4H6JB

Identification of cys 255 in hif-1 as a novel site for development of covalent inhibitors of hif-1 /arnt pasb domain protein-protein interaction.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
SVCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords HYPOXIA INDUCIBLE FACTOR 1-ALPHA
publication title Identification of Cys255 in HIF-1 alpha as a novel site for development of covalent inhibitors of HIF-1 alpha /ARNT PasB domain protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4h6jB01
3LIEA 2PDRA 4K08A 4PKYG 3LI8A 2P7JA 1X0OA 2WKPA 3KX0X 4EESA 5A8BA 4HP4A 3E4QA 2J80A 4HIAA 1GSWA 3F1NB 1V9ZA 4BBUA 4WUJA 1LT0A 1TS0A 4EQ1A 1V9YA 1F9IA 4EEPA 3IS2A 2VV6A 1T1CA 1LSVA 4LPZA 2V0UA 3H82B 4L9GA 3LIBA 3LUQA 4WN5A 1S1YA 4LRYC 2W27A 2Z6DA 3MXQA 2R78A 1LSWA 2INWA 1TS8A 1Y28A 4HH3A 1P97A 1OTDA 4GS9B 1OTEA 3CLOA 5F5YA 4XT2A 2VV7A 5G4YA 4WL9A 4I39A 4HI4A 5IS1A 2EA9A 1DP6A 5HWWA 5J4EA 1ODVA 5TBMB 3ICYA 3LI9A 4RQ9A 5HWVA 3NHQA 1VB6A 3GDIA 2D01A 3RTYA 2V0WA 2ZOIA 2W0NA 1OTIA 3A0VA 2H28A 2L4RA 4I3JA 1N9OA 2QWSA 3F1OA 3UB6A 4EXOA 3A0SA 1WA9A 4HY8A 3B33A 4DJ2A 1G28A 5HWTA 4R70A 3P7NA 4I3AA 4B9OA 3F1NA 4PKYA 4GCZA 2PHYA 2WKRA 4I38A 1MZUA 4R3AA 4LRXC 2A24A 1LSXA 1KOUA 3UB9A 1OJ5A 1D7EA 2PYPA 1T1BA 3H82A 1GSXA 4KQDA 4GW9A 1D06A 4JGRA 1N9LA 3GECA 3T50A 1TS6A 5F69A 3MQQA 4H6JA 2B02A 1OJGA 4DJ3A 4NXEA 1F98A 3H7WB 4GS9A 1S4RA 3RH8B 2I9VA 3F1PB 1XJ6A 2ZOHA 3NOPC 4I3IA 4HJ6A 4E04A 3MQOA 4GHIB 1XJ4A 2OWHA 5TBMA 3CWFA 5KIZA 3PHYA 2V1AA 4HQAA 5DJUA 3UMDA 2VLGA 1GSVA 4JGPA 3NJAA 4F3LA 2WKQA 1N9NA 1XJ3A 4NXBA 4HP9A 3OLOA 2PYRA 2GJ3A 2PR5A 2HV1A 4LLOB 4KUKA 3CAXA 4HH2A 3EWKA 4WF0A 3BY9A 2ZBBA 3A0RA 5DJTA 3EEHA 4JGOA 5HD5A 5F68A 3NOTC 4EEUA 3NOUC 4NXGA 2Z6CA 5AVFA 3SW1A 5DKLA 1T1AA 1EW0A 4MN5A 2L0WA 2D02A 3LIFA 2PD8A 3FC7A 1DP9A 5G4ZA 1P0ZA 2M1CA 2VEAA 5HSQA 2QHKA 3FG8A 4HNBA 4BBVA 1TS7A 2BASA 3VE4A 1T18A 2QKPA 4JGQA 2YKHA 3K3CA 1BYWA 2L1MA 2QJ5A 5I5LA 3LIDA 1S66L 1XFQA 2JHEA 4GHIA 1UGUA 4LRZE 1DRMA 2YKFA 1S67L 3LICA 2JN7A 1UWPX 2VV8A 3H9WA 2KDKA 5HDDA 3K3DA 2V1BA 1S1ZA 2V9AA 2A24B 4BBTA 4HHDA 4MN6A 3ZQ5A 3G6OA 3MJQA 3ULFA 3IBRA 3LIAA 1T19A 4R6LA 3LYXA 4YWZA 5HZHA 4EW7A 3C8CA 5HDCA 4L9FA 2K7SA 3IS2B 3HJIA 2OWJA 3UB7A 4H6JB 1NWZA 3VOLA 2CMNA 1OTBA 1XFNA 3VE3A 3C2WA 1XJ2A 1S4SA 3BY8A 3MFXA 2PR6A 1UWNX 5DKKA 3D72A 5F6AA 4XT2B 5HDSA 4L9EA 3UE6A 4NXFA 4EETB 4F3LB 1JNUA 4KUOA 4HJ4A 2KX6A 3UB8A 1OTAA 4I5SA 4EERA 3BWLA 5AVEA 5IU1A 3HJKA 2PD7A 5HD3A 1OT9A 1DP8A 5J3WA 4WLAA 1LL8A 1OT6A 3E4PA 4HOIA 4R38A 5EFWA 4HJ3A 4M4XA 3H7WA 3F1OB 3F1PA 3E4OA 2OOLA 2QJ7A 3MR0A 3PYPA 3UMEA 5J7EA
chains in the Genus database with same CATH superfamily
4OLGA 1L3LA 3LI8A 2Q0OA 2P7JA 3IXDA 1X0OA 3UPNA 1HVBA 4JBFA 5A8BA 4HP4A 5EOOA 4HIAA 1K55A 4BWIA 1V9ZA 3S7PA 4BBUA 1JVJA 1RGYA 4NETA 3A3FA 1TS0A 2HP6A 1V9YA 4WZ4A 2IWCA 2I72A 2Y2PA 4L9GA 2W3GA 3G30A 2P74A 4ARZB 4EV4A 4X69A 3VSLA 2H0TA 1VQQA 2O99A 1S1YA 1KE3A 2HDSA 2JKFA 3G34A 4Y15A 4GS9B 1O7EA 4XT2A 2XROA 1IYOA 1SCWA 3VP1A 3JYIA 2ZL1A 3G35A 3VSKA 4XXRA 4R4RA 2RCXA 4GDBA 1ODVA 3ICYA 3V3RA 1PWCA 2E8IA 3NHQA 1WE4A 5FATA 1VB6A 2XA7S 4MEZA 3RTYA 2V0WA 4YINA 5J8XA 4R0QA 1OTIA 3DAVA 2L4RA 3FPVA 3MMHA 3MBZA 5HARA 4U0XA 3PAEA 1ALQA 4MCWA 1YLTA 5L07A 3B33A 4DJ2A 1Y54A 5HWTA 4DDSA 3P7NA 1C3BA 4CLCD 4GDNA 1PW8A 5AJGA 4GCZA 2PHYA 4MDZA 1SDEA 5EVEA 2WKRA 1I2SA 3MZEA 4KG2A 2WGVA 1LSXA 1MBLA 3DTIA 4LFUA 1W8YA 2M7UA 4GW9A 2WZZA 2PU2A 3DW0A 5EUAA 2FFFB 1OPXA 3N8SA 4S2IA 3DWZA 1BLCA 3IX4A 3A3EA 3D4FA 3T4TA 4Q8IA 3T4QA 2KOIA 3C5AA 2EX9A 2JE5A 3GECA 4N9LA 1TS6A 3M2KA 4S2LA 2B02A 1L0EA 3W4PA 1KGGA 2DNSA 1S4RA 1HD8A 5HFOA 2B5RA 1XJ6A 2XGNA 3HLBA 3V5MA 4RA7A 2Z2MB 4N9KA 4OQ0A 4E04A 1DJBA 2V20A 5DF9A 3MQOA 4X53A 2EX6A 5EVIC 3SH7A 1K54C 2OWHA 4BENA 3PHYA 3C38A 3M2JA 4HQAA 5FQMA 5DJUA 2JKRM 3DTEA 5KZHA 3UMDA 4KENB 3S7OA 1PNEA 1FR1A 3HBRA 3R7WA 2XR0A 5FDHA 3V50A 1N9NA 1XJ3A 5F1FA 4PM9A 2Y2HA 1ESUA 4JXSA 4RX2A 2H5SA 3Q7ZA 5DFYA 2PYRA 4DDYA 3ZGAB 3CMZA 4LLOB 4EBLA 5EOEA 5HW3A 1YPRA 3VFHA 1K25A 3IX3A 4KUKA 3W8KA 4HH2A 4UQIM 1XX2A 3TJZC 3PR6A 5A93A 4RX3A 4QPRA 3TRCA 4IBXA 5DJTA 2IWDA 1K56A 4A5RA 3U2AA 2QMIA 4P87A 3ITAA 3IT9A 4EEUA 3NOUC 2HZ5A 2Z6CA 5EV0A 5CX7A 3SW1A 1T1AA 4BL2A 4EUVA 5BOHA 4MN5A 4NK3A 5GLCA 4JPMA 4P85A 3EOIA 3CZDA 4UEYA 4HBTA 3W4OA 2VEAA 2ZC5B 4Q0IA 4LENA 3FG8A 4HNBA 1TS7A 5EM0A 2BASA 5FASA 2B18A 2CC1A 2YKHA 3K3CA 1PI5A 1FQGA 3BFFA 4H8RA 4E6WA 1G6OA 1Z6FA 2QPNA 4OQGA 3JVVA 3T4SA 4O0PA 1LLBA 2MJ6A 4II7A 5CGWA 3V67A 1VEUA 3GRJA 3LICA 3ZYTA 5F83A 1FCOA 2ZMFA 3CPTB 1DY6A 4FD8A 5DVAA 5EVIA 3H9WA 2KDKA 1K54A 3AGDA 5TR7A 4OOMA 3B47A 3K3DA 2V1BA 1S1ZA 3MZDA 2V9AA 3HUMA 3UPPA 5AQAA 5HAQA 1H8ZA 1S0WA 5FQIA 1NJ4A 1PZOA 4Y0OA 5GLBA 3EGXC 3ZQ5A 3G6OA 4K0WA 3ULFA 3IBRA 3UY6A 1K6SA 2Y2JA 4CQHA 4R6LA 1XKZA 2ZQDA 3C8CA 4X68A 2K7SA 4QU3A 4E3IA 2OWJA 1GHIA 2Y2NA 4H6JB 1EWZA 1Z09A 3HLFA 2DCFA 2CMNA 3BYDA 1G68A 1XFNA 3VE3A 2HJEA 4IUKA 4Y0TA 1VETA 4DXCA 4DKIA 5EE8A 3ITBA 4WZ5C 1S4SA 5L10A 2XSSA 2Y2QA 4E3JA 1CI9A 3RFBA 1W5DA 4L0LA 2GX5A 4G3WA 3CI6A 2ZMVA 