5KSCA

E166a/r274n/r276n toho-1 beta-lactamase aztreonam acyl-enzyme intermediate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kscA00
1VQQA 2Y2IA 1IYOA 1LL5A 4K0WA 2OLVA 4RX2A 3PBOA 5CGWA 1FQGA 5AQ7A 3UPPA 4Y0TA 4WYYA 3HVFA 5HL1A 3CG5A 3IQAA 1ZG4A 4WBGA 4HESA 2WGIA 2G2UA 4PM9A 2WGWA 3A3IA 5EE8A 1ZC2A 4KQOA 5FQIA 2XR0A 4P6BA 4JF6A 4OQHA 2HP5A 4B4ZA 3V5MA 4HBUA 3I7JA 5JYOA 4C75A 1DJCA 2WGWB 3B3XA 2V20A 1NXYA 2RCXA 1H8ZA 1I5QA 3ISGA 4HBTA 1XGJA 1LI0A 1YLTA 3LY4A 2R9WA 4UAAA 5TGFA 4FH4A 4X55A 4EV4A 1VM1A 5E2FA 1MKIA 3S4XA 2ZQAA 4DE0A 2XFTA 4KZ5A 4S2JA 3BLMA 3VMAA 3DW0A 4CPKA 2WKEA 4R1GA 4OVDA 4NETA 5FQMA 4XXRA 4JBFA 1FR6A 3UN7A 2XGNA 2XLNA 3AGEA 3PAEA 4O7DA 4GKUA 5TFQA 5E43A 3RJUA 1Q2PA 3DTMA 1YLYA 4UHUA 4KZ9A 3IWIA 5CGXA 1S6RA 1CI9A 1W5DA 5EOOA 5CEDA 2VGJA 3BYDA 1JWVA 4ZJ3A 1SDNA 2Y2QA 2ZQDA 3VFFA 3UNWA 3SS5A 4LV3A 1SDEA 4E3OA 1XA1A 3G2ZA 4YFMA 1XA7A 2OSUA 2XD5A 3BM6A 3TOIA 4FD8A 3SS3A 1E25A 3Q7VA 3SS4A 2Y2NA 3C4OA 4JXWA 1OMEA 3FWLA 4JXSA 2ZQ8A 3A3JA 5FA7A 3M6HA 3IHAA 1PIOA 3AGDA 2J9OA 3EQUA 1CI8A 3N8RA 1XGIA 3C7VA 3P98A 4E6WA 1GA9A 4R3JA 5HW3A 5FI6A 4DRTA 1KGEA 4B4XA 1YQSA 4P87A 2E8IA 4PM7A 3MXSA 4R0QA 1XPBA 5CTNA 2OLUA 1W8QA 2WGVA 3N6IA 3PBNA 4KG2A 4OPRA 3ZNYA 1Z6FA 4JXGA 1K4EA 1DJAA 1FCMA 1ONGA 2ZQ9A 4OH0A 1HTZA 2J7VA 2DCFA 2Z2LB 2HDRA 3BFGA 4OQ0A 4FCFA 3UE3A 3ZG9B 4DDYA 1K56D 1YLJA 3OPPA 1KDSA 3ZG0A 1NJ4A 1ERMA 2J9PA 3IH8A 3EQVA 5M1AA 5J8XA 1MWUA 1EWZA 1H8YA 3UE1A 3MBZA 1KVMA 5FI2A 5FSRA 4WELA 4BL2A 1BSGA 4S2IA 5DTSA 4EWFA 1S0WA 3WS5A 1RCJA 5F1GA 2ZC7A 2EFUA 2HPBA 2PBYA 5CEBA 4EQIA 4QU3A 3NCKA 4N9LA 4BLMA 1KDWA 5F1FA 3ITAA 3ZHHA 3BFEA 4X69A 2Q9MA 4C3QA 1RP5A 4KZ8A 5FAQA 3HUMA 2HP9A 4ZTKA 1LL9A 4B88A 5M18A 3FV7A 3VOYA 3PTEA 4GNUA 3NI9A 3UDIA 4JLFA 5KSCA 3O87A 1K54A 4LCLA 1IELA 1NYYA 3HLFA 3NC8A 1HD8A 1M6KA 2CC1A 3GMWA 4E3JA 4KQQA 4KQRA 5U47A 4PMAA 1DY6A 1IYQA 3G32A 4IBXA 2C6WB 1SKFA 3N8LA 4KG6A 1YMXA 5HAQA 1EROA 3HUNA 3MXRA 5FQKA 4D2OA 2XH9A 2XD1A 2PU2A 3HLCA 3HL9A 4BJPA 5CRFA 3BFCA 3IXGA 5CHMA 1L0GA 3UDFA 3M2JA 1ESUA 4LV1A 4KG5A 1WYCA 5HARA 1C3BA 5A90A 2Y2KA 2WAEA 4K0XA 4P0MA 3IXDA 4OPQA 1AXBA 3HLWA 1JTGA 4BD0A 3PBTA 4GD6A 4OPZA 1XKZA 4MLLA 2ZLYA 2EX2A 2ZC4B 4GD8A 4DDSA 1XX2A 1MWRA 1KE0A 3OPLA 5CHJA 5EECA 4U0TA 5E2EA 2IWBA 1ES2A 1W7FA 3MFDA 3UO9A 4LCMA 4WZ4A 5AQ9A 2V1ZA 3N7WA 5GLCA 4RX3A 2DRWA 4GB7A 4MBKA 5GL9A 3UPNA 2XEPA 3DWZA 1W8YA 2X01A 1JTDA 5FATA 5L2FA 5E2GA 1WE4A 5FAPA 4FH2A 3G30A 1IYPA 4MEZA 3ZG5A 3WRZA 1CK3A 1TEMA 1XXMA 3M2KA 4X68A 5FASA 4S2NC 3S1YA 1CEGA 3PAGA 3OCLA 2WUQA 3SH8A 2ZC3B 3AGFA 4OONA 4N92A 4KZAA 4KZBA 1L0DA 4R4SA 4X53A 1ZKJA 4Y0OA 5KZHA 1KGGA 2RL3A 3G2YA 1MBLA 5GHYA 2H10A 2X71A 5E2HA 1YM1A 2H5SA 2ZC5B 1KE4A 2FFFB 5EVLA 5CERA 4OKPA 1NRFA 3W4QA 4S2KA 1ALQA 4QJGA 1MXOA 3WS2A 2QMIA 3ZFZA 4HEFA 4S2PA 3O88A 1TDLA 4QD4A 4WMCD 1K54C 1PWGA 4OP5A 5F83A 4GDBA 1NZUA 1ONHA 3GSGA 4WEKA 5BOHA 5GLBA 1H5XA 2IWDA 3OCNA 1K6SA 3Q7VB 5HX9A 5HAPA 4X56A 3O86A 4YINA 3MZDA 1I2SA 4WMCA 4X6TA 1PZPA 5EVID 3NDEA 1RGZA 1GCEA 1IYSA 1PW1A 2Y2JA 1E3UD 2ZM0A 3SOIA 4ZJ2A 3BRMA 3UDXA 1M40A 1MWTA 3OPHA 3IXBA 5KMWA 4PM6A 3A3DA 3ZG8B 4N1HA 3GTCA 1FCOA 1WYBA 4GZBA 1NYMA 1BTLA 1PI5A 5FI7A 2Y2PA 5HAIA 3BLSA 3HLBA 1PZOA 4IVKA 1K56A 4GOGA 1PYYA 1G6AA 1K4FA 2EX9A 3NDGA 5M19A 2ZMAA 3Q1FA 1O7EA 3E2KA 4DXCA 4S2NA 1IEMA 4E6XA 3OPRA 3Q81A 4RYEA 5FQQA 4E3KA 1PW8A 1BULA 5DF9A 1N9BA 4LV0A 4CJNA 2Z2MB 2Y4AA 4L0LA 5TR7A 3O3VA 1G68A 4F94A 2P74A 4OPYA 5I94A 2HDQA 3V50A 5GLAA 1KE3A 4QHCA 4KZ4A 4JXVA 4OOMA 1RGYA 3OZHA 1K6RA 3HLEA 1IKIA 3Q7ZA 4N1XA 4BQMA 2FFYA 3IWOA 4ZJ1A 3GRJA 4NK3A 2WKIA 2XDMA 1L0FA 4E3LA 3WS4A 2HDUA 3RXWA 4Q8IA 4XUZA 4UA6A 2IWCA 3E2LA 3ZNTA 5DVAA 3LCEA 4WEJA 3C5AA 4ZDXA 3NBLA 1JWZA 3W4PA 4P85A 1Y54A 2WK0A 5AQAA 1FR1A 3BEBA 3G35A 2XK1A 3W4OA 3UY6A 1GHPA 4GDNA 4WZ5C 3IF6C 5G18A 5GLDA 4R3BA 3GVBA 4UA9A 4BD1A 4ZBEA 2Q9NA 2Y55A 2XFSA 4EUZA 5DF7A 1O07A 4KZ3A 4U3TA 1XP4A 4EBPA 4BL3A 3VP1A 5A92A 1K57C 4S2MA 5IHVA 3CJMA 3VOZA 3ZVWA 4ID4A 3UE0A 2ZM2A 1YLWA 3FYZA 4RVAA 4MBHA 1HVBA 5KSHA 4S2LA 2JE5A 2Y2HA 5CXWA 5GHXA 2ZQ7A 1JWPA 1QMEA 3N8SA 4DXBA 5EVIC 4EBNA 1E4DA 2A49A 3VP4A 3S22A 3VP2A 3WS1A 1SHVA 1GHMA 1W79A 3CZDA 3MZFA 1NZOA 3FZCA 4LENA 1PI4A 2A3UA 3Q07A 3Q82A 1GA0A 2G2WA 3BECA 4QB8A 2WKHA 3V3RA 3LEZA 1LI9A 2XQZA 4H8RA 2OV5A 3M6BA 5DTKA 1ESIA 3G31A 3N4IA 4ZAMA 1ES3A 3PBRA 4RA7A 1I2WA 5CECA 1BLHA 1EI5A 3D4FA 3HBRA 4M3KA 3QNBA 1MY8A 3SH9A 3BFDA 5A93A 4Z9QA 4JPMA 1BLSA 3C4PA 1YMSA 1MWSA 1BZAA 2I72A 2ZJ9A 3HUOA 4LV2A 3W8KA 5A91A 2V2FF 3TSGA 1BLPA 1JVJA 3A3FA 1K38A 2Y2GA 1QMFA 3VFHA 2JBFA 5EOEA 2B5RA 4K91A 4Y0UA 4DE1A 5DTTA 5GHZA 3IT9A 4WM9A 3HLGA 4Y7PA 5JYPA 1FSWA 3BFFA 5FQ9A 1KGFA 1ES5A 1IKGA 3G34A 4IVIA 4GN2A 4WZ5A 2HP6A 3IF6A 4OOLA 2QPNA 2WADA 3IH9A 1K55C 3VSKA 4KZ6A 4PPRA 4A5RA 1K57A 4KENB 4OQGA 3ITBA 2JCHA 4MNRA 3V3SA 5HFOA 2BG1A 3MZEA 4OQIA 1Q2QA 3IF6B 5FQJA 1KVLA 3MKFA 2C5WB 1CEFA 3TG9A 4OLDA 5EVIA 2WZXA 2EFXA 3IHBA 2UWXA 1ERQA 4DKIA 1J9MA 1MPLA 1E3UA 2Y59A 1ZG6A 4E3MA 3ZGAB 5D3OA 1YT4A 4R4RA 4JF4A 2J8YA 5AQBA 3FKVA 2Y2OA 3IWQA 1TDGA 2H0TA 3GV9A 3ZVTA 5EVIB 2WAFA 3PBSA 4N9KA 1L2SA 2EX8A 3G4PA 3SH7A 4MBFA 4E3IA 3GR2A 1BLCA 3QHYA 2EXBA 5DF8A 3VSLA 3OC2A 3ZCZA 4S2OA 3C7UA 3HREA 1SCWA 1BUEA 3VP0A 3WS0A 3IXHA 4OLGA 4PM8A 4DE2A 1HZOA 1FOFA 2PU4A 2GDNA 3WWXA 3HLDA 5CGSA 3CMZA 4KZ7A 1ES4A 1L0EA 3A3EA 1GHIA 2DNSA 2EX6A 1BT5A 4U0XA 1U60A 3QNCA 2P9VA 3PBQA 1YLPA 3MKEA 2EXAA 2QZ6A 1NY0A 3GQZA 2Y2LA 3V39A 2VGKA 5CHUA 3IF5A 4QY6A 5F82A 3ZDJA 4DF6A 4JKTA 3NIAA 2X02A 1N4OA 2BLSA 3DWKA 5CTMA 3NY4A 3JYIA 1K55A 2P9VB 4IBRA 3ZG7B 2Y91A 5FDHA 2XF3A 4QY5A 4R23A 5FAOA 4OOYA 4C6YA 4IEDA 1PWCA 3WRTA 2ZC6B 3P09A 2ZM8A 5EPHA 4E3NA 4FSFA 4DE3A 1FSYA 2H0YA 2R9XA 2WZZA 2ZD8A 3LO7A 1LHYA 3LY3A 1K25A 1FCNA 1DJBA 4UA7A 3FKWA 2HDSA 4JF5A 2JC7A 1PWDA 4EBLA 4OP8A 3RXXA 4PM5A 1YLZA 3VP3A 2Y2MA 3UPOA 2ZQCA 1LLBA 5EUAA 4BENA 2WYXA 1TVFA 4XUXA
chains in the Genus database with same CATH superfamily
