5KSCA

E166a/r274n/r276n toho-1 beta-lactamase aztreonam acyl-enzyme intermediate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kscA00
3WRTA 2DNSA 2X02A 4YFMA 1K4FA 3IH9A 2RL3A 3DWKA 4S2KA 3SOIA 4KG5A 1KDSA 4IEDA 1DJAA 4O7DA 1K55A 4P85A 1KDWA 1RCJA 5CTNA 1ES3A 3OC2A 1SHVA 4R4SA 5GHZA 5DF8A 1E3UA 1XX2A 4N92A 2ZQ8A 1S0WA 5FSRA 4EWFA 3PBRA 4WMCD 2HP9A 4R4RA 3VP0A 5HAPA 1H8ZA 4JLFA 3G30A 1YLJA 5JYPA 3NI9A 1FCOA 2G2UA 3HUMA 4N9KA 2IWBA 4FD8A 4KZAA 2HP6A 5TR7A 3A3DA 2WK0A 3N7WA 4S2JA 4YINA 4E3JA 5M18A 1GHPA 2BG1A 3Q7ZA 1XPBA 1LI9A 3MXSA 3ZVWA 3PBTA 4XXRA 1ZG6A 1MWTA 1Y54A 3M2JA 1SDEA 3ZG7B 4QU3A 3M6HA 1K56A 3IXBA 4QD4A 5HARA 3ZVTA 2HDRA 1FCNA 1IYPA 3OCLA 2X01A 4PM9A 5TFQA 5CGSA 4DXBA 5DTKA 5F1GA 5J8XA 1SDNA 2Y2HA 5KSHA 3GRJA 4GB7A 5HL1A 5F83A 4MBFA 4MNRA 4Y0TA 3HL9A 4DXCA 1JWPA 5E2FA 5FQ9A 5FQQA 4S2MA 5CERA 1MWUA 2EXAA 4WZ5C 3ITBA 2WUQA 4Y0OA 1JWVA 1YQSA 2ZD8A 3BRMA 1O7EA 1KE3A 3FWLA 4U0XA 1W7FA 1XGIA 3IXHA 5IHVA 1XGJA 1FOFA 2R9WA 1LLBA 2A3UA 3QNCA 5DF7A 3OZHA 1ZC2A 2OV5A 1PI4A 1YT4A 3S4XA 1IYQA 4C3QA 1C3BA 4ZJ3A 4B88A 5FA7A 3GV9A 5D3OA 4ZJ1A 2Y2OA 4OOMA 1CI8A 1MY8A 3IXDA 4X6TA 4EUZA 3V50A 5BOHA 3VP4A 4KZ5A 4WZ4A 5CHMA 2HDQA 2HDUA 1K54A 2XR0A 4B4XA 4OPYA 4E3LA 4R3JA 4OQ0A 1ERMA 3W4PA 2JC7A 4X53A 1BSGA 1LL5A 3N8LA 4WELA 4LV3A 4KG2A 3OPHA 4BD0A 1PW1A 3PTEA 3BM6A 3LEZA 3IF6A 3MZDA 4P0MA 4X55A 2EX6A 3M2KA 2EXBA 5CRFA 3P09A 3G32A 4P6BA 5I94A 4HESA 1WYCA 3FKVA 1QMEA 4C75A 2ZC7A 3TSGA 2OLVA 2UWXA 2ZLYA 1KGGA 3LY4A 3MXRA 3AGEA 3NIAA 4OOLA 1FQGA 5CGWA 1M6KA 2H0TA 1LHYA 3Q81A 1K57C 3N8RA 1H5XA 1AXBA 3FKWA 1XA1A 1I5QA 3BFFA 1VM1A 4N1XA 4OP5A 1DJBA 2Y2NA 4ZBEA 5M19A 2WZXA 1FSYA 4JF4A 5FATA 4M3KA 3IWOA 3ZG5A 3D4FA 5FI7A 3VSLA 4WEKA 5EVIC 3BLSA 3LO7A 5GLAA 1YLZA 2WZZA 3WS1A 3BECA 4KZBA 3ZNTA 4Q8IA 1KGEA 4S2PA 3BYDA 3HLBA 4OPQA 3DW0A 3VFFA 2WKHA 5U47A 2C6WB 4PM7A 3IQAA 3VFHA 2ZC6B 1MPLA 3SS5A 3G2ZA 2GDNA 4JXWA 1NYYA 4IVIA 4DE2A 1K55C 3E2KA 3WRZA 4H8RA 2Y2JA 3S22A 2ZMAA 5CEBA 1GA0A 4KZ8A 4OLGA 3V39A 5EOEA 3HUNA 1XA7A 2Y59A 3GSGA 3E2LA 5DF9A 3CJMA 5EVLA 1ZKJA 1IEMA 5F82A 4E3KA 4D2OA 3IT9A 4DDYA 3G31A 3EQUA 2XQZA 3WS4A 2JBFA 3HUOA 3ZG9B 1YLPA 1ES2A 4BQMA 4KG6A 4U0TA 3HBRA 3RXXA 3PBQA 1BUEA 3G34A 3O87A 3OPPA 1IKIA 3IWQA 2Y55A 1BULA 3BFCA 4GNUA 5KZHA 5AQBA 3VSKA 2J9PA 4E3NA 2XF3A 2XFTA 4KZ9A 1GA9A 1S6RA 3AGDA 2X71A 5HAQA 1MWSA 5A93A 3LY3A 1HZOA 5CHUA 5EVID 3MZFA 3IHAA 1BT5A 1EWZA 1TVFA 3QNBA 4JF5A 5HW3A 1I2SA 4NK3A 5DVAA 5GLDA 4EQIA 4S2IA 4FH4A 1BLCA 3G4PA 4GZBA 4QHCA 4FH2A 1XP4A 4KQOA 3QHYA 3B3XA 3IH8A 3RXWA 4ZTKA 2WAFA 2ZM2A 3FV7A 3ZGAB 1E3UD 1PI5A 3Q07A 4HBUA 4BL2A 1KGFA 4OP8A 3LCEA 2EX9A 4BENA 2WAEA 1YM1A 1WYBA 4CJNA 1PIOA 4UA9A 4N1HA 3UO9A 2XH9A 1MBLA 3NDGA 4IBRA 3BFEA 2WGWB 4Z9QA 5EUAA 1L0DA 2WGWA 3NCKA 2DRWA 1MKIA 4DE0A 2Y4AA 4GDBA 1ONGA 2XLNA 1NYMA 1TDLA 3SS4A 1K54C 1BZAA 4OQIA 4R23A 1PZOA 2Y2IA 1M40A 5EE8A 1W5DA 3MBZA 4DF6A 5FAPA 1E4DA 5CXWA 3RJUA 5JYOA 1K6SA 4GD8A 1W8YA 3N4IA 1KVMA 2J8YA 4OOYA 1K56D 3W4QA 3V3RA 2WKIA 4OKPA 2ZM0A 5GHXA 4OLDA 4HEFA 3UDXA 2ZC3B 1RGZA 3IF6C 2Z2LB 3V5MA 4DRTA 2ZM8A 3AGFA 2Y2PA 4PM8A 4MEZA 3PBOA 3VOYA 1K4EA 3GQZA 5DTSA 4LV0A 1YLYA 3PAEA 2I72A 2J7VA 5E2HA 3O3VA 2R9XA 3C4PA 4KQRA 3NC8A 4JKTA 4DE3A 3PBNA 1YLTA 3OCNA 3Q82A 1GHMA 1BTLA 4K0WA 3UN7A 1K25A 3WS5A 5CECA 1IELA 2ZQDA 5FI6A 3UE0A 2V1ZA 3A3JA 3N6IA 2VGJA 3EQVA 3GTCA 4GD6A 4P87A 2G2WA 4OQHA 2ZJ9A 4GOGA 3UE3A 4A5RA 4L0LA 5FQJA 4E3IA 4PM5A 1NXYA 4GN2A 2OSUA 2WGVA 3OPRA 3O88A 4ID4A 2ZQAA 4CPKA 4WEJA 3HLCA 1MXOA 3A3EA 5FAOA 3UDFA 2EFXA 5GL9A 1JTDA 3FYZA 4PM6A 4KQQA 4WYYA 1BLPA 4BLMA 2ZQ9A 1KVLA 1Z6FA 3G35A 2ZQ7A 1NRFA 1PZPA 4E3OA 1YMSA 3BEBA 2CC1A 3ITAA 5EECA 1FR6A 5E2EA 4WMCA 2ZC4B 2Q9MA 3ZG0A 3MKFA 4JF6A 3ZNYA 4UA6A 2PU4A 3C5AA 4RX2A 3TOIA 3ZDJA 1YMXA 3GR2A 1NZUA 2JCHA 4XUZA 3BLMA 3HLDA 4MBKA 4ZAMA 4EBLA 1BLHA 1FR1A 2H5SA 3ZG8B 3WWXA 2HP5A 1ESUA 4S2NA 2J9OA 1BLSA 1N4OA 2Y91A 4JPMA 5FASA 3UPOA 5EVIB 1PYYA 4X56A 3W8KA 4OONA 2Y2MA 3UE1A 3ZHHA 2XGNA 3A3FA 4B4ZA 1SCWA 2QMIA 2C5WB 2XDMA 5GLBA 1RGYA 3SS3A 2B5RA 3UPNA 1FCMA 4LCMA 2Y2QA 5EOOA 3V3SA 3WS2A 1HVBA 4E6WA 5A90A 2ZC5B 3IF5A 2HPBA 5FI2A 4R1GA 5CGXA 2FFFB 3BFGA 4DKIA 5HAIA 3NBLA 3ZCZA 3UNWA 4FSFA 4Y0UA 1HD8A 4DDSA 3OPLA 4LV1A 5E43A 5AQAA 5FQIA 1TDGA 1J9MA 2Y2GA 1Q2PA 1GHIA 1PWCA 5KMWA 4RVAA 4JXGA 2EFUA 3O86A 3FZCA 1Q2QA 2QPNA 3G2YA 4RA7A 4BJPA 4EV4A 5GHYA 1DJCA 1G68A 3I7JA 3UY6A 4QJGA 3SH7A 3ZFZA 2XFSA 4XUXA 3PAGA 1PWGA 4JXVA 4PPRA 2Y2LA 1L0EA 4QY5A 1QMFA 1W79A 1ZG4A 4KZ6A 2A49A 4QY6A 2EX2A 1PW8A 3MKEA 4RYEA 3S1YA 5A91A 3IWIA 3HVFA 4DE1A 4IBXA 4PMAA 3ISGA 2WYXA 1PWDA 3BFDA 4GKUA 2Y2KA 3CMZA 3SH9A 2E8IA 2IWDA 5FAQA 4S2LA 2IWCA 4WBGA 4FCFA 4OQGA 1NZOA 1ES4A 1VQQA 3C7UA 4X69A 1O07A 5FDHA 5HFOA 1CEFA 2XEPA 5FQKA 4LCLA 4MLLA 3UPPA 4EBNA 2OLUA 3C4OA 4GDNA 5DTTA 1EROA 5E2GA 5GLCA 5A92A 4WZ5A 4R3BA 4KZ7A 2FFYA 4OH0A 1XKZA 4IVKA 2EX8A 4JXSA 3M6BA 1CEGA 1ES5A 3N8SA 2QZ6A 2WKEA 4KENB 5CEDA 1SKFA 3IHBA 1GCEA 1ALQA 5HX9A 1ERQA 3VP3A 3VP2A 1K6RA 4BD1A 1MWRA 2V2FF 2VGKA 3JYIA 4BL3A 4Y7PA 1ESIA 5EPHA 3SH8A 4RX3A 3VOZA 4OPZA 4K91A 1JVJA 1KE0A 1NJ4A 4LV2A 4JBFA 1XXMA 3P98A 4ZJ2A 3Q7VB 1LI0A 3Q7VA 2P74A 3UDIA 3NY4A 1E25A 1DY6A 1YLWA 1K38A 4KZ4A 4E3MA 4F94A 3VMAA 4KZ3A 1H8YA 4HBTA 1HTZA 3IF6B 2WGIA 5M1AA 1CI9A 2HDSA 3TG9A 4X68A 2V20A 2XD1A 5TGFA 1WE4A 1I2WA 1L2SA 2H0YA 2XK1A 1U60A 3Q1FA 2RCXA 3HLWA 4MBHA 3HLGA 3PBSA 3A3IA 3W4OA 3WS0A 4E6XA 5KSCA 2PBYA 2Z2MB 3HLEA 1LL9A 4OVDA 3MFDA 4U3TA 4QB8A 1IYSA 1L0FA 3DWZA 5CTMA 2JE5A 3NDEA 4K0XA 1NY0A 1CK3A 3C7VA 2ZQCA 5AQ7A 5AQ9A 1OMEA 5F1FA 2H10A 5FQMA 1K57A 3CZDA 4UHUA 2P9VB 1RP5A 4LENA 4NETA 1IYOA 2P9VA 4UA7A 2WADA 1L0GA 1KE4A 4EBPA 4S2NC 3DTMA 2PU2A 2XD5A 4C6YA 1EI5A 3VP1A 1W8QA 3IXGA 1N9BA 3MZEA 1ONHA 2Q9NA 2DCFA 3GMWA 1JWZA 3GVBA 4UAAA 5EVIA 2BLSA 1FSWA 1TEMA 3HLFA 4R0QA 5G18A 1G6AA 1IKGA 4OPRA 3CG5A 1JTGA 3HREA 4N9LA 4WM9A 5CHJA 4S2OA 4ZDXA 5L2FA
chains in the Genus database with same CATH superfamily
