5KSCA

E166a/r274n/r276n toho-1 beta-lactamase aztreonam acyl-enzyme intermediate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kscA00
4L0LA 1IYQA 3OPPA 5AQ9A 4MEZA 3O86A 3NI9A 4C3QA 3HLEA 4OOYA 4P6BA 5IHVA 1WYBA 1XX2A 4N9LA 3ZVTA 4P0MA 4BD0A 2Y2GA 3IWQA 2WAEA 4LV1A 4BJPA 2ZQ9A 4S2NC 4S2PA 5FAOA 1CEGA 3HBRA 2EFXA 3DTMA 5EVLA 2V1ZA 5CGSA 5A92A 3VP4A 4E3NA 3G31A 3HLFA 2G2WA 5EVIB 3IF6B 1EROA 4E3MA 5DF7A 3SOIA 1PZPA 4PMAA 1Q2PA 3BRMA 5CECA 4FH2A 5FDHA 1PW1A 3M2KA 1H8ZA 2DCFA 3DWZA 1N9BA 1IKGA 4N92A 3IXDA 3WS0A 4KZ5A 3V39A 4B4XA 3MXSA 4LV3A 4WZ4A 3W4PA 4KZAA 1IYSA 3V5MA 2Y59A 1TVFA 1G6AA 1PI5A 3CMZA 1XXMA 3AGEA 4KZ9A 3OPRA 1PWDA 4OONA 3UPPA 3IH9A 5M18A 3NDEA 2EXAA 4OKPA 1ZG6A 1JTDA 1E3UA 2ZM0A 1YLWA 5A93A 2HP6A 1CK3A 1JWPA 3NDGA 5CGXA 1W8QA 2C6WB 3HREA 3UE0A 5EPHA 2C5WB 4PM7A 1IELA 3TG9A 4R0QA 4IBRA 1MWTA 4X6TA 1ONHA 3V50A 2WZXA 2ZM8A 1BT5A 5EOOA 2FFFB 3HUMA 2Y2NA 3PAEA 4DE3A 3PBQA 3IHAA 3SS4A 4E3LA 2Y4AA 4DXBA 2Z2MB 1E3UD 4OVDA 2WKHA 3V3SA 3GTCA 4DRTA 1XGIA 1PWGA 1K4EA 3BFEA 4KQQA 4RX3A 4X69A 3B3XA 1BLPA 3IQAA 1PW8A 2ZC6B 5EE8A 1KE0A 5AQAA 5KZHA 2QZ6A 4O7DA 2CC1A 4EWFA 1NXYA 3ZG0A 1NY0A 3PBRA 4Y0OA 5FAQA 4PPRA 3NCKA 4EBLA 2XGNA 1E4DA 3BYDA 1K25A 1JWZA 3LY4A 4E3IA 3N8SA 3RXWA 4KG2A 4U0TA 5J8XA 1W79A 5TR7A 1MY8A 4R3JA 1XP4A 4LV0A 2DRWA 3IWIA 4K0WA 4QB8A 3ZVWA 2Y2IA 1N4OA 1JVJA 4C6YA 4KZBA 2IWDA 4KENB 3UE3A 2VGKA 1PYYA 1WYCA 2WGWB 3RXXA 2ZC3B 4HBTA 3BFDA 2Y55A 2Z2LB 3G34A 3WRZA 1DJBA 1K6RA 4WMCD 5A91A 3IXHA 4JXSA 1U60A 2XLNA 4M3KA 1TDLA 4UA9A 2PU2A 5EECA 3VSKA 4JF6A 1XKZA 5FQQA 2JE5A 4GN2A 3OPLA 5FI7A 4WEKA 5E2EA 5L2FA 2WK0A 4MBFA 3M2JA 1RGZA 2P9VB 3HUOA 2ZLYA 3MBZA 4DE0A 1HZOA 1K6SA 3RJUA 3ZNTA 3ITAA 5GLDA 1E25A 3A3FA 4OP5A 5E2HA 2IWBA 3PBSA 2JC7A 3O87A 4DKIA 3MKFA 3MXRA 5GHZA 3N7WA 3ZG8B 3BLMA 3GR2A 5M19A 4GNUA 4MBKA 3ITBA 4KZ7A 1KGEA 3GSGA 5KSHA 2R9WA 1JTGA 3S4XA 4PM8A 3C4PA 3C7UA 3AGFA 1K54A 3PTEA 3NBLA 1BUEA 4ZDXA 5E2GA 1NJ4A 2ZQDA 3GQZA 4JPMA 5CHJA 3JYIA 1EWZA 5CHUA 4OQIA 1OMEA 4JBFA 4C75A 2H0TA 3Q07A 4LCMA 3OC2A 1PIOA 2WKIA 4S2OA 2Y2OA 2QMIA 1K55A 4N9KA 2X01A 5KSCA 3BECA 3HL9A 4JXWA 1RGYA 4OQHA 2EX9A 1ES5A 2H5SA 2WADA 3IH8A 3UPNA 2WAFA 4JKTA 3OZHA 4OLGA 3ZHHA 3WS5A 3VFFA 4DDSA 4R4SA 1BSGA 1Y54A 1K4FA 1FSWA 4YFMA 4BLMA 4LV2A 3SH9A 3UNWA 4R3BA 1VM1A 2WGWA 2V2FF 4QU3A 2XD1A 3WS2A 4EBNA 5DVAA 3QNBA 4IVKA 1KDWA 1IKIA 1CEFA 4UA6A 3UDIA 5CERA 1QMEA 3M6BA 2E8IA 2HPBA 1YT4A 3D4FA 1YLTA 2WKEA 5DTKA 3FKWA 5U47A 3Q7VB 1VQQA 2XH9A 3WRTA 2V20A 3IWOA 3Q82A 1DJAA 1HD8A 2J8YA 3G4PA 1GHIA 5EOEA 1SKFA 1K54C 2UWXA 2Y2MA 1LL9A 4IBXA 1ES2A 1FOFA 4EBPA 4N1XA 4HESA 1JWVA 4UA7A 1S6RA 2X02A 1TEMA 1YMSA 1YLZA 1K55C 1GA9A 5FSRA 3E2KA 3FZCA 4Q8IA 4KZ4A 3UPOA 1L0EA 5DTSA 3EQUA 1FSYA 4GOGA 3G32A 3WWXA 4PM9A 3SH8A 1KE3A 2ZD8A 2Y91A 3PBOA 4NETA 2HP5A 1LI9A 4DXCA 4OQGA 3N8LA 1XGJA 5DF9A 5FI6A 2XDMA 4KG6A 2DNSA 3MFDA 4OPQA 1NYYA 4LENA 4F94A 4S2LA 1RP5A 3S1YA 1SCWA 2ZQ8A 3ZFZA 4KG5A 3E2LA 3C4OA 3HLGA 1PI4A 1MBLA 5CTNA 4ZBEA 1YM1A 4S2KA 2OV5A 2FFYA 3LO7A 3MZFA 1HVBA 1FCMA 3W8KA 2I72A 4EUZA 1L0GA 5EVIA 1ZG4A 3IF6A 3W4OA 1KGFA 3FYZA 1S0WA 1AXBA 1NZOA 4OPZA 3VP2A 5GLBA 4Y0TA 3G30A 1ESUA 3FKVA 1PZOA 1TDGA 3G35A 2R9XA 3W4QA 5TFQA 1XPBA 3Q7ZA 2RCXA 5DTTA 3OPHA 1GHMA 2ZQCA 3BLSA 2ZQ7A 5FATA 2XF3A 3N4IA 4B4ZA 2PBYA 5EVID 4EQIA 3ZDJA 3NIAA 1BLHA 2ZC5B 4FCFA 4JLFA 4NK3A 4E6WA 2EX8A 2H0YA 5F82A 2WUQA 3TSGA 3V3RA 1GA0A 1XA7A 2GDNA 5HAPA 3CG5A 1NRFA 3WS1A 1M40A 2ZJ9A 5AQBA 2XK1A 4OPYA 3HLBA 1LLBA 4DF6A 4GD8A 1PWCA 2Y2JA 2J9OA 3IF5A 5BOHA 4ID4A 4WYYA 1YLPA 1M6KA 4HBUA 4WBGA 4OOLA 3CJMA 4X56A 3HVFA 2WYXA 3OCNA 4XUXA 3IT9A 4YINA 3A3IA 4ZAMA 4QY5A 1O7EA 2G2UA 3ZGAB 2XD5A 3IF6C 5EVIC 5M1AA 1W7FA 1KVMA 4Z9QA 4GDNA 4QJGA 2A49A 5FAPA 1SHVA 1ZC2A 5D3OA 3Q81A 5A90A 1NYMA 4JXGA 4BL2A 4S2IA 1W8YA 2Y2HA 3SS5A 1I2WA 4OPRA 4GDBA 5EUAA 1Z6FA 4X53A 5E43A 4KZ3A 3A3JA 3BFGA 4KZ6A 1HTZA 3P09A 2J7VA 3GV9A 3WS4A 3SS3A 4GB7A 3HLCA 5F83A 5HW3A 3HLWA 5JYOA 2HDUA 4P85A 4WEJA 4QHCA 3HLDA 1LL5A 4EV4A 1FCOA 5FQIA 4S2MA 1H8YA 4OQ0A 5CRFA 4RA7A 3ZG7B 1Q2QA 4WZ5A 4S2JA 2Q9MA 2HP9A 3PBTA 5FQ9A 4ZJ3A 4OP8A 3I7JA 1L2SA 1YQSA 2XQZA 2Y2QA 4FSFA 4FD8A 1XA1A 5GHXA 3BEBA 4DE1A 3P98A 2XR0A 2WGIA 3G2ZA 3LY3A 1BLCA 5HX9A 3UN7A 3VP0A 5KMWA 1SDNA 3AGDA 2BLSA 1MXOA 1L0DA 3QHYA 4Y0UA 5AQ7A 4E3OA 2EXBA 3TOIA 3MZDA 2B5RA 1MWRA 3MZEA 1ERQA 2X71A 3NY4A 3UY6A 4DDYA 1DJCA 1GHPA 2H10A 4GKUA 4FH4A 2EX6A 1BULA 2P9VA 5CEDA 3IXBA 2Y2PA 3O88A 1MKIA 2OLVA 5HFOA 3SH7A 1RCJA 4Y7PA 3VFHA 3HUNA 1K57A 1O07A 4WM9A 3S22A 3ZNYA 5I94A 1ONGA 1ERMA 4JF4A 4XUZA 3LCEA 2Y2KA 5CHMA 4P87A 1BZAA 3FV7A 1H5XA 5F1FA 4JF5A 1BLSA 3VSLA 3OCLA 3GVBA 2EFUA 4WZ5C 3UDFA 5FQMA 1GCEA 3VOZA 1MWUA 5FI2A 3PBNA 4RYEA 4LCLA 5FQJA 1NZUA 2RL3A 5HAIA 4MLLA 3O3VA 1BTLA 3IXGA 4WELA 3FWLA 3VMAA 1LI0A 5GLCA 2HDQA 2ZQAA 3GMWA 5HAQA 3LEZA 5E2FA 5FQKA 3VP1A 2XFTA 4XXRA 3VOYA 3MKEA 1KVLA 4QD4A 2P74A 3ZG5A 4R23A 5GL9A 3Q1FA 4A5RA 1L0FA 2ZM2A 2Q9NA 1KDSA 3CZDA 4IEDA 5FA7A 4BQMA 3N8RA 4N1HA 3IHBA 5HL1A 4MBHA 1FQGA 3BFCA 2BG1A 4ZJ1A 1EI5A 4CPKA 1C3BA 4DE2A 4UAAA 2XEPA 3M6HA 1K57C 3ZG9B 4BD1A 4WMCA 4X55A 3BFFA 3PAGA 4OH0A 5CTMA 1SDEA 4ZTKA 4X68A 2J9PA 4BL3A 3GRJA 4KQOA 3VP3A 4GZBA 4RX2A 3Q7VA 4B88A 1ZKJA 4ZJ2A 5CEBA 5CXWA 1YMXA 1YLJA 3ISGA 3N6IA 5TGFA 4OLDA 2WGVA 4UHUA 4GD6A 3UO9A 5JYPA 3UE1A 1I2SA 5CGWA 1MPLA 2IWCA 5GLAA 5G18A 4S2NA 3NC8A 1K56A 3C5AA 3DWKA 4CJNA 2VGJA 5GHYA 4U3TA 1G68A 3BM6A 4K91A 2JBFA 1J9MA 1WE4A 2EX2A 3A3EA 1ALQA 2QPNA 2Y2LA 1LHYA 4OOMA 3A3DA 4PM6A 2ZMAA 3EQVA 4U0XA 1FCNA 5FASA 4HEFA 1FR1A 4E6XA 4IVIA 4R1GA 1KE4A 4KZ8A 5DF8A 4BENA 4KQRA 2WZZA 3QNCA 1CI8A 1FR6A 4E3JA 4H8RA 1K38A 4D2OA 4K0XA 3DW0A 4RVAA 4QY6A 1W5DA 1ES4A 2A3UA 4E3KA 2XFSA 3G2YA 5HARA 1YLYA 1MWSA 3ZCZA 1KGGA 3C7VA 5F1GA 4PM5A 4MNRA 1K56D 2HDSA 2OLUA 1ES3A 2JCHA 1IYOA 4JXVA 1QMFA 1IEMA 2PU4A 1CI9A 2ZC4B 1DY6A 3UDXA 1IYPA 1ESIA 2HDRA 1I5QA 2OSUA 2ZC7A 4R4RA
chains in the Genus database with same CATH superfamily