1UWPX 1IYOA 4RX2A 3FC7A 1FQGA 2P7JA 3UPPA 3IS2B 4IUKA 2WGWA 5HPFA 3E0YA 4PHTA 4B4ZA 2MJ6A 3L9KA 2NUPC 5DKKA 4HBUA 3I7JA 1MZUA 5JYOA 4IUHA 2WGWB 3B3XA 1NXYA 1CJFA 1XGJA 2O9CA 3LY4A 3V67A 4EV4A 5FEFA 3DW0A 4CPKA 2WKEA 4MN7A 2XGNA 3AGEA 4O7DA 4GKUA 3RJUA 2PHYA 3DTMA 4UHUA 5CGXA 1S6RA 1W5DA 3BYDA 4ZJ3A 2J3WA 4YNRA 2NUTC 3UNWA 3SS5A 4LV3A 4YFMA 1XA7A 2OSUA 1F2KA 4FOFA 3Q7VA 3U2AA 3SS4A 5FL3A 4JXSA 2Y8HA 1D7EA 3M6HA 3S7OA 2LB9A 1PNEA 1CI8A 3BY8A 1T1CA 4E6WA 3P98A 1F5MA 5I5LA 3NHQA 2E8IA 3IX3A 1W8QA 3N6IA 1ONGA 1OTIA 1LSWA 2Z2LB 4OQ0A 4FCFA 4UQIS 3GECA 4NXFA 5DFYA 1MWUA 4D60A 4GHIA 4BL2A 1BSGA 4S2IA 5HWTA 5AJGA 2PD7A 2EFUA 2HPBA 2P08A 4GHIB 2PD8A 4JGOA 4R70A 4BLMA 2Q9MA 1RP5A 5FAQA 1KOUA 1FIKA 1IFQA 3VOYA 2XSSA 1LT0A 3BQAA 3HLFA 3D9YA 1HD8A 1XJ2A 1EW0A 4KG6A 1YMXA 5HAQA 3MXRA 2V8CA 2XD1A 3T12B 1XJ6A 3HL9A 3M2JA 3A0SA 5HARA 1C3BA 5A90A 3IXDA 4NEED 3HLWA 1F9IA 5IT5A 4MLLA 1YAXA 2W3EA 4GD8A 3KO6A 5CHJA 2IWBA 4I38A 5E2EA 3UO9A 1ES2A 4LCMA 4WZ4A 2V1ZA 3BW6A 4GB7A 2XEPA 2QKPA 2X01A 3IBJA 5E2GA 5HZHA 5FAPA 5A8BA 4MEZA 3LIFA 3ZG5A 2D02A 5F69A 1TEMA 1XXMA 3M2KA 4X68A 5FASA 2WUQA 3SH8A 2ZC3B 4KZAA 2JKRI 4HJ6A 5KZHA 5GHYA 2H10A 2X71A 5EVLA 3W4QA 5CERA 4S2KA 3MR0A 2BASA 1TDLA 1NZUA 4WEKA 5GLBA 5HX9A 5HAPA 4I3AA 1I2SA 3ICYA 4ETXA 4NXEA 3MMHA 4X6TA 4O8GA 3NDEA 1GCEA 2Y2JA 2ZM0A 5L8MA 4ZJ2A 1M40A 5MC7A 2ZMFA 4PM6A 2KDKA 5FI7A 3BLSA 3UB8A 1K56A 1PYYA 3LIAA 3BQ8A 5M19A 3RFBA 4E3KA 2Y4AA 4L0LA 4WF0A 5TR7A 1DP6A 2P74A 5I94A 4NXBA 4OOMA 3QP8A 1RGYA 4N1XA 4B9OA 3GRJA 4NK3A 3RXWA 2EWVA 3EEAA 4Q8IA 3B47A 2IWCA 3E2LA 5EM1A 2OWHA 3DTKA 3W4PA 1NRJA 1Y54A 5AQAA 1FR1A 5FEGA 3UY6A 5GLDA 3HCYA 3IF6C 2Y55A 1XP4A 1S66L 3CJMA 4ID4A 4MBHA 3TJZC 1HVBA 2JE5A 5GHXA 2ZQ7A 1JWPA 1QMEA 3N8SA 1E4DA 2A49A 3VP2A 1SHVA 2ACGA 3MZFA 3T4TA 3FZCA 1OPXA 1PI4A 4EW7A 4QB8A 2WKHA 4H8RA 3VOLA 1ESIA 1I2WA 4HI4A 4M3KA 3QNBA 2HZ5A 5A93A 1SZVA 4JPMA 1BLSA 1MWSA 1BZAA 3HUOA 3W8KA 1JVJA 5EOEA 2VEAA 4DE1A 1GSWA 5GHZA 2KX6A 3G34A 1IKGA 4WZ5A 4OOLA 3JVUA 3IH9A 3VSKA 4KZ6A 1PFLA 4OQGA 3ITBA 4NXGA 3V3SA 3E98A 5FQJA 3VE4A 2C5WB 4I3JA 5EVIA 2PAVP 2WZXA 3TG9A 2EFXA 2UWXA 3FPWA 4ZRRA 4E3MA 1YT4A 1F98A 2J8YA 4JF4A 5IU1A 3FKVA 1TDGA 2H0TA 2J80A 2LB5A 5EVIB 4EEUA 4LGWA 1S4RA 5HDCA 3GR2A 3MXQA 3VSLA 4S2OA 1N9LA 3IXHA 4PM8A 4DE2A 4I5SA 4KZ7A 3HJIA 1CF0A 1ES4A 3R7WA 4BBVA 1DP8A 3A0VA 1BT5A 3PBQA 1S1YA 3FPVA 1YLPA 3MKEA 2VGKA 5CHUA 3IF5A 4ME4A 5F82A 3R7WB 4JKTA 3S7NA 2BLSA 3CAXA 3ZG7B 5FDHA 4QY5A 4R23A 5FAOA 4OOYA 3WRTA 4E3NA 4FSFA 4HQAA 2R9XA 3LY3A 1LHYA 1K25A 4QPRA 1FCNA 4EBLA 3S7QA 3E4QA 4UQIM 3VP3A 3UPOA 5EUAA 2WYXA 1P9WA 2Y2IA 5AQ7A 3PHYA 5HL1A 3HVFA 3CG5A 1ZG4A 4WBGA 2WGIA 2QYBA 2G2UA 3PXPA 4PM9A 2DMWA 3A3IA 5EE8A 1ZC2A 3GDIA 4JF6A 3EOIA 4HY8A 4C75A 1STZA 1H8ZA 4HBTA 2EWWA 3JVVA 3UB7A 4X55A 3EGXC 5L10A 1MKIA 2ZQAA 4GCZA 2XFTA 3C8CA 4NETA 3UN7A 5HD5A 5E43A 4KZ9A 3IWIA 1OT6A 1JWVA 2YKHA 3H82A 1SDEA 4E3OA 1XA1A 3QP1A 3TOIA 3SS3A 3HJKA 2Y2NA 3H82B 1OMEA 2Z6CA 3A3JA 5FA7A 1PIOA 2YKFA 5DKLA 1G5UA 4P6ZS 3TRCA 1XGIA 3C7VA 4Y13A 3K2NA 4DRTA 1J3WA 3OBFA 2B02A 5F5YA 2O0YA 3LI8A 4KG2A 2WGVA 3PBNA 1Z6FA 4JXGA 1DJAA 4II7A 2DCFA 3UE3A 1YLJA 3OPPA 2VA0A 2KLIA 2J9PA 5M1AA 5J8XA 1H8YA 2L4RA 3MBZA 1KVMA 5FI2A 4WELA 2QJ5A 3WS5A 3D72A 5F1GA 3F1PA 4Q0HA 4EQIA 5F1FA 1KDWA 2K31A 4KZ8A 1LL9A 3F1PB 3CITA 3FV7A 4BMWA 3CWFA 4X25A 4BWIA 1XFQA 2CC1A 1V9ZA 3T4KA 4E3JA 1IYQA 4HHDA 4ESPA 1EROA 2PU2A 4Q0IA 5CRFA 3BFCA 2QHKA 2JN7A 2WAEA 3MQ0A 1N9OA 4K0XA 4OPQA 4Y17A 1AXBA 2WKRA 4BD0A 4OPZA 1XKZA 1XX2A 5J3WA 1KE0A 1W7FA 3MFDA 2FH5A 5GLCA 4RX3A 1ZTUA 3DWZA 2W3DA 1JTDA 5FATA 5L2FA 1Y4OA 1WE4A 1IYPA 1CQAA 1LSXA 4S2NC 3H9WA 4OONA 4Y0OA 1ZKJA 3G2YA 2K7SA 1YM1A 4EU0A 4QJGA 1MXOA 2QMIA 4S2PA 2O99A 5G4ZA 3EWKA 4WMCD 1K54C 4DN0A 2R78A 1PWGA 5F83A 4GDBA 3KSIA 1H5XA 3OCNA 3Q7VB 2PR5A 1AWIA 4HJ3A 1PZPA 2Z6DA 2VLGA 1IYSA 1PW1A 2INWA 4YOFA 1MWTA 3UB5P 4FTXA 3IXBA 3A3DA 4BBTA 4N1HA 1WYBA 4GZBA 3NOPC 1WA9A 1PI5A 3LICA 3BWLA 4X1MA 1T18A 4IVKA 1VEUA 2EX9A 3Q1FA 1IEMA 3OPRA 3Q81A 4EETB 1PW8A 1BULA 5DF9A 2Z2MB 4DJ2A 1VEUB 1P97A 3O3VA 3RTYA 4OPYA 2HDQA 5GLAA 1KE3A 4KZ4A 1OTEA 4JXVA 3OZHA 1IKIA 2PT7A 5DJTA 4BQMA 5KIZA 2FFYA 4CLCD 4ZJ1A 1DP9A 2WKIA 2XDMA 3WS4A 4XT2A 1H0MA 4XUZA 4WEJA 3C5AA 1S4SA 4UEYA 3PYPA 2VGLS 3W4OA 1X0OA 2VV6A 5HDSA 4BD1A 5G18A 4R3BA 4XT2B 4ZBEA 2Q9NA 1O07A 4U3TA 4EBPA 4BL3A 3VP1A 1K57C 4S2MA 2PBDP 3ZVWA 2ZM2A 3FYZA 4RVAA 3UB6A 5KSHA 2PYRA 5HDDA 4Q0JA 2ZOIA 4LPZA 3VP4A 3S22A 3WS1A 2QWSA 3G6OA 3CZDA 1NZOA 3LEQA 4LENA 3KYQA 3Q82A 4O0PA 3Q07A 3ULFA 1GA0A 2G2WA 4MN6A 3CI6A 1LI9A 2XQZA 2OV5A 3M6BA 3T4OA 3N4IA 1ES3A 3PBRA 5CECA 1BLHA 3KYEA 4LRXC 1MY8A 3KSGA 2QJ7A 1T19A 4LV2A 1ZHHB 4MN5A 3A3FA 1K38A 2Y2GA 2GX5A 1QMFA 3KSHA 2JBFA 4Y0UA 1K0KA 4WM9A 3F1OA 4LLOB 4IVIA 3CUEA 2HP6A 1K55C 4PPRA 4A5RA 4CQHA 4CLCC 5HFOA 2O9AA 4Y5FA 3MZEA 2JKFA 4OQIA 4HIAA 3MKFA 1CEFA 4OLDA 1J9MA 1MPLA 1E3UA 2Y59A 3ZGAB 2V9AA 3FG8A 4R4RA 4RQ9A 3GV9A 3ZVTA 3PBSA 4N9KA 1TS8A 3LIEA 5K5BA 2EX8A 4MBFA 2ZOHA 5DF8A 3ZCZA 2VX8A 1BUEA 3VP0A 3W2ZA 4AFIA 3DAVA 1FOFA 3HLDA 1L0EA 4L9GA 2DNSA 5J7EA 2VKSA 2P9VA 4HP9A 3GQZA 2Y2LA 3V39A 2X02A 1N4OA 3DWKA 5CTMA 3NY4A 5IS1A 2P9VB 2XF3A 3CLOA 5HWVA 1PWCA 4JGRA 4L9FA 4K08A 4DE3A 1FSYA 2WZZA 3FKWA 1P9RA 4JF5A 1PWDA 4PM5A 2Y2MA 2ZQCA 1LLBA 3B33A 3ISGA 1LL5A 5CX7A 2OLVA 4Y0TA 4WYYA 5HL6A 4HH3A 2JKTM 4OQHA 3V5MA 1DJCA 2V0WA 2RCXA 1I5QA 1YLTA 4I39A 1VM1A 2V1BA 3D3OA 4DE0A 4KZ5A 3QP4A 4S2JA 4R1GA 5FQMA 2PDRA 4JBFA 4R38A 1FR6A 2XLNA 3CPTA 5TFQA 2WKPA 2Q0OA 5EOOA 5CEDA 2VGJA 3T4QA 1SDNA 2E8JA 2Y2QA 2ZQDA 4Y3IA 2AVXA 3CPTB 3G2ZA 3BM6A 2XD5A 3C4OA 3FWLA 1XJ3A 3IHAA 3AGDA 3LIBA 2L0WA 2GZAA 5FI6A 1KGEA 1XPBA 4G3WA 1XFNA 2M7VA 4OPRA 1K4EA 2WKQA 5L09A 2HDRA 4DDYA 1K56D 5EV0A 3ZG0A 1NJ4A 1H8MA 3F1NA 3EQVA 2A2LA 4PKYA 1EWZA 3UE1A 5FSRA 1RCJA 3F1NB 2ZC7A 3T1QB 2XRNA 2PBYA 3QP6A 3NCKA 4N9LA 3IX4A 2ZL1A 4C3QA 5HSQA 3T1SA 3HUMA 2HP9A 2K2NA 3LGOA 2XROA 4B88A 1DRMA 3PTEA 4GNUA 5KSCA 3O87A 1K54A 1LSVA 3NC8A 2ZL1B 1M6KA 3GMWA 4KQRA 4QWOA 5U47A 3G32A 4IBXA 2C6WB 1SKFA 3HUNA 5FQKA 1VHMA 2V8FA 4NG2A 2XH9A 2OOLA 3IXGA 5CHMA 3DTEA 1L0GA 4KG5A 1WYCA 2Y2KA 4P0MA 4HP4A 1JTGA 3PBTA 1BYWA 4GD6A 3CHWP 2EX2A 5EECA 3OPLA 2M1CA 4U0TA 3MSHA 5AQ9A 3N7WA 2DRWA 4MBKA 5GL9A 1W8YA 4ARZA 3T4LA 4GW9A 3WRZA 1OJ5A 3S1YA 2L1MA 1CEGA 3PAGA 3OCLA 3AGFA 2HGVA 4KZBA 4R4SA 1KGGA 2RL3A 4PKYG 5E2HA 1KE4A 1YKDA 4HH2A 3MJQA 1ONHA 5BOHA 2IWDA 3NULA 1NWZA 2A24A 3MZDA 4WMCA 5EVID 1MKMA 1RGZA 3MFXA 4L9EA 3BRMA 3UDXA 4HOIA 5KMWA 3GTCA 1FCOA 1NYMA 3PR6A 2CMNA 5HAIA 2Y2PA 3HLBA 2B95A 1PZOA 2W0NA 3T4SA 2XA7S 1G6AA 1K4FA 3NDGA 1O7EA 4DXCA 3QP5A 2EA9A 5FQQA 5AVFA 1N9BA 4CJNA 1G68A 4F94A 3A0RA 2HJEA 5C5KA 2Y79A 3Q7ZA 2HJ9C 3HLEA 2PRFA 3IWOA 1SKOA 3UE6A 4E3LA 1YSPA 1Y28A 5DVAA 3LCEA 4ZDXA 3NBLA 5EFWA 4CLCA 4P85A 2WK0A 1G28A 2VK3A 3BEBA 1SKOB 3R4KA 2I9VA 4WZ5C 1GHPA 4GDNA 4IHQA 4WUJA 4UA9A 3GVBA 2XFSA 5DF7A 2UV0E 3VOZA 3IS2A 3UE0A 4S2LA 5EVIC 4EBNA 4GJ4A 4H6JA 2IA2A 1W79A 3T1XA 3BECA 2M7UA 3RH8B 3LEZA 4ETZA 4H6JB 5DTKA 4ZAMA 4RA7A 3KSFA 1EI5A 3D4FA 3HBRA 4Y15A 3SH9A 3BFDA 1W63M 4LRZE 3C4PA 2ZJ9A 2I72A 3TSGA 1T1AA 2P04A 5HWWA 3VFHA 4F3LA 4K91A 5J4EA 4EEPA 3P01A 3IF6A 2QPNA 2VV8A 2HF6A 2W3HA 4F3LB 1T1BA 2VJWA 3QP2A 3LR4A 4MNRA 1OTBA 3LR3A 2BG1A 1Q2QA 3IF6B 1KVLA 1ODVA 1VETA 3IHBA 4DKIA 2J3TD 1FILA 5AVEA 2W1RA 2Y2OA 1VB6A 5LBRA 1VETB 2WAFA 3OLOA 1OT9A 3G4PA 3SH7A 4HJ4A 4E3IA 3E4OA 3HREA 2ZMVA 1HZOA 2GDNA 3C2WA 3WWXA 5CGSA 3CMZA 2EX6A 4MCWA 2OWJA 3NIAA 5TJJA 3JYIA 2Y91A 3SW1A 1W63Q 1GSXA 4C6YA 4IEDA 2ZC6B 2ZM8A 3LO7A 4UA7A 2HDSA 4LRYC 1YLZA 1XJ4A 1TVFA 1VQQA 3V3RA 4K0WA 5CGWA 