3T4OA 1NYYA 3V39A 3L7HA 4O7DA 5M1AA 1WYBA 3IF6C 1DJCA 1M6KA 5CTNA 5CEDA 4PAUA 2W1RA 4C75A 3C7VA 1MXOA 5FQQA 4Y2FA 1K38A 1CEGA 5DTSA 4JKTA 1YKDA 1DP8A 5TJJA 5J3WA 4Y0UA 5I94A 1XGJA 2W3EA 1NLYA 3DBAA 1FCNA 2K31A 1AXBA 3NBLA 2QJ7A 3MR0A 3UMEA 2OAQ1 3LIEA 2ZC3B 3I7JA 3D9YA 3PBNA 1TDLA 1MWTA 3AGFA 4WBGA 3E4QA 5M19A 4UQIS 5E43A 4KZ9A 3OBFA 4D2OA 1LT0A 1NRJA 3KSHA 4GD6A 4EEPA 3IS2A 2VV6A 2WUQA 4NKPA 1T1CA 3UNWA 2QZ6A 3VMAA 2V0UA 4BJPA 3OCNA 4G3KA 4WMCD 3LUQA 4PMAA 4WN5A 3FPWA 3JPUA 2HDQA 1YT4A 5EM1A 3VOZA 4LRYC 4B88A 4FH2A 2R78A 2Y4AA 3IXHA 4OH0A 4ZJ2A 3VP3A 4EWFA 2INWA 5CERA 1TS8A 2O9CA 1W79A 3MFDA 2XEPA 1OTDA 1NRFA 3CLOA 3KSIA 5F5YA 2HGVA 3G32A 2VV7A 3UN7A 4KZ6A 4WL9A 3O86A 4F94A 4WZ5A 4I39A 4O8GA 3N7WA 5IS1A 4XUZA 1N9BA 3VP4A 2QYBA 1ESIA 2EA9A 4B4XA 5HWWA 5EPHA 5CXWA 3LI9A 3LY3A 3IF6A 4K91A 2R9XA 1CI8A 1RCJA 5FAOA 2H28A 1G5UA 3DTMA 4I3JA 1YM1A 1N9OA 4EXOA 3CHWP 2VGLS 3N6IA 1WA9A 4E3KA 4HY8A 1LL5A 1NY0A 2UV0E 4FOFA 1G28A 4Y5FA 4R70A 1GA0A 1YSPA 1P9RA 4EU0A 4ZJ1A 4LCMA 2ZM0A 4MN7A 3IH9A 1ZG4A 3N4IA 2XQZA 1K4EA 1K4FA 1MKMA 2UWXA 1H8YA 2A49A 2W3HA 1KDWA 3IF5A 1IKGA 4IBRA 3WS2A 2Y2LA 4ARZA 4KZBA 2DMWA 4ETZA 3NECA 5MC7A 3HL9A 4KZ8A 3PBQA 3T1QB 3SH8A 3T50A 4GD8A 3MQQA 2Y59A 4NXEA 4GS9A 2WGWB 4OOYA 2I9VA 3F1PB 4IUHA 3A3IA 4I3IA 4OP5A 2Y2MA 5FDSA 1XPBA 4OLDA 4GHIB 2LB9A 5KSHA 3ZG7B 5FEGA 5KIZA 1CEFA 2FZ0A 1BSGA 1E3UD 3LFVA 4DF6A 1IYQA 1TF1A 2VLGA 2VX8A 1EI5A 3CITA 4JGPA 2V8FA 3NJAA 2JC7A 4F3LA 2B95A 3UE3A 2WK0A 1TDGA 4DE1A 4HP9A 3G2ZA 2R9WA 4YOFA 1BLSA 5FI7A 3CAXA 3Q07A 5IT5A 1JWVA 3HREA 2ZBBA 3A0RA 1HTZA 3PBTA 4PM8A 4DXBA 1ZC2A 1LL9A 4E3MA 4WYYA 4LV3A 3HUOA 4RVAA 5HD5A 5F68A 4HEFA 3FKVA 2ZL1B 5DKLA 1EW0A 4S2MA 3LY4A 3WS1A 2D02A 2PD8A 2J3TC 1FSWA 1DP9A 4GN2A 4IVIA 2M1CA 1PW1A 3FV7A 4S2JA 3HLDA 2Y2IA 2OV5A 4S2PA 1O07A 1BYWA 4B93A 5L2FA 2L1MA 2OSUA 5CHJA 3LIDA 1S66L 4JF4A 2EXAA 1SKFA 3G2YA 4QJGA 1DRMA 4ZRRA 2YKFA 1S67L 4BD0A 2Q9MA 1VM1A 4N1XA 4BQMA 4D60A 1J3WA 1XP4A 3O5YA 4FUWA 4KG5A 4Y17A 1IOUA 4P6BA 3MS6A 4IVKA 4WM9A 4PPRA 3ZG8B 2P9VB 5E2GA 3E0YA 4S2NC 1XXMA 3QP5A 4MN6A 3ISGA 3BQ8A 3PBOA 3ZVWA 1ZHHB 4P0MA 3D3OA 5FI2A 3UO9A 3LIAA 1IYSA 4YNRA 4OP8A 1ONHA 1LI0A 4EW7A 2PAVP 4AFIA 3UE0A 4L9FA 1ZKJA 2Q9NA 1K57C 2ZC4B 3W2ZA 2XF3A 3BEBA 3BQAA 1FOFA 4ZAMA 2G2UA 3VOLA 1OTBA 3P98A 2HJ9C 4MNRA 5GHYA 2HP9A 5U47A 3NULA 2JKGA 1XJ2A 4E3LA 1F5MA 3C4PA 1PI4A 4GNUA 4MLLA 4Q0JA 3QHYA 2PR6A 4C3QA 3FZCA 1F2KA 3D72A 5F6AA 5HDSA 1CJFA 3GV9A 3IX8A 4L9EA 3UE6A 3S4XA 4NXFA 5EVLA 1JNUA 2XK1A 3LR5A 4R23A 3M6HA 4R1GA 4KUOA 2KLIA 5HL1A 1SHVA 5AVEA 1BLPA 3HJKA 4GLQA 5LBRA 1OT6A 3E4PA 3WWXA 4OKPA 4M4XA 3H7WA 1GHPA 3F1OB 3CPTA 2EX8A 2ZQ7A 3UPOA 1SDNA 3E4OA 2M7VA 1GA9A 3QP6A 2PU4A 5J7EA 4K08A 4WEJA 4IEDA 2WKPA 4BD1A 3KX0X 4EESA 3M6BA 2VK3A 1PWGA 1YQSA 3F1NB 4S2NA 4WUJA 2IWBA 3IQAA 1CK3A 2XRNA 2EWVA 1YSQA 3ZDJA 3DWKA 3H82B 4LV1A 4LV0A 2ZD8A 2PT7A 3LIBA 2DRWA 4NEED 4JXWA 2BG1A 2X01A 1K57A 1NZOA 4P6ZM 4KG6A 3MXQA 1BUEA 2NUPC 1LSWA 3BFGA 4QD4A 1WYCA 1W63M 1Y28A 4E3OA 5A92A 1NZUA 1ACFA 2XFSA 2ZMAA 5EVIB 5G4YA 1BZAA 4CLCC 3KYEA 4ETXA 4HI4A 1I2WA 3Q7VA 4E6XA 4OOLA 3PAGA 5J4EA 5TBMB 3B3XA 2EFUA 1W7FA 3IXGA 4R3JA 2D01A 5CGSA 3P01A 1E4DA 1TD5A 3KSGA 5FL3A 2W0NA 2HPBA 3A0VA 5FAQA 4KZ7A 3S7QA 2QWSA 3GVBA 2C6WB 3A0SA 3PTEA 1ES5A 3UE1A 3PXPA 5FQJA 2G7UA 3IWQA 1YLZA 4I3AA 1H8MA 1H0MA 4YFMA 3WS5A 1I5QA 5F82A 4B9OA 3S7NA 4PKYA 1ZG6A 3IXBA 1MZUA 4DMZA 2PBDP 3IHAA 5IHVA 2A24A 2VA0A 1KOUA 3HLWA 3N8LA 4KQRA 1N4OA 3LR0A 3O3VA 4PM7A 1OMEA 2ACGA 1GSXA 3ZG9B 2EFXA 4KQDA 3ZVTA 2WKEA 1HZOA 3T1XA 1D06A 4JGRA 4CJNA 1L0GA 5FI6A 3O87A 5CHUA 3QP8A 3KSFA 5DTKA 2Y55A 1KGEA 1K56D 1YAXA 1OJGA 4EUZA 3A3DA 1SKOA 4DN0A 4DJ3A 4Y7PA 1F98A 2X71A 1NXYA 5DTTA 3RH8B 5JYPA 4WELA 2ZOHA 1LHYA 4DRTA 4C6YA 4QWOA 3CWFA 3T4LA 1RGZA 4CLCA 3V3SA 1KDSA 4ZJ3A 3C7UA 4GB7A 1YMXA 3Q82A 3R4KA 2JKTI 2V1ZA 4GZBA 3E98A 3GTCA 2LB5A 3U4LP 1CQAA 4ZBEA 3WS0A 3ZFZA 3LR4A 1NYMA 4IJGA 2OLVA 4KZ5A 3OLOA 1MPLA 5CRFA 2HV1A 3GQZA 4N92A 1KE4A 3BFEA 4UAAA 3HUNA 1MWSA 3EWKA 4WF0A 3BLSA 3BY9A 4MBHA 3BJNA 5GHZA 4JXGA 4U3TA 5EVID 1H5XA 3O88A 4MMNA 1QMEA 4Q0HA 4LCLA 4OPZA 4HESA 3NOTC 4NXGA 1FILA 3CUEC 3Q81A 3NCKA 5AVFA 2JBFA 5E2EA 3LEZA 4P6ZS 5TFQA 3SOIA 2L0WA 5G18A 3VV4A 5KSCA 4ESPA 4JF6A 2O9AA 2HF6A 2ZQ9A 5K5BA 2W1TB 1JWZA 1P0ZA 3OOVA 4Z9QA 3A3JA 3IWIA 1IFQA 5FA7A 5HSQA 1L0FA 4BBVA 4WEKA 1PFLA 2QKPA 4EBNA 2WKHA 2VZWA 1XA7A 3AGEA 1A0KA 2WGWA 5I5LA 3T1RA 2Y79A 3QP4A 1XFQA 1K6RA 2JHEA 2GZAA 2XFTA 4GHIA 1UGUA 2VJWA 4LRZE 1J9MA 2VGKA 3HLEA 2JN7A 1PWDA 5A91A 1E25A 2VV8A 3FWLA 5DFXA 3LGOA 1IEMA 2ZJ9A 3TW8A 2WAFA 3NIAA 4KZ3A 3BM6A 4BBTA 4LV2A 4HHDA 5KMWA 2GDNA 1MY8A 1PIOA 3RXWA 3C30A 3MJQA 3EQVA 3BFCA 4FCFA 2PBYA 4FTXA 3ZNTA 1FCMA 3LYXA 3CJMA 5HZHA 4ZDXA 4FH4A 5HDCA 5M18A 3HJIA 3UB7A 3EQUA 1KGFA 1KVLA 1NWZA 3MZFA 3NDGA 2K2NA 4KQOA 2Y2KA 4Y13A 5CHMA 1DJAA 2J9PA 3MSHA 3C2WA 3UB5P 3S1YA 1BTLA 1ES2A 3CUEA 1PRQA 5GHXA 3BLMA 1UWNX 1YLWA 1M40A 4XT2B 4ZTKA 2WADA 4X56A 4EETB 4F3LB 4EQIA 5F1GA 3NC8A 2EWWA 3MKEA 2WZXA 5JYOA 4FSFA 3E2KA 4HJ4A 1ONGA 5GL9A 3UB8A 