4XT2B 5EV0A 3TE8A 5AQ9A 3HLEA 4P6BA 1WYBA 4N9LA 2BTFP 2JKFA 2JKRI 3QP1A 5FAOA 2O9BA 3NECA 3P01A 3R7WA 3HBRA 4HJ3A 3E4OA 2V1ZA 3VP4A 4E3MA 5CECA 4FH2A 3GDIA 1H8ZA 4N92A 3BQAA 2VV8A 4R6LA 2Y59A 1G6AA 1PI5A 4MCWA 4GHIA 1OT6A 4OONA 4O8GA 4PAUA 3T4JA 5A93A 4KUOA 2C6WB 1W63Q 1LSVA 1G5UA 4HY8A 4PM7A 5A8BA 2W1TB 4IBRA 4X6TA 2WZXA 5EOOA 2FFFB 3PBQA 5DJUA 4E3LA 2Y4AA 4XT2A 4DRTA 2E8JA 2W1RA 1XGIA 1PWGA 1K4EA 3UB8A 3LICA 3B3XA 1KE0A 2L4RA 4O7DA 3FG8A 4MN6A 4Y0OA 5FAQA 1E4DA 3BYDA 5J8XA 3N8SA 3RXWA 1T19A 3UMDA 1OTEA 2B95A 4LV0A 1S4RA 2K31A 2O9CA 3PR6A 1XFQA 2IWDA 4KENB 1WYCA 3IS2A 2WGWB 3RXXA 4HBTA 4QWOA 2Y55A 3G34A 3WRZA 3IXHA 1DP9A 2XLNA 2W3HA 1T1CA 1XKZA 3CI6A 2FH5A 4GN2A 5EM1A 5E2EA 4MBFA 4E04A 1K6SA 3RJUA 3ZNTA 5E2HA 4OP5A 3V67A 3N7WA 4DMZA 2EWWA 3ITBA 4KZ7A 5KSHA 4EESA 3S4XA 3C7UA 3ULFA 3PTEA 1NWZA 5CHUA 4JPMA 5CHJA 2B02A 1NLZA 4OQIA 1OMEA 4C75A 4EW7A 3OC2A 2ZBBA 1K55A 4ETXA 4JXWA 4OQHA 2EX9A 1ES5A 2H5SA 4R4SA 1HLUP 2EWVA 4F3LB 3HJIA 4G3KA 4LGWA 2W3FA 4Q0IA 5L09A 2WGWA 2XD1A 3UDIA 4AFIA 1IKIA 2HJ9C 5CERA 1YPRA 4B93A 2HPBA 2EA9A 1P9WA 3FKWA 2V20A 3Q82A 3H7WA 1GHIA 5EOEA 2Y2MA 1K54C 4IBXA 1LL9A 1S1YA 1ES2A 4MN7A 4I3AA 4EBPA 2X02A 1OTAA 1EW0A 2KOIA 1GA9A 5FSRA 4KZ4A 4LRZE 3G32A 3WWXA 4GJ4A 4NETA 2ZL1B 1XGJA 5FI6A 4HHDA 3QP8A 2DNSA 2V9AA 3E2LA 4HOIA 4IHQA 1PI4A 4MDZA 3FC7A 3UB6A 3BWLA 1TS7A 3IF6A 3FYZA 3NJAA 3VP2A 2P7JA 2PT7A 2CMNA 3T1SA 1XPBA 3Q7ZA 2ZQCA 3DBAA 5EVID 2ZC5B 1YAXA 5F82A 5F5YA 4DF6A 3IX4A 4GD8A 2J9OA 2QJ7A 4ID4A 4Y2FA 1OTBA 4ZRRA 4XUXA 2VLGA 4QY5A 1O7EA 5EVIC 5M1AA 5FEFA 2ZL1A 1SHVA 3C30A 3LIEA 5EUAA 1Z6FA 3CUEA 5E43A 3A3JA 1VHMA 1HTZA 3EGXC 5EM0A 2V0UA 1TF1A 5F83A 1UWPX 3HLWA 2HDUA 1N9NA 3HJKA 1F98A 4WEJA 3HLDA 4LLOB 3NULA 4RA7A 2KDKA 4S2JA 2Q9MA 3B47A 4L9GA 2HP9A 3PBTA 4ZJ3A 2XQZA 3BEBA 3P98A 5KMWA 3LY3A 5HX9A 3H82B 1MXOA 4E3OA 2VKSA 3KYEA 1ERQA 3LI9A 2X71A 3NY4A 4PHTA 1GHPA 2H10A 1BULA 3E4PA 2ZOIA 3E98A 5CX7A 3BY9A 4JF4A 3LCEA 1TS6A 4II7A 4D60A 3VSLA 3GVBA 2EFUA 4WZ5C 3UDFA 5FQMA 5HD3A 3PBNA 4R70A 2WKRA 5HAIA 2KX6A 5F69A 3T1RA 3VMAA 1LI0A 3S7NA 5AJGA 3VP1A 3VOYA 3T1XA 4R23A 2HV1A 2V1AA 1KDSA 3KSIA 3DAVA 4EXOA 4GCZA 1P97A 2Y8HA 4BQMA 2J3WA 4MBHA 4Y5FA 4ZJ1A 4CPKA 4DE2A 4UAAA 4X55A 1D7EA 5G4ZA 1XJ3A 2OWJA 4RX2A 3N6IA 5TGFA 4UHUA 4G3WA 1I2SA 5GLAA 4CJNA 2VGJA 5GHYA 1G68A 4K91A 2JBFA 1WE4A 3A3EA 4U0XA 2Y2LA 3A3DA 5FASA 1OTIA 1V9ZA 4R1GA 4BENA 2WZZA 4X1LA 4E3JA 4H8RA 4K0XA 2QKPA 4E3KA 3UB7A 1H0MA 5HARA 4G3VA 4PM5A 1K56D 2OLUA 2JCHA 3NHQA 4JXVA 4HQAA 3F1OB 2VGLS 1DY6A 1IYPA 4RQ9A 1I5QA 2OSUA 2ZC7A 4GLQA 3HCYA 2UV0E 4OOYA 5IHVA 5DKLA 4LV1A 4S2NC 4Y13A 1CEGA 1PRQA 1VB6A 2EFXA 3A0VA 3K3DA 2Z6CA 4MMNA 3KYZA 2G2WA 5EVIB 3U2AA 3SOIA 3BRMA 1PW1A 3VE3A 2DCFA 2WKPA 1N9BA 5HL6A 3WS0A 3V39A 3MXSA 1IFQA 3V5MA 3D3OA 3AGEA 3UPPA 1ODVA 4OKPA 1ZG6A 2ZM0A 3VE4A 1YLWA 1CK3A 3NDGA 3NOUC 5CGXA 3UE0A 2C5WB 3RFBA 1PFLA 3LEQA 3KO6A 3PAEA 3T4KA 3IHAA 3SS4A 4DXBA 1E3UD 1TS0A 4OVDA 4DJ2A 2VX8A 4Y17A 2VJWA 4X69A 1BLPA 3DTIA 4PPRA 1D06A 1JWZA 4U0TA 1W79A 5TR7A 4QB8A 2OAQ1 1LT0A 3C2WA 3UE3A 2ZC3B 4WMCD 4M3KA 4UA9A 2PU2A 4ARZB 4JF6A 5FQQA 1OTDA 3OPLA 4Y3IA 5L2FA 2XRNA 3NOTC 2P9VB 3HUOA 2ZLYA 1HZOA 4HP4A 4Q0HA 5GLDA 1E25A 4WL9A 2O0YA 2IWBA 4DKIA 3MKFA 5DFYA 3KX0X 3MXRA 5GHZA 1KGEA 2R9WA 3S7OA 3E4QA 1BUEA 2A24B 1A0KA 2H0TA 3Q07A 4S2OA 4NXBA 2IA2A 5KSCA 3BECA 3HL9A 2HGVA 4JKTA 3OZHA 4OLGA 3WS5A 3MJQA 4BLMA 3SH9A 4JGOA 3WS2A 3EGDC 1QMEA 3D4FA 1YT4A 4ARZA 1VQQA 1DJAA 3CITA 2QWSA 1SKFA 4UQIS 3IBRA 1FOFA 4HESA 3MQ0A 1J3WA 1TEMA 1YMSA 4ETZA 3E2KA 3UPOA 5DTSA 3OOVA 1P0ZA 4PM9A 3PBOA 2HP5A 1L3LA 4OQGA 1S66L 3MFDA 4F94A 3LR0A 2ZQ8A 3ZFZA 3C4OA 3HLGA 4ZBEA 1XJ4A 4S2KA 2OV5A 5L07A 3MZFA 4O01A 2QYBA 1FCMA 4L9FA 4EUZA 1ZG4A 3GECA 4Y0TA 1AXBA 2W27A 3G35A 2RCXA 5DTTA 1GHMA 1T1AA 1MKMA 5DKKA 3ZDJA 4FCFA 4JLFA 5J7EA 3V3RA 4ME4A 2GDNA 1M40A 5AQBA 4OPYA 3HLBA 4WN5A 5BOHA 1M6KA 1Z09A 4HBUA 2W1TA 3D9YA 1XJ2A 3A3IA 3PHYA 2G2UA 1W7FA 1KVMA 2LB9A 4Z9QA 2A49A 2KLIA 5KIZA 1ZC2A 3Q81A 5A90A 4Q0JA 1W8YA 3SS5A 1I2WA 1DP6A 4KZ3A 4KZ6A 3WS4A 3SS3A 4GB7A 2VGLM 4KQDA 5HW3A 2AVXA 4P85A 3BW6A 4HJ6A 2Y79A 5CRFA 1Q2QA 5FQ9A 1FILA 3KSGA 1L2SA 4DE1A 2XR0A 2WGIA 3G2ZA 1BLCA 3UN7A 3AGDA 3QHYA 5J3WA 2EXBA 2W0NA 1UWNX 3MZDA 4I3JA 5AVEA 1DJCA 1CF0A 5CEDA 3IXBA 5HWTA 3O88A 3LIAA 4Y7PA 4WUJA 1O07A 2QJ5A 3S22A 3JVUA 3ZNYA 4GS9B 4XUZA 2Y2KA 5F1FA 4JF5A 4HNBA 1GCEA 4LCLA 1NZUA 2B18A 3MF0A 3NOPC 3O3VA 4WELA 3FWLA 3LR5A 3GMWA 5IT5A 5K5BA 4XXRA 4DN0A 5IU1A 3MKEA 1KVLA 2ACGA 5GL9A 3Q1FA 1L0FA 4F3LA 3CZDA 2PR6A 2YKHA 3IHBA 3BFCA 5DFXA 2XEPA 3M6HA 1K57C 4BD1A 4WMCA 4EERA 4OH0A 5CTMA 1SDEA 3A0RA 1PNEA 3VP3A 2W3GA 4B88A 2WKQA 1YMXA 3ISGA 4OLDA 4HP9A 4BBUA 3UO9A 5G18A 3DWKA 1J9MA 1ALQA 1LHYA 1FCNA 3LIDA 1NLYA 1TS8A 4IVIA 1KE4A 1K38A 3RTYA 3DW0A 4QY6A 1KGGA 3LIFA 1IEMA 4BWIA 5TJJA 1ESIA 4MEZA 2M7VA 3O86A 4C3QA 3BY8A 5F68A 3IWQA 2WAEA 1OPXA 3EEHA 3DTMA 5EVLA 2V8FA 4E3NA 3HLFA 1EROA 5DF7A 4PMAA 5HWVA 5FDHA 5AVFA 3EEAA 3OBFA 1KOUA 3DWZA 2Q0OA 4KZ5A 4B4XA 4WZ4A 3MQOA 5C5KA 3W4PA 4KZAA 3CMZA 5HDCA 1UGUA 5HPIA 3IH9A 2EXAA 3CPTB 4EQ1A 2MJ6A 1JTDA 2HP6A 1YSPA 4UQIM 5EPHA 5HD5A 1IELA 4R0QA 2JKGA 2ZM8A 1CJFA 2Z2MB 1ACFA 3GTCA 3BFEA 4RX3A 1VETB 5EE8A 1PW8A 2ZC6B 2NUPC 5AQAA 2QZ6A 2CC1A 4EWFA 1NXYA 3ZG0A 1NY0A 3PBRA 3NCKA 3VV4A 4EBLA 2XGNA 3H82A 1K25A 3LY4A 4E3IA 4H6JB 4KG2A 1MY8A 4R3JA 2NUTC 1XP4A 2PBDP 1OT9A 4K0WA 1JVJA 1GSWA 2VGKA 1PYYA 2HF6A 3BFDA 2Z2LB 1K6RA 4JXSA 4EUVA 1U60A 2HZ5A 3TRCA 3LFVA 5EECA 3VSKA 2JE5A 4M4XA 5LBRA 1GSXA 5FI7A 5IS1A 3LR3A 3MBZA 4DE0A 4MN5A 3ITAA 2QHKA 3A3FA 2JC7A 3O87A 5HDSA 3BLMA 4MBKA 3GSGA 4NG2A 4EEPA 4PM8A 3C4PA 5HSQA 1K54A 4ZDXA 2L1MA 1Y4OA 3G6OA 2PD8A 1PIOA 4IUKA 3MMHA 2X01A 2XROA 1H3QA 1RGYA 2WADA 3IH8A 3UPNA 1N9LA 2WAFA 3UB9A 1Y54A 1S4SA 4LRYC 1K4FA 1FSWA 3BJNA 3T4OA 1SKOB 3H9WA 2PHYA 3UNWA 2PDRA 1VM1A 2GJ3A 4QU3A 4EBNA 1CEFA 2V8CA 4YWZA 5F6AA 3UB5P 3M6BA 5DTKA 2WKEA 5U47A 3Q7VB 2XH9A 3WRTA 2OOLA 2J8YA 1X0OA 2UWXA 2JHEA 3LI8A 2ZMVA 3EWKA 4UA7A 4Y15A 1K55C 1VEUB 3EQUA 1FSYA 3K3CA 3F1OA 3SH8A 2ZD8A 5DF9A 5HZHA 4CQHA 4OPQA 4LENA 3S1YA 1SCWA 3B33A 4EEUA 5G4YA 2VV7A 1YM1A 2FFYA 2L0WA 1HVBA 3W8KA 2I72A 1L0GA 5EVIA 3W4OA 3G30A 3FKVA 1PZOA 1TDGA 3W4QA 4I5SA 5TFQA 2XA7M 1S1ZA 2D02A 3OPHA 2ZQ7A 4B4ZA 5DJTA 4NK3A 2H0YA 3RH8B 2D01A 1XA7A 5HAPA 1NRFA 2I9VA 2XK1A 1LLBA 4EETB 1PWCA 2Y2JA 3IF5A 4WYYA 2W3DA 4OOLA 3CJMA 5HPFA 3L7HA 2WYXA 1VEUA 2H28A 2XD5A 3IF6C 5MC7A 4GDNA 4L9EA 5D3OA 1YSQA 1NYMA 4BL2A 4OPRA 4X1MA 3BFGA 2JKTM 3P09A 3GV9A 3R4KA 3TW8A 5JYOA 5L8MA 1G6OA 4QHCA 1LL5A 3B42A 5FQIA 4S2MA 3ICYA 3ZG7B 4WZ5A 4OP8A 4FSFA 1YQSA 5GHXA 3T4LA 3VP0A 1SDNA 1L0DA 4Y0UA 3QP2A 4NXFA 4P6ZM 3MS6A 1MWRA 2LB5A 2OWHA 1F5MA 3MZEA 3S7QA 3CAXA 2GX5A 4DDYA 2J80A 3CUEC 2EX6A 4JGPA 2P9VA 3IS2B 3MQQA 3SH7A 3QP6A 1OJ5A 3IBJA 3MFXA 5HDDA 3HUNA 4WM9A 5I94A 2DMWA 1ONGA 2VA0A 4NEED 5CHMA 4P87A 1BZAA 3FV7A 1H5XA 1BLSA 3OCLA 4FUWA 5FI2A 2A24A 2RL3A 4MLLA 4WLAA 2HDQA 1XFNA 2ZQAA 5HAQA 5FQKA 2GZAA 2XFTA 4K08A 2P74A 3ZG5A 2V0WA 4R38A 5FA7A 3LGOA 2O99A 4N1HA 1XJ6A 2ZMFA 3BQ8A 2PR5A 3BFFA 4ZTKA 5EFWA 4X68A 2J9PA 3GRJA 4GZBA 1ZKJA 2OAP1 4ZJ2A 5CEBA 5CXWA 1YLJA 4GW9A 2WGVA 3UE1A 4S2NA 1K56A 3C5AA 4U3TA 2EX2A 4FTXA 2QPNA 4PM6A 4CLCE 2ZMAA 3EQVA 4BBVA 4HEFA 4JGRA 4E6XA 4KZ8A 3QNCA 1CI8A 1FR6A 1T1BA 3PXPA 3H7WB 4RVAA 1W5DA 4DJ3A 2XFSA 1MZUA 3G2YA 3ZCZA 1MWSA 3T4SA 3T12B 5F1GA 5L10A 3LIBA 1QMFA 2G7UA 2PU4A 5FEGA 3DTEA 1CI9A 2ZC4B 4HH3A 2HDRA 2PD7A 4L0LA 1IYQA 1TD5A 3OPPA 3NI9A 1T18A 1XX2A 3ZVTA 4P0MA 1STZA 4BD0A 2Y2GA 4BJPA 2ZQ9A 4S2PA 3IX3A 4BBTA 4LPZA 5A92A 5CGSA 3F1NB 5TBMB 3G31A 3LR4A 3IF6B 3MR0A 