3PBOA 3IQAA 4HESA 1Z09A 3NOUC 2V1AA 4G3KA 4KQOA 5FQIA 2XR0A 4P6BA 4M4XA 2HP5A 2J3TC 5DJUA 3T1RA 2V20A 1LI0A 4UAAA 2R9WA 5TGFA 4FH4A 3BY9A 1D06A 5E2FA 3S4XA 1HLUP 3LI9A 3SZTA 2OAQ1 3BLMA 3VMAA 1UGUA 4OVDA 2B18A 4XXRA 3PAEA 1Q2PA 1YLYA 4O01A 4B93A 3H7WA 1CI9A 2OAP1 3VFFA 3H7WB 4FD8A 3VV4A 3F1OB 1E25A 4JXWA 1MC0A 2ZQ8A 3C30A 2BTFP 4WLAA 2J9OA 3EQUA 3NJAA 3KX0X 3N8RA 1GA9A 4R3JA 5HW3A 4B4XA 1YQSA 4P87A 4PM7A 3MXSA 4R0QA 5CTNA 2OLUA 4R3AA 3ZNYA 5EVEA 1FCMA 2ZQ9A 4OH0A 5DFXA 1HTZA 1UWNX 2J7VA 3ZG9B 3BFGA 1KDSA 1ERMA 3B42A 3DBAA 3IH8A 3EEHA 5G4YA 1PRQA 5DTSA 4EWFA 1S0WA 2VZWA 1TS0A 5CEBA 4QU3A 3UMEA 4P6ZM 3ITAA 3ZHHA 3BFEA 4X69A 3ZQ5A 3P7NA 4ZTKA 4LFUA 5M18A 1YSQA 3UDIA 3NI9A 4JLFA 4LCLA 1IELA 1NYYA 4KQQA 4PMAA 1DY6A 5FDSA 3N8LA 4D2OA 3HLCA 4BJPA 1V9YA 3UDFA 3C38A 1ESUA 4LV1A 1TF1A 1YPRA 2XA7M 4EQ1A 3UB9A 4WL9A 3MQOA 3LUQA 4EXOA 2ZLYA 2ZC4B 4DDSA 3DTIA 1MWRA 4R6LA 1JNUA 4PAUA 1TD5A 3UPNA 1G6OA 1ACFA 4FH2A 3G30A 3TE8A 3LR0A 1CK3A 4Z1WA 4EERA 4N92A 4X53A 1L0DA 2W27A 1MBLA 4JGQA 2H5SA 2ZC5B 2FFFB 4MDZA 4WN5A 3O5YA 1NRFA 4OKPA 1ALQA 3U4LP 3WS2A 3ZFZA 4HEFA 3LFVA 3O88A 4QD4A 1OTAA 4G3VA 3MS6A 4OP5A 3ZYTA 3GSGA 2PR6A 1K6SA 4X56A 3O86A 1D1JA 4JGPA 2GJ3A 4YINA 3JPUA 4BBUA 4KUKA 4Y2FA 4X1LA 1E3UD 3SOIA 3TW8A 3OPHA 5L07A 3ZG8B 4EESA 2V0UA 3LIDA 1BTLA 1NLYA 3MF0A 3OOVA 3NECA 2FZ0A 4GOGA 5F68A 3VE3A 4EUVA 2ZMAA 4KQDA 3E2KA 4S2NA 4E6XA 4RYEA 5EM0A 4LV0A 1TS7A 3V50A 4QHCA 3S7PA 4GS9A 1K6RA 4E04A 3MQQA 1L0FA 4GS9B 2HDUA 4UA6A 1A0KA 3ZNTA 3EGDC 1JWZA 1TS6A 3G35A 2XK1A 4I3IA 3CUEC 1IOUA 2GNXA 4EUZA 4KZ3A 5A92A 5IHVA 1YLWA 1S1ZA 4FUWA 2Y2HA 5CXWA 2HV1A 2W3FA 4DXBA 1GHMA 3NOTC 4DJ3A 1OTDA 2W1TA 2A3UA 3K3CA 4KUOA 2H28A 3G31A 2PYPA 2W1TB 4ARZB 1P0ZA 2VGLM 3LYXA 3T4JA 4Z9QA 3IBRA 1YMSA 5A91A 2V2FF 1BLPA 2B5RA 1OJGA 5DTTA 3IT9A 4Y7PA 3HLGA 4MMNA 4NKPA 5JYPA 1FSWA 3BFFA 5FQ9A 1KGFA 1ES5A 4GN2A 2WADA 3E4PA 2ZBBA 2G7UA 1K57A 4KENB 2JCHA 3IX8A 2A24B 3T50A 2VV7A 1ERQA 1ZG6A 5D3OA 5AQBA 4DMZA 3IWQA 1H3QA 1L2SA 1NLZA 2JKRM 2W3GA 3LR5A 4CLCE 1BLCA 3QHYA 2EXBA 3OC2A 5F6AA 3C7UA 1SCWA 3WS0A 1LL8A 3UMDA 1S67L 4OLGA 5TBMA 2D01A 2PU4A 3KYZA 3A3EA 1GHIA 3K3DA 4U0XA 2JKTI 1U60A 3QNCA 2KOIA 5TBMB 2EXAA 2QZ6A 1N9NA 1NY0A 4GLQA 3ZDJA 4QY6A 4DF6A 5HD3A 4HNBA 1GSVA 4YWZA 1K55A 4IBRA 2JHEA 4IJGA 3P09A 5EPHA 5HPIA 2H0YA 2ZD8A 1DJBA 2JKGA 2O9BA 2JC7A 4CLCB 3BJNA 4OP8A 3RXXA 1L3LA 3L7HA 4BENA 4XUXA
chains in the Genus database with same CATH topology
1VQQA 2Y2IA 1IYOA 1LL5A 4K0WA 2OLVA 4RX2A 3PBOA 5CGWA 1FQGA 5AQ7A 3UPPA 4Y0TA 4WYYA 3HVFA 5HL1A 3CG5A 3IQAA 1ZG4A 4WBGA 4HESA 2WGIA 2G2UA 4PM9A 2WGWA 3A3IA 5EE8A 1ZC2A 4KQOA 5FQIA 2XR0A 4P6BA 4JF6A 4OQHA 2HP5A 4B4ZA 3V5MA 4HBUA 3I7JA 5JYOA 4C75A 1DJCA 2WGWB 3B3XA 2V20A 1NXYA 2RCXA 1H8ZA 1I5QA 3ISGA 4HBTA 1XGJA 1LI0A 1YLTA 3LY4A 2R9WA 4UAAA 5TGFA 4FH4A 4X55A 4EV4A 1VM1A 5E2FA 1MKIA 3S4XA 2ZQAA 4DE0A 2XFTA 4KZ5A 4S2JA 3BLMA 3VMAA 3DW0A 4CPKA 2WKEA 4R1GA 4OVDA 4NETA 5FQMA 4XXRA 4JBFA 1FR6A 3UN7A 2XGNA 2XLNA 3AGEA 3PAEA 4O7DA 4GKUA 5TFQA 5E43A 3RJUA 1Q2PA 3DTMA 1YLYA 4UHUA 4KZ9A 3IWIA 5CGXA 1S6RA 1CI9A 1W5DA 5EOOA 5CEDA 2VGJA 3BYDA 1JWVA 4ZJ3A 1SDNA 2Y2QA 2ZQDA 3VFFA 3UNWA 3SS5A 4LV3A 1SDEA 4E3OA 1XA1A 3G2ZA 4YFMA 1XA7A 2OSUA 2XD5A 3BM6A 3TOIA 4FD8A 3SS3A 1E25A 3Q7VA 3SS4A 2Y2NA 3C4OA 4JXWA 1OMEA 3FWLA 4JXSA 2ZQ8A 3A3JA 5FA7A 3M6HA 3IHAA 1PIOA 3AGDA 2J9OA 3EQUA 1CI8A 3N8RA 1XGIA 3C7VA 3P98A 4E6WA 1GA9A 4R3JA 5HW3A 5FI6A 4DRTA 1KGEA 4B4XA 1YQSA 4P87A 2E8IA 4PM7A 3MXSA 4R0QA 1XPBA 5CTNA 2OLUA 1W8QA 2WGVA 3N6IA 3PBNA 4KG2A 4OPRA 3ZNYA 1Z6FA 4JXGA 1K4EA 1DJAA 1FCMA 1ONGA 2ZQ9A 4OH0A 1HTZA 2J7VA 2DCFA 2Z2LB 2HDRA 3BFGA 4OQ0A 4FCFA 3UE3A 3ZG9B 4DDYA 1K56D 1YLJA 3OPPA 1KDSA 3ZG0A 1NJ4A 1ERMA 2J9PA 3IH8A 3EQVA 5M1AA 5J8XA 1MWUA 1EWZA 1H8YA 3UE1A 3MBZA 1KVMA 5FI2A 5FSRA 4WELA 4BL2A 1BSGA 4S2IA 5DTSA 4EWFA 1S0WA 3WS5A 1RCJA 5F1GA 2ZC7A 2EFUA 2HPBA 2PBYA 5CEBA 4EQIA 4QU3A 3NCKA 4N9LA 4BLMA 1KDWA 5F1FA 3ITAA 3ZHHA 3BFEA 4X69A 2Q9MA 4C3QA 1RP5A 4KZ8A 5FAQA 3HUMA 2HP9A 4ZTKA 1LL9A 4B88A 5M18A 3FV7A 3VOYA 3PTEA 4GNUA 3NI9A 3UDIA 4JLFA 5KSCA 3O87A 1K54A 4LCLA 1IELA 1NYYA 3HLFA 3NC8A 1HD8A 1M6KA 2CC1A 3GMWA 4E3JA 4KQQA 4KQRA 5U47A 4PMAA 1DY6A 1IYQA 3G32A 4IBXA 2C6WB 1SKFA 3N8LA 4KG6A 1YMXA 5HAQA 1EROA 3HUNA 3MXRA 5FQKA 4D2OA 2XH9A 2XD1A 2PU2A 3HLCA 3HL9A 4BJPA 5CRFA 3BFCA 3IXGA 5CHMA 1L0GA 3UDFA 3M2JA 1ESUA 4LV1A 4KG5A 1WYCA 5HARA 1C3BA 5A90A 2Y2KA 2WAEA 4K0XA 4P0MA 3IXDA 4OPQA 1AXBA 3HLWA 1JTGA 4BD0A 3PBTA 4GD6A 4OPZA 1XKZA 4MLLA 2ZLYA 2EX2A 2ZC4B 4GD8A 4DDSA 1XX2A 1MWRA 1KE0A 3OPLA 5CHJA 5EECA 4U0TA 5E2EA 2IWBA 1ES2A 1W7FA 3MFDA 3UO9A 4LCMA 4WZ4A 5AQ9A 2V1ZA 3N7WA 5GLCA 4RX3A 2DRWA 4GB7A 4MBKA 5GL9A 3UPNA 2XEPA 3DWZA 1W8YA 2X01A 1JTDA 5FATA 5L2FA 5E2GA 1WE4A 5FAPA 4FH2A 3G30A 1IYPA 4MEZA 3ZG5A 3WRZA 1CK3A 1TEMA 1XXMA 3M2KA 4X68A 5FASA 4S2NC 3S1YA 1CEGA 3PAGA 3OCLA 2WUQA 3SH8A 2ZC3B 3AGFA 4OONA 4N92A 4KZAA 4KZBA 1L0DA 4R4SA 4X53A 1ZKJA 4Y0OA 5KZHA 1KGGA 2RL3A 3G2YA 1MBLA 5GHYA 2H10A 2X71A 5E2HA 1YM1A 2H5SA 2ZC5B 1KE4A 2FFFB 5EVLA 5CERA 4OKPA 1NRFA 3W4QA 4S2KA 1ALQA 4QJGA 1MXOA 3WS2A 2QMIA 3ZFZA 4HEFA 4S2PA 3O88A 1TDLA 4QD4A 4WMCD 1K54C 1PWGA 4OP5A 5F83A 4GDBA 1NZUA 1ONHA 3GSGA 4WEKA 5BOHA 5GLBA 1H5XA 2IWDA 3OCNA 1K6SA 3Q7VB 5HX9A 5HAPA 4X56A 3O86A 4YINA 3MZDA 1I2SA 4WMCA 4X6TA 1PZPA 5EVID 3NDEA 1RGZA 1GCEA 1IYSA 1PW1A 2Y2JA 1E3UD 2ZM0A 3SOIA 4ZJ2A 3BRMA 3UDXA 1M40A 1MWTA 3OPHA 3IXBA 5KMWA 4PM6A 3A3DA 3ZG8B 4N1HA 3GTCA 1FCOA 1WYBA 4GZBA 1NYMA 1BTLA 1PI5A 5FI7A 2Y2PA 5HAIA 3BLSA 3HLBA 1PZOA 4IVKA 1K56A 4GOGA 1PYYA 1G6AA 1K4FA 2EX9A 3NDGA 5M19A 2ZMAA 3Q1FA 1O7EA 3E2KA 4DXCA 4S2NA 1IEMA 4E6XA 3OPRA 3Q81A 4RYEA 5FQQA 4E3KA 1PW8A 1BULA 5DF9A 1N9BA 4LV0A 4CJNA 2Z2MB 2Y4AA 4L0LA 5TR7A 3O3VA 1G68A 4F94A 2P74A 4OPYA 5I94A 2HDQA 3V50A 5GLAA 1KE3A 4QHCA 4KZ4A 4JXVA 4OOMA 1RGYA 3OZHA 1K6RA 3HLEA 1IKIA 3Q7ZA 4N1XA 4BQMA 2FFYA 3IWOA 4ZJ1A 3GRJA 4NK3A 2WKIA 2XDMA 1L0FA 4E3LA 3WS4A 2HDUA 3RXWA 4Q8IA 4XUZA 4UA6A 2IWCA 3E2LA 3ZNTA 5DVAA 3LCEA 4WEJA 3C5AA 4ZDXA 3NBLA 1JWZA 3W4PA 4P85A 1Y54A 2WK0A 5AQAA 1FR1A 3BEBA 3G35A 2XK1A 3W4OA 3UY6A 1GHPA 4GDNA 4WZ5C 3IF6C 5G18A 5GLDA 4R3BA 3GVBA 4UA9A 4BD1A 4ZBEA 2Q9NA 2Y55A 2XFSA 4EUZA 5DF7A 1O07A 4KZ3A 4U3TA 1XP4A 4EBPA 4BL3A 3VP1A 5A92A 1K57C 4S2MA 5IHVA 3CJMA 3VOZA 3ZVWA 4ID4A 3UE0A 2ZM2A 1YLWA 3FYZA 4RVAA 4MBHA 1HVBA 5KSHA 4S2LA 2JE5A 2Y2HA 5CXWA 5GHXA 2ZQ7A 1JWPA 1QMEA 3N8SA 4DXBA 5EVIC 4EBNA 1E4DA 2A49A 3VP4A 3S22A 3VP2A 3WS1A 1SHVA 1GHMA 1W79A 3CZDA 3MZFA 1NZOA 3FZCA 4LENA 1PI4A 2A3UA 3Q07A 3Q82A 1GA0A 2G2WA 3BECA 4QB8A 2WKHA 3V3RA 3LEZA 1LI9A 2XQZA 4H8RA 2OV5A 3M6BA 5DTKA 1ESIA 3G31A 3N4IA 4ZAMA 1ES3A 3PBRA 4RA7A 1I2WA 5CECA 1BLHA 1EI5A 3D4FA 3HBRA 4M3KA 3QNBA 1MY8A 3SH9A 3BFDA 5A93A 4Z9QA 4JPMA 1BLSA 3C4PA 1YMSA 