3WRTA 2X02A 2RL3A 3DWKA 2XA7S 2PT7A 1PFLA 4P85A 1Y4OA 1ES3A 1P9RA 4LRYC 2WKQA 2JKRM 5LBRA 3VP0A 5HAPA 3HUMA 5F6AA 4NG2A 4FD8A 3N7WA 5A8BA 1XPBA 3PBTA 1ZG6A 1Y54A 4Q0JA 3ZG7B 3B33A 3BQ8A 4QD4A 3P01A 1FCNA 3F1OA 1FILA 5J4EA 4PKYG 5TFQA 1CF0A 4Q0HA 5J8XA 1SDNA 3GRJA 5HL1A 5F83A 4MBFA 4Y0TA 3HL9A 4DXCA 1SKOB 5E2FA 5FQQA 4S2MA 1MWUA 1JWVA 2ZD8A 5IHVA 4LRXC 4ZJ3A 4ZJ1A 4L9GA 4OOMA 4EUZA 2WKRA 5CHMA 1H3QA 2HDQA 4E3LA 4ETZA 4L9EA 3MSHA 3N8LA 4KG2A 1UWPX 2O99A 3BM6A 1W63Q 3IF6A 3LEZA 2ACGA 2EX6A 3T12B 4P6BA 4HESA 1FIKA 3QP8A 4GHIA 3S7QA 1KGGA 3LY4A 3LR4A 3NIAA 2J80A 3IS2A 1FQGA 5CGWA 1N9NA 1AXBA 3FKWA 4OP5A 1DJBA 2Y2NA 5L07A 1VETB 5L09A 4JF4A 5FATA 1OTDA 3LICA 2CMNA 1N9LA 1YLZA 2V8FA 4Q8IA 3U2AA 5HWTA 4CLCD 4IVIA 3E2KA 3PYPA 4H8RA 3OLOA 3HUNA 1MC0A 2Y79A 4JGQA 1ZKJA 4E3KA 4I39A 2PYRA 3IT9A 4DDYA 4Y2FA 3LR5A 3LIBA 1DP9A 3PBQA 1IKIA 2OAQ1 5KZHA 2JKFA 3LY3A 4YNRA 4D60A 5A93A 4HNBA 1BT5A 3LGOA 3BY8A 4II7A 5L10A 2R78A 1I2SA 4NK3A 4EQIA 4BMWA 3T4KA 3FV7A 2XA7M 1WYBA 1PIOA 4UA9A 4N1HA 2Q0OA 2WGWB 4Z9QA 5EUAA 3NCKA 3E0YA 3T1RA 2W1RA 1S66L 2L0WA 2WKPA 1E4DA 2WKIA 2ZM0A 1G6OA 3LI9A 2ZC3B 3IF6C 2ZM8A 4PM8A 3ICYA 2W3FA 3C2WA 4MEZA 4O8GA 3PBOA 3UB5P 1K4EA 3PAEA 2J7VA 5E2HA 2R9XA 3C4PA 4KQRA 3NC8A 4DE3A 3PBNA 3JVVA 3Q82A 1GHMA 3O5YA 1IELA 3DTIA 2ZQDA 2QJ5A 4NXBA 3N6IA 2VGJA 4GD6A 2L1MA 3LR3A 5FQJA 3PR6A 2OSUA 4PM6A 3BY9A 1Z6FA 3G35A 3BEBA 1OJGA 1FR6A 5J7EA 4WMCA 3ZNYA 5KIZA 3ZDJA 1NZUA 3BLMA 3MMHA 3HLDA 2ZMVA 4MN7A 4EBLA 1BLHA 2PYPA 4F3LB 4S2NA 2Y91A 5AVFA 4AFIA 4X56A 4OONA 3GECA 1VEUB 1SCWA 5F68A 3SS3A 2OWHA 4QWOA 3UNWA 4FSFA 4Y0UA 4LV1A 1TDGA 2Y2GA 1OPXA 1OTAA 3T50A 4JXGA 2EFUA 3LR0A 1G68A 1OTBA 4PPRA 4QY5A 1QMFA 2A49A 5DKLA 2EX2A 1PW8A 3IWIA 3F1OB 2PDRA 1PWDA 2WYXA 3TJZC 2K7SA 3CMZA 3CAXA 4GW9A 5FAQA 1V9YA 4DJ3A 1ES4A 1VQQA 2VV7A 4X69A 3E4OA 1O07A 5HWVA 1CJFA 5HFOA 1CEFA 4EBNA 3KYEA 3QP4A 5GLCA 5A92A 1LSWA 4WZ5A 1XKZA 1ES5A 4R6LA 3IHBA 5HDSA 1GCEA 5HX9A 1ERQA 1NWZA 4BD1A 2VGKA 3C30A 1ESIA 1Y28A 4HJ3A 3SH8A 2QHKA 1NJ4A 4LV2A 1DP6A 3T4LA 4JBFA 1DY6A 1YLWA 4E3MA 2B02A 1HTZA 3IF6B 5TGFA 2XK1A 1U60A 3MQOA 4CLCE 1G28A 3PBSA 4E6XA 2VX8A 5KSCA 2PBYA 3HLEA 1TD5A 4OVDA 1OJ5A 4Q0IA 3K3CA 3UMEA 3P7NA 1CK3A 2ZQCA 3LIAA 5AQ7A 4I3IA 3D3OA 1K57A 4LENA 4UA7A 4EBPA 2WADA 4S2NC 3RH8B 3DTMA 4C6YA 2VLGA 2PD8A 3IXGA 1N9BA 3BQAA 3GMWA 5FEGA 4DMZA 2BLSA 2GNXA 4OPRA 4NXEA 5CHJA 3IH9A 3SOIA 4KG5A 1DJAA 4O7DA 1K55A 1KDWA 4R38A 1T19A 5GHZA 4R4SA 4B9OA 5DF8A 1XX2A 5FSRA 4EWFA 4WMCD 2HP9A 2ZL1A 5JYPA 3NI9A 3E4PA 3UE6A 3KX0X 4KZAA 1UGUA 2YKHA 4S2JA 4YINA 3MXSA 3LI8A 3IXBA 4NEED 5HARA 3ZVTA 2O9BA 1IYPA 3OCLA 2X01A 5MC7A 4PM9A 3FPWA 5DTKA 5F1GA 4IUKA 5KSHA 4GB7A 5FQ9A 5I5LA 3CPTA 2EXAA 4WZ5C 4CQHA 3BRMA 1XJ3A 4U0XA 1KE3A 1W7FA 4LRZE 3QNCA 1WA9A 3OZHA 2OV5A 1PI4A 4C3QA 2W3DA 1IYQA 1C3BA 2OWJA 2M7UA 2Y2OA 1MY8A 1S1YA 3IXDA 4X6TA 4KZ5A 4WZ4A 2HDUA 1K54A 2XR0A 4B4XA 3W4PA 3VE3A 2JC7A 1BSGA 4WELA 2P04A 4P0MA 5CRFA 3P09A 3QP2A 3U4LP 5IS1A 3NULA 1WYCA 3FKVA 4HY8A 2ZLYA 1D7EA 2PR5A 2H0TA 1K57C 3N8RA 1I5QA 1VM1A 4N1XA 5M19A 1FSYA 3UB7A 4M3KA 1F9IA 3E4QA 4QPRA 4EU0A 4I38A 4EESA 3BLSA 3LO7A 2V1BA 5DFXA 4S2PA 4EW7A 2WKHA 5U47A 2ZC6B 2GDNA 1NYYA 4DE2A 1K55C 4K08A 1T18A 3NHQA 2QWSA 5EOEA 1XA7A 2Y59A 4YOFA 3GSGA 5DF9A 3CJMA 1T1AA 1IEMA 4JGOA 2JKTI 2W3EA 2JBFA 2E8JA 2JKTM 4X25A 3MF0A 4KG6A 3LFVA 3IWQA 4GNUA 1GA9A 2X71A 1MWSA 1HZOA 3FG8A 3IHAA 5TBMA 3ZYTA 4JF5A 3CWFA 1N9OA 1BLCA 3G4PA 4QHCA 1D1JA 3H7WA 1PNEA 3A0VA 3CUEA 4ZTKA 4OP8A 4BENA 2P08A 2WAEA 1S4SA 2KX6A 4HP4A 3NDGA 1YPRA 1L0DA 2Y4AA 1TDLA 3SS4A 1K54C 1M40A 5FAPA 5EV0A 1KVMA 3W4QA 3V3RA 4OKPA 2EWVA 4X1MA 4LV0A 1YLYA 4CLCC 3CI6A 2G7UA 3MJQA 3PXPA 3OCNA 4UQIS 5CECA 3JVUA 3WS5A 3CLOA 3CITA 1TS6A 3A3JA 2PD7A 5IU1A 3GTCA 3TE8A 4P87A 2G2WA 4OQHA 3UE3A 4PM5A 3OPRA 3O88A 4G3WA 2ZQAA 1MXOA 2EFXA 1JTDA 4BBVA 2ZQ7A 1T1BA 2QYBA 1PZPA 4E3OA 1YMSA 3S7OA 3MKFA 4JF6A 1AWIA 1YMXA 4ZAMA 1FR1A 2H5SA 3ZG8B 1ESUA 1BLSA 3MXQA 3UPOA 3NOPC 3W8KA 2XGNA 4FTXA 2C5WB 3MQ0A 1RGYA 2VEAA 4MN6A 5EOOA 3V3SA 4E6WA 5A90A 3IF5A 3T1XA 2HPBA 5FI2A 4R1GA 5HAIA 3ZCZA 4X1LA 4DDSA 3IX3A 3OPLA 5AQAA 5FQIA 3G6OA 1GHIA 4JGPA 5KMWA 2EWWA 3FZCA 3CUEC 1LSXA 5K5BA 3I7JA 3E98A 5CX7A 3PAGA 1TS0A 4KZ6A 5FDSA 4RYEA 3S1YA 3HVFA 3LIDA 4DE1A 5IT5A 3ISGA 3BFDA 2IWCA 3LIEA 4FCFA 4OQGA 1XFQA 2W1TA 3CPTB 5FDHA 4LCLA 2OLUA 4GDNA 3F1NA 1EROA 5E2GA 4R3BA 2FFYA 3LIFA 2EX8A 4JXSA 3BW6A 3MQQA 3PHYA 2QZ6A 3HJKA 1SKFA 4XT2A 2HJEA 3VP3A 1K6RA 2V2FF 4Y7PA 5HPFA 3R4KA 4UEYA 4K91A 1GSVA 2ZOHA 1JVJA 5DKKA 3P98A 4ZJ2A 3Q7VB 3VMAA 2NUTC 4HBTA 1XJ6A 2WGIA 3FC7A 4X68A 2XD1A 1L2SA 4KUKA 2RCXA 3HLWA 2ZMFA 4MBHA 4CLCB 3A3IA 2ZBBA 3T1SA 2PR6A 1IYSA 1L0FA 2VZWA 3OBFA 3DWZA 5CTMA 4K0XA 1NY0A 1DRMA 3V67A 5F1FA 4B93A 1IYOA 2P9VA 1KE4A 3KSFA 2MJ6A 3VP1A 2Q9NA 2DCFA 4UQIM 4HH2A 1D06A 1X0OA 3DAVA 2VA0A 2VGLS 3HLFA 1MKMA 3T4QA 3K3DA 1IKGA 1JTGA 4BBTA 5HWWA 4WM9A 4ZDXA 5L2FA 3MS6A 1KDSA 4P6ZS 1RCJA 5CTNA 3D72A 1BYWA 2ZQ8A 1S0WA 3PBRA 4JLFA 5HDCA 1FCOA 2G2UA 1H0MA 2PRFA 2HP6A 3A3DA 4E3JA 2XSSA 1GHPA 4HJ6A 5HD5A 1OTEA 3NOTC 3EGXC 2O9CA 1LI9A 4XXRA 1MWTA 3M2JA 1SDEA 3M6HA 1K56A 2HDRA 3H9WA 5AVEA 2Y2HA 4PAUA 4MNRA 1JWPA 1SKOA 2M1CA 4GJ4A 1ZTUA 3ITBA 4Y0OA 1O7EA 3FWLA 2W27A 1XGIA 4Z1WA 1FOFA 2A24A 5DF7A 2A3UA 4YWZA 1YT4A 4B88A 2AVXA 2INWA 5FA7A 5D3OA 2JHEA 5BOHA 4R3JA 4OQ0A 3T4TA 1ERMA 1LL5A 3OPHA 1PW1A 4R70A 3M2KA 4I3AA 2EXBA 1H8MA 3G32A 5I94A 4C75A 4GHIB 2ZC7A 3TSGA 2OLVA 1P0ZA 4WL9A 3IS2B 4OOLA 3F1PA 5HPIA 1LHYA 3Q81A 1H5XA 2BASA 4ZBEA 5FEFA 2VJWA 2WZXA 3TRCA 1VETA 3IWOA 2W3HA 5FI7A 3VSLA 2W0NA 5GLAA 2EA9A 3BECA 3MFXA 4HP9A 4KZBA 1CQAA 1KGEA 3BYDA 3HLBA 2B18A 1V9ZA 3DW0A 3VFFA 4R3AA 2C6WB 3IQAA 3NJAA 3VFHA 3S22A 4KZ8A 3V39A 4OLGA 5FL3A 2JKGA 3E2LA 4D2OA 2Y8HA 3G31A 3EQUA 2XQZA 3WS4A 1ES2A 4BQMA 4U0TA 2VK3A 3K2NA 1BUEA 3G34A 1BULA 3BFCA 5AQBA 4E3NA 2J9PA 2XFTA 5HAQA 2B95A 2FZ0A 2VV6A 5CHUA 2V1AA 3EWKA 2Z6DA 2FH5A 4GLQA 4ME4A 2VGLM 3JPUA 5DVAA 4ZRRA 4GS9A 2O0YA 5GLDA 2W3GA 4S2IA 2D01A 5HDDA 4FH2A 1XP4A 2OOLA 3FPVA 4KQOA 3QHYA 3B3XA 3IH8A 3RXWA 4Y3IA 2ZM2A 4HBUA 2DMWA 3LCEA 4P6ZM 1YM1A 5EM0A 4Y17A 1EW0A 2WGWA 4DE0A 1ONGA 2XLNA 1NYMA 1YSPA 1HLUP 4R23A 5HZHA 2W1TB 2Y2IA 1W5DA 4DF6A 3RJUA 3C8CA 4GD8A 1W8YA 2PBDP 3N4IA 3F1NB 1K56D 3T4JA 4HIAA 1YSQA 1NLYA 1RGZA 3LYXA 2Z2LB 3V5MA 4DRTA 3AGFA 2JN7A 1S67L 4DJ2A 4XT2B 2I72A 2VV8A 2OAP1 4PKYA 1BTLA 4K0WA 3UN7A 2K31A 4M4XA 1OTIA 3MR0A 3QP6A 4I3JA 3UE0A 2V1ZA 1ZHHB 1L3LA 4IHQA 2ZJ9A 4GOGA 4E3IA 2HF6A 2QKPA 1PRQA 4CPKA 4WEJA 3HLCA 5FAOA 5GL9A 1P9WA 1OT6A 4KQQA 1BLPA 1GSXA 4WYYA 4BLMA 1KVLA 3CHWP 1NRFA 3ITAA 5E2EA 2ZC4B 2Q9MA 1LT0A 5F69A 3T4SA 3ZG0A 3L9KA 4UA6A 4RX2A 1DP8A 2JCHA 4XUZA 4MBKA 3WWXA 2J9OA 5FASA 2HZ5A 4KUOA 2K2NA 3T1QB 2QMIA 1LL8A 1Z09A 2B5RA 1KOUA 3UPNA 3WS2A 2Y2QA 1HVBA 1YKDA 1F2KA 2ZC5B 3S7PA 3ULFA 5CGXA 4EERA 3BFGA 4DKIA 2JKRI 3VV4A 5E43A 1J9MA 1Q2PA 4EUVA 1PWCA 1P97A 1Q2QA 4RA7A 4BJPA 3SH7A 3ZFZA 3UB9A 4XUXA 1PWGA 4JXVA 1L0EA 1W79A 1ZG4A 4LFUA 3MKEA 2KDKA 4IBXA 4GKUA 5HSQA 3SH9A 2E8IA 4S2LA 4EQ1A 1NZOA 3R7WA 4LLOB 4MLLA 3BWLA 3C4OA 5DTTA 5EM1A 4H6JA 4KZ7A 1A0KA 4OH0A 2A24B 3KO6A 4I5SA 4IVKA 1CEGA 1TS7A 2WKEA 3VP2A 4BL3A 5EPHA 1IFQA 4RX3A 3VOZA 1MZUA 3IBJA 1LI0A 3UDIA 2P74A 1GSWA 4PHTA 1K38A 3H82A 1LSVA 2HDSA 2V20A 1WE4A 1I2WA 2LB5A 3Q1FA 2L4RA 3W4OA 1LL9A 3DTKA 4U3TA 4QB8A 3F1PB 3QP1A 4WN5A 5AQ9A 1OMEA 4HHDA 2KLIA 2H10A 4ETXA 4NETA 1L0GA 3NOUC 2PU2A 2XD5A 1NLZA 3MZEA 1ONHA 5EVIA 5EFWA 2HJ9C 3B42A 1TEMA 4R0QA 5G18A 1G6AA 3CG5A 3HREA 4G3KA 4S2OA 2DNSA 4HOIA 4YFMA 1K4FA 4S2KA 2D02A 4IEDA 3OC2A 1SHVA 5C5KA 2GZAA 1E3UA 4N92A 2ZL1B 4R4RA 1H8ZA 