1PZPA 1Q2PA 2JN7A 2VZWA 3M2KA 2PYPA 4PKYA 1IKGA 3IXDA 1W63M 4LV3A 4I3IA 1IYSA 1TVFA 4NKPA 1XXMA 4KZ9A 3OPRA 1PWDA 3F1PB 5FDSA 5M18A 3NDEA 4IUHA 1E3UA 1JWPA 1W8QA 3HREA 1S67L 3TG9A 1MWTA 1LSWA 1P9RA 1ONHA 4PKYG 3V50A 3D72A 1BT5A 3S7PA 3HUMA 2PYRA 2Y2NA 4DE3A 1DP8A 2WKHA 3V3SA 1MC0A 3W2ZA 4KQQA 3C38A 3IQAA 2XA7S 5KZHA 1JNUA 3T4TA 4CLCD 3JVVA 3F1NA 5TBMA 2DRWA 3IWIA 3ZVWA 4X25A 2Y2IA 1N4OA 4C6YA 1FIKA 2PRFA 4KZBA 2JKTI 4CLCC 3ZQ5A 1DJBA 5A91A 2BASA 1TDLA 4GS9A 3F1PA 4LFUA 3T50A 4WEKA 3L9KA 5I5LA 2WK0A 3M2JA 1RGZA 1N9OA 2R78A 3PBSA 4ESPA 3ZG8B 3GR2A 1D1JA 5M19A 4GNUA 2J3TD 1JTGA 2YKFA 3AGFA 3NBLA 5E2GA 1NJ4A 2ZQDA 3GQZA 3JYIA 1EWZA 4JBFA 4LCMA 4I38A 2WKIA 2Y2OA 2QMIA 4N9KA 2HJEA 3FPVA 4HH2A 4P6ZS 3ZHHA 3VFFA 4DDSA 1BSGA 3IX8A 2J3TC 4YFMA 1ZHHB 4LV2A 1NRJA 4R3BA 2V2FF 3LUQA 5DVAA 3QNBA 4IVKA 1KDWA 4UA6A 1IOUA 2E8IA 2K2NA 3CHWP 1YLTA 3IWOA 1HD8A 4B9OA 3G4PA 3C8CA 2V1BA 3SZTA 4N1XA 4HJ4A 1JWVA 2JKRM 1S6RA 1YLZA 4LRXC 3FZCA 4Q8IA 1L0EA 4KUKA 4GOGA 1ZTUA 1KE3A 2Y91A 2GNXA 1LI9A 4DXCA 5J4EA 3N8LA 3T4QA 2XDMA 4KG6A 1DRMA 3SW1A 1NYYA 4S2LA 1RP5A 2P08A 4KG5A 1MBLA 5CTNA 5FL3A 4UEYA 3VOLA 3LO7A 4BMWA 4JGQA 1LSXA 1KGFA 1S0WA 1NZOA 4OPZA 5GLBA 1ESUA 2R9XA 5EVEA 3KSHA 1CQAA 3BLSA 5FATA 4WF0A 2XF3A 3CWFA 3N4IA 2PBYA 2Z6DA 4EQIA 3NIAA 1BLHA 4E6WA 2EX8A 2W3EA 1H8MA 2WUQA 3TSGA 1GA0A 3CPTA 3CG5A 3WS1A 2ZJ9A 4IJGA 1OJGA 1YLPA 4WBGA 4X56A 3HVFA 3OCNA 4I39A 3IT9A 4YINA 2XSSA 4ZAMA 4Z1WA 4O0PA 3ZGAB 3OLOA 4QJGA 3LYXA 5FAPA 4JXGA 4S2IA 3E0YA 2Y2HA 3TJZC 1V9YA 1VETA 3P7NA 4GDBA 4X53A 4NXGA 4CLCB 2J7VA 2M1CA 3HLCA 3UMEA 3A0SA 4H6JA 3DTKA 3KYQA 4QPRA 4EV4A 1FCOA 1H8YA 1SZVA 4OQ0A 3EOIA 3I7JA 2FZ0A 2Y2QA 4FD8A 1XA1A 4HIAA 1BYWA 2BLSA 5AQ7A 3T1QB 3TOIA 2B5RA 2M7UA 1AWIA 4YNRA 3UY6A 2VEAA 3U4LP 1YKDA 4GKUA 4FH4A 5HWWA 4FOFA 1K0KA 2Y2PA 3KSFA 1MKIA 2OLVA 5HFOA 1RCJA 3VFHA 3CLOA 1K57A 1ERMA 1GSVA 3VOZA 1MWUA 4RYEA 5FQJA 3QP4A 4EU0A 2INWA 1BTLA 3IXGA 4CLCA 3MSHA 5GLCA 1LL8A 3LEZA 5E2FA 1F9IA 4QD4A 2O9AA 2PAVP 2ZOHA 4A5RA 2P04A 2ZM2A 2Q9NA 4IEDA 3PYPA 1SKOA 3N8RA 5HL1A 3R7WB 1WA9A 1FQGA 2BG1A 1EI5A 1C3BA 3MXQA 4NXEA 3ZG9B 3PAGA 2K7SA 4BL3A 4KQOA 3Q7VA 3UE6A 3ZYTA 2VK3A 3O5YA 4GD6A 5JYPA 4R3AA 5CGWA 1MPLA 2IWCA 3NC8A 3BM6A 4GHIB 4OOMA 1FR1A 2VV6A 5DF8A 4KQRA 4D2OA 3K2NA 1ES4A 2A3UA 2A2LA 1YLYA 3C7VA 4MNRA 2HDSA 1G28A 1F2KA 3QP5A 1ES3A 4HI4A 1IYOA 3JPUA 1Y28A 3FPWA 3UDXA 4YOFA 4R4RA
chains in the Genus database with same CATH topology
4L0LA 1IYQA 3OPPA 5AQ9A 4MEZA 3O86A 3NI9A 4C3QA 3HLEA 4OOYA 4P6BA 5IHVA 1WYBA 1XX2A 4N9LA 3ZVTA 4P0MA 4BD0A 2Y2GA 3IWQA 2WAEA 4LV1A 4BJPA 2ZQ9A 4S2NC 4S2PA 5FAOA 1CEGA 3HBRA 2EFXA 3DTMA 5EVLA 2V1ZA 5CGSA 5A92A 3VP4A 4E3NA 3G31A 3HLFA 2G2WA 5EVIB 3IF6B 1EROA 4E3MA 5DF7A 3SOIA 1PZPA 4PMAA 1Q2PA 3BRMA 5CECA 4FH2A 5FDHA 1PW1A 3M2KA 1H8ZA 2DCFA 3DWZA 1N9BA 1IKGA 4N92A 3IXDA 3WS0A 4KZ5A 3V39A 4B4XA 3MXSA 4LV3A 4WZ4A 3W4PA 4KZAA 1IYSA 3V5MA 2Y59A 1TVFA 1G6AA 1PI5A 3CMZA 1XXMA 3AGEA 4KZ9A 3OPRA 1PWDA 4OONA 3UPPA 3IH9A 5M18A 3NDEA 2EXAA 4OKPA 1ZG6A 1JTDA 1E3UA 2ZM0A 1YLWA 5A93A 2HP6A 1CK3A 1JWPA 3NDGA 5CGXA 1W8QA 2C6WB 3HREA 3UE0A 5EPHA 2C5WB 4PM7A 1IELA 3TG9A 4R0QA 4IBRA 1MWTA 4X6TA 1ONHA 3V50A 2WZXA 2ZM8A 1BT5A 5EOOA 2FFFB 3HUMA 2Y2NA 3PAEA 4DE3A 3PBQA 3IHAA 3SS4A 4E3LA 2Y4AA 4DXBA 2Z2MB 1E3UD 4OVDA 2WKHA 3V3SA 3GTCA 4DRTA 1XGIA 1PWGA 1K4EA 3BFEA 4KQQA 4RX3A 4X69A 3B3XA 1BLPA 3IQAA 1PW8A 2ZC6B 5EE8A 1KE0A 5AQAA 5KZHA 2QZ6A 4O7DA 2CC1A 4EWFA 1NXYA 3ZG0A 1NY0A 3PBRA 4Y0OA 5FAQA 4PPRA 3NCKA 4EBLA 2XGNA 1E4DA 3BYDA 1K25A 1JWZA 3LY4A 4E3IA 3N8SA 3RXWA 4KG2A 4U0TA 5J8XA 1W79A 5TR7A 1MY8A 4R3JA 1XP4A 4LV0A 2DRWA 3IWIA 4K0WA 4QB8A 3ZVWA 2Y2IA 1N4OA 1JVJA 4C6YA 4KZBA 2IWDA 4KENB 3UE3A 2VGKA 1PYYA 1WYCA 2WGWB 3RXXA 2ZC3B 4HBTA 3BFDA 2Y55A 2Z2LB 3G34A 3WRZA 1DJBA 1K6RA 4WMCD 5A91A 3IXHA 4JXSA 1U60A 2XLNA 4M3KA 1TDLA 4UA9A 2PU2A 5EECA 3VSKA 4JF6A 1XKZA 5FQQA 2JE5A 4GN2A 3OPLA 5FI7A 4WEKA 5E2EA 5L2FA 2WK0A 4MBFA 3M2JA 1RGZA 2P9VB 3HUOA 2ZLYA 3MBZA 4DE0A 1HZOA 1K6SA 3RJUA 3ZNTA 3ITAA 5GLDA 1E25A 3A3FA 4OP5A 5E2HA 2IWBA 3PBSA 2JC7A 3O87A 4DKIA 3MKFA 3MXRA 5GHZA 3N7WA 3ZG8B 3BLMA 3GR2A 5M19A 4GNUA 4MBKA 3ITBA 4KZ7A 1KGEA 3GSGA 5KSHA 2R9WA 1JTGA 3S4XA 4PM8A 3C4PA 3C7UA 3AGFA 1K54A 3PTEA 3NBLA 1BUEA 4ZDXA 5E2GA 1NJ4A 2ZQDA 3GQZA 4JPMA 5CHJA 3JYIA 1EWZA 5CHUA 4OQIA 1OMEA 4JBFA 4C75A 2H0TA 3Q07A 4LCMA 3OC2A 1PIOA 2WKIA 4S2OA 2Y2OA 2QMIA 1K55A 4N9KA 2X01A 5KSCA 3BECA 3HL9A 4JXWA 1RGYA 4OQHA 2EX9A 1ES5A 2H5SA 2WADA 3IH8A 3UPNA 2WAFA 4JKTA 3OZHA 4OLGA 3ZHHA 3WS5A 3VFFA 4DDSA 4R4SA 1BSGA 1Y54A 1K4FA 1FSWA 4YFMA 4BLMA 4LV2A 3SH9A 3UNWA 4R3BA 1VM1A 2WGWA 2V2FF 4QU3A 2XD1A 3WS2A 4EBNA 5DVAA 3QNBA 4IVKA 1KDWA 1IKIA 1CEFA 4UA6A 3UDIA 5CERA 1QMEA 3M6BA 2E8IA 2HPBA 1YT4A 3D4FA 1YLTA 2WKEA 5DTKA 3FKWA 5U47A 3Q7VB 1VQQA 2XH9A 3WRTA 2V20A 3IWOA 3Q82A 1DJAA 1HD8A 2J8YA 3G4PA 1GHIA 5EOEA 1SKFA 1K54C 2UWXA 2Y2MA 1LL9A 4IBXA 1ES2A 1FOFA 4EBPA 4N1XA 4HESA 1JWVA 4UA7A 1S6RA 2X02A 1TEMA 1YMSA 1YLZA 1K55C 1GA9A 5FSRA 3E2KA 3FZCA 4Q8IA 4KZ4A 3UPOA 1L0EA 5DTSA 3EQUA 1FSYA 4GOGA 3G32A 3WWXA 4PM9A 3SH8A 1KE3A 2ZD8A 2Y91A 3PBOA 4NETA 2HP5A 1LI9A 4DXCA 4OQGA 3N8LA 1XGJA 5DF9A 5FI6A 2XDMA 4KG6A 2DNSA 3MFDA 4OPQA 1NYYA 4LENA 4F94A 4S2LA 1RP5A 3S1YA 1SCWA 2ZQ8A 3ZFZA 4KG5A 3E2LA 3C4OA 3HLGA 1PI4A 1MBLA 5CTNA 4ZBEA 1YM1A 4S2KA 2OV5A 2FFYA 3LO7A 3MZFA 1HVBA 1FCMA 3W8KA 2I72A 4EUZA 1L0GA 5EVIA 1ZG4A 3IF6A 3W4OA 1KGFA 3FYZA 1S0WA 1AXBA 1NZOA 4OPZA 3VP2A 5GLBA 4Y0TA 3G30A 1ESUA 3FKVA 1PZOA 1TDGA 3G35A 2R9XA 3W4QA 5TFQA 1XPBA 3Q7ZA 2RCXA 5DTTA 3OPHA 1GHMA 2ZQCA 3BLSA 2ZQ7A 5FATA 2XF3A 3N4IA 4B4ZA 2PBYA 5EVID 4EQIA 3ZDJA 3NIAA 1BLHA 2ZC5B 4FCFA 4JLFA 4NK3A 4E6WA 2EX8A 2H0YA 5F82A 2WUQA 3TSGA 3V3RA 1GA0A 1XA7A 2GDNA 5HAPA 3CG5A 1NRFA 3WS1A 1M40A 2ZJ9A 5AQBA 2XK1A 4OPYA 3HLBA 1LLBA 4DF6A 4GD8A 1PWCA 2Y2JA 2J9OA 3IF5A 5BOHA 4ID4A 4WYYA 1YLPA 1M6KA 4HBUA 4WBGA 4OOLA 3CJMA 4X56A 3HVFA 2WYXA 3OCNA 4XUXA 3IT9A 4YINA 3A3IA 4ZAMA 4QY5A 1O7EA 2G2UA 3ZGAB 2XD5A 3IF6C 5EVIC 5M1AA 1W7FA 1KVMA 4Z9QA 4GDNA 4QJGA 2A49A 5FAPA 1SHVA 1ZC2A 5D3OA 3Q81A 5A90A 1NYMA 4JXGA 4BL2A 4S2IA 1W8YA 2Y2HA 3SS5A 1I2WA 4OPRA 4GDBA 5EUAA 1Z6FA 4X53A 5E43A 4KZ3A 3A3JA 3BFGA 4KZ6A 1HTZA 3P09A 2J7VA 3GV9A 3WS4A 3SS3A 4GB7A 3HLCA 5F83A 5HW3A 3HLWA 5JYOA 2HDUA 4P85A 4WEJA 4QHCA 3HLDA 1LL5A 4EV4A 1FCOA 5FQIA 4S2MA 1H8YA 4OQ0A 5CRFA 4RA7A 3ZG7B 1Q2QA 4WZ5A 4S2JA 2Q9MA 2HP9A 3PBTA 5FQ9A 4ZJ3A 4OP8A 3I7JA 1L2SA 1YQSA 2XQZA 2Y2QA 4FSFA 4FD8A 1XA1A 5GHXA 3BEBA 4DE1A 3P98A 2XR0A 2WGIA 3G2ZA 3LY3A 1BLCA 5HX9A 3UN7A 3VP0A 5KMWA 1SDNA 3AGDA 2BLSA 1MXOA 1L0DA 3QHYA 4Y0UA 5AQ7A 4E3OA 2EXBA 3TOIA 3MZDA 2B5RA 1MWRA 3MZEA 1ERQA 2X71A 3NY4A 3UY6A 4DDYA 1DJCA 1GHPA 2H10A 4GKUA 4FH4A 2EX6A 1BULA 2P9VA 5CEDA 3IXBA 2Y2PA 3O88A 1MKIA 2OLVA 5HFOA 