1MWSA 1BZAA 2I72A 2ZJ9A 3HUOA 4LV2A 3W8KA 5A91A 2V2FF 3TSGA 1BLPA 1JVJA 3A3FA 1K38A 2Y2GA 1QMFA 3VFHA 2JBFA 5EOEA 2B5RA 4K91A 4Y0UA 4DE1A 5DTTA 5GHZA 3IT9A 4WM9A 3HLGA 4Y7PA 5JYPA 1FSWA 3BFFA 5FQ9A 1KGFA 1ES5A 1IKGA 3G34A 4IVIA 4GN2A 4WZ5A 2HP6A 3IF6A 4OOLA 2QPNA 2WADA 3IH9A 1K55C 3VSKA 4KZ6A 4PPRA 4A5RA 1K57A 4KENB 4OQGA 3ITBA 2JCHA 4MNRA 3V3SA 5HFOA 2BG1A 3MZEA 4OQIA 1Q2QA 3IF6B 5FQJA 1KVLA 3MKFA 2C5WB 1CEFA 3TG9A 4OLDA 5EVIA 2WZXA 2EFXA 3IHBA 2UWXA 1ERQA 4DKIA 1J9MA 1MPLA 1E3UA 2Y59A 1ZG6A 4E3MA 3ZGAB 5D3OA 1YT4A 4R4RA 4JF4A 2J8YA 5AQBA 3FKVA 2Y2OA 3IWQA 1TDGA 2H0TA 3GV9A 3ZVTA 5EVIB 2WAFA 3PBSA 4N9KA 1L2SA 2EX8A 3G4PA 3SH7A 4MBFA 4E3IA 3GR2A 1BLCA 3QHYA 2EXBA 5DF8A 3VSLA 3OC2A 3ZCZA 4S2OA 3C7UA 3HREA 1SCWA 1BUEA 3VP0A 3WS0A 3IXHA 4OLGA 4PM8A 4DE2A 1HZOA 1FOFA 2PU4A 2GDNA 3WWXA 3HLDA 5CGSA 3CMZA 4KZ7A 1ES4A 1L0EA 3A3EA 1GHIA 2DNSA 2EX6A 1BT5A 4U0XA 1U60A 3QNCA 2P9VA 3PBQA 1YLPA 3MKEA 2EXAA 2QZ6A 1NY0A 3GQZA 2Y2LA 3V39A 2VGKA 5CHUA 3IF5A 4QY6A 5F82A 3ZDJA 4DF6A 4JKTA 3NIAA 2X02A 1N4OA 2BLSA 3DWKA 5CTMA 3NY4A 3JYIA 1K55A 2P9VB 4IBRA 3ZG7B 2Y91A 5FDHA 2XF3A 4QY5A 4R23A 5FAOA 4OOYA 4C6YA 4IEDA 1PWCA 3WRTA 2ZC6B 3P09A 2ZM8A 5EPHA 4E3NA 4FSFA 4DE3A 1FSYA 2H0YA 2R9XA 2WZZA 2ZD8A 3LO7A 1LHYA 3LY3A 1K25A 1FCNA 1DJBA 4UA7A 3FKWA 2HDSA 4JF5A 2JC7A 1PWDA 4EBLA 4OP8A 3RXXA 4PM5A 1YLZA 3VP3A 2Y2MA 3UPOA 2ZQCA 1LLBA 5EUAA 4BENA 2WYXA 1TVFA 4XUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQQ A;  2Y2I A;  1IYO A;  1LL5 A;  4K0W A;  2OLV A;  4RX2 A;  3PBO A;  5CGW A;  1FQG A;  5AQ7 A;  3UPP A;  4Y0T A;  4WYY A;  3HVF A;  5HL1 A;  3CG5 A;  3IQA A;  1ZG4 A;  4WBG A;  4HES A;  2WGI A;  2G2U A;  4PM9 A;  2WGW A;  3A3I A;  5EE8 A;  1ZC2 A;  4KQO A;  5FQI A;  2XR0 A;  4P6B A;  4JF6 A;  4OQH A;  2HP5 A;  4B4Z A;  3V5M A;  4HBU A;  3I7J A;  5JYO A;  4C75 A;  1DJC A;  2WGW B;  3B3X A;  2V20 A;  1NXY A;  2RCX A;  1H8Z A;  1I5Q A;  3ISG A;  4HBT A;  1XGJ A;  1LI0 A;  1YLT A;  3LY4 A;  2R9W A;  4UAA A;  5TGF A;  4FH4 A;  4X55 A;  4EV4 A;  1VM1 A;  5E2F A;  1MKI A;  3S4X A;  2ZQA A;  4DE0 A;  2XFT A;  4KZ5 A;  4S2J A;  3BLM A;  3VMA A;  3DW0 A;  4CPK A;  2WKE A;  4R1G A;  4OVD A;  4NET A;  5FQM A;  4XXR A;  4JBF A;  1FR6 A;  3UN7 A;  2XGN A;  2XLN A;  3AGE A;  3PAE A;  4O7D A;  4GKU A;  5TFQ A;  5E43 A;  3RJU A;  1Q2P A;  3DTM A;  1YLY A;  4UHU A;  4KZ9 A;  3IWI A;  5CGX A;  1S6R A;  1CI9 A;  1W5D A;  5EOO A;  5CED A;  2VGJ A;  3BYD A;  1JWV A;  4ZJ3 A;  1SDN A;  2Y2Q A;  2ZQD A;  3VFF A;  3UNW A;  3SS5 A;  4LV3 A;  1SDE A;  4E3O A;  1XA1 A;  3G2Z A;  4YFM A;  1XA7 A;  2OSU A;  2XD5 A;  3BM6 A;  3TOI A;  4FD8 A;  3SS3 A;  1E25 A;  3Q7V A;  3SS4 A;  2Y2N A;  3C4O A;  4JXW A;  1OME A;  3FWL A;  4JXS A;  2ZQ8 A;  3A3J A;  5FA7 A;  3M6H A;  3IHA A;  1PIO A;  3AGD A;  2J9O A;  3EQU A;  1CI8 A;  3N8R A;  1XGI A;  3C7V A;  3P98 A;  4E6W A;  1GA9 A;  4R3J A;  5HW3 A;  5FI6 A;  4DRT A;  1KGE A;  4B4X A;  1YQS A;  4P87 A;  2E8I A;  4PM7 A;  3MXS A;  4R0Q A;  1XPB A;  5CTN A;  2OLU A;  1W8Q A;  2WGV A;  3N6I A;  3PBN A;  4KG2 A;  4OPR A;  3ZNY A;  1Z6F A;  4JXG A;  1K4E A;  1DJA A;  1FCM A;  1ONG A;  2ZQ9 A;  4OH0 A;  1HTZ A;  2J7V A;  2DCF A;  2Z2L B;  2HDR A;  3BFG A;  4OQ0 A;  4FCF A;  3UE3 A;  3ZG9 B;  4DDY A;  1K56 D;  1YLJ A;  3OPP A;  1KDS A;  3ZG0 A;  1NJ4 A;  1ERM A;  2J9P A;  3IH8 A;  3EQV A;  5M1A A;  5J8X A;  1MWU A;  1EWZ A;  1H8Y A;  3UE1 A;  3MBZ A;  1KVM A;  5FI2 A;  5FSR A;  4WEL A;  4BL2 A;  1BSG A;  4S2I A;  5DTS A;  4EWF A;  1S0W A;  3WS5 A;  1RCJ A;  5F1G A;  2ZC7 A;  2EFU A;  2HPB A;  2PBY A;  5CEB A;  4EQI A;  4QU3 A;  3NCK A;  4N9L A;  4BLM A;  1KDW A;  5F1F A;  3ITA A;  3ZHH A;  3BFE A;  4X69 A;  2Q9M A;  4C3Q A;  1RP5 A;  4KZ8 A;  5FAQ A;  3HUM A;  2HP9 A;  4ZTK A;  1LL9 A;  4B88 A;  5M18 A;  3FV7 A;  3VOY A;  3PTE A;  4GNU A;  3NI9 A;  3UDI A;  4JLF A;  5KSC A;  3O87 A;  1K54 A;  4LCL A;  1IEL A;  1NYY A;  3HLF A;  3NC8 A;  1HD8 A;  1M6K A;  2CC1 A;  3GMW A;  4E3J A;  4KQQ A;  4KQR A;  5U47 A;  4PMA A;  1DY6 A;  1IYQ A;  3G32 A;  4IBX A;  2C6W B;  1SKF A;  3N8L A;  4KG6 A;  1YMX A;  5HAQ A;  1ERO A;  3HUN A;  3MXR A;  5FQK A;  4D2O A;  2XH9 A;  2XD1 A;  2PU2 A;  3HLC A;  3HL9 A;  4BJP A;  5CRF A;  3BFC A;  3IXG A;  5CHM A;  1L0G A;  3UDF A;  3M2J A;  1ESU A;  4LV1 A;  4KG5 A;  1WYC A;  5HAR A;  1C3B A;  5A90 A;  2Y2K A;  2WAE A;  4K0X A;  4P0M A;  3IXD A;  4OPQ A;  1AXB A;  3HLW A;  1JTG A;  4BD0 A;  3PBT A;  4GD6 A;  4OPZ A;  1XKZ A;  4MLL A;  2ZLY A;  2EX2 A;  2ZC4 B;  4GD8 A;  4DDS A;  1XX2 A;  1MWR A;  1KE0 A;  3OPL A;  5CHJ A;  5EEC A;  4U0T A;  5E2E A;  2IWB A;  1ES2 A;  1W7F A;  3MFD A;  3UO9 A;  4LCM A;  4WZ4 A;  5AQ9 A;  2V1Z A;  3N7W A;  5GLC A;  4RX3 A;  2DRW A;  4GB7 A;  4MBK A;  5GL9 A;  3UPN A;  2XEP A;  3DWZ A;  1W8Y A;  2X01 A;  1JTD A;  5FAT A;  5L2F A;  5E2G A;  1WE4 A;  5FAP A;  4FH2 A;  3G30 A;  1IYP A;  4MEZ A;  3ZG5 A;  3WRZ A;  1CK3 A;  1TEM A;  1XXM A;  3M2K A;  4X68 A;  5FAS A;  4S2N C;  3S1Y A;  1CEG A;  3PAG A;  3OCL A;  2WUQ A;  3SH8 A;  2ZC3 B;  3AGF A;  4OON A;  4N92 A;  4KZA A;  4KZB A;  1L0D A;  4R4S A;  4X53 A;  1ZKJ A;  4Y0O A;  5KZH A;  1KGG A;  2RL3 A;  3G2Y A;  1MBL A;  5GHY A;  2H10 A;  2X71 A;  5E2H A;  1YM1 A;  2H5S A;  2ZC5 B;  1KE4 A;  2FFF B;  5EVL A;  5CER A;  4OKP A;  1NRF A;  3W4Q A;  4S2K A;  1ALQ A;  4QJG A;  1MXO A;  3WS2 A;  2QMI A;  3ZFZ A;  4HEF A;  4S2P A;  3O88 A;  1TDL A;  4QD4 A;  4WMC D;  1K54 C;  1PWG A;  4OP5 A;  5F83 A;  4GDB A;  1NZU A;  1ONH A;  3GSG A;  4WEK A;  5BOH A;  5GLB A;  1H5X A;  2IWD A;  3OCN A;  1K6S A;  3Q7V B;  5HX9 A;  5HAP A;  4X56 A;  3O86 A;  4YIN A;  3MZD A;  1I2S A;  4WMC A;  4X6T A;  1PZP A;  5EVI D;  3NDE A;  1RGZ A;  1GCE A;  1IYS A;  1PW1 A;  2Y2J A;  1E3U D;  2ZM0 A;  3SOI A;  4ZJ2 A;  3BRM A;  3UDX A;  1M40 A;  1MWT A;  3OPH A;  3IXB A;  5KMW A;  4PM6 A;  3A3D A;  3ZG8 B;  4N1H A;  3GTC A;  1FCO A;  1WYB A;  4GZB A;  1NYM A;  1BTL A;  1PI5 A;  5FI7 A;  2Y2P A;  5HAI A;  3BLS A;  3HLB A;  1PZO A;  4IVK A;  1K56 A;  4GOG A;  1PYY A;  1G6A A;  1K4F A;  2EX9 A;  3NDG A;  5M19 A;  2ZMA A;  3Q1F A;  1O7E A;  3E2K A;  4DXC A;  4S2N A;  1IEM A;  4E6X A;  3OPR A;  3Q81 A;  4RYE A;  5FQQ A;  4E3K A;  1PW8 A;  1BUL A;  5DF9 A;  1N9B A;  4LV0 A;  4CJN A;  2Z2M B;  2Y4A A;  4L0L A;  5TR7 A;  3O3V A;  1G68 A;  4F94 A;  2P74 A;  4OPY A;  5I94 A;  2HDQ A;  3V50 A;  5GLA A;  1KE3 A;  4QHC A;  4KZ4 A;  4JXV A;  4OOM A;  1RGY A;  3OZH A;  1K6R A;  3HLE A;  1IKI A;  3Q7Z A;  4N1X A;  4BQM A;  2FFY A;  3IWO A;  4ZJ1 A;  3GRJ A;  4NK3 A;  2WKI A;  2XDM A;  1L0F A;  4E3L A;  3WS4 A;  2HDU A;  3RXW A;  4Q8I A;  4XUZ A;  4UA6 A;  2IWC A;  3E2L A;  3ZNT A;  5DVA