4H6JB

Identification of cys 255 in hif-1 as a novel site for development of covalent inhibitors of hif-1 /arnt pasb domain protein-protein interaction.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
SVCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYPOXIA INDUCIBLE FACTOR 1-ALPHA
publication title Identification of Cys255 in HIF-1 alpha as a novel site for development of covalent inhibitors of HIF-1 alpha /ARNT PasB domain protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4h6jB01
4LRXC 3C8CA 5DJTA 4L9FA 2OWJA 4EXOA 3MQOA 4GCZA 5KIZA 4HQAA 2WKPA 1LSXA 3H9WA 4I3IA 3A0VA 1TS0A 2M1CA 3F1NA 2L4RA 2W27A 3LI8A 2VV6A 4WUJA 3MR0A 3EWKA 4HIAA 3LIFA 4RQ9A 3UB8A 3E4OA 4EETB 4EW7A 1N9LA 1UWPX 1XFQA 4K08A 5AVFA 1DP9A 3NOTC 1OJ5A 4R6LA 3HJIA 5TBMA 4B9OA 1P97A 2WKRA 1S1YA 2PR5A 3C2WA 4HH3A 5I5LA 3CAXA 1G28A 3BWLA 3H7WA 4I3JA 2QHKA 2VV7A 1OTDA 1OTEA 5HWWA 3UB6A 3BY8A 4GHIB 4JGQA 1S4SA 3LIBA 1DRMA 3FG8A 1LT0A 4HP4A 3F1OB 3A0SA 5G4ZA 3E4PA 1T1AA 3HJKA 1VB6A 3LICA 1DP8A 2YKFA 4HP9A 1XJ4A 4E04A 5J3WA 1V9YA 3VE4A 2Z6DA 5J7EA 2QJ7A 3IS2A 3T50A 4HOIA 4JGPA 1KOUA 2QJ5A 4NXEA 3F1OA 2L0WA 5HWTA 4EEPA 4R38A 2V1AA 5G4YA 4LLOB 2V0UA 2I9VA 1N9OA 3F1PB 1GSWA 1LSVA 2PR6A 1LSWA 2PD7A 5HDCA 4I5SA 3ZQ5A 4LPZA 2PYRA 3GECA 2R78A 4KUOA 4NXBA 2PYPA 2B02A 5EFWA 1N9NA 4I38A 5F68A 2EA9A 3LYXA 2A24B 1MZUA 4LRZE 3GDIA 2HV1A 4HI4A 4XT2B 2WKQA 4NXGA 5DKLA 5IS1A 1OTBA 3F1PA 3OLOA 3VE3A 2Z6CA 2PDRA 3SW1A 1UWNX 5F6AA 1OTIA 2W0NA 4I39A 3NHQA 2QWSA 3MJQA 1S67L 3MFXA 2A24A 5HZHA 4F3LB 3G6OA 4XT2A 2D02A 3LIAA 5F69A 4EQ1A 3UMDA 4H6JB 4HH2A 1XJ6A 5J4EA 3RH8B 5HDSA 2KX6A 4WF0A 4WL9A 3EEHA 1GSXA 1S1ZA 2INWA 4F3LA 2L1MA 3FC7A 3UE6A 3K3DA 2V9AA 2BASA 2ZOIA 2GJ3A 1S4RA 2KDKA 1EW0A 4H6JA 1TS8A 2CMNA 4GHIA 3K3CA 4L9EA 5A8BA 1D7EA 1NWZA 2ZBBA 3D72A 4EEUA 3LIEA 1TS7A 4MN6A 1JNUA 1ODVA 4GS9B 5HSQA 1TS6A 4NXFA 1LL8A 5DJUA 