3SH7A 1RCJA 4Y7PA 3VFHA 3HUNA 1K57A 1O07A 4WM9A 3S22A 3ZNYA 5I94A 1ONGA 1ERMA 4JF4A 4XUZA 3LCEA 2Y2KA 5CHMA 4P87A 1BZAA 3FV7A 1H5XA 5F1FA 4JF5A 1BLSA 3VSLA 3OCLA 3GVBA 2EFUA 4WZ5C 3UDFA 5FQMA 1GCEA 3VOZA 1MWUA 5FI2A 3PBNA 4RYEA 4LCLA 5FQJA 1NZUA 2RL3A 5HAIA 4MLLA 3O3VA 1BTLA 3IXGA 4WELA 3FWLA 3VMAA 1LI0A 5GLCA 2HDQA 2ZQAA 3GMWA 5HAQA 3LEZA 5E2FA 5FQKA 3VP1A 2XFTA 4XXRA 3VOYA 3MKEA 1KVLA 4QD4A 2P74A 3ZG5A 4R23A 5GL9A 3Q1FA 4A5RA 1L0FA 2ZM2A 2Q9NA 1KDSA 3CZDA 4IEDA 5FA7A 4BQMA 3N8RA 4N1HA 3IHBA 5HL1A 4MBHA 1FQGA 3BFCA 2BG1A 4ZJ1A 1EI5A 4CPKA 1C3BA 4DE2A 4UAAA 2XEPA 3M6HA 1K57C 3ZG9B 4BD1A 4WMCA 4X55A 3BFFA 3PAGA 4OH0A 5CTMA 1SDEA 4ZTKA 4X68A 2J9PA 4BL3A 3GRJA 4KQOA 3VP3A 4GZBA 4RX2A 3Q7VA 4B88A 1ZKJA 4ZJ2A 5CEBA 5CXWA 1YMXA 1YLJA 3ISGA 3N6IA 5TGFA 4OLDA 2WGVA 4UHUA 4GD6A 3UO9A 5JYPA 3UE1A 1I2SA 5CGWA 1MPLA 2IWCA 5GLAA 5G18A 4S2NA 3NC8A 1K56A 3C5AA 3DWKA 4CJNA 2VGJA 5GHYA 4U3TA 1G68A 3BM6A 4K91A 2JBFA 1J9MA 1WE4A 2EX2A 3A3EA 1ALQA 2QPNA 2Y2LA 1LHYA 4OOMA 3A3DA 4PM6A 2ZMAA 3EQVA 4U0XA 1FCNA 5FASA 4HEFA 1FR1A 4E6XA 4IVIA 4R1GA 1KE4A 4KZ8A 5DF8A 4BENA 4KQRA 2WZZA 3QNCA 1CI8A 1FR6A 4E3JA 4H8RA 1K38A 4D2OA 4K0XA 3DW0A 4RVAA 4QY6A 1W5DA 1ES4A 2A3UA 4E3KA 2XFSA 3G2YA 5HARA 1YLYA 1MWSA 3ZCZA 1KGGA 3C7VA 5F1GA 4PM5A 4MNRA 1K56D 2HDSA 2OLUA 1ES3A 2JCHA 1IYOA 4JXVA 1QMFA 1IEMA 2PU4A 1CI9A 2ZC4B 1DY6A 3UDXA 1IYPA 1ESIA 2HDRA 1I5QA 2OSUA 2ZC7A 4R4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L0L A;  1IYQ A;  3OPP A;  5AQ9 A;  4MEZ A;  3O86 A;  3NI9 A;  4C3Q A;  3HLE A;  4OOY A;  4P6B A;  5IHV A;  1WYB A;  1XX2 A;  4N9L A;  3ZVT A;  4P0M A;  4BD0 A;  2Y2G A;  3IWQ A;  2WAE A;  4LV1 A;  4BJP A;  2ZQ9 A;  4S2N C;  4S2P A;  5FAO A;  1CEG A;  3HBR A;  2EFX A;  3DTM A;  5EVL A;  2V1Z A;  5CGS A;  5A92 A;  3VP4 A;  4E3N A;  3G31 A;  3HLF A;  2G2W A;  5EVI B;  3IF6 B;  1ERO A;  4E3M A;  5DF7 A;  3SOI A;  1PZP A;  4PMA A;  1Q2P A;  3BRM A;  5CEC A;  4FH2 A;  5FDH A;  1PW1 A;  3M2K A;  1H8Z A;  2DCF A;  3DWZ A;  1N9B A;  1IKG A;  4N92 A;  3IXD A;  3WS0 A;  4KZ5 A;  3V39 A;  4B4X A;  3MXS A;  4LV3 A;  4WZ4 A;  3W4P A;  4KZA A;  1IYS A;  3V5M A;  2Y59 A;  1TVF A;  1G6A A;  1PI5 A;  3CMZ A;  1XXM A;  3AGE A;  4KZ9 A;  3OPR A;  1PWD A;  4OON A;  3UPP A;  3IH9 A;  5M18 A;  3NDE A;  2EXA A;  4OKP A;  1ZG6 A;  1JTD A;  1E3U A;  2ZM0 A;  1YLW A;  5A93 A;  2HP6 A;  1CK3 A;  1JWP A;  3NDG A;  5CGX A;  1W8Q A;  2C6W B;  3HRE A;  3UE0 A;  5EPH A;  2C5W B;  4PM7 A;  1IEL A;  3TG9 A;  4R0Q A;  4IBR A;  1MWT A;  4X6T A;  1ONH A;  3V50 A;  2WZX A;  2ZM8 A;  1BT5 A;  5EOO A;  2FFF B;  3HUM A;  2Y2N A;  3PAE A;  4DE3 A;  3PBQ A;  3IHA A;  3SS4 A;  4E3L A;  2Y4A A;  4DXB A;  2Z2M B;  1E3U D;  4OVD A;  2WKH A;  3V3S A;  3GTC A;  4DRT A;  1XGI A;  1PWG A;  1K4E A;  3BFE A;  4KQQ A;  4RX3 A;  4X69 A;  3B3X A;  1BLP A;  3IQA A;  1PW8 A;  2ZC6 B;  5EE8 A;  1KE0 A;  5AQA A;  5KZH A;  2QZ6 A;  4O7D A;  2CC1 A;  4EWF A;  1NXY A;  3ZG0 A;  1NY0 A;  3PBR A;  4Y0O A;  5FAQ A;  4PPR A;  3NCK A;  4EBL A;  2XGN A;  1E4D A;  3BYD A;  1K25 A;  1JWZ A;  3LY4 A;  4E3I A;  3N8S A;  3RXW A;  4KG2 A;  4U0T A;  5J8X A;  1W79 A;  5TR7 A;  1MY8 A;  4R3J A;  1XP4 A;  4LV0 A;  2DRW A;  3IWI A;  4K0W A;  4QB8 A;  3ZVW A;  2Y2I A;  1N4O A;  1JVJ A;  4C6Y A;  4KZB A;  2IWD A;  4KEN B;  3UE3 A;  2VGK A;  1PYY A;  1WYC A;  2WGW B;  3RXX A;  2ZC3 B;  4HBT A;  3BFD A;  2Y55 A;  2Z2L B;  3G34 A;  3WRZ A;  1DJB A;  1K6R A;  4WMC D;  5A91 A;  3IXH A;  4JXS A;  1U60 A;  2XLN A;  4M3K A;  1TDL A;  4UA9 A;  2PU2 A;  5EEC A;  3VSK A;  4JF6 A;  1XKZ A;  5FQQ A;  2JE5 A;  4GN2 A;  3OPL A;  5FI7 A;  4WEK A;  5E2E A;  5L2F A;  2WK0 A;  4MBF A;  3M2J A;  1RGZ A;  2P9V B;  3HUO A;  2ZLY A;  3MBZ A;  4DE0 A;  1HZO A;  1K6S A;  3RJU A;  3ZNT A;  3ITA A;  5GLD A;  1E25 A;  3A3F A;  4OP5 A;  5E2H A;  2IWB A;  3PBS A;  2JC7 A;  3O87 A;  4DKI A;  3MKF A;  3MXR A;  5GHZ A;  3N7W A;  3ZG8 B;  3BLM A;  3GR2 A;  5M19 A;  4GNU A;  4MBK A;  3ITB A;  4KZ7 A;  1KGE A;  3GSG A;  5KSH A;  2R9W A;  1JTG A;  3S4X A;  4PM8 A;  3C4P A;  3C7U A;  3AGF A;  1K54 A;  3PTE A;  3NBL A;  1BUE A;  4ZDX A;  5E2G A;  1NJ4 A;  2ZQD A;  3GQZ A;  4JPM A;  5CHJ A;  3JYI A;  1EWZ A;  5CHU A;  4OQI A;  1OME A;  4JBF A;  4C75 A;  2H0T A;  3Q07 A;  4LCM A;  3OC2 A;  1PIO A;  2WKI A;  4S2O A;  2Y2O A;  2QMI A;  1K55 A;  4N9K A;  2X01 A;  5KSC A;  3BEC A;  3HL9 A;  4JXW A;  1RGY A;  4OQH A;  2EX9 A;  1ES5 A;  2H5S A;  2WAD A;  3IH8 A;  3UPN A;  2WAF A;  4JKT A;  3OZH A;  4OLG A;  3ZHH A;  3WS5 A;  3VFF A;  4DDS A;  4R4S A;  1BSG A;  1Y54 A;  1K4F A;  1FSW A;  4YFM A;  4BLM A;  4LV2 A;  3SH9 A;  3UNW A;  4R3B A;  1VM1 A;  2WGW A;  2V2F F;  4QU3 A;  2XD1 A;  3WS2 A;  4EBN A;  5DVA A;  3QNB A;  4IVK A;  1KDW A;  1IKI A;  1CEF A;  4UA6 A;  3UDI A;  5CER A;  1QME A;  3M6B A;  2E8I A;  2HPB A;  1YT4 A;  3D4F A;  1YLT A;  2WKE A;  5DTK A;  3FKW A;  5U47 A;  3Q7V B;  1VQQ A;  2XH9 A;  3WRT A;  2V20 A;  3IWO A;  3Q82 A;  1DJA A;  1HD8 A;  2J8Y A;  3G4P A;  1GHI A;  5EOE A;  1SKF A;  1K54 C;  2UWX A;  2Y2M A;  1LL9 A;  4IBX A;  1ES2 A;  1FOF A;  4EBP A;  4N1X A;  4HES A;  1JWV A;  4UA7 A;  1S6R A;  2X02 A;  1TEM A;  1YMS A;  1YLZ A;  1K55 C;  1GA9 A;  5FSR A;  3E2K A;  3FZC A;  4Q8I A;  4KZ4 A;  3UPO A;  1L0E A;  5DTS A;  3EQU A;  1FSY A;  4GOG A;  3G32 A;  3WWX A;  4PM9 A;  3SH8 A;  1KE3 A;  2ZD8 A;  2Y91 A;  3PBO A;  4NET A;  2HP5 A;  1LI9 A;  4DXC A;  4OQG A;  3N8L A;  1XGJ A;  5DF9 A;  5FI6 A;  2XDM A;  4KG6 A;  2DNS A;  3MFD A;  4OPQ A;  1NYY A;  4LEN A;  4F94 A;  4S2L A;  1RP5 A;  3S1Y A;  1SCW A;  2ZQ8 A;  3ZFZ A;  4KG5 A;  3E2L A;  3C4O A;  3HLG A;  1PI4 A;  1MBL A;  5CTN A;  4ZBE A;  1YM1 A;  4S2K A;  2OV5 A;  2FFY A;  3LO7 A;  3MZF A;  1HVB A;  1FCM A;  3W8K A;  2I72 A;  4EUZ A;  1L0G A;  5EVI A;  1ZG4 A;  3IF6 A;  3W4O A;  1KGF A;  3FYZ A;  1S0W A;  1AXB A;  1NZO A;  4OPZ A;  3VP2 A;  5GLB A;  4Y0T A;  3G30 A;  1ESU A;  3FKV A;  1PZO A;  1TDG A;  3G35 A;  2R9X A;  3W4Q A;  5TFQ A;  1XPB A;  3Q7Z A;  2RCX A;  5DTT A;  3OPH A;  1GHM A;  2ZQC A;  3BLS A;  2ZQ7 A;  5FAT A;  2XF3 A;  3N4I A;  4B4Z A;  2PBY A;  5EVI D;  4EQI A;  3ZDJ A;  3NIA A;  1BLH A;  2ZC5 B;  4FCF A;  4JLF A;  4NK3 A;  4E6W A;  2EX8 A;  2H0Y A;  5F82 A;  2WUQ A;  3TSG A;  3V3R A;  1GA0 A;  1XA7 A;  2GDN A;  5HAP A;  3CG5 A;  1NRF A;  3WS1 A;  1M40 A;  2ZJ9 A;  5AQB A;  2XK1 A;  4OPY A;  3HLB A;  1LLB A;  4DF6 A;  4GD8 A;  1PWC A;  2Y2J A;  2J9O A;  3IF5 A;  5BOH A;  4ID4 A;  4WYY A;  1YLP A;  1M6K A;  4HBU A;  4WBG A;  4OOL A;  3CJM A;  4X56 A;  3HVF A;  2WYX A;  3OCN A;  4XUX A;  3IT9 A;  4YIN A;  3A3I A;  4ZAM A;  4QY5 A;  1O7E A;  2G2U A;  3ZGA B;  2XD5 A;  3IF6 C;  5EVI