5KSCA

E166a/r274n/r276n toho-1 beta-lactamase aztreonam acyl-enzyme intermediate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kscA00
1TVFA 4OPQA 2VGKA 1ZKJA 3PBSA 1XGJA 2JE5A 1PZOA 3Q7VA 4R3BA 4RYEA 4IBRA 1JTDA 3M2JA 3IWOA 1RCJA 1FR6A 2Y2KA 3W4OA 5U47A 5EOEA 2IWCA 2XH9A 1HD8A 4EWFA 2Z2LB 3G2ZA 4X53A 3V39A 3ZG0A 1K55A 1MWSA 1PWDA 2VGJA 3WRZA 1RGYA 5DF9A 3S4XA 2WZZA 1S0WA 4GKUA 1YLWA 3RXXA 1HTZA 5EVLA 1BUEA 3HREA 4HEFA 4E6XA 5FI2A 2H10A 4EBNA 4X69A 3ZG5A 2QPNA 1FCNA 3UNWA 2Y2QA 4M3KA 3V50A 3ZVTA 4LV0A 1ES2A 1XA1A 4NK3A 4XUXA 1BT5A 3PBOA 3GSGA 1YLJA 1HVBA 1K54A 1L2SA 1MY8A 1ALQA 4ID4A 3HLEA 3IH8A 3PBRA 4BJPA 2HDQA 5D3OA 5FAQA 5HX9A 3W4QA 3GV9A 3ZGAB 3HLDA 4S2NA 4EQIA 1GCEA 4E3KA 1ES5A 3MKFA 4OLGA 4OONA 4PMAA 1E25A 1EWZA 3G32A 1O07A 2RL3A 3N6IA 4C75A 5TR7A 4ZAMA 1BSGA 4DDSA 3UPOA 3C5AA 2HP6A 4HESA 5EUAA 1XXMA 2DNSA 2GDNA 2XQZA 3IXHA 4WM9A 5G18A 4P85A 3WS0A 3BEBA 1I2WA 1K56A 1PZPA 1L0FA 1FSYA 5CXWA 5KSHA 3TG9A 4R4RA 3LO7A 1RGZA 2A3UA 3HLGA 3PBTA 3C7VA 3TOIA 2EFUA 3VP1A 4LV1A 4OQIA 1L0EA 2E8IA 5HAPA 1BLCA 1NYYA 2ZQDA 3RJUA 3SH7A 2OSUA 3IHBA 4ZJ1A 1IEMA 4YINA 2I72A 3IXBA 2WAEA 5GLCA 3M6HA 5DVAA 5CECA 2FFFB 2ZQCA 2QMIA 2XF3A 3DWKA 5L2FA 2WGIA 3UY6A 1H8YA 3IWIA 1YLZA 2ZD8A 3UO9A 3OPPA 1Z6FA 4FSFA 1NJ4A 2FFYA 3OPLA 2BLSA 5GLDA 3C4PA 2ZM8A 4D2OA 3VFHA 1YMSA 2X02A 2WZXA 1CI8A 3PAEA 1N9BA 3MXRA 3A3EA 4QY5A 4E3JA 3G34A 2WKIA 2ZMAA 3BRMA 3UN7A 2A49A 2ZM0A 3A3IA 1K6SA 2XK1A 4CPKA 4QJGA 2ZC4B 4NETA 4UA7A 3BECA 1FOFA 4UAAA 1QMEA 4JXWA 4S2NC 3NDGA 2EX8A 3NY4A 3BFEA 3N4IA 1E3UD 4WZ4A 4Y0OA 3UDFA 5HAQA 5F83A 4A5RA 4P0MA 5AQBA 4WBGA 1J9MA 3IF6A 3MKEA 4DXBA 4WELA 4ZJ2A 3HBRA 3S22A 4C3QA 4Z9QA 4LENA 4OOYA 3CG5A 4K91A 2EX9A 1XX2A 5BOHA 1WYBA 4S2OA 2XD1A 5EVIC 1PI5A 4KZAA 1SKFA 3N7WA 3C4OA 4OOMA 4S2PA 4U0TA 3UE1A 1GHMA 2IWBA 1IELA 5A92A 2C6WB 2WKEA 2J8YA 1CI9A 4KG5A 5DTSA 3BFGA 1E4DA 3OPRA 3IQAA 3QNCA 3MZEA 4DE2A 1LI0A 1LL9A 1ZG4A 5FAPA 4WYYA 5FATA 3OC2A 4PM9A 1IYPA 3O86A 1ZC2A 4S2MA 5CHMA 3HL9A 1EROA 4KZ4A 2G2UA 2P9VA 4XXRA 3VFFA 1CK3A 3NI9A 4X6TA 1N4OA 5KZHA 5EVIB 5A90A 1NYMA 1FCMA 2X71A 3G2YA 3LY3A 2Y2IA 4JLFA 5CGWA 2ZC7A 3ITBA 4N92A 3LY4A 5EVIA 5EOOA 3SOIA 5HL1A 2UWXA 1BZAA 4LV2A 3PTEA 2XDMA 4H8RA 4XUZA 4LV3A 3VP4A 2XLNA 5FQ9A 5GLAA 4WZ5C 2J7VA 1K38A 5F1GA 1K6RA 4KZBA 3MZDA 1K57A 1KE4A 5DF7A 1YT4A 1LHYA 3VOZA 3N8LA 4FH2A 3ZDJA 3LCEA 1KDWA 4KQRA 2EXBA 2XFSA 3N8RA 1LI9A 3CJMA 3Q1FA 4E3IA 4KQQA 4OQGA 3SS3A 1I2SA 4PPRA 4DE1A 4KENB 4X68A 4Y7PA 1YQSA 3AGFA 1DY6A 3GQZA 3IF6B 4OOLA 2V2FF 3UDXA 1YM1A 2ZQ8A 3G4PA 1Y54A 1C3BA 4R0QA 3UPNA 1CEFA 1FQGA 3E2KA 2CC1A 3VP3A 1K55C 5DF8A 2XEPA 4MEZA 3NIAA 1MPLA 4DE3A 4DKIA 4S2IA 1TEMA 3HLBA 3SH8A 3TSGA 1IKIA 5CHJA 1PYYA 3IXDA 5FQIA 1K54C 2Y2JA 3BLSA 2Y59A 3NDEA 4QD4A 1YLTA 1MWUA 1NY0A 1ZG6A 2JBFA 3UE3A 2J9OA 4RX3A 4JXGA 3ISGA 4PM6A 2OV5A 1IYOA 3ZVWA 5F1FA 4OH0A 5DTKA 4ZDXA 2H0YA 3A3DA 1MKIA 2P9VB 4KZ7A 4OLDA 3MFDA 1QMFA 3NC8A 2R9XA 1O7EA 4HBTA 5GHXA 4OPYA 1S6RA 1YLYA 5FAOA 1MBLA 3O87A 4WEJA 3Q7VB 2ZC5B 1KGFA 4RA7A 2QZ6A 4GN2A 3IF5A 4RVAA 4B4ZA 1DJCA 5GLBA 1ERMA 1SDEA 1Q2PA 4PM8A 3VOYA 5E2HA 2J9PA 3OZHA 1BTLA 1NXYA 3OPHA 3W4PA 2HP5A 2WYXA 4EUZA 3ZG7B 1GHPA 4P87A 4QB8A 4FD8A 4C6YA 4LCLA 4YFMA 5CEBA 1CEGA 2DCFA 3G35A 4GDBA 4KQOA 2Y55A 1DJAA 1W5DA 1XPBA 2B5RA 4JXSA 4BQMA 4Y0UA 5FI7A 1BLPA 3A3JA 5E2FA 1K56D 4E6WA 3FWLA 4BL2A 5JYOA 2Z2MB 3GR2A 4GZBA 5TGFA 4IVKA 4JBFA 1M6KA 5GHYA 4QU3A 3Q81A 1IYQA 1GHIA 1L0DA 1GA0A 5FQKA 3GVBA 2IWDA 1W8YA 1Q2QA 4FH4A 2HDSA 4S2JA 5E2GA 5AQ9A 5FI6A 3MBZA 3PAGA 3WS4A 4OP5A 4N9KA 1BULA 4MBKA 3EQUA 2PU4A 5HARA 5TFQA 3N8SA 4R3JA 1YLPA 4R1GA 1SDNA 3G31A 4WMCA 4KZ9A 3A3FA 1AXBA 4JPMA 3WWXA 5FQMA 3FYZA 2Y2PA 1NZOA 4MBFA 4BD1A 2ZQAA 5DTTA 5E2EA 5FA7A 4DRTA 1HZOA 4PM5A 5FQJA 2HP9A 3IT9A 3P98A 4GB7A 1LLBA 4JF6A 5M18A 2EFXA 4DF6A 3G30A 2PU2A 3VP0A 4N1XA 1BLHA 3M2KA 4WMCD 4B88A 2WADA 1KE0A 4E3MA 3O3VA 1U60A 4Q8IA 1XKZA 2BG1A 3DWZA 1KVLA 1ESIA 3DW0A 5M19A 4OVDA 1PIOA 1K4FA 3RXWA 2R9WA 1G68A 3UPPA 1W7FA 3BM6A 5KMWA 1G6AA 1FR1A 4X56A 1VQQA 4L0LA 3OCLA 3IF6C 3VSKA 1TDLA 2WKHA 5CHUA 2V1ZA 4EBLA 1E3UA 2V20A 4O7DA 1BLSA 1PWGA 1XGIA 1SHVA 1M40A 3BLMA 4RX2A 4BL3A 3IHAA 4OKPA 5CRFA 3V5MA 5KSCA 2ZLYA 1ES3A 2WAFA 3CMZA 3HUNA 3IWQA 1TDGA 4HBUA 4JXVA 4KZ6A 3ZNTA 1JTGA 1ES4A 1WYCA 3WS5A 1PW8A 3SS4A 4UHUA 5A91A 1K25A 3FKVA 1PWCA 3NCKA 5CTNA 2P74A 2HDRA 2WGVA 1KGEA 2EX6A 3CZDA 3HVFA 4LCMA 4DE0A 1K4EA 4OPZA 2DRWA 2XGNA 2H0TA 1JWZA 4B4XA 2Y2OA 3QNBA 1L0GA 2X01A 4KG2A 3VSLA 4BENA 2WUQA 3DTMA 3ZCZA 4MLLA 3V3RA 2JC7A 2Y2HA 2ZC3B 3VP2A 3OCNA 2RCXA 3GMWA 1ONGA 4BD0A 3ZG9B 5EVID 1H8ZA 2EX2A 4DDYA 5GL9A 4EBPA 4GOGA 3JYIA 4R4SA 4KZ3A 4OPRA 1W8QA 4KG6A 3MZFA 1H5XA 4JF4A 1NRFA 3AGEA 4OQHA 2WGWB 3BFDA 5EE8A 3ZG8B 2C5WB 2ZQ9A 2Y4AA 4IVIA 2PBYA 4MNRA 5E43A 5CEDA 4K0XA 4Y0TA 1DJBA 2WGWA 4R23A 4QHCA 4DXCA 5CGSA 3IXGA 1XA7A 5J8XA 3O88A 4S2KA 1IYSA 4E3LA 1RP5A 3BFCA 5CERA 1MWRA 4ZJ3A 4CJNA 2G2WA 3P09A 4EV4A 5AQAA 5HAIA 1NZUA 4KZ5A 5FSRA 1XP4A 3Q82A 4P6BA 3MXSA 5M1AA 3HUOA 1ONHA 5FASA 2WK0A 4GNUA 3WS1A 5EECA 3PBNA 3BYDA 3LEZA 3SS5A 1KGGA 3M6BA 3ZHHA 3ZFZA 4WZ5A 1JWPA 3BFFA 3ITAA 4X55A 5AQ7A 4U0XA 2ZM2A 2Q9NA 3B3XA 1KE3A 3SH9A 4E3NA 3AGDA 3VMAA 4MBHA 3HLFA 3V3SA 1PI4A 2OLVA 3ZNYA 2Y2NA 1EI5A 1PW1A 3W8KA 5FDHA 1LL5A 2Q9MA 5HFOA 3GRJA 1ERQA 3PBQA 4K0WA 4OP8A 1JVJA 1IKGA 2JCHA 5EPHA 1K57C 3GTCA 4JKTA 5I94A 1WE4A 1KDSA 4GD6A 4F94A 1GA9A 4PM7A 2XFTA 4U3TA 3HUMA 3EQVA 3IH9A 5CTMA 3UDIA 4KZ8A 1MWTA 5IHVA 4FCFA 4UA6A 2HDUA 4S2LA 3FZCA 2XR0A 1I5QA 3FV7A 3FKWA 3C7UA 4IBXA 5FQQA 1W79A 1YMXA 4GD8A 2Y2MA 3E2LA 3Q7ZA 4E3OA 2Y91A 1FSWA 4ZBEA 3HLWA 2EXAA 1JWVA 5A93A 2H5SA 3HLCA 3Q07A 4IEDA 5JYPA 2ZJ9A 2ZQ7A 4ZTKA 1VM1A 3NBLA 3S1YA 1MXOA 3I7JA 3QHYA 3WS2A 4WEKA 1FCOA 2Y2GA 4N1HA 4OQ0A 2XD5A 4JF5A 5GHZA 1SCWA 5HW3A 4GDNA 3D4FA 3UE0A 1ESUA 2ZC6B 2Y2LA 4BLMA 5F82A 4N9LA 5CGXA 2HPBA 2OLUA 4QY6A 4UA9A 3WRTA 1KVMA 1OMEA
chains in the Genus database with same CATH superfamily