4R4SA 1JTGA 4QB8A 4I5SA 1YMSA 4R3BA 3ZHHA 5HD3A 2XD1A 4UA9A 3QNCA 4WLAA 2ZQ8A 4E3NA 1LL8A 4HOIA 3GSGA 4OPRA 5EFWA 4HJ3A 5AQBA 2Y8HA 2OOLA 2P9VA 3PYPA 2OLUA 3PBSA 2PDRA 4PKYG 2O9BA 2WKIA 3LR3A 2Z2LB 5FQ9A 2J80A 1GSWA 1K0KA 4CPKA 2P08A 3ZCZA 4EQ1A 1F9IA 3HLCA 3KYQA 1HLUP 1LSVA 4KZ4A 1AWIA 4LPZA 1L2SA 4DE3A 2ZM2A 5GLDA 3LO7A 1H3QA 4MBKA 5DF7A 2JKRI 3HCYA 4IHQA 3OPPA 2Y2OA 2G2WA 3PBRA 3OPRA 2W27A 2Z6DA 3SS3A 4Y3IA 2IA2A 3MXRA 4HH3A 1P97A 2OAP1 1OTEA 1IKIA 4BMWA 4ID4A 4UA7A 3TOIA 4XUXA 1DP6A 3T4JA 2WGIA 4RQ9A 5FAPA 3SS5A 5HWVA 3GDIA 4X55A 3TG9A 2HDUA 2ZOIA 5A90A 3R7WB 3F1OA 3UB6A 4K0XA 3SZTA 5HAIA 2J9OA 3CG5A 1S6RA 3GR2A 3ZNYA 3VFFA 1YLPA 3MF0A 1ERQA 2ZC6B 3T12B 4PHTA 4JF5A 4WMCA 5HPFA 2ZM8A 3EGDC 3F1NA 5L09A 1TEMA 1BLHA 1L0DA 1RP5A 4BLMA 1FSYA 3C4OA 4I38A 1BULA 4R3AA 4LRXC 4QY5A 2ZC7A 4JLFA 3UB9A 4UHUA 1OJ5A 1D7EA 2PYPA 1ERMA 1Y4OA 3Q1FA 1KVMA 1T1BA 4QY6A 3H82A 2RL3A 4PM6A 1P9WA 1MC0A 2WYXA 3VP2A 3GMWA 3TSGA 2HDRA 1GCEA 2E8JA 1N9LA 3B42A 3UDIA 5FQKA 2ZQAA 5F69A 3OCLA 4H6JA 3RXXA 3H7WB 1KE0A 4JXVA 2V2FF 3SS4A 4M3KA 5C5KA 3NDEA 3NOPC 3WS4A 3MKFA 4HJ6A 2VGLM 1XJ4A 4GOGA 2Y91A 1VEUB 2XD5A 2O0YA 5TBMA 3BW6A 2V1AA 3IHBA 1XGIA 3KYZA 2J8YA 3EEAA 4DE2A 1FIKA 4DE0A 3UDFA 1GSVA 5CEBA 3HVFA 4PM5A 5FSRA 2FH5A 5E2FA 1ES4A 5DF8A 5HAPA 4LGWA 3G31A 3L9KA 2WKQA 1Q2QA 3OPLA 4NXBA 4MBFA 2X02A 1XA1A 2W3DA 4BL3A 4U0TA 1MKIA 5EECA 3T1SA 2A2LA 2GJ3A 4QHCA 2PR5A 3E2LA 2W3FA 1VHMA 1FR6A 2VGJA 1QMFA 2C5WB 2NUTC 4KQQA 3EEHA 1D1JA 2V8CA 3RJUA 2VKSA 4JGOA 2XDMA 5HX9A 4KZAA 1YLYA 4NG2A 3S22A 1Q2PA 3Q7VB 4OPYA 1VETB 3FKWA 3T4KA 3P09A 1EROA 3LIFA 5L8MA 3FC7A 2P04A 5E2HA 3WRZA 2HP5A 5G4ZA 1E3UA 3W4QA 5FEFA 3LEQA 2QHKA 3QP1A 5CGXA 4X1MA 1MWUA 3QP2A 3VE4A 1T18A 4JGQA 4S2KA 5AQ9A 1JTDA 3ZG0A 2QJ5A 1CF0A 2ZLYA 3WRTA 3NI9A 5D3OA 1LI9A 1UWPX 2XA7M 4UA6A 5HL6A 3OZHA 2EXBA 5HPIA 3LCEA 5HDDA 5AQ7A 2JCHA 4GJ4A 2J3TD 2H0YA 1K55C 2A24B 4O01A 2BTFP 2XLNA 1IELA 3K2NA 3MQ0A 1T19A 1PYYA 4OQIA 4OQHA 1W63Q 4YWZA 5CTMA 5TGFA 3KO6A 1U60A 3IS2B 4S2OA 4X1LA 3G4PA 1GHMA 3UDXA 1SKOB 2EX2A 2JKTM 4HBUA 3SH9A 4G3VA 3VP0A 4EBPA 3OC2A 4OPQA 1IYPA 1STZA 2AVXA 2WAEA 3IH8A 3BRMA 4GKUA 2GNXA 3OPHA 1BT5A 1PZPA 2J7VA 3BFDA 3QNBA 4OVDA 4ME4A 3BY8A 3MFXA 2A3UA 4CLCB 2W1TA 3BECA 5DKKA 4CLCE 1ZTUA 1MWRA 1G6AA 2FFYA 4OONA 3ZG5A 2ZQCA 4X6TA 2PRFA 3FYZA 3VOYA 2BLSA 3IBJA 2XH9A 2KX6A 4B4ZA 1OTAA 5GLAA 3IF6B 1W8QA 4EERA 3BWLA 5IU1A 3N8RA 2PD7A 3HLGA 1OT9A 2H10A 1YLJA 4N1HA 3DTKA 1TVFA 3MXSA 4RYEA 4R38A 1NLZA 2Y2GA 3NY4A 4X25A 3TE8A 1SZVA 3F1PA 2J3WA 4Z1WA 5CECA 1ES3A 1JWPA 3IWOA 3JVUA
chains in the Genus database with same CATH topology
2OAQ1 3LIEA 3PBSA 2PDRA 4K08A 4PKYG 3LI8A 2O9BA 2P7JA 4WEJA 1X0OA 2WKPA 3KX0X 3PBNA 3LR3A 4EESA 5A8BA 4HP4A 3E4QA 2J80A 4HIAA 4UQIS 4BWIA 1GSWA 3F1NB 1V9ZA 3S7PA 4BBUA 3OBFA 4WUJA 2P08A 1LT0A 1TS0A 1NRJA 4EQ1A 1V9YA 1F9IA 3KSHA 4EEPA 3IS2A 2VV6A 4NKPA 3KYQA 1T1CA 2XRNA 1LSVA 2EWVA 4LPZA 1YSQA 2V0UA 4BJPA 3H82B 4L9GA 3OCNA 2W3GA 4G3KA 2PT7A 4ARZB 3LIBA 3LUQA 4NEED 1H3QA 4WN5A 2JKRI 3FPWA 3HCYA 4IHQA 2O99A 4P6ZM 1S1YA 3PBRA 4LRYC 2W27A 2Z6DA 3MXQA 2R78A 2NUPC 1LSWA 2INWA 1W63M 4Y3IA 2IA2A 1TS8A 2O9CA 1Y28A 4HH3A 1P97A 1OTDA 2OAP1 4GS9B 1OTEA 3CLOA 3KSIA 5F5YA 2HGVA 4XT2A 4BMWA 2VV7A 2XROA 5G4YA 4WL9A 4CLCC 4I39A 4O8GA 4HI4A 4ETXA 5IS1A 2QYBA 4OOLA 2EA9A 1DP6A 5HWWA 3T4JA 5J4EA 1ODVA 5TBMB 3ICYA 3LI9A 4RQ9A 5HWVA 3NHQA 1VB6A 2XA7S 3GDIA 2D01A 3RTYA 2V0WA 3P01A 1TD5A 3KSGA 5FL3A 2ZOIA 2W0NA 1OTIA 3A0VA 2H28A 2L4RA 3FPVA 4I3JA 3R7WB 1N9OA 3MMHA 3S7QA 2QWSA 3F1OA 3UB6A 4EXOA 2VGLS 3A0SA 1WA9A 4HY8A 3MF0A 4MCWA 3B33A 4DJ2A 4FOFA 1G28A 3PXPA 4PHTA 4Y5FA 5HWTA 2G7UA 4R70A 5HPFA 3P7NA 4I3AA 1YSPA 1P9RA 4EU0A 1H8MA 4CLCD 3EGDC 4MN7A 5AJGA 4B9OA 3F1NA 3S7NA 4PKYA 4GCZA 2PHYA 4MDZA 2WKRA 4I38A 1MZUA 4R3AA 4LRXC 4DMZA 1MKMA 1LSXA 2A24A 2VA0A 1KOUA 3UB9A 1OJ5A 1D7EA 2PYPA 2W3HA 3LR0A 1T1BA 3H82A 1GSXA 4KQDA 2M7UA 4GW9A 4ARZA 1D06A 2DMWA 4JGRA 4ETZA 1OPXA 5MC7A 1P9WA 1MC0A 3T4TA 3T4QA 2KOIA 1N9LA 3PBQA 3B42A 3KSFA 3GECA 3T50A 1TS6A 5F69A 3MQQA 3OCLA 4H6JA 2B02A 1YAXA 1OJGA 4DN0A 4DJ3A 4NXEA 1F98A 3H7WB 4GS9A 1S4RA 3RH8B 2I9VA 3F1PB 4IUHA 5C5KA 4WELA 1XJ6A 2ZOHA 3NOPC 4I3IA 4HJ6A 4E04A 5DF9A 3MQOA 2VGLM 4GHIB 1XJ4A 2LB9A 5KSHA 2OWHA 2O0YA 3CWFA 5TBMA 5KIZA 3BW6A 2FZ0A 3PHYA 3C38A 3T4LA 2V1AA 4HQAA 4CLCA 3KYZA 5DJUA 2JKRM 3LFVA 3EEAA 3UMDA 1TF1A 2VLGA 1GSVA 2VX8A 3S7OA 3CITA 3R4KA 2JKTI 4JGPA 3E98A 3NJAA 4F3LA 2LB5A 3R7WA 2FH5A 3UE3A 3LR4A 2WKQA 1N9NA 1XJ3A 4IJGA 4NXBA 4HP9A 2W3DA 3OLOA 4YOFA 2A2LA 5DFYA 2PYRA 2GJ3A 2PR5A 2HV1A 4LLOB 2W3FA 4KUKA 3CAXA 1VHMA 4HH2A 4UQIM 3EWKA 3PR6A 3TJZC 4WF0A 5IT5A 3BY9A 4QPRA 3BJNA 3TRCA 2ZBBA 3A0RA 2NUTC 5DJTA 3EEHA 4MMNA 3PBTA 2VKSA 4JGOA 4Q0HA 3U2AA 5HD5A 5F68A 3NOTC 4EEUA 3NOUC 4NXGA 3CUEC 2Z6CA 5AVFA 5CX7A 3SW1A 5DKLA 1T1AA 4EUVA 1EW0A 4MN5A 4P6ZS 3T4KA 2L0WA 3VV4A 2D02A 3LIFA 2O9AA 3EOIA 2HF6A 2PD8A 3FC7A 2J3TC 2P04A 5L8MA 4UEYA 5K5BA 1DP9A 5G4ZA 2W1TB 1P0ZA 3OOVA 1IFQA 2M1CA 2VEAA 5HSQA 2QHKA 4Q0IA 3FG8A 4HNBA 4BBVA 1TS7A 2BASA 4WEKA 3VE4A 