C;  5M1A A;  1W7F A;  1KVM A;  4Z9Q A;  4GDN A;  4QJG A;  2A49 A;  5FAP A;  1SHV A;  1ZC2 A;  5D3O A;  3Q81 A;  5A90 A;  1NYM A;  4JXG A;  4BL2 A;  4S2I A;  1W8Y A;  2Y2H A;  3SS5 A;  1I2W A;  4OPR A;  4GDB A;  5EUA A;  1Z6F A;  4X53 A;  5E43 A;  4KZ3 A;  3A3J A;  3BFG A;  4KZ6 A;  1HTZ A;  3P09 A;  2J7V A;  3GV9 A;  3WS4 A;  3SS3 A;  4GB7 A;  3HLC A;  5F83 A;  5HW3 A;  3HLW A;  5JYO A;  2HDU A;  4P85 A;  4WEJ A;  4QHC A;  3HLD A;  1LL5 A;  4EV4 A;  1FCO A;  5FQI A;  4S2M A;  1H8Y A;  4OQ0 A;  5CRF A;  4RA7 A;  3ZG7 B;  1Q2Q A;  4WZ5 A;  4S2J A;  2Q9M A;  2HP9 A;  3PBT A;  5FQ9 A;  4ZJ3 A;  4OP8 A;  3I7J A;  1L2S A;  1YQS A;  2XQZ A;  2Y2Q A;  4FSF A;  4FD8 A;  1XA1 A;  5GHX A;  3BEB A;  4DE1 A;  3P98 A;  2XR0 A;  2WGI A;  3G2Z A;  3LY3 A;  1BLC A;  5HX9 A;  3UN7 A;  3VP0 A;  5KMW A;  1SDN A;  3AGD A;  2BLS A;  1MXO A;  1L0D A;  3QHY A;  4Y0U A;  5AQ7 A;  4E3O A;  2EXB A;  3TOI A;  3MZD A;  2B5R A;  1MWR A;  3MZE A;  1ERQ A;  2X71 A;  3NY4 A;  3UY6 A;  4DDY A;  1DJC A;  1GHP A;  2H10 A;  4GKU A;  4FH4 A;  2EX6 A;  1BUL A;  2P9V A;  5CED A;  3IXB A;  2Y2P A;  3O88 A;  1MKI A;  2OLV A;  5HFO A;  3SH7 A;  1RCJ A;  4Y7P A;  3VFH A;  3HUN A;  1K57 A;  1O07 A;  4WM9 A;  3S22 A;  3ZNY A;  5I94 A;  1ONG A;  1ERM A;  4JF4 A;  4XUZ A;  3LCE A;  2Y2K A;  5CHM A;  4P87 A;  1BZA A;  3FV7 A;  1H5X A;  5F1F A;  4JF5 A;  1BLS A;  3VSL A;  3OCL A;  3GVB A;  2EFU A;  4WZ5 C;  3UDF A;  5FQM A;  1GCE A;  3VOZ A;  1MWU A;  5FI2 A;  3PBN A;  4RYE A;  4LCL A;  5FQJ A;  1NZU A;  2RL3 A;  5HAI A;  4MLL A;  3O3V A;  1BTL A;  3IXG A;  4WEL A;  3FWL A;  3VMA A;  1LI0 A;  5GLC A;  2HDQ A;  2ZQA A;  3GMW A;  5HAQ A;  3LEZ A;  5E2F A;  5FQK A;  3VP1 A;  2XFT A;  4XXR A;  3VOY A;  3MKE A;  1KVL A;  4QD4 A;  2P74 A;  3ZG5 A;  4R23 A;  5GL9 A;  3Q1F A;  4A5R A;  1L0F A;  2ZM2 A;  2Q9N A;  1KDS A;  3CZD A;  4IED A;  5FA7 A;  4BQM A;  3N8R A;  4N1H A;  3IHB A;  5HL1 A;  4MBH A;  1FQG A;  3BFC A;  2BG1 A;  4ZJ1 A;  1EI5 A;  4CPK A;  1C3B A;  4DE2 A;  4UAA A;  2XEP A;  3M6H A;  1K57 C;  3ZG9 B;  4BD1 A;  4WMC A;  4X55 A;  3BFF A;  3PAG A;  4OH0 A;  5CTM A;  1SDE A;  4ZTK A;  4X68 A;  2J9P A;  4BL3 A;  3GRJ A;  4KQO A;  3VP3 A;  4GZB A;  4RX2 A;  3Q7V A;  4B88 A;  1ZKJ A;  4ZJ2 A;  5CEB A;  5CXW A;  1YMX A;  1YLJ A;  3ISG A;  3N6I A;  5TGF A;  4OLD A;  2WGV A;  4UHU A;  4GD6 A;  3UO9 A;  5JYP A;  3UE1 A;  1I2S A;  5CGW A;  1MPL A;  2IWC A;  5GLA A;  5G18 A;  4S2N A;  3NC8 A;  1K56 A;  3C5A A;  3DWK A;  4CJN A;  2VGJ A;  5GHY A;  4U3T A;  1G68 A;  3BM6 A;  4K91 A;  2JBF A;  1J9M A;  1WE4 A;  2EX2 A;  3A3E A;  1ALQ A;  2QPN A;  2Y2L A;  1LHY A;  4OOM A;  3A3D A;  4PM6 A;  2ZMA A;  3EQV A;  4U0X A;  1FCN A;  5FAS A;  4HEF A;  1FR1 A;  4E6X A;  4IVI A;  4R1G A;  1KE4 A;  4KZ8 A;  5DF8 A;  4BEN A;  4KQR A;  2WZZ A;  3QNC A;  1CI8 A;  1FR6 A;  4E3J A;  4H8R A;  1K38 A;  4D2O A;  4K0X A;  3DW0 A;  4RVA A;  4QY6 A;  1W5D A;  1ES4 A;  2A3U A;  4E3K A;  2XFS A;  3G2Y A;  5HAR A;  1YLY A;  1MWS A;  3ZCZ A;  1KGG A;  3C7V A;  5F1G A;  4PM5 A;  4MNR A;  1K56 D;  2HDS A;  2OLU A;  1ES3 A;  2JCH A;  1IYO A;  4JXV A;  1QMF A;  1IEM A;  2PU4 A;  1CI9 A;  2ZC4 B;  1DY6 A;  3UDX A;  1IYP A;  1ESI A;  2HDR A;  1I5Q A;  2OSU A;  2ZC7 A;  4R4R A; 
#chains in the Genus database with same CATH topology
 4XT2 B;  5EV0 A;  3TE8 A;  5AQ9 A;  3HLE A;  4P6B A;  1WYB A;  4N9L A;  2BTF P;  2JKF A;  2JKR I;  3QP1 A;  5FAO A;  2O9B A;  3NEC A;  3P01 A;  3R7W A;  3HBR A;  4HJ3 A;  3E4O A;  2V1Z A;  3VP4 A;  4E3M A;  5CEC A;  4FH2 A;  3GDI A;  1H8Z A;  4N92 A;  3BQA A;  2VV8 A;  4R6L A;  2Y59 A;  1G6A A;  1PI5 A;  4MCW A;  4GHI A;  1OT6 A;  4OON A;  4O8G A;  4PAU A;  3T4J A;  5A93 A;  4KUO A;  2C6W B;  1W63 Q;  1LSV A;  1G5U A;  4HY8 A;  4PM7 A;  5A8B A;  2W1T B;  4IBR A;  4X6T A;  2WZX A;  5EOO A;  2FFF B;  3PBQ A;  5DJU A;  4E3L A;  2Y4A A;  4XT2 A;  4DRT A;  2E8J A;  2W1R A;  1XGI A;  1PWG A;  1K4E A;  3UB8 A;  3LIC A;  3B3X A;  1KE0 A;  2L4R A;  4O7D A;  3FG8 A;  4MN6 A;  4Y0O A;  5FAQ A;  1E4D A;  3BYD A;  5J8X A;  3N8S A;  3RXW A;  1T19 A;  3UMD A;  1OTE A;  2B95 A;  4LV0 A;  1S4R A;  2K31 A;  2O9C A;  3PR6 A;  1XFQ A;  2IWD A;  4KEN B;  1WYC A;  3IS2 A;  2WGW B;  3RXX A;  4HBT A;  4QWO A;  2Y55 A;  3G34 A;  3WRZ A;  3IXH A;  1DP9 A;  2XLN A;  2W3H A;  1T1C A;  1XKZ A;  3CI6 A;  2FH5 A;  4GN2 A;  5EM1 A;  5E2E A;  4MBF A;  4E04 A;  1K6S A;  3RJU A;  3ZNT A;  5E2H A;  4OP5 A;  3V67 A;  3N7W A;  4DMZ A;  2EWW A;  3ITB A;  4KZ7 A;  5KSH A;  4EES A;  3S4X A;  3C7U A;  3ULF A;  3PTE A;  1NWZ A;  5CHU A;  4JPM A;  5CHJ A;  2B02 A;  1NLZ A;  4OQI A;  1OME A;  4C75 A;  4EW7 A;  3OC2 A;  2ZBB A;  1K55 A;  4ETX A;  4JXW A;  4OQH A;  2EX9 A;  1ES5 A;  2H5S A;  4R4S A;  1HLU P;  2EWV A;  4F3L B;  3HJI A;  4G3K A;  4LGW A;  2W3F A;  4Q0I A;  5L09 A;  2WGW A;  2XD1 A;  3UDI A;  4AFI A;  1IKI A;  2HJ9 C;  5CER A;  1YPR A;  4B93 A;  2HPB A;  2EA9 A;  1P9W A;  3FKW A;  2V20 A;  3Q82 A;  3H7W A;  1GHI A;  5EOE A;  2Y2M A;  1K54 C;  4IBX A;  1LL9 A;  1S1Y A;  1ES2 A;  4MN7 A;  4I3A A;  4EBP A;  2X02 A;  1OTA A;  1EW0 A;  2KOI A;  1GA9 A;  5FSR A;  4KZ4 A;  4LRZ E;  3G32 A;  3WWX A;  4GJ4 A;  4NET A;  2ZL1 B;  1XGJ A;  5FI6 A;  4HHD A;  3QP8 A;  2DNS A;  2V9A A;  3E2L A;  4HOI A;  4IHQ A;  1PI4 A;  4MDZ A;  3FC7 A;  3UB6 A;  3BWL A;  1TS7 A;  3IF6 A;  3FYZ A;  3NJA A;  3VP2 A;  2P7J A;  2PT7 A;  2CMN A;  3T1S A;  1XPB A;  3Q7Z A;  2ZQC A;  3DBA A;  5EVI D;  2ZC5 B;  1YAX A;  5F82 A;  5F5Y A;  4DF6 A;  3IX4 A;  4GD8 A;  2J9O A;  2QJ7 A;  4ID4 A;  4Y2F A;  1OTB A;  4ZRR A;  4XUX A;  2VLG A;  4QY5 A;  1O7E A;  5EVI C;  5M1A A;  5FEF A;  2ZL1 A;  1SHV A;  3C30 A;  3LIE A;  5EUA A;  1Z6F A;  3CUE A;  5E43 A;  3A3J A;  1VHM A;  1HTZ A;  3EGX C;  5EM0 A;  2V0U A;  1TF1 A;  5F83 A;  1UWP X;  3HLW A;  2HDU A;  1N9N A;  3HJK A;  1F98 A;  4WEJ A;  3HLD A;  4LLO B;  3NUL A;  4RA7 A;  2KDK A;  4S2J A;  2Q9M A;  3B47 A;  4L9G A;  2HP9 A;  3PBT A;  4ZJ3 A;  2XQZ A;  3BEB A;  3P98 A;  5KMW A;  3LY3 A;  5HX9 A;  3H82 B;  1MXO A;  4E3O A;  2VKS A;  3KYE A;  1ERQ A;  3LI9 A;  2X71 A;  3NY4 A;  4PHT A;  1GHP A;  2H10 A;  1BUL A;  3E4P A;  2ZOI A;  3E98 A;  5CX7 A;  3BY9 A;  4JF4 A;  3LCE A;  1TS6 A;  4II7 A;  4D60 A;  3VSL A;  3GVB A;  2EFU A;  4WZ5 C;  3UDF A;  5FQM A;  5HD3 A;  3PBN A;  4R70 A;  2WKR A;  5HAI A;  2KX6 A;  5F69 A;  3T1R A;  3VMA A;  1LI0 A;  3S7N A;  5AJG A;  3VP1 A;  3VOY A;  3T1X A;  4R23 A;  2HV1 A;  2V1A A;  1KDS A;  3KSI A;  3DAV A;  4EXO A;  4GCZ A;  1P97 A;  2Y8H A;  4BQM A;  2J3W A;  4MBH A;  4Y5F A;  4ZJ1 A;  4CPK A;  4DE2 A;  4UAA A;  4X55 A;  1D7E A;  5G4Z A;  1XJ3 A;  2OWJ A;  4RX2 A;  3N6I