A;  3LCE A;  4WEJ A;  3C5A A;  4ZDX A;  3NBL A;  1JWZ A;  3W4P A;  4P85 A;  1Y54 A;  2WK0 A;  5AQA A;  1FR1 A;  3BEB A;  3G35 A;  2XK1 A;  3W4O A;  3UY6 A;  1GHP A;  4GDN A;  4WZ5 C;  3IF6 C;  5G18 A;  5GLD A;  4R3B A;  3GVB A;  4UA9 A;  4BD1 A;  4ZBE A;  2Q9N A;  2Y55 A;  2XFS A;  4EUZ A;  5DF7 A;  1O07 A;  4KZ3 A;  4U3T A;  1XP4 A;  4EBP A;  4BL3 A;  3VP1 A;  5A92 A;  1K57 C;  4S2M A;  5IHV A;  3CJM A;  3VOZ A;  3ZVW A;  4ID4 A;  3UE0 A;  2ZM2 A;  1YLW A;  3FYZ A;  4RVA A;  4MBH A;  1HVB A;  5KSH A;  4S2L A;  2JE5 A;  2Y2H A;  5CXW A;  5GHX A;  2ZQ7 A;  1JWP A;  1QME A;  3N8S A;  4DXB A;  5EVI C;  4EBN A;  1E4D A;  2A49 A;  3VP4 A;  3S22 A;  3VP2 A;  3WS1 A;  1SHV A;  1GHM A;  1W79 A;  3CZD A;  3MZF A;  1NZO A;  3FZC A;  4LEN A;  1PI4 A;  2A3U A;  3Q07 A;  3Q82 A;  1GA0 A;  2G2W A;  3BEC A;  4QB8 A;  2WKH A;  3V3R A;  3LEZ A;  1LI9 A;  2XQZ A;  4H8R A;  2OV5 A;  3M6B A;  5DTK A;  1ESI A;  3G31 A;  3N4I A;  4ZAM A;  1ES3 A;  3PBR A;  4RA7 A;  1I2W A;  5CEC A;  1BLH A;  1EI5 A;  3D4F A;  3HBR A;  4M3K A;  3QNB A;  1MY8 A;  3SH9 A;  3BFD A;  5A93 A;  4Z9Q A;  4JPM A;  1BLS A;  3C4P A;  1YMS A;  1MWS A;  1BZA A;  2I72 A;  2ZJ9 A;  3HUO A;  4LV2 A;  3W8K A;  5A91 A;  2V2F F;  3TSG A;  1BLP A;  1JVJ A;  3A3F A;  1K38 A;  2Y2G A;  1QMF A;  3VFH A;  2JBF A;  5EOE A;  2B5R A;  4K91 A;  4Y0U A;  4DE1 A;  5DTT A;  5GHZ A;  3IT9 A;  4WM9 A;  3HLG A;  4Y7P A;  5JYP A;  1FSW A;  3BFF A;  5FQ9 A;  1KGF A;  1ES5 A;  1IKG A;  3G34 A;  4IVI A;  4GN2 A;  4WZ5 A;  2HP6 A;  3IF6 A;  4OOL A;  2QPN A;  2WAD A;  3IH9 A;  1K55 C;  3VSK A;  4KZ6 A;  4PPR A;  4A5R A;  1K57 A;  4KEN B;  4OQG A;  3ITB A;  2JCH A;  4MNR A;  3V3S A;  5HFO A;  2BG1 A;  3MZE A;  4OQI A;  1Q2Q A;  3IF6 B;  5FQJ A;  1KVL A;  3MKF A;  2C5W B;  1CEF A;  3TG9 A;  4OLD A;  5EVI A;  2WZX A;  2EFX A;  3IHB A;  2UWX A;  1ERQ A;  4DKI A;  1J9M A;  1MPL A;  1E3U A;  2Y59 A;  1ZG6 A;  4E3M A;  3ZGA B;  5D3O A;  1YT4 A;  4R4R A;  4JF4 A;  2J8Y A;  5AQB A;  3FKV A;  2Y2O A;  3IWQ A;  1TDG A;  2H0T A;  3GV9 A;  3ZVT A;  5EVI B;  2WAF A;  3PBS A;  4N9K A;  1L2S A;  2EX8 A;  3G4P A;  3SH7 A;  4MBF A;  4E3I A;  3GR2 A;  1BLC A;  3QHY A;  2EXB A;  5DF8 A;  3VSL A;  3OC2 A;  3ZCZ A;  4S2O A;  3C7U A;  3HRE A;  1SCW A;  1BUE A;  3VP0 A;  3WS0 A;  3IXH A;  4OLG A;  4PM8 A;  4DE2 A;  1HZO A;  1FOF A;  2PU4 A;  2GDN A;  3WWX A;  3HLD A;  5CGS A;  3CMZ A;  4KZ7 A;  1ES4 A;  1L0E A;  3A3E A;  1GHI A;  2DNS A;  2EX6 A;  1BT5 A;  4U0X A;  1U60 A;  3QNC A;  2P9V A;  3PBQ A;  1YLP A;  3MKE A;  2EXA A;  2QZ6 A;  1NY0 A;  3GQZ A;  2Y2L A;  3V39 A;  2VGK A;  5CHU A;  3IF5 A;  4QY6 A;  5F82 A;  3ZDJ A;  4DF6 A;  4JKT A;  3NIA A;  2X02 A;  1N4O A;  2BLS A;  3DWK A;  5CTM A;  3NY4 A;  3JYI A;  1K55 A;  2P9V B;  4IBR A;  3ZG7 B;  2Y91 A;  5FDH A;  2XF3 A;  4QY5 A;  4R23 A;  5FAO A;  4OOY A;  4C6Y A;  4IED A;  1PWC A;  3WRT A;  2ZC6 B;  3P09 A;  2ZM8 A;  5EPH A;  4E3N A;  4FSF A;  4DE3 A;  1FSY A;  2H0Y A;  2R9X A;  2WZZ A;  2ZD8 A;  3LO7 A;  1LHY A;  3LY3 A;  1K25 A;  1FCN A;  1DJB A;  4UA7 A;  3FKW A;  2HDS A;  4JF5 A;  2JC7 A;  1PWD A;  4EBL A;  4OP8 A;  3RXX A;  4PM5 A;  1YLZ A;  3VP3 A;  2Y2M A;  3UPO A;  2ZQC A;  1LLB A;  5EUA A;  4BEN A;  2WYX A;  1TVF A;  4XUX A; 
#chains in the Genus database with same CATH topology
 1UWP X;  1IYO A;  4RX2 A;  3FC7 A;  1FQG A;  2P7J A;  3UPP A;  3IS2 B;  4IUK A;  2WGW A;  5HPF A;  3E0Y A;  4PHT A;  4B4Z A;  2MJ6 A;  3L9K A;  2NUP C;  5DKK A;  4HBU A;  3I7J A;  1MZU A;  5JYO A;  4IUH A;  2WGW B;  3B3X A;  1NXY A;  1CJF A;  1XGJ A;  2O9C A;  3LY4 A;  3V67 A;  4EV4 A;  5FEF A;  3DW0 A;  4CPK A;  2WKE A;  4MN7 A;  2XGN A;  3AGE A;  4O7D A;  4GKU A;  3RJU A;  2PHY A;  3DTM A;  4UHU A;  5CGX A;  1S6R A;  1W5D A;  3BYD A;  4ZJ3 A;  2J3W A;  4YNR A;  2NUT C;  3UNW A;  3SS5 A;  4LV3 A;  4YFM A;  1XA7 A;  2OSU A;  1F2K A;  4FOF A;  3Q7V A;  3U2A A;  3SS4 A;  5FL3 A;  4JXS A;  2Y8H A;  1D7E A;  3M6H A;  3S7O A;  2LB9 A;  1PNE A;  1CI8 A;  3BY8 A;  1T1C A;  4E6W A;  3P98 A;  1F5M A;  5I5L A;  3NHQ A;  2E8I A;  3IX3 A;  1W8Q A;  3N6I A;  1ONG A;  1OTI A;  1LSW A;  2Z2L B;  4OQ0 A;  4FCF A;  4UQI S;  3GEC A;  4NXF A;  5DFY A;  1MWU A;  4D60 A;  4GHI A;  4BL2 A;  1BSG A;  4S2I A;  5HWT A;  5AJG A;  2PD7 A;  2EFU A;  2HPB A;  2P08 A;  4GHI B;  2PD8 A;  4JGO A;  4R70 A;  4BLM A;  2Q9M A;  1RP5 A;  5FAQ A;  1KOU A;  1FIK A;  1IFQ A;  3VOY A;  2XSS A;  1LT0 A;  3BQA A;  3HLF A;  3D9Y A;  1HD8 A;  1XJ2 A;  1EW0 A;  4KG6 A;  1YMX A;  5HAQ A;  3MXR A;  2V8C A;  2XD1 A;  3T12 B;  1XJ6 A;  3HL9 A;  3M2J A;  3A0S A;  5HAR A;  1C3B A;  5A90 A;  3IXD A;  4NEE D;  3HLW A;  1F9I A;  5IT5 A;  4MLL A;  1YAX A;  2W3E A;  4GD8 A;  3KO6 A;  5CHJ A;  2IWB A;  4I38 A;  5E2E A;  3UO9 A;  1ES2 A;  4LCM A;  4WZ4 A;  2V1Z A;  3BW6 A;  4GB7 A;  2XEP A;  2QKP A;  2X01 A;  3IBJ A;  5E2G A;  5HZH A;  5FAP A;  5A8B A;  4MEZ A;  3LIF A;  3ZG5 A;  2D02 A;  5F69 A;  1TEM A;  1XXM A;  3M2K A;  4X68 A;  5FAS A;  2WUQ A;  3SH8 A;  2ZC3 B;  4KZA A;  2JKR I;  4HJ6 A;  5KZH A;  5GHY A;  2H10 A;  2X71 A;  5EVL A;  3W4Q A;  5CER A;  4S2K A;  3MR0 A;  2BAS A;  1TDL A;  1NZU A;  4WEK A;  5GLB A;  5HX9 A;  5HAP A;  4I3A A;  1I2S A;  3ICY A;  4ETX A;  4NXE A;  3MMH A;  4X6T A;  4O8G A;  3NDE A;  1GCE A;  2Y2J A;  2ZM0 A;  5L8M A;  4ZJ2 A;  1M40 A;  5MC7 A;  2ZMF A;  4PM6 A;  2KDK A;  5FI7 A;  3BLS A;  3UB8 A;  1K56 A;  1PYY A;  3LIA A;  3BQ8 A;  5M19 A;  3RFB A;  4E3K A;  2Y4A A;  4L0L A;  4WF0 A;  5TR7 A;  1DP6 A;  2P74 A;  5I94 A;  4NXB A;  4OOM A;  3QP8 A;  1RGY A;  4N1X A;  4B9O A;  3GRJ A;  4NK3 A;  3RXW A;  2EWV A;  3EEA A;  4Q8I A;  3B47 A;  2IWC A;  3E2L A;  5EM1 A;  2OWH A;  3DTK A;  3W4P A;  1NRJ A;  1Y54 A;  5AQA A;  1FR1 A;  5FEG A;  3UY6 A;  5GLD A;  3HCY A;  3IF6 C;  2Y55 A;  1XP4 A;  1S66 L;  3CJM A;  4ID4 A;  4MBH A;  3TJZ C;  1HVB A;  2JE5 A;  5GHX A;  2ZQ7 A;  1JWP A;  1QME A;  3N8S A;  1E4D A;  2A49 A;  3VP2 A;  1SHV A;  2ACG A;  3MZF A;  3T4T A;  3FZC A;  1OPX A;  1PI4 A;  4EW7 A;  4QB8 A;  2WKH A;  4H8R A;  3VOL A;  1ESI A;  1I2W A;  4HI4 A;  4M3K A;  3QNB A;  2HZ5 A;  5A93 A;  1SZV A;  4JPM A;  1BLS A;  1MWS A;  1BZA A;  3HUO A;  3W8K A;  1JVJ A;  5EOE A;  2VEA A;  4DE1 A;  1GSW A;  5GHZ A;  2KX6 A;  3G34 A;  1IKG A;  4WZ5 A;  4OOL A;  3JVU A;  3IH9 A;  3VSK A;  4KZ6 A;  1PFL A;  4OQG A;  3ITB A;  4NXG A;  3V3S A;  3E98 A;  5FQJ A;  3VE4 A;  2C5W B;  4I3J A;  5EVI A;  2PAV P;  2WZX A;  3TG9 A;  2EFX A;  2UWX A;  3FPW A;  4ZRR A;  4E3M A;  1YT4 A;  1F98 A;  2J8Y A;  4JF4 A;  5IU1 A;  3FKV A;  1TDG A;  2H0T A;  2J80 A;  2LB5 A;  5EVI B;  4EEU A;  4LGW A;  1S4R A;  5HDC A;  3GR2 A;  3MXQ A;  3VSL