1T18A 2B18A 2QKPA 4JGQA 2YKHA 3K3CA 2VZWA 1BYWA 4B93A 2L1MA 2QJ5A 5I5LA 3LIDA 1S66L 1G6OA 2Y79A 1XFQA 3JVVA 3T4SA 2JHEA 2GZAA 4GHIA 4O0PA 1UGUA 2MJ6A 2VJWA 4II7A 4LRZE 1DRMA 4ZRRA 2YKFA 1S67L 3V67A 3LICA 2JN7A 1UWPX 2XA7M 3O5YA 3ZYTA 2VV8A 5HL6A 5DFXA 2ZMFA 1IOUA 3H9WA 2KDKA 3TW8A 5HPIA 5HDDA 4OOMA 3B47A 3K3DA 2V1BA 1S1ZA 4GJ4A 2J3TD 2V9AA 2A24B 3E0YA 4BBTA 4O01A 4HHDA 4MN6A 3BQ8A 3PBOA 1ZHHB 3D3OA 3EGXC 3ZQ5A 3G6OA 3C30A 3MJQA 3ULFA 3K2NA 3IBRA 3EQVA 3LIAA 3MQ0A 4YNRA 1T19A 4CQHA 4R6LA 3LYXA 1W63Q 4YWZA 5HZHA 4EW7A 4AFIA 3KO6A 3C8CA 5HDCA 4L9FA 2K7SA 3IS2B 3HJIA 2OWJA 3W2ZA 3UB7A 3EQUA 3BQAA 4H6JB 1NWZA 3VOLA 2JKTM 2K2NA 4KQOA 2CMNA 1OTBA 4G3VA 1XFNA 2HJ9C 3VE3A 3OC2A 1STZA 2HJEA 4IUKA 3C2WA 2GNXA 1XJ2A 1S4SA 1F5MA 2XSSA 4ME4A 3BY8A 3MFXA 4Q0JA 4CLCB 3CUEA 2W1TA 2PR6A 3RFBA 4L0LA 1UWNX 2GX5A 5DKKA 4G3WA 3CI6A 2ZMVA 3D72A 5F6AA 3T4OA 4XT2B 5HDSA 4CLCE 4L9EA 1ZTUA 3UE6A 4NXFA 4EETB 4F3LB 1JNUA 3LR5A 2EWWA 4KUOA 2W1RA 4PAUA 4FSFA 3IBJA 4HJ4A 4Y2FA 2KX6A 3UB8A 1OTAA 2KLIA 4I5SA 4EERA 3BWLA 5AVEA 5IU1A 3HJKA 1YKDA 2PD7A 5HD3A 1OT9A 1DP8A 5TJJA 5J3WA 4WLAA 4GLQA 1LL8A 5LBRA 2W3EA 1OT6A 3E4PA 4HOIA 1NLYA 4R38A 1NLZA 5EFWA 3TE8A 4HJ3A 3DBAA 3H7WA 4M4XA 3F1OB 2Y8HA 3F1PA 2K31A 3E4OA 2M7VA 2J3WA 4Z1WA 2OOLA 2QJ7A 3MR0A 3PYPA 3UMEA 5J7EA 3JVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  2PDR A;  4K08 A;  4PKY G;  3LI8 A;  2P7J A;  1X0O A;  2WKP A;  3KX0 X;  4EES A;  5A8B A;  4HP4 A;  3E4Q A;  2J80 A;  4HIA A;  1GSW A;  3F1N B;  1V9Z A;  4BBU A;  4WUJ A;  1LT0 A;  1TS0 A;  4EQ1 A;  1V9Y A;  1F9I A;  4EEP A;  3IS2 A;  2VV6 A;  1T1C A;  1LSV A;  4LPZ A;  2V0U A;  3H82 B;  4L9G A;  3LIB A;  3LUQ A;  4WN5 A;  1S1Y A;  4LRY C;  2W27 A;  2Z6D A;  3MXQ A;  2R78 A;  1LSW A;  2INW A;  1TS8 A;  1Y28 A;  4HH3 A;  1P97 A;  1OTD A;  4GS9 B;  1OTE A;  3CLO A;  5F5Y A;  4XT2 A;  2VV7 A;  5G4Y A;  4WL9 A;  4I39 A;  4HI4 A;  5IS1 A;  2EA9 A;  1DP6 A;  5HWW A;  5J4E A;  1ODV A;  5TBM B;  3ICY A;  3LI9 A;  4RQ9 A;  5HWV A;  3NHQ A;  1VB6 A;  3GDI A;  2D01 A;  3RTY A;  2V0W A;  2ZOI A;  2W0N A;  1OTI A;  3A0V A;  2H28 A;  2L4R A;  4I3J A;  1N9O A;  2QWS A;  3F1O A;  3UB6 A;  4EXO A;  3A0S A;  1WA9 A;  4HY8 A;  3B33 A;  4DJ2 A;  1G28 A;  5HWT A;  4R70 A;  3P7N A;  4I3A A;  4B9O A;  3F1N A;  4PKY A;  4GCZ A;  2PHY A;  2WKR A;  4I38 A;  1MZU A;  4R3A A;  4LRX C;  2A24 A;  1LSX A;  1KOU A;  3UB9 A;  1OJ5 A;  1D7E A;  2PYP A;  1T1B A;  3H82 A;  1GSX A;  4KQD A;  4GW9 A;  1D06 A;  4JGR A;  1N9L A;  3GEC A;  3T50 A;  1TS6 A;  5F69 A;  3MQQ A;  4H6J A;  2B02 A;  1OJG A;  4DJ3 A;  4NXE A;  1F98 A;  3H7W B;  4GS9 A;  1S4R A;  3RH8 B;  2I9V A;  3F1P B;  1XJ6 A;  2ZOH A;  3NOP C;  4I3I A;  4HJ6 A;  4E04 A;  3MQO A;  4GHI B;  1XJ4 A;  2OWH A;  5TBM A;  3CWF A;  5KIZ A;  3PHY A;  2V1A A;  4HQA A;  5DJU A;  3UMD A;  2VLG A;  1GSV A;  4JGP A;  3NJA A;  4F3L A;  2WKQ A;  1N9N A;  1XJ3 A;  4NXB A;  4HP9 A;  3OLO A;  2PYR A;  2GJ3 A;  2PR5 A;  2HV1 A;  4LLO B;  4KUK A;  3CAX A;  4HH2 A;  3EWK A;  4WF0 A;  3BY9 A;  2ZBB A;  3A0R A;  5DJT A;  3EEH A;  4JGO A;  5HD5 A;  5F68 A;  3NOT C;  4EEU A;  3NOU C;  4NXG A;  2Z6C A;  5AVF A;  3SW1 A;  5DKL A;  1T1A A;  1EW0 A;  4MN5 A;  2L0W A;  2D02 A;  3LIF A;  2PD8 A;  3FC7 A;  1DP9 A;  5G4Z A;  1P0Z A;  2M1C A;  2VEA A;  5HSQ A;  2QHK A;  3FG8 A;  4HNB A;  4BBV A;  1TS7 A;  2BAS A;  3VE4 A;  1T18 A;  2QKP A;  4JGQ A;  2YKH A;  3K3C A;  1BYW A;  2L1M A;  2QJ5 A;  5I5L A;  3LID A;  1S66 L;  1XFQ A;  2JHE A;  4GHI A;  1UGU A;  4LRZ E;  1DRM A;  2YKF A;  1S67 L;  3LIC A;  2JN7 A;  1UWP X;  2VV8 A;  3H9W A;  2KDK A;  5HDD A;  3K3D A;  2V1B A;  1S1Z A;  2V9A A;  2A24 B;  4BBT A;  4HHD A;  4MN6 A;  3ZQ5 A;  3G6O A;  3MJQ A;  3ULF A;  3IBR A;  3LIA A;  1T19 A;  4R6L A;  3LYX A;  4YWZ A;  5HZH A;  4EW7 A;  3C8C A;  5HDC A;  4L9F A;  2K7S A;  3IS2 B;  3HJI A;  2OWJ A;  3UB7 A;  4H6J B;  1NWZ A;  3VOL A;  2CMN A;  1OTB A;  1XFN A;  3VE3 A;  3C2W A;  1XJ2 A;  1S4S A;  3BY8 A;  3MFX A;  2PR6 A;  1UWN X;  5DKK A;  3D72 A;  5F6A A;  4XT2 B;  5HDS A;  4L9E A;  3UE6 A;  4NXF A;  4EET B;  4F3L B;  1JNU A;  4KUO A;  4HJ4 A;  2KX6 A;  3UB8 A;  1OTA A;  4I5S A;  4EER A;  3BWL A;  5AVE A;  5IU1 A;  3HJK A;  2PD7 A;  5HD3 A;  1OT9 A;  1DP8 A;  5J3W A;  4WLA A;  1LL8 A;  1OT6 A;  3E4P A;  4HOI A;  4R38 A;  5EFW A;  4HJ3 A;  4M4X A;  3H7W A;  3F1O B;  3F1P A;  3E4O A;  2OOL A;  2QJ7 A;  3MR0 A;  3PYP A;  3UME A;  5J7E A; 
#chains in the Genus database with same CATH topology
