5KSCA

E166a/r274n/r276n toho-1 beta-lactamase aztreonam acyl-enzyme intermediate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kscA00
2J8YA 5AQ7A 1L2SA 3NC8A 5FQQA 2ZQCA 4HBUA 4Y0OA 3FKWA 4OOMA 5CTMA 5FQIA 2Y2MA 2WKHA 1DY6A 3HUNA 2A49A 5FI6A 4C75A 5KSHA 1GCEA 2Y4AA 2VGJA 5A91A 3BM6A 4WYYA 1IYPA 1FCNA 1IKIA 2Q9MA 5G18A 3UPNA 1MWTA 4DXCA 4GD6A 3LEZA 4U0XA 1KE0A 4WM9A 2R9WA 4MBFA 3FZCA 5GL9A 1TDLA 3ZG5A 4GD8A 5KZHA 1CEGA 3GTCA 2FFYA 3VP0A 3AGDA 1K38A 1OMEA 1SHVA 4JKTA 2EFXA 4EBPA 5CGWA 4QJGA 1SDEA 3G31A 4O7DA 4DF6A 4QD4A 4WELA 5CGSA 3VFFA 2XDMA 2ZM2A 1AXBA 3CJMA 1O07A 3IF6C 5EE8A 1K55A 1MBLA 2WYXA 4OOLA 5F1FA 4UA7A 3PAEA 4KZ7A 4XUZA 1L0GA 3IWOA 4DE2A 4X68A 1PWCA 2QMIA 2I72A 4GDBA 1LLBA 2ZQDA 4WZ5C 1BULA 2Y2OA 3C7UA 4BLMA 3CG5A 3HLEA 3MZFA 1PW8A 3C5AA 3MKFA 4KZAA 4S2PA 5AQBA 1IEMA 3C4PA 3IF6B 3A3DA 3VSLA 2J7VA 2ZC7A 1GHIA 3PTEA 2XFTA 3LO7A 3ZG0A 1E3UD 1K57A 3TSGA 3ZVWA 4IVKA 3GVBA 4OVDA 4GZBA 4WMCD 3IH9A 4DE3A 2BG1A 2P9VA 1BTLA 4D2OA 2XR0A 5FI2A 1MWRA 3PBRA 3PBOA 2ZQ8A 4IVIA 2Y2GA 3MZEA 3NCKA 4OOYA 4QB8A 4DDSA 1W8YA 2Y2PA 3HLBA 3QNBA 3HUOA 1XX2A 4JLFA 4N1HA 3IXBA 4KZ5A 5DTTA 1K4EA 3CZDA 4BL3A 5CXWA 4PM5A 1Z6FA 3ZG7B 4MNRA 4C6YA 4WZ5A 5KMWA 2QZ6A 4E3LA 3W4PA 4WMCA 1LI9A 1PIOA 2WGIA 4X55A 1XGJA 2ZC5B 1DJAA 1LL5A 3OZHA 1W7FA 2GDNA 5HL1A 4ID4A 3NIAA 4OP8A 4QU3A 1L0FA 3UPOA 3IF6A 1CI8A 1KVMA 1VM1A 4UHUA 1ONHA 1IYOA 3M6BA 5J8XA 2WGVA 1RGYA 5E2GA 4E6XA 3HREA 4N1XA 1BZAA 5IHVA 4NETA 4DXBA 3SS4A 1H8YA 2ZM0A 3GQZA 2Y2IA 3O87A 4RYEA 4WEKA 3AGEA 2B5RA 5DTSA 1E4DA 4MLLA 5E2EA 2HDQA 2PU2A 4MBKA 4JXVA 2BLSA 1NJ4A 5FQ9A 2XEPA 4BL2A 1BLSA 1YQSA 5EOOA 1LL9A 1PW1A 4XUXA 4OLDA 2PU4A 4UA6A 5FQJA 3OCLA 2Y55A 4M3KA 3OPHA 1L0DA 3BLSA 2XD1A 5FSRA 2OSUA 1K4FA 1KGFA 2A3UA 1XA1A 4B88A 2ZQ9A 2XD5A 5EVIC 3RJUA 3MFDA 3UDIA 3FWLA 1W8QA 3GR2A 3E2LA 1GHPA 5GLAA 1VQQA 5F83A 1FQGA 3WS4A 4HESA 3A3JA 3G2YA 2XFSA 3G35A 1K25A 2G2WA 1YLTA 3NDGA 4E3OA 1K56A 3P09A 1K57C 4OQ0A 2HP9A 1FCOA 2V20A 1YMSA 3VOZA 4ZAMA 1H5XA 4B4XA 3NDEA 4BJPA 3UDFA 1SDNA 2J9PA 2EX8A 4KZBA 5L2FA 4GNUA 1W5DA 3HBRA 3VSKA 4R0QA 3LCEA 1CI9A 1Q2PA 4KZ8A 4KQQA 3V39A 4JPMA 3A3EA 4DE0A 3RXXA 4H8RA 1K55C 1PYYA 3WS0A 1YLJA 5EUAA 4S2OA 4EBLA 4E3IA 3Q81A 3HLFA 1LI0A 3OPRA 2X71A 1N9BA 2P9VB 2HPBA 5M18A 2EX6A 3SS5A 4LV1A 1YLZA 3IF5A 3PBQA 5TR7A 3B3XA 4ZTKA 4C3QA 4E3NA 3MKEA 2DRWA 3FYZA 4WEJA 5GLBA 3MZDA 1GA9A 5U47A 1RP5A 2HDSA 3GV9A 5CTNA 2OLVA 5E2HA 3HLGA 5KSCA 1BLHA 3DW0A 4Y7PA 1JWVA 3N8SA 3P98A 3PBTA 2IWCA 3MXSA 3N8RA 4JBFA 5EVLA 3O3VA 5EVIB 5HX9A 4LENA 3IHBA 2OV5A 1JVJA 1HZOA 5A92A 3BYDA 3OPPA 3M2JA 4F94A 1C3BA 1WYBA 3ZNYA 4JF5A 1ZC2A 4K0WA 1FR6A 5EOEA 3VOYA 4R3BA 1BUEA 4QY6A 2Y59A 3I7JA 3C4OA 3W4QA 4OP5A 3ITAA 1LHYA 3E2KA 4PM7A 4N92A 5HARA 4YFMA 1NYYA 1PZPA 4X56A 1FR1A 1I2SA 5M1AA 3ZDJA 3ISGA 2ZM8A 1MKIA 2WKEA 2WZZA 4GDNA 1YM1A 5TGFA 2FFFB 1I2WA 5FA7A 3VMAA 5GHYA 2V1ZA 1O7EA 2Y2QA 1HD8A 1KE3A 3S1YA 1PI4A 1HTZA 1L0EA 3A3IA 4OQHA 3CMZA 4HBTA 3HLDA 4S2LA 2XQZA 2CC1A 3UE1A 3WRZA 3SH8A 1CEFA 4WZ4A 1ESIA 1ESUA 4ZJ2A 2DNSA 3SH7A 2EXAA 5HAQA 1HVBA 3VFHA 2Y2KA 4KG5A 2IWDA 4A5RA 1N4OA 1S6RA 3ZG8B 2XH9A 2WAFA 2HP5A 4LCLA 4IBRA 1FCMA 3V3RA 4OONA 2HDRA 3IXHA 1NYMA 4N9KA 3ZNTA 1ES5A 3PAGA 4B4ZA 3IXGA 3DTMA 4R23A 1K54C 4S2IA 3DWZA 2WGWB 4EV4A 1W79A 4UAAA 1CK3A 1MWSA 4IEDA 4P87A 4X53A 3S4XA 1PWDA 1Y54A 4L0LA 4K0XA 4JXWA 2P74A 4KZ4A 1K54A 1G68A 3Q82A 5F1GA 3W8KA 1KGGA 3NY4A 3VP4A 2VGKA 1NZUA 1YLYA 2QPNA 3Q7VB 1ES3A 3QHYA 3JYIA 1KGEA 5EVID 4S2JA 5CGXA 3SH9A 2XGNA 4OQGA 3SOIA 4Y0TA 4BD1A 3VP2A 2H0YA 1YT4A 4MEZA 3G34A 3NI9A 4KZ6A 1XGIA 4EQIA 1JWZA 3EQVA 5EECA 4UA9A 3HLWA 4EBNA 1NY0A 3PBNA 4RA7A 5D3OA 3G4PA 2Y91A 1XPBA 1ZKJA 4KG2A 4KZ3A 1K6RA 3PBSA 5GLDA 4GOGA 2Q9NA 1M6KA 4PM8A 3VP1A 1BSGA 1Q2QA 1RCJA 2EX9A 2ZC3B 2DCFA 5E2FA 2EX2A 2Y2LA 4E3MA 4FH4A 3IWQA 4P0MA 3N8LA 2ZC4B 3SS3A 1DJCA 4OPQA 1WYCA 3HL9A 1GA0A 5FAOA 1GHMA 4E3KA 1XXMA 5EVIA 3WS2A 5CEDA 2WKIA 3FV7A 2PBYA 2X02A 3ZVTA 4LV0A 1KE4A 2WZXA 1M40A 3ZG9B 4OLGA 2RL3A 2WK0A 5GLCA 2X01A 3UE3A 4BD0A 2ZC6B 4HEFA 4QY5A 5JYPA 4FH2A 5FAQA 1JWPA 3M6HA 4QHCA 4X69A 3ZFZA 3O88A 5FI7A 5FASA 3GRJA 3EQUA 2HDUA 2ZQAA 4KG6A 1I5QA 5FAPA 3UY6A 4DE1A 2Y2NA 4RX2A 1IELA 4N9LA 1YMXA 5HAIA 3LY4A 4R4SA 3UPPA 1FSWA 5DF7A 4OKPA 3IH8A 4R3JA 2WAEA 1PI5A 3C7VA 3N4IA 4LV3A 4JF4A 3UNWA 4P6BA 5DF9A 2XLNA 1S0WA 5CEBA 3BLMA 2IWBA 3FKVA 4P85A 2WADA 2ZLYA 4R4RA 4FD8A 2ZQ7A 3N6IA 1BLCA 3QNCA 2E8IA 1EROA 1NXYA 4PM6A 4S2NC 2JC7A 4JF6A 3WS1A 4WBGA 3DWKA 5DVAA 4ZJ3A 3UE0A 5JYOA 3OCNA 3A3FA 5F82A 4PM9A 1FSYA 1YLPA 3V50A 1DJBA 3BECA 1BT5A 1H8ZA 3IHAA 1ERMA 1KVLA 4FCFA 4GKUA 2EFUA 1ONGA 2RCXA 1RGZA 2V2FF 3BFFA 4K91A 3WS5A 1ES2A 1JTDA 2G2UA 5DTKA 1BLPA 3V5MA 3UO9A 1E25A 1IYQA 1SKFA 5CECA 3BRMA 5A93A 4E3JA 3ZGAB 1K56D 2WGWA 4GN2A 4U3TA 3WRTA 3IQAA 4KQRA 4ZJ1A 3IXDA 1SCWA 5CRFA 1MWUA 4E6WA 1TEMA 1K6SA 4DKIA 5CHUA 5CERA 2H10A 4X6TA 4ZBEA 4OH0A 1TDGA 3BFEA 1PWGA 3VP3A 4EUZA 2Z2MB 3V3SA 5CHMA 2OLUA 1EWZA 3GMWA 4PMAA 4LCMA 3D4FA 4CJNA 1QMEA 2H0TA 4RX3A 4CPKA 1XA7A 2JCHA 2ZD8A 3G30A 5GHXA 4BQMA 5A90A 1NZOA 3LY3A 3N7WA 4PPRA 1J9MA 3RXWA 1EI5A 4S2KA 5BOHA 5DF8A 4MBHA 1IKGA 1ZG6A 4FSFA 4IBXA 2XF3A 1NRFA 5M19A 4GB7A 5AQ9A 3S22A 3G2ZA 1IYSA 4LV2A 2Y2HA 3UN7A 3ZCZA 1PZOA 4RVAA 4OPRA 4U0TA 3OPLA 5GHZA 5I94A 1ES4A 2J9OA 1XP4A 1WE4A 4XXRA 5CHJA 1JTGA 2Z2LB 3Q07A 4S2MA 5HW3A 3HUMA 1U60A 3MBZA 4JXSA 4Z9QA 5FQKA 1YLWA 5FQMA 4BENA 2R9XA 2UWXA 2ZJ9A 5EPHA 2HP6A 3Q1FA 3GSGA 3G32A 1E3UA 2EXBA 2XK1A 4KZ9A 4OPZA 3O86A 1TVFA 3BFCA 1G6AA 3BFGA 1QMFA 3UDXA 1KDSA 4DDYA 4Q8IA 4OQIA 5AQAA 5FATA 3BEBA 3Q7VA 1MY8A 2C6WB 4Y0UA 5HFOA 3W4OA 2C5WB 4EWFA 2WUQA 1MXOA 4R1GA 5TFQA 3Q7ZA 1FOFA 1KDWA 1ALQA 4KQOA 2JBFA 5HAPA 3HVFA 3M2KA 3OC2A 4OPYA 2Y2JA 3TG9A 3WWXA 4S2NA 4DRTA 3HLCA 3MXRA 3NBLA 3IT9A 2H5SA 3IWIA 4ZDXA 3AGFA 2ZMAA 3TOIA 4NK3A 3ZHHA 1MPLA 4JXGA 1XKZA 4KENB 5FDHA 5E43A 1ERQA 3BFDA 4YINA 2JE5A 3ITBA 1ZG4A
chains in the Genus database with same CATH superfamily