3VOLA 4WLAA 4BBTA 2P7JA 2J80A 4MN5A 2K7SA 4HJ4A 3UB7A 3UMEA 4HJ6A 1T18A 1T19A 2V1BA 2JN7A 2V0WA 4L9GA 4WN5A 4HHDA 4EERA 3MXQA 1T1BA 4GS9A 3NOPC 3B33A 4DJ2A 3PHYA 2D01A 1F98A 2VEAA 4R3AA 4LRYC 4JGRA 1XFNA 3KX0X 1GSVA 2H28A 5TBMB 4KUKA 3LI9A 2OOLA 1XJ2A 5AVEA 1T1CA 4PKYG 3H7WB 3PYPA 2PD8A 4YWZA 3A0RA 4M4XA 4I3AA 1V9ZA 5IU1A 4HJ3A 1OJGA 4KQDA 2OWHA 3ICYA 3NOUC 2VV8A 1Y28A 2QKPA 2VLGA 4HNBA 3P7NA 5DKKA 1UGUA 1DP6A 4HY8A 3ULFA 4JGOA 4EESA 1OTAA 3IBRA 3IS2B 1OT9A 3MQQA 3CWFA 3H82B 1WA9A 5HWVA 2ZOHA 3RTYA 4GW9A 4PKYA 3NJAA 1X0OA 3UB9A 2PHYA 3BY9A 1BYWA 2JHEA 1S66L 3CLOA 3LIDA 2YKHA 5HDDA 3LUQA 5HD3A 5F5YA 1OT6A 4R70A 3E4QA 3H82A 1XJ3A 3F1NB 1F9IA 1D06A 5HD5A 4BBVA 4BBUA 1P0ZA 4DJ3A
chains in the Genus database with same CATH superfamily
4LRXC 3LR4A 4L9FA 3S22A 4GCZA 4BD0A 3T4JA 1SCWA 5TFQA 2FZ0A 4PM9A 1LI0A 3A0VA 1ZKJA 1KDSA 3G31A 2M1CA 3OC2A 4R4SA 1RP5A 4NKPA 1LL9A 1ZHHB 5KMWA 3UB8A 3E4OA 4Y7PA 4EW7A 4FUWA 4K08A 5FEGA 1K55C 3T4LA 4CLCE 2W3FA 3U2AA 1OJ5A 1VEUA 3T4QA 1GHIA 4C6YA 4XUXA 3P01A 3S7PA 3V39A 4GKUA 1P97A 4QY5A 1K56A 1OMEA 1IELA 4I3JA 1IKGA 4XUZA 2QHKA 1OTDA 3U4LP 4YOFA 4DXBA 4GN2A 1HLUP 3T4OA 3IX8A 3WS4A 1XKZA 2P04A 4HEFA 4L0LA 4RX2A 4O7DA 5DF9A 1K25A 5DFXA 1DRMA 1D1JA 1TVFA 4GDBA 1ERQA 3UPNA 4R4RA 5A92A 2RCXA 3UDIA 1SZVA 2EWVA 3T4TA 2XQZA 3LICA 3CJMA 4Q0JA 5HAIA 1G68A 4BL2A 2R9XA 1KVLA 4E6XA 2JKTM 3NY4A 2ZC4B 3VE4A 3S7OA 4MBHA 2Z6DA 3DTIA 5GLDA 1HD8A 1W63M 3MSHA 3CZDA 4KENB 2C6WB 4BLMA 3DW0A 3T1SA 1KOUA 3BFFA 2QJ5A 2L0WA 4EEPA 4KZAA 3O5YA 4YINA 4ESPA 1NRJA 4FH4A 5DVAA 2V0UA 4LV3A 1N9OA 4UA7A 1J3WA 3RXWA 5HARA 1GHPA 4RA7A 3FPWA 5IHVA 4PM8A 2G2UA 3GECA 4MN7A 4NXBA 2PYPA 1PRQA 3LY4A 4I38A 4OOLA 4OPQA 2A24B 4LRZE 2ACGA 1BULA 3IF6B 2WKQA 2ZQ9A 2V8CA 1YLYA 1Z09A 1OTBA 4P0MA 3W2ZA 1PZOA 2XLNA 4I39A 1N9BA 4DE1A 4EV4A 2JC7A 2I72A 5E43A 2M7VA 2XD1A 1EROA 5L2FA 4XT2A 1YLJA 3SZTA 3S7QA 