 4OLG A;  1L3L A;  3LI8 A;  2Q0O A;  2P7J A;  3IXD A;  1X0O A;  3UPN A;  1HVB A;  4JBF A;  5A8B A;  4HP4 A;  5EOO A;  4HIA A;  1K55 A;  4BWI A;  1V9Z A;  3S7P A;  4BBU A;  1JVJ A;  1RGY A;  4NET A;  3A3F A;  1TS0 A;  2HP6 A;  1V9Y A;  4WZ4 A;  2IWC A;  2I72 A;  2Y2P A;  4L9G A;  2W3G A;  3G30 A;  2P74 A;  4ARZ B;  4EV4 A;  4X69 A;  3VSL A;  2H0T A;  1VQQ A;  2O99 A;  1S1Y A;  1KE3 A;  2HDS A;  2JKF A;  3G34 A;  4Y15 A;  4GS9 B;  1O7E A;  4XT2 A;  2XRO A;  1IYO A;  1SCW A;  3VP1 A;  3JYI A;  2ZL1 A;  3G35 A;  3VSK A;  4XXR A;  4R4R A;  2RCX A;  4GDB A;  1ODV A;  3ICY A;  3V3R A;  1PWC A;  2E8I A;  3NHQ A;  1WE4 A;  5FAT A;  1VB6 A;  2XA7 S;  4MEZ A;  3RTY A;  2V0W A;  4YIN A;  5J8X A;  4R0Q A;  1OTI A;  3DAV A;  2L4R A;  3FPV A;  3MMH A;  3MBZ A;  5HAR A;  4U0X A;  3PAE A;  1ALQ A;  4MCW A;  1YLT A;  5L07 A;  3B33 A;  4DJ2 A;  1Y54 A;  5HWT A;  4DDS A;  3P7N A;  1C3B A;  4CLC D;  4GDN A;  1PW8 A;  5AJG A;  4GCZ A;  2PHY A;  4MDZ A;  1SDE A;  5EVE A;  2WKR A;  1I2S A;  3MZE A;  4KG2 A;  2WGV A;  1LSX A;  1MBL A;  3DTI A;  4LFU A;  1W8Y A;  2M7U A;  4GW9 A;  2WZZ A;  2PU2 A;  3DW0 A;  5EUA A;  2FFF B;  1OPX A;  3N8S A;  4S2I A;  3DWZ A;  1BLC A;  3IX4 A;  3A3E A;  3D4F A;  3T4T A;  4Q8I A;  3T4Q A;  2KOI A;  3C5A A;  2EX9 A;  2JE5 A;  3GEC A;  4N9L A;  1TS6 A;  3M2K A;  4S2L A;  2B02 A;  1L0E A;  3W4P A;  1KGG A;  2DNS A;  1S4R A;  1HD8 A;  5HFO A;  2B5R A;  1XJ6 A;  2XGN A;  3HLB A;  3V5M A;  4RA7 A;  2Z2M B;  4N9K A;  4OQ0 A;  4E04 A;  1DJB A;  2V20 A;  5DF9 A;  3MQO A;  4X53 A;  2EX6 A;  5EVI C;  3SH7 A;  1K54 C;  2OWH A;  4BEN A;  3PHY A;  3C38 A;  3M2J A;  4HQA A;  5FQM A;  5DJU A;  2JKR M;  3DTE A;  5KZH A;  3UMD A;  4KEN B;  3S7O A;  1PNE A;  1FR1 A;  3HBR A;  3R7W A;  2XR0 A;  5FDH A;  3V50 A;  1N9N A;  1XJ3 A;  5F1F A;  4PM9 A;  2Y2H A;  1ESU A;  4JXS A;  4RX2 A;  2H5S A;  3Q7Z A;  5DFY A;  2PYR A;  4DDY A;  3ZGA B;  3CMZ A;  4LLO B;  4EBL A;  5EOE A;  5HW3 A;  1YPR A;  3VFH A;  1K25 A;  3IX3 A;  4KUK A;  3W8K A;  4HH2 A;  4UQI M;  1XX2 A;  3TJZ C;  3PR6 A;  5A93 A;  4RX3 A;  4QPR A;  3TRC A;  4IBX A;  5DJT A;  2IWD A;  1K56 A;  4A5R A;  3U2A A;  2QMI A;  4P87 A;  3ITA A;  3IT9 A;  4EEU A;  3NOU C;  2HZ5 A;  2Z6C A;  5EV0 A;  5CX7 A;  3SW1 A;  1T1A A;  4BL2 A;  4EUV A;  5BOH A;  4MN5 A;  4NK3 A;  5GLC A;  4JPM A;  4P85 A;  3EOI A;  3CZD A;  4UEY A;  4HBT A;  3W4O A;  2VEA A;  2ZC5 B;  4Q0I A;  4LEN A;  3FG8 A;  4HNB A;  1TS7 A;  5EM0 A;  2BAS A;  5FAS A;  2B18 A;  2CC1 A;  2YKH A;  3K3C A;  1PI5 A;  1FQG A;  3BFF A;  4H8R A;  4E6W A;  1G6O A;  1Z6F A;  2QPN A;  4OQG A;  3JVV A;  3T4S A;  4O0P A;  1LLB A;  2MJ6 A;  4II7 A;  5CGW A;  3V67 A;  1VEU A;  3GRJ A;  3LIC A;  3ZYT A;  5F83 A;  1FCO A;  2ZMF A;  3CPT B;  1DY6 A;  4FD8 A;  5DVA A;  5EVI A;  3H9W A;  2KDK A;  1K54 A;  3AGD A;  5TR7 A;  4OOM A;  3B47 A;  3K3D A;  2V1B A;  1S1Z A;  3MZD A;  2V9A A;  3HUM A;  3UPP A;  5AQA A;  5HAQ A;  1H8Z A;  1S0W A;  5FQI A;  1NJ4 A;  1PZO A;  4Y0O A;  5GLB A;  3EGX C;  3ZQ5 A;  3G6O A;  4K0W A;  3ULF A;  3IBR A;  3UY6 A;  1K6S A;  2Y2J A;  4CQH A;  4R6L A;  1XKZ A;  2ZQD A;  3C8C A;  4X68 A;  2K7S A;  4QU3 A;  4E3I A;  2OWJ A;  1GHI A;  2Y2N A;  4H6J B;  1EWZ A;  1Z09 A;  3HLF A;  2DCF A;  2CMN A;  3BYD A;  1G68 A;  1XFN A;  3VE3 A;  2HJE A;  4IUK A;  4Y0T A;  1VET A;  4DXC A;  4DKI A;  5EE8 A;  3ITB A;  4WZ5 C;  1S4S A;  5L10 A;  2XSS A;  2Y2Q A;  4E3J A;  1CI9 A;  3RFB A;  1W5D A;  4L0L A;  2GX5 A;  4G3W A;  3CI6 A;  2ZMV A;  3T4O A;  1NYY A;  3V39 A;  3L7H A;  4O7D A;  5M1A A;  1WYB A;  3IF6 C;  1DJC A;  1M6K A;  5CTN A;  5CED A;  4PAU A;  2W1R A;  4C75 A;  3C7V A;  1MXO A;  5FQQ A;  4Y2F A;  1K38 A;  1CEG A;  5DTS A;  4JKT A;  1YKD A;  1DP8 A;  5TJJ A;  5J3W A;  4Y0U A;  5I94 A;  1XGJ A;  2W3E A;  1NLY A;  3DBA A;  1FCN A;  2K31 A;  1AXB A;  3NBL A;  2QJ7 A;  3MR0 A;  3UME A;  2OAQ 1;  3LIE A;  2ZC3 B;  3I7J A;  3D9Y A;  3PBN A;  1TDL A;  1MWT A;  3AGF A;  4WBG A;  3E4Q A;  5M19 A;  4UQI S;  5E43 A;  4KZ9 A;  3OBF A;  4D2O A;  1LT0 A;  1NRJ A;  3KSH A;  4GD6 A;  4EEP A;  3IS2 A;  2VV6 A;  2WUQ A;  4NKP A;  1T1C A;  3UNW A;  2QZ6 A;  3VMA A;  2V0U A;  4BJP A;  3OCN A;  4G3K A;  4WMC D;  3LUQ A;  4PMA A;  4WN5 A;  3FPW A;  3JPU A;  2HDQ A;  1YT4 A;  5EM1 A;  3VOZ A;  4LRY C;  4B88 A;  4FH2 A;  2R78 A;  2Y4A A;  3IXH A;  4OH0 A;  4ZJ2 A;  3VP3 A;  4EWF A;  2INW A;  5CER A;  1TS8 A;  2O9C A;  1W79 A;  3MFD A;  2XEP A;  1OTD A;  1NRF A;  3CLO A;  3KSI A;  5F5Y A;  2HGV A;  3G32 A;  2VV7 A;  3UN7 A;  4KZ6 A;  4WL9 A;  3O86 A;  4F94 A;  4WZ5 A;  4I39 A;  4O8G A;  3N7W A;  5IS1 A;  4XUZ A;  1N9B A;  3VP4 A;  2QYB A;  1ESI A;  2EA9 A;  4B4X A;  5HWW A;  5EPH A;  5CXW A;  3LI9 A;  3LY3 A;  3IF6 A;  4K91 A;  2R9X A;  1CI8 A;  1RCJ A;  5FAO A;  2H28 A;  1G5U A;  3DTM A;  4I3J A;  1YM1 A;  1N9O A;  4EXO A;  3CHW P;  2VGL S;  3N6I A;  1WA9 A;  4E3K A;  4HY8 A;  1LL5 A;  1NY0 A;  2UV0 E;  4FOF A;  1G28 A;  4Y5F A;  4R70 A;  1GA0 A;  1YSP A;  1P9R A;  4EU0 A;  4ZJ1 A;  4LCM A;  2ZM0 A;  4MN7 A;  3IH9 A;  1ZG4 A;  3N4I A;  2XQZ A;  1K4E A;  1K4F A;  1MKM A;  2UWX A;  1H8Y A;  2A49 A;  2W3H A;  1KDW A;  3IF5 A;  1IKG A;  4IBR A;  3WS2 A;  2Y2L A;  4ARZ A;  4KZB A;  2DMW A;  4ETZ A;  3NEC A;  5MC7 A;  3HL9 A;  4KZ8 A;  3PBQ A;  3T1Q B;  3SH8 A;  3T50 A;  4GD8 A;  3MQQ A;  2Y59 A;  4NXE A;  4GS9 A;  2WGW B;  4OOY A;  2I9V A;  3F1P B;  4IUH A;  3A3I A;  4I3I A;  4OP5 A;  2Y2M A;  5FDS A;  1XPB A;  4OLD A;  