A;  5TGF A;  4UHU A;  4G3W A;  1I2S A;  5GLA A;  4CJN A;  2VGJ A;  5GHY A;  1G68 A;  4K91 A;  2JBF A;  1WE4 A;  3A3E A;  4U0X A;  2Y2L A;  3A3D A;  5FAS A;  1OTI A;  1V9Z A;  4R1G A;  4BEN A;  2WZZ A;  4X1L A;  4E3J A;  4H8R A;  4K0X A;  2QKP A;  4E3K A;  3UB7 A;  1H0M A;  5HAR A;  4G3V A;  4PM5 A;  1K56 D;  2OLU A;  2JCH A;  3NHQ A;  4JXV A;  4HQA A;  3F1O B;  2VGL S;  1DY6 A;  1IYP A;  4RQ9 A;  1I5Q A;  2OSU A;  2ZC7 A;  4GLQ A;  3HCY A;  2UV0 E;  4OOY A;  5IHV A;  5DKL A;  4LV1 A;  4S2N C;  4Y13 A;  1CEG A;  1PRQ A;  1VB6 A;  2EFX A;  3A0V A;  3K3D A;  2Z6C A;  4MMN A;  3KYZ A;  2G2W A;  5EVI B;  3U2A A;  3SOI A;  3BRM A;  1PW1 A;  3VE3 A;  2DCF A;  2WKP A;  1N9B A;  5HL6 A;  3WS0 A;  3V39 A;  3MXS A;  1IFQ A;  3V5M A;  3D3O A;  3AGE A;  3UPP A;  1ODV A;  4OKP A;  1ZG6 A;  2ZM0 A;  3VE4 A;  1YLW A;  1CK3 A;  3NDG A;  3NOU C;  5CGX A;  3UE0 A;  2C5W B;  3RFB A;  1PFL A;  3LEQ A;  3KO6 A;  3PAE A;  3T4K A;  3IHA A;  3SS4 A;  4DXB A;  1E3U D;  1TS0 A;  4OVD A;  4DJ2 A;  2VX8 A;  4Y17 A;  2VJW A;  4X69 A;  1BLP A;  3DTI A;  4PPR A;  1D06 A;  1JWZ A;  4U0T A;  1W79 A;  5TR7 A;  4QB8 A;  2OAQ 1;  1LT0 A;  3C2W A;  3UE3 A;  2ZC3 B;  4WMC D;  4M3K A;  4UA9 A;  2PU2 A;  4ARZ B;  4JF6 A;  5FQQ A;  1OTD A;  3OPL A;  4Y3I A;  5L2F A;  2XRN A;  3NOT C;  2P9V B;  3HUO A;  2ZLY A;  1HZO A;  4HP4 A;  4Q0H A;  5GLD A;  1E25 A;  4WL9 A;  2O0Y A;  2IWB A;  4DKI A;  3MKF A;  5DFY A;  3KX0 X;  3MXR A;  5GHZ A;  1KGE A;  2R9W A;  3S7O A;  3E4Q A;  1BUE A;  2A24 B;  1A0K A;  2H0T A;  3Q07 A;  4S2O A;  4NXB A;  2IA2 A;  5KSC A;  3BEC A;  3HL9 A;  2HGV A;  4JKT A;  3OZH A;  4OLG A;  3WS5 A;  3MJQ A;  4BLM A;  3SH9 A;  4JGO A;  3WS2 A;  3EGD C;  1QME A;  3D4F A;  1YT4 A;  4ARZ A;  1VQQ A;  1DJA A;  3CIT A;  2QWS A;  1SKF A;  4UQI S;  3IBR A;  1FOF A;  4HES A;  3MQ0 A;  1J3W A;  1TEM A;  1YMS A;  4ETZ A;  3E2K A;  3UPO A;  5DTS A;  3OOV A;  1P0Z A;  4PM9 A;  3PBO A;  2HP5 A;  1L3L A;  4OQG A;  1S66 L;  3MFD A;  4F94 A;  3LR0 A;  2ZQ8 A;  3ZFZ A;  3C4O A;  3HLG A;  4ZBE A;  1XJ4 A;  4S2K A;  2OV5 A;  5L07 A;  3MZF A;  4O01 A;  2QYB A;  1FCM A;  4L9F A;  4EUZ A;  1ZG4 A;  3GEC A;  4Y0T A;  1AXB A;  2W27 A;  3G35 A;  2RCX A;  5DTT A;  1GHM A;  1T1A A;  1MKM A;  5DKK A;  3ZDJ A;  4FCF A;  4JLF A;  5J7E A;  3V3R A;  4ME4 A;  2GDN A;  1M40 A;  5AQB A;  4OPY A;  3HLB A;  4WN5 A;  5BOH A;  1M6K A;  1Z09 A;  4HBU A;  2W1T A;  3D9Y A;  1XJ2 A;  3A3I A;  3PHY A;  2G2U A;  1W7F A;  1KVM A;  2LB9 A;  4Z9Q A;  2A49 A;  2KLI A;  5KIZ A;  1ZC2 A;  3Q81 A;  5A90 A;  4Q0J A;  1W8Y A;  3SS5 A;  1I2W A;  1DP6 A;  4KZ3 A;  4KZ6 A;  3WS4 A;  3SS3 A;  4GB7 A;  2VGL M;  4KQD A;  5HW3 A;  2AVX A;  4P85 A;  3BW6 A;  4HJ6 A;  2Y79 A;  5CRF A;  1Q2Q A;  5FQ9 A;  1FIL A;  3KSG A;  1L2S A;  4DE1 A;  2XR0 A;  2WGI A;  3G2Z A;  1BLC A;  3UN7 A;  3AGD A;  3QHY A;  5J3W A;  2EXB A;  2W0N A;  1UWN X;  3MZD A;  4I3J A;  5AVE A;  1DJC A;  1CF0 A;  5CED A;  3IXB A;  5HWT A;  3O88 A;  3LIA A;  4Y7P A;  4WUJ A;  1O07 A;  2QJ5 A;  3S22 A;  3JVU A;  3ZNY A;  4GS9 B;  4XUZ A;  2Y2K A;  5F1F A;  4JF5 A;  4HNB A;  1GCE A;  4LCL A;  1NZU A;  2B18 A;  3MF0 A;  3NOP C;  3O3V A;  4WEL A;  3FWL A;  3LR5 A;  3GMW A;  5IT5 A;  5K5B A;  4XXR A;  4DN0 A;  5IU1 A;  3MKE A;  1KVL A;  2ACG A;  5GL9 A;  3Q1F A;  1L0F A;  4F3L A;  3CZD A;  2PR6 A;  2YKH A;  3IHB A;  3BFC A;  5DFX A;  2XEP A;  3M6H A;  1K57 C;  4BD1 A;  4WMC A;  4EER A;  4OH0 A;  5CTM A;  1SDE A;  3A0R A;  1PNE A;  3VP3 A;  2W3G A;  4B88 A;  2WKQ A;  1YMX A;  3ISG A;  4OLD A;  4HP9 A;  4BBU A;  3UO9 A;  5G18 A;  3DWK A;  1J9M A;  1ALQ A;  1LHY A;  1FCN A;  3LID A;  1NLY A;  1TS8 A;  4IVI A;  1KE4 A;  1K38 A;  3RTY A;  3DW0 A;  4QY6 A;  1KGG A;  3LIF A;  1IEM A;  4BWI A;  5TJJ A;  1ESI A;  4MEZ A;  2M7V A;  3O86 A;  4C3Q A;  3BY8 A;  5F68 A;  3IWQ A;  2WAE A;  1OPX A;  3EEH A;  3DTM A;  5EVL A;  2V8F A;  4E3N A;  3HLF A;  1ERO A;  5DF7 A;  4PMA A;  5HWV A;  5FDH A;  5AVF A;  3EEA A;  3OBF A;  1KOU A;  3DWZ A;  2Q0O A;  4KZ5 A;  4B4X A;  4WZ4 A;  3MQO A;  5C5K A;  3W4P A;  4KZA A;  3CMZ A;  5HDC A;  1UGU A;  5HPI A;  3IH9 A;  2EXA A;  3CPT B;  4EQ1 A;  2MJ6 A;  1JTD A;  2HP6 A;  1YSP A;  4UQI M;  5EPH A;  5HD5 A;  1IEL A;  4R0Q A;  2JKG A;  2ZM8 A;  1CJF A;  2Z2M B;  1ACF A;  3GTC A;  3BFE A;  4RX3 A;  1VET B;  5EE8 A;  1PW8 A;  2ZC6 B;  2NUP C;  5AQA A;  2QZ6 A;  2CC1 A;  4EWF A;  1NXY A;  3ZG0 A;  1NY0 A;  3PBR A;  3NCK A;  3VV4 A;  4EBL A;  2XGN A;  3H82 A;  1K25 A;  3LY4 A;  4E3I A;  4H6J B;  4KG2 A;  1MY8 A;  4R3J A;  2NUT C;  1XP4 A;  2PBD P;  1OT9 A;  4K0W A;  1JVJ A;  1GSW A;  2VGK A;  1PYY A;  2HF6 A;  3BFD A;  2Z2L B;  1K6R A;  4JXS A;  4EUV A;  1U60 A;  2HZ5 A;  3TRC A;  3LFV A;  5EEC A;  3VSK A;  2JE5 A;  4M4X A;  5LBR A;  1GSX A;  5FI7 A;  5IS1 A;  3LR3 A;  3MBZ A;  4DE0 A;  4MN5 A;  3ITA A;  2QHK A;  3A3F A;  2JC7 A;  3O87 A;  5HDS A;  3BLM A;  4MBK A;  3GSG A;  4NG2 A;  4EEP A;  4PM8 A;  3C4P A;  5HSQ A;  1K54 A;  4ZDX A;  2L1M A;  1Y4O A;  3G6O A;  2PD8 A;  1PIO A;  4IUK A;  3MMH A;  2X01 A;  2XRO A;  1H3Q A;  1RGY A;  2WAD A;  3IH8 A;  3UPN A;  1N9L A;  2WAF A;  3UB9 A;  1Y54 A;  1S4S A;  4LRY C;  1K4F A;  1FSW A;  3BJN A;  3T4O A;  1SKO B;  3H9W A;  2PHY A;  3UNW A;  2PDR A;  1VM1 A;  2GJ3 A;  4QU3 A;  4EBN A;  1CEF A;  2V8C A;  4YWZ A;  5F6A A;  3UB5 P;  3M6B A;  5DTK A;  2WKE A;  5U47 A;  3Q7V B;  2XH9 A;  3WRT A;  2OOL A;  2J8Y A;  1X0O A;  2UWX A;  2JHE A;  3LI8 A;  2ZMV A;  3EWK A;  4UA7 A;  4Y15 A;  1K55 C;  1VEU B;  3EQU A;  1FSY A;  3K3C A;  3F1O A;  3SH8 A;  2ZD8 A;  5DF9 A;  5HZH A;  4CQH A;  4OPQ A;  4LEN A;  3S1Y A;  1SCW A;  3B33 A;  4EEU A;  5G4Y A;  2VV7 A;  1YM1 A;  2FFY A;  2L0W A;  1HVB A;  3W8K A;  2I72 A;  1L0G A;  5EVI A;  3W4O A;  3G30 A;  3FKV A;  1PZO A;  1TDG A;  3W4Q A;  4I5S A;  5TFQ A;  2XA7 M;  1S1Z A;  2D02 A;  3OPH A;  2ZQ7 A;  4B4Z A;  5DJT A;  4NK3 A;  2H0Y A;  3RH8 B;  2D01 A;  1XA7 A;  5HAP A;  1NRF A;  2I9V A;  2XK1 A;  1LLB A;  4EET B;  1PWC A;  2Y2J A;  3IF5 A;  4WYY A;  2W3D A;  4OOL A;  3CJM A;  5HPF A;  3L7H A;  2WYX A;  1VEU A;  2H28 A;  2XD5 A;  3IF6 C;  5MC7 A;  4GDN A;  4L9E A;  5D3O A;  1YSQ A;  1NYM A;  4BL2 A;  4OPR A;  4X1M A;  3BFG A;  2JKT M;  3P09 A;  3GV9 A;  3R4K A;  3TW8 A;  5JYO A;  5L8M A;  1G6O A;  4QHC A;  1LL5 A;  3B42 A;  5FQI A;  4S2M A;  3ICY A;  3ZG7 B;  4WZ5 A;  4OP8 A;  4FSF A;  1YQS A;  5GHX A;  3T4L A;  3VP0 A;  1SDN A;  1L0D A;  4Y0U A;  3QP2 A;  4NXF A;  4P6Z M;  3MS6 A;  1MWR A;  2LB5 A;  2OWH A;  1F5M A;  3MZE A;  3S7Q A;  3CAX A;  2GX5 A;  4DDY A;  2J80 A;  3CUE C;  2EX6 A;  4JGP A;  2P9V A;  3IS2 B;  3MQQ A;  3SH7 A;  3QP6 A;  1OJ5 A;  3IBJ A;  