5CEDA 5LBRA 3GVBA 5AJGA 4RX3A 1VETB 1H0MA 4MEZA 5HX9A 3ZG0A 4S2MA 2WGWB 4ZDXA 1NYMA 4NG2A 4S2LA 1GSXA 2EFUA 2WYXA 4R3BA 3FC7A 5FAPA 2V9AA 2XROA 1MWRA 1EI5A 2GZAA 4H6JA 1ERMA 3N8SA 2CMNA 2V2FF 1ALQA 4ARZB 4NK3A 1NWZA 3D72A 3T4KA 4EEUA 4MN6A 5EOOA 1ODVA 2XFSA 1JTGA 1VM1A 4NXFA 2ZMFA 2X02A 3K2NA 4ZAMA 4MN5A 5EVID 3ZHHA 3QP6A 3UB7A 4OQ0A 3UMEA 3WS2A 4HJ6A 3HLEA 2V0WA 2LB9A 4WN5A 5BOHA 4K91A 4Y3IA 1HZOA 4PPRA 3D4FA 4WZ4A 4N92A 4HHDA 3W4PA 1YM1A 2ZM0A 2ZC5B 3NOPC 1K4EA 3V5MA 4R23A 1ZTUA 3VMAA 4X25A 1BLSA 4A5RA 3QNBA 5KZHA 4JGRA 3OPHA 1K0KA 1ACFA 1K38A 4GJ4A 1XFNA 3KSHA 3PBRA 4WEKA 5TBMB 3ZG7B 1T1CA 3UDXA 3V3RA 1G6AA 3HUMA 3OPRA 4PKYG 1P9WA 3VFFA 2PD8A 1NRFA 3JVVA 2OAP1 5M18A 4S2PA 2W3GA 4EBLA 3IF6A 4HBTA 1H3QA 5IU1A 1I2WA 2W1TB 2OLUA 4HJ3A 2WUQA 3BQAA 4S2KA 2Y2GA 3HUOA 3N4IA 5CRFA 2WGVA 3BECA 3IT9A 3M2KA 3QP4A 5CXWA 1EWZA 2QKPA 3O88A 3PBNA 2XA7S 2ZC7A 1NLYA 3G2YA 4N9LA 3BJNA 2Y2QA 3HBRA 4DE2A 1YLZA 2E8JA 3BEBA 1UGUA 3ULFA 4JGOA 2XF3A 1XA1A 4ZRRA 4KZ3A 3AGEA 1VETA 5JYOA 2H10A 1XGJA 3H82B 1Y4OA 2CC1A 3O3VA 2JKRM 4Z1WA 3E2KA 5EVIC 1F2KA 4QPRA 5EVIA 1PWDA 3BY9A 2JHEA 3NDEA 3LIDA 4LV0A 2YKHA 2IWBA 1ES3A 3DWKA 5I94A 1SKOA 5HD3A 4ZJ2A 5CHMA 4OQHA 1KGFA 2XEPA 4R70A 4DRTA 5L07A 3B47A 5FI2A 2O0YA 2WKEA 2XSSA 3C8CA 3NIAA 4FSFA 5C5KA 4Q0IA 3MQOA 5KIZA 2ZLYA 4HQAA 1VQQA 1VEUB 2X01A 1M6KA 1YLPA 2DMWA 4IVIA 2ZC6B 1PIOA 2VV6A 3BFDA 3ZNYA 4WUJA 3LFVA 3UDFA 3N7WA 5AQ7A 4LCLA 1N9LA 4LV1A 2Y2HA 4WELA 5DTKA 3HLFA 1FCNA 4Y13A 3ZGAB 3KYZA 2EWWA 3SS4A 5TBMA 1NZUA 4B9OA 3PBOA 2WKRA 1S1YA 3QHYA 4HH3A 3OOVA 5I5LA 1RGZA 2DCFA 2NUTC 5M19A 3MFDA 1K56D 1RGYA 2O99A 2DNSA 3NULA 5DF8A 1ESIA 3T4SA 3UB6A 4BQMA 5CEBA 3IF5A 3BY8A 3CG5A 1E3UD 2NUPC 4GHIB 2WKHA 4N9KA 3VV4A 1PI4A 2KOIA 1Q2PA 3LIBA 2QMIA 4S2OA 3G35A 2FFYA 3L7HA 1T1AA 3HJKA 4JKTA 4KZ4A 4EU0A 1VB6A 1STZA 4HP9A 3FPVA 1Q2QA 4JXSA 2V20A 4CQHA 5FSRA 5EVLA 4LCMA 3UE0A 