4OPQA 1ZKJA 3QP6A 4R3BA 4RYEA 3QP2A 5HDDA 5EOEA 2IWCA 2Z2LB 1P97A 2JKGA 5MC7A 1K55A 5DF9A 3S4XA 2A24B 5EVLA 3HREA 4FUWA 3FPWA 4EBNA 3ZG5A 3A0VA 2Y2QA 1VHMA 1ES2A 3PBOA 4G3KA 3T4JA 2WKPA 5FAQA 1GCEA 5HPIA 4PMAA 3KO6A 2EWWA 4C75A 1BSGA 3UPOA 3C5AA 2JHEA 4HESA 1MZUA 1LSXA 3QP1A 4Q0HA 4WM9A 5F69A 5IT5A 1UWNX 4JGOA 1VEUA 3TG9A 2EFUA 2E8IA 2JKFA 1BLCA 3F1PB 3SH7A 2OSUA 4ZJ1A 1IEMA 4YINA 2WAEA 1LSVA 5CECA 5FEGA 2ZQCA 3DAVA 3DWKA 3CITA 1STZA 4HP9A 3NECA 2ZD8A 3UO9A 1NLZA 4D2OA 2WZXA 1CI8A 3PAEA 5DJUA 3F1NB 2WKIA 3G34A 4UQIM 2V0WA 3UN7A 2A49A 1DP6A 3BECA 4JXWA 3NDGA 2EX8A 3NY4A 3BFEA 1E3UD 1N9LA 3UDFA 3E4PA 5AQBA 4Y17A 3HBRA 3LGOA 1OPXA 1WYBA 4AFIA 3UE1A 1GHMA 1IELA 2C6WB 2I9VA 2WKEA 2J8YA 3NOTC 2J3TC 4KG5A 2PYPA 3CHWP 3IQAA 2VGLS 3MZEA 5FATA 3OC2A 1IYPA 1ZC2A 4S2MA 1WA9A 3UB6A 1NYMA 2ZC7A 2V1BA 4N92A 3SOIA 1SKOB 2BASA 2UWXA 4EXOA 4H8RA 3KYEA 4LV3A 2VKSA 2J7VA 3MSHA 4I38A 1K57A 4KQDA 3T1QB 4GJ4A 3LCEA 3MFXA 2XFSA 4KQQA 4OQGA 4KENB 4X68A 3EOIA 3T50A 2ZQ8A 1CEFA 2CC1A 4G3VA 1MPLA 4S2IA 1TEMA 3SH8A 3T4TA 3IXDA 5FQIA 3NDEA 4JGQA 3UE3A 2JBFA 2GX5A 4IUHA 1PNEA 1P0ZA 5DTKA 1MKIA 2AVXA 2V0UA 3NC8A 1QMFA 4II7A 4KZ7A 4HBTA 3SZTA 5HWVA 1YLYA 4WEJA 2GJ3A 2ZC5B 1XJ2A 2QZ6A 4RVAA 1DJCA 5GLBA 3HCYA 3VOYA 1F9IA 1NXYA 3OPHA 2EWVA 1GHPA 3UB5P 1T1BA 3C38A 4GDBA 4KQOA 1K0KA 1DJAA 1XPBA 2YKFA 5FI7A 3A3JA 5E2FA 2Z2MB 3LIAA 4JBFA 5GHYA 1IYQA 5EVEA 5IU1A 1TS0A 1W8YA 3IX8A 4S2JA 5FI6A 3LIBA 5LBRA 1UWPX 2PHYA 4R3JA 4CLCA 2IA2A 1YLPA 4KZ9A 1W63M 4P6ZS 3WWXA 4JPMA 3BY9A 4DRTA 2ZL1B 3IT9A 3P98A 4GB7A 3TJZC 1DP9A 2PU2A 2FZ0A 1KE0A 3O3VA 1NRJA 3DWZA 2JKRM 2GNXA 2ZBBA 4OVDA 3UPPA 4R38A 1W7FA 3BM6A 1G6AA 3OCLA 2V1ZA 2V20A 4O7DA 1P9RA 4BL3A 5CRFA 1ES3A 3IWQA 3CMZA 4HBUA 4JGPA 4JXVA 1JTGA 1K25A 5CTNA 4DE0A 3HVFA 5AJGA 4XT2B 4OPZA 2DRWA 2XGNA 2W27A 3BY8A 3IX3A 3QNBA 3VSLA 2WUQA 2W3GA 3VP2A 4BD0A 1G28A 2LB5A 1H8ZA 4DDYA 4EBPA 4GOGA 4OPRA 5EE8A 5FL3A 3D3OA 5CGSA 1XA7A 4NXEA 4IJGA 1KOUA 1G6OA 4HH3A 5HAIA 1HLUP 4QWOA 5EECA 3SS5A 3ZHHA 4WZ5A 3MQOA 3ITAA 4X55A 3B3XA 3SH9A 4Q0JA 3VMAA 1F98A 5IS1A 5FDHA 4PKYG 5EPHA 2JCHA 1K57C 4JKTA 1WE4A 4PM7A 4ARZB 3HUMA 3EQVA 4KZ8A 2QHKA 4FCFA 4UA6A 4S2LA 4CLCE 3FZCA 3FV7A 3C7UA 4IBXA 1W79A 3NHQA 4O0PA 1DRMA 3C2WA 4HJ3A 3F1OA 4DJ3A 4DN0A 3HLCA 5HL6A 2ZQ7A 3QHYA 3WS2A 2PR6A 3UE0A 2ZC6B 4BLMA 5CGXA 5HDSA 2OLUA 4QY6A 1KVMA 1OMEA 3CAXA 3PBSA 4GW9A 4IBRA 1JTDA 3M2JA 1RCJA 1FR6A 2Y2KA 3W4OA 4HH2A 3E98A 3V39A 2VGJA 1YLWA 1HTZA 3HJIA 4E6XA 4YWZA 4FTXA 1FCNA 3V50A 1XA1A 4NK3A 4WF0A 3CUEA 1HVBA 3HLEA 4R3AA 5HX9A 3W4QA 2MJ6A 4EQIA 4OLGA 4LPZA 4X1MA 3G32A 3N6IA 3P01A 4ZAMA 4DDSA 4Z1WA 1XXMA 2DNSA 3R7WA 3WS0A 1K56A 3K3DA 5KSHA 3D72A 3FPVA 2A3UA 3C7VA 3TOIA 4LV1A 4OQIA 1TF1A 1CF0A 2ZQDA 1NYYA 5HAPA 2H28A 4Y5FA 3M6HA 5DVAA 2VGLM 2XA7M 4DMZA 3UY6A 1H8YA 3HJKA 4FSFA 1NJ4A 2W1RA 2X02A 3QP8A 1N9BA 5EM0A 3P7NA 2NUTC 4E3JA 1PRQA 2E8JA 5FEFA 2ZM0A 2XK1A 4CPKA 4UA7A 4NG2A 1QMEA 4EETB 4WLAA 3UB8A 4WZ4A 2XA7S 3CLOA 4P0MA 4WBGA 1J9MA 3IF6A 5DKKA 4WELA 4ZJ2A 4Z9QA 4LENA 2PYRA 3CG5A 4K91A 2EX9A 2YKHA 3OBFA 4KZAA 3N7WA 4OOMA 2XRNA 5HWWA 3BFGA 1E4DA 3OPRA 3S7OA 1J3WA 1F5MA 1LI0A 1LL9A 5FAPA 2W0NA 3D9YA 5CHMA 4KZ4A 1EROA 4XXRA 1CK3A 3VV4A 3NI9A 1N4OA 5KZHA 2Y2IA 4JLFA 2P04A 3B42A 2WKQA 5EOOA 5HL1A 4EU0A 4HHDA 4CLCB 5GLAA 1OTBA 4K08A 5F1GA 4KZBA 3MZDA 1ACFA 5DF7A 2P7JA 1LHYA 3T1SA 4NXFA 1W63Q 2R78A 3IF6B 4OOLA 1Y54A 1FQGA 3E2KA 3BW6A 3PHYA 2XEPA 2O9AA 4R70A 2OOLA 2B95A 4DKIA 2L0WA 3MJQA 1IKIA 5CHJA 3RTYA 1K54C 1NY0A 2J9OA 2QWSA 3ISGA 4PM6A 1IYOA 4OH0A 4ZDXA 2P9VB 4OLDA 3MFDA 2R9XA 3DTKA 4Q0IA 4OPYA 5FAOA 3EGDC 3IF5A 4HOIA 4PM8A 2OAP1 3OZHA 1OT6A 2V8CA 3ZG7B 3KSHA 4MN7A 4LCLA 5CEBA 3NOPC 1CEGA 2HJ9C 3FWLA 1G5UA 3IS2B 5TGFA 1AWIA 1L0DA 5HZHA 4FH4A 3A0SA 3PAGA 4I3IA 4N9KA 3MQQA 3EQUA 2PU4A 5TFQA 1PFLA 4NKPA 3G31A 3A3FA 3H82A 3R7WB 3FYZA 1NZOA 3BQ8A 3MR0A 3OLOA 1OTEA 5M18A 4N1XA 1BLHA 4WMCD 3LI8A 3VOLA 4B88A 2VK3A 3UE6A 3KSIA 2BG1A 4EQ1A 3DW0A 5M19A 4ARZA 2A24A 1T1CA 4IHQA 4GS9A 3DTEA 4ME4A 1PWGA 3BLMA 4X1LA 4KZ6A 4B9OA 2GZAA 1WYCA 2NUPC 3WS5A 4CQHA 3IS2A 1PW8A 3LR3A 1ZHHB 2EX6A 1K4EA 3JVVA 2D02A 3PYPA 4XT2A 2Y2OA 2ZMVA 1L0GA 1L3LA 2X01A 3ZCZA 2JC7A 2RCXA 1XFQA 3JYIA 1W8QA 4KG6A 3ZG8B 2WGWB 1GSWA 2ZQ9A 1TS6A 4K0XA 4ETZA 3IXGA 5J8XA 3BFCA 4CJNA 2G2WA 3P09A 4EV4A 2VV6A 1ONHA 5HD5A 4GNUA 1JNUA 4MN5A 3WS1A 5EFWA 5L8MA 3UB7A 1JWPA 3BFFA 1SZVA 2ZM2A 3EEAA 4ETXA 2BTFP 4MBHA 3V3SA 2Y2NA 1EI5A 5HFOA 1XJ6A 4OP8A 1JVJA 1IKGA 5L10A 4F94A 1GA9A 5F68A 2HZ5A 5IHVA 3F1OB 5FQQA 3C30A 4GD8A 3E2LA 3Q7ZA 2M1CA 4BMWA 5EM1A 2OWHA 2EXAA 4IEDA 1VM1A 5KIZA 4WEKA 1FCOA 4N1HA 4JF5A 5HW3A 1TS7A 1FILA 3UMEA 3WRTA 2HPBA 3E4QA 2J3WA 1TVFA 4UEYA 2VGKA 1XGJA 2JE5A 3Q7VA 3IWOA 2XH9A 2O9BA 2FH5A 4MCWA 4X53A 3G2ZA 1MWSA 3WRZA 2DMWA 2WZZA 1S0WA 4ZRRA 5J7EA 4GKUA 3RXXA 1BUEA 1S66L 1BYWA 4BBUA 4LV0A 4XUXA 1X0OA 2PD7A 3GSGA 1YLJA 2ZMFA 1K54A 1MY8A 4ID4A 3IH8A 3PBRA 4BJPA 2HDQA 5D3OA 3LICA 4LRXC 3ZGAB 3W2ZA 5G4ZA 1EWZA 2RL3A 3DBAA 2PT7A 2HP6A 5G4YA 1S1ZA 4BBTA 2XQZA 3IXHA 4P85A 3BEBA 1I2WA 1PZPA 1FSYA 5CXWA 4R4RA 2W1TA 3GECA 3LO7A 1RGZA 3HLGA 3PBTA 5DFYA 5I5LA 1L0EA 4I3JA 2I72A 5GLCA 4HY8A 2FFFB 4E04A 2QMIA 2WGIA 2VV8A 1LT0A 4GHIA 1YLZA 5A8BA 3OPPA 2B02A 2O9CA 1SKOA 2UV0E 2PD8A 3C4PA 2ZM8A 3RH8B 3MXRA 3LR4A 1S4SA 3PXPA 2JKTM 3EEHA 1T18A 1FIKA 4DJ2A 3A3IA 1K6SA 4CLCC 4D60A 1FOFA 1OJ5A 2ZOIA 4Y0OA 2ACGA 2KLIA 5F83A 4O01A 2VEAA 4HP4A 3S22A 3T4OA 4C3QA 3O5YA 3MXQA 1XX2A 5BOHA 4S2OA 1PI5A 2QYBA 4S2PA 4U0TA 4PHTA 2V9AA 3VE3A 3F1PA 5A92A 1D1JA 1V9YA 1CI9A 4GCZA 3QNCA 5J3WA 4EEUA 4NXGA 4WYYA 3HL9A 3VFFA 2G2UA 4MDZA 4MN6A 2KDKA 3ITBA 1YSPA 5EVIA 1YPRA 4YOFA 4LV2A 1BZAA 2XDMA 2JKTI 3VP4A 5FQ9A 1VB6A 4WZ5C 4NXBA 1K6RA 4FH2A 3ZDJA 2W3HA 4KQRA 2QKPA 3N8RA 3CJMA 4E3IA 4PPRA 3LFVA 4DE1A 3LR0A 4Y7PA 1YQSA 1ODVA 1DY6A 4Y15A 3UDXA 1YM1A 4R0QA 5HWTA 3VP3A 5DF8A 3NIAA 4DE3A 3E0YA 1OJGA 3HLBA 3TSGA 4GHIB 4B93A 2VLGA 3CI6A 3BLSA 3R4KA 4QD4A 1YLTA 4ESPA 2A2LA 4EESA 4HIAA 5F5YA 1S1YA 1D06A 4JXGA 5HDCA 3ZVWA 2H0YA 3BJNA 4F3LA 2V1AA 1S6RA 4I3AA 3GDIA 1KGFA 1OTAA 4B4ZA 3CWFA 1SDEA 1Q2PA 1DP8A 2J9PA 3BWLA 2WYXA 3A0RA 4FD8A 4YFMA 2DCFA 4I5SA 1W5DA 3L9KA 4BQMA 4Y0UA 1BLPA 4E6WA 5JYOA 4L9EA 3GR2A 4GZBA 4WUJA 4QU3A 3CPTA 1GA0A 3UB9A 3GVBA 3KYQA 3DTIA 1Q2QA 5AQ9A 2HGVA 1IOUA 5E2GA 3WS4A 2KX6A 4OP5A 2KOIA 5HARA 5K5BA 3N8SA 5J4EA 4R1GA 1SDNA 1T19A 4LRYC 5HPFA 4BD1A 2Y2PA 4MBFA 3C8CA 5DTTA 5E2EA 1HZOA 3OOVA 4PM5A 5FQJA 1LLBA 1OTDA 4QPRA 3G30A 3VP0A 3M2KA 2PBDP 3ZQ5A 4Q8IA 1K4FA 3RXWA 2R9WA 1FR1A 4X56A 2Z6CA 3IF6C 3JVUA 1TDLA 2WKHA 3KSGA 5CHUA 3VSKA 4EBLA 1E3UA 1BLSA 1SHVA 1M40A 4RX2A 3LR5A 4OKPA 2ZLYA 2WAFA 2PDRA 2Y79A 1TDGA 3CUEC 3SS4A 1Y4OA 3FKVA 1PWCA 2QJ7A 2P74A 2WGVA 1KGEA 3CZDA 3TW8A 2H0TA 1S4RA 4F3LB 1MC0A 4MLLA 2Y2HA 1EW0A 1ZTUA 5EVID 5GL9A 2K7SA 3LEQA 1CJFA 4JF4A 1H5XA 2VX8A 4OQHA 3BFDA 2C5WB 4X25A 2Y4AA 2PBYA 3EGXC 4Y0TA 2WGWA 4QHCA 3S7NA 2G7UA 3O88A 3KYZA 1RP5A 4HJ6A 3K2NA 1NZUA 5FSRA 3G6OA 3Q82A 4P6BA 3MXSA 2WK0A 3PBNA 3TRCA 1KGGA 1Y28A 4U0XA 4L9FA 2P08A 4E3NA 3AGDA 1LSWA 2OLVA 2VZWA 1PW1A 3B33A 2W3EA 2Q9MA 3GRJA 3NJAA 3PBQA 5I94A 3GTCA 4Y2FA 1KDSA 2CMNA 4GD6A 2XFTA 4U3TA 3IH9A 5F6AA 1MWTA 2JN7A 2HDUA 1I5QA 3FKWA 1YMXA 5TBMA 2Y91A 1FSWA 4ZBEA 3LIDA 2H5SA 2V8FA 3H9WA 3Q07A 5JYPA 4ZTKA 3S1YA 3S7PA 3K3CA 4OQ0A 3PR6A 2ZOHA 3D4FA 4GDNA 1ESUA 2Y2LA 4N9LA 1Z09A 4UA9A 4BL2A 2PRFA 4IUKA 1PZOA 3NULA 3EWKA 3FC7A 1N9NA 4EERA 3S7QA 5U47A 1HD8A 4EWFA 3ZG0A 1PWDA 4MMNA 1RGYA 3B47A 4HEFA 1GSVA 2VV7A 5FI2A 2H10A 4EW7A 4X69A 2QPNA 3BQAA 3UNWA 4M3KA 3ZVTA 4Y13A 1A0KA 1D7EA 1BT5A 1L2SA 1ALQA 5EV0A 5HSQA 4UQIS 2VA0A 3GV9A 