A;  4S2O A;  1N9L A;  3IXH A;  4PM8 A;  4DE2 A;  4I5S A;  4KZ7 A;  3HJI A;  1CF0 A;  1ES4 A;  3R7W A;  4BBV A;  1DP8 A;  3A0V A;  1BT5 A;  3PBQ A;  1S1Y A;  3FPV A;  1YLP A;  3MKE A;  2VGK A;  5CHU A;  3IF5 A;  4ME4 A;  5F82 A;  3R7W B;  4JKT A;  3S7N A;  2BLS A;  3CAX A;  3ZG7 B;  5FDH A;  4QY5 A;  4R23 A;  5FAO A;  4OOY A;  3WRT A;  4E3N A;  4FSF A;  4HQA A;  2R9X A;  3LY3 A;  1LHY A;  1K25 A;  4QPR A;  1FCN A;  4EBL A;  3S7Q A;  3E4Q A;  4UQI M;  3VP3 A;  3UPO A;  5EUA A;  2WYX A;  1P9W A;  2Y2I A;  5AQ7 A;  3PHY A;  5HL1 A;  3HVF A;  3CG5 A;  1ZG4 A;  4WBG A;  2WGI A;  2QYB A;  2G2U A;  3PXP A;  4PM9 A;  2DMW A;  3A3I A;  5EE8 A;  1ZC2 A;  3GDI A;  4JF6 A;  3EOI A;  4HY8 A;  4C75 A;  1STZ A;  1H8Z A;  4HBT A;  2EWW A;  3JVV A;  3UB7 A;  4X55 A;  3EGX C;  5L10 A;  1MKI A;  2ZQA A;  4GCZ A;  2XFT A;  3C8C A;  4NET A;  3UN7 A;  5HD5 A;  5E43 A;  4KZ9 A;  3IWI A;  1OT6 A;  1JWV A;  2YKH A;  3H82 A;  1SDE A;  4E3O A;  1XA1 A;  3QP1 A;  3TOI A;  3SS3 A;  3HJK A;  2Y2N A;  3H82 B;  1OME A;  2Z6C A;  3A3J A;  5FA7 A;  1PIO A;  2YKF A;  5DKL A;  1G5U A;  4P6Z S;  3TRC A;  1XGI A;  3C7V A;  4Y13 A;  3K2N A;  4DRT A;  1J3W A;  3OBF A;  2B02 A;  5F5Y A;  2O0Y A;  3LI8 A;  4KG2 A;  2WGV A;  3PBN A;  1Z6F A;  4JXG A;  1DJA A;  4II7 A;  2DCF A;  3UE3 A;  1YLJ A;  3OPP A;  2VA0 A;  2KLI A;  2J9P A;  5M1A A;  5J8X A;  1H8Y A;  2L4R A;  3MBZ A;  1KVM A;  5FI2 A;  4WEL A;  2QJ5 A;  3WS5 A;  3D72 A;  5F1G A;  3F1P A;  4Q0H A;  4EQI A;  5F1F A;  1KDW A;  2K31 A;  4KZ8 A;  1LL9 A;  3F1P B;  3CIT A;  3FV7 A;  4BMW A;  3CWF A;  4X25 A;  4BWI A;  1XFQ A;  2CC1 A;  1V9Z A;  3T4K A;  4E3J A;  1IYQ A;  4HHD A;  4ESP A;  1ERO A;  2PU2 A;  4Q0I A;  5CRF A;  3BFC A;  2QHK A;  2JN7 A;  2WAE A;  3MQ0 A;  1N9O A;  4K0X A;  4OPQ A;  4Y17 A;  1AXB A;  2WKR A;  4BD0 A;  4OPZ A;  1XKZ A;  1XX2 A;  5J3W A;  1KE0 A;  1W7F A;  3MFD A;  2FH5 A;  5GLC A;  4RX3 A;  1ZTU A;  3DWZ A;  2W3D A;  1JTD A;  5FAT A;  5L2F A;  1Y4O A;  1WE4 A;  1IYP A;  1CQA A;  1LSX A;  4S2N C;  3H9W A;  4OON A;  4Y0O A;  1ZKJ A;  3G2Y A;  2K7S A;  1YM1 A;  4EU0 A;  4QJG A;  1MXO A;  2QMI A;  4S2P A;  2O99 A;  5G4Z A;  3EWK A;  4WMC D;  1K54 C;  4DN0 A;  2R78 A;  1PWG A;  5F83 A;  4GDB A;  3KSI A;  1H5X A;  3OCN A;  3Q7V B;  2PR5 A;  1AWI A;  4HJ3 A;  1PZP A;  2Z6D A;  2VLG A;  1IYS A;  1PW1 A;  2INW A;  4YOF A;  1MWT A;  3UB5 P;  4FTX A;  3IXB A;  3A3D A;  4BBT A;  4N1H A;  1WYB A;  4GZB A;  3NOP C;  1WA9 A;  1PI5 A;  3LIC A;  3BWL A;  4X1M A;  1T18 A;  4IVK A;  1VEU A;  2EX9 A;  3Q1F A;  1IEM A;  3OPR A;  3Q81 A;  4EET B;  1PW8 A;  1BUL A;  5DF9 A;  2Z2M B;  4DJ2 A;  1VEU B;  1P97 A;  3O3V A;  3RTY A;  4OPY A;  2HDQ A;  5GLA A;  1KE3 A;  4KZ4 A;  1OTE A;  4JXV A;  3OZH A;  1IKI A;  2PT7 A;  5DJT A;  4BQM A;  5KIZ A;  2FFY A;  4CLC D;  4ZJ1 A;  1DP9 A;  2WKI A;  2XDM A;  3WS4 A;  4XT2 A;  1H0M A;  4XUZ A;  4WEJ A;  3C5A A;  1S4S A;  4UEY A;  3PYP A;  2VGL S;  3W4O A;  1X0O A;  2VV6 A;  5HDS A;  4BD1 A;  5G18 A;  4R3B A;  4XT2 B;  4ZBE A;  2Q9N A;  1O07 A;  4U3T A;  4EBP A;  4BL3 A;  3VP1 A;  1K57 C;  4S2M A;  2PBD P;  3ZVW A;  2ZM2 A;  3FYZ A;  4RVA A;  3UB6 A;  5KSH A;  2PYR A;  5HDD A;  4Q0J A;  2ZOI A;  4LPZ A;  3VP4 A;  3S22 A;  3WS1 A;  2QWS A;  3G6O A;  3CZD A;  1NZO A;  3LEQ A;  4LEN A;  3KYQ A;  3Q82 A;  4O0P A;  3Q07 A;  3ULF A;  1GA0 A;  2G2W A;  4MN6 A;  3CI6 A;  1LI9 A;  2XQZ A;  2OV5 A;  3M6B A;  3T4O A;  3N4I A;  1ES3 A;  3PBR A;  5CEC A;  1BLH A;  3KYE A;  4LRX C;  1MY8 A;  3KSG A;  2QJ7 A;  1T19 A;  4LV2 A;  1ZHH B;  4MN5 A;  3A3F A;  1K38 A;  2Y2G A;  2GX5 A;  1QMF A;  3KSH A;  2JBF A;  4Y0U A;  1K0K A;  4WM9 A;  3F1O A;  4LLO B;  4IVI A;  3CUE A;  2HP6 A;  1K55 C;  4PPR A;  4A5R A;  4CQH A;  4CLC C;  5HFO A;  2O9A A;  4Y5F A;  3MZE A;  2JKF A;  4OQI A;  4HIA A;  3MKF A;  1CEF A;  4OLD A;  1J9M A;  1MPL A;  1E3U A;  2Y59 A;  3ZGA B;  2V9A A;  3FG8 A;  4R4R A;  4RQ9 A;  3GV9 A;  3ZVT A;  3PBS A;  4N9K A;  1TS8 A;  3LIE A;  5K5B A;  2EX8 A;  4MBF A;  2ZOH A;  5DF8 A;  3ZCZ A;  2VX8 A;  1BUE A;  3VP0 A;  3W2Z A;  4AFI A;  3DAV A;  1FOF A;  3HLD A;  1L0E A;  4L9G A;  2DNS A;  5J7E A;  2VKS A;  2P9V A;  4HP9 A;  3GQZ A;  2Y2L A;  3V39 A;  2X02 A;  1N4O A;  3DWK A;  5CTM A;  3NY4 A;  5IS1 A;  2P9V B;  2XF3 A;  3CLO A;  5HWV A;  1PWC A;  4JGR A;  4L9F A;  4K08 A;  4DE3 A;  1FSY A;  2WZZ A;  3FKW A;  1P9R A;  4JF5 A;  1PWD A;  4PM5 A;  2Y2M A;  2ZQC A;  1LLB A;  3B33 A;  3ISG A;  1LL5 A;  5CX7 A;  2OLV A;  4Y0T A;  4WYY A;  5HL6 A;  4HH3 A;  2JKT M;  4OQH A;  3V5M A;  1DJC A;  2V0W A;  2RCX A;  1I5Q A;  1YLT A;  4I39 A;  1VM1 A;  2V1B A;  3D3O A;  4DE0 A;  4KZ5 A;  3QP4 A;  4S2J A;  4R1G A;  5FQM A;  2PDR A;  4JBF A;  4R38 A;  1FR6 A;  2XLN A;  3CPT A;  5TFQ A;  2WKP A;  2Q0O A;  5EOO A;  5CED A;  2VGJ A;  3T4Q A;  1SDN A;  2E8J A;  2Y2Q A;  2ZQD A;  4Y3I A;  2AVX A;  3CPT B;  3G2Z A;  3BM6 A;  2XD5 A;  3C4O A;  3FWL A;  1XJ3 A;  3IHA A;  3AGD A;  3LIB A;  2L0W A;  2GZA A;  5FI6 A;  1KGE A;  1XPB A;  4G3W A;  1XFN A;  2M7V A;  4OPR A;  1K4E A;  2WKQ A;  5L09 A;  2HDR A;  4DDY A;  1K56 D;  5EV0 A;  3ZG0 A;  1NJ4 A;  1H8M A;  3F1N A;  3EQV A;  2A2L A;  4PKY A;  1EWZ A;  3UE1 A;  5FSR A;  1RCJ A;  3F1N B;  2ZC7 A;  3T1Q B;  2XRN A;  2PBY A;  3QP6 A;  3NCK A;  4N9L A;  3IX4 A;  2ZL1 A;  4C3Q A;  5HSQ A;  3T1S A;  3HUM A;  2HP9 A;  2K2N A;  3LGO A;  2XRO A;  4B88 A;  1DRM A;  3PTE A;  4GNU A;  5KSC A;  3O87 A;  1K54 A;  1LSV A;  3NC8 A;  2ZL1 B;  1M6K A;  3GMW A;  4KQR A;  4QWO A;  5U47 A;  3G32 A;  4IBX A;  2C6W B;  1SKF A;  3HUN A;  5FQK A;  1VHM A;  2V8F A;  4NG2 A;  2XH9 A;  2OOL A;  3IXG A;  5CHM A;  3DTE A;  1L0G A;  4KG5 A;  1WYC A;  2Y2K A;  4P0M A;  4HP4 A;  1JTG A;  3PBT A;  1BYW A;  4GD6 A;  3CHW P;  2EX2 A;  5EEC A;  3OPL A;  2M1C A;  4U0T A;  3MSH A;  5AQ9 A;  3N7W A;  2DRW A;  4MBK A;  5GL9 A;  1W8Y A;  4ARZ A;  3T4L A;  4GW9 A;  3WRZ A;  1OJ5 A;  3S1Y A;  2L1M A;  1CEG A;  3PAG A;  3OCL A;  3AGF A;  2HGV A;  4KZB A;  4R4S A;  1KGG A;  2RL3 A;  4PKY G;  5E2H A;  1KE4 A;  1YKD A;  4HH2 A;  3MJQ A;  1ONH A;  5BOH A;  2IWD A;  3NUL A;  1NWZ A;  2A24 A;  3MZD A;  4WMC A;  5EVI D;  1MKM A;  1RGZ A;  3MFX A;  4L9E A;  3BRM A;  3UDX A;  4HOI A;  5KMW A;  3GTC A;  1FCO A;  1NYM A;  3PR6 A;  2CMN A;  5HAI A;  2Y2P A;  3HLB A;  2B95 A;  1PZO A;  2W0N A;  3T4S A;  2XA7 S;  1G6A A;  1K4F A;  3NDG A;  1O7E A;  4DXC A;  3QP5 A;  2EA9 A;  5FQQ A;  5AVF A;  1N9B A;  4CJN A;  1G68 A;  4F94 A;  3A0R A;  2HJE A;  5C5K A;  2Y79 A;  3Q7Z A;  2HJ9 C;  3HLE A;  2PRF A;  3IWO A;  1SKO A;  3UE6 A;  4E3L A;  1YSP A;  1Y28 A;  5DVA A;  3LCE A;  4ZDX A;  3NBL A;  5EFW A;  4CLC A;  4P85 A;  