4OLGA 4P6ZM 2XR0A 4PHTA 1L2SA 2FFFB 1GCEA 4WEJA 2HDUA 5CERA 1PWCA 4GB7A 2VA0A 4NXEA 1YKDA 3DTEA 2XFTA 3IBJA 3IXDA 1W5DA 4KG6A 4E3IA 3Q1FA 1YMXA 4ZTKA 4R3JA 3ZG5A 4LLOB 4CJNA 1LSWA 2PD7A 1WYBA 5HDCA 2A2LA 3OBFA 3UE3A 5F1FA 2PYRA 2R78A 2B02A 5EPHA 1N4OA 3LYXA 3QP5A 4PM6A 1MZUA 1H8MA 5MC7A 4OPRA 4XT2B 2VGLS 4C3QA 4NXGA 3P98A 4OOYA 1YMSA 3F1PA 2Y59A 5IT5A 1K55A 3SW1A 1UWNX 1OTIA 2W0NA 2JKGA 3V3SA 3MJQA 3MFXA 3V67A 3G32A 5AQAA 1CK3A 5HZHA 3ZVWA 4QD4A 4BMWA 2PBDP 1G5UA 4HBUA 1E3UA 3LIAA 4G3WA 3NCKA 2JBFA 3I7JA 1GA0A 4H6JB 3VSKA 4HH2A 2HZ5A 2Q9NA 4P85A 1XJ6A 3WRZA 5HDSA 3MZFA 4WF0A 4LFUA 5CHJA 5CTMA 3EEHA 1S1ZA 1YAXA 3AGFA 2L1MA 2ZQ7A 3HUNA 3LR3A 3IXBA 2XK1A 5EECA 1NJ4A 1W63Q 2Z2MB 1S4RA 2KDKA 1EW0A 2VKSA 1W79A 4EUZA 4JPMA 2W1RA 3UO9A 1CQAA 4GHIA 4L9EA 2ZBBA 1Y54A 1I2SA 3ZNTA 1M40A 2EX6A 2J3WA 2WAFA 1JNUA 1SDEA 5HSQA 1TS6A 3LR5A 3GV9A 1A0KA 1LL8A 4O8GA 1ONGA 4X69A 2Y55A 2P9VB 3VP4A 2P7JA 2EFXA 4WBGA 4JF6A 3HL9A 4HJ4A 2HPBA 3OPPA 4X55A 3EGXC 1T19A 2V1BA 2JN7A 1L0FA 2IA2A 4QJGA 4FH2A 3D3OA 2Y79A 2J7VA 5FI6A 4DXCA 1P9RA 3QP1A 2HP9A 1T1BA 3FKWA 4GS9A 5FASA 1PNEA 1TF1A 1BSGA 3PHYA 4OONA 1F98A 4GLQA 4R3AA 4X68A 3DBAA 4Y0TA 3A3JA 1JTDA 3ITBA 3WS0A 4KUKA 2OOLA 4U0XA 3DWZA 2BG1A 3M6HA 1XPBA 1XXMA 1J9MA 1Z6FA 4X1LA 4YWZA 3S7NA 4BD1A 3O86A 4M4XA 2M7UA 4P87A 1K54C 3MKFA 1K54A 3VOZA 2WAEA 5A93A 4BJPA 5HW3A 4Y5FA 1OJGA 4KQDA 3GQZA 3CPTB 4XXRA 2B18A 5F82A 1QMEA 3PTEA 5FDHA 3RJUA 3ZG9B 5FEFA 3PBTA 3A3DA 4GDNA 3P7NA 3VSLA 2W3HA 3MZDA 4FCFA 5FQQA 3IHBA 3M2JA 5DKKA 3Q07A 5EVIB 2VZWA 1MPLA 3EOIA 4EESA 2B5RA 5HFOA 4UHUA 1H8ZA 3ZG8B 1LHYA 1SKOB 3IBRA 3IS2B 4IEDA 3MQQA 3CWFA 1WA9A 3NDGA 1YT4A 3ZVTA 2ZOHA 3ITAA 3RTYA 4GW9A 4PKYA 3NJAA 4QU3A 3MZEA 2HP6A 2Y2KA 3UB9A 4NEED 3BFGA 2PHYA 3SS3A 3FKVA 3BQ8A 4Y17A 1FSWA 4X56A 3W4QA 2EX8A 2ZJ9A 3LUQA 2OAQ1 3JPUA 5F5YA 3E4QA 2EX9A 4U3TA 3HLCA 4IJGA 4KQOA 5M1AA 1P0ZA 