5AQ7A 3NC8A 5FQQA 4GLQA 3HUNA 5FI6A 5HD5A 2Y4AA 4WYYA 3IX8A 1IYPA 3LICA 4IUKA 1YSQA 2V0WA 1W63Q 3JVVA 5GL9A 1CEGA 3IX3A 3LI8A 1K38A 1OMEA 1SHVA 4JKTA 3T1SA 4QJGA 3G31A 4DF6A 2HGVA 2XDMA 4MMNA 2JKGA 4Q0HA 5F1FA 3PAEA 4XUZA 2GJ3A 2E8JA 1SKOA 2ZQDA 4WZ5C 1BULA 4DE1A 3MKFA 4BWIA 3VSLA 4DJ2A 2LB5A 3ZVWA 4IVKA 3GVBA 3QP5A 2P9VA 2J3TD 5FL3A 5FI2A 2W3DA 2VJWA 2Y2GA 4QB8A 5EV0A 4P6ZM 2Y2PA 4N1HA 5DTTA 5CXWA 3LIEA 1Z6FA 3OOVA 3IBRA 3LIFA 4WMCA 2O9CA 4X55A 5EM1A 1W7FA 1VM1A 4P6ZS 4R6LA 1ONHA 3M6BA 5J8XA 3DTEA 1RGYA 5E2GA 4N1XA 4I5SA 4NETA 1H8YA 4WEKA 5A90A 3AGEA 4MLLA 5E2EA 2PU2A 4JXVA 4Q0IA 1TF1A 5EOOA 1LL9A 1PW1A 4O0PA 4OLDA 2PU4A 5FQJA 2VZWA 4EXOA 3OPHA 1LL8A 3D72A 4CLCE 2W3GA 1KGFA 2R78A 5IU1A 5EVIC 3UDIA 3WS4A 3A3JA 3G35A 1K25A 4ZRRA 3P09A 4OQ0A 2HP9A 1YMSA 3VOZA 4ZAMA 5FEGA 3NOPC 4PAUA 4KZBA 5L2FA 1T18A 3T50A 4KQQA 3RXXA 2A2LA 3P7NA 5EUAA 4S2OA 1W63M 2K2NA 2B02A 5M18A 3SS5A 3B3XA 4C3QA 2DRWA 3MZDA 5U47A 2VV8A 5CTNA 3GV9A 3DW0A 3N8SA 3P98A 1MKMA 5HX9A 2PR6A 2OV5A 4F94A 5TJJA 1LSWA 2O9AA 1P0ZA 3CLOA 3VE4A 2VK3A 3DTKA 5HARA 4I38A 3C30A 4JGRA 2WKEA 1YM1A 3NECA 1I2WA 3VV4A 2PD7A 1PI4A 4HBTA 2XQZA 1ESIA 4ZJ2A 2Y2KA 4ETXA 2OOLA 2YKHA 5DKLA 1NYMA 1ES5A 1W79A 1CK3A 4IEDA 1PWDA 2W3HA 4GCZA 5F1GA 3KSIA 3Q82A 2KX6A 1GSWA 3VP4A 2VGKA 2QPNA 1ES3A 2H28A 3MSHA 4OQGA 2JKTI 5L07A 3NI9A 4KZ6A 3S7QA 3EQVA 3HLWA 3G4PA 3LR4A 1ZKJA 2ACGA 3VOLA 5GLDA 4PM8A 4D60A 1Q2QA 2EX9A 2XRNA 2DCFA 2EX2A 4E3MA 3QP4A 1T1BA 3N8LA 1DJCA 3PHYA 5EVEA 4E3KA 4Y15A 3W2ZA 1XXMA 2X02A 1TS7A 3LI9A 1M40A 2YKFA 4HEFA 5JYPA 4IUHA 1VEUA 1OJGA 3ICYA 3GRJA 4X1MA 2K31A 3EEHA 2HJEA 4KG6A 3F1NA 1NRJA 4R4SA 1LT0A 5DF7A 2PDRA 3IH8A 4JF4A 4P6BA 4UQIM 3FKVA 1OJ5A 4R4RA 3N6IA 3LIDA 4PM6A 4YNRA 4L9FA 4JGPA 4WF0A 4PM9A 3O5YA 5CX7A 3V50A 4Y13A 2CMNA 1ERMA 1KVLA 1J3WA 3LIBA 3TRCA 2ZBBA 3BFFA 4K91A 5DTKA 2ZMFA 3V5MA 1E25A 1SKFA 1Z09A 3E98A 1K56D 2VEAA 4NEED 4LLOB 4E6WA 4HHDA 2P7JA 3UB6A 4OH0A 1PWGA 2WKPA 3BWLA 2L1MA 5CHMA 2OLUA 3GMWA 4LRXC 5L10A 4RX3A 2JKFA 4GHIA 5BOHA 1XJ2A 4IBXA 1NRFA 5M19A 4GB7A 3MFXA 5AQ9A 1IYSA 2PYRA 2W3FA 3H7WB 1P9WA 4OPRA 3OPLA 5GHZA 4EEPA 1G28A 2J9OA 1XP4A 3F1PA 4XXRA 2Z2LB 1HLUP 2GZAA 4Z9QA 5FQKA 1XFQA 2ZJ9A 2HP6A 3GSGA 3GDIA 1Y4OA 3FPWA 2EXBA 2VGLS 2XK1A 4KZ9A 4DMZA 1QMFA 1G5UA 1KDSA 5AQAA 4EWFA 4R1GA 3HCYA 1KDWA 1ALQA 4KQOA 2JBFA 3WWXA 3DAVA 3HLCA 3MXRA 4NK3A 4X25A 3ZHHA 1MPLA 3BFDA 2J8YA 2Y2MA 2WKHA 2A49A 5KSHA 4FUWA 4HIAA 1IKIA 3UPNA 4GD6A 5AVFA 2HV1A 4U0XA 5AJGA 3IX4A 5HWVA 2EA9A 1F98A 4EBPA 4O7DA 4WELA 3OLOA 3CJMA 3IF6C 3S7OA 2JKRM 1L0GA 1PWCA 2QMIA 4BBUA 5DFXA 4GDBA 2Y2OA 3D9YA 3CG5A 5AQBA 4JGOA 1IEMA 2J7VA 2ZC7A 4I3AA 3PTEA 3LO7A 4GZBA 4DE3A 2BG1A 4MCWA 3NCKA 4LFUA 1NLYA 1TS6A 1XX2A 3F1PB 3T4JA 4KZ5A 3CUEA 5F68A 1K4EA 3UB5P 4NXBA 4PM5A 4NXEA 3RFBA 3QP6A 3H7WA 4C6YA 2PYPA 4WZ5A 2OWHA 5HPFA 1D06A 2ZC5B 1DJAA 5HL1A 4ID4A 1L0FA 3S7NA 1CI8A 1KVMA 1XJ4A 2L0WA 2QYBA 4DXBA 4G3VA 4GHIB 2ZM0A 4BL2A 3LFVA 4MBKA 5FQ9A 2XEPA 1YQSA 3S7PA 1X0OA 3BW6A 3LR3A 3FPVA 3ZYTA 3F1OB 4WL9A 2Y55A 1L0DA 2FH5A 1S66L 2A3UA 2VA0A 2ZQ9A 5I5LA 3UB8A 3FC7A 3RJUA 3MFDA 4WLAA 4LGWA 5GLAA 3MJQA 5F83A 2I9VA 1FQGA 1ZHHB 3G2YA 5A8BA 1YKDA 4E3OA 5AVEA 3R7WA 2V20A 5EFWA 2J9PA 5HSQA 4HP4A 1W5DA 4KZ8A 4JPMA 2Y79A 4MDZA 3WS0A 4KUOA 4KUKA 1IOUA 3OPRA 2X71A 1N9BA 2P9VB 2EX6A 4LV1A 3PBQA 5TR7A 3FYZA 5GLBA 5HZHA 1DP6A 1GA9A 3R4KA 2OLVA 3HLGA 5FDSA 2A24A 3MXSA 4JBFA 3O3VA 3IHBA 1JVJA 3M2JA 2Z6CA 3LUQA 1ZC2A 3VOYA 4L9EA 4MN5A 3W4QA 3BY9A 4EQ1A 3E2KA 1NYYA 3HJIA 1I2SA 5HL6A 3ZDJA 2WZZA 3B42A 2FFFB 4HJ4A 3VMAA 5GHYA 4ARZB 1H8MA 1KE3A 1HTZA 3CMZA 4DN0A 2CC1A 3SH8A 4WZ4A 3K3CA 3A0SA 1LSVA 4LCLA 3V3RA 4OONA 3IXHA 5F6AA 3IS2A 4R23A 4EV4A 1K54C 4S2IA 3DWZA 4UAAA 4HH3A 1MWSA 4PHTA 4P87A 4X53A 3S4XA 1G6OA 3D3OA 4JXWA 3W8KA 3TE8A 1STZA 1T1AA 3NY4A 1S4SA 3Q7VB 3JYIA 4S2JA 5CGXA 3SH9A 4Y0TA 4ARZA 4CLCD 1UWNX 2H0YA 4ETZA 2V1AA 1XGIA 1JWZA 4UA9A 4EBNA 1NY0A 3PBNA 4EUVA 2Y91A 4KG2A 2V8FA 2W1RA 3MR0A 2Q9NA 1M6KA 5IT5A 5HDDA 4FH4A 3SS3A 1XFNA 1WYCA 5FAOA 2VKSA 2ZL1A 1GHMA 3HL9A 4E04A 3FV7A 4PKYA 1KE4A 3IBJA 4OLGA 2RL3A 2WK0A 2ZC6B 4QY5A 4FH2A 3M6HA 3CWFA 4QHCA 3O88A 5FI7A 4CLCC 3EQUA 2HDUA 2ZQAA 3UY6A 2V8CA 2Y2NA 4RX2A 5HAIA 3LY4A 4R3JA 2WAEA 3N4IA 4EW7A 5DF9A 4Z1WA 2XLNA 4F3LB 3BLMA 2IWBA 1OTEA 4P85A 1BLCA 3QNCA 2E8IA 4S2NC 2VV7A 2Y8HA 2V9AA 4WBGA 5EM0A 3K2NA 5F82A 3R7WB 1YLPA 1DJBA 1H8ZA 4FCFA 4GKUA 2EFUA 1H0MA 2W0NA 1JTDA 2G2UA 1MC0A 3NHQA 3BRMA 2B18A 3WRTA 3UE6A 3IXDA 5CRFA 1MWUA 1TEMA 2H10A 4X6TA 1OTDA 3UB9A 5DJUA 2Z2MB 2PR5A 4PMAA 4LCMA 2QJ5A 3D4FA 4CJNA 2H0TA 3LYXA 1NZOA 3N7WA 4PPRA 1J9MA 1EI5A 3T4SA 2OWJA 4S2KA 3PYPA 1IKGA 1ODVA 1ZG6A 4Q0JA 3S22A 4GS9B 4LV2A 4CLCB 4U0TA 2O99A 2NUPC 1WE4A 4EERA 2XA7M 4AFIA 5HW3A 3HUMA 1VB6A 1U60A 2IA2A 3MQQA 4BENA 3TJZC 3BY8A 1E3UA 2K7SA 1TVFA 3BFCA 3BFGA 3UDXA 5F5YA 4DDYA 5FATA 1YPRA 3T1QB 1P9RA 2C5WB 1VETA 3TW8A 5TFQA 3Q7ZA 3HVFA 3KO6A 4DRTA 3NBLA 1YSPA 2P04A 2H5SA 3IWIA 3AGFA 3T1RA 1KOUA 3TOIA 3K3DA 1FIKA 4JXGA 4GS9A 5E43A 2JE5A 1ZG4A 1FILA 2ZQCA 3CPTB 4Y0OA 5FQIA 3C2WA 4OOMA 1DY6A 1GCEA 2VGJA 5A91A 2Q9MA 1K0KA 1MWTA 1KE0A 4WM9A 2R9WA 3MQ0A 4MBFA 5KZHA 3ZG5A 4GD8A 3F1OA 3VP0A 1OTIA 4HQAA 3NOTC 3LR5A 2EFXA 3H82B 5HD3A 5CGWA 3VFFA 2W27A 2ZM2A 3VE3A 3T12B 2D02A 1K55A 1MBLA 4OOLA 4KZ7A 1A0KA 2B95A 4X68A 4WUJA 1CJFA 1LLBA 3T4TA 1PRQA 4BLMA 3MZFA 3HLEA 4S2PA 4KZAA 3C4PA 4LRZE 1E3UD 1K57A 3TSGA 4OVDA 3IH9A 1BTLA 2XR0A 3PBRA 3PBOA 4IVIA 4OOYA 4DDSA 1N9LA 3HUOA 3OBFA 3QNBA 3IXBA 3CZDA 2QWSA 2PRFA 3EGXC 3ZG7B 5J7EA 3CAXA 4E3LA 1PIOA 3A0RA 1XGJA 3SZTA 1LL5A 3OZHA 1UGUA 3NIAA 1P97A 5HDCA 3UPOA 4B93A 3EGDC 2INWA 5IHVA 3CI6A 5J4EA 2ZOIA 3SS4A 3ZNTA 3KYEA 2Y2IA 3O87A 4RYEA 2B5RA 2V1BA 2ZL1B 2W3EA 2PBDP 4JGQA 1V9YA 1F5MA 4UA6A 3OCLA 1XJ6A 3DTIA 2M7UA 3BLSA 2XD1A 5FSRA 2OSUA 1D1JA 1XA1A 4B88A 2Z6DA 4O8GA 2XD5A 4NG2A 3FWLA 3GR2A 1GHPA 1YLTA 3NDGA 3E0YA 2JHEA 4BJPA 3UDFA 1GSVA 4R0QA 3LCEA 1Q2PA 4DE0A 5MC7A 4UQIS 4H8RA 1PYYA 1YLJA 5L8MA 4EBLA 2J3WA 3HLFA 4EEUA 4HJ6A 3IF5A 5TBMB 1RP5A 5KSCA 2HJ9C 4Y7PA 1F2KA 3PBTA 3N8RA 5EVLA 5FEFA 1HZOA 4QPRA 5A92A 3OPPA 4K0WA 1FR6A 4R3BA 1BUEA 2Y59A 3C4OA 4OP5A 1S4RA 3ITAA 1GSXA 1S67L 4PM7A 4N92A 4X56A 1PZPA 3C8CA 5M1AA 3ISGA 2ZM8A 1NLZA 5J3WA 2WKQA 4GDNA 5TGFA 2BASA 2V1ZA 1T1CA 1O7EA 3S1YA 1L0EA 1CQAA 4OQHA 3HLDA 4S2LA 3UE1A 3L9KA 2EXAA 4HH2A 5HAQA 1HVBA 4B9OA 3ZG8B 1S6RA 2HP5A 1FCMA 2HDRA 3PAGA 3IXGA 3DTMA 1ZTUA 2VLGA 1Y54A 1PNEA 2WKRA 2P74A 1K54A 1KGGA 1T19A 1NZUA 1YLYA 3QHYA 3B33A 2FZ0A 2XGNA 4KQDA 3SOIA 3VP2A 4MEZA 4EQIA 3NOUC 4RA7A 5D3OA 1XPBA 4KZ3A 2GNXA 3VP1A 1BSGA 2ZC3B 1RCJA 5F69A 2Y2LA 1WA9A 4P0MA 4OPQA 4XT2B 4LRYC 1ACFA 3ZVTA 3ZG9B 2X01A 4Y17A 2VV6A 5GLCA 4EETB 3F1NB 4ESPA 5FAQA 4Y5FA 4X69A 3ZFZA 5FASA 1VEUB 3BQAA 1I5QA 2GX5A 4O01A 1IELA 3UPPA 3UNWA 1V9ZA 4RQ9A 3KX0X 5CEBA 3G6OA 3A0VA 1UWPX 2WADA 2HF6A 4FD8A 3BJNA 1SZVA 2JC7A 4JF6A 3WS1A 3UE0A 4ZJ3A 4I39A 5DJTA 3QP8A 3UMEA 1BT5A 2UV0E 1N9NA 2XA7S 5G4ZA 3PR6A 4Y2FA 2MJ6A 3GECA 3LGOA 2V2FF 3DBAA 3WS5A 5A93A 3KSFA 2WGWA 4BBTA 3IQAA 2EWWA 4ZJ1A 1SCWA 3H82A 1K6SA 5CHUA 4ZBEA 1TDGA 4EUZA 3VP3A 2J80A 1EWZA 1QMEA 2JKRI 3G30A 5GHXA 5HDSA 3LY3A 2OAQ1 1L3LA 3HJKA 4G3KA 5DF8A 3E4PA 4MBHA 4R38A 3CPTA 2QJ7A 2XF3A 1OTBA 1Y28A 3V67A 1F9IA 2EWVA 3T4QA 1VHMA 4HP9A 1PZOA 4RVAA 5I94A 1ES4A 1TS8A 1VETB 2UWXA 5EPHA 3Q1FA 3G32A 3UMDA 4OPZA 3ZQ5A 4EU0A 3O86A 1G6AA 2KOIA 4OQIA 3Q7VA 2VX8A 2W1TA 1MY8A 2C6WB 5HFOA 4PKYG 2WUQA 3RH8B 5HAPA 4OPYA 3OC2A 4S2NA 3IT9A 4I3IA 4ZDXA 2ZMAA 4M4XA 3JPUA 1XKZA 4KENB 4YWZA 1ERQA 2KLIA 1DP9A 2PD8A 1L2SA 4HBUA 3FKWA 5CTMA 5HWWA 4C75A 3BM6A 4CQHA 1FCNA 5G18A 5DKKA 