3MFX A;  5HDD A;  3HUN A;  4WM9 A;  5I94 A;  2DMW A;  1ONG A;  2VA0 A;  4NEE D;  5CHM A;  4P87 A;  1BZA A;  3FV7 A;  1H5X A;  1BLS A;  3OCL A;  4FUW A;  5FI2 A;  2A24 A;  2RL3 A;  4MLL A;  4WLA A;  2HDQ A;  1XFN A;  2ZQA A;  5HAQ A;  5FQK A;  2GZA A;  2XFT A;  4K08 A;  2P74 A;  3ZG5 A;  2V0W A;  4R38 A;  5FA7 A;  3LGO A;  2O99 A;  4N1H A;  1XJ6 A;  2ZMF A;  3BQ8 A;  2PR5 A;  3BFF A;  4ZTK A;  5EFW A;  4X68 A;  2J9P A;  3GRJ A;  4GZB A;  1ZKJ A;  2OAP 1;  4ZJ2 A;  5CEB A;  5CXW A;  1YLJ A;  4GW9 A;  2WGV A;  3UE1 A;  4S2N A;  1K56 A;  3C5A A;  4U3T A;  2EX2 A;  4FTX A;  2QPN A;  4PM6 A;  4CLC E;  2ZMA A;  3EQV A;  4BBV A;  4HEF A;  4JGR A;  4E6X A;  4KZ8 A;  3QNC A;  1CI8 A;  1FR6 A;  1T1B A;  3PXP A;  3H7W B;  4RVA A;  1W5D A;  4DJ3 A;  2XFS A;  1MZU A;  3G2Y A;  3ZCZ A;  1MWS A;  3T4S A;  3T12 B;  5F1G A;  5L10 A;  3LIB A;  1QMF A;  2G7U A;  2PU4 A;  5FEG A;  3DTE A;  1CI9 A;  2ZC4 B;  4HH3 A;  2HDR A;  2PD7 A;  4L0L A;  1IYQ A;  1TD5 A;  3OPP A;  3NI9 A;  1T18 A;  1XX2 A;  3ZVT A;  4P0M A;  1STZ A;  4BD0 A;  2Y2G A;  4BJP A;  2ZQ9 A;  4S2P A;  3IX3 A;  4BBT A;  4LPZ A;  5A92 A;  5CGS A;  3F1N B;  5TBM B;  3G31 A;  3LR4 A;  3IF6 B;  3MR0 A;  1PZP A;  1Q2P A;  2JN7 A;  2VZW A;  3M2K A;  2PYP A;  4PKY A;  1IKG A;  3IXD A;  1W63 M;  4LV3 A;  4I3I A;  1IYS A;  1TVF A;  4NKP A;  1XXM A;  4KZ9 A;  3OPR A;  1PWD A;  3F1P B;  5FDS A;  5M18 A;  3NDE A;  4IUH A;  1E3U A;  1JWP A;  1W8Q A;  3HRE A;  1S67 L;  3TG9 A;  1MWT A;  1LSW A;  1P9R A;  1ONH A;  4PKY G;  3V50 A;  3D72 A;  1BT5 A;  3S7P A;  3HUM A;  2PYR A;  2Y2N A;  4DE3 A;  1DP8 A;  2WKH A;  3V3S A;  1MC0 A;  3W2Z A;  4KQQ A;  3C38 A;  3IQA A;  2XA7 S;  5KZH A;  1JNU A;  3T4T A;  4CLC D;  3JVV A;  3F1N A;  5TBM A;  2DRW A;  3IWI A;  3ZVW A;  4X25 A;  2Y2I A;  1N4O A;  4C6Y A;  1FIK A;  2PRF A;  4KZB A;  2JKT I;  4CLC C;  3ZQ5 A;  1DJB A;  5A91 A;  2BAS A;  1TDL A;  4GS9 A;  3F1P A;  4LFU A;  3T50 A;  4WEK A;  3L9K A;  5I5L A;  2WK0 A;  3M2J A;  1RGZ A;  1N9O A;  2R78 A;  3PBS A;  4ESP A;  3ZG8 B;  3GR2 A;  1D1J A;  5M19 A;  4GNU A;  2J3T D;  1JTG A;  2YKF A;  3AGF A;  3NBL A;  5E2G A;  1NJ4 A;  2ZQD A;  3GQZ A;  3JYI A;  1EWZ A;  4JBF A;  4LCM A;  4I38 A;  2WKI A;  2Y2O A;  2QMI A;  4N9K A;  2HJE A;  3FPV A;  4HH2 A;  4P6Z S;  3ZHH A;  3VFF A;  4DDS A;  1BSG A;  3IX8 A;  2J3T C;  4YFM A;  1ZHH B;  4LV2 A;  1NRJ A;  4R3B A;  2V2F F;  3LUQ A;  5DVA A;  3QNB A;  4IVK A;  1KDW A;  4UA6 A;  1IOU A;  2E8I A;  2K2N A;  3CHW P;  1YLT A;  3IWO A;  1HD8 A;  4B9O A;  3G4P A;  3C8C A;  2V1B A;  3SZT A;  4N1X A;  4HJ4 A;  1JWV A;  2JKR M;  1S6R A;  1YLZ A;  4LRX C;  3FZC A;  4Q8I A;  1L0E A;  4KUK A;  4GOG A;  1ZTU A;  1KE3 A;  2Y91 A;  2GNX A;  1LI9 A;  4DXC A;  5J4E A;  3N8L A;  3T4Q A;  2XDM A;  4KG6 A;  1DRM A;  3SW1 A;  1NYY A;  4S2L A;  1RP5 A;  2P08 A;  4KG5 A;  1MBL A;  5CTN A;  5FL3 A;  4UEY A;  3VOL A;  3LO7 A;  4BMW A;  4JGQ A;  1LSX A;  1KGF A;  1S0W A;  1NZO A;  4OPZ A;  5GLB A;  1ESU A;  2R9X A;  5EVE A;  3KSH A;  1CQA A;  3BLS A;  5FAT A;  4WF0 A;  2XF3 A;  3CWF A;  3N4I A;  2PBY A;  2Z6D A;  4EQI A;  3NIA A;  1BLH A;  4E6W A;  2EX8 A;  2W3E A;  1H8M A;  2WUQ A;  3TSG A;  1GA0 A;  3CPT A;  3CG5 A;  3WS1 A;  2ZJ9 A;  4IJG A;  1OJG A;  1YLP A;  4WBG A;  4X56 A;  3HVF A;  3OCN A;  4I39 A;  3IT9 A;  4YIN A;  2XSS A;  4ZAM A;  4Z1W A;  4O0P A;  3ZGA B;  3OLO A;  4QJG A;  3LYX A;  5FAP A;  4JXG A;  4S2I A;  3E0Y A;  2Y2H A;  3TJZ C;  1V9Y A;  1VET A;  3P7N A;  4GDB A;  4X53 A;  4NXG A;  4CLC B;  2J7V A;  2M1C A;  3HLC A;  3UME A;  3A0S A;  4H6J A;  3DTK A;  3KYQ A;  4QPR A;  4EV4 A;  1FCO A;  1H8Y A;  1SZV A;  4OQ0 A;  3EOI A;  3I7J A;  2FZ0 A;  2Y2Q A;  4FD8 A;  1XA1 A;  4HIA A;  1BYW A;  2BLS A;  5AQ7 A;  3T1Q B;  3TOI A;  2B5R A;  2M7U A;  1AWI A;  4YNR A;  3UY6 A;  2VEA A;  3U4L P;  1YKD A;  4GKU A;  4FH4 A;  5HWW A;  4FOF A;  1K0K A;  2Y2P A;  3KSF A;  1MKI A;  2OLV A;  5HFO A;  1RCJ A;  3VFH A;  3CLO A;  1K57 A;  1ERM A;  1GSV A;  3VOZ A;  1MWU A;  4RYE A;  5FQJ A;  3QP4 A;  4EU0 A;  2INW A;  1BTL A;  3IXG A;  4CLC A;  3MSH A;  5GLC A;  1LL8 A;  3LEZ A;  5E2F A;  1F9I A;  4QD4 A;  2O9A A;  2PAV P;  2ZOH A;  4A5R A;  2P04 A;  2ZM2 A;  2Q9N A;  4IED A;  3PYP A;  1SKO A;  3N8R A;  5HL1 A;  3R7W B;  1WA9 A;  1FQG A;  2BG1 A;  1EI5 A;  1C3B A;  3MXQ A;  4NXE A;  3ZG9 B;  3PAG A;  2K7S A;  4BL3 A;  4KQO A;  3Q7V A;  3UE6 A;  3ZYT A;  2VK3 A;  3O5Y A;  4GD6 A;  5JYP A;  4R3A A;  5CGW A;  1MPL A;  2IWC A;  3NC8 A;  3BM6 A;  4GHI B;  4OOM A;  1FR1 A;  2VV6 A;  5DF8 A;  4KQR A;  4D2O A;  3K2N A;  1ES4 A;  2A3U A;  2A2L A;  1YLY A;  3C7V A;  4MNR A;  2HDS A;  1G28 A;  1F2K A;  3QP5 A;  1ES3 A;  4HI4 A;  1IYO A;  3JPU A;  1Y28 A;  3FPW A;  3UDX A;  4YOF A;  4R4R A; 
#chains in the Genus database with same CATH homology
 4L0L A;  1IYQ A;  3OPP A;  5AQ9 A;  4MEZ A;  3O86 A;  3NI9 A;  4C3Q A;  3HLE A;  4OOY A;  4P6B A;  5IHV A;  1WYB A;  1XX2 A;  4N9L A;  3ZVT A;  4P0M A;  4BD0 A;  2Y2G A;  3IWQ A;  2WAE A;  4LV1 A;  4BJP A;  2ZQ9 A;  4S2N C;  4S2P A;  5FAO A;  1CEG A;  3HBR A;  2EFX A;  3DTM A;  5EVL A;  2V1Z A;  5CGS A;  5A92 A;  3VP4 A;  4E3N A;  3G31 A;  3HLF A;  2G2W A;  5EVI B;  3IF6 B;  1ERO A;  4E3M A;  5DF7 A;  3SOI A;  1PZP A;  4PMA A;  1Q2P A;  3BRM A;  5CEC A;  4FH2 A;  5FDH A;  1PW1 A;  3M2K A;  1H8Z A;  2DCF A;  3DWZ A;  1N9B A;  1IKG A;  4N92 A;  3IXD A;  3WS0 A;  4KZ5 A;  3V39 A;  4B4X A;  3MXS A;  4LV3 A;  4WZ4 A;  3W4P A;  4KZA A;  1IYS A;  3V5M A;  2Y59 A;  1TVF A;  1G6A A;  1PI5 A;  3CMZ A;  1XXM A;  3AGE A;  4KZ9 A;  3OPR A;  1PWD A;  4OON A;  3UPP A;  3IH9 A;  5M18 A;  3NDE A;  2EXA A;  4OKP A;  1ZG6 A;  1JTD A;  1E3U A;  2ZM0 A;  1YLW A;  5A93 A;  2HP6 A;  1CK3 A;  1JWP A;  3NDG A;  5CGX A;  1W8Q A;  2C6W B;  3HRE A;  3UE0 A;  5EPH A;  2C5W B;  4PM7 A;  1IEL A;  3TG9 A;  4R0Q A;  4IBR A;  1MWT A;  4X6T A;  1ONH A;  3V50 A;  2WZX A;  2ZM8 A;  1BT5 A;  5EOO A;  2FFF B;  3HUM A;  2Y2N A;  3PAE A;  4DE3 A;  3PBQ A;  3IHA A;  3SS4 A;  4E3L A;  2Y4A A;  4DXB A;  2Z2M B;  1E3U D;  4OVD A;  2WKH A;  3V3S A;  3GTC A;  4DRT A;  1XGI A;  1PWG A;  1K4E A;  3BFE A;  4KQQ A;  4RX3 A;  4X69 A;  3B3X A;  1BLP A;  3IQA A;  1PW8 A;  2ZC6 B;  5EE8 A;  1KE0 A;  5AQA A;  5KZH A;  2QZ6 A;  4O7D A;  2CC1 A;  4EWF A;  1NXY A;  3ZG0 A;  1NY0 A;  3PBR A;  4Y0O A;  5FAQ A;  4PPR A;  3NCK A;  4EBL A;  2XGN A;  1E4D A;  3BYD A;  1K25 A;  1JWZ A;  3LY4 A;  4E3I A;  3N8S A;  3RXW A;  4KG2 A;  4U0T A;  5J8X A;  1W79 A;  5TR7 A;  1MY8 A;  4R3J A;  1XP4 A;  4LV0 A;  2DRW A;  3IWI A;  4K0W A;  4QB8 A;  3ZVW A;  2Y2I A;  1N4O A;  1JVJ A;  4C6Y A;  4KZB A;  2IWD A;  4KEN B;  3UE3 A;  2VGK A;  