3G30A 1YLJA 4N9KA 2IWBA 5TR7A 2WK0A 5M18A 2BG1A 3B47A 3Q7ZA 3ZVWA 2IA2A 4G3VA 3KYQA 4QU3A 4WUJA 4GS9B 5CGSA 4DXBA 4WLAA 3RFBA 5CERA 2BTFP 2WUQA 1YQSA 3IXHA 1XGJA 2R9WA 1LLBA 2V8CA 1ZC2A 3S4XA 3GV9A 5G4ZA 2KOIA 1CI8A 3V50A 3VP4A 3NECA 4OPYA 1YAXA 3DTEA 2GX5A 4O01A 4X53A 4HH3A 4NXGA 4BBUA 4LPZA 4LV3A 2NUPC 4BD0A 3PTEA 3IBRA 3MZDA 4X55A 5DFYA 3SZTA 2GJ3A 5G4YA 2P7JA 2V9AA 1QMEA 2UWXA 3MXRA 3AGEA 1M6KA 1XA1A 3BFFA 4O0PA 3ZG5A 3D9YA 1JNUA 3D4FA 2PAVP 4WEKA 5EVIC 2QJ7A 1K0KA 2WZZA 3WS1A 4Y15A 3A0RA 2M7VA 3ZNTA 4KQDA 4OPQA 4EEPA 4ARZA 4PM7A 1MPLA 4LGWA 3SS5A 3G2ZA 4JXWA 3WRZA 2Y2JA 2ZMAA 5CEBA 1GA0A 1TF1A 3KSIA 3VE4A 5EVLA 5F82A 4FOFA 3HUOA 3ZG9B 1YLPA 3HBRA 3RXXA 3O87A 3OPPA 2Y55A 3DBAA 3VSKA 2XF3A 4KZ9A 1S6RA 2H28A 3AGDA 5EVID 2HV1A 3MZFA 5DJTA 5TBMB 4NKPA 1EWZA 1TVFA 4BWIA 3QNBA 5HW3A 3KSGA 4FH4A 2Z6CA 4GZBA 4L9FA 3HJIA 3UB8A 3H7WB 2J3TC 2WAFA 3ZGAB 1E3UD 1PI5A 3Q07A 5L8MA 4BL2A 1KGFA 2EX9A 4MDZA 4CJNA 3UO9A 2XH9A 4MMNA 1MBLA 4IBRA 3BFEA 2A2LA 1UWNX 5F5YA 1XFNA 1MKIA 2DRWA 4Y13A 4GDBA 2XRNA 3R7WB 1BZAA 4OQIA 3UB6A 1PZOA 3BJNA 1STZA 5EE8A 1XJ4A 3MBZA 5CXWA 5JYOA 1K6SA 1G5UA 2J8YA 4HJ4A 4OOYA 3TW8A 4H6JB 3KYZA 5GHXA 5DJUA 4OLDA 4WF0A 4HEFA 3UDXA 3T4OA 2Y2PA 3VOYA 5AJGA 3GQZA 5DTSA 3EOIA 3O3VA 2J3TD 3GDIA 4JKTA 1YLTA 1F5MA 1NRJA 1S1ZA 1K25A 5FI6A 3C38A 3H82B 3EQVA 1S4RA 4A5RA 4L0LA 2I9VA 3EGDC 1NXYA 3EEAA 2YKFA 3EEHA 4GN2A 2WGVA 3KSHA 4ID4A 5EVEA 3L7HA 3A3EA 3UDFA 3FYZA 3LEQA 2ZQ9A 1VHMA 1T1CA 2CC1A 3HCYA 5EECA 4MCWA 2ZOIA 5HD3A 3IX8A 1OT9A 2XROA 2PU4A 3C5AA 3TOIA 3GR2A 1W63M 4RQ9A 1SZVA 4GCZA 2HP5A 1N4OA 4JPMA 3S7NA 5EVIB 1PYYA 4HI4A 2Y2MA 3UE1A 3ZHHA 3A3FA 4B4ZA 5GLBA 2XDMA 4MN5A 1FCMA 4LCMA 3VOLA 2FFFB 4EETB 3NBLA 4IUHA 1HD8A 5TJJA 5HL6A 2LB9A 4RVAA 1J3WA 3UMDA 3O86A 2QPNA 3G2YA 4EEUA 4EV4A 4DN0A 5GHYA 1DJCA 3UY6A 4QJGA 2XFSA 2Y2LA 4QY6A 4HQAA 4IJGA 5A91A 2PHYA 4PMAA 3IX4A 2Y2KA 2IWDA 4WBGA 3C7UA 3LUQA 1ACFA 2XEPA 5FQKA 3UPPA 2V0WA 2O9AA 2J3WA 3M6BA 3N8SA 4KENB 5CEDA 1ALQA 3W2ZA 4NXFA 3SW1A 1MWRA 3JYIA 1F98A 2UV0E 4OPZA 1KE0A 4JGRA 1XXMA 3Q7VA 3NY4A 1E25A 4KZ4A 4F94A 5J3WA 4KZ3A 1H8YA 4Y5FA 5M1AA 1CI9A 1XJ2A 3TG9A 2H0YA 1IOUA 3HLGA 4CLCA 3WS0A 1VB6A 2Z2MB 3MFDA 3OOVA 2JE5A 3NDEA 3C7VA 4E04A 5FQMA 3CZDA 4UHUA 2HGVA 2P9VB 1RP5A 1TS8A 2V0UA 4ESPA 1ODVA 1EI5A 1W8QA 4FUWA 4F3LA 1JWZA 3GVBA 4UAAA 3QP5A 3ZQ5A 1FSWA 3RTYA 1VEUA 4ARZB 4N9LA 2VKSA 4EXOA 3A0SA
chains in the Genus database with same CATH topology
3WRTA 2DNSA 2X02A 4YFMA 1K4FA 3IH9A 2RL3A 3DWKA 4S2KA 3SOIA 4KG5A 1KDSA 4IEDA 1DJAA 4O7DA 1K55A 4P85A 1KDWA 1RCJA 5CTNA 1ES3A 3OC2A 1SHVA 4R4SA 5GHZA 5DF8A 1E3UA 1XX2A 4N92A 2ZQ8A 1S0WA 5FSRA 4EWFA 3PBRA 4WMCD 2HP9A 4R4RA 3VP0A 5HAPA 1H8ZA 4JLFA 3G30A 1YLJA 5JYPA 3NI9A 1FCOA 2G2UA 3HUMA 4N9KA 2IWBA 4FD8A 4KZAA 2HP6A 5TR7A 3A3DA 2WK0A 3N7WA 4S2JA 4YINA 4E3JA 5M18A 1GHPA 2BG1A 3Q7ZA 1XPBA 1LI9A 3MXSA 3ZVWA 3PBTA 4XXRA 1ZG6A 1MWTA 1Y54A 3M2JA 1SDEA 3ZG7B 4QU3A 3M6HA 1K56A 3IXBA 4QD4A 5HARA 3ZVTA 2HDRA 1FCNA 1IYPA 3OCLA 2X01A 4PM9A 5TFQA 5CGSA 4DXBA 5DTKA 5F1GA 5J8XA 1SDNA 2Y2HA 5KSHA 3GRJA 4GB7A 5HL1A 5F83A 4MBFA 4MNRA 4Y0TA 3HL9A 4DXCA 1JWPA 5E2FA 5FQ9A 5FQQA 4S2MA 5CERA 1MWUA 2EXAA 4WZ5C 3ITBA 2WUQA 4Y0OA 1JWVA 1YQSA 2ZD8A 3BRMA 1O7EA 1KE3A 3FWLA 4U0XA 1W7FA 1XGIA 3IXHA 5IHVA 1XGJA 1FOFA 2R9WA 1LLBA 2A3UA 3QNCA 5DF7A 3OZHA 1ZC2A 2OV5A 1PI4A 1YT4A 3S4XA 1IYQA 4C3QA 1C3BA 4ZJ3A 4B88A 5FA7A 3GV9A 5D3OA 4ZJ1A 2Y2OA 4OOMA 1CI8A 1MY8A 3IXDA 4X6TA 4EUZA 3V50A 5BOHA 3VP4A 4KZ5A 4WZ4A 5CHMA 2HDQA 2HDUA 1K54A 2XR0A 4B4XA 4OPYA 4E3LA 4R3JA 4OQ0A 1ERMA 3W4PA 2JC7A 4X53A 1BSGA 1LL5A 3N8LA 4WELA 4LV3A 4KG2A 3OPHA 4BD0A 1PW1A 3PTEA 3BM6A 3LEZA 3IF6A 3MZDA 4P0MA 4X55A 2EX6A 3M2KA 2EXBA 5CRFA 3P09A 3G32A 4P6BA 5I94A 4HESA 1WYCA 3FKVA 1QMEA 4C75A 2ZC7A 3TSGA 2OLVA 2UWXA 2ZLYA 1KGGA 3LY4A 3MXRA 3AGEA 3NIAA 4OOLA 1FQGA 5CGWA 1M6KA 2H0TA 1LHYA 3Q81A 1K57C 3N8RA 1H5XA 1AXBA 3FKWA 1XA1A 1I5QA 3BFFA 1VM1A 4N1XA 4OP5A 1DJBA 2Y2NA 4ZBEA 5M19A 2WZXA 1FSYA 4JF4A 5FATA 4M3KA 3IWOA 3ZG5A 3D4FA 5FI7A 3VSLA 4WEKA 5EVIC 3BLSA 3LO7A 5GLAA 1YLZA 2WZZA 3WS1A 3BECA 4KZBA 3ZNTA 4Q8IA 1KGEA 4S2PA 3BYDA 3HLBA 4OPQA 3DW0A 3VFFA 2WKHA 5U47A 2C6WB 4PM7A 3IQAA 3VFHA 2ZC6B 1MPLA 3SS5A 3G2ZA 2GDNA 4JXWA 1NYYA 4IVIA 4DE2A 1K55C 3E2KA 3WRZA 4H8RA 2Y2JA 3S22A 2ZMAA 5CEBA 1GA0A 4KZ8A 4OLGA 3V39A 5EOEA 3HUNA 1XA7A 2Y59A 3GSGA 3E2LA 5DF9A 3CJMA 5EVLA 1ZKJA 1IEMA 5F82A 4E3KA 4D2OA 3IT9A 4DDYA 3G31A 3EQUA 2XQZA 3WS4A 2JBFA 3HUOA 3ZG9B 1YLPA 1ES2A 4BQMA 4KG6A 4U0TA 3HBRA 3RXXA 3PBQA 1BUEA 3G34A 3O87A 3OPPA 1IKIA 3IWQA 2Y55A 1BULA 3BFCA 4GNUA 5KZHA 5AQBA 3VSKA 2J9PA 4E3NA 2XF3A 2XFTA 4KZ9A 1GA9A 1S6RA 3AGDA 2X71A 5HAQA 1MWSA 5A93A 3LY3A 1HZOA 5CHUA 5EVID 3MZFA 3IHAA 1BT5A 1EWZA 1TVFA 3QNBA 4JF5A 5HW3A 1I2SA 4NK3A 5DVAA 5GLDA 4EQIA 4S2IA 4FH4A 1BLCA 3G4PA 4GZBA 4QHCA 4FH2A 1XP4A 4KQOA 3QHYA 3B3XA 3IH8A 3RXWA 4ZTKA 2WAFA 2ZM2A 3FV7A 3ZGAB 1E3UD 1PI5A 3Q07A 4HBUA 4BL2A 1KGFA 4OP8A 3LCEA 2EX9A 4BENA 2WAEA 1YM1A 1WYBA 4CJNA 1PIOA 4UA9A 4N1HA 3UO9A 2XH9A 1MBLA 3NDGA 4IBRA 3BFEA 2WGWB 4Z9QA 5EUAA 1L0DA 2WGWA 3NCKA 2DRWA 1MKIA 4DE0A 2Y4AA 4GDBA 1ONGA 2XLNA 1NYMA 1TDLA 3SS4A 1K54C 1BZAA 4OQIA 4R23A 1PZOA 2Y2IA 1M40A 5EE8A 1W5DA 3MBZA 4DF6A 5FAPA 1E4DA 5CXWA 3RJUA 5JYOA 1K6SA 4GD8A 1W8YA 3N4IA 1KVMA 2J8YA 4OOYA 1K56D 3W4QA 3V3RA 2WKIA 4OKPA 2ZM0A 5GHXA 4OLDA 4HEFA 3UDXA 2ZC3B 1RGZA 3IF6C 2Z2LB 3V5MA 4DRTA 2ZM8A 3AGFA 2Y2PA 4PM8A 4MEZA 3PBOA 3VOYA 1K4EA 3GQZA 5DTSA 4LV0A 1YLYA 3PAEA 2I72A 2J7VA 5E2HA 3O3VA 2R9XA 3C4PA 4KQRA 3NC8A 4JKTA 4DE3A 3PBNA 1YLTA 3OCNA 3Q82A 1GHMA 1BTLA 4K0WA 3UN7A 1K25A 3WS5A 5CECA 1IELA 2ZQDA 5FI6A 3UE0A 2V1ZA 3A3JA 3N6IA 2VGJA 3EQVA 3GTCA 4GD6A 4P87A 2G2WA 4OQHA 2ZJ9A 4GOGA 3UE3A 4A5RA 4L0LA 5FQJA 4E3IA 4PM5A 1NXYA 4GN2A 2OSUA 2WGVA 3OPRA 3O88A 4ID4A 2ZQAA 4CPKA 4WEJA 3HLCA 1MXOA 3A3EA 5FAOA 3UDFA 2EFXA 5GL9A 1JTDA 3FYZA 4PM6A 4KQQA 4WYYA 1BLPA 4BLMA 2ZQ9A 1KVLA 1Z6FA 3G35A 2ZQ7A 1NRFA 1PZPA 4E3OA 1YMSA 3BEBA 2CC1A 3ITAA 5EECA 1FR6A 5E2EA 4WMCA 2ZC4B 2Q9MA 3ZG0A 3MKFA 4JF6A 3ZNYA 4UA6A 2PU4A 3C5AA 4RX2A 3TOIA 3ZDJA 1YMXA 3GR2A 1NZUA 2JCHA 4XUZA 3BLMA 3HLDA 4MBKA 4ZAMA 4EBLA 1BLHA 1FR1A 2H5SA 3ZG8B 3WWXA 2HP5A 1ESUA 4S2NA 2J9OA 1BLSA 1N4OA 2Y91A 4JPMA 5FASA 3UPOA 5EVIB 1PYYA 4X56A 3W8KA 4OONA 2Y2MA 3UE1A 3ZHHA 2XGNA 3A3FA 4B4ZA 1SCWA 2QMIA 2C5WB 2XDMA 5GLBA 1RGYA 3SS3A 2B5RA 3UPNA 1FCMA 4LCMA 2Y2QA 5EOOA 3V3SA 3WS2A 1HVBA 4E6WA 5A90A 2ZC5B 3IF5A 2HPBA 5FI2A 4R1GA 5CGXA 2FFFB 3BFGA 4DKIA 5HAIA 3NBLA 3ZCZA 3UNWA 4FSFA 4Y0UA 1HD8A 4DDSA 3OPLA 4LV1A 5E43A 5AQAA 5FQIA 1TDGA 1J9MA 2Y2GA 1Q2PA 1GHIA 1PWCA 5KMWA 4RVAA 4JXGA 2EFUA 3O86A 3FZCA 1Q2QA 2QPNA 3G2YA 4RA7A 4BJPA 4EV4A 5GHYA 1DJCA 1G68A 3I7JA 3UY6A 4QJGA 3SH7A 3ZFZA 2XFSA 4XUXA 3PAGA 1PWGA 4JXVA 4PPRA 2Y2LA 1L0EA 