4GHI B;  2LB9 A;  5KSH A;  3ZG7 B;  5FEG A;  5KIZ A;  1CEF A;  2FZ0 A;  1BSG A;  1E3U D;  3LFV A;  4DF6 A;  1IYQ A;  1TF1 A;  2VLG A;  2VX8 A;  1EI5 A;  3CIT A;  4JGP A;  2V8F A;  3NJA A;  2JC7 A;  4F3L A;  2B95 A;  3UE3 A;  2WK0 A;  1TDG A;  4DE1 A;  4HP9 A;  3G2Z A;  2R9W A;  4YOF A;  1BLS A;  5FI7 A;  3CAX A;  3Q07 A;  5IT5 A;  1JWV A;  3HRE A;  2ZBB A;  3A0R A;  1HTZ A;  3PBT A;  4PM8 A;  4DXB A;  1ZC2 A;  1LL9 A;  4E3M A;  4WYY A;  4LV3 A;  3HUO A;  4RVA A;  5HD5 A;  5F68 A;  4HEF A;  3FKV A;  2ZL1 B;  5DKL A;  1EW0 A;  4S2M A;  3LY4 A;  3WS1 A;  2D02 A;  2PD8 A;  2J3T C;  1FSW A;  1DP9 A;  4GN2 A;  4IVI A;  2M1C A;  1PW1 A;  3FV7 A;  4S2J A;  3HLD A;  2Y2I A;  2OV5 A;  4S2P A;  1O07 A;  1BYW A;  4B93 A;  5L2F A;  2L1M A;  2OSU A;  5CHJ A;  3LID A;  1S66 L;  4JF4 A;  2EXA A;  1SKF A;  3G2Y A;  4QJG A;  1DRM A;  4ZRR A;  2YKF A;  1S67 L;  4BD0 A;  2Q9M A;  1VM1 A;  4N1X A;  4BQM A;  4D60 A;  1J3W A;  1XP4 A;  3O5Y A;  4FUW A;  4KG5 A;  4Y17 A;  1IOU A;  4P6B A;  3MS6 A;  4IVK A;  4WM9 A;  4PPR A;  3ZG8 B;  2P9V B;  5E2G A;  3E0Y A;  4S2N C;  1XXM A;  3QP5 A;  4MN6 A;  3ISG A;  3BQ8 A;  3PBO A;  3ZVW A;  1ZHH B;  4P0M A;  3D3O A;  5FI2 A;  3UO9 A;  3LIA A;  1IYS A;  4YNR A;  4OP8 A;  1ONH A;  1LI0 A;  4EW7 A;  2PAV P;  4AFI A;  3UE0 A;  4L9F A;  1ZKJ A;  2Q9N A;  1K57 C;  2ZC4 B;  3W2Z A;  2XF3 A;  3BEB A;  3BQA A;  1FOF A;  4ZAM A;  2G2U A;  3VOL A;  1OTB A;  3P98 A;  2HJ9 C;  4MNR A;  5GHY A;  2HP9 A;  5U47 A;  3NUL A;  2JKG A;  1XJ2 A;  4E3L A;  1F5M A;  3C4P A;  1PI4 A;  4GNU A;  4MLL A;  4Q0J A;  3QHY A;  2PR6 A;  4C3Q A;  3FZC A;  1F2K A;  3D72 A;  5F6A A;  5HDS A;  1CJF A;  3GV9 A;  3IX8 A;  4L9E A;  3UE6 A;  3S4X A;  4NXF A;  5EVL A;  1JNU A;  2XK1 A;  3LR5 A;  4R23 A;  3M6H A;  4R1G A;  4KUO A;  2KLI A;  5HL1 A;  1SHV A;  5AVE A;  1BLP A;  3HJK A;  4GLQ A;  5LBR A;  1OT6 A;  3E4P A;  3WWX A;  4OKP A;  4M4X A;  3H7W A;  1GHP A;  3F1O B;  3CPT A;  2EX8 A;  2ZQ7 A;  3UPO A;  1SDN A;  3E4O A;  2M7V A;  1GA9 A;  3QP6 A;  2PU4 A;  5J7E A;  4K08 A;  4WEJ A;  4IED A;  2WKP A;  4BD1 A;  3KX0 X;  4EES A;  3M6B A;  2VK3 A;  1PWG A;  1YQS A;  3F1N B;  4S2N A;  4WUJ A;  2IWB A;  3IQA A;  1CK3 A;  2XRN A;  2EWV A;  1YSQ A;  3ZDJ A;  3DWK A;  3H82 B;  4LV1 A;  4LV0 A;  2ZD8 A;  2PT7 A;  3LIB A;  2DRW A;  4NEE D;  4JXW A;  2BG1 A;  2X01 A;  1K57 A;  1NZO A;  4P6Z M;  4KG6 A;  3MXQ A;  1BUE A;  2NUP C;  1LSW A;  3BFG A;  4QD4 A;  1WYC A;  1W63 M;  1Y28 A;  4E3O A;  5A92 A;  1NZU A;  1ACF A;  2XFS A;  2ZMA A;  5EVI B;  5G4Y A;  1BZA A;  4CLC C;  3KYE A;  4ETX A;  4HI4 A;  1I2W A;  3Q7V A;  4E6X A;  4OOL A;  3PAG A;  5J4E A;  5TBM B;  3B3X A;  2EFU A;  1W7F A;  3IXG A;  4R3J A;  2D01 A;  5CGS A;  3P01 A;  1E4D A;  1TD5 A;  3KSG A;  5FL3 A;  2W0N A;  2HPB A;  3A0V A;  5FAQ A;  4KZ7 A;  3S7Q A;  2QWS A;  3GVB A;  2C6W B;  3A0S A;  3PTE A;  1ES5 A;  3UE1 A;  3PXP A;  5FQJ A;  2G7U A;  3IWQ A;  1YLZ A;  4I3A A;  1H8M A;  1H0M A;  4YFM A;  3WS5 A;  1I5Q A;  5F82 A;  4B9O A;  3S7N A;  4PKY A;  1ZG6 A;  3IXB A;  1MZU A;  4DMZ A;  2PBD P;  3IHA A;  5IHV A;  2A24 A;  2VA0 A;  1KOU A;  3HLW A;  3N8L A;  4KQR A;  1N4O A;  3LR0 A;  3O3V A;  4PM7 A;  1OME A;  2ACG A;  1GSX A;  3ZG9 B;  2EFX A;  4KQD A;  3ZVT A;  2WKE A;  1HZO A;  3T1X A;  1D06 A;  4JGR A;  4CJN A;  1L0G A;  5FI6 A;  3O87 A;  5CHU A;  3QP8 A;  3KSF A;  5DTK A;  2Y55 A;  1KGE A;  1K56 D;  1YAX A;  1OJG A;  4EUZ A;  3A3D A;  1SKO A;  4DN0 A;  4DJ3 A;  4Y7P A;  1F98 A;  2X71 A;  1NXY A;  5DTT A;  3RH8 B;  5JYP A;  4WEL A;  2ZOH A;  1LHY A;  4DRT A;  4C6Y A;  4QWO A;  3CWF A;  3T4L A;  1RGZ A;  4CLC A;  3V3S A;  1KDS A;  4ZJ3 A;  3C7U A;  4GB7 A;  1YMX A;  3Q82 A;  3R4K A;  2JKT I;  2V1Z A;  4GZB A;  3E98 A;  3GTC A;  2LB5 A;  3U4L P;  1CQA A;  4ZBE A;  3WS0 A;  3ZFZ A;  3LR4 A;  1NYM A;  4IJG A;  2OLV A;  4KZ5 A;  3OLO A;  1MPL A;  5CRF A;  2HV1 A;  3GQZ A;  4N92 A;  1KE4 A;  3BFE A;  4UAA A;  3HUN A;  1MWS A;  3EWK A;  4WF0 A;  3BLS A;  3BY9 A;  4MBH A;  3BJN A;  5GHZ A;  4JXG A;  4U3T A;  5EVI D;  1H5X A;  3O88 A;  4MMN A;  1QME A;  4Q0H A;  4LCL A;  4OPZ A;  4HES A;  3NOT C;  4NXG A;  1FIL A;  3CUE C;  3Q81 A;  3NCK A;  5AVF A;  2JBF A;  5E2E A;  3LEZ A;  4P6Z S;  5TFQ A;  3SOI A;  2L0W A;  5G18 A;  3VV4 A;  5KSC A;  4ESP A;  4JF6 A;  2O9A A;  2HF6 A;  2ZQ9 A;  5K5B A;  2W1T B;  1JWZ A;  1P0Z A;  3OOV A;  4Z9Q A;  3A3J A;  3IWI A;  1IFQ A;  5FA7 A;  5HSQ A;  1L0F A;  4BBV A;  4WEK A;  1PFL A;  2QKP A;  4EBN A;  2WKH A;  2VZW A;  1XA7 A;  3AGE A;  1A0K A;  2WGW A;  5I5L A;  3T1R A;  2Y79 A;  3QP4 A;  1XFQ A;  1K6R A;  2JHE A;  2GZA A;  2XFT A;  4GHI A;  1UGU A;  2VJW A;  4LRZ E;  1J9M A;  2VGK A;  3HLE A;  2JN7 A;  1PWD A;  5A91 A;  1E25 A;  2VV8 A;  3FWL A;  5DFX A;  3LGO A;  1IEM A;  2ZJ9 A;  3TW8 A;  2WAF A;  3NIA A;  4KZ3 A;  3BM6 A;  4BBT A;  4LV2 A;  4HHD A;  5KMW A;  2GDN A;  1MY8 A;  1PIO A;  3RXW A;  3C30 A;  3MJQ A;  3EQV A;  3BFC A;  4FCF A;  2PBY A;  4FTX A;  3ZNT A;  1FCM A;  3LYX A;  3CJM A;  5HZH A;  4ZDX A;  4FH4 A;  5HDC A;  5M18 A;  3HJI A;  3UB7 A;  3EQU A;  1KGF A;  1KVL A;  1NWZ A;  3MZF A;  3NDG A;  2K2N A;  4KQO A;  2Y2K A;  4Y13 A;  5CHM A;  1DJA A;  2J9P A;  3MSH A;  3C2W A;  3UB5 P;  3S1Y A;  1BTL A;  1ES2 A;  3CUE A;  1PRQ A;  5GHX A;  3BLM A;  1UWN X;  1YLW A;  1M40 A;  4XT2 B;  4ZTK A;  2WAD A;  4X56 A;  4EET B;  4F3L B;  4EQI A;  5F1G A;  3NC8 A;  2EWW A;  3MKE A;  2WZX A;  5JYO A;  4FSF A;  3E2K A;  4HJ4 A;  1ONG A;  5GL9 A;  3UB8 A;  4R4S A;  1JTG A;  4QB8 A;  4I5S A;  1YMS A;  4R3B A;  3ZHH A;  5HD3 A;  2XD1 A;  4UA9 A;  3QNC A;  4WLA A;  2ZQ8 A;  4E3N A;  1LL8 A;  4HOI A;  3GSG A;  4OPR A;  5EFW A;  4HJ3 A;  5AQB A;  2Y8H A;  2OOL A;  2P9V A;  3PYP A;  2OLU A;  3PBS A;  2PDR A;  4PKY G;  2O9B A;  2WKI A;  3LR3 A;  2Z2L B;  5FQ9 A;  2J80 A;  1GSW A;  1K0K A;  4CPK A;  2P08 A;  3ZCZ A;  4EQ1 A;  1F9I A;  3HLC A;  3KYQ A;  1HLU P;  1LSV A;  4KZ4 A;  1AWI A;  4LPZ A;  1L2S A;  4DE3 A;  2ZM2 A;  5GLD A;  3LO7 A;  1H3Q A;  4MBK A;  5DF7 A;  2JKR I;  3HCY A;  4IHQ A;  3OPP A;  2Y2O A;  2G2W A;  3PBR A;  3OPR A;  2W27 A;  2Z6D A;  3SS3 A;  4Y3I A;  2IA2 A;  3MXR A;  4HH3 A;  1P97 A;  2OAP 1;  1OTE A;  1IKI A;  4BMW A;  4ID4 A;  4UA7 A;  3TOI A;  4XUX A;  1DP6 A;  3T4J A;  2WGI A;  4RQ9 A;  5FAP A;  3SS5 A;  5HWV A;  3GDI A;  4X55 A;  3TG9 A;  2HDU A;  2ZOI A;  5A90 A;  3R7W B;  3F1O A;  3UB6 A;  4K0X A;  3SZT A;  5HAI A;  2J9O A;  3CG5 A;  1S6R A;  3GR2 A;  3ZNY A;  3VFF A;  1YLP A;  3MF0 A;  1ERQ A;  2ZC6 B;  3T12 B;  4PHT A;  4JF5 A;  4WMC A;  5HPF A;  2ZM8 A;  3EGD C;  3F1N A;  5L09 A;  1TEM A;  1BLH A;  1L0D A;  1RP5 A;  4BLM A;  1FSY A;  3C4O A;  4I38 A;  1BUL A;  4R3A A;  4LRX C;  4QY5 A;  2ZC7 A;  4JLF A;  3UB9 A;  4UHU A;  1OJ5 A;  1D7E A;  2PYP A;  1ERM A;  1Y4O A;  3Q1F A;  1KVM A;  1T1B A;  4QY6 A;  3H82 A;  2RL3 A;  4PM6 A;  1P9W A;  1MC0 A;  2WYX A;  3VP2 A;  3GMW A;  3TSG A;  2HDR A;  1GCE A;  2E8J A;  1N9L A;  3B42 A;  3UDI A;  5FQK A;  2ZQA A;  5F69 A;  3OCL A;  4H6J A;  3RXX A;  3H7W B;  1KE0 A;  4JXV A;  2V2F F;  3SS4 A;  4M3K A;  5C5K A;  3NDE A;  3NOP C;  3WS4 A;  3MKF A;  4HJ6 A;  2VGL M;  1XJ4 A;  4GOG A;  2Y91 A;  1VEU B;  2XD5 A;  2O0Y A;  5TBM A;  3BW6 A;  2V1A A;  3IHB A;  1XGI A;  3KYZ A;  2J8Y A;  3EEA A;  4DE2 A;  1FIK A;  4DE0 A;  3UDF A;  1GSV A;  5CEB A;  3HVF A;  4PM5 A;  5FSR A;  2FH5 A;  5E2F A;  1ES4 A;  5DF8 A;  5HAP A;  4LGW A;  3G31 A;  3L9K A;  2WKQ A;  1Q2Q A;  3OPL A;  4NXB A;  4MBF A;  2X02 A;  1XA1 A;  2W3D A;  4BL3 A;  4U0T A;  1MKI A;  5EEC A;  3T1S A;  2A2L A;  2GJ3 A;  4QHC A;  2PR5 A;  3E2L A;  2W3F A;  1VHM A;  1FR6 A;  2VGJ A;  1QMF A;  2C5W B;  2NUT C;  4KQQ A;  3EEH A;  1D1J A;  2V8C A;  3RJU A;  2VKS A;  4JGO A;  2XDM A;  5HX9 A;  4KZA A;  1YLY A;  4NG2 A;  3S22 A;  1Q2P A;  3Q7V B;  4OPY A;  1VET B;  3FKW A;  3T4K A;  3P09 A;  1ERO A;  3LIF A;  5L8M A;  3FC7 A;  2P04 A;  5E2H A;  3WRZ A;  2HP5 A;  5G4Z A;  1E3U A;  3W4Q A;  5FEF A;  3LEQ A;  2QHK A;  3QP1 A;  5CGX A;  4X1M A;  1MWU A;  3QP2 A;  3VE4 A;  1T18 A;  4JGQ A;  4S2K A;  5AQ9 A;  1JTD A;  3ZG0 A;  2QJ5 A;  1CF0 A;  2ZLY A;  3WRT A;  3NI9 A;  5D3O A;  1LI9 A;  1UWP X;  2XA7 M;  4UA6 A;  5HL6 A;  3OZH A;  2EXB A;  5HPI A;  3LCE A;  5HDD A;  5AQ7 A;  2JCH A;  4GJ4 A;  2J3T D;  2H0Y A;  1K55 C;  2A24 B;  4O01 A;  2BTF P;  2XLN A;  1IEL A;  3K2N A;  3MQ0 A;  1T19 A;  1PYY A;  4OQI A;  4OQH A;  1W63 Q;  4YWZ A;  5CTM A;  5TGF A;  3KO6 A;  1U60 A;  3IS2 B;  4S2O A;  4X1L A;  3G4P A;  1GHM A;  3UDX A;  1SKO B;  2EX2 A;  2JKT M;  4HBU A;  3SH9 A;  4G3V A;  3VP0 A;  4EBP A;  3OC2 A;  4OPQ A;  1IYP A;  1STZ A;  2AVX A;  2WAE A;  3IH8 A;  3BRM A;  4GKU A;  2GNX A;  3OPH A;  1BT5 A;  1PZP A;  2J7V A;  3BFD A;  3QNB A;  4OVD A;  4ME4 A;  3BY8 A;  3MFX A;  2A3U A;  4CLC B;  2W1T A;  3BEC A;  5DKK A;  4CLC E;  1ZTU A;  1MWR A;  1G6A A;  2FFY A;  4OON A;  3ZG5 A;  2ZQC A;  4X6T A;  2PRF A;  3FYZ A;  3VOY A;  2BLS A;  3IBJ A;  2XH9 A;  2KX6 A;  4B4Z A;  1OTA A;  5GLA A;  3IF6 B;  1W8Q A;  4EER A;  3BWL A;  5IU1 A;  3N8R A;  2PD7 A;  3HLG A;  1OT9 A;  2H10 A;  1YLJ A;  4N1H A;  3DTK A;  1TVF A;  3MXS A;  4RYE A;  4R38 A;  1NLZ A;  2Y2G A;  3NY4 A;  4X25 A;  3TE8 A;  1SZV A;  3F1P A;  2J3W A;  4Z1W A;  5CEC A;  1ES3 A;  1JWP A;  3IWO A;  3JVU A; 
#chains in the Genus database with same CATH homology