1PYY A;  1WYC A;  2WGW B;  3RXX A;  2ZC3 B;  4HBT A;  3BFD A;  2Y55 A;  2Z2L B;  3G34 A;  3WRZ A;  1DJB A;  1K6R A;  4WMC D;  5A91 A;  3IXH A;  4JXS A;  1U60 A;  2XLN A;  4M3K A;  1TDL A;  4UA9 A;  2PU2 A;  5EEC A;  3VSK A;  4JF6 A;  1XKZ A;  5FQQ A;  2JE5 A;  4GN2 A;  3OPL A;  5FI7 A;  4WEK A;  5E2E A;  5L2F A;  2WK0 A;  4MBF A;  3M2J A;  1RGZ A;  2P9V B;  3HUO A;  2ZLY A;  3MBZ A;  4DE0 A;  1HZO A;  1K6S A;  3RJU A;  3ZNT A;  3ITA A;  5GLD A;  1E25 A;  3A3F A;  4OP5 A;  5E2H A;  2IWB A;  3PBS A;  2JC7 A;  3O87 A;  4DKI A;  3MKF A;  3MXR A;  5GHZ A;  3N7W A;  3ZG8 B;  3BLM A;  3GR2 A;  5M19 A;  4GNU A;  4MBK A;  3ITB A;  4KZ7 A;  1KGE A;  3GSG A;  5KSH A;  2R9W A;  1JTG A;  3S4X A;  4PM8 A;  3C4P A;  3C7U A;  3AGF A;  1K54 A;  3PTE A;  3NBL A;  1BUE A;  4ZDX A;  5E2G A;  1NJ4 A;  2ZQD A;  3GQZ A;  4JPM A;  5CHJ A;  3JYI A;  1EWZ A;  5CHU A;  4OQI A;  1OME A;  4JBF A;  4C75 A;  2H0T A;  3Q07 A;  4LCM A;  3OC2 A;  1PIO A;  2WKI A;  4S2O A;  2Y2O A;  2QMI A;  1K55 A;  4N9K A;  2X01 A;  5KSC A;  3BEC A;  3HL9 A;  4JXW A;  1RGY A;  4OQH A;  2EX9 A;  1ES5 A;  2H5S A;  2WAD A;  3IH8 A;  3UPN A;  2WAF A;  4JKT A;  3OZH A;  4OLG A;  3ZHH A;  3WS5 A;  3VFF A;  4DDS A;  4R4S A;  1BSG A;  1Y54 A;  1K4F A;  1FSW A;  4YFM A;  4BLM A;  4LV2 A;  3SH9 A;  3UNW A;  4R3B A;  1VM1 A;  2WGW A;  2V2F F;  4QU3 A;  2XD1 A;  3WS2 A;  4EBN A;  5DVA A;  3QNB A;  4IVK A;  1KDW A;  1IKI A;  1CEF A;  4UA6 A;  3UDI A;  5CER A;  1QME A;  3M6B A;  2E8I A;  2HPB A;  1YT4 A;  3D4F A;  1YLT A;  2WKE A;  5DTK A;  3FKW A;  5U47 A;  3Q7V B;  1VQQ A;  2XH9 A;  3WRT A;  2V20 A;  3IWO A;  3Q82 A;  1DJA A;  1HD8 A;  2J8Y A;  3G4P A;  1GHI A;  5EOE A;  1SKF A;  1K54 C;  2UWX A;  2Y2M A;  1LL9 A;  4IBX A;  1ES2 A;  1FOF A;  4EBP A;  4N1X A;  4HES A;  1JWV A;  4UA7 A;  1S6R A;  2X02 A;  1TEM A;  1YMS A;  1YLZ A;  1K55 C;  1GA9 A;  5FSR A;  3E2K A;  3FZC A;  4Q8I A;  4KZ4 A;  3UPO A;  1L0E A;  5DTS A;  3EQU A;  1FSY A;  4GOG A;  3G32 A;  3WWX A;  4PM9 A;  3SH8 A;  1KE3 A;  2ZD8 A;  2Y91 A;  3PBO A;  4NET A;  2HP5 A;  1LI9 A;  4DXC A;  4OQG A;  3N8L A;  1XGJ A;  5DF9 A;  5FI6 A;  2XDM A;  4KG6 A;  2DNS A;  3MFD A;  4OPQ A;  1NYY A;  4LEN A;  4F94 A;  4S2L A;  1RP5 A;  3S1Y A;  1SCW A;  2ZQ8 A;  3ZFZ A;  4KG5 A;  3E2L A;  3C4O A;  3HLG A;  1PI4 A;  1MBL A;  5CTN A;  4ZBE A;  1YM1 A;  4S2K A;  2OV5 A;  2FFY A;  3LO7 A;  3MZF A;  1HVB A;  1FCM A;  3W8K A;  2I72 A;  4EUZ A;  1L0G A;  5EVI A;  1ZG4 A;  3IF6 A;  3W4O A;  1KGF A;  3FYZ A;  1S0W A;  1AXB A;  1NZO A;  4OPZ A;  3VP2 A;  5GLB A;  4Y0T A;  3G30 A;  1ESU A;  3FKV A;  1PZO A;  1TDG A;  3G35 A;  2R9X A;  3W4Q A;  5TFQ A;  1XPB A;  3Q7Z A;  2RCX A;  5DTT A;  3OPH A;  1GHM A;  2ZQC A;  3BLS A;  2ZQ7 A;  5FAT A;  2XF3 A;  3N4I A;  4B4Z A;  2PBY A;  5EVI D;  4EQI A;  3ZDJ A;  3NIA A;  1BLH A;  2ZC5 B;  4FCF A;  4JLF A;  4NK3 A;  4E6W A;  2EX8 A;  2H0Y A;  5F82 A;  2WUQ A;  3TSG A;  3V3R A;  1GA0 A;  1XA7 A;  2GDN A;  5HAP A;  3CG5 A;  1NRF A;  3WS1 A;  1M40 A;  2ZJ9 A;  5AQB A;  2XK1 A;  4OPY A;  3HLB A;  1LLB A;  4DF6 A;  4GD8 A;  1PWC A;  2Y2J A;  2J9O A;  3IF5 A;  5BOH A;  4ID4 A;  4WYY A;  1YLP A;  1M6K A;  4HBU A;  4WBG A;  4OOL A;  3CJM A;  4X56 A;  3HVF A;  2WYX A;  3OCN A;  4XUX A;  3IT9 A;  4YIN A;  3A3I A;  4ZAM A;  4QY5 A;  1O7E A;  2G2U A;  3ZGA B;  2XD5 A;  3IF6 C;  5EVI C;  5M1A A;  1W7F A;  1KVM A;  4Z9Q A;  4GDN A;  4QJG A;  2A49 A;  5FAP A;  1SHV A;  1ZC2 A;  5D3O A;  3Q81 A;  5A90 A;  1NYM A;  4JXG A;  4BL2 A;  4S2I A;  1W8Y A;  2Y2H A;  3SS5 A;  1I2W A;  4OPR A;  4GDB A;  5EUA A;  1Z6F A;  4X53 A;  5E43 A;  4KZ3 A;  3A3J A;  3BFG A;  4KZ6 A;  1HTZ A;  3P09 A;  2J7V A;  3GV9 A;  3WS4 A;  3SS3 A;  4GB7 A;  3HLC A;  5F83 A;  5HW3 A;  3HLW A;  5JYO A;  2HDU A;  4P85 A;  4WEJ A;  4QHC A;  3HLD A;  1LL5 A;  4EV4 A;  1FCO A;  5FQI A;  4S2M A;  1H8Y A;  4OQ0 A;  5CRF A;  4RA7 A;  3ZG7 B;  1Q2Q A;  4WZ5 A;  4S2J A;  2Q9M A;  2HP9 A;  3PBT A;  5FQ9 A;  4ZJ3 A;  4OP8 A;  3I7J A;  1L2S A;  1YQS A;  2XQZ A;  2Y2Q A;  4FSF A;  4FD8 A;  1XA1 A;  5GHX A;  3BEB A;  4DE1 A;  3P98 A;  2XR0 A;  2WGI A;  3G2Z A;  3LY3 A;  1BLC A;  5HX9 A;  3UN7 A;  3VP0 A;  5KMW A;  1SDN A;  3AGD A;  2BLS A;  1MXO A;  1L0D A;  3QHY A;  4Y0U A;  5AQ7 A;  4E3O A;  2EXB A;  3TOI A;  3MZD A;  2B5R A;  1MWR A;  3MZE A;  1ERQ A;  2X71 A;  3NY4 A;  3UY6 A;  4DDY A;  1DJC A;  1GHP A;  2H10 A;  4GKU A;  4FH4 A;  2EX6 A;  1BUL A;  2P9V A;  5CED A;  3IXB A;  2Y2P A;  3O88 A;  1MKI A;  2OLV A;  5HFO A;  3SH7 A;  1RCJ A;  4Y7P A;  3VFH A;  3HUN A;  1K57 A;  1O07 A;  4WM9 A;  3S22 A;  3ZNY A;  5I94 A;  1ONG A;  1ERM A;  4JF4 A;  4XUZ A;  3LCE A;  2Y2K A;  5CHM A;  4P87 A;  1BZA A;  3FV7 A;  1H5X A;  5F1F A;  4JF5 A;  1BLS A;  3VSL A;  3OCL A;  3GVB A;  2EFU A;  4WZ5 C;  3UDF A;  5FQM A;  1GCE A;  3VOZ A;  1MWU A;  5FI2 A;  3PBN A;  4RYE A;  4LCL A;  5FQJ A;  1NZU A;  2RL3 A;  5HAI A;  4MLL A;  3O3V A;  1BTL A;  3IXG A;  4WEL A;  3FWL A;  3VMA A;  1LI0 A;  5GLC A;  2HDQ A;  2ZQA A;  3GMW A;  5HAQ A;  3LEZ A;  5E2F A;  5FQK A;  3VP1 A;  2XFT A;  4XXR A;  3VOY A;  3MKE A;  1KVL A;  4QD4 A;  2P74 A;  3ZG5 A;  4R23 A;  5GL9 A;  3Q1F A;  4A5R A;  1L0F A;  2ZM2 A;  2Q9N A;  1KDS A;  3CZD A;  4IED A;  5FA7 A;  4BQM A;  3N8R A;  4N1H A;  3IHB A;  5HL1 A;  4MBH A;  1FQG A;  3BFC A;  2BG1 A;  4ZJ1 A;  1EI5 A;  4CPK A;  1C3B A;  4DE2 A;  4UAA A;  2XEP A;  3M6H A;  1K57 C;  3ZG9 B;  4BD1 A;  4WMC A;  4X55 A;  3BFF A;  3PAG A;  4OH0 A;  5CTM A;  1SDE A;  4ZTK A;  4X68 A;  2J9P A;  4BL3 A;  3GRJ A;  4KQO A;  3VP3 A;  4GZB A;  4RX2 A;  3Q7V A;  4B88 A;  1ZKJ A;  4ZJ2 A;  5CEB A;  5CXW A;  1YMX A;  1YLJ A;  3ISG A;  3N6I A;  5TGF A;  4OLD A;  2WGV A;  4UHU A;  4GD6 A;  3UO9 A;  5JYP A;  3UE1 A;  1I2S A;  5CGW A;  1MPL A;  2IWC A;  5GLA A;  5G18 A;  4S2N A;  3NC8 A;  1K56 A;  3C5A A;  3DWK A;  4CJN A;  2VGJ A;  5GHY A;  4U3T A;  1G68 A;  3BM6 A;  4K91 A;  2JBF A;  1J9M A;  1WE4 A;  2EX2 A;  3A3E A;  1ALQ A;  2QPN A;  2Y2L A;  1LHY A;  4OOM A;  3A3D A;  4PM6 A;  2ZMA A;  3EQV A;  4U0X A;  1FCN A;  5FAS A;  4HEF A;  1FR1 A;  4E6X A;  4IVI A;  4R1G A;  1KE4 A;  4KZ8 A;  5DF8 A;  4BEN A;  4KQR A;  2WZZ A;  3QNC A;  1CI8 A;  1FR6 A;  4E3J A;  4H8R A;  1K38 A;  4D2O A;  4K0X A;  3DW0 A;  4RVA A;  4QY6 A;  1W5D A;  1ES4 A;  2A3U A;  4E3K A;  2XFS A;  3G2Y A;  5HAR A;  1YLY A;  1MWS A;  3ZCZ A;  1KGG A;  3C7V A;  5F1G A;  4PM5 A;  4MNR A;  1K56 D;  2HDS A;  2OLU A;  1ES3 A;  2JCH A;  1IYO A;  4JXV A;  1QMF A;  1IEM A;  2PU4 A;  1CI9 A;  2ZC4 B;  1DY6 A;  3UDX A;  1IYP A;  1ESI A;  2HDR A;  1I5Q A;  2OSU A;  2ZC7 A;  4R4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...