3T1XA 4DXCA 3LEZA 3SW1A 2M7VA 3FZCA 1TDLA 4NKPA 3GTCA 3JVUA 2FFYA 3AGDA 2QKPA 2O0YA 2ZOHA 2O9BA 1SDEA 4QD4A 4H6JB 5CGSA 1AXBA 1O07A 5EE8A 2WYXA 5LBRA 4HY8A 4UA7A 3IWOA 4DE2A 2I72A 3C7UA 1PW8A 3C5AA 5TBMA 3IF6B 3A3DA 1GHIA 1DP8A 2XFTA 3ZG0A 1BYWA 3T4LA 3CUEC 4WMCD 4D2OA 3CITA 1MWRA 4IJGA 2ZQ8A 3MZEA 1W8YA 3HLBA 3QP1A 4JLFA 4F3LA 4BL3A 2VGLM 4MNRA 5KMWA 2QZ6A 3W4PA 1LI9A 2WGIA 1TS0A 2GDNA 4OP8A 4QU3A 3IF6A 4R3AA 4UHUA 1IYOA 2WGVA 3LIAA 3HREA 4E6XA 1BZAA 3GQZA 5DTSA 2JN7A 1E4DA 2XROA 2HDQA 1NJ4A 1OT6A 1BLSA 4XUXA 5KIZA 2BTFP 5C5KA 4M3KA 1K4FA 3NJAA 4DJ3A 1W8QA 3E2LA 1VQQA 4HESA 4IHQA 2XFSA 2G2WA 1K56A 1K57C 1FCOA 2AVXA 1H5XA 4B4XA 2XSSA 3NDEA 2L4RA 1SDNA 2EX8A 4GNUA 2PHYA 1H3QA 3HBRA 3NULA 3IS2B 3VSKA 1CI9A 3V39A 3A3EA 1K55C 4MN6A 1MZUA 2DMWA 4E3IA 3Q81A 1LI0A 2W1TB 2HPBA 3U2AA 1YLZA 4HOIA 2PT7A 2ZMVA 4ZTKA 4E3NA 3MKEA 3H9WA 4WEJA 2HDSA 2OAP1 5E2HA 3E4OA 1BLHA 1D7EA 5HPIA 1JWVA 2KDKA 4NXFA 2IWCA 4Y3IA 5EVIB 4LENA 3C38A 3UB7A 3BYDA 1C3BA 1WYBA 3ZNYA 4JF5A 5EOEA 5DFYA 4QY6A 3I7JA 5G4YA 4BBVA 1OPXA 1LHYA 4YFMA 2A24B 1FR1A 1CF0A 3U4LP 1MKIA 1S1YA 5FA7A 2Y2QA 1HD8A 4HNBA 3T4OA 3A3IA 4HJ3A 3CHWP 3WRZA 1CEFA 1ESUA 2G7UA 3SH7A 2DNSA 1S1ZA 3MS6A 3VFHA 4KG5A 3PXPA 2IWDA 4A5RA 3B47A 1N4OA 2XH9A 4II7A 2WAFA 4IBRA 1IFQA 3RTYA 4N9KA 4GW9A 4B4ZA 2LB9A 2WGWB 4YOFA 3KYQA 4ME4A 2NUTC 3L7HA 4L0LA 4K0XA 4KZ4A 1G68A 3KSGA 5EVID 1KGEA 4LPZA 1XJ3A 4BD1A 4X1LA 1YT4A 3G34A 4NXGA 5EECA 4GJ4A 1AWIA 1N9OA 1K6RA 2QHKA 4MN7A 3PBSA 4GOGA 4G3WA 1JNUA 2J3TC 5E2FA 3MXQA 3IWQA 1NWZA 2ZC4B 1GA0A 4CLCA 2M1CA 5EVIA 3WS2A 5CEDA 2WKIA 2PBYA 4LV0A 2WZXA 3UE3A 4K08A 4BD0A 1JWPA 2Q0OA 2HZ5A 5FAPA 4N9LA 1YMXA 1FSWA 4OKPA 1PI5A 3C7VA 3KYZA 4LV3A 4XT2A 1YAXA 3QP2A 3BQ8A 3T4KA 1S0WA 3MF0A 1EW0A 2ZLYA 2ZQ7A 1EROA 1NXYA 5HWTA 1OT9A 4R70A 3DWKA 5DVAA 5JYOA 3OCNA 3A3FA 1PFLA 2V0UA 3EEAA 1FSYA 3FG8A 3BECA 3IHAA 1SKOB 3LEQA 4L9GA 1ONGA 2RCXA 1RGZA 4FTXA 1ES2A 1BLPA 3UO9A 1IYQA 5CECA 4E3JA 3ZGAB 4GN2A 4U3TA 3EOIA 4KQRA 4DKIA 5CERA 2P08A 3BFEA 3LR0A 3V3SA 3ULFA 4CPKA 1XA7A 2JCHA 2ZD8A 3E4QA 4BQMA 4WN5A 3RXWA 5L09A 3MMHA 2D01A 4FSFA 1LSXA 3G2ZA 2Y2HA 3UN7A 3ZCZA 2JKTM 1TD5A 4FOFA 4I3JA 5CHJA 1JTGA 3KSHA 3Q07A 4S2MA 3MBZA 4JXSA 1YLWA 5FQMA 3EWKA 4UEYA 2R9XA 5K5BA 4Q8IA 3BEBA 3W4OA 4Y0UA 3MQOA 4BMWA 4HI4A 1MXOA 1FOFA 3M2KA 2Y2JA 2PAVP 4H6JA 3TG9A 5IS1A 4EESA 1DRMA 4QWOA 5FDHA 1OTAA 3P01A 4YINA 2BLSA 3ITBA
chains in the Genus database with same CATH topology
2J8YA 5AQ7A 1L2SA 3NC8A 5FQQA 2ZQCA 4HBUA 4Y0OA 3FKWA 4OOMA 5CTMA 5FQIA 2Y2MA 2WKHA 1DY6A 3HUNA 2A49A 5FI6A 4C75A 5KSHA 1GCEA 2Y4AA 2VGJA 5A91A 3BM6A 4WYYA 1IYPA 1FCNA 1IKIA 2Q9MA 5G18A 3UPNA 1MWTA 4DXCA 4GD6A 3LEZA 4U0XA 1KE0A 4WM9A 2R9WA 4MBFA 3FZCA 5GL9A 1TDLA 3ZG5A 4GD8A 5KZHA 1CEGA 3GTCA 2FFYA 3VP0A 3AGDA 1K38A 1OMEA 1SHVA 4JKTA 2EFXA 4EBPA 5CGWA 4QJGA 1SDEA 3G31A 4O7DA 4DF6A 4QD4A 4WELA 5CGSA 3VFFA 2XDMA 2ZM2A 1AXBA 3CJMA 1O07A 3IF6C 5EE8A 1K55A 1MBLA 2WYXA 4OOLA 5F1FA 4UA7A 3PAEA 4KZ7A 4XUZA 1L0GA 3IWOA 4DE2A 4X68A 1PWCA 2QMIA 2I72A 4GDBA 1LLBA 2ZQDA 4WZ5C 1BULA 2Y2OA 3C7UA 4BLMA 3CG5A 3HLEA 3MZFA 1PW8A 3C5AA 3MKFA 4KZAA 4S2PA 5AQBA 1IEMA 3C4PA 3IF6B 3A3DA 3VSLA 2J7VA 2ZC7A 1GHIA 3PTEA 2XFTA 3LO7A 3ZG0A 1E3UD 1K57A 3TSGA 3ZVWA 4IVKA 3GVBA 4OVDA 4GZBA 4WMCD 3IH9A 4DE3A 2BG1A 2P9VA 1BTLA 4D2OA 2XR0A 5FI2A 1MWRA 3PBRA 3PBOA 2ZQ8A 4IVIA 2Y2GA 3MZEA 3NCKA 4OOYA 4QB8A 4DDSA 1W8YA 2Y2PA 3HLBA 3QNBA 3HUOA 1XX2A 4JLFA 4N1HA 3IXBA 4KZ5A 5DTTA 1K4EA 3CZDA 4BL3A 5CXWA 4PM5A 1Z6FA 3ZG7B 4MNRA 4C6YA 4WZ5A 5KMWA 2QZ6A 4E3LA 3W4PA 4WMCA 1LI9A 1PIOA 2WGIA 4X55A 1XGJA 2ZC5B 1DJAA 1LL5A 3OZHA 1W7FA 2GDNA 5HL1A 4ID4A 3NIAA 4OP8A 4QU3A 1L0FA 3UPOA 3IF6A 1CI8A 1KVMA 1VM1A 4UHUA 1ONHA 1IYOA 3M6BA 5J8XA 2WGVA 1RGYA 5E2GA 4E6XA 3HREA 4N1XA 1BZAA 5IHVA 4NETA 4DXBA 3SS4A 1H8YA 2ZM0A 3GQZA 2Y2IA 3O87A 4RYEA 4WEKA 3AGEA 2B5RA 5DTSA 1E4DA 4MLLA 5E2EA 2HDQA 2PU2A 4MBKA 4JXVA 2BLSA 1NJ4A 5FQ9A 2XEPA 4BL2A 1BLSA 1YQSA 5EOOA 1LL9A 1PW1A 4XUXA 4OLDA 2PU4A 4UA6A 5FQJA 3OCLA 2Y55A 4M3KA 3OPHA 1L0DA 3BLSA 2XD1A 5FSRA 2OSUA 1K4FA 1KGFA 2A3UA 1XA1A 4B88A 2ZQ9A 2XD5A 5EVIC 3RJUA 3MFDA 3UDIA 3FWLA 1W8QA 3GR2A 3E2LA 1GHPA 5GLAA 1VQQA 5F83A 1FQGA 3WS4A 4HESA 3A3JA 3G2YA 2XFSA 3G35A 1K25A 2G2WA 1YLTA 3NDGA 4E3OA 1K56A 3P09A 1K57C 4OQ0A 2HP9A 1FCOA 2V20A 1YMSA 3VOZA 4ZAMA 1H5XA 4B4XA 3NDEA 4BJPA 3UDFA 1SDNA 2J9PA 2EX8A 4KZBA 5L2FA 4GNUA 1W5DA 3HBRA 3VSKA 4R0QA 3LCEA 1CI9A 1Q2PA 4KZ8A 4KQQA 3V39A 4JPMA 3A3EA 4DE0A 3RXXA 4H8RA 1K55C 1PYYA 3WS0A 1YLJA 5EUAA 4S2OA 4EBLA 4E3IA 3Q81A 3HLFA 1LI0A 3OPRA 2X71A 1N9BA 2P9VB 2HPBA 5M18A 2EX6A 3SS5A 4LV1A 1YLZA 3IF5A 3PBQA 5TR7A 3B3XA 4ZTKA 4C3QA 4E3NA 3MKEA 2DRWA 3FYZA 4WEJA 5GLBA 3MZDA 1GA9A 5U47A 1RP5A 2HDSA 3GV9A 5CTNA 2OLVA 5E2HA 3HLGA 5KSCA 1BLHA 3DW0A 4Y7PA 1JWVA 3N8SA 3P98A 3PBTA 2IWCA 3MXSA 3N8RA 4JBFA 5EVLA 3O3VA 5EVIB 5HX9A 4LENA 3IHBA 2OV5A 1JVJA 1HZOA 5A92A 3BYDA 3OPPA 3M2JA 4F94A 1C3BA 1WYBA 3ZNYA 4JF5A 1ZC2A 4K0WA 1FR6A 5EOEA 3VOYA 4R3BA 1BUEA 4QY6A 2Y59A 3I7JA 3C4OA 3W4QA 4OP5A 3ITAA 1LHYA 3E2KA 4PM7A 4N92A 5HARA 4YFMA 1NYYA 1PZPA 4X56A 1FR1A 1I2SA 5M1AA 3ZDJA 3ISGA 2ZM8A 1MKIA 2WKEA 2WZZA 4GDNA 1YM1A 5TGFA 2FFFB 1I2WA 5FA7A 3VMAA 5GHYA 2V1ZA 1O7EA 2Y2QA 1HD8A 1KE3A 3S1YA 1PI4A 1HTZA 1L0EA 3A3IA 4OQHA 3CMZA 4HBTA 3HLDA 4S2LA 2XQZA 2CC1A 3UE1A 3WRZA 3SH8A 1CEFA 4WZ4A 1ESIA 1ESUA 4ZJ2A 2DNSA 3SH7A 2EXAA 5HAQA 1HVBA 3VFHA 2Y2KA 4KG5A 2IWDA 4A5RA 1N4OA 1S6RA 3ZG8B 2XH9A 2WAFA 2HP5A 4LCLA 4IBRA 1FCMA 3V3RA 4OONA 2HDRA 3IXHA 1NYMA 4N9KA 3ZNTA 1ES5A 3PAGA 4B4ZA 3IXGA 3DTMA 4R23A 1K54C 4S2IA 3DWZA 2WGWB 4EV4A 1W79A 4UAAA 1CK3A 1MWSA 4IEDA 4P87A 4X53A 3S4XA 1PWDA 1Y54A 4L0LA 4K0XA 4JXWA 2P74A 4KZ4A 1K54A 1G68A 3Q82A 5F1GA 3W8KA 1KGGA 3NY4A 3VP4A 2VGKA 1NZUA 1YLYA 2QPNA 3Q7VB 1ES3A 3QHYA 3JYIA 1KGEA 5EVID 4S2JA 5CGXA 3SH9A 2XGNA 4OQGA 3SOIA 4Y0TA 4BD1A 3VP2A 2H0YA 1YT4A 4MEZA 3G34A 3NI9A 4KZ6A 1XGIA 4EQIA 1JWZA 3EQVA 5EECA 4UA9A 3HLWA 4EBNA 1NY0A 3PBNA 4RA7A 5D3OA 3G4PA 2Y91A 1XPBA 1ZKJA 4KG2A 4KZ3A 1K6RA 3PBSA 5GLDA 4GOGA 2Q9NA 1M6KA 4PM8A 3VP1A 1BSGA 1Q2QA 1RCJA 2EX9A 2ZC3B 2DCFA 5E2FA 2EX2A 2Y2LA 4E3MA 4FH4A 3IWQA 4P0MA 3N8LA 2ZC4B 3SS3A 1DJCA 4OPQA 1WYCA 3HL9A 1GA0A 5FAOA 1GHMA 4E3KA 1XXMA 5EVIA 3WS2A 5CEDA 2WKIA 3FV7A 2PBYA 2X02A 3ZVTA 4LV0A 1KE4A 2WZXA 1M40A 3ZG9B 4OLGA 2RL3A 2WK0A 5GLCA 2X01A 3UE3A 4BD0A 2ZC6B 4HEFA 4QY5A 5JYPA 4FH2A 5FAQA 1JWPA 3M6HA 4QHCA 4X69A 3ZFZA 3O88A 5FI7A 5FASA 3GRJA 3EQUA 2HDUA 2ZQAA 4KG6A 1I5QA 5FAPA 3UY6A 4DE1A 2Y2NA 4RX2A 1IELA 4N9LA 1YMXA 5HAIA 3LY4A 4R4SA 3UPPA 1FSWA 5DF7A 4OKPA 3IH8A 4R3JA 2WAEA 1PI5A 3C7VA 3N4IA 4LV3A 4JF4A 3UNWA 4P6BA 5DF9A 2XLNA 1S0WA 5CEBA 3BLMA 2IWBA 3FKVA 4P85A 2WADA 2ZLYA 4R4RA 4FD8A 2ZQ7A 3N6IA 1BLCA 3QNCA 2E8IA 1EROA 1NXYA 4PM6A 4S2NC 2JC7A 4JF6A 3WS1A 