2WK0 A;  1G28 A;  2VK3 A;  3BEB A;  1SKO B;  3R4K A;  2I9V A;  4WZ5 C;  1GHP A;  4GDN A;  4IHQ A;  4WUJ A;  4UA9 A;  3GVB A;  2XFS A;  5DF7 A;  2UV0 E;  3VOZ A;  3IS2 A;  3UE0 A;  4S2L A;  5EVI C;  4EBN A;  4GJ4 A;  4H6J A;  2IA2 A;  1W79 A;  3T1X A;  3BEC A;  2M7U A;  3RH8 B;  3LEZ A;  4ETZ A;  4H6J B;  5DTK A;  4ZAM A;  4RA7 A;  3KSF A;  1EI5 A;  3D4F A;  3HBR A;  4Y15 A;  3SH9 A;  3BFD A;  1W63 M;  4LRZ E;  3C4P A;  2ZJ9 A;  2I72 A;  3TSG A;  1T1A A;  2P04 A;  5HWW A;  3VFH A;  4F3L A;  4K91 A;  5J4E A;  4EEP A;  3P01 A;  3IF6 A;  2QPN A;  2VV8 A;  2HF6 A;  2W3H A;  4F3L B;  1T1B A;  2VJW A;  3QP2 A;  3LR4 A;  4MNR A;  1OTB A;  3LR3 A;  2BG1 A;  1Q2Q A;  3IF6 B;  1KVL A;  1ODV A;  1VET A;  3IHB A;  4DKI A;  2J3T D;  1FIL A;  5AVE A;  2W1R A;  2Y2O A;  1VB6 A;  5LBR A;  1VET B;  2WAF A;  3OLO A;  1OT9 A;  3G4P A;  3SH7 A;  4HJ4 A;  4E3I A;  3E4O A;  3HRE A;  2ZMV A;  1HZO A;  2GDN A;  3C2W A;  3WWX A;  5CGS A;  3CMZ A;  2EX6 A;  4MCW A;  2OWJ A;  3NIA A;  5TJJ A;  3JYI A;  2Y91 A;  3SW1 A;  1W63 Q;  1GSX A;  4C6Y A;  4IED A;  2ZC6 B;  2ZM8 A;  3LO7 A;  4UA7 A;  2HDS A;  4LRY C;  1YLZ A;  1XJ4 A;  1TVF A;  1VQQ A;  3V3R A;  4K0W A;  5CGW A;  3PBO A;  3IQA A;  4HES A;  1Z09 A;  3NOU C;  2V1A A;  4G3K A;  4KQO A;  5FQI A;  2XR0 A;  4P6B A;  4M4X A;  2HP5 A;  2J3T C;  5DJU A;  3T1R A;  2V20 A;  1LI0 A;  4UAA A;  2R9W A;  5TGF A;  4FH4 A;  3BY9 A;  1D06 A;  5E2F A;  3S4X A;  1HLU P;  3LI9 A;  3SZT A;  2OAQ 1;  3BLM A;  3VMA A;  1UGU A;  4OVD A;  2B18 A;  4XXR A;  3PAE A;  1Q2P A;  1YLY A;  4O01 A;  4B93 A;  3H7W A;  1CI9 A;  2OAP 1;  3VFF A;  3H7W B;  4FD8 A;  3VV4 A;  3F1O B;  1E25 A;  4JXW A;  1MC0 A;  2ZQ8 A;  3C30 A;  2BTF P;  4WLA A;  2J9O A;  3EQU A;  3NJA A;  3KX0 X;  3N8R A;  1GA9 A;  4R3J A;  5HW3 A;  4B4X A;  1YQS A;  4P87 A;  4PM7 A;  3MXS A;  4R0Q A;  5CTN A;  2OLU A;  4R3A A;  3ZNY A;  5EVE A;  1FCM A;  2ZQ9 A;  4OH0 A;  5DFX A;  1HTZ A;  1UWN X;  2J7V A;  3ZG9 B;  3BFG A;  1KDS A;  1ERM A;  3B42 A;  3DBA A;  3IH8 A;  3EEH A;  5G4Y A;  1PRQ A;  5DTS A;  4EWF A;  1S0W A;  2VZW A;  1TS0 A;  5CEB A;  4QU3 A;  3UME A;  4P6Z M;  3ITA A;  3ZHH A;  3BFE A;  4X69 A;  3ZQ5 A;  3P7N A;  4ZTK A;  4LFU A;  5M18 A;  1YSQ A;  3UDI A;  3NI9 A;  4JLF A;  4LCL A;  1IEL A;  1NYY A;  4KQQ A;  4PMA A;  1DY6 A;  5FDS A;  3N8L A;  4D2O A;  3HLC A;  4BJP A;  1V9Y A;  3UDF A;  3C38 A;  1ESU A;  4LV1 A;  1TF1 A;  1YPR A;  2XA7 M;  4EQ1 A;  3UB9 A;  4WL9 A;  3MQO A;  3LUQ A;  4EXO A;  2ZLY A;  2ZC4 B;  4DDS A;  3DTI A;  1MWR A;  4R6L A;  1JNU A;  4PAU A;  1TD5 A;  3UPN A;  1G6O A;  1ACF A;  4FH2 A;  3G30 A;  3TE8 A;  3LR0 A;  1CK3 A;  4Z1W A;  4EER A;  4N92 A;  4X53 A;  1L0D A;  2W27 A;  1MBL A;  4JGQ A;  2H5S A;  2ZC5 B;  2FFF B;  4MDZ A;  4WN5 A;  3O5Y A;  1NRF A;  4OKP A;  1ALQ A;  3U4L P;  3WS2 A;  3ZFZ A;  4HEF A;  3LFV A;  3O88 A;  4QD4 A;  1OTA A;  4G3V A;  3MS6 A;  4OP5 A;  3ZYT A;  3GSG A;  2PR6 A;  1K6S A;  4X56 A;  3O86 A;  1D1J A;  4JGP A;  2GJ3 A;  4YIN A;  3JPU A;  4BBU A;  4KUK A;  4Y2F A;  4X1L A;  1E3U D;  3SOI A;  3TW8 A;  3OPH A;  5L07 A;  3ZG8 B;  4EES A;  2V0U A;  3LID A;  1BTL A;  1NLY A;  3MF0 A;  3OOV A;  3NEC A;  2FZ0 A;  4GOG A;  5F68 A;  3VE3 A;  4EUV A;  2ZMA A;  4KQD A;  3E2K A;  4S2N A;  4E6X A;  4RYE A;  5EM0 A;  4LV0 A;  1TS7 A;  3V50 A;  4QHC A;  3S7P A;  4GS9 A;  1K6R A;  4E04 A;  3MQQ A;  1L0F A;  4GS9 B;  2HDU A;  4UA6 A;  1A0K A;  3ZNT A;  3EGD C;  1JWZ A;  1TS6 A;  3G35 A;  2XK1 A;  4I3I A;  3CUE C;  1IOU A;  2GNX A;  4EUZ A;  4KZ3 A;  5A92 A;  5IHV A;  1YLW A;  1S1Z A;  4FUW A;  2Y2H A;  5CXW A;  2HV1 A;  2W3F A;  4DXB A;  1GHM A;  3NOT C;  4DJ3 A;  1OTD A;  2W1T A;  2A3U A;  3K3C A;  4KUO A;  2H28 A;  3G31 A;  2PYP A;  2W1T B;  4ARZ B;  1P0Z A;  2VGL M;  3LYX A;  3T4J A;  4Z9Q A;  3IBR A;  1YMS A;  5A91 A;  2V2F F;  1BLP A;  2B5R A;  1OJG A;  5DTT A;  3IT9 A;  4Y7P A;  3HLG A;  4MMN A;  4NKP A;  5JYP A;  1FSW A;  3BFF A;  5FQ9 A;  1KGF A;  1ES5 A;  4GN2 A;  2WAD A;  3E4P A;  2ZBB A;  2G7U A;  1K57 A;  4KEN B;  2JCH A;  3IX8 A;  2A24 B;  3T50 A;  2VV7 A;  1ERQ A;  1ZG6 A;  5D3O A;  5AQB A;  4DMZ A;  3IWQ A;  1H3Q A;  1L2S A;  1NLZ A;  2JKR M;  2W3G A;  3LR5 A;  4CLC E;  1BLC A;  3QHY A;  2EXB A;  3OC2 A;  5F6A A;  3C7U A;  1SCW A;  3WS0 A;  1LL8 A;  3UMD A;  1S67 L;  4OLG A;  5TBM A;  2D01 A;  2PU4 A;  3KYZ A;  3A3E A;  1GHI A;  3K3D A;  4U0X A;  2JKT I;  1U60 A;  3QNC A;  2KOI A;  5TBM B;  2EXA A;  2QZ6 A;  1N9N A;  1NY0 A;  4GLQ A;  3ZDJ A;  4QY6 A;  4DF6 A;  5HD3 A;  4HNB A;  1GSV A;  4YWZ A;  1K55 A;  4IBR A;  2JHE A;  4IJG A;  3P09 A;  5EPH A;  5HPI A;  2H0Y A;  2ZD8 A;  1DJB A;  2JKG A;  2O9B A;  2JC7 A;  4CLC B;  3BJN A;  4OP8 A;  3RXX A;  1L3L A;  3L7H A;  4BEN A;  4XUX A; 
#chains in the Genus database with same CATH homology
 1VQQ A;  2Y2I A;  1IYO A;  1LL5 A;  4K0W A;  2OLV A;  4RX2 A;  3PBO A;  5CGW A;  1FQG A;  5AQ7 A;  3UPP A;  4Y0T A;  4WYY A;  3HVF A;  5HL1 A;  3CG5 A;  3IQA A;  1ZG4 A;  4WBG A;  4HES A;  2WGI A;  2G2U A;  4PM9 A;  2WGW A;  3A3I A;  5EE8 A;  1ZC2 A;  4KQO A;  5FQI A;  2XR0 A;  4P6B A;  4JF6 A;  4OQH A;  2HP5 A;  4B4Z A;  3V5M A;  4HBU A;  3I7J A;  5JYO A;  4C75 A;  1DJC A;  2WGW B;  3B3X A;  2V20 A;  1NXY A;  2RCX A;  1H8Z A;  1I5Q A;  3ISG A;  4HBT A;  1XGJ A;  1LI0 A;  1YLT A;  3LY4 A;  2R9W A;  4UAA A;  5TGF A;  4FH4 A;  4X55 A;  4EV4 A;  1VM1 A;  5E2F A;  1MKI A;  3S4X A;  2ZQA A;  4DE0 A;  2XFT A;  4KZ5 A;  4S2J A;  3BLM A;  3VMA A;  3DW0 A;  4CPK A;  2WKE A;  4R1G A;  4OVD A;  4NET A;  5FQM A;  4XXR A;  4JBF A;  1FR6 A;  3UN7 A;  2XGN A;  2XLN A;  3AGE A;  3PAE A;  4O7D A;  4GKU A;  5TFQ A;  5E43 A;  3RJU A;  1Q2P A;  3DTM A;  1YLY A;  4UHU A;  4KZ9 A;  3IWI A;  5CGX A;  1S6R A;  1CI9 A;  1W5D A;  5EOO A;  5CED A;  2VGJ A;  3BYD A;  1JWV A;  4ZJ3 A;  1SDN A;  2Y2Q A;  2ZQD A;  3VFF A;  3UNW A;  3SS5 A;  4LV3 A;  1SDE A;  4E3O A;  1XA1 A;  3G2Z A;  4YFM A;  1XA7 A;  2OSU A;  2XD5 A;  3BM6 A;  3TOI A;  4FD8 A;  3SS3 A;  1E25 A;  3Q7V A;  3SS4 A;  2Y2N A;  3C4O A;  4JXW A;  1OME A;  3FWL A;  4JXS A;  2ZQ8 A;  3A3J A;  5FA7 A;  3M6H A;  3IHA A;  1PIO A;  3AGD A;  2J9O A;  3EQU A;  1CI8 A;  3N8R A;  1XGI A;  3C7V A;  3P98 A;  4E6W A;  1GA9 A;  4R3J A;  5HW3 A;  5FI6 A;  4DRT A;  1KGE A;  4B4X A;  1YQS A;  4P87 A;  2E8I A;  4PM7 A;  3MXS A;  4R0Q A;  1XPB A;  5CTN A;  2OLU A;  1W8Q A;  2WGV A;  3N6I A;  3PBN A;  4KG2 A;  4OPR A;  3ZNY A;  1Z6F A;  4JXG A;  1K4E A;  1DJA A;  1FCM A;  1ONG A;  2ZQ9 A;  4OH0 A;  1HTZ A;  2J7V A;  2DCF A;  2Z2L B;  2HDR A;  3BFG A;  4OQ0 A;  4FCF A;  3UE3 A;  3ZG9 B;  4DDY A;  1K56 D;  1YLJ A;  3OPP A;  1KDS A;  3ZG0 A;  1NJ4 A;  