3ICYA 3HLDA 4S2NA 4E3KA 1ES5A 3MKFA 4OONA 5FDSA 3U4LP 1E25A 2K31A 1YAXA 3NOUC 2Q0OA 1O07A 5TR7A 2ZL1A 5EUAA 2Y8HA 2GDNA 5AVEA 5G18A 3T4QA 1L0FA 4I39A 2JKRI 4M4XA 1LL8A 1H8MA 2K2NA 2W1TB 2XROA 3VP1A 3RJUA 5DJTA 3IHBA 3IXBA 3E4OA 2LB9A 3IBJA 2XF3A 5L2FA 3IWIA 2XSSA 5TBMB 1YSQA 1Z6FA 2FFYA 3OPLA 2BLSA 4HI4A 5GLDA 3H7WA 3MS6A 3VFHA 1YMSA 5TJJA 3T4LA 3A3EA 4QY5A 2ZMAA 3BRMA 4RQ9A 4QJGA 2ZC4B 4NETA 5HD3A 4UAAA 4S2NC 1UGUA 3N4IA 5HAQA 4A5RA 4KUOA 5DKLA 1P9WA 3MKEA 4DXBA 1NWZA 4OOYA 2M7VA 3LUQA 4GS9B 2XD1A 5EVIC 4WL9A 1SKFA 3C4OA 3TE8A 2IWBA 3IBRA 5DTSA 2D01A 1OTIA 1S67L 4DE2A 1ZG4A 1YKDA 4PM9A 3O86A 4EUVA 2P9VA 1XJ4A 4X6TA 3V67A 5EVIB 5A90A 1H0MA 1FCMA 2X71A 3G2YA 3LY3A 5CGWA 3LY4A 4NEED 3H7WB 3RFBA 3PTEA 4XUZA 1VETB 2XLNA 1K38A 2W3DA 4BWIA 2W3FA 1KE4A 1YT4A 4P6ZM 3VOZA 3N8LA 2M7UA 1KDWA 2EXBA 1LI9A 3Q1FA 3QP5A 3SW1A 3SS3A 3T1XA 1I2SA 3LI9A 3AGFA 2INWA 3GQZA 4WN5A 2V2FF 3T1RA 3G4PA 3IX4A 1C3BA 3UPNA 4KUKA 1K55C 3LIFA 4MEZA 3UMDA 2PAVP 4LFUA 1TD5A 1PYYA 2Y2JA 2Y59A 1MWUA 3T4KA 1ZG6A 3H82B 4RX3A 2OV5A 5F1FA 3A3DA 3KX0X 4LRZE 1O7EA 3MQ0A 5GHXA 4H6JB 1MBLA 3O87A 3Q7VB 4RA7A 1VETA 4GN2A 1IFQA 4HNBA 1ERMA 4GLQA 5E2HA 1BTLA 3W4PA 2HP5A 4EUZA 4P87A 2WKRA 4QB8A 4C6YA 3G35A 2Y55A 4JXSA 1GSXA 2B5RA 5C5KA 4HJ4A 4Y3IA 1K56D 4FOFA 1V9ZA 4IVKA 1M6KA 3U2AA 3Q81A 1GHIA 4BBVA 5FQKA 2IWDA 2J3TD 2HDSA 3MBZA 3KSFA 1BULA 2HV1A 2J80A 4MBKA 4WMCA 1AXBA 2PR5A 5FQMA 2ZQAA 5FA7A 3LIEA 2HP9A 4JF6A 2EFXA 4DF6A 2WADA 4E3MA 3JPUA 1U60A 1XKZA 1KVLA 1ESIA 1PIOA 1G68A 5KMWA 1VQQA 3CPTB 4L0LA 5DFXA 1MKMA 1XFNA 3LYXA 1XGIA 3IHAA 2EA9A 3V5MA 5KSCA 3HUNA 3ZYTA 4EEPA 3ZNTA 1ES4A 4UHUA 5A91A 4LGWA 2HF6A 2HJEA 3NCKA 3VE4A 4CLCD 2HDRA 4PKYA 4LCMA 4R6LA 2OWJA 1NLYA 1JWZA 4B4XA 4KG2A 4BENA 3T12B 3DTMA 3V3RA 4H6JA 2ZC3B 3T4SA 4HQAA 3OCNA 3GMWA 1ONGA 3ZG9B 2B18A 2EX2A 1H3QA 3L7HA 1VEUB 5CX7A 4R4SA 1TS8A 4KZ3A 3MZFA 1NRFA 3AGEA 5CEDA 4G3WA 4IVIA 5E43A 4MNRA 3QP4A 1DJBA 4R23A 2O0YA 4DXCA 4S2KA 1IYSA 4E3LA 5CERA 1MWRA 4ZJ3A 5AQAA 4KZ5A 4JGRA 1XP4A 4PAUA 5M1AA 3HUOA 5FASA 4L9GA 3BYDA 3LEZA 3M6BA 3ZFZA 1T1AA 5AVFA 2QJ5A 3ULFA 5AQ7A 2Q9NA 1KE3A 2L1MA 3F1NA 3FG8A 3HLFA 1PI4A 3ZNYA 2Z6DA 3W8KA 1LL5A 1CQAA 4K0WA 1ERQA 4YNRA 1F2KA 5CTMA 3UDIA 4O8GA 2OAQ1 3MF0A 1XJ3A 2XR0A 5L07A 2Y2MA 4E3OA 3HLWA 1JWVA 2O99A 5A93A 5L09A 2ZJ9A 3NBLA 1MXOA 3I7JA 1N9OA 2Y2GA 2VJWA 5GHZA 2XD5A 1SCWA 5F82A 3MMHA 1OT9A 4LLOB 2L4RA
chains in the Genus database with same CATH topology
1TVFA 4OPQA 2VGKA 1ZKJA 3PBSA 1XGJA 2JE5A 1PZOA 3Q7VA 4R3BA 4RYEA 4IBRA 1JTDA 3M2JA 3IWOA 1RCJA 1FR6A 2Y2KA 3W4OA 5U47A 5EOEA 2IWCA 2XH9A 1HD8A 4EWFA 2Z2LB 3G2ZA 4X53A 3V39A 3ZG0A 1K55A 1MWSA 1PWDA 2VGJA 3WRZA 1RGYA 5DF9A 3S4XA 2WZZA 1S0WA 4GKUA 1YLWA 3RXXA 1HTZA 5EVLA 1BUEA 3HREA 4HEFA 4E6XA 5FI2A 2H10A 4EBNA 4X69A 3ZG5A 2QPNA 1FCNA 3UNWA 2Y2QA 4M3KA 3V50A 3ZVTA 4LV0A 1ES2A 1XA1A 4NK3A 4XUXA 1BT5A 3PBOA 3GSGA 1YLJA 1HVBA 1K54A 1L2SA 1MY8A 1ALQA 4ID4A 3HLEA 3IH8A 3PBRA 4BJPA 2HDQA 5D3OA 5FAQA 5HX9A 3W4QA 3GV9A 3ZGAB 3HLDA 4S2NA 4EQIA 1GCEA 4E3KA 1ES5A 3MKFA 4OLGA 4OONA 4PMAA 1E25A 1EWZA 3G32A 1O07A 2RL3A 3N6IA 4C75A 5TR7A 4ZAMA 1BSGA 4DDSA 3UPOA 3C5AA 2HP6A 4HESA 5EUAA 1XXMA 2DNSA 2GDNA 2XQZA 3IXHA 4WM9A 5G18A 4P85A 3WS0A 3BEBA 1I2WA 1K56A 1PZPA 1L0FA 1FSYA 5CXWA 5KSHA 3TG9A 4R4RA 3LO7A 1RGZA 2A3UA 3HLGA 3PBTA 3C7VA 3TOIA 2EFUA 3VP1A 4LV1A 4OQIA 1L0EA 2E8IA 5HAPA 1BLCA 1NYYA 2ZQDA 3RJUA 3SH7A 2OSUA 3IHBA 4ZJ1A 1IEMA 4YINA 2I72A 3IXBA 2WAEA 5GLCA 3M6HA 5DVAA 5CECA 2FFFB 2ZQCA 2QMIA 2XF3A 3DWKA 5L2FA 2WGIA 3UY6A 1H8YA 3IWIA 1YLZA 2ZD8A 3UO9A 3OPPA 1Z6FA 4FSFA 1NJ4A 2FFYA 3OPLA 2BLSA 5GLDA 3C4PA 2ZM8A 4D2OA 3VFHA 1YMSA 2X02A 2WZXA 1CI8A 3PAEA 1N9BA 3MXRA 3A3EA 4QY5A 4E3JA 3G34A 2WKIA 2ZMAA 3BRMA 3UN7A 2A49A 2ZM0A 3A3IA 1K6SA 2XK1A 4CPKA 4QJGA 2ZC4B 4NETA 4UA7A 3BECA 1FOFA 4UAAA 1QMEA 4JXWA 4S2NC 3NDGA 2EX8A 3NY4A 3BFEA 3N4IA 1E3UD 4WZ4A 4Y0OA 3UDFA 5HAQA 5F83A 4A5RA 4P0MA 5AQBA 4WBGA 1J9MA 3IF6A 3MKEA 4DXBA 4WELA 4ZJ2A 3HBRA 3S22A 4C3QA 4Z9QA 4LENA 4OOYA 3CG5A 4K91A 2EX9A 1XX2A 5BOHA 1WYBA 4S2OA 2XD1A 5EVIC 1PI5A 4KZAA 1SKFA 3N7WA 3C4OA 4OOMA 4S2PA 4U0TA 3UE1A 1GHMA 2IWBA 1IELA 5A92A 2C6WB 2WKEA 2J8YA 1CI9A 4KG5A 5DTSA 3BFGA 1E4DA 3OPRA 3IQAA 3QNCA 3MZEA 4DE2A 1LI0A 1LL9A 1ZG4A 5FAPA 4WYYA 5FATA 3OC2A 4PM9A 1IYPA 3O86A 1ZC2A 4S2MA 5CHMA 3HL9A 1EROA 4KZ4A 2G2UA 2P9VA 4XXRA 3VFFA 1CK3A 3NI9A 4X6TA 1N4OA 5KZHA 5EVIB 5A90A 1NYMA 1FCMA 2X71A 3G2YA 3LY3A 2Y2IA 4JLFA 5CGWA 2ZC7A 3ITBA 4N92A 3LY4A 5EVIA 5EOOA 3SOIA 5HL1A 2UWXA 1BZAA 4LV2A 3PTEA 2XDMA 4H8RA 4XUZA 4LV3A 3VP4A 2XLNA 5FQ9A 5GLAA 4WZ5C 2J7VA 1K38A 5F1GA 1K6RA 4KZBA 3MZDA 1K57A 1KE4A 5DF7A 1YT4A 1LHYA 3VOZA 3N8LA 4FH2A 3ZDJA 3LCEA 1KDWA 4KQRA 2EXBA 2XFSA 3N8RA 1LI9A 3CJMA 3Q1FA 4E3IA 4KQQA 4OQGA 3SS3A 1I2SA 4PPRA 4DE1A 4KENB 4X68A 4Y7PA 1YQSA 3AGFA 1DY6A 3GQZA 3IF6B 4OOLA 2V2FF 3UDXA 1YM1A 2ZQ8A 3G4PA 1Y54A 1C3BA 4R0QA 3UPNA 1CEFA 1FQGA 3E2KA 2CC1A 3VP3A 1K55C 5DF8A 2XEPA 4MEZA 3NIAA 1MPLA 4DE3A 4DKIA 4S2IA 1TEMA 3HLBA 3SH8A 3TSGA 1IKIA 5CHJA 1PYYA 3IXDA 5FQIA 1K54C 2Y2JA 3BLSA 2Y59A 3NDEA 4QD4A 1YLTA 1MWUA 1NY0A 1ZG6A 2JBFA 3UE3A 2J9OA 4RX3A 4JXGA 3ISGA 4PM6A 2OV5A 1IYOA 3ZVWA 5F1FA 4OH0A 5DTKA 4ZDXA 2H0YA 3A3DA 1MKIA 2P9VB 4KZ7A 4OLDA 3MFDA 1QMFA 3NC8A 2R9XA 1O7EA 4HBTA 5GHXA 4OPYA 1S6RA 1YLYA 5FAOA 1MBLA 3O87A 4WEJA 3Q7VB 2ZC5B 1KGFA 4RA7A 2QZ6A 4GN2A 3IF5A 4RVAA 4B4ZA 1DJCA 5GLBA 1ERMA 1SDEA 1Q2PA 4PM8A 3VOYA 5E2HA 2J9PA 3OZHA 1BTLA 1NXYA 3OPHA 3W4PA 2HP5A 2WYXA 4EUZA 3ZG7B 1GHPA 4P87A 4QB8A 4FD8A 4C6YA 4LCLA 4YFMA 5CEBA 1CEGA 2DCFA 3G35A 4GDBA 4KQOA 2Y55A 1DJAA 1W5DA 1XPBA 2B5RA 4JXSA 4BQMA 4Y0UA 5FI7A 1BLPA 3A3JA 5E2FA 1K56D 4E6WA 3FWLA 4BL2A 5JYOA 2Z2MB 3GR2A 4GZBA 5TGFA 4IVKA 4JBFA 1M6KA 5GHYA 4QU3A 3Q81A 1IYQA 1GHIA 1L0DA 1GA0A 5FQKA 3GVBA 2IWDA 1W8YA 1Q2QA 4FH4A 2HDSA 4S2JA 5E2GA 5AQ9A 5FI6A 3MBZA 3PAGA 3WS4A 4OP5A 4N9KA 1BULA 4MBKA 3EQUA 2PU4A 5HARA 5TFQA 3N8SA 4R3JA 1YLPA 4R1GA 1SDNA 3G31A 4WMCA 4KZ9A 3A3FA 1AXBA 4JPMA 3WWXA 5FQMA 3FYZA 2Y2PA 1NZOA 4MBFA 4BD1A 2ZQAA 5DTTA 5E2EA 5FA7A 4DRTA 1HZOA 4PM5A 5FQJA 2HP9A 3IT9A 3P98A 4GB7A 1LLBA 4JF6A 5M18A 2EFXA 4DF6A 3G30A 2PU2A 3VP0A 4N1XA 1BLHA 3M2KA 4WMCD 4B88A 2WADA 1KE0A 4E3MA 3O3VA 1U60A 4Q8IA 1XKZA 2BG1A 3DWZA 1KVLA 1ESIA 3DW0A 5M19A 4OVDA 1PIOA 1K4FA 3RXWA 2R9WA 1G68A 3UPPA 1W7FA 3BM6A 5KMWA 1G6AA 1FR1A 4X56A 1VQQA 4L0LA 3OCLA 3IF6C 3VSKA 1TDLA 2WKHA 5CHUA 2V1ZA 4EBLA 1E3UA 2V20A 4O7DA 1BLSA 1PWGA 1XGIA 1SHVA 1M40A 3BLMA 4RX2A 4BL3A 3IHAA 4OKPA 5CRFA 3V5MA 5KSCA 2ZLYA 1ES3A 2WAFA 3CMZA 3HUNA 3IWQA 1TDGA 4HBUA 4JXVA 4KZ6A 3ZNTA 1JTGA 1ES4A 1WYCA 3WS5A 1PW8A 3SS4A 4UHUA 5A91A 1K25A 3FKVA 1PWCA 3NCKA 5CTNA 2P74A 2HDRA 2WGVA 1KGEA 2EX6A 3CZDA 3HVFA 4LCMA 4DE0A 1K4EA 4OPZA 2DRWA 2XGNA 2H0TA 1JWZA 4B4XA 2Y2OA 3QNBA 