4WBGA 3DWKA 5DVAA 4ZJ3A 3UE0A 5JYOA 3OCNA 3A3FA 5F82A 4PM9A 1FSYA 1YLPA 3V50A 1DJBA 3BECA 1BT5A 1H8ZA 3IHAA 1ERMA 1KVLA 4FCFA 4GKUA 2EFUA 1ONGA 2RCXA 1RGZA 2V2FF 3BFFA 4K91A 3WS5A 1ES2A 1JTDA 2G2UA 5DTKA 1BLPA 3V5MA 3UO9A 1E25A 1IYQA 1SKFA 5CECA 3BRMA 5A93A 4E3JA 3ZGAB 1K56D 2WGWA 4GN2A 4U3TA 3WRTA 3IQAA 4KQRA 4ZJ1A 3IXDA 1SCWA 5CRFA 1MWUA 4E6WA 1TEMA 1K6SA 4DKIA 5CHUA 5CERA 2H10A 4X6TA 4ZBEA 4OH0A 1TDGA 3BFEA 1PWGA 3VP3A 4EUZA 2Z2MB 3V3SA 5CHMA 2OLUA 1EWZA 3GMWA 4PMAA 4LCMA 3D4FA 4CJNA 1QMEA 2H0TA 4RX3A 4CPKA 1XA7A 2JCHA 2ZD8A 3G30A 5GHXA 4BQMA 5A90A 1NZOA 3LY3A 3N7WA 4PPRA 1J9MA 3RXWA 1EI5A 4S2KA 5BOHA 5DF8A 4MBHA 1IKGA 1ZG6A 4FSFA 4IBXA 2XF3A 1NRFA 5M19A 4GB7A 5AQ9A 3S22A 3G2ZA 1IYSA 4LV2A 2Y2HA 3UN7A 3ZCZA 1PZOA 4RVAA 4OPRA 4U0TA 3OPLA 5GHZA 5I94A 1ES4A 2J9OA 1XP4A 1WE4A 4XXRA 5CHJA 1JTGA 2Z2LB 3Q07A 4S2MA 5HW3A 3HUMA 1U60A 3MBZA 4JXSA 4Z9QA 5FQKA 1YLWA 5FQMA 4BENA 2R9XA 2UWXA 2ZJ9A 5EPHA 2HP6A 3Q1FA 3GSGA 3G32A 1E3UA 2EXBA 2XK1A 4KZ9A 4OPZA 3O86A 1TVFA 3BFCA 1G6AA 3BFGA 1QMFA 3UDXA 1KDSA 4DDYA 4Q8IA 4OQIA 5AQAA 5FATA 3BEBA 3Q7VA 1MY8A 2C6WB 4Y0UA 5HFOA 3W4OA 2C5WB 4EWFA 2WUQA 1MXOA 4R1GA 5TFQA 3Q7ZA 1FOFA 1KDWA 1ALQA 4KQOA 2JBFA 5HAPA 3HVFA 3M2KA 3OC2A 4OPYA 2Y2JA 3TG9A 3WWXA 4S2NA 4DRTA 3HLCA 3MXRA 3NBLA 3IT9A 2H5SA 3IWIA 4ZDXA 3AGFA 2ZMAA 3TOIA 4NK3A 3ZHHA 1MPLA 4JXGA 1XKZA 4KENB 5FDHA 5E43A 1ERQA 3BFDA 4YINA 2JE5A 3ITBA 1ZG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8Y A;  5AQ7 A;  1L2S A;  3NC8 A;  5FQQ A;  2ZQC A;  4HBU A;  4Y0O A;  3FKW A;  4OOM A;  5CTM A;  5FQI A;  2Y2M A;  2WKH A;  1DY6 A;  3HUN A;  2A49 A;  5FI6 A;  4C75 A;  5KSH A;  1GCE A;  2Y4A A;  2VGJ A;  5A91 A;  3BM6 A;  4WYY A;  1IYP A;  1FCN A;  1IKI A;  2Q9M A;  5G18 A;  3UPN A;  1MWT A;  4DXC A;  4GD6 A;  3LEZ A;  4U0X A;  1KE0 A;  4WM9 A;  2R9W A;  4MBF A;  3FZC A;  5GL9 A;  1TDL A;  3ZG5 A;  4GD8 A;  5KZH A;  1CEG A;  3GTC A;  2FFY A;  3VP0 A;  3AGD A;  1K38 A;  1OME A;  1SHV A;  4JKT A;  2EFX A;  4EBP A;  5CGW A;  4QJG A;  1SDE A;  3G31 A;  4O7D A;  4DF6 A;  4QD4 A;  4WEL A;  5CGS A;  3VFF A;  2XDM A;  2ZM2 A;  1AXB A;  3CJM A;  1O07 A;  3IF6 C;  5EE8 A;  1K55 A;  1MBL A;  2WYX A;  4OOL A;  5F1F A;  4UA7 A;  3PAE A;  4KZ7 A;  4XUZ A;  1L0G A;  3IWO A;  4DE2 A;  4X68 A;  1PWC A;  2QMI A;  2I72 A;  4GDB A;  1LLB A;  2ZQD A;  4WZ5 C;  1BUL A;  2Y2O A;  3C7U A;  4BLM A;  3CG5 A;  3HLE A;  3MZF A;  1PW8 A;  3C5A A;  3MKF A;  4KZA A;  4S2P A;  5AQB A;  1IEM A;  3C4P A;  3IF6 B;  3A3D A;  3VSL A;  2J7V A;  2ZC7 A;  1GHI A;  3PTE A;  2XFT A;  3LO7 A;  3ZG0 A;  1E3U D;  1K57 A;  3TSG A;  3ZVW A;  4IVK A;  3GVB A;  4OVD A;  4GZB A;  4WMC D;  3IH9 A;  4DE3 A;  2BG1 A;  2P9V A;  1BTL A;  4D2O A;  2XR0 A;  5FI2 A;  1MWR A;  3PBR A;  3PBO A;  2ZQ8 A;  4IVI A;  2Y2G A;  3MZE A;  3NCK A;  4OOY A;  4QB8 A;  4DDS A;  1W8Y A;  2Y2P A;  3HLB A;  3QNB A;  3HUO A;  1XX2 A;  4JLF A;  4N1H A;  3IXB A;  4KZ5 A;  5DTT A;  1K4E A;  3CZD A;  4BL3 A;  5CXW A;  4PM5 A;  1Z6F A;  3ZG7 B;  4MNR A;  4C6Y A;  4WZ5 A;  5KMW A;  2QZ6 A;  4E3L A;  3W4P A;  4WMC A;  1LI9 A;  1PIO A;  2WGI A;  4X55 A;  1XGJ A;  2ZC5 B;  1DJA A;  1LL5 A;  3OZH A;  1W7F A;  2GDN A;  5HL1 A;  4ID4 A;  3NIA A;  4OP8 A;  4QU3 A;  1L0F A;  3UPO A;  3IF6 A;  1CI8 A;  1KVM A;  1VM1 A;  4UHU A;  1ONH A;  1IYO A;  3M6B A;  5J8X A;  2WGV A;  1RGY A;  5E2G A;  4E6X A;  3HRE A;  4N1X A;  1BZA A;  5IHV A;  4NET A;  4DXB A;  3SS4 A;  1H8Y A;  2ZM0 A;  3GQZ A;  2Y2I A;  3O87 A;  4RYE A;  4WEK A;  3AGE A;  2B5R A;  5DTS A;  1E4D A;  4MLL A;  5E2E A;  2HDQ A;  2PU2 A;  4MBK A;  4JXV A;  2BLS A;  1NJ4 A;  5FQ9 A;  2XEP A;  4BL2 A;  1BLS A;  1YQS A;  5EOO A;  1LL9 A;  1PW1 A;  4XUX A;  4OLD A;  2PU4 A;  4UA6 A;  5FQJ A;  3OCL A;  2Y55 A;  4M3K A;  3OPH A;  1L0D A;  3BLS A;  2XD1 A;  5FSR A;  2OSU A;  1K4F A;  1KGF A;  2A3U A;  1XA1 A;  4B88 A;  2ZQ9 A;  2XD5 A;  5EVI C;  3RJU A;  3MFD A;  3UDI A;  3FWL A;  1W8Q A;  3GR2 A;  3E2L A;  1GHP A;  5GLA A;  1VQQ A;  5F83 A;  1FQG A;  3WS4 A;  4HES A;  3A3J A;  3G2Y A;  2XFS A;  3G35 A;  1K25 A;  2G2W A;  1YLT A;  3NDG A;  4E3O A;  1K56 A;  3P09 A;  1K57 C;  4OQ0 A;  2HP9 A;  1FCO A;  2V20 A;  1YMS A;  3VOZ A;  4ZAM A;  1H5X A;  4B4X A;  3NDE A;  4BJP A;  3UDF A;  1SDN A;  2J9P A;  2EX8 A;  4KZB A;  5L2F A;  4GNU A;  1W5D A;  3HBR A;  3VSK A;  4R0Q A;  3LCE A;  1CI9 A;  1Q2P A;  4KZ8 A;  4KQQ A;  3V39 A;  4JPM A;  3A3E A;  4DE0 A;  3RXX A;  4H8R A;  1K55 C;  1PYY A;  3WS0 A;  1YLJ A;  5EUA A;  4S2O A;  4EBL A;  4E3I A;  3Q81 A;  3HLF A;  1LI0 A;  3OPR A;  2X71 A;  1N9B A;  2P9V B;  2HPB A;  5M18 A;  2EX6 A;  3SS5 A;  4LV1 A;  1YLZ A;  3IF5 A;  3PBQ A;  5TR7 A;  3B3X A;  4ZTK A;  4C3Q A;  4E3N A;  3MKE A;  2DRW A;  3FYZ A;  4WEJ A;  5GLB A;  3MZD A;  1GA9 A;  5U47 A;  1RP5 A;  2HDS A;  3GV9 A;  5CTN A;  2OLV A;  5E2H A;  3HLG A;  5KSC A;  1BLH A;  3DW0 A;  4Y7P A;  1JWV A;  3N8S A;  3P98 A;  3PBT A;  2IWC A;  3MXS A;  3N8R A;  4JBF A;  5EVL A;  3O3V A;  5EVI B;  5HX9 A;  4LEN A;  3IHB A;  2OV5 A;  1JVJ A;  1HZO A;  5A92 A;  3BYD A;  3OPP A;  3M2J A;  4F94 A;  1C3B A;  1WYB A;  3ZNY A;  4JF5 A;  1ZC2 A;  4K0W A;  1FR6 A;  5EOE A;  3VOY A;  4R3B A;  1BUE A;  4QY6 A;  2Y59 A;  3I7J A;  3C4O A;  3W4Q A;  4OP5 A;  3ITA A;  1LHY A;  3E2K A;  4PM7 A;  4N92 A;  5HAR A;  4YFM A;  1NYY A;  1PZP A;  4X56 A;  1FR1 A;  1I2S A;  5M1A A;  3ZDJ A;  3ISG A;  2ZM8 A;  1MKI A;  2WKE A;  2WZZ A;  4GDN A;  1YM1 A;  5TGF A;  2FFF B;  1I2W A;  5FA7 A;  3VMA A;  5GHY A;  2V1Z A;  1O7E A;  2Y2Q A;  1HD8 A;  1KE3 A;  3S1Y A;  1PI4 A;  1HTZ A;  1L0E A;  3A3I A;  4OQH A;  3CMZ A;  4HBT A;  3HLD A;  4S2L A;  2XQZ A;  2CC1 A;  3UE1 A;  3WRZ A;  3SH8 A;  1CEF A;  4WZ4 A;  1ESI A;  1ESU A;  4ZJ2 A;  2DNS A;  3SH7 A;  2EXA A;  5HAQ A;  1HVB A;  3VFH A;  2Y2K A;  4KG5 A;  2IWD A;  4A5R A;  1N4O A;  1S6R A;  3ZG8 B;  2XH9 A;  2WAF A;  2HP5 A;  4LCL A;  4IBR A;  1FCM A;  3V3R A;  4OON A;  2HDR A;  3IXH A;  1NYM A;  4N9K A;  3ZNT A;  1ES5 A;  3PAG A;  4B4Z A;  3IXG A;  3DTM A;  4R23 A;  1K54 C;  4S2I A;  3DWZ A;  2WGW B;  4EV4 A;  1W79 A;  4UAA A;  1CK3 A;  1MWS A;  4IED A;  4P87 A;  4X53 A;  3S4X A;  1PWD A;  1Y54 A;  4L0L A;  4K0X A;  4JXW A;  2P74 A;  4KZ4 A;  1K54 A;  1G68 A;  3Q82 A;  5F1G A;  3W8K A;  1KGG A;  3NY4 A;  3VP4 A;  2VGK A;  1NZU A;  1YLY A;  2QPN A;  3Q7V B;  1ES3 A;  3QHY A;  3JYI A;  1KGE A;  5EVI D;  4S2J A;  5CGX A;  3SH9 A;  2XGN A;  4OQG A;  3SOI A;  4Y0T A;  4BD1 A;  3VP2 A;  2H0Y A;  1YT4 A;  4MEZ A;  3G34 A;  3NI9 A;  4KZ6 A;  1XGI A;  4EQI A;  1JWZ A;  3EQV A;  5EEC A;  4UA9 A;  3HLW A;  4EBN A;  1NY0 A;  3PBN A;  4RA7 A;  5D3O A;  3G4P A;  2Y91 A;  1XPB A;  1ZKJ A;  4KG2 