1ERM A;  2J9P A;  3IH8 A;  3EQV A;  5M1A A;  5J8X A;  1MWU A;  1EWZ A;  1H8Y A;  3UE1 A;  3MBZ A;  1KVM A;  5FI2 A;  5FSR A;  4WEL A;  4BL2 A;  1BSG A;  4S2I A;  5DTS A;  4EWF A;  1S0W A;  3WS5 A;  1RCJ A;  5F1G A;  2ZC7 A;  2EFU A;  2HPB A;  2PBY A;  5CEB A;  4EQI A;  4QU3 A;  3NCK A;  4N9L A;  4BLM A;  1KDW A;  5F1F A;  3ITA A;  3ZHH A;  3BFE A;  4X69 A;  2Q9M A;  4C3Q A;  1RP5 A;  4KZ8 A;  5FAQ A;  3HUM A;  2HP9 A;  4ZTK A;  1LL9 A;  4B88 A;  5M18 A;  3FV7 A;  3VOY A;  3PTE A;  4GNU A;  3NI9 A;  3UDI A;  4JLF A;  5KSC A;  3O87 A;  1K54 A;  4LCL A;  1IEL A;  1NYY A;  3HLF A;  3NC8 A;  1HD8 A;  1M6K A;  2CC1 A;  3GMW A;  4E3J A;  4KQQ A;  4KQR A;  5U47 A;  4PMA A;  1DY6 A;  1IYQ A;  3G32 A;  4IBX A;  2C6W B;  1SKF A;  3N8L A;  4KG6 A;  1YMX A;  5HAQ A;  1ERO A;  3HUN A;  3MXR A;  5FQK A;  4D2O A;  2XH9 A;  2XD1 A;  2PU2 A;  3HLC A;  3HL9 A;  4BJP A;  5CRF A;  3BFC A;  3IXG A;  5CHM A;  1L0G A;  3UDF A;  3M2J A;  1ESU A;  4LV1 A;  4KG5 A;  1WYC A;  5HAR A;  1C3B A;  5A90 A;  2Y2K A;  2WAE A;  4K0X A;  4P0M A;  3IXD A;  4OPQ A;  1AXB A;  3HLW A;  1JTG A;  4BD0 A;  3PBT A;  4GD6 A;  4OPZ A;  1XKZ A;  4MLL A;  2ZLY A;  2EX2 A;  2ZC4 B;  4GD8 A;  4DDS A;  1XX2 A;  1MWR A;  1KE0 A;  3OPL A;  5CHJ A;  5EEC A;  4U0T A;  5E2E A;  2IWB A;  1ES2 A;  1W7F A;  3MFD A;  3UO9 A;  4LCM A;  4WZ4 A;  5AQ9 A;  2V1Z A;  3N7W A;  5GLC A;  4RX3 A;  2DRW A;  4GB7 A;  4MBK A;  5GL9 A;  3UPN A;  2XEP A;  3DWZ A;  1W8Y A;  2X01 A;  1JTD A;  5FAT A;  5L2F A;  5E2G A;  1WE4 A;  5FAP A;  4FH2 A;  3G30 A;  1IYP A;  4MEZ A;  3ZG5 A;  3WRZ A;  1CK3 A;  1TEM A;  1XXM A;  3M2K A;  4X68 A;  5FAS A;  4S2N C;  3S1Y A;  1CEG A;  3PAG A;  3OCL A;  2WUQ A;  3SH8 A;  2ZC3 B;  3AGF A;  4OON A;  4N92 A;  4KZA A;  4KZB A;  1L0D A;  4R4S A;  4X53 A;  1ZKJ A;  4Y0O A;  5KZH A;  1KGG A;  2RL3 A;  3G2Y A;  1MBL A;  5GHY A;  2H10 A;  2X71 A;  5E2H A;  1YM1 A;  2H5S A;  2ZC5 B;  1KE4 A;  2FFF B;  5EVL A;  5CER A;  4OKP A;  1NRF A;  3W4Q A;  4S2K A;  1ALQ A;  4QJG A;  1MXO A;  3WS2 A;  2QMI A;  3ZFZ A;  4HEF A;  4S2P A;  3O88 A;  1TDL A;  4QD4 A;  4WMC D;  1K54 C;  1PWG A;  4OP5 A;  5F83 A;  4GDB A;  1NZU A;  1ONH A;  3GSG A;  4WEK A;  5BOH A;  5GLB A;  1H5X A;  2IWD A;  3OCN A;  1K6S A;  3Q7V B;  5HX9 A;  5HAP A;  4X56 A;  3O86 A;  4YIN A;  3MZD A;  1I2S A;  4WMC A;  4X6T A;  1PZP A;  5EVI D;  3NDE A;  1RGZ A;  1GCE A;  1IYS A;  1PW1 A;  2Y2J A;  1E3U D;  2ZM0 A;  3SOI A;  4ZJ2 A;  3BRM A;  3UDX A;  1M40 A;  1MWT A;  3OPH A;  3IXB A;  5KMW A;  4PM6 A;  3A3D A;  3ZG8 B;  4N1H A;  3GTC A;  1FCO A;  1WYB A;  4GZB A;  1NYM A;  1BTL A;  1PI5 A;  5FI7 A;  2Y2P A;  5HAI A;  3BLS A;  3HLB A;  1PZO A;  4IVK A;  1K56 A;  4GOG A;  1PYY A;  1G6A A;  1K4F A;  2EX9 A;  3NDG A;  5M19 A;  2ZMA A;  3Q1F A;  1O7E A;  3E2K A;  4DXC A;  4S2N A;  1IEM A;  4E6X A;  3OPR A;  3Q81 A;  4RYE A;  5FQQ A;  4E3K A;  1PW8 A;  1BUL A;  5DF9 A;  1N9B A;  4LV0 A;  4CJN A;  2Z2M B;  2Y4A A;  4L0L A;  5TR7 A;  3O3V A;  1G68 A;  4F94 A;  2P74 A;  4OPY A;  5I94 A;  2HDQ A;  3V50 A;  5GLA A;  1KE3 A;  4QHC A;  4KZ4 A;  4JXV A;  4OOM A;  1RGY A;  3OZH A;  1K6R A;  3HLE A;  1IKI A;  3Q7Z A;  4N1X A;  4BQM A;  2FFY A;  3IWO A;  4ZJ1 A;  3GRJ A;  4NK3 A;  2WKI A;  2XDM A;  1L0F A;  4E3L A;  3WS4 A;  2HDU A;  3RXW A;  4Q8I A;  4XUZ A;  4UA6 A;  2IWC A;  3E2L A;  3ZNT A;  5DVA A;  3LCE A;  4WEJ A;  3C5A A;  4ZDX A;  3NBL A;  1JWZ A;  3W4P A;  4P85 A;  1Y54 A;  2WK0 A;  5AQA A;  1FR1 A;  3BEB A;  3G35 A;  2XK1 A;  3W4O A;  3UY6 A;  1GHP A;  4GDN A;  4WZ5 C;  3IF6 C;  5G18 A;  5GLD A;  4R3B A;  3GVB A;  4UA9 A;  4BD1 A;  4ZBE A;  2Q9N A;  2Y55 A;  2XFS A;  4EUZ A;  5DF7 A;  1O07 A;  4KZ3 A;  4U3T A;  1XP4 A;  4EBP A;  4BL3 A;  3VP1 A;  5A92 A;  1K57 C;  4S2M A;  5IHV A;  3CJM A;  3VOZ A;  3ZVW A;  4ID4 A;  3UE0 A;  2ZM2 A;  1YLW A;  3FYZ A;  4RVA A;  4MBH A;  1HVB A;  5KSH A;  4S2L A;  2JE5 A;  2Y2H A;  5CXW A;  5GHX A;  2ZQ7 A;  1JWP A;  1QME A;  3N8S A;  4DXB A;  5EVI C;  4EBN A;  1E4D A;  2A49 A;  3VP4 A;  3S22 A;  3VP2 A;  3WS1 A;  1SHV A;  1GHM A;  1W79 A;  3CZD A;  3MZF A;  1NZO A;  3FZC A;  4LEN A;  1PI4 A;  2A3U A;  3Q07 A;  3Q82 A;  1GA0 A;  2G2W A;  3BEC A;  4QB8 A;  2WKH A;  3V3R A;  3LEZ A;  1LI9 A;  2XQZ A;  4H8R A;  2OV5 A;  3M6B A;  5DTK A;  1ESI A;  3G31 A;  3N4I A;  4ZAM A;  1ES3 A;  3PBR A;  4RA7 A;  1I2W A;  5CEC A;  1BLH A;  1EI5 A;  3D4F A;  3HBR A;  4M3K A;  3QNB A;  1MY8 A;  3SH9 A;  3BFD A;  5A93 A;  4Z9Q A;  4JPM A;  1BLS A;  3C4P A;  1YMS A;  1MWS A;  1BZA A;  2I72 A;  2ZJ9 A;  3HUO A;  4LV2 A;  3W8K A;  5A91 A;  2V2F F;  3TSG A;  1BLP A;  1JVJ A;  3A3F A;  1K38 A;  2Y2G A;  1QMF A;  3VFH A;  2JBF A;  5EOE A;  2B5R A;  4K91 A;  4Y0U A;  4DE1 A;  5DTT A;  5GHZ A;  3IT9 A;  4WM9 A;  3HLG A;  4Y7P A;  5JYP A;  1FSW A;  3BFF A;  5FQ9 A;  1KGF A;  1ES5 A;  1IKG A;  3G34 A;  4IVI A;  4GN2 A;  4WZ5 A;  2HP6 A;  3IF6 A;  4OOL A;  2QPN A;  2WAD A;  3IH9 A;  1K55 C;  3VSK A;  4KZ6 A;  4PPR A;  4A5R A;  1K57 A;  4KEN B;  4OQG A;  3ITB A;  2JCH A;  4MNR A;  3V3S A;  5HFO A;  2BG1 A;  3MZE A;  4OQI A;  1Q2Q A;  3IF6 B;  5FQJ A;  1KVL A;  3MKF A;  2C5W B;  1CEF A;  3TG9 A;  4OLD A;  5EVI A;  2WZX A;  2EFX A;  3IHB A;  2UWX A;  1ERQ A;  4DKI A;  1J9M A;  1MPL A;  1E3U A;  2Y59 A;  1ZG6 A;  4E3M A;  3ZGA B;  5D3O A;  1YT4 A;  4R4R A;  4JF4 A;  2J8Y A;  5AQB A;  3FKV A;  2Y2O A;  3IWQ A;  1TDG A;  2H0T A;  3GV9 A;  3ZVT A;  5EVI B;  2WAF A;  3PBS A;  4N9K A;  1L2S A;  2EX8 A;  3G4P A;  3SH7 A;  4MBF A;  4E3I A;  3GR2 A;  1BLC A;  3QHY A;  2EXB A;  5DF8 A;  3VSL A;  3OC2 A;  3ZCZ A;  4S2O A;  3C7U A;  3HRE A;  1SCW A;  1BUE A;  3VP0 A;  3WS0 A;  3IXH A;  4OLG A;  4PM8 A;  4DE2 A;  1HZO A;  1FOF A;  2PU4 A;  2GDN A;  3WWX A;  3HLD A;  5CGS A;  3CMZ A;  4KZ7 A;  1ES4 A;  1L0E A;  3A3E A;  1GHI A;  2DNS A;  2EX6 A;  1BT5 A;  4U0X A;  1U60 A;  3QNC A;  2P9V A;  3PBQ A;  1YLP A;  3MKE A;  2EXA A;  2QZ6 A;  1NY0 A;  3GQZ A;  2Y2L A;  3V39 A;  2VGK A;  5CHU A;  3IF5 A;  4QY6 A;  5F82 A;  3ZDJ A;  4DF6 A;  4JKT A;  3NIA A;  2X02 A;  1N4O A;  2BLS A;  3DWK A;  5CTM A;  3NY4 A;  3JYI A;  1K55 A;  2P9V B;  4IBR A;  3ZG7 B;  2Y91 A;  5FDH A;  2XF3 A;  4QY5 A;  4R23 A;  5FAO A;  4OOY A;  4C6Y A;  4IED A;  1PWC A;  3WRT A;  2ZC6 B;  3P09 A;  2ZM8 A;  5EPH A;  4E3N A;  4FSF A;  4DE3 A;  1FSY A;  2H0Y A;  2R9X A;  2WZZ A;  2ZD8 A;  3LO7 A;  1LHY A;  3LY3 A;  1K25 A;  1FCN A;  1DJB A;  4UA7 A;  3FKW A;  2HDS A;  4JF5 A;  2JC7 A;  1PWD A;  4EBL A;  4OP8 A;  3RXX A;  4PM5 A;  1YLZ A;  3VP3 A;  2Y2M A;  3UPO A;  2ZQC A;  1LLB A;  5EUA A;  4BEN A;  2WYX A;  1TVF A;  4XUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...