4QY5A 1QMFA 1W79A 1ZG4A 4KZ6A 2A49A 4QY6A 2EX2A 1PW8A 3MKEA 4RYEA 3S1YA 5A91A 3IWIA 3HVFA 4DE1A 4IBXA 4PMAA 3ISGA 2WYXA 1PWDA 3BFDA 4GKUA 2Y2KA 3CMZA 3SH9A 2E8IA 2IWDA 5FAQA 4S2LA 2IWCA 4WBGA 4FCFA 4OQGA 1NZOA 1ES4A 1VQQA 3C7UA 4X69A 1O07A 5FDHA 5HFOA 1CEFA 2XEPA 5FQKA 4LCLA 4MLLA 3UPPA 4EBNA 2OLUA 3C4OA 4GDNA 5DTTA 1EROA 5E2GA 5GLCA 5A92A 4WZ5A 4R3BA 4KZ7A 2FFYA 4OH0A 1XKZA 4IVKA 2EX8A 4JXSA 3M6BA 1CEGA 1ES5A 3N8SA 2QZ6A 2WKEA 4KENB 5CEDA 1SKFA 3IHBA 1GCEA 1ALQA 5HX9A 1ERQA 3VP3A 3VP2A 1K6RA 4BD1A 1MWRA 2V2FF 2VGKA 3JYIA 4BL3A 4Y7PA 1ESIA 5EPHA 3SH8A 4RX3A 3VOZA 4OPZA 4K91A 1JVJA 1KE0A 1NJ4A 4LV2A 4JBFA 1XXMA 3P98A 4ZJ2A 3Q7VB 1LI0A 3Q7VA 2P74A 3UDIA 3NY4A 1E25A 1DY6A 1YLWA 1K38A 4KZ4A 4E3MA 4F94A 3VMAA 4KZ3A 1H8YA 4HBTA 1HTZA 3IF6B 2WGIA 5M1AA 1CI9A 2HDSA 3TG9A 4X68A 2V20A 2XD1A 5TGFA 1WE4A 1I2WA 1L2SA 2H0YA 2XK1A 1U60A 3Q1FA 2RCXA 3HLWA 4MBHA 3HLGA 3PBSA 3A3IA 3W4OA 3WS0A 4E6XA 5KSCA 2PBYA 2Z2MB 3HLEA 1LL9A 4OVDA 3MFDA 4U3TA 4QB8A 1IYSA 1L0FA 3DWZA 5CTMA 2JE5A 3NDEA 4K0XA 1NY0A 1CK3A 3C7VA 2ZQCA 5AQ7A 5AQ9A 1OMEA 5F1FA 2H10A 5FQMA 1K57A 3CZDA 4UHUA 2P9VB 1RP5A 4LENA 4NETA 1IYOA 2P9VA 4UA7A 2WADA 1L0GA 1KE4A 4EBPA 4S2NC 3DTMA 2PU2A 2XD5A 4C6YA 1EI5A 3VP1A 1W8QA 3IXGA 1N9BA 3MZEA 1ONHA 2Q9NA 2DCFA 3GMWA 1JWZA 3GVBA 4UAAA 5EVIA 2BLSA 1FSWA 1TEMA 3HLFA 4R0QA 5G18A 1G6AA 1IKGA 4OPRA 3CG5A 1JTGA 3HREA 4N9LA 4WM9A 5CHJA 4S2OA 4ZDXA 5L2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WRT A;  2DNS A;  2X02 A;  4YFM A;  1K4F A;  3IH9 A;  2RL3 A;  3DWK A;  4S2K A;  3SOI A;  4KG5 A;  1KDS A;  4IED A;  1DJA A;  4O7D A;  1K55 A;  4P85 A;  1KDW A;  1RCJ A;  5CTN A;  1ES3 A;  3OC2 A;  1SHV A;  4R4S A;  5GHZ A;  5DF8 A;  1E3U A;  1XX2 A;  4N92 A;  2ZQ8 A;  1S0W A;  5FSR A;  4EWF A;  3PBR A;  4WMC D;  2HP9 A;  4R4R A;  3VP0 A;  5HAP A;  1H8Z A;  4JLF A;  3G30 A;  1YLJ A;  5JYP A;  3NI9 A;  1FCO A;  2G2U A;  3HUM A;  4N9K A;  2IWB A;  4FD8 A;  4KZA A;  2HP6 A;  5TR7 A;  3A3D A;  2WK0 A;  3N7W A;  4S2J A;  4YIN A;  4E3J A;  5M18 A;  1GHP A;  2BG1 A;  3Q7Z A;  1XPB A;  1LI9 A;  3MXS A;  3ZVW A;  3PBT A;  4XXR A;  1ZG6 A;  1MWT A;  1Y54 A;  3M2J A;  1SDE A;  3ZG7 B;  4QU3 A;  3M6H A;  1K56 A;  3IXB A;  4QD4 A;  5HAR A;  3ZVT A;  2HDR A;  1FCN A;  1IYP A;  3OCL A;  2X01 A;  4PM9 A;  5TFQ A;  5CGS A;  4DXB A;  5DTK A;  5F1G A;  5J8X A;  1SDN A;  2Y2H A;  5KSH A;  3GRJ A;  4GB7 A;  5HL1 A;  5F83 A;  4MBF A;  4MNR A;  4Y0T A;  3HL9 A;  4DXC A;  1JWP A;  5E2F A;  5FQ9 A;  5FQQ A;  4S2M A;  5CER A;  1MWU A;  2EXA A;  4WZ5 C;  3ITB A;  2WUQ A;  4Y0O A;  1JWV A;  1YQS A;  2ZD8 A;  3BRM A;  1O7E A;  1KE3 A;  3FWL A;  4U0X A;  1W7F A;  1XGI A;  3IXH A;  5IHV A;  1XGJ A;  1FOF A;  2R9W A;  1LLB A;  2A3U A;  3QNC A;  5DF7 A;  3OZH A;  1ZC2 A;  2OV5 A;  1PI4 A;  1YT4 A;  3S4X A;  1IYQ A;  4C3Q A;  1C3B A;  4ZJ3 A;  4B88 A;  5FA7 A;  3GV9 A;  5D3O A;  4ZJ1 A;  2Y2O A;  4OOM A;  1CI8 A;  1MY8 A;  3IXD A;  4X6T A;  4EUZ A;  3V50 A;  5BOH A;  3VP4 A;  4KZ5 A;  4WZ4 A;  5CHM A;  2HDQ A;  2HDU A;  1K54 A;  2XR0 A;  4B4X A;  4OPY A;  4E3L A;  4R3J A;  4OQ0 A;  1ERM A;  3W4P A;  2JC7 A;  4X53 A;  1BSG A;  1LL5 A;  3N8L A;  4WEL A;  4LV3 A;  4KG2 A;  3OPH A;  4BD0 A;  1PW1 A;  3PTE A;  3BM6 A;  3LEZ A;  3IF6 A;  3MZD A;  4P0M A;  4X55 A;  2EX6 A;  3M2K A;  2EXB A;  5CRF A;  3P09 A;  3G32 A;  4P6B A;  5I94 A;  4HES A;  1WYC A;  3FKV A;  1QME A;  4C75 A;  2ZC7 A;  3TSG A;  2OLV A;  2UWX A;  2ZLY A;  1KGG A;  3LY4 A;  3MXR A;  3AGE A;  3NIA A;  4OOL A;  1FQG A;  5CGW A;  1M6K A;  2H0T A;  1LHY A;  3Q81 A;  1K57 C;  3N8R A;  1H5X A;  1AXB A;  3FKW A;  1XA1 A;  1I5Q A;  3BFF A;  1VM1 A;  4N1X A;  4OP5 A;  1DJB A;  2Y2N A;  4ZBE A;  5M19 A;  2WZX A;  1FSY A;  4JF4 A;  5FAT A;  4M3K A;  3IWO A;  3ZG5 A;  3D4F A;  5FI7 A;  3VSL A;  4WEK A;  5EVI C;  3BLS A;  3LO7 A;  5GLA A;  1YLZ A;  2WZZ A;  3WS1 A;  3BEC A;  4KZB A;  3ZNT A;  4Q8I A;  1KGE A;  4S2P A;  3BYD A;  3HLB A;  4OPQ A;  3DW0 A;  3VFF A;  2WKH A;  5U47 A;  2C6W B;  4PM7 A;  3IQA A;  3VFH A;  2ZC6 B;  1MPL A;  3SS5 A;  3G2Z A;  2GDN A;  4JXW A;  1NYY A;  4IVI A;  4DE2 A;  1K55 C;  3E2K A;  3WRZ A;  4H8R A;  2Y2J A;  3S22 A;  2ZMA A;  5CEB A;  1GA0 A;  4KZ8 A;  4OLG A;  3V39 A;  5EOE A;  3HUN A;  1XA7 A;  2Y59 A;  3GSG A;  3E2L A;  5DF9 A;  3CJM A;  5EVL A;  1ZKJ A;  1IEM A;  5F82 A;  4E3K A;  4D2O A;  3IT9 A;  4DDY A;  3G31 A;  3EQU A;  2XQZ A;  3WS4 A;  2JBF A;  3HUO A;  3ZG9 B;  1YLP A;  1ES2 A;  4BQM A;  4KG6 A;  4U0T A;  3HBR A;  3RXX A;  3PBQ A;  1BUE A;  3G34 A;  3O87 A;  3OPP A;  1IKI A;  3IWQ A;  2Y55 A;  1BUL A;  3BFC A;  4GNU A;  5KZH A;  5AQB A;  3VSK A;  2J9P A;  4E3N A;  2XF3 A;  2XFT A;  4KZ9 A;  1GA9 A;  1S6R A;  3AGD A;  2X71 A;  5HAQ A;  1MWS A;  5A93 A;  3LY3 A;  1HZO A;  5CHU A;  5EVI D;  3MZF A;  3IHA A;  1BT5 A;  1EWZ A;  1TVF A;  3QNB A;  4JF5 A;  5HW3 A;  1I2S A;  4NK3 A;  5DVA A;  5GLD A;  4EQI A;  4S2I A;  4FH4 A;  1BLC A;  3G4P A;  4GZB A;  4QHC A;  4FH2 A;  1XP4 A;  4KQO A;  3QHY A;  3B3X A;  3IH8 A;  3RXW A;  4ZTK A;  2WAF A;  2ZM2 A;  3FV7 A;  3ZGA B;  1E3U D;  1PI5 A;  3Q07 A;  4HBU A;  4BL2 A;  1KGF A;  4OP8 A;  3LCE A;  2EX9 A;  4BEN A;  2WAE A;  1YM1 A;  1WYB A;  4CJN A;  1PIO A;  4UA9 A;  4N1H A;  3UO9 A;  2XH9 A;  1MBL A;  3NDG A;  4IBR A;  3BFE A;  2WGW B;  4Z9Q A;  5EUA A;  1L0D A;  2WGW A;  3NCK A;  2DRW A;  1MKI A;  4DE0 A;  2Y4A A;  4GDB A;  1ONG A;  2XLN A;  1NYM A;  1TDL A;  3SS4 A;  1K54 C;  1BZA A;  4OQI A;  4R23 A;  1PZO A;  2Y2I A;  1M40 A;  5EE8 A;  1W5D A;  3MBZ A;  4DF6 A;  5FAP A;  1E4D A;  5CXW A;  3RJU A;  5JYO A;  1K6S A;  4GD8 A;  1W8Y A;  3N4I A;  1KVM A;  2J8Y A;  4OOY A;  1K56 D;  3W4Q A;  3V3R A;  2WKI A;  4OKP A;  2ZM0 A;  5GHX A;  4OLD A;  4HEF A;  3UDX A;  2ZC3 B;  1RGZ A;  3IF6 C;  2Z2L B;  3V5M A;  4DRT A;  2ZM8 A;  3AGF A;  2Y2P A;  4PM8 A;  4MEZ A;  3PBO A;  3VOY A;  1K4E A;  3GQZ A;  5DTS A;  4LV0 A;  1YLY A;  3PAE A;  2I72 A;  2J7V A;  5E2H A;  3O3V A;  2R9X A;  3C4P A;  4KQR A;  3NC8 A;  4JKT A;  4DE3 A;  3PBN A;  1YLT A;  3OCN A;  3Q82 A;  1GHM A;  1BTL A;  4K0W A;  3UN7 A;  1K25 A;  3WS5 A;  5CEC A;  1IEL A;  2ZQD A;  5FI6 A;  3UE0 A;  2V1Z A;  3A3J A;  3N6I A;  2VGJ A;  3EQV A;  3GTC A;  4GD6 A;  4P87 A;  2G2W A;  4OQH A;  2ZJ9 A;  4GOG A;  3UE3 A;  4A5R A;  4L0L A;  5FQJ A;  4E3I A;  4PM5 A;  1NXY A;  4GN2 A;  2OSU A;  2WGV A;  3OPR A;  3O88 A;  4ID4 A;  2ZQA A;  4CPK A;  4WEJ A;  3HLC A;  1MXO A;  3A3E A;  5FAO A;  3UDF A;  2EFX A;  5GL9 A;  1JTD A;  3FYZ A;  4PM6 A;  4KQQ A;  4WYY A;  1BLP A;  4BLM A;  2ZQ9 A;  1KVL A;  1Z6F A;  3G35 A;  2ZQ7 A;  1NRF A;  1PZP A;  4E3O A;  1YMS A;  3BEB A;  2CC1 A;  3ITA A;  5EEC A;  1FR6 A;  5E2E