A;  4KZ3 A;  1K6R A;  3PBS A;  5GLD A;  4GOG A;  2Q9N A;  1M6K A;  4PM8 A;  3VP1 A;  1BSG A;  1Q2Q A;  1RCJ A;  2EX9 A;  2ZC3 B;  2DCF A;  5E2F A;  2EX2 A;  2Y2L A;  4E3M A;  4FH4 A;  3IWQ A;  4P0M A;  3N8L A;  2ZC4 B;  3SS3 A;  1DJC A;  4OPQ A;  1WYC A;  3HL9 A;  1GA0 A;  5FAO A;  1GHM A;  4E3K A;  1XXM A;  5EVI A;  3WS2 A;  5CED A;  2WKI A;  3FV7 A;  2PBY A;  2X02 A;  3ZVT A;  4LV0 A;  1KE4 A;  2WZX A;  1M40 A;  3ZG9 B;  4OLG A;  2RL3 A;  2WK0 A;  5GLC A;  2X01 A;  3UE3 A;  4BD0 A;  2ZC6 B;  4HEF A;  4QY5 A;  5JYP A;  4FH2 A;  5FAQ A;  1JWP A;  3M6H A;  4QHC A;  4X69 A;  3ZFZ A;  3O88 A;  5FI7 A;  5FAS A;  3GRJ A;  3EQU A;  2HDU A;  2ZQA A;  4KG6 A;  1I5Q A;  5FAP A;  3UY6 A;  4DE1 A;  2Y2N A;  4RX2 A;  1IEL A;  4N9L A;  1YMX A;  5HAI A;  3LY4 A;  4R4S A;  3UPP A;  1FSW A;  5DF7 A;  4OKP A;  3IH8 A;  4R3J A;  2WAE A;  1PI5 A;  3C7V A;  3N4I A;  4LV3 A;  4JF4 A;  3UNW A;  4P6B A;  5DF9 A;  2XLN A;  1S0W A;  5CEB A;  3BLM A;  2IWB A;  3FKV A;  4P85 A;  2WAD A;  2ZLY A;  4R4R A;  4FD8 A;  2ZQ7 A;  3N6I A;  1BLC A;  3QNC A;  2E8I A;  1ERO A;  1NXY A;  4PM6 A;  4S2N C;  2JC7 A;  4JF6 A;  3WS1 A;  4WBG A;  3DWK A;  5DVA A;  4ZJ3 A;  3UE0 A;  5JYO A;  3OCN A;  3A3F A;  5F82 A;  4PM9 A;  1FSY A;  1YLP A;  3V50 A;  1DJB A;  3BEC A;  1BT5 A;  1H8Z A;  3IHA A;  1ERM A;  1KVL A;  4FCF A;  4GKU A;  2EFU A;  1ONG A;  2RCX A;  1RGZ A;  2V2F F;  3BFF A;  4K91 A;  3WS5 A;  1ES2 A;  1JTD A;  2G2U A;  5DTK A;  1BLP A;  3V5M A;  3UO9 A;  1E25 A;  1IYQ A;  1SKF A;  5CEC A;  3BRM A;  5A93 A;  4E3J A;  3ZGA B;  1K56 D;  2WGW A;  4GN2 A;  4U3T A;  3WRT A;  3IQA A;  4KQR A;  4ZJ1 A;  3IXD A;  1SCW A;  5CRF A;  1MWU A;  4E6W A;  1TEM A;  1K6S A;  4DKI A;  5CHU A;  5CER A;  2H10 A;  4X6T A;  4ZBE A;  4OH0 A;  1TDG A;  3BFE A;  1PWG A;  3VP3 A;  4EUZ A;  2Z2M B;  3V3S A;  5CHM A;  2OLU A;  1EWZ A;  3GMW A;  4PMA A;  4LCM A;  3D4F A;  4CJN A;  1QME A;  2H0T A;  4RX3 A;  4CPK A;  1XA7 A;  2JCH A;  2ZD8 A;  3G30 A;  5GHX A;  4BQM A;  5A90 A;  1NZO A;  3LY3 A;  3N7W A;  4PPR A;  1J9M A;  3RXW A;  1EI5 A;  4S2K A;  5BOH A;  5DF8 A;  4MBH A;  1IKG A;  1ZG6 A;  4FSF A;  4IBX A;  2XF3 A;  1NRF A;  5M19 A;  4GB7 A;  5AQ9 A;  3S22 A;  3G2Z A;  1IYS A;  4LV2 A;  2Y2H A;  3UN7 A;  3ZCZ A;  1PZO A;  4RVA A;  4OPR A;  4U0T A;  3OPL A;  5GHZ A;  5I94 A;  1ES4 A;  2J9O A;  1XP4 A;  1WE4 A;  4XXR A;  5CHJ A;  1JTG A;  2Z2L B;  3Q07 A;  4S2M A;  5HW3 A;  3HUM A;  1U60 A;  3MBZ A;  4JXS A;  4Z9Q A;  5FQK A;  1YLW A;  5FQM A;  4BEN A;  2R9X A;  2UWX A;  2ZJ9 A;  5EPH A;  2HP6 A;  3Q1F A;  3GSG A;  3G32 A;  1E3U A;  2EXB A;  2XK1 A;  4KZ9 A;  4OPZ A;  3O86 A;  1TVF A;  3BFC A;  1G6A A;  3BFG A;  1QMF A;  3UDX A;  1KDS A;  4DDY A;  4Q8I A;  4OQI A;  5AQA A;  5FAT A;  3BEB A;  3Q7V A;  1MY8 A;  2C6W B;  4Y0U A;  5HFO A;  3W4O A;  2C5W B;  4EWF A;  2WUQ A;  1MXO A;  4R1G A;  5TFQ A;  3Q7Z A;  1FOF A;  1KDW A;  1ALQ A;  4KQO A;  2JBF A;  5HAP A;  3HVF A;  3M2K A;  3OC2 A;  4OPY A;  2Y2J A;  3TG9 A;  3WWX A;  4S2N A;  4DRT A;  3HLC A;  3MXR A;  3NBL A;  3IT9 A;  2H5S A;  3IWI A;  4ZDX A;  3AGF A;  2ZMA A;  3TOI A;  4NK3 A;  3ZHH A;  1MPL A;  4JXG A;  1XKZ A;  4KEN B;  5FDH A;  5E43 A;  1ERQ A;  3BFD A;  4YIN A;  2JE5 A;  3ITB A;  1ZG4 A; 
#chains in the Genus database with same CATH topology
 5AQ7 A;  3NC8 A;  5FQQ A;  4GLQ A;  3HUN A;  5FI6 A;  5HD5 A;  2Y4A A;  4WYY A;  3IX8 A;  1IYP A;  3LIC A;  4IUK A;  1YSQ A;  2V0W A;  1W63 Q;  3JVV A;  5GL9 A;  1CEG A;  3IX3 A;  3LI8 A;  1K38 A;  1OME A;  1SHV A;  4JKT A;  3T1S A;  4QJG A;  3G31 A;  4DF6 A;  2HGV A;  2XDM A;  4MMN A;  2JKG A;  4Q0H A;  5F1F A;  3PAE A;  4XUZ A;  2GJ3 A;  2E8J A;  1SKO A;  2ZQD A;  4WZ5 C;  1BUL A;  4DE1 A;  3MKF A;  4BWI A;  3VSL A;  4DJ2 A;  2LB5 A;  3ZVW A;  4IVK A;  3GVB A;  3QP5 A;  2P9V A;  2J3T D;  5FL3 A;  5FI2 A;  2W3D A;  2VJW A;  2Y2G A;  4QB8 A;  5EV0 A;  4P6Z M;  2Y2P A;  4N1H A;  5DTT A;  5CXW A;  3LIE A;  1Z6F A;  3OOV A;  3IBR A;  3LIF A;  4WMC A;  2O9C A;  4X55 A;  5EM1 A;  1W7F A;  1VM1 A;  4P6Z S;  4R6L A;  1ONH A;  3M6B A;  5J8X A;  3DTE A;  1RGY A;  5E2G A;  4N1X A;  4I5S A;  4NET A;  1H8Y A;  4WEK A;  5A90 A;  3AGE A;  4MLL A;  5E2E A;  2PU2 A;  4JXV A;  4Q0I A;  1TF1 A;  5EOO A;  1LL9 A;  1PW1 A;  4O0P A;  4OLD A;  2PU4 A;  5FQJ A;  2VZW A;  4EXO A;  3OPH A;  1LL8 A;  3D72 A;  4CLC E;  2W3G A;  1KGF A;  2R78 A;  5IU1 A;  5EVI C;  3UDI A;  3WS4 A;  3A3J A;  3G35 A;  1K25 A;  4ZRR A;  3P09 A;  4OQ0 A;  2HP9 A;  1YMS A;  3VOZ A;  4ZAM A;  5FEG A;  3NOP C;  4PAU A;  4KZB A;  5L2F A;  1T18 A;  3T50 A;  4KQQ A;  3RXX A;  2A2L A;  3P7N A;  5EUA A;  4S2O A;  1W63 M;  2K2N A;  2B02 A;  5M18 A;  3SS5 A;  3B3X A;  4C3Q A;  2DRW A;  3MZD A;  5U47 A;  2VV8 A;  5CTN A;  3GV9 A;  3DW0 A;  3N8S A;  3P98 A;  1MKM A;  5HX9 A;  2PR6 A;  2OV5 A;  4F94 A;  5TJJ A;  1LSW A;  2O9A A;  1P0Z A;  3CLO A;  3VE4 A;  2VK3 A;  3DTK A;  5HAR A;  4I38 A;  3C30 A;  4JGR A;  2WKE A;  1YM1 A;  3NEC A;  1I2W A;  3VV4 A;  2PD7 A;  1PI4 A;  4HBT A;  2XQZ A;  1ESI A;  4ZJ2 A;  2Y2K A;  4ETX A;  2OOL A;  2YKH A;  5DKL A;  1NYM A;  1ES5 A;  1W79 A;  1CK3 A;  4IED A;  1PWD A;  2W3H A;  4GCZ A;  5F1G A;  3KSI A;  3Q82 A;  2KX6 A;  1GSW A;  3VP4 A;  2VGK A;  2QPN A;  1ES3 A;  2H28 A;  3MSH A;  4OQG A;  2JKT I;  5L07 A;  3NI9 A;  4KZ6 A;  3S7Q A;  3EQV A;  3HLW A;  3G4P A;  3LR4 A;  1ZKJ A;  2ACG A;  3VOL A;  5GLD A;  4PM8 A;  4D60 A;  1Q2Q A;  2EX9 A;  2XRN A;  2DCF A;  2EX2 A;  4E3M A;  3QP4 A;  1T1B A;  3N8L A;  1DJC A;  3PHY A;  5EVE A;  4E3K A;  4Y15 A;  3W2Z A;  1XXM A;  2X02 A;  1TS7 A;  3LI9 A;  1M40 A;  2YKF A;  4HEF A;  5JYP A;  4IUH A;  1VEU A;  1OJG A;  3ICY A;  3GRJ A;  4X1M A;  2K31 A;  3EEH A;  2HJE A;  4KG6 A;  3F1N A;  1NRJ A;  4R4S A;  1LT0 A;  5DF7 A;  2PDR A;  3IH8 A;  4JF4 A;  4P6B A;  4UQI M;  3FKV A;  1OJ5 A;  4R4R A;  3N6I A;  3LID A;  4PM6 A;  4YNR A;  4L9F A;  4JGP A;  4WF0 A;  4PM9 A;  3O5Y A;  5CX7 A;  3V50 A;  4Y13 A;  2CMN A;  1ERM A;  1KVL A;  1J3W A;  3LIB A;  3TRC A;  2ZBB A;  3BFF A;  4K91 A;  5DTK A;  2ZMF A;  3V5M A;  1E25 A;  1SKF A;  1Z09 A;  3E98 A;  1K56 D;  2VEA A;  4NEE D;  4LLO B;  4E6W A;  4HHD A;  2P7J A;  3UB6 A;  4OH0 A;  1PWG A;  2WKP A;  3BWL A;  2L1M A;  5CHM A;  2OLU A;  3GMW A;  4LRX C;  5L10 A;  4RX3 A;  2JKF A;  4GHI A;  5BOH A;  1XJ2 A;  4IBX A;  1NRF A;  5M19 A;  4GB7 A;  3MFX A;  5AQ9 A;  1IYS A;  2PYR A;  2W3F A;  3H7W B;  1P9W A;  4OPR A;  3OPL A;  5GHZ A;  4EEP A;  1G28 A;  2J9O A;  1XP4 A;  3F1P A;  4XXR A;  2Z2L B;  1HLU P;  2GZA A;  4Z9Q A;  5FQK A;  1XFQ A;  2ZJ9 A;  2HP6 A;  3GSG A;  3GDI A;  1Y4O A;  3FPW A;  2EXB A;  2VGL S;  2XK1 A;  4KZ9 A;  4DMZ A;  1QMF A;  1G5U A;  1KDS A;  5AQA A;  4EWF A;  4R1G A;  3HCY A;  1KDW A;  1ALQ A;  4KQO A;  2JBF A;  3WWX A;  3DAV A;  3HLC A;  3MXR A;  4NK3 A;  4X25 A;  3ZHH A;  1MPL A;  3BFD A;  2J8Y A;  2Y2M A;  2WKH A;  2A49 A;  5KSH A;  4FUW A;  4HIA A;  1IKI A;  3UPN A;  4GD6 A;  5AVF A;  2HV1 A;  4U0X A;  5AJG A;  3IX4 A;  5HWV A;  2EA9 A;  1F98 A;  4EBP A;  4O7D A;  4WEL A;  3OLO A;  3CJM A;  3IF6 C;  3S7O A;  2JKR M;  1L0G A;  1PWC A;  2QMI A;  4BBU A;  5DFX A;  4GDB A;  2Y2O A;  3D9Y A;  3CG5 A;  5AQB A;  4JGO A;  1IEM A;  2J7V A;  2ZC7 A;  4I3A A;  3PTE A;  3LO7 A;  4GZB A;  4DE3 A;  2BG1 A;  4MCW A;  3NCK A;  4LFU A;  1NLY A;  1TS6 A;  1XX2 A;  3F1P B;  3T4J A;  4KZ5 A;  3CUE A;  5F68 A;  1K4E A;  3UB5 P;  4NXB A;  4PM5 A;  4NXE A;  3RFB A;  3QP6 A;  3H7W A;  4C6Y A;  2PYP A;  4WZ5 A;  2OWH A;  5HPF A;  1D06 A;  2ZC5 B;  1DJA A;  5HL1 A;  4ID4 A;  1L0F A;  3S7N A;  1CI8 A;  1KVM A;  1XJ4 A;  2L0W A;  2QYB A;  4DXB A;  4G3V A;  4GHI B;  2ZM0 A;  4BL2 A;  3LFV A;  4MBK A;  5FQ9 A;  2XEP A;  1YQS A;  3S7P A;  1X0O A;  3BW6 A;  3LR3 A;  3FPV A;  3ZYT A;  3F1O B;  4WL9 A;  2Y55 A;  1L0D A;  2FH5 A;  1S66 L;  2A3U A;  2VA0 A;  2ZQ9 A;  5I5L A;  3UB8 A;  3FC7 A;  3RJU A;  3MFD A;  4WLA A;  4LGW A;  5GLA A;  3MJQ A;  5F83 A;  2I9V A;  1FQG A;  1ZHH B;  3G2Y A;  5A8B A;  1YKD A;  4E3O A;  5AVE A;  3R7W A;  2V20 A;  5EFW A;  2J9P A;  5HSQ A;  4HP4 A;  1W5D A;  4KZ8 A;  4JPM A;  2Y79 A;  4MDZ A;  3WS0 A;  4KUO A;  4KUK A;  1IOU A;  3OPR A;  2X71 A;  1N9B A;  2P9V B;  2EX6 A;  4LV1 A;  3PBQ A;  5TR7 A;  3FYZ A;  5GLB A;  5HZH A;  1DP6 A;  1GA9 A;  3R4K A;  2OLV A;  3HLG A;  5FDS A;  2A24 A;  3MXS A;  4JBF A;  3O3V A;  3IHB A;  1JVJ A;  3M2J A;  2Z6C A;  3LUQ A;  1ZC2 A;  3VOY A;  4L9E A;  4MN5 A;  3W4Q A;  3BY9 A;  4EQ1 A;  3E2K A;  1NYY A;  3HJI A;  1I2S A;  5HL6 A;  3ZDJ A;  2WZZ A;  3B42 A;  2FFF B;  4HJ4 A;  3VMA A;  5GHY A;  4ARZ B;  1H8M A;  1KE3 A;  1HTZ A;  3CMZ A;  4DN0 A;  2CC1 A;  3SH8 A;  4WZ4 A;  3K3C A;  3A0S A;  1LSV A;  4LCL A;  3V3R A;  4OON A;  3IXH A;  5F6A A;  3IS2 A;  4R23 A;  4EV4 A;  1K54 C;  4S2I A;  3DWZ A;  4UAA A;  4HH3 A;  1MWS A;  4PHT A;  4P87 A;  4X53 A;  3S4X A;  1G6O A;  3D3O A;  4JXW A;  3W8K A;  3TE8 A;  1STZ A;  1T1A A;  3NY4 A;  1S4S A;  3Q7V B;  3JYI A;  4S2J A;  5CGX A;  3SH9 A;  4Y0T A;  4ARZ A;  4CLC D;  1UWN X;  2H0Y A;  4ETZ A;  2V1A A;  1XGI A;  1JWZ A;  4UA9 A;  4EBN A;  1NY0 A;  3PBN A;  4EUV A;  2Y91 A;  4KG2 A;  2V8F A;  2W1R A;  3MR0 A;  2Q9N A;  1M6K A;  5IT5 A;  5HDD A;  4FH4 A;  3SS3 A;  1XFN A;  1WYC A;  5FAO A;  2VKS A;  2ZL1 A;  1GHM A;  3HL9 A;  4E04 A;  3FV7 A;  4PKY A;  1KE4 A;  3IBJ A;  4OLG A;  2RL3 A;  2WK0 A;  2ZC6 B;  4QY5 A;  4FH2 A;  3M6H A;  3CWF A;  4QHC A;  3O88 A;  5FI7 A;  4CLC C;  3EQU A;  2HDU A;  2ZQA A;  3UY6 A;  2V8C A;  2Y2N A;  4RX2 A;  5HAI A;  3LY4 A;  4R3J A;  2WAE A;  3N4I A;  4EW7 A;  5DF9 A;  4Z1W A;  2XLN A;  4F3L B;  3BLM A;  2IWB A;  1OTE A;  4P85 A;  1BLC A;  3QNC A;  2E8I A;  4S2N C;  2VV7 A;  2Y8H A;  2V9A A;  4WBG A;  5EM0 A;  3K2N A;  5F82 A;  3R7W B;  1YLP A;  1DJB A;  1H8Z A;  4FCF A;  4GKU A;  2EFU A;  1H0M A;  2W0N A;  1JTD A;  2G2U A;  1MC0 A;  3NHQ A;  3BRM A;  2B18 A;  3WRT A;  3UE6 A;  3IXD A;  5CRF A;  1MWU A;  1TEM A;  2H10 A;  4X6T A;  1OTD A;  3UB9 A;  5DJU A;  2Z2M B;  2PR5 A;  4PMA A;  4LCM A;  2QJ5 A;  3D4F A;  4CJN A;  2H0T A;  3LYX A;  1NZO A;  3N7W A;  4PPR A;  1J9M A;  1EI5 A;  3T4S A;  2OWJ A;  4S2K A;  3PYP A;  1IKG A;  1ODV A;  1ZG6 A;  4Q0J A;  3S22 A;  4GS9 B;  4LV2 A;  4CLC B;  4U0T A;  2O99 A;  2NUP C;  1WE4 A;  4EER A;  2XA7 M;  4AFI A;  5HW3 A;  3HUM A;  1VB6 A;  1U60 A;  2IA2 A;  3MQQ A;  4BEN A;  3TJZ C;  3BY8 A;  1E3U A;  2K7S A;  1TVF A;  3BFC A;  3BFG A;  3UDX A;  5F5Y A;  4DDY A;  5FAT A;  1YPR A;  3T1Q B;  1P9R A;  2C5W B;  1VET A;  3TW8 A;  5TFQ A;  3Q7Z A;  3HVF A;  3KO6 A;  4DRT A;  3NBL A;  1YSP A;  2P04 A;  2H5S A;  3IWI A;  3AGF A;  3T1R A;  1KOU A;  3TOI A;  3K3D A;  1FIK A;  4JXG A;  4GS9 A;  5E43 A;  2JE5 A;  1ZG4 A;  1FIL A;  2ZQC A;  3CPT B;  4Y0O A;  5FQI A;  3C2W A;  4OOM A;  1DY6 A;  1GCE A;  2VGJ A;  5A91 A;  2Q9M A;  1K0K A;  1MWT A;  1KE0 A;  4WM9 A;  2R9W A;  3MQ0 A;  4MBF A;  5KZH A;  3ZG5 A;  4GD8 A;  3F1O A;  3VP0 A;  1OTI A;  4HQA A;  3NOT C;  3LR5 A;  2EFX A;  3H82 B;  5HD3 A;  5CGW A;  3VFF A;  2W27 A;  2ZM2 A;  3VE3 A;  3T12 B;  2D02 A;  1K55 A;  1MBL A;  4OOL A;  4KZ7 A;  1A0K A;  2B95 A;  4X68 A;  4WUJ A;  1CJF A;  1LLB A;  3T4T A;  1PRQ A;  4BLM A;  3MZF A;  3HLE A;  4S2P A;  4KZA A;  3C4P A;  4LRZ E;  1E3U D;  1K57 A;  3TSG A;  4OVD A;  3IH9 A;  1BTL A;  2XR0 A;  3PBR A;  3PBO A;  4IVI A;  4OOY A;  4DDS A;  1N9L A;  3HUO A;  3OBF A;  3QNB A;  3IXB A;  3CZD A;  2QWS A;  2PRF A;  3EGX C;  3ZG7 B;  5J7E A;  3CAX A;  4E3L A;  1PIO A;  3A0R A;  1XGJ A;  3SZT A;  1LL5 A;  3OZH A;  1UGU A;  3NIA A;  1P97 A;  5HDC A;  3UPO A;  4B93 A;  3EGD C;  2INW A;  5IHV A;  3CI6 A;  5J4E A;  2ZOI A;  3SS4 A;  3ZNT A;  3KYE A;  2Y2I A;  3O87 A;  4RYE A;  2B5R A;  2V1B A;  2ZL1 B;  2W3E A;  2PBD P;  4JGQ A;  1V9Y A;  1F5M A;  4UA6 A;  3OCL A;  1XJ6 A;  3DTI A;  2M7U A;  3BLS A;  2XD1 A;  5FSR A;  2OSU A;  1D1J A;  1XA1 A;  4B88 A;  2Z6D A;  4O8G A;  2XD5 A;  4NG2 A;  3FWL A;  3GR2 A;  1GHP A;  1YLT A;  3NDG A;  3E0Y A;  2JHE A;  4BJP A;  3UDF A;  1GSV A;  4R0Q A;  3LCE A;  1Q2P A;  4DE0 A;  5MC7 A;  4UQI S;  4H8R A;  1PYY A;  1YLJ A;  5L8M A;  4EBL A;  2J3W A;  3HLF A;  4EEU A;  4HJ6 A;  3IF5 A;  5TBM B;  1RP5 A;  5KSC A;  2HJ9 C;  4Y7P A;  1F2K A;  3PBT A;  3N8R A;  5EVL A;  5FEF A;  1HZO A;  4QPR A;  5A92 A;  3OPP A;  4K0W A;  1FR6 A;  4R3B A;  1BUE A;  2Y59 A;  3C4O A;  4OP5 A;  1S4R A;  3ITA A;  1GSX A;  1S67 L;  4PM7 A;  4N92 A;  4X56 A;  1PZP A;  3C8C A;  5M1A A;  3ISG A;  2ZM8 A;  1NLZ A;  5J3W A;  2WKQ A;  4GDN A;  5TGF A;  2BAS A;  2V1Z A;  1T1C A;  1O7E A;  3S1Y A;  1L0E A;  1CQA A;  4OQH A;  3HLD A;  4S2L A;  3UE1 A;  3L9K A;  2EXA A;  4HH2 A;  5HAQ A;  1HVB A;  4B9O A;  3ZG8 B;  1S6R A;  2HP5 A;  1FCM A;  2HDR A;  3PAG A;  3IXG A;  3DTM A;  1ZTU A;  2VLG A;  1Y54 A;  1PNE A;  2WKR A;  2P74 A;  1K54 A;  1KGG A;  1T19 A;  1NZU A;  1YLY A;  3QHY A;  3B33 A;  2FZ0 A;  2XGN A;  4KQD A;  3SOI A;  3VP2 A;  4MEZ A;  4EQI A;  3NOU C;  4RA7 A;  5D3O A;  1XPB A;  4KZ3 A;  2GNX A;  3VP1 A;  1BSG A;  2ZC3 B;  1RCJ A;  5F69 A;  2Y2L A;  1WA9 A;  4P0M A;  4OPQ A;  4XT2 B;  4LRY C;  1ACF A;  3ZVT A;  3ZG9 B;  2X01 A;  4Y17 A;  2VV6 A;  5GLC A;  4EET B;  3F1N B;  4ESP A;  5FAQ A;  4Y5F A;  4X69 A;  3ZFZ A;  5FAS A;  1VEU B;  3BQA A;  1I5Q A;  2GX5 A;  4O01 A;  1IEL A;  3UPP A;  3UNW A;  1V9Z A;  4RQ9 A;  