3LR0A 4KZ8A 4N1XA 1BLPA 4CLCC 2P9VA 2OWJA 3C7VA 2A3UA 4Y0UA 2XD5A 2WKPA 2W3EA 3TJZC 1LSXA 3H9WA 3IWIA 1DJCA 1TS0A 4O01A 2L4RA 3LEZA 4E3OA 3MR0A 1DY6A 3LIFA 4RQ9A 3VOYA 2XDMA 4EETB 3A3EA 4MLLA 1UWPX 1DP9A 1FILA 3MF0A 3NOTC 3ZDJA 2UWXA 4OPZA 4Q8IA 1CEFA 4KQQA 2Y91A 3LO7A 3ISGA 3HJIA 1TEMA 1XX2A 3C2WA 3IX3A 1G28A 2FH5A 2P74A 3KYEA 4UA6A 1K4FA 3JYIA 2EX2A 2G7UA 2DRWA 3CHWP 4OVDA 1CF0A 3CPTA 3T1XA 1S4SA 3BRMA 3DTKA 1MC0A 2Y4AA 4EBNA 3T1QB 3V50A 2Q0OA 3FG8A 1LT0A 4HP4A 2ZM8A 3QP8A 2XA7M 3A0SA 4LGWA 3E4PA 2WKIA 3LCEA 1PW1A 1MWUA 1YQSA 5A90A 4Q0HA 4DKIA 2YKFA 3B3XA 4E04A 4WM9A 5EUAA 3UPPA 1V9YA 3OCLA 2HJEA 5J8XA 5J7EA 3IS2A 3ZCZA 3T50A 2VX8A 3KSFA 2MJ6A 4HOIA 3VFHA 2JKTI 3OZHA 5F83A 2J9OA 3UNWA 3F1OA 3KYQA 3R4KA 1MWTA 2Y2MA 4R38A 1ES4A 5JYPA 3IWOA 3TRCA 5G4YA 5DTSA 3F1PB 1GSWA 1TDGA 1LSVA 1O7EA 4OP5A 5FQKA 1NXYA 4I5SA 4K0XA 3HLBA 4LPZA 4B93A 1DJBA 4KUOA 3KSIA 1PW8A 1H5XA 1BUEA 1F5MA 4HI4A 3G2ZA 1FR1A 4E3KA 5HPIA 5CX7A 1JWPA 1E25A 3Q7VA 3WRTA 1CJFA 2GX5A 5EVEA 4MBKA 3VE3A 3JVUA 2Z6CA 3HREA 1LI9A 5F6AA 3GSGA 3TSGA 5TGFA 3C5AA 4E6WA 4Z9QA 3IX4A 2IWCA 4X53A 4QHCA 1NY0A 4S2NC 5FI7A 2O9BA 4S2NA 1IOUA 3IXHA 4JBFA 4EQ1A 2KLIA 3UMDA 4DN0A 3G30A 3N8LA 1SKFA 4ZJ3A 2OLVA 5KSCA 1GA9A 3RH8B 5L09A 4KG5A 2KX6A 3UE1A 3C7UA 4EQIA 2INWA 3S1YA 4JF4A 4F3LA 2WGIA 4IBRA 2Y2NA 3PR6A 3UE6A 4OP8A 5HAPA 1IYPA 3EQUA 2BASA 2ZOIA 4MDZA 3BLMA 2GJ3A 4S2IA 3A3IA 1BLHA 5KSHA 2V1ZA 4E3NA 5EM0A 1CI8A 1PI5A 3K3CA 4D60A 1D7EA 2Y2LA 1C3BA 4GD8A 3LIEA 1SHVA 4OH0A 2VGKA 4GS9B 3PBSA 1XGIA 5DJUA 3VOLA 5G18A 4X1MA 4BBTA 3C4OA 2J80A 2RL3A 4JF5A 5CGSA 1AWIA 1KE0A 3IH8A 1YSPA 5K5BA 4YFMA 1ZG4A 1MY8A 2HDSA 3VP3A 5CECA 3HCYA 5HL6A 4EERA 3MXQA 4WZ5C 1ES5A 3SH8A 2GNXA 4B4XA 3B33A 4NETA 1FIKA 4DJ2A 4MCWA 1FSYA 3C4PA 3GMWA 2VEAA 2Y2IA 4KZ9A 2LB5A 2HGVA 4KQRA 2ZL1A 1ONHA 2H28A 1YPRA 1YSQA 2ZD8A 3OPLA 3LI9A 1BZAA 5U47A 5GHZA 5AVEA 5FQ9A 