A;  4WMC A;  2ZC4 B;  2Q9M A;  3ZG0 A;  3MKF A;  4JF6 A;  3ZNY A;  4UA6 A;  2PU4 A;  3C5A A;  4RX2 A;  3TOI A;  3ZDJ A;  1YMX A;  3GR2 A;  1NZU A;  2JCH A;  4XUZ A;  3BLM A;  3HLD A;  4MBK A;  4ZAM A;  4EBL A;  1BLH A;  1FR1 A;  2H5S A;  3ZG8 B;  3WWX A;  2HP5 A;  1ESU A;  4S2N A;  2J9O A;  1BLS A;  1N4O A;  2Y91 A;  4JPM A;  5FAS A;  3UPO A;  5EVI B;  1PYY A;  4X56 A;  3W8K A;  4OON A;  2Y2M A;  3UE1 A;  3ZHH A;  2XGN A;  3A3F A;  4B4Z A;  1SCW A;  2QMI A;  2C5W B;  2XDM A;  5GLB A;  1RGY A;  3SS3 A;  2B5R A;  3UPN A;  1FCM A;  4LCM A;  2Y2Q A;  5EOO A;  3V3S A;  3WS2 A;  1HVB A;  4E6W A;  5A90 A;  2ZC5 B;  3IF5 A;  2HPB A;  5FI2 A;  4R1G A;  5CGX A;  2FFF B;  3BFG A;  4DKI A;  5HAI A;  3NBL A;  3ZCZ A;  3UNW A;  4FSF A;  4Y0U A;  1HD8 A;  4DDS A;  3OPL A;  4LV1 A;  5E43 A;  5AQA A;  5FQI A;  1TDG A;  1J9M A;  2Y2G A;  1Q2P A;  1GHI A;  1PWC A;  5KMW A;  4RVA A;  4JXG A;  2EFU A;  3O86 A;  3FZC A;  1Q2Q A;  2QPN A;  3G2Y A;  4RA7 A;  4BJP A;  4EV4 A;  5GHY A;  1DJC A;  1G68 A;  3I7J A;  3UY6 A;  4QJG A;  3SH7 A;  3ZFZ A;  2XFS A;  4XUX A;  3PAG A;  1PWG A;  4JXV A;  4PPR A;  2Y2L A;  1L0E A;  4QY5 A;  1QMF A;  1W79 A;  1ZG4 A;  4KZ6 A;  2A49 A;  4QY6 A;  2EX2 A;  1PW8 A;  3MKE A;  4RYE A;  3S1Y A;  5A91 A;  3IWI A;  3HVF A;  4DE1 A;  4IBX A;  4PMA A;  3ISG A;  2WYX A;  1PWD A;  3BFD A;  4GKU A;  2Y2K A;  3CMZ A;  3SH9 A;  2E8I A;  2IWD A;  5FAQ A;  4S2L A;  2IWC A;  4WBG A;  4FCF A;  4OQG A;  1NZO A;  1ES4 A;  1VQQ A;  3C7U A;  4X69 A;  1O07 A;  5FDH A;  5HFO A;  1CEF A;  2XEP A;  5FQK A;  4LCL A;  4MLL A;  3UPP A;  4EBN A;  2OLU A;  3C4O A;  4GDN A;  5DTT A;  1ERO A;  5E2G A;  5GLC A;  5A92 A;  4WZ5 A;  4R3B A;  4KZ7 A;  2FFY A;  4OH0 A;  1XKZ A;  4IVK A;  2EX8 A;  4JXS A;  3M6B A;  1CEG A;  1ES5 A;  3N8S A;  2QZ6 A;  2WKE A;  4KEN B;  5CED A;  1SKF A;  3IHB A;  1GCE A;  1ALQ A;  5HX9 A;  1ERQ A;  3VP3 A;  3VP2 A;  1K6R A;  4BD1 A;  1MWR A;  2V2F F;  2VGK A;  3JYI A;  4BL3 A;  4Y7P A;  1ESI A;  5EPH A;  3SH8 A;  4RX3 A;  3VOZ A;  4OPZ A;  4K91 A;  1JVJ A;  1KE0 A;  1NJ4 A;  4LV2 A;  4JBF A;  1XXM A;  3P98 A;  4ZJ2 A;  3Q7V B;  1LI0 A;  3Q7V A;  2P74 A;  3UDI A;  3NY4 A;  1E25 A;  1DY6 A;  1YLW A;  1K38 A;  4KZ4 A;  4E3M A;  4F94 A;  3VMA A;  4KZ3 A;  1H8Y A;  4HBT A;  1HTZ A;  3IF6 B;  2WGI A;  5M1A A;  1CI9 A;  2HDS A;  3TG9 A;  4X68 A;  2V20 A;  2XD1 A;  5TGF A;  1WE4 A;  1I2W A;  1L2S A;  2H0Y A;  2XK1 A;  1U60 A;  3Q1F A;  2RCX A;  3HLW A;  4MBH A;  3HLG A;  3PBS A;  3A3I A;  3W4O A;  3WS0 A;  4E6X A;  5KSC A;  2PBY A;  2Z2M B;  3HLE A;  1LL9 A;  4OVD A;  3MFD A;  4U3T A;  4QB8 A;  1IYS A;  1L0F A;  3DWZ A;  5CTM A;  2JE5 A;  3NDE A;  4K0X A;  1NY0 A;  1CK3 A;  3C7V A;  2ZQC A;  5AQ7 A;  5AQ9 A;  1OME A;  5F1F A;  2H10 A;  5FQM A;  1K57 A;  3CZD A;  4UHU A;  2P9V B;  1RP5 A;  4LEN A;  4NET A;  1IYO A;  2P9V A;  4UA7 A;  2WAD A;  1L0G A;  1KE4 A;  4EBP A;  4S2N C;  3DTM A;  2PU2 A;  2XD5 A;  4C6Y A;  1EI5 A;  3VP1 A;  1W8Q A;  3IXG A;  1N9B A;  3MZE A;  1ONH A;  2Q9N A;  2DCF A;  3GMW A;  1JWZ A;  3GVB A;  4UAA A;  5EVI A;  2BLS A;  1FSW A;  1TEM A;  3HLF A;  4R0Q A;  5G18 A;  1G6A A;  1IKG A;  4OPR A;  3CG5 A;  1JTG A;  3HRE A;  4N9L A;  4WM9 A;  5CHJ A;  4S2O A;  4ZDX A;  5L2F A; 
#chains in the Genus database with same CATH topology
 3WRT A;  2X02 A;  2RL3 A;  3DWK A;  2XA7 S;  2PT7 A;  1PFL A;  4P85 A;  1Y4O A;  1ES3 A;  1P9R A;  4LRY C;  2WKQ A;  2JKR M;  5LBR A;  3VP0 A;  5HAP A;  3HUM A;  5F6A A;  4NG2 A;  4FD8 A;  3N7W A;  5A8B A;  1XPB A;  3PBT A;  1ZG6 A;  1Y54 A;  4Q0J A;  3ZG7 B;  3B33 A;  3BQ8 A;  4QD4 A;  3P01 A;  1FCN A;  3F1O A;  1FIL A;  5J4E A;  4PKY G;  5TFQ A;  1CF0 A;  4Q0H A;  5J8X A;  1SDN A;  3GRJ A;  5HL1 A;  5F83 A;  4MBF A;  4Y0T A;  3HL9 A;  4DXC A;  1SKO B;  5E2F A;  5FQQ A;  4S2M A;  1MWU A;  1JWV A;  2ZD8 A;  5IHV A;  4LRX C;  4ZJ3 A;  4ZJ1 A;  4L9G A;  4OOM A;  4EUZ A;  2WKR A;  5CHM A;  1H3Q A;  2HDQ A;  4E3L A;  4ETZ A;  4L9E A;  3MSH A;  3N8L A;  4KG2 A;  1UWP X;  2O99 A;  3BM6 A;  1W63 Q;  3IF6 A;  3LEZ A;  2ACG A;  2EX6 A;  3T12 B;  4P6B A;  4HES A;  1FIK A;  3QP8 A;  4GHI A;  3S7Q A;  1KGG A;  3LY4 A;  3LR4 A;  3NIA A;  2J80 A;  3IS2 A;  1FQG A;  5CGW A;  1N9N A;  1AXB A;  3FKW A;  4OP5 A;  1DJB A;  2Y2N A;  5L07 A;  1VET B;  5L09 A;  4JF4 A;  5FAT A;  1OTD A;  3LIC A;  2CMN A;  1N9L A;  1YLZ A;  2V8F A;  4Q8I A;  3U2A A;  5HWT A;  4CLC D;  4IVI A;  3E2K A;  3PYP A;  4H8R A;  3OLO A;  3HUN A;  1MC0 A;  2Y79 A;  4JGQ A;  1ZKJ A;  4E3K A;  4I39 A;  2PYR A;  3IT9 A;  4DDY A;  4Y2F A;  3LR5 A;  3LIB A;  1DP9 A;  3PBQ A;  1IKI A;  2OAQ 1;  5KZH A;  2JKF A;  3LY3 A;  4YNR A;  4D60 A;  5A93 A;  4HNB A;  1BT5 A;  3LGO A;  3BY8 A;  4II7 A;  5L10 A;  2R78 A;  1I2S A;  4NK3 A;  4EQI A;  4BMW A;  3T4K A;  3FV7 A;  2XA7 M;  1WYB A;  1PIO A;  4UA9 A;  4N1H A;  2Q0O A;  2WGW B;  4Z9Q A;  5EUA A;  3NCK A;  3E0Y A;  3T1R A;  2W1R A;  1S66 L;  2L0W A;  2WKP A;  1E4D A;  2WKI A;  2ZM0 A;  1G6O A;  3LI9 A;  2ZC3 B;  3IF6 C;  2ZM8 A;  4PM8 A;  3ICY A;  2W3F A;  3C2W A;  4MEZ A;  4O8G A;  3PBO A;  3UB5 P;  1K4E A;  3PAE A;  2J7V A;  5E2H A;  2R9X A;  3C4P A;  4KQR A;  3NC8 A;  4DE3 A;  3PBN A;  3JVV A;  3Q82 A;  1GHM A;  3O5Y A;  1IEL A;  3DTI A;  2ZQD A;  2QJ5 A;  4NXB A;  3N6I A;  2VGJ A;  4GD6 A;  2L1M A;  3LR3 A;  5FQJ A;  3PR6 A;  2OSU A;  4PM6 A;  3BY9 A;  1Z6F A;  3G35 A;  3BEB A;  1OJG A;  1FR6 A;  5J7E A;  4WMC A;  3ZNY A;  5KIZ A;  3ZDJ A;  1NZU A;  3BLM A;  3MMH A;  3HLD A;  2ZMV A;  4MN7 A;  4EBL A;  1BLH A;  2PYP A;  4F3L B;  4S2N A;  2Y91 A;  5AVF A;  4AFI A;  4X56 A;  4OON A;  3GEC A;  1VEU B;  1SCW A;  5F68 A;  3SS3 A;  2OWH A;  4QWO A;  3UNW A;  4FSF A;  4Y0U A;  4LV1 A;  1TDG A;  2Y2G A;  1OPX A;  1OTA A;  3T50 A;  4JXG A;  2EFU A;  3LR0 A;  1G68 A;  1OTB A;  4PPR A;  4QY5 A;  1QMF A;  2A49 A;  5DKL A;  2EX2 A;  1PW8 A;  3IWI A;  3F1O B;  2PDR A;  1PWD A;  2WYX A;  3TJZ C;  2K7S A;  3CMZ A;  3CAX A;  4GW9 A;  5FAQ A;  1V9Y A;  4DJ3 A;  1ES4 A;  1VQQ A;  2VV7 A;  4X69 A;  3E4O A;  1O07 A;  5HWV A;  1CJF A;  5HFO A;  1CEF A;  4EBN A;  3KYE A;  3QP4 A;  5GLC A;  5A92 A;  1LSW A;  4WZ5 A;  1XKZ A;  1ES5 A;  4R6L A;  3IHB A;  5HDS A;  1GCE A;  5HX9 A;  1ERQ A;  1NWZ A;  4BD1 A;  2VGK A;  3C30 A;  1ESI A;  1Y28 A;  4HJ3 A;  3SH8 A;  2QHK A;  1NJ4 A;  4LV2 A;  1DP6 A;  3T4L A;  4JBF A;  1DY6 A;  1YLW A;  4E3M A;  2B02 A;  1HTZ A;  3IF6 B;  5TGF A;  2XK1 A;  1U60 A;  3MQO A;  4CLC E;  1G28 A;  3PBS A;  4E6X A;  2VX8 A;  5KSC A;  2PBY A;  3HLE A;  1TD5 A;  4OVD A;  1OJ5 A;  4Q0I A;  3K3C A;  3UME A;  3P7N A;  1CK3 A;  2ZQC A;  3LIA A;  5AQ7 A;  4I3I A;  3D3O A;  1K57 A;  4LEN A;  4UA7 A;  4EBP A;  2WAD A;  4S2N C;  3RH8 B;  3DTM A;  4C6Y A;  2VLG A;  2PD8 A;  3IXG A;  1N9B A;  3BQA A;  3GMW A;  5FEG A;  4DMZ A;  2BLS A;  2GNX A;  4OPR A;  4NXE A;  5CHJ A;  3IH9 A;  3SOI A;  4KG5 A;  1DJA A;  4O7D A;  1K55 A;  1KDW A;  4R38 A;  1T19 A;  5GHZ A;  4R4S A;  4B9O A;  5DF8 A;  1XX2 A;  5FSR A;  4EWF A;  4WMC D;  2HP9 A;  2ZL1 A;  5JYP A;  3NI9 A;  3E4P A;  3UE6 A;  3KX0 X;  4KZA A;  1UGU A;  2YKH A;  4S2J A;  4YIN A;  3MXS A;  3LI8 A;  3IXB A;  4NEE D;  5HAR A;  3ZVT A;  2O9B A;  1IYP A;  3OCL A;  2X01 A;  5MC7 A;  4PM9 A;  3FPW A;  5DTK A;  5F1G A;  4IUK A;  5KSH A;  4GB7 A;  5FQ9 A;  5I5L A;  3CPT A;  2EXA A;  4WZ5 C;  4CQH A;  3BRM A;  1XJ3 A;  4U0X A;  1KE3 A;  1W7F A;  4LRZ E;  3QNC A;  1WA9 A;  3OZH A;  2OV5 A;  1PI4 A;  4C3Q A;  2W3D A;  1IYQ A;  1C3B A;  2OWJ A;  2M7U A;  2Y2O A;  1MY8 A;  1S1Y A;  3IXD A;  4X6T A;  4KZ5 A;  4WZ4 A;  2HDU A;  1K54 A;  2XR0 A;  4B4X A;  3W4P A;  3VE3 A;  2JC7 A;  1BSG A;  4WEL A;  2P04 A;  4P0M A;  5CRF A;  3P09 A;  3QP2 A;  3U4L P;  5IS1 A;  3NUL A;  1WYC A;  3FKV A;  4HY8 A;  2ZLY A;  1D7E A;  2PR5 A;  2H0T A;  1K57 C;  3N8R A;  1I5Q A;  1VM1 A;  4N1X A;  5M19 A;  1FSY A;  3UB7 A;  4M3K A;  1F9I A;  3E4Q A;  4QPR A;  4EU0 A;  4I38 A;  4EES A;  3BLS A;  3LO7 A;  2V1B A;  5DFX A;  4S2P A;  4EW7 A;  2WKH A;  5U47 A;  2ZC6 B;  2GDN A;  1NYY A;  4DE2 A;  1K55 C;  4K08 A;  1T18 A;  3NHQ A;  2QWS A;  5EOE A;  1XA7 A;  2Y59 A;  4YOF A;  3GSG A;  5DF9 A;  3CJM A;  1T1A A;  1IEM A;  4JGO A;  2JKT I;  2W3E A;  2JBF A;  2E8J A;  2JKT M;  4X25 A;  3MF0 A;  4KG6 A;  3LFV A;  3IWQ A;  4GNU A;  1GA9 A;  2X71 A;  1MWS A;  1HZO A;  3FG8 A;  3IHA A;  5TBM A;  3ZYT A;  4JF5 A;  3CWF A;  1N9O A;  1BLC A;  3G4P A;  4QHC A;  1D1J A;  3H7W A;  1PNE A;  3A0V A;  3CUE A;  4ZTK A;  4OP8 A;  4BEN A;  2P08 A;  2WAE A;  1S4S A;  2KX6 A;  4HP4 A;  3NDG A;  1YPR A;  1L0D A;  2Y4A A;  1TDL A;  3SS4 A;  1K54 C;  1M40 A;  5FAP A;  5EV0 A;  1KVM A;  3W4Q A;  3V3R A;  4OKP A;  2EWV A;  4X1M A;  4LV0 A;  1YLY A;  4CLC C;  3CI6 A;  2G7U A;  3MJQ A;  3PXP A;  3OCN A;  4UQI S;  5CEC A;  3JVU A;  3WS5 A;  3CLO A;  3CIT A;  1TS6 A;  3A3J A;  2PD7 A;  5IU1 A;  3GTC A;  3TE8 A;  4P87 A;  2G2W A;  4OQH A;  3UE3 A;  4PM5 A;  3OPR A;  3O88 A;  4G3W A;  2ZQA A;  1MXO A;  2EFX A;  1JTD A;  4BBV A;  2ZQ7 A;  1T1B A;  2QYB A;  1PZP A;  4E3O A;  1YMS A;  3S7O A;  3MKF A;  4JF6 A;  1AWI A;  1YMX A;  4ZAM A;  1FR1 A;  2H5S A;  3ZG8 B;  1ESU A;  1BLS A;  3MXQ A;  3UPO A;  3NOP C;  3W8K A;  2XGN A;  4FTX A;  2C5W B;  3MQ0 A;  1RGY A;  2VEA A;  4MN6 A;  5EOO A;  3V3S A;  4E6W A;  5A90 A;  3IF5 A;  3T1X A;  2HPB A;  5FI2 A;  4R1G A;  5HAI A;  3ZCZ A;  4X1L A;  4DDS A;  3IX3 A;  3OPL A;  5AQA A;  5FQI A;  3G6O A;  1GHI A;  4JGP A;  5KMW A;  2EWW A;  3FZC A;  3CUE C;  1LSX A;  5K5B A;  3I7J A;  3E98 A;  5CX7 A;  3PAG A;  1TS0 A;  4KZ6 A;  5FDS A;  4RYE A;  3S1Y A;  3HVF A;  3LID A;  4DE1 A;  5IT5 A;  3ISG A;  3BFD A;  2IWC A;  3LIE A;  4FCF A;  4OQG A;  1XFQ A;  2W1T A;  3CPT B;  5FDH A;  4LCL A;  2OLU A;  4GDN A;  3F1N A;  1ERO A;  5E2G A;  4R3B A;  2FFY A;  3LIF A;  2EX8 A;  4JXS A;  3BW6 A;  3MQQ A;  3PHY A;  2QZ6 A;  3HJK A;  1SKF A;  4XT2 A;  2HJE A;  3VP3 A;  1K6R A;  2V2F F;  4Y7P A;  5HPF A;  3R4K A;  4UEY A;  4K91 A;  1GSV A;  2ZOH A;  1JVJ A;  5DKK A;  3P98 A;  4ZJ2 A;  3Q7V B;  3VMA A;  2NUT C;  4HBT A;  1XJ6 A;  2WGI A;  3FC7 A;  4X68 A;  2XD1 A;  1L2S A;  4KUK A;  2RCX A;  3HLW A;  2ZMF A;  4MBH A;  4CLC B;  3A3I A;  2ZBB A;  3T1S A;  2PR6 A;  1IYS A;  1L0F A;  2VZW A;  3OBF A;  3DWZ A;  5CTM A;  4K0X A;  1NY0 A;  1DRM A;  3V67 A;  5F1F A;  4B93 A;  1IYO A;  2P9V A;  1KE4 A;  3KSF A;  2MJ6 A;  3VP1 A;  2Q9N A;  2DCF A;  4UQI M;  4HH2 A;  1D06 A;  1X0O A;  3DAV A;  2VA0 A;  2VGL S;  3HLF A;  1MKM A;  3T4Q A;  3K3D A;  1IKG A;  1JTG A;  4BBT A;  5HWW A;  4WM9 A;  4ZDX A;  5L2F A;  3MS6 A;  1KDS A;  4P6Z S;  1RCJ A;  5CTN A;  3D72 A;  1BYW A;  2ZQ8 A;  1S0W A;  3PBR A;  4JLF A;  5HDC A;  1FCO A;  2G2U A;  1H0M A;  2PRF A;  2HP6 A;  3A3D A;  4E3J A;  2XSS A;  1GHP A;  4HJ6 A;  5HD5 A;  1OTE A;  3NOT C;  3EGX C;  2O9C A;  1LI9 A;  4XXR A;  1MWT A;  3M2J A;  1SDE A;  3M6H A;  1K56 A;  2HDR A;  3H9W A;  5AVE A;  2Y2H A;  4PAU A;  4MNR A;  1JWP A;  1SKO A;  2M1C A;  4GJ4 A;  1ZTU A;  3ITB A;  4Y0O A;  1O7E A;  3FWL A;  2W27 A;  1XGI A;  4Z1W A;  1FOF A;  2A24 A;  5DF7 A;  2A3U A;  4YWZ A;  1YT4 A;  4B88 A;  2AVX A;  2INW A;  5FA7 A;  5D3O A;  2JHE A;  5BOH A;  4R3J A;  4OQ0 A;  3T4T A;  1ERM A;  1LL5 A;  3OPH A;  1PW1 A;  4R70 A;  3M2K A;  4I3A A;  2EXB A;  1H8M A;  3G32 A;  5I94 A;  4C75 A;  4GHI B;  2ZC7 A;  3TSG A;  2OLV A;  1P0Z A;  4WL9 A;  3IS2 B;  4OOL A;  3F1P A;  5HPI A;  1LHY A;  3Q81 A;  1H5X A;  2BAS A;  4ZBE A;  5FEF A;  2VJW A;  2WZX A;  3TRC A;  1VET A;  3IWO A;  2W3H A;  5FI7 A;  3VSL A;  2W0N A;  5GLA A;  2EA9 A;  3BEC A;  3MFX A;  4HP9 A;  4KZB A;  1CQA A;  1KGE A;  3BYD A;  3HLB A;  2B18 A;  1V9Z A;  3DW0 A;  3VFF A;  4R3A A;  2C6W B;  3IQA A;  3NJA A;  3VFH A;  3S22 A;  4KZ8 A;  3V39 A;  4OLG A;  5FL3 A;  2JKG A;  3E2L A;  4D2O A;  2Y8H A;  3G31 A;  3EQU A;  2XQZ A;  3WS4 A;  1ES2 A;  4BQM A;  4U0T A;  2VK3 A;  3K2N A;  1BUE A;  3G34 A;  1BUL A;  3BFC A;  5AQB A;  4E3N A;  2J9P A;  2XFT A;  5HAQ A;  2B95 A;  2FZ0 A;  2VV6 A;  5CHU A;  2V1A A;  3EWK A;  2Z6D A;  2FH5 A;  4GLQ A;  4ME4 A;  2VGL M;  3JPU A;  5DVA A;  4ZRR A;  4GS9 A;  2O0Y A;  5GLD A;  2W3G A;  4S2I A;  2D01 A;  5HDD A;  4FH2 A;  1XP4 A;  2OOL A;  3FPV A;  4KQO A;  3QHY A;  3B3X A;  3IH8 A;  3RXW A;  4Y3I A;  2ZM2 A;  4HBU A;  2DMW A;  3LCE A;  4P6Z M;  1YM1 A;  5EM0 A;  4Y17 A;  1EW0 A;  2WGW A;  4DE0 A;  1ONG A;  2XLN A;  1NYM A;  1YSP A;  1HLU P;  4R23 A;  5HZH A;  2W1T B;  2Y2I A;  1W5D A;  4DF6 A;  3RJU A;  3C8C A;  4GD8 A;  1W8Y A;  2PBD P;  3N4I A;  3F1N B;  1K56 D;  3T4J A;  4HIA A;  1YSQ A;  1NLY A;  1RGZ A;  3LYX A;  2Z2L B;  3V5M A;  4DRT A;  3AGF A;  2JN7 A;  1S67 L;  4DJ2 A;  4XT2 B;  2I72 A;  2VV8 A;  2OAP 1;  4PKY A;  1BTL A;  4K0W A;  3UN7 A;  2K31 A;  4M4X A;  1OTI A;  3MR0 A;  3QP6 A;  4I3J A;  3UE0 A;  2V1Z A;  1ZHH B;  1L3L A;  4IHQ A;  2ZJ9 A;  4GOG A;  4E3I A;  2HF6 A;  2QKP A;  1PRQ A;  4CPK A;  4WEJ A;  3HLC A;  5FAO A;  5GL9 A;  1P9W A;  1OT6 A;  4KQQ A;  1BLP A;  1GSX A;  4WYY A;  4BLM A;  1KVL A;  3CHW P;  1NRF A;  3ITA A;  5E2E A;  2ZC4 B;  2Q9M A;  1LT0 A;  5F69 A;  3T4S A;  3ZG0 A;  3L9K A;  4UA6 A;  4RX2 A;  1DP8 A;  2JCH A;  4XUZ A;  4MBK A;  3WWX A;  2J9O A;  5FAS A;  2HZ5 A;  4KUO A;  2K2N A;  3T1Q B;  2QMI A;  1LL8 A;  1Z09 A;  2B5R A;  1KOU A;  3UPN A;  3WS2 A;  2Y2Q A;  1HVB A;  1YKD A;  1F2K A;  