1L0GA 2X01A 4KG2A 3VSLA 4BENA 2WUQA 3DTMA 3ZCZA 4MLLA 3V3RA 2JC7A 2Y2HA 2ZC3B 3VP2A 3OCNA 2RCXA 3GMWA 1ONGA 4BD0A 3ZG9B 5EVID 1H8ZA 2EX2A 4DDYA 5GL9A 4EBPA 4GOGA 3JYIA 4R4SA 4KZ3A 4OPRA 1W8QA 4KG6A 3MZFA 1H5XA 4JF4A 1NRFA 3AGEA 4OQHA 2WGWB 3BFDA 5EE8A 3ZG8B 2C5WB 2ZQ9A 2Y4AA 4IVIA 2PBYA 4MNRA 5E43A 5CEDA 4K0XA 4Y0TA 1DJBA 2WGWA 4R23A 4QHCA 4DXCA 5CGSA 3IXGA 1XA7A 5J8XA 3O88A 4S2KA 1IYSA 4E3LA 1RP5A 3BFCA 5CERA 1MWRA 4ZJ3A 4CJNA 2G2WA 3P09A 4EV4A 5AQAA 5HAIA 1NZUA 4KZ5A 5FSRA 1XP4A 3Q82A 4P6BA 3MXSA 5M1AA 3HUOA 1ONHA 5FASA 2WK0A 4GNUA 3WS1A 5EECA 3PBNA 3BYDA 3LEZA 3SS5A 1KGGA 3M6BA 3ZHHA 3ZFZA 4WZ5A 1JWPA 3BFFA 3ITAA 4X55A 5AQ7A 4U0XA 2ZM2A 2Q9NA 3B3XA 1KE3A 3SH9A 4E3NA 3AGDA 3VMAA 4MBHA 3HLFA 3V3SA 1PI4A 2OLVA 3ZNYA 2Y2NA 1EI5A 1PW1A 3W8KA 5FDHA 1LL5A 2Q9MA 5HFOA 3GRJA 1ERQA 3PBQA 4K0WA 4OP8A 1JVJA 1IKGA 2JCHA 5EPHA 1K57C 3GTCA 4JKTA 5I94A 1WE4A 1KDSA 4GD6A 4F94A 1GA9A 4PM7A 2XFTA 4U3TA 3HUMA 3EQVA 3IH9A 5CTMA 3UDIA 4KZ8A 1MWTA 5IHVA 4FCFA 4UA6A 2HDUA 4S2LA 3FZCA 2XR0A 1I5QA 3FV7A 3FKWA 3C7UA 4IBXA 5FQQA 1W79A 1YMXA 4GD8A 2Y2MA 3E2LA 3Q7ZA 4E3OA 2Y91A 1FSWA 4ZBEA 3HLWA 2EXAA 1JWVA 5A93A 2H5SA 3HLCA 3Q07A 4IEDA 5JYPA 2ZJ9A 2ZQ7A 4ZTKA 1VM1A 3NBLA 3S1YA 1MXOA 3I7JA 3QHYA 3WS2A 4WEKA 1FCOA 2Y2GA 4N1HA 4OQ0A 2XD5A 4JF5A 5GHZA 1SCWA 5HW3A 4GDNA 3D4FA 3UE0A 1ESUA 2ZC6B 2Y2LA 4BLMA 5F82A 4N9LA 5CGXA 2HPBA 2OLUA 4QY6A 4UA9A 3WRTA 1KVMA 1OMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVF A;  4OPQ A;  2VGK A;  1ZKJ A;  3PBS A;  1XGJ A;  2JE5 A;  1PZO A;  3Q7V A;  4R3B A;  4RYE A;  4IBR A;  1JTD A;  3M2J A;  3IWO A;  1RCJ A;  1FR6 A;  2Y2K A;  3W4O A;  5U47 A;  5EOE A;  2IWC A;  2XH9 A;  1HD8 A;  4EWF A;  2Z2L B;  3G2Z A;  4X53 A;  3V39 A;  3ZG0 A;  1K55 A;  1MWS A;  1PWD A;  2VGJ A;  3WRZ A;  1RGY A;  5DF9 A;  3S4X A;  2WZZ A;  1S0W A;  4GKU A;  1YLW A;  3RXX A;  1HTZ A;  5EVL A;  1BUE A;  3HRE A;  4HEF A;  4E6X A;  5FI2 A;  2H10 A;  4EBN A;  4X69 A;  3ZG5 A;  2QPN A;  1FCN A;  3UNW A;  2Y2Q A;  4M3K A;  3V50 A;  3ZVT A;  4LV0 A;  1ES2 A;  1XA1 A;  4NK3 A;  4XUX A;  1BT5 A;  3PBO A;  3GSG A;  1YLJ A;  1HVB A;  1K54 A;  1L2S A;  1MY8 A;  1ALQ A;  4ID4 A;  3HLE A;  3IH8 A;  3PBR A;  4BJP A;  2HDQ A;  5D3O A;  5FAQ A;  5HX9 A;  3W4Q A;  3GV9 A;  3ZGA B;  3HLD A;  4S2N A;  4EQI A;  1GCE A;  4E3K A;  1ES5 A;  3MKF A;  4OLG A;  4OON A;  4PMA A;  1E25 A;  1EWZ A;  3G32 A;  1O07 A;  2RL3 A;  3N6I A;  4C75 A;  5TR7 A;  4ZAM A;  1BSG A;  4DDS A;  3UPO A;  3C5A A;  2HP6 A;  4HES A;  5EUA A;  1XXM A;  2DNS A;  2GDN A;  2XQZ A;  3IXH A;  4WM9 A;  5G18 A;  4P85 A;  3WS0 A;  3BEB A;  1I2W A;  1K56 A;  1PZP A;  1L0F A;  1FSY A;  5CXW A;  5KSH A;  3TG9 A;  4R4R A;  3LO7 A;  1RGZ A;  2A3U A;  3HLG A;  3PBT A;  3C7V A;  3TOI A;  2EFU A;  3VP1 A;  4LV1 A;  4OQI A;  1L0E A;  2E8I A;  5HAP A;  1BLC A;  1NYY A;  2ZQD A;  3RJU A;  3SH7 A;  2OSU A;  3IHB A;  4ZJ1 A;  1IEM A;  4YIN A;  2I72 A;  3IXB A;  2WAE A;  5GLC A;  3M6H A;  5DVA A;  5CEC A;  2FFF B;  2ZQC A;  2QMI A;  2XF3 A;  3DWK A;  5L2F A;  2WGI A;  3UY6 A;  1H8Y A;  3IWI A;  1YLZ A;  2ZD8 A;  3UO9 A;  3OPP A;  1Z6F A;  4FSF A;  1NJ4 A;  2FFY A;  3OPL A;  2BLS A;  5GLD A;  3C4P A;  2ZM8 A;  4D2O A;  3VFH A;  1YMS A;  2X02 A;  2WZX A;  1CI8 A;  3PAE A;  1N9B A;  3MXR A;  3A3E A;  4QY5 A;  4E3J A;  3G34 A;  2WKI A;  2ZMA A;  3BRM A;  3UN7 A;  2A49 A;  2ZM0 A;  3A3I A;  1K6S A;  2XK1 A;  4CPK A;  4QJG A;  2ZC4 B;  4NET A;  4UA7 A;  3BEC A;  1FOF A;  4UAA A;  1QME A;  4JXW A;  4S2N C;  3NDG A;  2EX8 A;  3NY4 A;  3BFE A;  3N4I A;  1E3U D;  4WZ4 A;  4Y0O A;  3UDF A;  5HAQ A;  5F83 A;  4A5R A;  4P0M A;  5AQB A;  4WBG A;  1J9M A;  3IF6 A;  3MKE A;  4DXB A;  4WEL A;  4ZJ2 A;  3HBR A;  3S22 A;  4C3Q A;  4Z9Q A;  4LEN A;  4OOY A;  3CG5 A;  4K91 A;  2EX9 A;  1XX2 A;  5BOH A;  1WYB A;  4S2O A;  2XD1 A;  5EVI C;  1PI5 A;  4KZA A;  1SKF A;  3N7W A;  3C4O A;  4OOM A;  4S2P A;  4U0T A;  3UE1 A;  1GHM A;  2IWB A;  1IEL A;  5A92 A;  2C6W B;  2WKE A;  2J8Y A;  1CI9 A;  4KG5 A;  5DTS A;  3BFG A;  1E4D A;  3OPR A;  3IQA A;  3QNC A;  3MZE A;  4DE2 A;  1LI0 A;  1LL9 A;  1ZG4 A;  5FAP A;  4WYY A;  5FAT A;  3OC2 A;  4PM9 A;  1IYP A;  3O86 A;  1ZC2 A;  4S2M A;  5CHM A;  3HL9 A;  1ERO A;  4KZ4 A;  2G2U A;  2P9V A;  4XXR A;  3VFF A;  1CK3 A;  3NI9 A;  4X6T A;  1N4O A;  5KZH A;  5EVI B;  5A90 A;  1NYM A;  1FCM A;  2X71 A;  3G2Y A;  3LY3 A;  2Y2I A;  4JLF A;  5CGW A;  2ZC7 A;  3ITB A;  4N92 A;  3LY4 A;  5EVI A;  5EOO A;  3SOI A;  5HL1 A;  2UWX A;  1BZA A;  4LV2 A;  3PTE A;  2XDM A;  4H8R A;  4XUZ A;  4LV3 A;  3VP4 A;  2XLN A;  5FQ9 A;  5GLA A;  4WZ5 C;  2J7V A;  1K38 A;  5F1G A;  1K6R A;  4KZB A;  3MZD A;  1K57 A;  1KE4 A;  5DF7 A;  1YT4 A;  1LHY A;  3VOZ A;  3N8L A;  4FH2 A;  3ZDJ A;  3LCE A;  1KDW A;  4KQR A;  2EXB A;  2XFS A;  3N8R A;  1LI9 A;  3CJM A;  3Q1F A;  4E3I A;  4KQQ A;  4OQG A;  3SS3 A;  1I2S A;  4PPR A;  4DE1 A;  4KEN B;  4X68 A;  4Y7P A;  1YQS A;  3AGF A;  1DY6 A;  3GQZ A;  3IF6 B;  4OOL A;  2V2F F;  3UDX A;  1YM1 A;  2ZQ8 A;  3G4P A;  1Y54 A;  1C3B A;  4R0Q A;  3UPN A;  1CEF A;  1FQG A;  3E2K A;  2CC1 A;  3VP3 A;  1K55 C;  5DF8 A;  2XEP A;  4MEZ A;  3NIA A;  1MPL A;  4DE3 A;  4DKI A;  4S2I A;  1TEM A;  3HLB A;  3SH8 A;  3TSG A;  1IKI A;  5CHJ A;  1PYY A;  3IXD A;  5FQI A;  1K54 C;  2Y2J A;  3BLS A;  2Y59 A;  3NDE A;  4QD4 A;  1YLT A;  1MWU A;  1NY0 A;  1ZG6 A;  2JBF A;  3UE3 A;  2J9O A;  4RX3 A;  4JXG A;  3ISG A;  4PM6 A;  2OV5 A;  1IYO A;  3ZVW A;  5F1F A;  4OH0 A;  5DTK A;  4ZDX A;  2H0Y A;  3A3D A;  1MKI A;  2P9V B;  4KZ7 A;  4OLD A;  3MFD A;  1QMF A;  3NC8 A;  2R9X A;  1O7E A;  4HBT A;  5GHX A;  4OPY A;  1S6R A;  1YLY A;  5FAO A;  1MBL A;  3O87 A;  4WEJ A;  3Q7V B;  2ZC5 B;  1KGF A;  4RA7 A;  2QZ6 A;  4GN2 A;  3IF5 A;  4RVA A;  4B4Z A;  1DJC A;  5GLB A;  1ERM A;  1SDE A;  1Q2P A;  4PM8 A;  3VOY A;  5E2H A;  2J9P A;  3OZH A;  1BTL A;  1NXY A;  3OPH A;  3W4P A;  2HP5 A;  2WYX A;  4EUZ A;  3ZG7 B;  1GHP A;  4P87 A;  4QB8 A;  4FD8 A;  4C6Y A;  4LCL A;  4YFM A;  5CEB A;  1CEG A;  2DCF A;  3G35 A;  4GDB A;  4KQO A;  2Y55 A;  1DJA A;  1W5D A;  1XPB A;  2B5R A;  4JXS A;  4BQM A;  4Y0U A;  5FI7 A;  1BLP A;  3A3J A;  5E2F A;  1K56 D;  4E6W A;  3FWL A;  4BL2 A;  5JYO A;  2Z2M B;  3GR2 A;  4GZB A;  5TGF A;  4IVK A;  4JBF A;  1M6K A;  5GHY A;  4QU3 A;  3Q81 A;  1IYQ A;  1GHI A;  1L0D A;  1GA0 A;  5FQK A;  3GVB A;  2IWD A;  1W8Y A;  1Q2Q A;  4FH4 A;  2HDS A;  4S2J A;  5E2G A;  5AQ9 A;  5FI6 A;  3MBZ A;  3PAG A;  3WS4 A;  4OP5 A;  4N9K A;  1BUL A;  4MBK A;  3EQU A;  2PU4 A;  5HAR A;  5TFQ A;  3N8S A;  4R3J A;  1YLP A;  4R1G A;  1SDN A;  3G31 A;  4WMC A;  4KZ9 A;  3A3F A;  1AXB A;  4JPM A;  3WWX A;  5FQM A;  3FYZ A;  2Y2P A;  1NZO A;  4MBF A;  4BD1 A;  2ZQA A;  5DTT A;  5E2E A;  5FA7 A;  4DRT A;  1HZO A;  4PM5 A;  5FQJ A;  2HP9 A;  3IT9 A;  3P98 A;  4GB7 A;  1LLB A;  4JF6 A;  5M18 A;  2EFX A;  4DF6 A;  3G30 A;  2PU2 A;  3VP0 A;  4N1X A;  1BLH A;  3M2K A;  4WMC D;  4B88 A;  2WAD A;  1KE0 A;  4E3M A;  3O3V A;  1U60 A;  4Q8I A;  1XKZ A;  2BG1 A;  3DWZ A;  1KVL A;  1ESI A;  3DW0 A;  5M19 A;  4OVD A;  1PIO A;  1K4F A;  3RXW A;  2R9W A;  1G68 A;  3UPP A;  1W7F A;  3BM6 A;  5KMW A;  1G6A A;  1FR1 A;  4X56 A;  1VQQ A;  4L0L A;  3OCL A;  3IF6 C;  3VSK A;  1TDL A;  2WKH A;  5CHU A;  2V1Z A;  4EBL A;  1E3U A;  2V20 A;  4O7D A;  1BLS A;  1PWG A;  1XGI A;  1SHV A;  1M40 A;  3BLM A;  4RX2 A;  4BL3 A;  3IHA A;  4OKP A;  5CRF A;  3V5M A;  5KSC A;  2ZLY A;  1ES3 A;  2WAF A;  3CMZ A;  3HUN A;  3IWQ A;  1TDG A;  4HBU A;  4JXV A;  4KZ6 A;  3ZNT A;  1JTG A;  1ES4 A;  1WYC A;  3WS5 A;  1PW8 A;  3SS4 A;  4UHU A;  5A91 A;  1K25 A;  3FKV A;  1PWC A;  3NCK A;  5CTN A;  2P74 A;  2HDR A;  2WGV A;  1KGE A;  2EX6 A;  3CZD A;  3HVF A;  4LCM A;  4DE0 A;  1K4E A;  4OPZ A;  2DRW A;  2XGN A;  2H0T A;  1JWZ A;  4B4X A;  2Y2O A;  3QNB A;  1L0G A;  2X01 A;  4KG2 A;  3VSL A;  4BEN A;  2WUQ A;  3DTM A;  3ZCZ A;  4MLL A;  3V3R A;  2JC7 A;  2Y2H A;  2ZC3 B;  3VP2 A;  3OCN A;  2RCX A;  3GMW A;  1ONG A;  4BD0 A;  3ZG9 B;  5EVI D;  1H8Z A;  2EX2 A;  4DDY A;  5GL9 A;  4EBP A;  4GOG A;  3JYI A;  4R4S A;  4KZ3 A;  4OPR A;  1W8Q A;  4KG6 A;  3MZF A;  1H5X A;  4JF4 A;  1NRF A;  3AGE A;  4OQH A;  2WGW B;  3BFD A;  5EE8 A;  3ZG8 B;  2C5W B;  2ZQ9 A;  2Y4A A;  4IVI A;  2PBY A;  4MNR A;  5E43 A;  5CED A;  4K0X A;  4Y0T A;  1DJB A;  2WGW A;  4R23 A;  4QHC A;  4DXC A;  5CGS A;  3IXG A;  1XA7 A;  5J8X A;  3O88 A;  4S2K A;  1IYS A;  4E3L A;  1RP5 A;  3BFC A;  5CER A;  1MWR A;  4ZJ3 A;  4CJN A;  2G2W A;  3P09 A;  4EV4 A;  5AQA A;  5HAI A;  1NZU A;  4KZ5 A;  5FSR A;  1XP4 A;  3Q82 A;  4P6B A;  3MXS A;  5M1A A;  3HUO A;  1ONH A;  5FAS A;  2WK0 A;  4GNU A;  3WS1 A;  5EEC A;  3PBN A;  3BYD A;  3LEZ A;  3SS5 A;  1KGG A;  3M6B A;  3ZHH A;  3ZFZ A;  4WZ5 A;  1JWP A;  3BFF A;  3ITA A;  4X55 A;  5AQ7 A;  4U0X A;  2ZM2 A;  2Q9N A;  3B3X A;  1KE3 A;  3SH9 A;  4E3N A;  3AGD A;  3VMA A;  4MBH A;  3HLF A;  3V3S A;  1PI4 A;  2OLV A;  3ZNY A;  2Y2N A;  1EI5 A;  1PW1 A;  3W8K A;  5FDH A;  1LL5 A;  2Q9M A;  5HFO A;  3GRJ A;  1ERQ A;  3PBQ A;  4K0W A;  4OP8 A;  1JVJ A;  1IKG A;  2JCH A;  5EPH A;  1K57 C;  3GTC A;  4JKT A;  5I94 A;  1WE4 A;  1KDS A;  4GD6 A;  4F94 A;  1GA9 A;  4PM7 A;  2XFT A;  4U3T A;  3HUM A;  3EQV A;  3IH9 A;  5CTM A;  3UDI A;  4KZ8 A;  1MWT A;  5IHV A;  4FCF A;  4UA6 A;  2HDU A;  4S2L A;  3FZC A;  2XR0 A;  1I5Q A;  3FV7 A;  3FKW A;  3C7U A;  4IBX A;  5FQQ A;  1W79 A;  1YMX A;  4GD8 A;  2Y2M A;  3E2L A;  3Q7Z A;  4E3O A;  2Y91 A;  1FSW A;  4ZBE A;  3HLW A;  2EXA A;  1JWV A;  5A93 A;  2H5S A;  3HLC A;  3Q07 A;  4IED A;  5JYP A;  2ZJ9 A;  2ZQ7 A;  4ZTK A;  1VM1 A;  3NBL A;  3S1Y A;  1MXO A;  3I7J A;  3QHY A;  3WS2 A;  4WEK A;  1FCO A;  2Y2G A;  4N1H A;  4OQ0 A;  2XD5 A;  4JF5 A;  5GHZ A;  1SCW A;  5HW3 A;  4GDN A;  3D4F A;  3UE0 A;  1ESU A;  2ZC6 B;  2Y2L A;  4BLM A;  5F82 A;  4N9L A;  5CGX A;  2HPB A;  2OLU A;  4QY6 A;  4UA9 A;  3WRT A;  1KVM A;  1OME A; 
#chains in the Genus database with same CATH topology
 4OPQ A;  1ZKJ A;  3QP6 A;  4R3B A;  4RYE A;  3QP2 A;  5HDD A;  5EOE A;  2IWC A;  2Z2L B;  1P97 A;  2JKG A;  5MC7 A;  1K55 A;  5DF9 A;  3S4X A;  2A24 B;  5EVL A;  3HRE A;  4FUW A;  3FPW A;  4EBN A;  3ZG5 A;  3A0V A;  2Y2Q A;  1VHM A;  1ES2 A;  3PBO A;  4G3K A;  3T4J A;  2WKP A;  5FAQ A;  1GCE A;  5HPI A;  4PMA A;  3KO6 A;  2EWW A;  4C75 A;  1BSG A;  3UPO A;  3C5A A;  2JHE A;  4HES A;  1MZU A;  1LSX A;  3QP1 A;  4Q0H A;  4WM9 A;  5F69 A;  5IT5 A;  1UWN X;  4JGO A;  1VEU A;  3TG9 A;  2EFU A;  2E8I A;  2JKF A;  1BLC A;  3F1P B;  3SH7 A;  2OSU A;  4ZJ1 A;  1IEM A;  4YIN A;  2WAE A;  1LSV A;  5CEC A;  5FEG A;  2ZQC A;  3DAV A;  3DWK A;  3CIT A;  1STZ A;  4HP9 A;  3NEC A;  2ZD8 A;  3UO9 A;  1NLZ A;  4D2O A;  2WZX A;  1CI8 A;  3PAE A;  5DJU A;  3F1N B;  2WKI A;  3G34 A;  4UQI M;  2V0W A;  3UN7 A;  2A49 A;  1DP6 A;  3BEC A;  4JXW A;  3NDG A;  2EX8 A;  3NY4 A;  3BFE A;  1E3U D;  1N9L A;  3UDF A;  3E4P A;  5AQB A;  4Y17 A;  3HBR A;  3LGO A;  1OPX A;  1WYB A;  4AFI A;  3UE1 A;  1GHM A;  1IEL A;  2C6W B;  2I9V A;  2WKE A;  2J8Y A;  3NOT C;  2J3T C;  4KG5 A;  2PYP A;  3CHW P;  3IQA A;  2VGL S;  3MZE A;  5FAT A;  3OC2 A;  1IYP A;  1ZC2 A;  4S2M A;  1WA9 A;  3UB6 A;  1NYM A;  2ZC7 A;  2V1B A;  4N92 A;  3SOI A;  1SKO B;  2BAS A;  2UWX A;  4EXO A;  4H8R A;  3KYE A;  4LV3 A;  2VKS A;  2J7V A;  3MSH A;  4I38 A;  1K57 A;  4KQD A;  3T1Q B;  4GJ4 A;  3LCE A;  3MFX A;  2XFS A;  4KQQ A;  4OQG A;  4KEN B;  4X68 A;  3EOI A;  3T50 A;  2ZQ8 A;  1CEF A;  2CC1 A;  4G3V A;  1MPL A;  4S2I A;  1TEM A;  3SH8 A;  3T4T A;  3IXD A;  5FQI A;  3NDE A;  4JGQ A;  3UE3 A;  2JBF A;  2GX5 A;  4IUH A;  1PNE A;  1P0Z A;  5DTK A;  1MKI A;  2AVX A;  2V0U A;  3NC8 A;  1QMF A;  4II7 A;  4KZ7 A;  4HBT A;  3SZT A;  5HWV A;  1YLY A;  4WEJ A;  2GJ3 A;  2ZC5 B;  1XJ2 A;  2QZ6 A;  4RVA A;  1DJC A;  5GLB A;  3HCY A;  3VOY A;  1F9I A;  1NXY A;  3OPH A;  2EWV A;  1GHP A;  3UB5 P;  1T1B A;  3C38 A;  4GDB A;  4KQO A;  1K0K A;  1DJA A;  1XPB A;  2YKF A;  5FI7 A;  3A3J A;  5E2F A;  2Z2M B;  3LIA A;  4JBF A;  5GHY A;  1IYQ A;  5EVE A;  5IU1 A;  1TS0 A;  1W8Y A;  3IX8 A;  4S2J A;  5FI6 A;  3LIB A;  5LBR A;  1UWP X;  2PHY A;  4R3J A;  4CLC A;  2IA2 A;  1YLP A;  4KZ9 A;  1W63 M;  4P6Z S;  3WWX A;  4JPM A;  3BY9 A;  4DRT A;  2ZL1 B;  3IT9 A;  3P98 A;  4GB7 A;  3TJZ C;  1DP9 A;  2PU2 A;  2FZ0 A;  1KE0 A;  3O3V A;  1NRJ A;  3DWZ A;  2JKR M;  2GNX A;  2ZBB A;  4OVD A;  3UPP A;  4R38 A;  1W7F A;  3BM6 A;  1G6A A;  3OCL A;  2V1Z A;  2V20 A;  4O7D A;  1P9R A;  4BL3 A;  5CRF A;  1ES3 A;  3IWQ A;  3CMZ A;  4HBU A;  4JGP A;  4JXV A;  1JTG A;  1K25 A;  5CTN A;  4DE0 A;  3HVF A;  5AJG A;  4XT2 B;  4OPZ A;  2DRW A;  2XGN A;  2W27 A;  3BY8 A;  3IX3 A;  3QNB A;  3VSL A;  2WUQ A;  2W3G A;  3VP2 A;  4BD0 A;  1G28 A;  2LB5 A;  1H8Z A;  4DDY A;  4EBP A;  4GOG A;  4OPR A;  5EE8 A;  5FL3 A;  3D3O A;  5CGS A;  1XA7 A;  4NXE A;  4IJG A;  1KOU A;  1G6O A;  4HH3 A;  5HAI A;  1HLU P;  4QWO A;  5EEC A;  3SS5 A;  3ZHH A;  4WZ5 A;  3MQO A;  3ITA A;  4X55 A;  3B3X A;  3SH9 A;  4Q0J A;  3VMA A;  1F98 A;  5IS1 A;  5FDH A;  4PKY G;  5EPH A;  2JCH A;  1K57 C;  4JKT A;  1WE4 A;  4PM7 A;  4ARZ B;  3HUM A;  3EQV A;  4KZ8 A;  2QHK A;  4FCF A;  4UA6 A;  4S2L A;  4CLC E;  3FZC A;  3FV7 A;  3C7U A;  4IBX A;  1W79 A;  3NHQ A;  4O0P A;  1DRM A;  3C2W A;  4HJ3 A;  3F1O A;  4DJ3 A;  4DN0 