3KX0 X;  5CEB A;  3G6O A;  3A0V A;  1UWP X;  2WAD A;  2HF6 A;  4FD8 A;  3BJN A;  1SZV A;  2JC7 A;  4JF6 A;  3WS1 A;  3UE0 A;  4ZJ3 A;  4I39 A;  5DJT A;  3QP8 A;  3UME A;  1BT5 A;  2UV0 E;  1N9N A;  2XA7 S;  5G4Z A;  3PR6 A;  4Y2F A;  2MJ6 A;  3GEC A;  3LGO A;  2V2F F;  3DBA A;  3WS5 A;  5A93 A;  3KSF A;  2WGW A;  4BBT A;  3IQA A;  2EWW A;  4ZJ1 A;  1SCW A;  3H82 A;  1K6S A;  5CHU A;  4ZBE A;  1TDG A;  4EUZ A;  3VP3 A;  2J80 A;  1EWZ A;  1QME A;  2JKR I;  3G30 A;  5GHX A;  5HDS A;  3LY3 A;  2OAQ 1;  1L3L A;  3HJK A;  4G3K A;  5DF8 A;  3E4P A;  4MBH A;  4R38 A;  3CPT A;  2QJ7 A;  2XF3 A;  1OTB A;  1Y28 A;  3V67 A;  1F9I A;  2EWV A;  3T4Q A;  1VHM A;  4HP9 A;  1PZO A;  4RVA A;  5I94 A;  1ES4 A;  1TS8 A;  1VET B;  2UWX A;  5EPH A;  3Q1F A;  3G32 A;  3UMD A;  4OPZ A;  3ZQ5 A;  4EU0 A;  3O86 A;  1G6A A;  2KOI A;  4OQI A;  3Q7V A;  2VX8 A;  2W1T A;  1MY8 A;  2C6W B;  5HFO A;  4PKY G;  2WUQ A;  3RH8 B;  5HAP A;  4OPY A;  3OC2 A;  4S2N A;  3IT9 A;  4I3I A;  4ZDX A;  2ZMA A;  4M4X A;  3JPU A;  1XKZ A;  4KEN B;  4YWZ A;  1ERQ A;  2KLI A;  1DP9 A;  2PD8 A;  1L2S A;  4HBU A;  3FKW A;  5CTM A;  5HWW A;  4C75 A;  3BM6 A;  4CQH A;  1FCN A;  5G18 A;  5DKK A;  3T1X A;  4DXC A;  3LEZ A;  3SW1 A;  2M7V A;  3FZC A;  1TDL A;  4NKP A;  3GTC A;  3JVU A;  2FFY A;  3AGD A;  2QKP A;  2O0Y A;  2ZOH A;  2O9B A;  1SDE A;  4QD4 A;  4H6J B;  5CGS A;  1AXB A;  1O07 A;  5EE8 A;  2WYX A;  5LBR A;  4HY8 A;  4UA7 A;  3IWO A;  4DE2 A;  2I72 A;  3C7U A;  1PW8 A;  3C5A A;  5TBM A;  3IF6 B;  3A3D A;  1GHI A;  1DP8 A;  2XFT A;  3ZG0 A;  1BYW A;  3T4L A;  3CUE C;  4WMC D;  4D2O A;  3CIT A;  1MWR A;  4IJG A;  2ZQ8 A;  3MZE A;  1W8Y A;  3HLB A;  3QP1 A;  4JLF A;  4F3L A;  4BL3 A;  2VGL M;  4MNR A;  5KMW A;  2QZ6 A;  3W4P A;  1LI9 A;  2WGI A;  1TS0 A;  2GDN A;  4OP8 A;  4QU3 A;  3IF6 A;  4R3A A;  4UHU A;  1IYO A;  2WGV A;  3LIA A;  3HRE A;  4E6X A;  1BZA A;  3GQZ A;  5DTS A;  2JN7 A;  1E4D A;  2XRO A;  2HDQ A;  1NJ4 A;  1OT6 A;  1BLS A;  4XUX A;  5KIZ A;  2BTF P;  5C5K A;  4M3K A;  1K4F A;  3NJA A;  4DJ3 A;  1W8Q A;  3E2L A;  1VQQ A;  4HES A;  4IHQ A;  2XFS A;  2G2W A;  1K56 A;  1K57 C;  1FCO A;  2AVX A;  1H5X A;  4B4X A;  2XSS A;  3NDE A;  2L4R A;  1SDN A;  2EX8 A;  4GNU A;  2PHY A;  1H3Q A;  3HBR A;  3NUL A;  3IS2 B;  3VSK A;  1CI9 A;  3V39 A;  3A3E A;  1K55 C;  4MN6 A;  1MZU A;  2DMW A;  4E3I A;  3Q81 A;  1LI0 A;  2W1T B;  2HPB A;  3U2A A;  1YLZ A;  4HOI A;  2PT7 A;  2ZMV A;  4ZTK A;  4E3N A;  3MKE A;  3H9W A;  4WEJ A;  2HDS A;  2OAP 1;  5E2H A;  3E4O A;  1BLH A;  1D7E A;  5HPI A;  1JWV A;  2KDK A;  4NXF A;  2IWC A;  4Y3I A;  5EVI B;  4LEN A;  3C38 A;  3UB7 A;  3BYD A;  1C3B A;  1WYB A;  3ZNY A;  4JF5 A;  5EOE A;  5DFY A;  4QY6 A;  3I7J A;  5G4Y A;  4BBV A;  1OPX A;  1LHY A;  4YFM A;  2A24 B;  1FR1 A;  1CF0 A;  3U4L P;  1MKI A;  1S1Y A;  5FA7 A;  2Y2Q A;  1HD8 A;  4HNB A;  3T4O A;  3A3I A;  4HJ3 A;  3CHW P;  3WRZ A;  1CEF A;  1ESU A;  2G7U A;  3SH7 A;  2DNS A;  1S1Z A;  3MS6 A;  3VFH A;  4KG5 A;  3PXP A;  2IWD A;  4A5R A;  3B47 A;  1N4O A;  2XH9 A;  4II7 A;  2WAF A;  4IBR A;  1IFQ A;  3RTY A;  4N9K A;  4GW9 A;  4B4Z A;  2LB9 A;  2WGW B;  4YOF A;  3KYQ A;  4ME4 A;  2NUT C;  3L7H A;  4L0L A;  4K0X A;  4KZ4 A;  1G68 A;  3KSG A;  5EVI D;  1KGE A;  4LPZ A;  1XJ3 A;  4BD1 A;  4X1L A;  1YT4 A;  3G34 A;  4NXG A;  5EEC A;  4GJ4 A;  1AWI A;  1N9O A;  1K6R A;  2QHK A;  4MN7 A;  3PBS A;  4GOG A;  4G3W A;  1JNU A;  2J3T C;  5E2F A;  3MXQ A;  3IWQ A;  1NWZ A;  2ZC4 B;  1GA0 A;  4CLC A;  2M1C A;  5EVI A;  3WS2 A;  5CED A;  2WKI A;  2PBY A;  4LV0 A;  2WZX A;  3UE3 A;  4K08 A;  4BD0 A;  1JWP A;  2Q0O A;  2HZ5 A;  5FAP A;  4N9L A;  1YMX A;  1FSW A;  4OKP A;  1PI5 A;  3C7V A;  3KYZ A;  4LV3 A;  4XT2 A;  1YAX A;  3QP2 A;  3BQ8 A;  3T4K A;  1S0W A;  3MF0 A;  1EW0 A;  2ZLY A;  2ZQ7 A;  1ERO A;  1NXY A;  5HWT A;  1OT9 A;  4R70 A;  3DWK A;  5DVA A;  5JYO A;  3OCN A;  3A3F A;  1PFL A;  2V0U A;  3EEA A;  1FSY A;  3FG8 A;  3BEC A;  3IHA A;  1SKO B;  3LEQ A;  4L9G A;  1ONG A;  2RCX A;  1RGZ A;  4FTX A;  1ES2 A;  1BLP A;  3UO9 A;  1IYQ A;  5CEC A;  4E3J A;  3ZGA B;  4GN2 A;  4U3T A;  3EOI A;  4KQR A;  4DKI A;  5CER A;  2P08 A;  3BFE A;  3LR0 A;  3V3S A;  3ULF A;  4CPK A;  1XA7 A;  2JCH A;  2ZD8 A;  3E4Q A;  4BQM A;  4WN5 A;  3RXW A;  5L09 A;  3MMH A;  2D01 A;  4FSF A;  1LSX A;  3G2Z A;  2Y2H A;  3UN7 A;  3ZCZ A;  2JKT M;  1TD5 A;  4FOF A;  4I3J A;  5CHJ A;  1JTG A;  3KSH A;  3Q07 A;  4S2M A;  3MBZ A;  4JXS A;  1YLW A;  5FQM A;  3EWK A;  4UEY A;  2R9X A;  5K5B A;  4Q8I A;  3BEB A;  3W4O A;  4Y0U A;  3MQO A;  4BMW A;  4HI4 A;  1MXO A;  1FOF A;  3M2K A;  2Y2J A;  2PAV P;  4H6J A;  3TG9 A;  5IS1 A;  4EES A;  1DRM A;  4QWO A;  5FDH A;  1OTA A;  3P01 A;  4YIN A;  2BLS A;  3ITB A; 
#chains in the Genus database with same CATH homology
 2J8Y A;  5AQ7 A;  1L2S A;  3NC8 A;  5FQQ A;  2ZQC A;  4HBU A;  4Y0O A;  3FKW A;  4OOM A;  5CTM A;  5FQI A;  2Y2M A;  2WKH A;  1DY6 A;  3HUN A;  2A49 A;  5FI6 A;  4C75 A;  5KSH A;  1GCE A;  2Y4A A;  2VGJ A;  5A91 A;  3BM6 A;  4WYY A;  1IYP A;  1FCN A;  1IKI A;  2Q9M A;  5G18 A;  3UPN A;  1MWT A;  4DXC A;  4GD6 A;  3LEZ A;  4U0X A;  1KE0 A;  4WM9 A;  2R9W A;  4MBF A;  3FZC A;  5GL9 A;  1TDL A;  3ZG5 A;  4GD8 A;  5KZH A;  1CEG A;  3GTC A;  2FFY A;  3VP0 A;  3AGD A;  1K38 A;  1OME A;  1SHV A;  4JKT A;  2EFX A;  4EBP A;  5CGW A;  4QJG A;  1SDE A;  3G31 A;  4O7D A;  4DF6 A;  4QD4 A;  4WEL A;  5CGS A;  3VFF A;  2XDM A;  2ZM2 A;  1AXB A;  3CJM A;  1O07 A;  3IF6 C;  5EE8 A;  1K55 A;  1MBL A;  2WYX A;  4OOL A;  5F1F A;  4UA7 A;  3PAE A;  4KZ7 A;  4XUZ A;  1L0G A;  3IWO A;  4DE2 A;  4X68 A;  1PWC A;  2QMI A;  2I72 A;  4GDB A;  1LLB A;  2ZQD A;  4WZ5 C;  1BUL A;  2Y2O A;  3C7U A;  4BLM A;  3CG5 A;  3HLE A;  3MZF A;  1PW8 A;  3C5A A;  3MKF A;  4KZA A;  4S2P A;  5AQB A;  1IEM A;  3C4P A;  3IF6 B;  3A3D A;  3VSL A;  2J7V A;  2ZC7 A;  1GHI A;  3PTE A;  2XFT A;  3LO7 A;  3ZG0 A;  1E3U D;  1K57 A;  3TSG A;  3ZVW A;  4IVK A;  3GVB A;  4OVD A;  4GZB A;  4WMC D;  3IH9 A;  4DE3 A;  2BG1 A;  2P9V A;  1BTL A;  4D2O A;  2XR0 A;  5FI2 A;  1MWR A;  3PBR A;  3PBO A;  2ZQ8 A;  4IVI A;  2Y2G A;  3MZE A;  3NCK A;  4OOY A;  4QB8 A;  4DDS A;  1W8Y A;  2Y2P A;  3HLB A;  3QNB A;  3HUO A;  1XX2 A;  4JLF A;  4N1H A;  3IXB A;  4KZ5 A;  5DTT A;  1K4E A;  3CZD A;  4BL3 A;  5CXW A;  4PM5 A;  1Z6F A;  3ZG7 B;  4MNR A;  4C6Y A;  4WZ5 A;  5KMW A;  2QZ6 A;  4E3L A;  3W4P A;  4WMC A;  1LI9 A;  1PIO A;  2WGI A;  4X55 A;  1XGJ A;  2ZC5 B;  1DJA A;  1LL5 A;  3OZH A;  1W7F A;  2GDN A;  5HL1 A;  4ID4 A;  3NIA A;  4OP8 A;  4QU3 A;  1L0F A;  3UPO A;  3IF6 A;  1CI8 A;  1KVM A;  1VM1 A;  4UHU A;  1ONH A;  1IYO A;  