2ZC5 B;  3S7P A;  3ULF A;  5CGX A;  4EER A;  3BFG A;  4DKI A;  2JKR I;  3VV4 A;  5E43 A;  1J9M A;  1Q2P A;  4EUV A;  1PWC A;  1P97 A;  1Q2Q A;  4RA7 A;  4BJP A;  3SH7 A;  3ZFZ A;  3UB9 A;  4XUX A;  1PWG A;  4JXV A;  1L0E A;  1W79 A;  1ZG4 A;  4LFU A;  3MKE A;  2KDK A;  4IBX A;  4GKU A;  5HSQ A;  3SH9 A;  2E8I A;  4S2L A;  4EQ1 A;  1NZO A;  3R7W A;  4LLO B;  4MLL A;  3BWL A;  3C4O A;  5DTT A;  5EM1 A;  4H6J A;  4KZ7 A;  1A0K A;  4OH0 A;  2A24 B;  3KO6 A;  4I5S A;  4IVK A;  1CEG A;  1TS7 A;  2WKE A;  3VP2 A;  4BL3 A;  5EPH A;  1IFQ A;  4RX3 A;  3VOZ A;  1MZU A;  3IBJ A;  1LI0 A;  3UDI A;  2P74 A;  1GSW A;  4PHT A;  1K38 A;  3H82 A;  1LSV A;  2HDS A;  2V20 A;  1WE4 A;  1I2W A;  2LB5 A;  3Q1F A;  2L4R A;  3W4O A;  1LL9 A;  3DTK A;  4U3T A;  4QB8 A;  3F1P B;  3QP1 A;  4WN5 A;  5AQ9 A;  1OME A;  4HHD A;  2KLI A;  2H10 A;  4ETX A;  4NET A;  1L0G A;  3NOU C;  2PU2 A;  2XD5 A;  1NLZ A;  3MZE A;  1ONH A;  5EVI A;  5EFW A;  2HJ9 C;  3B42 A;  1TEM A;  4R0Q A;  5G18 A;  1G6A A;  3CG5 A;  3HRE A;  4G3K A;  4S2O A;  2DNS A;  4HOI A;  4YFM A;  1K4F A;  4S2K A;  2D02 A;  4IED A;  3OC2 A;  1SHV A;  5C5K A;  2GZA A;  1E3U A;  4N92 A;  2ZL1 B;  4R4R A;  1H8Z A;  3G30 A;  1YLJ A;  4N9K A;  2IWB A;  5TR7 A;  2WK0 A;  5M18 A;  2BG1 A;  3B47 A;  3Q7Z A;  3ZVW A;  2IA2 A;  4G3V A;  3KYQ A;  4QU3 A;  4WUJ A;  4GS9 B;  5CGS A;  4DXB A;  4WLA A;  3RFB A;  5CER A;  2BTF P;  2WUQ A;  1YQS A;  3IXH A;  1XGJ A;  2R9W A;  1LLB A;  2V8C A;  1ZC2 A;  3S4X A;  3GV9 A;  5G4Z A;  2KOI A;  1CI8 A;  3V50 A;  3VP4 A;  3NEC A;  4OPY A;  1YAX A;  3DTE A;  2GX5 A;  4O01 A;  4X53 A;  4HH3 A;  4NXG A;  4BBU A;  4LPZ A;  4LV3 A;  2NUP C;  4BD0 A;  3PTE A;  3IBR A;  3MZD A;  4X55 A;  5DFY A;  3SZT A;  2GJ3 A;  5G4Y A;  2P7J A;  2V9A A;  1QME A;  2UWX A;  3MXR A;  3AGE A;  1M6K A;  1XA1 A;  3BFF A;  4O0P A;  3ZG5 A;  3D9Y A;  1JNU A;  3D4F A;  2PAV P;  4WEK A;  5EVI C;  2QJ7 A;  1K0K A;  2WZZ A;  3WS1 A;  4Y15 A;  3A0R A;  2M7V A;  3ZNT A;  4KQD A;  4OPQ A;  4EEP A;  4ARZ A;  4PM7 A;  1MPL A;  4LGW A;  3SS5 A;  3G2Z A;  4JXW A;  3WRZ A;  2Y2J A;  2ZMA A;  5CEB A;  1GA0 A;  1TF1 A;  3KSI A;  3VE4 A;  5EVL A;  5F82 A;  4FOF A;  3HUO A;  3ZG9 B;  1YLP A;  3HBR A;  3RXX A;  3O87 A;  3OPP A;  2Y55 A;  3DBA A;  3VSK A;  2XF3 A;  4KZ9 A;  1S6R A;  2H28 A;  3AGD A;  5EVI D;  2HV1 A;  3MZF A;  5DJT A;  5TBM B;  4NKP A;  1EWZ A;  1TVF A;  4BWI A;  3QNB A;  5HW3 A;  3KSG A;  4FH4 A;  2Z6C A;  4GZB A;  4L9F A;  3HJI A;  3UB8 A;  3H7W B;  2J3T C;  2WAF A;  3ZGA B;  1E3U D;  1PI5 A;  3Q07 A;  5L8M A;  4BL2 A;  1KGF A;  2EX9 A;  4MDZ A;  4CJN A;  3UO9 A;  2XH9 A;  4MMN A;  1MBL A;  4IBR A;  3BFE A;  2A2L A;  1UWN X;  5F5Y A;  1XFN A;  1MKI A;  2DRW A;  4Y13 A;  4GDB A;  2XRN A;  3R7W B;  1BZA A;  4OQI A;  3UB6 A;  1PZO A;  3BJN A;  1STZ A;  5EE8 A;  1XJ4 A;  3MBZ A;  5CXW A;  5JYO A;  1K6S A;  1G5U A;  2J8Y A;  4HJ4 A;  4OOY A;  3TW8 A;  4H6J B;  3KYZ A;  5GHX A;  5DJU A;  4OLD A;  4WF0 A;  4HEF A;  3UDX A;  3T4O A;  2Y2P A;  3VOY A;  5AJG A;  3GQZ A;  5DTS A;  3EOI A;  3O3V A;  2J3T D;  3GDI A;  4JKT A;  1YLT A;  1F5M A;  1NRJ A;  1S1Z A;  1K25 A;  5FI6 A;  3C38 A;  3H82 B;  3EQV A;  1S4R A;  4A5R A;  4L0L A;  2I9V A;  3EGD C;  1NXY A;  3EEA A;  2YKF A;  3EEH A;  4GN2 A;  2WGV A;  3KSH A;  4ID4 A;  5EVE A;  3L7H A;  3A3E A;  3UDF A;  3FYZ A;  3LEQ A;  2ZQ9 A;  1VHM A;  1T1C A;  2CC1 A;  3HCY A;  5EEC A;  4MCW A;  2ZOI A;  5HD3 A;  3IX8 A;  1OT9 A;  2XRO A;  2PU4 A;  3C5A A;  3TOI A;  3GR2 A;  1W63 M;  4RQ9 A;  1SZV A;  4GCZ A;  2HP5 A;  1N4O A;  4JPM A;  3S7N A;  5EVI B;  1PYY A;  4HI4 A;  2Y2M A;  3UE1 A;  3ZHH A;  3A3F A;  4B4Z A;  5GLB A;  2XDM A;  4MN5 A;  1FCM A;  4LCM A;  3VOL A;  2FFF B;  4EET B;  3NBL A;  4IUH A;  1HD8 A;  5TJJ A;  5HL6 A;  2LB9 A;  4RVA A;  1J3W A;  3UMD A;  3O86 A;  2QPN A;  3G2Y A;  4EEU A;  4EV4 A;  4DN0 A;  5GHY A;  1DJC A;  3UY6 A;  4QJG A;  2XFS A;  2Y2L A;  4QY6 A;  4HQA A;  4IJG A;  5A91 A;  2PHY A;  4PMA A;  3IX4 A;  2Y2K A;  2IWD A;  4WBG A;  3C7U A;  3LUQ A;  1ACF A;  2XEP A;  5FQK A;  3UPP A;  2V0W A;  2O9A A;  2J3W A;  3M6B A;  3N8S A;  4KEN B;  5CED A;  1ALQ A;  3W2Z A;  4NXF A;  3SW1 A;  1MWR A;  3JYI A;  1F98 A;  2UV0 E;  4OPZ A;  1KE0 A;  4JGR A;  1XXM A;  3Q7V A;  3NY4 A;  1E25 A;  4KZ4 A;  4F94 A;  5J3W A;  4KZ3 A;  1H8Y A;  4Y5F A;  5M1A A;  1CI9 A;  1XJ2 A;  3TG9 A;  2H0Y A;  1IOU A;  3HLG A;  4CLC A;  3WS0 A;  1VB6 A;  2Z2M B;  3MFD A;  3OOV A;  2JE5 A;  3NDE A;  3C7V A;  4E04 A;  5FQM A;  3CZD A;  4UHU A;  2HGV A;  2P9V B;  1RP5 A;  1TS8 A;  2V0U A;  4ESP A;  1ODV A;  1EI5 A;  1W8Q A;  4FUW A;  4F3L A;  1JWZ A;  3GVB A;  4UAA A;  3QP5 A;  3ZQ5 A;  1FSW A;  3RTY A;  1VEU A;  4ARZ B;  4N9L A;  2VKS A;  4EXO A;  3A0S A; 
#chains in the Genus database with same CATH homology
 3WRT A;  2DNS A;  2X02 A;  4YFM A;  1K4F A;  3IH9 A;  2RL3 A;  3DWK A;  4S2K A;  3SOI A;  4KG5 A;  1KDS A;  4IED A;  1DJA A;  4O7D A;  1K55 A;  4P85 A;  1KDW A;  1RCJ A;  5CTN A;  1ES3 A;  3OC2 A;  1SHV A;  4R4S A;  5GHZ A;  5DF8 A;  1E3U A;  1XX2 A;  4N92 A;  2ZQ8 A;  1S0W A;  5FSR A;  4EWF A;  3PBR A;  4WMC D;  2HP9 A;  4R4R A;  3VP0 A;  5HAP A;  1H8Z A;  4JLF A;  3G30 A;  1YLJ A;  5JYP A;  3NI9 A;  1FCO A;  2G2U A;  3HUM A;  4N9K A;  2IWB A;  4FD8 A;  4KZA A;  2HP6 A;  5TR7 A;  3A3D A;  2WK0 A;  3N7W A;  4S2J A;  4YIN A;  4E3J A;  5M18 A;  1GHP A;  2BG1 A;  3Q7Z A;  1XPB A;  1LI9 A;  3MXS A;  3ZVW A;  3PBT A;  4XXR A;  1ZG6 A;  1MWT A;  1Y54 A;  3M2J A;  1SDE A;  3ZG7 B;  4QU3 A;  3M6H A;  1K56 A;  3IXB A;  4QD4 A;  5HAR A;  3ZVT A;  2HDR A;  1FCN A;  1IYP A;  3OCL A;  2X01 A;  4PM9 A;  5TFQ A;  5CGS A;  4DXB A;  5DTK A;  5F1G A;  5J8X A;  1SDN A;  2Y2H A;  5KSH A;  3GRJ A;  4GB7 A;  5HL1 A;  5F83 A;  4MBF A;  4MNR A;  4Y0T A;  3HL9 A;  4DXC A;  1JWP A;  5E2F A;  5FQ9 A;  5FQQ A;  4S2M A;  5CER A;  1MWU A;  2EXA A;  4WZ5 C;  3ITB A;  2WUQ A;  4Y0O A;  1JWV A;  1YQS A;  2ZD8 A;  3BRM A;  1O7E A;  1KE3 A;  3FWL A;  4U0X A;  1W7F A;  1XGI A;  3IXH A;  5IHV A;  1XGJ A;  1FOF A;  2R9W A;  1LLB A;  2A3U A;  3QNC A;  5DF7 A;  3OZH A;  1ZC2 A;  2OV5 A;  1PI4 A;  1YT4 A;  3S4X A;  1IYQ A;  4C3Q A;  1C3B A;  4ZJ3 A;  4B88 A;  5FA7 A;  3GV9 A;  5D3O A;  4ZJ1 A;  2Y2O A;  4OOM A;  1CI8 A;  1MY8 A;  3IXD A;  4X6T A;  4EUZ A;  3V50 A;  5BOH A;  3VP4 A;  4KZ5 A;  4WZ4 A;  5CHM A;  2HDQ A;  2HDU A;  1K54 A;  2XR0 A;  4B4X A;  4OPY A;  4E3L A;  4R3J A;  4OQ0 A;  1ERM A;  3W4P A;  2JC7 A;  4X53 A;  1BSG A;  1LL5 A;  3N8L A;  4WEL A;  4LV3 A;  4KG2 A;  3OPH A;  4BD0 A;  1PW1 A;  3PTE A;  3BM6 A;  3LEZ A;  3IF6 A;  3MZD A;  4P0M A;  4X55 A;  2EX6 A;  3M2K A;  2EXB A;  5CRF A;  