3H7WB 3PYPA 1TDLA 3T1RA 4D2OA 2PU4A 4I3AA 4G3KA 3TOIA 1V9ZA 2VGLM 1BT5A 4DMZA 1CI9A 2VK3A 4KZBA 3AGDA 2QPNA 2J9PA 2C5WB 3ICYA 3NOUC 3M6BA 1Y28A 2WADA 1KVMA 2R9WA 1KE4A 2HF6A 4HNBA 4DE3A 5DTTA 1JVJA 1ZG6A 4ME4A 1KGGA 1DP6A 4FTXA 3MKEA 1OTAA 3BLSA 4LV2A 2B95A 1G6OA 3IH9A 3QP2A 5HWVA 3R7WA 1WE4A 1FR6A 2JKRI 1XA7A 3IXGA 3MMHA 1S66L 4CLCB 2EXAA 3CLOA 5DF7A 3SH9A 2ZMAA 4OPYA 4B88A 2A49A 1I5QA 1XJ3A 4OLDA 3G34A 1F9IA 3CMZA 5HD5A 3VP1A 4BBVA 2HDRA 4GZBA 4MNRA 1YLWA 5CGWA 3IQAA 1MKMA 1H8YA 5DJTA 4PAUA 5E2GA 1BLCA 4GNUA 4EXOA 4R1GA 1ZC2A 3GTCA 1JWVA 2H0TA 1HTZA 4E3MA 5EM1A 4CLCD 4I3IA 1W8QA 4FD8A 2ZQ8A 3KO6A 1MBLA 1TD5A 3F1NA 2O9AA 2W27A 3CUEC 1IYOA 5CHUA 3LI8A 3CUEA 1L3LA 3W4OA 3EWKA 3CITA 4HIAA 3WS1A 1ESUA 1S6RA 1K6SA 3T12B 3C38A 3G4PA 2G2WA 5CTNA 4JXVA 5FAQA 4UEYA 1FQGA 3FWLA 1XFQA 2Q9MA 5AVFA 4KZ5A 4IBXA 2BTFP 4R6LA 5GLBA 3GR2A 3PXPA 4HESA 3S4XA 2ZMVA 3BFEA 2VJWA 2PR5A 4KZ6A 3CAXA 2J3TD 5A91A 3BWLA 3H7WA 3UY6A 3BM6A 2VV7A 2Y8HA 3BYDA 5GLCA 1E4DA 1OTEA 4G3VA 4F94A 1PYYA 4RVAA 5HWWA 4DF6A 4II7A 3Q81A 2Y2PA 1MXOA 4JGQA 4S2JA 2JE5A 3WS5A 3TG9A 3C30A 1BTLA 3PAGA 3F1OB 4PM7A 2WK0A 5G4ZA 4QY6A 3N6IA 2PU2A 4IHQA 1FCOA 5FQMA 1DP8A 2JKFA 3EEAA 1NZOA 1W8YA 1IKIA 3E98A 5GHYA 3E0YA 2H5SA 4M3KA 1XJ4A 4QB8A 4WMCD 3Q7ZA 4WYYA 4E3LA 4JXGA 2ZQDA 4UQIS 5J3WA 5FDSA 1PFLA 2QJ7A 4QWOA 3Q82A 3SOIA 3FYZA 4JGPA 2PRFA 2VGJA 5FL3A 1KDWA 4P6BA 5HWTA 4ZBEA 4YNRA 1VHMA 3SS5A 1ES2A 2V1AA 4ETXA 2ZM2A 1L0DA 3Q7VB 2I9VA 4CLCA 3E2LA 2PR6A 4UQIM 5L10A 3ZQ5A 3WWXA 5HL1A 4IUKA 5EFWA 1N9NA 5F68A 1DJAA 5L8MA 2EA9A 3GDIA 2HV1A 5GLAA 3LEQA 4MMNA 5FQIA 3W8KA 1KE3A 3FZCA 3CI6A 3TE8A 3MXSA 4KZ7A 1IFQA 5DKLA 5IS1A 1LL5A 2QZ6A 3OLOA 2PDRA 5GHXA 2J3TC 3MS6A 1L0GA 3NHQA 2QWSA 2PT7A 1RCJA 1S67L 2A24A 2XRNA 5AQBA 1KGEA 3OCNA 2WZXA 5HPFA 3IHAA 3ZFZA 4F3LB 3G6OA 3IF6C 3P09A 3PBQA 4IUHA 3NI9A 3HVFA 3QNCA 1PZPA 2D02A 5E2FA 2HDQA 5EE8A 5F69A 