3M6B A;  5J8X A;  2WGV A;  1RGY A;  5E2G A;  4E6X A;  3HRE A;  4N1X A;  1BZA A;  5IHV A;  4NET A;  4DXB A;  3SS4 A;  1H8Y A;  2ZM0 A;  3GQZ A;  2Y2I A;  3O87 A;  4RYE A;  4WEK A;  3AGE A;  2B5R A;  5DTS A;  1E4D A;  4MLL A;  5E2E A;  2HDQ A;  2PU2 A;  4MBK A;  4JXV A;  2BLS A;  1NJ4 A;  5FQ9 A;  2XEP A;  4BL2 A;  1BLS A;  1YQS A;  5EOO A;  1LL9 A;  1PW1 A;  4XUX A;  4OLD A;  2PU4 A;  4UA6 A;  5FQJ A;  3OCL A;  2Y55 A;  4M3K A;  3OPH A;  1L0D A;  3BLS A;  2XD1 A;  5FSR A;  2OSU A;  1K4F A;  1KGF A;  2A3U A;  1XA1 A;  4B88 A;  2ZQ9 A;  2XD5 A;  5EVI C;  3RJU A;  3MFD A;  3UDI A;  3FWL A;  1W8Q A;  3GR2 A;  3E2L A;  1GHP A;  5GLA A;  1VQQ A;  5F83 A;  1FQG A;  3WS4 A;  4HES A;  3A3J A;  3G2Y A;  2XFS A;  3G35 A;  1K25 A;  2G2W A;  1YLT A;  3NDG A;  4E3O A;  1K56 A;  3P09 A;  1K57 C;  4OQ0 A;  2HP9 A;  1FCO A;  2V20 A;  1YMS A;  3VOZ A;  4ZAM A;  1H5X A;  4B4X A;  3NDE A;  4BJP A;  3UDF A;  1SDN A;  2J9P A;  2EX8 A;  4KZB A;  5L2F A;  4GNU A;  1W5D A;  3HBR A;  3VSK A;  4R0Q A;  3LCE A;  1CI9 A;  1Q2P A;  4KZ8 A;  4KQQ A;  3V39 A;  4JPM A;  3A3E A;  4DE0 A;  3RXX A;  4H8R A;  1K55 C;  1PYY A;  3WS0 A;  1YLJ A;  5EUA A;  4S2O A;  4EBL A;  4E3I A;  3Q81 A;  3HLF A;  1LI0 A;  3OPR A;  2X71 A;  1N9B A;  2P9V B;  2HPB A;  5M18 A;  2EX6 A;  3SS5 A;  4LV1 A;  1YLZ A;  3IF5 A;  3PBQ A;  5TR7 A;  3B3X A;  4ZTK A;  4C3Q A;  4E3N A;  3MKE A;  2DRW A;  3FYZ A;  4WEJ A;  5GLB A;  3MZD A;  1GA9 A;  5U47 A;  1RP5 A;  2HDS A;  3GV9 A;  5CTN A;  2OLV A;  5E2H A;  3HLG A;  5KSC A;  1BLH A;  3DW0 A;  4Y7P A;  1JWV A;  3N8S A;  3P98 A;  3PBT A;  2IWC A;  3MXS A;  3N8R A;  4JBF A;  5EVL A;  3O3V A;  5EVI B;  5HX9 A;  4LEN A;  3IHB A;  2OV5 A;  1JVJ A;  1HZO A;  5A92 A;  3BYD A;  3OPP A;  3M2J A;  4F94 A;  1C3B A;  1WYB A;  3ZNY A;  4JF5 A;  1ZC2 A;  4K0W A;  1FR6 A;  5EOE A;  3VOY A;  4R3B A;  1BUE A;  4QY6 A;  2Y59 A;  3I7J A;  3C4O A;  3W4Q A;  4OP5 A;  3ITA A;  1LHY A;  3E2K A;  4PM7 A;  4N92 A;  5HAR A;  4YFM A;  1NYY A;  1PZP A;  4X56 A;  1FR1 A;  1I2S A;  5M1A A;  3ZDJ A;  3ISG A;  2ZM8 A;  1MKI A;  2WKE A;  2WZZ A;  4GDN A;  1YM1 A;  5TGF A;  2FFF B;  1I2W A;  5FA7 A;  3VMA A;  5GHY A;  2V1Z A;  1O7E A;  2Y2Q A;  1HD8 A;  1KE3 A;  3S1Y A;  1PI4 A;  1HTZ A;  1L0E A;  3A3I A;  4OQH A;  3CMZ A;  4HBT A;  3HLD A;  4S2L A;  2XQZ A;  2CC1 A;  3UE1 A;  3WRZ A;  3SH8 A;  1CEF A;  4WZ4 A;  1ESI A;  1ESU A;  4ZJ2 A;  2DNS A;  3SH7 A;  2EXA A;  5HAQ A;  1HVB A;  3VFH A;  2Y2K A;  4KG5 A;  2IWD A;  4A5R A;  1N4O A;  1S6R A;  3ZG8 B;  2XH9 A;  2WAF A;  2HP5 A;  4LCL A;  4IBR A;  1FCM A;  3V3R A;  4OON A;  2HDR A;  3IXH A;  1NYM A;  4N9K A;  3ZNT A;  1ES5 A;  3PAG A;  4B4Z A;  3IXG A;  3DTM A;  4R23 A;  1K54 C;  4S2I A;  3DWZ A;  2WGW B;  4EV4 A;  1W79 A;  4UAA A;  1CK3 A;  1MWS A;  4IED A;  4P87 A;  4X53 A;  3S4X A;  1PWD A;  1Y54 A;  4L0L A;  4K0X A;  4JXW A;  2P74 A;  4KZ4 A;  1K54 A;  1G68 A;  3Q82 A;  5F1G A;  3W8K A;  1KGG A;  3NY4 A;  3VP4 A;  2VGK A;  1NZU A;  1YLY A;  2QPN A;  3Q7V B;  1ES3 A;  3QHY A;  3JYI A;  1KGE A;  5EVI D;  4S2J A;  5CGX A;  3SH9 A;  2XGN A;  4OQG A;  3SOI A;  4Y0T A;  4BD1 A;  3VP2 A;  2H0Y A;  1YT4 A;  4MEZ A;  3G34 A;  3NI9 A;  4KZ6 A;  1XGI A;  4EQI A;  1JWZ A;  3EQV A;  5EEC A;  4UA9 A;  3HLW A;  4EBN A;  1NY0 A;  3PBN A;  4RA7 A;  5D3O A;  3G4P A;  2Y91 A;  1XPB A;  1ZKJ A;  4KG2 A;  4KZ3 A;  1K6R A;  3PBS A;  5GLD A;  4GOG A;  2Q9N A;  1M6K A;  4PM8 A;  3VP1 A;  1BSG A;  1Q2Q A;  1RCJ A;  2EX9 A;  2ZC3 B;  2DCF A;  5E2F A;  2EX2 A;  2Y2L A;  4E3M A;  4FH4 A;  3IWQ A;  4P0M A;  3N8L A;  2ZC4 B;  3SS3 A;  1DJC A;  4OPQ A;  1WYC A;  3HL9 A;  1GA0 A;  5FAO A;  1GHM A;  4E3K A;  1XXM A;  5EVI A;  3WS2 A;  5CED A;  2WKI A;  3FV7 A;  2PBY A;  2X02 A;  3ZVT A;  4LV0 A;  1KE4 A;  2WZX A;  1M40 A;  3ZG9 B;  4OLG A;  2RL3 A;  2WK0 A;  5GLC A;  2X01 A;  3UE3 A;  4BD0 A;  2ZC6 B;  4HEF A;  4QY5 A;  5JYP A;  4FH2 A;  5FAQ A;  1JWP A;  3M6H A;  4QHC A;  4X69 A;  3ZFZ A;  3O88 A;  5FI7 A;  5FAS A;  3GRJ A;  3EQU A;  2HDU A;  2ZQA A;  4KG6 A;  1I5Q A;  5FAP A;  3UY6 A;  4DE1 A;  2Y2N A;  4RX2 A;  1IEL A;  4N9L A;  1YMX A;  5HAI A;  3LY4 A;  4R4S A;  3UPP A;  1FSW A;  5DF7 A;  4OKP A;  3IH8 A;  4R3J A;  2WAE A;  1PI5 A;  3C7V A;  3N4I A;  4LV3 A;  4JF4 A;  3UNW A;  4P6B A;  5DF9 A;  2XLN A;  1S0W A;  5CEB A;  3BLM A;  2IWB A;  3FKV A;  4P85 A;  2WAD A;  2ZLY A;  4R4R A;  4FD8 A;  2ZQ7 A;  3N6I A;  1BLC A;  3QNC A;  2E8I A;  1ERO A;  1NXY A;  4PM6 A;  4S2N C;  2JC7 A;  4JF6 A;  3WS1 A;  4WBG A;  3DWK A;  5DVA A;  4ZJ3 A;  3UE0 A;  5JYO A;  3OCN A;  3A3F A;  5F82 A;  4PM9 A;  1FSY A;  1YLP A;  3V50 A;  1DJB A;  3BEC A;  1BT5 A;  1H8Z A;  3IHA A;  1ERM A;  1KVL A;  4FCF A;  4GKU A;  2EFU A;  1ONG A;  2RCX A;  1RGZ A;  2V2F F;  3BFF A;  4K91 A;  3WS5 A;  1ES2 A;  1JTD A;  2G2U A;  5DTK A;  1BLP A;  3V5M A;  3UO9 A;  1E25 A;  1IYQ A;  1SKF A;  5CEC A;  3BRM A;  5A93 A;  4E3J A;  3ZGA B;  1K56 D;  2WGW A;  4GN2 A;  4U3T A;  3WRT A;  3IQA A;  4KQR A;  4ZJ1 A;  3IXD A;  1SCW A;  5CRF A;  1MWU A;  4E6W A;  1TEM A;  1K6S A;  4DKI A;  5CHU A;  5CER A;  2H10 A;  4X6T A;  4ZBE A;  4OH0 A;  1TDG A;  3BFE A;  1PWG A;  3VP3 A;  4EUZ A;  2Z2M B;  3V3S A;  5CHM A;  2OLU A;  1EWZ A;  3GMW A;  4PMA A;  4LCM A;  3D4F A;  4CJN A;  1QME A;  2H0T A;  4RX3 A;  4CPK A;  1XA7 A;  2JCH A;  2ZD8 A;  3G30 A;  5GHX A;  4BQM A;  5A90 A;  1NZO A;  3LY3 A;  3N7W A;  4PPR A;  1J9M A;  3RXW A;  1EI5 A;  4S2K A;  5BOH A;  5DF8 A;  4MBH A;  1IKG A;  1ZG6 A;  4FSF A;  4IBX A;  2XF3 A;  1NRF A;  5M19 A;  4GB7 A;  5AQ9 A;  3S22 A;  3G2Z A;  1IYS A;  4LV2 A;  2Y2H A;  3UN7 A;  3ZCZ A;  1PZO A;  4RVA A;  4OPR A;  4U0T A;  3OPL A;  5GHZ A;  5I94 A;  1ES4 A;  2J9O A;  1XP4 A;  1WE4 A;  4XXR A;  5CHJ A;  1JTG A;  2Z2L B;  3Q07 A;  4S2M A;  5HW3 A;  3HUM A;  1U60 A;  3MBZ A;  4JXS A;  4Z9Q A;  5FQK A;  1YLW A;  5FQM A;  4BEN A;  2R9X A;  2UWX A;  2ZJ9 A;  5EPH A;  2HP6 A;  3Q1F A;  3GSG A;  3G32 A;  1E3U A;  2EXB A;  2XK1 A;  4KZ9 A;  4OPZ A;  3O86 A;  1TVF A;  3BFC A;  1G6A A;  3BFG A;  1QMF A;  3UDX A;  1KDS A;  4DDY A;  4Q8I A;  4OQI A;  5AQA A;  5FAT A;  3BEB A;  3Q7V A;  1MY8 A;  2C6W B;  4Y0U A;  5HFO A;  3W4O A;  2C5W B;  4EWF A;  2WUQ A;  1MXO A;  4R1G A;  5TFQ A;  3Q7Z A;  1FOF A;  1KDW A;  1ALQ A;  4KQO A;  2JBF A;  5HAP A;  3HVF A;  3M2K A;  3OC2 A;  4OPY A;  2Y2J A;  3TG9 A;  3WWX A;  4S2N A;  4DRT A;  3HLC A;  3MXR A;  3NBL A;  3IT9 A;  2H5S A;  3IWI A;  4ZDX A;  3AGF A;  2ZMA A;  3TOI A;  4NK3 A;  3ZHH A;  1MPL A;  4JXG A;  1XKZ A;  4KEN B;  5FDH A;  5E43 A;  1ERQ A;  3BFD A;  4YIN A;  2JE5 A;  3ITB A;  1ZG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...