 2OAQ 1;  3LIE A;  3PBS A;  2PDR A;  4K08 A;  4PKY G;  3LI8 A;  2O9B A;  2P7J A;  4WEJ A;  1X0O A;  2WKP A;  3KX0 X;  3PBN A;  3LR3 A;  4EES A;  5A8B A;  4HP4 A;  3E4Q A;  2J80 A;  4HIA A;  4UQI S;  4BWI A;  1GSW A;  3F1N B;  1V9Z A;  3S7P A;  4BBU A;  3OBF A;  4WUJ A;  2P08 A;  1LT0 A;  1TS0 A;  1NRJ A;  4EQ1 A;  1V9Y A;  1F9I A;  3KSH A;  4EEP A;  3IS2 A;  2VV6 A;  4NKP A;  3KYQ A;  1T1C A;  2XRN A;  1LSV A;  2EWV A;  4LPZ A;  1YSQ A;  2V0U A;  4BJP A;  3H82 B;  4L9G A;  3OCN A;  2W3G A;  4G3K A;  2PT7 A;  4ARZ B;  3LIB A;  3LUQ A;  4NEE D;  1H3Q A;  4WN5 A;  2JKR I;  3FPW A;  3HCY A;  4IHQ A;  2O99 A;  4P6Z M;  1S1Y A;  3PBR A;  4LRY C;  2W27 A;  2Z6D A;  3MXQ A;  2R78 A;  2NUP C;  1LSW A;  2INW A;  1W63 M;  4Y3I A;  2IA2 A;  1TS8 A;  2O9C A;  1Y28 A;  4HH3 A;  1P97 A;  1OTD A;  2OAP 1;  4GS9 B;  1OTE A;  3CLO A;  3KSI A;  5F5Y A;  2HGV A;  4XT2 A;  4BMW A;  2VV7 A;  2XRO A;  5G4Y A;  4WL9 A;  4CLC C;  4I39 A;  4O8G A;  4HI4 A;  4ETX A;  5IS1 A;  2QYB A;  4OOL A;  2EA9 A;  1DP6 A;  5HWW A;  3T4J A;  5J4E A;  1ODV A;  5TBM B;  3ICY A;  3LI9 A;  4RQ9 A;  5HWV A;  3NHQ A;  1VB6 A;  2XA7 S;  3GDI A;  2D01 A;  3RTY A;  2V0W A;  3P01 A;  1TD5 A;  3KSG A;  5FL3 A;  2ZOI A;  2W0N A;  1OTI A;  3A0V A;  2H28 A;  2L4R A;  3FPV A;  4I3J A;  3R7W B;  1N9O A;  3MMH A;  3S7Q A;  2QWS A;  3F1O A;  3UB6 A;  4EXO A;  2VGL S;  3A0S A;  1WA9 A;  4HY8 A;  3MF0 A;  4MCW A;  3B33 A;  4DJ2 A;  4FOF A;  1G28 A;  3PXP A;  4PHT A;  4Y5F A;  5HWT A;  2G7U A;  4R70 A;  5HPF A;  3P7N A;  4I3A A;  1YSP A;  1P9R A;  4EU0 A;  1H8M A;  4CLC D;  3EGD C;  4MN7 A;  5AJG A;  4B9O A;  3F1N A;  3S7N A;  4PKY A;  4GCZ A;  2PHY A;  4MDZ A;  2WKR A;  4I38 A;  1MZU A;  4R3A A;  4LRX C;  4DMZ A;  1MKM A;  1LSX A;  2A24 A;  2VA0 A;  1KOU A;  3UB9 A;  1OJ5 A;  1D7E A;  2PYP A;  2W3H A;  3LR0 A;  1T1B A;  3H82 A;  1GSX A;  4KQD A;  2M7U A;  4GW9 A;  4ARZ A;  1D06 A;  2DMW A;  4JGR A;  4ETZ A;  1OPX A;  5MC7 A;  1P9W A;  1MC0 A;  3T4T A;  3T4Q A;  2KOI A;  1N9L A;  3PBQ A;  3B42 A;  3KSF A;  3GEC A;  3T50 A;  1TS6 A;  5F69 A;  3MQQ A;  3OCL A;  4H6J A;  2B02 A;  1YAX A;  1OJG A;  4DN0 A;  4DJ3 A;  4NXE A;  1F98 A;  3H7W B;  4GS9 A;  1S4R A;  3RH8 B;  2I9V A;  3F1P B;  4IUH A;  5C5K A;  4WEL A;  1XJ6 A;  2ZOH A;  3NOP C;  4I3I A;  4HJ6 A;  4E04 A;  5DF9 A;  3MQO A;  2VGL M;  4GHI B;  1XJ4 A;  2LB9 A;  5KSH A;  2OWH A;  2O0Y A;  3CWF A;  5TBM A;  5KIZ A;  3BW6 A;  2FZ0 A;  3PHY A;  3C38 A;  3T4L A;  2V1A A;  4HQA A;  4CLC A;  3KYZ A;  5DJU A;  2JKR M;  3LFV A;  3EEA A;  3UMD A;  1TF1 A;  2VLG A;  1GSV A;  2VX8 A;  3S7O A;  3CIT A;  3R4K A;  2JKT I;  4JGP A;  3E98 A;  3NJA A;  4F3L A;  2LB5 A;  3R7W A;  2FH5 A;  3UE3 A;  3LR4 A;  2WKQ A;  1N9N A;  1XJ3 A;  4IJG A;  4NXB A;  4HP9 A;  2W3D A;  3OLO A;  4YOF A;  2A2L A;  5DFY A;  2PYR A;  2GJ3 A;  2PR5 A;  2HV1 A;  4LLO B;  2W3F A;  4KUK A;  3CAX A;  1VHM A;  4HH2 A;  4UQI M;  3EWK A;  3PR6 A;  3TJZ C;  4WF0 A;  5IT5 A;  3BY9 A;  4QPR A;  3BJN A;  3TRC A;  2ZBB A;  3A0R A;  2NUT C;  5DJT A;  3EEH A;  4MMN A;  3PBT A;  2VKS A;  4JGO A;  4Q0H A;  3U2A A;  5HD5 A;  5F68 A;  3NOT C;  4EEU A;  3NOU C;  4NXG A;  3CUE C;  2Z6C A;  5AVF A;  5CX7 A;  3SW1 A;  5DKL A;  1T1A A;  4EUV A;  1EW0 A;  4MN5 A;  4P6Z S;  3T4K A;  2L0W A;  3VV4 A;  2D02 A;  3LIF A;  2O9A A;  3EOI A;  2HF6 A;  2PD8 A;  3FC7 A;  2J3T C;  2P04 A;  5L8M A;  4UEY A;  5K5B A;  1DP9 A;  5G4Z A;  2W1T B;  1P0Z A;  3OOV A;  1IFQ A;  2M1C A;  2VEA A;  5HSQ A;  2QHK A;  4Q0I A;  3FG8 A;  4HNB A;  4BBV A;  1TS7 A;  2BAS A;  4WEK A;  3VE4 A;  1T18 A;  2B18 A;  2QKP A;  4JGQ A;  2YKH A;  3K3C A;  2VZW A;  1BYW A;  4B93 A;  2L1M A;  2QJ5 A;  5I5L A;  3LID A;  1S66 L;  1G6O A;  2Y79 A;  1XFQ A;  3JVV A;  3T4S A;  2JHE A;  2GZA A;  4GHI A;  4O0P A;  1UGU A;  2MJ6 A;  2VJW A;  4II7 A;  4LRZ E;  1DRM A;  4ZRR A;  2YKF A;  1S67 L;  3V67 A;  3LIC A;  2JN7 A;  1UWP X;  2XA7 M;  3O5Y A;  3ZYT A;  2VV8 A;  5HL6 A;  5DFX A;  2ZMF A;  1IOU A;  3H9W A;  2KDK A;  3TW8 A;  5HPI A;  5HDD A;  4OOM A;  3B47 A;  3K3D A;  2V1B A;  1S1Z A;  4GJ4 A;  2J3T D;  2V9A A;  2A24 B;  3E0Y A;  4BBT A;  4O01 A;  4HHD A;  4MN6 A;  3BQ8 A;  3PBO A;  1ZHH B;  3D3O A;  3EGX C;  3ZQ5 A;  3G6O A;  3C30 A;  3MJQ A;  3ULF A;  3K2N A;  3IBR A;  3EQV A;  3LIA A;  3MQ0 A;  4YNR A;  1T19 A;  4CQH A;  4R6L A;  3LYX A;  1W63 Q;  4YWZ A;  5HZH A;  4EW7 A;  4AFI A;  3KO6 A;  3C8C A;  5HDC A;  4L9F A;  2K7S A;  3IS2 B;  3HJI A;  2OWJ A;  3W2Z A;  3UB7 A;  3EQU A;  3BQA A;  4H6J B;  1NWZ A;  3VOL A;  2JKT M;  2K2N A;  4KQO A;  2CMN A;  1OTB A;  4G3V A;  1XFN A;  2HJ9 C;  3VE3 A;  3OC2 A;  1STZ A;  2HJE A;  4IUK A;  3C2W A;  2GNX A;  1XJ2 A;  1S4S A;  1F5M A;  2XSS A;  4ME4 A;  3BY8 A;  3MFX A;  4Q0J A;  4CLC B;  3CUE A;  2W1T A;  2PR6 A;  3RFB A;  4L0L A;  1UWN X;  2GX5 A;  5DKK A;  4G3W A;  3CI6 A;  2ZMV A;  3D72 A;  5F6A A;  3T4O A;  4XT2 B;  5HDS A;  4CLC E;  4L9E A;  1ZTU A;  3UE6 A;  4NXF A;  4EET B;  4F3L B;  1JNU A;  3LR5 A;  2EWW A;  4KUO A;  2W1R A;  4PAU A;  4FSF A;  3IBJ A;  4HJ4 A;  4Y2F A;  2KX6 A;  3UB8 A;  1OTA A;  2KLI A;  4I5S A;  4EER A;  3BWL A;  5AVE A;  5IU1 A;  3HJK A;  1YKD A;  2PD7 A;  5HD3 A;  1OT9 A;  1DP8 A;  5TJJ A;  5J3W A;  4WLA A;  4GLQ A;  1LL8 A;  5LBR A;  2W3E A;  1OT6 A;  3E4P A;  4HOI A;  1NLY A;  4R38 A;  1NLZ A;  5EFW A;  3TE8 A;  4HJ3 A;  3DBA A;  3H7W A;  4M4X A;  3F1O B;  2Y8H A;  3F1P A;  2K31 A;  3E4O A;  2M7V A;  2J3W A;  4Z1W A;  2OOL A;  2QJ7 A;  3MR0 A;  3PYP A;  3UME A;  5J7E A;  3JVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...