  2XEP A;  3UDF A;  4R23 A;  1HVB A;  1M6K A;  2IWD A;  3G4P A;  3LCE A;  3FYZ A;  3NDE A;  1S0W A;  4E3L A;  1K4E A;  2Z2L B;  4N92 A;  1YLZ A;  3NI9 A;  3RXW A;  3VOY A;  1WYB A;  5IHV A;  1LL5 A;  2WGV A;  1FSW A;  1J9M A;  2WKE A;  4DXB A;  1Q2Q A;  4KZB A;  3DWK A;  4JLF A;  5CED A;  5HFO A;  2R9X A;  3IH8 A;  2EX2 A;  1G6A A;  5FAQ A;  1YT4 A;  3V5M A;  2XFS A;  4ZBE A;  4S2I A;  2Q9M A;  1BT5 A;  4ZDX A;  2J8Y A;  4JF6 A;  3ZFZ A;  3P09 A;  1JWV A;  5M18 A;  5EOO A;  2WGW A;  1BZA A;  2P9V B;  1E3U A;  5AQB A;  4E6W A;  2ZC6 B;  1W79 A;  4S2P A;  1ESI A;  2ZQ7 A;  4N9K A;  3ZG9 B;  4RX2 A;  3GVB A;  3TOI A;  5CHU A;  3GMW A;  1BUE A;  4C3Q A;  3WS1 A;  1BLS A;  5FQM A;  4ZAM A;  2GDN A;  2Y59 A;  3BFF A;  3UDX A;  2XGN A;  3G35 A;  5E2F A;  3A3D A;  4EV4 A;  5FQJ A;  1K55 A;  1NZO A;  3HLC A;  3PBN A;  1ERO A;  4WMC D;  4X68 A;  4GKU A;  3Q82 A;  4FSF A;  1S6R A;  4RX3 A;  1N9B A;  3G2Z A;  5EVI A;  4M3K A;  1L2S A;  2JBF A;  3DWZ A;  1SHV A;  2J9O A;  4ZJ3 A;  3GV9 A;  4OPR A;  3OC2 A;  2R9W A;  5KMW A;  1MXO A;  2X71 A;  5FAT A;  1PW8 A;  3S1Y A;  4KEN B;  4U0T A;  1K56 D;  2ZC3 B;  1LI0 A;  4MNR A;  3V3S A;  4YFM A;  2WKI A;  5CEC A;  5A93 A;  1MBL A;  2Y2H A;  5CTM A;  1MWS A;  2HP9 A;  2JE5 A;  4R3B A;  4CJN A;  4FD8 A;  3IHA A;  2PBY A;  1U60 A;  4NET A;  3EQU A;  4MBH A;  4X56 A;  1FR6 A;  3N8S A;  1BTL A;  5HAQ A;  2FFF B;  3BFD A;  2Y2M A;  2Y2K A;  1DJB A;  1LLB A;  2Y2N A;  1IKG A;  2UWX A;  5E2H A;  2IWB A;  3V50 A;  1QME A;  1L0G A;  4EBL A;  2X02 A;  1LHY A;  5F82 A;  1E4D A;  3IH9 A;  1NYM A;  1ALQ A;  4QD4 A;  4QHC A;  1K57 C;  2CC1 A;  3JYI A;  4IVK A;  4QB8 A;  4DKI A;  3Q07 A;  4E3K A;  3SH9 A;  5M1A A;  3N7W A;  3MZD A;  1MPL A;  4WZ4 A;  3G30 A;  1K6S A;  1I2S A;  1XPB A;  4BL2 A;  3PTE A;  4XUZ A;  3RXX A;  4KG2 A;  1RGZ A;  1GHI A;  1PZP A;  1E3U D;  1XXM A;  3VOZ A;  5EPH A;  3OPP A;  3VSL A;  2HDS A;  5EEC A;  2WUQ A;  3IHB A;  4IBR A;  4OKP A;  4MBK A;  1ZG4 A;  4KQQ A;  4HEF A;  1KGE A;  2WAE A;  3GQZ A;  2XD1 A;  2ZJ9 A;  4K0W A;  3HVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...