A;  3HLC A;  5HL6 A;  2ZQ7 A;  3QHY A;  3WS2 A;  2PR6 A;  3UE0 A;  2ZC6 B;  4BLM A;  5CGX A;  5HDS A;  2OLU A;  4QY6 A;  1KVM A;  1OME A;  3CAX A;  3PBS A;  4GW9 A;  4IBR A;  1JTD A;  3M2J A;  1RCJ A;  1FR6 A;  2Y2K A;  3W4O A;  4HH2 A;  3E98 A;  3V39 A;  2VGJ A;  1YLW A;  1HTZ A;  3HJI A;  4E6X A;  4YWZ A;  4FTX A;  1FCN A;  3V50 A;  1XA1 A;  4NK3 A;  4WF0 A;  3CUE A;  1HVB A;  3HLE A;  4R3A A;  5HX9 A;  3W4Q A;  2MJ6 A;  4EQI A;  4OLG A;  4LPZ A;  4X1M A;  3G32 A;  3N6I A;  3P01 A;  4ZAM A;  4DDS A;  4Z1W A;  1XXM A;  2DNS A;  3R7W A;  3WS0 A;  1K56 A;  3K3D A;  5KSH A;  3D72 A;  3FPV A;  2A3U A;  3C7V A;  3TOI A;  4LV1 A;  4OQI A;  1TF1 A;  1CF0 A;  2ZQD A;  1NYY A;  5HAP A;  2H28 A;  4Y5F A;  3M6H A;  5DVA A;  2VGL M;  2XA7 M;  4DMZ A;  3UY6 A;  1H8Y A;  3HJK A;  4FSF A;  1NJ4 A;  2W1R A;  2X02 A;  3QP8 A;  1N9B A;  5EM0 A;  3P7N A;  2NUT C;  4E3J A;  1PRQ A;  2E8J A;  5FEF A;  2ZM0 A;  2XK1 A;  4CPK A;  4UA7 A;  4NG2 A;  1QME A;  4EET B;  4WLA A;  3UB8 A;  4WZ4 A;  2XA7 S;  3CLO A;  4P0M A;  4WBG A;  1J9M A;  3IF6 A;  5DKK A;  4WEL A;  4ZJ2 A;  4Z9Q A;  4LEN A;  2PYR A;  3CG5 A;  4K91 A;  2EX9 A;  2YKH A;  3OBF A;  4KZA A;  3N7W A;  4OOM A;  2XRN A;  5HWW A;  3BFG A;  1E4D A;  3OPR A;  3S7O A;  1J3W A;  1F5M A;  1LI0 A;  1LL9 A;  5FAP A;  2W0N A;  3D9Y A;  5CHM A;  4KZ4 A;  1ERO A;  4XXR A;  1CK3 A;  3VV4 A;  3NI9 A;  1N4O A;  5KZH A;  2Y2I A;  4JLF A;  2P04 A;  3B42 A;  2WKQ A;  5EOO A;  5HL1 A;  4EU0 A;  4HHD A;  4CLC B;  5GLA A;  1OTB A;  4K08 A;  5F1G A;  4KZB A;  3MZD A;  1ACF A;  5DF7 A;  2P7J A;  1LHY A;  3T1S A;  4NXF A;  1W63 Q;  2R78 A;  3IF6 B;  4OOL A;  1Y54 A;  1FQG A;  3E2K A;  3BW6 A;  3PHY A;  2XEP A;  2O9A A;  4R70 A;  2OOL A;  2B95 A;  4DKI A;  2L0W A;  3MJQ A;  1IKI A;  5CHJ A;  3RTY A;  1K54 C;  1NY0 A;  2J9O A;  2QWS A;  3ISG A;  4PM6 A;  1IYO A;  4OH0 A;  4ZDX A;  2P9V B;  4OLD A;  3MFD A;  2R9X A;  3DTK A;  4Q0I A;  4OPY A;  5FAO A;  3EGD C;  3IF5 A;  4HOI A;  4PM8 A;  2OAP 1;  3OZH A;  1OT6 A;  2V8C A;  3ZG7 B;  3KSH A;  4MN7 A;  4LCL A;  5CEB A;  3NOP C;  1CEG A;  2HJ9 C;  3FWL A;  1G5U A;  3IS2 B;  5TGF A;  1AWI A;  1L0D A;  5HZH A;  4FH4 A;  3A0S A;  3PAG A;  4I3I A;  4N9K A;  3MQQ A;  3EQU A;  2PU4 A;  5TFQ A;  1PFL A;  4NKP A;  3G31 A;  3A3F A;  3H82 A;  3R7W B;  3FYZ A;  1NZO A;  3BQ8 A;  3MR0 A;  3OLO A;  1OTE A;  5M18 A;  4N1X A;  1BLH A;  4WMC D;  3LI8 A;  3VOL A;  4B88 A;  2VK3 A;  3UE6 A;  3KSI A;  2BG1 A;  4EQ1 A;  3DW0 A;  5M19 A;  4ARZ A;  2A24 A;  1T1C A;  4IHQ A;  4GS9 A;  3DTE A;  4ME4 A;  1PWG A;  3BLM A;  4X1L A;  4KZ6 A;  4B9O A;  2GZA A;  1WYC A;  2NUP C;  3WS5 A;  4CQH A;  3IS2 A;  1PW8 A;  3LR3 A;  1ZHH B;  2EX6 A;  1K4E A;  3JVV A;  2D02 A;  3PYP A;  4XT2 A;  2Y2O A;  2ZMV A;  1L0G A;  1L3L A;  2X01 A;  3ZCZ A;  2JC7 A;  2RCX A;  1XFQ A;  3JYI A;  1W8Q A;  4KG6 A;  3ZG8 B;  2WGW B;  1GSW A;  2ZQ9 A;  1TS6 A;  4K0X A;  4ETZ A;  3IXG A;  5J8X A;  3BFC A;  4CJN A;  2G2W A;  3P09 A;  4EV4 A;  2VV6 A;  1ONH A;  5HD5 A;  4GNU A;  1JNU A;  4MN5 A;  3WS1 A;  5EFW A;  5L8M A;  3UB7 A;  1JWP A;  3BFF A;  1SZV A;  2ZM2 A;  3EEA A;  4ETX A;  2BTF P;  4MBH A;  3V3S A;  2Y2N A;  1EI5 A;  5HFO A;  1XJ6 A;  4OP8 A;  1JVJ A;  1IKG A;  5L10 A;  4F94 A;  1GA9 A;  5F68 A;  2HZ5 A;  5IHV A;  3F1O B;  5FQQ A;  3C30 A;  4GD8 A;  3E2L A;  3Q7Z A;  2M1C A;  4BMW A;  5EM1 A;  2OWH A;  2EXA A;  4IED A;  1VM1 A;  5KIZ A;  4WEK A;  1FCO A;  4N1H A;  4JF5 A;  5HW3 A;  1TS7 A;  1FIL A;  3UME A;  3WRT A;  2HPB A;  3E4Q A;  2J3W A;  1TVF A;  4UEY A;  2VGK A;  1XGJ A;  2JE5 A;  3Q7V A;  3IWO A;  2XH9 A;  2O9B A;  2FH5 A;  4MCW A;  4X53 A;  3G2Z A;  1MWS A;  3WRZ A;  2DMW A;  2WZZ A;  1S0W A;  4ZRR A;  5J7E A;  4GKU A;  3RXX A;  1BUE A;  1S66 L;  1BYW A;  4BBU A;  4LV0 A;  4XUX A;  1X0O A;  2PD7 A;  3GSG A;  1YLJ A;  2ZMF A;  1K54 A;  1MY8 A;  4ID4 A;  3IH8 A;  3PBR A;  4BJP A;  2HDQ A;  5D3O A;  3LIC A;  4LRX C;  3ZGA B;  3W2Z A;  5G4Z A;  1EWZ A;  2RL3 A;  3DBA A;  2PT7 A;  2HP6 A;  5G4Y A;  1S1Z A;  4BBT A;  2XQZ A;  3IXH A;  4P85 A;  3BEB A;  1I2W A;  1PZP A;  1FSY A;  5CXW A;  4R4R A;  2W1T A;  3GEC A;  3LO7 A;  1RGZ A;  3HLG A;  3PBT A;  5DFY A;  5I5L A;  1L0E A;  4I3J A;  2I72 A;  5GLC A;  4HY8 A;  2FFF B;  4E04 A;  2QMI A;  2WGI A;  2VV8 A;  1LT0 A;  4GHI A;  1YLZ A;  5A8B A;  3OPP A;  2B02 A;  2O9C A;  1SKO A;  2UV0 E;  2PD8 A;  3C4P A;  2ZM8 A;  3RH8 B;  3MXR A;  3LR4 A;  1S4S A;  3PXP A;  2JKT M;  3EEH A;  1T18 A;  1FIK A;  4DJ2 A;  3A3I A;  1K6S A;  4CLC C;  4D60 A;  1FOF A;  1OJ5 A;  2ZOI A;  4Y0O A;  2ACG A;  2KLI A;  5F83 A;  4O01 A;  2VEA A;  4HP4 A;  3S22 A;  3T4O A;  4C3Q A;  3O5Y A;  3MXQ A;  1XX2 A;  5BOH A;  4S2O A;  1PI5 A;  2QYB A;  4S2P A;  4U0T A;  4PHT A;  2V9A A;  3VE3 A;  3F1P A;  5A92 A;  1D1J A;  1V9Y A;  1CI9 A;  4GCZ A;  3QNC A;  5J3W A;  4EEU A;  4NXG A;  4WYY A;  3HL9 A;  3VFF A;  2G2U A;  4MDZ A;  4MN6 A;  2KDK A;  3ITB A;  1YSP A;  5EVI A;  1YPR A;  4YOF A;  4LV2 A;  1BZA A;  2XDM A;  2JKT I;  3VP4 A;  5FQ9 A;  1VB6 A;  4WZ5 C;  4NXB A;  1K6R A;  4FH2 A;  3ZDJ A;  2W3H A;  4KQR A;  2QKP A;  3N8R A;  3CJM A;  4E3I A;  4PPR A;  3LFV A;  4DE1 A;  3LR0 A;  4Y7P A;  1YQS A;  1ODV A;  1DY6 A;  4Y15 A;  3UDX A;  1YM1 A;  4R0Q A;  5HWT A;  3VP3 A;  5DF8 A;  3NIA A;  4DE3 A;  3E0Y A;  1OJG A;  3HLB A;  3TSG A;  4GHI B;  4B93 A;  2VLG A;  3CI6 A;  3BLS A;  3R4K A;  4QD4 A;  1YLT A;  4ESP A;  2A2L A;  4EES A;  4HIA A;  5F5Y A;  1S1Y A;  1D06 A;  4JXG A;  5HDC A;  3ZVW A;  2H0Y A;  3BJN A;  4F3L A;  2V1A A;  1S6R A;  4I3A A;  3GDI A;  1KGF A;  1OTA A;  4B4Z A;  3CWF A;  1SDE A;  1Q2P A;  1DP8 A;  2J9P A;  3BWL A;  2WYX A;  3A0R A;  4FD8 A;  4YFM A;  2DCF A;  4I5S A;  1W5D A;  3L9K A;  4BQM A;  4Y0U A;  1BLP A;  4E6W A;  5JYO A;  4L9E A;  3GR2 A;  4GZB A;  4WUJ A;  4QU3 A;  3CPT A;  1GA0 A;  3UB9 A;  3GVB A;  3KYQ A;  3DTI A;  1Q2Q A;  5AQ9 A;  2HGV A;  1IOU A;  5E2G A;  3WS4 A;  2KX6 A;  4OP5 A;  2KOI A;  5HAR A;  5K5B A;  3N8S A;  5J4E A;  4R1G A;  1SDN A;  1T19 A;  4LRY C;  5HPF A;  4BD1 A;  2Y2P A;  4MBF A;  3C8C A;  5DTT A;  5E2E A;  1HZO A;  3OOV A;  4PM5 A;  5FQJ A;  1LLB A;  1OTD A;  4QPR A;  3G30 A;  3VP0 A;  3M2K A;  2PBD P;  3ZQ5 A;  4Q8I A;  1K4F A;  3RXW A;  2R9W A;  1FR1 A;  4X56 A;  2Z6C A;  3IF6 C;  3JVU A;  1TDL A;  2WKH A;  3KSG A;  5CHU A;  3VSK A;  4EBL A;  1E3U A;  1BLS A;  1SHV A;  1M40 A;  4RX2 A;  3LR5 A;  4OKP A;  2ZLY A;  2WAF A;  2PDR A;  2Y79 A;  1TDG A;  3CUE C;  3SS4 A;  1Y4O A;  3FKV A;  1PWC A;  2QJ7 A;  2P74 A;  2WGV A;  1KGE A;  3CZD A;  3TW8 A;  2H0T A;  1S4R A;  4F3L B;  1MC0 A;  4MLL A;  2Y2H A;  1EW0 A;  1ZTU A;  5EVI D;  5GL9 A;  2K7S A;  