3P09 A;  3G32 A;  4P6B A;  5I94 A;  4HES A;  1WYC A;  3FKV A;  1QME A;  4C75 A;  2ZC7 A;  3TSG A;  2OLV A;  2UWX A;  2ZLY A;  1KGG A;  3LY4 A;  3MXR A;  3AGE A;  3NIA A;  4OOL A;  1FQG A;  5CGW A;  1M6K A;  2H0T A;  1LHY A;  3Q81 A;  1K57 C;  3N8R A;  1H5X A;  1AXB A;  3FKW A;  1XA1 A;  1I5Q A;  3BFF A;  1VM1 A;  4N1X A;  4OP5 A;  1DJB A;  2Y2N A;  4ZBE A;  5M19 A;  2WZX A;  1FSY A;  4JF4 A;  5FAT A;  4M3K A;  3IWO A;  3ZG5 A;  3D4F A;  5FI7 A;  3VSL A;  4WEK A;  5EVI C;  3BLS A;  3LO7 A;  5GLA A;  1YLZ A;  2WZZ A;  3WS1 A;  3BEC A;  4KZB A;  3ZNT A;  4Q8I A;  1KGE A;  4S2P A;  3BYD A;  3HLB A;  4OPQ A;  3DW0 A;  3VFF A;  2WKH A;  5U47 A;  2C6W B;  4PM7 A;  3IQA A;  3VFH A;  2ZC6 B;  1MPL A;  3SS5 A;  3G2Z A;  2GDN A;  4JXW A;  1NYY A;  4IVI A;  4DE2 A;  1K55 C;  3E2K A;  3WRZ A;  4H8R A;  2Y2J A;  3S22 A;  2ZMA A;  5CEB A;  1GA0 A;  4KZ8 A;  4OLG A;  3V39 A;  5EOE A;  3HUN A;  1XA7 A;  2Y59 A;  3GSG A;  3E2L A;  5DF9 A;  3CJM A;  5EVL A;  1ZKJ A;  1IEM A;  5F82 A;  4E3K A;  4D2O A;  3IT9 A;  4DDY A;  3G31 A;  3EQU A;  2XQZ A;  3WS4 A;  2JBF A;  3HUO A;  3ZG9 B;  1YLP A;  1ES2 A;  4BQM A;  4KG6 A;  4U0T A;  3HBR A;  3RXX A;  3PBQ A;  1BUE A;  3G34 A;  3O87 A;  3OPP A;  1IKI A;  3IWQ A;  2Y55 A;  1BUL A;  3BFC A;  4GNU A;  5KZH A;  5AQB A;  3VSK A;  2J9P A;  4E3N A;  2XF3 A;  2XFT A;  4KZ9 A;  1GA9 A;  1S6R A;  3AGD A;  2X71 A;  5HAQ A;  1MWS A;  5A93 A;  3LY3 A;  1HZO A;  5CHU A;  5EVI D;  3MZF A;  3IHA A;  1BT5 A;  1EWZ A;  1TVF A;  3QNB A;  4JF5 A;  5HW3 A;  1I2S A;  4NK3 A;  5DVA A;  5GLD A;  4EQI A;  4S2I A;  4FH4 A;  1BLC A;  3G4P A;  4GZB A;  4QHC A;  4FH2 A;  1XP4 A;  4KQO A;  3QHY A;  3B3X A;  3IH8 A;  3RXW A;  4ZTK A;  2WAF A;  2ZM2 A;  3FV7 A;  3ZGA B;  1E3U D;  1PI5 A;  3Q07 A;  4HBU A;  4BL2 A;  1KGF A;  4OP8 A;  3LCE A;  2EX9 A;  4BEN A;  2WAE A;  1YM1 A;  1WYB A;  4CJN A;  1PIO A;  4UA9 A;  4N1H A;  3UO9 A;  2XH9 A;  1MBL A;  3NDG A;  4IBR A;  3BFE A;  2WGW B;  4Z9Q A;  5EUA A;  1L0D A;  2WGW A;  3NCK A;  2DRW A;  1MKI A;  4DE0 A;  2Y4A A;  4GDB A;  1ONG A;  2XLN A;  1NYM A;  1TDL A;  3SS4 A;  1K54 C;  1BZA A;  4OQI A;  4R23 A;  1PZO A;  2Y2I A;  1M40 A;  5EE8 A;  1W5D A;  3MBZ A;  4DF6 A;  5FAP A;  1E4D A;  5CXW A;  3RJU A;  5JYO A;  1K6S A;  4GD8 A;  1W8Y A;  3N4I A;  1KVM A;  2J8Y A;  4OOY A;  1K56 D;  3W4Q A;  3V3R A;  2WKI A;  4OKP A;  2ZM0 A;  5GHX A;  4OLD A;  4HEF A;  3UDX A;  2ZC3 B;  1RGZ A;  3IF6 C;  2Z2L B;  3V5M A;  4DRT A;  2ZM8 A;  3AGF A;  2Y2P A;  4PM8 A;  4MEZ A;  3PBO A;  3VOY A;  1K4E A;  3GQZ A;  5DTS A;  4LV0 A;  1YLY A;  3PAE A;  2I72 A;  2J7V A;  5E2H A;  3O3V A;  2R9X A;  3C4P A;  4KQR A;  3NC8 A;  4JKT A;  4DE3 A;  3PBN A;  1YLT A;  3OCN A;  3Q82 A;  1GHM A;  1BTL A;  4K0W A;  3UN7 A;  1K25 A;  3WS5 A;  5CEC A;  1IEL A;  2ZQD A;  5FI6 A;  3UE0 A;  2V1Z A;  3A3J A;  3N6I A;  2VGJ A;  3EQV A;  3GTC A;  4GD6 A;  4P87 A;  2G2W A;  4OQH A;  2ZJ9 A;  4GOG A;  3UE3 A;  4A5R A;  4L0L A;  5FQJ A;  4E3I A;  4PM5 A;  1NXY A;  4GN2 A;  2OSU A;  2WGV A;  3OPR A;  3O88 A;  4ID4 A;  2ZQA A;  4CPK A;  4WEJ A;  3HLC A;  1MXO A;  3A3E A;  5FAO A;  3UDF A;  2EFX A;  5GL9 A;  1JTD A;  3FYZ A;  4PM6 A;  4KQQ A;  4WYY A;  1BLP A;  4BLM A;  2ZQ9 A;  1KVL A;  1Z6F A;  3G35 A;  2ZQ7 A;  1NRF A;  1PZP A;  4E3O A;  1YMS A;  3BEB A;  2CC1 A;  3ITA A;  5EEC A;  1FR6 A;  5E2E A;  4WMC A;  2ZC4 B;  2Q9M A;  3ZG0 A;  3MKF A;  4JF6 A;  3ZNY A;  4UA6 A;  2PU4 A;  3C5A A;  4RX2 A;  3TOI A;  3ZDJ A;  1YMX A;  3GR2 A;  1NZU A;  2JCH A;  4XUZ A;  3BLM A;  3HLD A;  4MBK A;  4ZAM A;  4EBL A;  1BLH A;  1FR1 A;  2H5S A;  3ZG8 B;  3WWX A;  2HP5 A;  1ESU A;  4S2N A;  2J9O A;  1BLS A;  1N4O A;  2Y91 A;  4JPM A;  5FAS A;  3UPO A;  5EVI B;  1PYY A;  4X56 A;  3W8K A;  4OON A;  2Y2M A;  3UE1 A;  3ZHH A;  2XGN A;  3A3F A;  4B4Z A;  1SCW A;  2QMI A;  2C5W B;  2XDM A;  5GLB A;  1RGY A;  3SS3 A;  2B5R A;  3UPN A;  1FCM A;  4LCM A;  2Y2Q A;  5EOO A;  3V3S A;  3WS2 A;  1HVB A;  4E6W A;  5A90 A;  2ZC5 B;  3IF5 A;  2HPB A;  5FI2 A;  4R1G A;  5CGX A;  2FFF B;  3BFG A;  4DKI A;  5HAI A;  3NBL A;  3ZCZ A;  3UNW A;  4FSF A;  4Y0U A;  1HD8 A;  4DDS A;  3OPL A;  4LV1 A;  5E43 A;  5AQA A;  5FQI A;  1TDG A;  1J9M A;  2Y2G A;  1Q2P A;  1GHI A;  1PWC A;  5KMW A;  4RVA A;  4JXG A;  2EFU A;  3O86 A;  3FZC A;  1Q2Q A;  2QPN A;  3G2Y A;  4RA7 A;  4BJP A;  4EV4 A;  5GHY A;  1DJC A;  1G68 A;  3I7J A;  3UY6 A;  4QJG A;  3SH7 A;  3ZFZ A;  2XFS A;  4XUX A;  3PAG A;  1PWG A;  4JXV A;  4PPR A;  2Y2L A;  1L0E A;  4QY5 A;  1QMF A;  1W79 A;  1ZG4 A;  4KZ6 A;  2A49 A;  4QY6 A;  2EX2 A;  1PW8 A;  3MKE A;  4RYE A;  3S1Y A;  5A91 A;  3IWI A;  3HVF A;  4DE1 A;  4IBX A;  4PMA A;  3ISG A;  2WYX A;  1PWD A;  3BFD A;  4GKU A;  2Y2K A;  3CMZ A;  3SH9 A;  2E8I A;  2IWD A;  5FAQ A;  4S2L A;  2IWC A;  4WBG A;  4FCF A;  4OQG A;  1NZO A;  1ES4 A;  1VQQ A;  3C7U A;  4X69 A;  1O07 A;  5FDH A;  5HFO A;  1CEF A;  2XEP A;  5FQK A;  4LCL A;  4MLL A;  3UPP A;  4EBN A;  2OLU A;  3C4O A;  4GDN A;  5DTT A;  1ERO A;  5E2G A;  5GLC A;  5A92 A;  4WZ5 A;  4R3B A;  4KZ7 A;  2FFY A;  4OH0 A;  1XKZ A;  4IVK A;  2EX8 A;  4JXS A;  3M6B A;  1CEG A;  1ES5 A;  3N8S A;  2QZ6 A;  2WKE A;  4KEN B;  5CED A;  1SKF A;  3IHB A;  1GCE A;  1ALQ A;  5HX9 A;  1ERQ A;  3VP3 A;  3VP2 A;  1K6R A;  4BD1 A;  1MWR A;  2V2F F;  2VGK A;  3JYI A;  4BL3 A;  4Y7P A;  1ESI A;  5EPH A;  3SH8 A;  4RX3 A;  3VOZ A;  4OPZ A;  4K91 A;  1JVJ A;  1KE0 A;  1NJ4 A;  4LV2 A;  4JBF A;  1XXM A;  3P98 A;  4ZJ2 A;  3Q7V B;  1LI0 A;  3Q7V A;  2P74 A;  3UDI A;  3NY4 A;  1E25 A;  1DY6 A;  1YLW A;  1K38 A;  4KZ4 A;  4E3M A;  4F94 A;  3VMA A;  4KZ3 A;  1H8Y A;  4HBT A;  1HTZ A;  3IF6 B;  2WGI A;  5M1A A;  1CI9 A;  2HDS A;  3TG9 A;  4X68 A;  2V20 A;  2XD1 A;  5TGF A;  1WE4 A;  1I2W A;  1L2S A;  2H0Y A;  2XK1 A;  1U60 A;  3Q1F A;  2RCX A;  3HLW A;  4MBH A;  3HLG A;  3PBS A;  3A3I A;  3W4O A;  3WS0 A;  4E6X A;  5KSC A;  2PBY A;  2Z2M B;  3HLE A;  1LL9 A;  4OVD A;  3MFD A;  4U3T A;  4QB8 A;  1IYS A;  1L0F A;  3DWZ A;  5CTM A;  2JE5 A;  3NDE A;  4K0X A;  1NY0 A;  1CK3 A;  3C7V A;  2ZQC A;  5AQ7 A;  5AQ9 A;  1OME A;  5F1F A;  2H10 A;  5FQM A;  1K57 A;  3CZD A;  4UHU A;  2P9V B;  1RP5 A;  4LEN A;  4NET A;  1IYO A;  2P9V A;  4UA7 A;  2WAD A;  1L0G A;  1KE4 A;  4EBP A;  4S2N C;  3DTM A;  2PU2 A;  2XD5 A;  4C6Y A;  1EI5 A;  3VP1 A;  1W8Q A;  3IXG A;  1N9B A;  3MZE A;  1ONH A;  2Q9N A;  2DCF A;  3GMW A;  1JWZ A;  3GVB A;  4UAA A;  5EVI A;  2BLS A;  1FSW A;  1TEM A;  3HLF A;  4R0Q A;  5G18 A;  1G6A A;  1IKG A;  4OPR A;  3CG5 A;  1JTG A;  3HRE A;  4N9L A;  4WM9 A;  5CHJ A;  4S2O A;  4ZDX A;  5L2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...