3LEQ A;  1CJF A;  4JF4 A;  1H5X A;  2VX8 A;  4OQH A;  3BFD A;  2C5W B;  4X25 A;  2Y4A A;  2PBY A;  3EGX C;  4Y0T A;  2WGW A;  4QHC A;  3S7N A;  2G7U A;  3O88 A;  3KYZ A;  1RP5 A;  4HJ6 A;  3K2N A;  1NZU A;  5FSR A;  3G6O A;  3Q82 A;  4P6B A;  3MXS A;  2WK0 A;  3PBN A;  3TRC A;  1KGG A;  1Y28 A;  4U0X A;  4L9F A;  2P08 A;  4E3N A;  3AGD A;  1LSW A;  2OLV A;  2VZW A;  1PW1 A;  3B33 A;  2W3E A;  2Q9M A;  3GRJ A;  3NJA A;  3PBQ A;  5I94 A;  3GTC A;  4Y2F A;  1KDS A;  2CMN A;  4GD6 A;  2XFT A;  4U3T A;  3IH9 A;  5F6A A;  1MWT A;  2JN7 A;  2HDU A;  1I5Q A;  3FKW A;  1YMX A;  5TBM A;  2Y91 A;  1FSW A;  4ZBE A;  3LID A;  2H5S A;  2V8F A;  3H9W A;  3Q07 A;  5JYP A;  4ZTK A;  3S1Y A;  3S7P A;  3K3C A;  4OQ0 A;  3PR6 A;  2ZOH A;  3D4F A;  4GDN A;  1ESU A;  2Y2L A;  4N9L A;  1Z09 A;  4UA9 A;  4BL2 A;  2PRF A;  4IUK A;  1PZO A;  3NUL A;  3EWK A;  3FC7 A;  1N9N A;  4EER A;  3S7Q A;  5U47 A;  1HD8 A;  4EWF A;  3ZG0 A;  1PWD A;  4MMN A;  1RGY A;  3B47 A;  4HEF A;  1GSV A;  2VV7 A;  5FI2 A;  2H10 A;  4EW7 A;  4X69 A;  2QPN A;  3BQA A;  3UNW A;  4M3K A;  3ZVT A;  4Y13 A;  1A0K A;  1D7E A;  1BT5 A;  1L2S A;  1ALQ A;  5EV0 A;  5HSQ A;  4UQI S;  2VA0 A;  3GV9 A;  3ICY A;  3HLD A;  4S2N A;  4E3K A;  1ES5 A;  3MKF A;  4OON A;  5FDS A;  3U4L P;  1E25 A;  2K31 A;  1YAX A;  3NOU C;  2Q0O A;  1O07 A;  5TR7 A;  2ZL1 A;  5EUA A;  2Y8H A;  2GDN A;  5AVE A;  5G18 A;  3T4Q A;  1L0F A;  4I39 A;  2JKR I;  4M4X A;  1LL8 A;  1H8M A;  2K2N A;  2W1T B;  2XRO A;  3VP1 A;  3RJU A;  5DJT A;  3IHB A;  3IXB A;  3E4O A;  2LB9 A;  3IBJ A;  2XF3 A;  5L2F A;  3IWI A;  2XSS A;  5TBM B;  1YSQ A;  1Z6F A;  2FFY A;  3OPL A;  2BLS A;  4HI4 A;  5GLD A;  3H7W A;  3MS6 A;  3VFH A;  1YMS A;  5TJJ A;  3T4L A;  3A3E A;  4QY5 A;  2ZMA A;  3BRM A;  4RQ9 A;  4QJG A;  2ZC4 B;  4NET A;  5HD3 A;  4UAA A;  4S2N C;  1UGU A;  3N4I A;  5HAQ A;  4A5R A;  4KUO A;  5DKL A;  1P9W A;  3MKE A;  4DXB A;  1NWZ A;  4OOY A;  2M7V A;  3LUQ A;  4GS9 B;  2XD1 A;  5EVI C;  4WL9 A;  1SKF A;  3C4O A;  3TE8 A;  2IWB A;  3IBR A;  5DTS A;  2D01 A;  1OTI A;  1S67 L;  4DE2 A;  1ZG4 A;  1YKD A;  4PM9 A;  3O86 A;  4EUV A;  2P9V A;  1XJ4 A;  4X6T A;  3V67 A;  5EVI B;  5A90 A;  1H0M A;  1FCM A;  2X71 A;  3G2Y A;  3LY3 A;  5CGW A;  3LY4 A;  4NEE D;  3H7W B;  3RFB A;  3PTE A;  4XUZ A;  1VET B;  2XLN A;  1K38 A;  2W3D A;  4BWI A;  2W3F A;  1KE4 A;  1YT4 A;  4P6Z M;  3VOZ A;  3N8L A;  2M7U A;  1KDW A;  2EXB A;  1LI9 A;  3Q1F A;  3QP5 A;  3SW1 A;  3SS3 A;  3T1X A;  1I2S A;  3LI9 A;  3AGF A;  2INW A;  3GQZ A;  4WN5 A;  2V2F F;  3T1R A;  3G4P A;  3IX4 A;  1C3B A;  3UPN A;  4KUK A;  1K55 C;  3LIF A;  4MEZ A;  3UMD A;  2PAV P;  4LFU A;  1TD5 A;  1PYY A;  2Y2J A;  2Y59 A;  1MWU A;  3T4K A;  1ZG6 A;  3H82 B;  4RX3 A;  2OV5 A;  5F1F A;  3A3D A;  3KX0 X;  4LRZ E;  1O7E A;  3MQ0 A;  5GHX A;  4H6J B;  1MBL A;  3O87 A;  3Q7V B;  4RA7 A;  1VET A;  4GN2 A;  1IFQ A;  4HNB A;  1ERM A;  4GLQ A;  5E2H A;  1BTL A;  3W4P A;  2HP5 A;  4EUZ A;  4P87 A;  2WKR A;  4QB8 A;  4C6Y A;  3G35 A;  2Y55 A;  4JXS A;  1GSX A;  2B5R A;  5C5K A;  4HJ4 A;  4Y3I A;  1K56 D;  4FOF A;  1V9Z A;  4IVK A;  1M6K A;  3U2A A;  3Q81 A;  1GHI A;  4BBV A;  5FQK A;  2IWD A;  2J3T D;  2HDS A;  3MBZ A;  3KSF A;  1BUL A;  2HV1 A;  2J80 A;  4MBK A;  4WMC A;  1AXB A;  2PR5 A;  5FQM A;  2ZQA A;  5FA7 A;  3LIE A;  2HP9 A;  4JF6 A;  2EFX A;  4DF6 A;  2WAD A;  4E3M A;  3JPU A;  1U60 A;  1XKZ A;  1KVL A;  1ESI A;  1PIO A;  1G68 A;  5KMW A;  1VQQ A;  3CPT B;  4L0L A;  5DFX A;  1MKM A;  1XFN A;  3LYX A;  1XGI A;  3IHA A;  2EA9 A;  3V5M A;  5KSC A;  3HUN A;  3ZYT A;  4EEP A;  3ZNT A;  1ES4 A;  4UHU A;  5A91 A;  4LGW A;  2HF6 A;  2HJE A;  3NCK A;  3VE4 A;  4CLC D;  2HDR A;  4PKY A;  4LCM A;  4R6L A;  2OWJ A;  1NLY A;  1JWZ A;  4B4X A;  4KG2 A;  4BEN A;  3T12 B;  3DTM A;  3V3R A;  4H6J A;  2ZC3 B;  3T4S A;  4HQA A;  3OCN A;  3GMW A;  1ONG A;  3ZG9 B;  2B18 A;  2EX2 A;  1H3Q A;  3L7H A;  1VEU B;  5CX7 A;  4R4S A;  1TS8 A;  4KZ3 A;  3MZF A;  1NRF A;  3AGE A;  5CED A;  4G3W A;  4IVI A;  5E43 A;  4MNR A;  3QP4 A;  1DJB A;  4R23 A;  2O0Y A;  4DXC A;  4S2K A;  1IYS A;  4E3L A;  5CER A;  1MWR A;  4ZJ3 A;  5AQA A;  4KZ5 A;  4JGR A;  1XP4 A;  4PAU A;  5M1A A;  3HUO A;  5FAS A;  4L9G A;  3BYD A;  3LEZ A;  3M6B A;  3ZFZ A;  1T1A A;  5AVF A;  2QJ5 A;  3ULF A;  5AQ7 A;  2Q9N A;  1KE3 A;  2L1M A;  3F1N A;  3FG8 A;  3HLF A;  1PI4 A;  3ZNY A;  2Z6D A;  3W8K A;  1LL5 A;  1CQA A;  4K0W A;  1ERQ A;  4YNR A;  1F2K A;  5CTM A;  3UDI A;  4O8G A;  2OAQ 1;  3MF0 A;  1XJ3 A;  2XR0 A;  5L07 A;  2Y2M A;  4E3O A;  3HLW A;  1JWV A;  2O99 A;  5A93 A;  5L09 A;  2ZJ9 A;  3NBL A;  1MXO A;  3I7J A;  1N9O A;  2Y2G A;  2VJW A;  5GHZ A;  2XD5 A;  1SCW A;  5F82 A;  3MMH A;  1OT9 A;  4LLO B;  2L4R A; 
#chains in the Genus database with same CATH homology
 1TVF A;  4OPQ A;  2VGK A;  1ZKJ A;  3PBS A;  1XGJ A;  2JE5 A;  1PZO A;  3Q7V A;  4R3B A;  4RYE A;  4IBR A;  1JTD A;  3M2J A;  3IWO A;  1RCJ A;  1FR6 A;  2Y2K A;  3W4O A;  5U47 A;  5EOE A;  2IWC A;  2XH9 A;  1HD8 A;  4EWF A;  2Z2L B;  3G2Z A;  4X53 A;  3V39 A;  3ZG0 A;  1K55 A;  1MWS A;  1PWD A;  2VGJ A;  3WRZ A;  1RGY A;  5DF9 A;  3S4X A;  2WZZ A;  1S0W A;  4GKU A;  1YLW A;  3RXX A;  1HTZ A;  5EVL A;  1BUE A;  3HRE A;  4HEF A;  4E6X A;  5FI2 A;  2H10 A;  4EBN A;  4X69 A;  3ZG5 A;  2QPN A;  1FCN A;  3UNW A;  2Y2Q A;  4M3K A;  3V50 A;  3ZVT A;  4LV0 A;  1ES2 A;  1XA1 A;  4NK3 A;  4XUX A;  1BT5 A;  3PBO A;  3GSG A;  1YLJ A;  1HVB A;  1K54 A;  1L2S A;  1MY8 A;  1ALQ A;  4ID4 A;  3HLE A;  3IH8 A;  3PBR A;  4BJP A;  2HDQ A;  5D3O A;  5FAQ A;  5HX9 A;  3W4Q A;  3GV9 A;  3ZGA B;  3HLD A;  4S2N A;  4EQI A;  1GCE A;  4E3K A;  1ES5 A;  3MKF A;  4OLG A;  4OON A;  4PMA A;  1E25 A;  1EWZ A;  3G32 A;  1O07 A;  2RL3 A;  3N6I A;  4C75 A;  5TR7 A;  4ZAM A;  1BSG A;  4DDS A;  3UPO A;  3C5A A;  2HP6 A;  4HES A;  5EUA A;  1XXM A;  2DNS A;  2GDN A;  2XQZ A;  3IXH A;  4WM9 A;  5G18 A;  4P85 A;  3WS0 A;  3BEB A;  1I2W A;  1K56 A;  1PZP A;  1L0F A;  1FSY A;  5CXW A;  5KSH A;  3TG9 A;  4R4R A;  3LO7 A;  1RGZ A;  2A3U A;  3HLG A;  3PBT A;  3C7V A;  3TOI A;  2EFU A;  3VP1 A;  4LV1 A;  4OQI A;  1L0E A;  2E8I A;  5HAP A;  1BLC A;  1NYY A;  2ZQD A;  3RJU A;  3SH7 A;  2OSU A;  3IHB A;  4ZJ1 A;  1IEM A;  4YIN A;  2I72 A;  3IXB A;  2WAE A;  5GLC A;  3M6H A;  5DVA A;  5CEC A;  2FFF B;  2ZQC A;  2QMI A;  2XF3 A;  3DWK A;  5L2F A;  2WGI A;  3UY6 A;  1H8Y A;  3IWI A;  1YLZ A;  2ZD8 A;  3UO9 A;  3OPP A;  1Z6F A;  4FSF A;  1NJ4 A;  2FFY A;  3OPL A;  2BLS A;  5GLD A;  3C4P A;  2ZM8 A;  4D2O A;  3VFH A;  1YMS A;  2X02 A;  2WZX A;  1CI8 A;  3PAE A;  1N9B A;  3MXR A;  3A3E A;  4QY5 A;  4E3J A;  3G34 A;  2WKI A;  2ZMA A;  3BRM A;  3UN7 A;  2A49 A;  2ZM0 A;  3A3I A;  1K6S A;  2XK1 A;  4CPK A;  4QJG A;  2ZC4 B;  4NET A;  4UA7 A;  3BEC A;  1FOF A;  4UAA A;  1QME A;  4JXW A;  4S2N C;  3NDG A;  2EX8 A;  3NY4 A;  3BFE A;  3N4I A;  1E3U D;  4WZ4 A;  4Y0O A;  3UDF A;  5HAQ A;  5F83 A;  4A5R A;  4P0M A;  5AQB A;  4WBG A;  1J9M A;  3IF6 A;  3MKE A;  4DXB A;  4WEL A;  4ZJ2 A;  3HBR A;  3S22 A;  4C3Q A;  4Z9Q A;  4LEN A;  4OOY A;  3CG5 A;  4K91 A;  2EX9 A;  1XX2 A;  5BOH A;  1WYB A;  4S2O A;  2XD1 A;  5EVI C;  1PI5 A;  4KZA A;  1SKF A;  3N7W A;  3C4O A;  4OOM A;  4S2P A;  4U0T A;  3UE1 A;  1GHM A;  2IWB A;  1IEL A;  5A92 A;  2C6W B;  2WKE A;  2J8Y A;  1CI9 A;  4KG5 A;  5DTS A;  3BFG A;  1E4D A;  3OPR A;  3IQA A;  3QNC A;  3MZE A;  4DE2 A;  1LI0 A;  1LL9 A;  1ZG4 A;  5FAP A;  4WYY A;  5FAT A;  3OC2 A;  4PM9 A;  1IYP A;  3O86 A;  1ZC2 A;  4S2M A;  5CHM A;  3HL9 A;  1ERO A;  4KZ4 A;  2G2U A;  2P9V A;  4XXR A;  3VFF A;  1CK3 A;  3NI9 A;  4X6T A;  1N4O A;  5KZH A;  5EVI B;  5A90 A;  1NYM A;  1FCM A;  2X71 A;  3G2Y A;  3LY3 A;  2Y2I A;  4JLF A;  5CGW A;  2ZC7 A;  3ITB A;  4N92 A;  3LY4 A;  5EVI A;  5EOO A;  3SOI A;  5HL1 A;  2UWX A;  1BZA A;  4LV2 A;  3PTE A;  2XDM A;  4H8R A;  4XUZ A;  4LV3 A;  3VP4 A;  2XLN A;  5FQ9 A;  5GLA A;  4WZ5 C;  2J7V A;  1K38 A;  5F1G A;  1K6R A;  4KZB A;  3MZD A;  1K57 A;  1KE4 A;  5DF7 A;  1YT4 A;  1LHY A;  3VOZ A;  3N8L A;  4FH2 A;  3ZDJ A;  3LCE A;  1KDW A;  4KQR A;  2EXB A;  2XFS A;  3N8R A;  1LI9 A;  3CJM A;  3Q1F A;  4E3I A;  4KQQ A;  4OQG A;  3SS3 A;  1I2S A;  4PPR A;  4DE1 A;  4KEN B;  4X68 A;  4Y7P A;  1YQS A;  3AGF A;  1DY6 A;  3GQZ A;  3IF6 B;  4OOL A;  2V2F F;  3UDX A;  1YM1 A;  2ZQ8 A;  3G4P A;  1Y54 A;  1C3B A;  4R0Q A;  3UPN A;  1CEF A;  1FQG A;  3E2K A;  2CC1 A;  3VP3 A;  1K55 C;  5DF8 A;  2XEP A;  4MEZ A;  3NIA A;  1MPL A;  4DE3 A;  4DKI A;  4S2I A;  1TEM A;  3HLB A;  3SH8 A;  3TSG A;  1IKI A;  5CHJ A;  1PYY A;  3IXD A;  5FQI A;  1K54 C;  2Y2J A;  3BLS A;  2Y59 A;  3NDE A;  4QD4 A;  1YLT A;  1MWU A;  1NY0 A;  1ZG6 A;  2JBF A;  3UE3 A;  2J9O A;  4RX3 A;  4JXG A;  3ISG A;  4PM6 A;  2OV5 A;  1IYO A;  3ZVW A;  5F1F A;  4OH0 A;  5DTK A;  4ZDX A;  2H0Y A;  3A3D A;  1MKI A;  2P9V B;  4KZ7 A;  4OLD A;  3MFD A;  1QMF A;  3NC8 A;  2R9X A;  1O7E A;  4HBT A;  5GHX A;  4OPY A;  1S6R A;  1YLY A;  5FAO A;  1MBL A;  3O87 A;  4WEJ A;  3Q7V B;  2ZC5 B;  1KGF A;  4RA7 A;  2QZ6 A;  4GN2 A;  3IF5 A;  4RVA A;  4B4Z A;  1DJC A;  5GLB A;  1ERM A;  1SDE A;  1Q2P A;  4PM8 A;  3VOY A;  5E2H A;  2J9P A;  3OZH A;  1BTL A;  1NXY A;  3OPH A;  3W4P A;  2HP5 A;  2WYX A;  4EUZ A;  3ZG7 B;  1GHP A;  4P87 A;  4QB8 A;  4FD8 A;  4C6Y A;  4LCL A;  4YFM A;  5CEB A;  1CEG A;  2DCF A;  3G35 A;  4GDB A;  4KQO A;  2Y55 A;  1DJA A;  1W5D A;  1XPB A;  2B5R A;  4JXS A;  4BQM A;  4Y0U A;  5FI7 A;  1BLP A;  3A3J A;  5E2F A;  1K56 D;  4E6W A;  3FWL A;  4BL2 A;  5JYO A;  2Z2M B;  3GR2 A;  4GZB A;  5TGF A;  4IVK A;  4JBF A;  1M6K A;  5GHY A;  4QU3 A;  3Q81 A;  1IYQ A;  1GHI A;  1L0D A;  1GA0 A;  5FQK A;  3GVB A;  2IWD A;  1W8Y A;  1Q2Q A;  4FH4 A;  2HDS A;  4S2J A;  5E2G A;  5AQ9 A;  5FI6 A;  3MBZ A;  3PAG A;  3WS4 A;  4OP5 A;  4N9K A;  1BUL A;  4MBK A;  3EQU A;  2PU4 A;  5HAR A;  5TFQ A;  3N8S A;  4R3J A;  1YLP A;  4R1G A;  1SDN A;  3G31 A;  4WMC A;  4KZ9 A;  3A3F A;  1AXB A;  4JPM A;  3WWX A;  5FQM A;  3FYZ A;  2Y2P A;  1NZO A;  4MBF A;  4BD1 A;  2ZQA A;  5DTT A;  5E2E A;  5FA7 A;  4DRT A;  1HZO A;  4PM5 A;  5FQJ A;  2HP9 A;  3IT9 A;  3P98 A;  4GB7 A;  1LLB A;  4JF6 A;  5M18 A;  2EFX A;  4DF6 A;  3G30 A;  2PU2 A;  3VP0 A;  4N1X A;  1BLH A;  3M2K A;  4WMC D;  4B88 A;  2WAD A;  1KE0 A;  4E3M A;  3O3V A;  1U60 A;  4Q8I A;  1XKZ A;  2BG1 A;  3DWZ A;  1KVL A;  1ESI A;  3DW0 A;  5M19 A;  4OVD A;  1PIO A;  1K4F A;  3RXW A;  2R9W A;  1G68 A;  3UPP A;  1W7F A;  3BM6 A;  5KMW A;  1G6A A;  1FR1 A;  4X56 A;  1VQQ A;  4L0L A;  3OCL A;  3IF6 C;  3VSK A;  1TDL A;  2WKH A;  5CHU A;  2V1Z A;  4EBL A;  1E3U A;  2V20 A;  4O7D A;  1BLS A;  1PWG A;  1XGI A;  1SHV A;  1M40 A;  3BLM A;  4RX2 A;  4BL3 A;  3IHA A;  4OKP A;  5CRF A;  3V5M A;  5KSC A;  2ZLY A;  1ES3 A;  2WAF A;  3CMZ A;  3HUN A;  3IWQ A;  1TDG A;  4HBU A;  4JXV A;  4KZ6 A;  3ZNT A;  1JTG A;  1ES4 A;  1WYC A;  3WS5 A;  1PW8 A;  3SS4 A;  4UHU A;  5A91 A;  1K25 A;  3FKV A;  1PWC A;  3NCK A;  5CTN A;  2P74 A;  2HDR A;  2WGV A;  1KGE A;  2EX6 A;  3CZD A;  3HVF A;  4LCM A;  4DE0 A;  1K4E A;  4OPZ A;  2DRW A;  2XGN A;  2H0T A;  1JWZ A;  4B4X A;  2Y2O A;  3QNB A;  1L0G A;  2X01 A;  4KG2 A;  3VSL A;  4BEN A;  2WUQ A;  3DTM A;  3ZCZ A;  4MLL A;  3V3R A;  2JC7 A;  2Y2H A;  2ZC3 B;  3VP2 A;  3OCN A;  2RCX A;  3GMW A;  1ONG A;  4BD0 A;  3ZG9 B;  5EVI D;  1H8Z A;  2EX2 A;  4DDY A;  5GL9 A;  4EBP A;  4GOG A;  3JYI A;  4R4S A;  4KZ3 A;  4OPR A;  1W8Q A;  4KG6 A;  3MZF A;  1H5X A;  4JF4 A;  1NRF A;  3AGE A;  4OQH A;  2WGW B;  3BFD A;  5EE8 A;  3ZG8 B;  2C5W B;  2ZQ9 A;  2Y4A A;  4IVI A;  2PBY A;  4MNR A;  5E43 A;  5CED A;  4K0X A;  4Y0T A;  1DJB A;  2WGW A;  4R23 A;  4QHC A;  4DXC A;  5CGS A;  3IXG A;  1XA7 A;  5J8X A;  3O88 A;  4S2K A;  1IYS A;  4E3L A;  1RP5 A;  3BFC A;  5CER A;  1MWR A;  4ZJ3 A;  4CJN A;  2G2W A;  3P09 A;  4EV4 A;  5AQA A;  5HAI A;  1NZU A;  4KZ5 A;  5FSR A;  1XP4 A;  3Q82 A;  4P6B A;  3MXS A;  5M1A A;  3HUO A;  1ONH A;  5FAS A;  2WK0 A;  4GNU A;  3WS1 A;  5EEC A;  3PBN A;  3BYD A;  3LEZ A;  3SS5 A;  1KGG A;  3M6B A;  3ZHH A;  3ZFZ A;  4WZ5 A;  1JWP A;  3BFF A;  3ITA A;  4X55 A;  5AQ7 A;  4U0X A;  2ZM2 A;  2Q9N A;  3B3X A;  1KE3 A;  3SH9 A;  4E3N A;  3AGD A;  3VMA A;  4MBH A;  3HLF A;  3V3S A;  1PI4 A;  2OLV A;  3ZNY A;  2Y2N A;  1EI5 A;  1PW1 A;  3W8K A;  5FDH A;  1LL5 A;  2Q9M A;  5HFO A;  3GRJ A;  1ERQ A;  3PBQ A;  4K0W A;  4OP8 A;  1JVJ A;  1IKG A;  2JCH A;  5EPH A;  1K57 C;  3GTC A;  4JKT A;  5I94 A;  1WE4 A;  1KDS A;  4GD6 A;  4F94 A;  1GA9 A;  4PM7 A;  2XFT A;  4U3T A;  3HUM A;  3EQV A;  3IH9 A;  5CTM A;  3UDI A;  4KZ8 A;  1MWT A;  5IHV A;  4FCF A;  4UA6 A;  2HDU A;  4S2L A;  3FZC A;  2XR0 A;  1I5Q A;  3FV7 A;  3FKW A;  3C7U A;  4IBX A;  5FQQ A;  1W79 A;  1YMX A;  4GD8 A;  2Y2M A;  3E2L A;  3Q7Z A;  4E3O A;  2Y91 A;  1FSW A;  4ZBE A;  3HLW A;  2EXA A;  1JWV A;  5A93 A;  2H5S A;  3HLC A;  3Q07 A;  4IED A;  5JYP A;  2ZJ9 A;  2ZQ7 A;  4ZTK A;  1VM1 A;  3NBL A;  3S1Y A;  1MXO A;  3I7J A;  3QHY A;  3WS2 A;  4WEK A;  1FCO A;  2Y2G A;  4N1H A;  4OQ0 A;  2XD5 A;  4JF5 A;  5GHZ A;  1SCW A;  5HW3 A;  4GDN A;  3D4F A;  3UE0 A;  1ESU A;  2ZC6 B;  2Y2L A;  4BLM A;  5F82 A;  4N9L A;  5CGX A;  2HPB A;  2OLU A;  4QY6 A;  4UA9 A;  3WRT A;  1KVM A;  1OME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...