4R0QA 4PM5A 2AVXA 3GRJA 4OKPA 5J4EA 4DDSA 3UPOA 4UA9A 4WL9A 3VP2A 3SH7A 4IVKA 2HJ9C 4Y0OA 3EQVA 1PWGA 1QMFA 2IWDA 1O07A 1JWZA 5HAQA 1GHMA 2Z2LB 3L9KA 3RFBA 3K3DA 4WMCA 4O0PA 2PAVP 1CEGA 5CGXA 2UV0E 5TJJA 1TS8A 2WGWA 3LGOA 5A8BA 4GOGA 4N1HA 3O87A 2J8YA 2QYBA 3MQ0A 1TS7A 4DDYA 2O9CA 4DE0A 3D9YA 4WLAA 2K2NA 3DTMA 4AFIA 2K7SA 2ZL1B 4ARZA 2HP5A 1T18A 1IYQA 4FOFA 1L0EA 4L9GA 1U60A 4LENA 3BW6A 3A3FA 5TR7A 3KSGA 4RYEA 2D01A 2XGNA 3TW8A 1YLTA 4C75A 5F1GA 2BLSA 4LRYC 5E2HA 3VP0A 2WZZA 4K0WA 1OPXA 3KX0X 1GSVA 3DAVA 2PBYA 1IYSA 2Y2JA 4ZJ1A 4BENA 4EBPA 5FQJA 1XJ2A 3NC8A 4Y2FA 3IWQA 4GD6A 2OV5A 3A0RA 1MWSA 1IEMA 3B42A 2OSUA 4EWFA 5DFYA 1HVBA 1AXBA 5E2EA 4KG2A 4UAAA 3HLDA 4BWIA 4OQGA 1WYCA 4H8RA 1XP4A 4ETZA 2OWHA 1LLBA 4BL3A 2VV8A 1K57C 1K57A 2EXBA 2ZQAA 5GL9A 2VLGA 2XH9A 3R7WB 1FCMA 3RXXA 3MXRA 5FAOA 4Y15A 4E3JA 2K31A 4HY8A 3HLGA 1K6RA 1NYYA 2W1TA 2Y2OA 1NLZA 4P6ZS 4OOMA 5FATA 3PAEA 4MBFA 5D3OA 4CPKA 1OT9A 3NECA 5EOEA 2E8IA 3UN7A 4OQIA 4X6TA 3N8RA 4ID4A 1W7FA 2P08A 1X0OA 2ZQCA 2ZC3B 1SDNA 5AQ9A 4JLFA 1BYWA 3LY3A 5FA7A 3FV7A 4PMAA 4B4ZA 5HDDA 2GDNA 2X71A 2V8FA 4EUVA 3EGDC 3HLWA 3MBZA 1FOFA 1OT6A 1MKIA 3H82A 4U0TA 3BFCA 2JCHA 5EV0A 3F1NB 4JXWA 1D06A 1S0WA 3NBLA 2W3DA 3ZYTA 4BBUA 4DJ3A 2H0YA 3UB5P 4WZ5A
chains in the Genus database with same CATH topology
2XSSA 4LRXC 3C8CA 4CLCC 5DJTA 3LR4A 4L9FA 4FSFA 4PAUA 2OWJA 5C5KA 4Q0IA 4EXOA 3MQOA 4GCZA 5KIZA 4HQAA 3T4JA 2WKPA 2FZ0A 2W3EA 3TJZC 4CLCD 1LSXA 3H9WA 4I3IA 3A0VA 1TS0A 3KO6A 1TD5A 2M1CA 3F1NA 4O01A 2DMWA 3OC2A 2L4RA 2O9AA 2W27A 3CUEC 3LI8A 3CUEA 2VV6A 4NKPA 4WUJA 3MR0A 3EWKA 3CITA 1ZHHB 3LFVA 4HIAA 3LIFA 4RQ9A 3C38A 3UB8A 3E4OA 4EETB 4UEYA 4EW7A 1N9LA 1UWPX 1XFQA 4K08A 5AVFA 4WELA 3T4LA 1DP9A 4CLCE 3MF0A 3NOTC 2W3FA 3U2AA 1OJ5A 4R6LA 3KYZA 3PXPA 3T4QA 2EWWA 2ZMVA 3HJIA 3P01A 3S7PA 5TBMA 4B9OA 3PBOA 1P97A 2VJWA 2WKRA 1S1YA 2PR5A 3C2WA 3OOVA 4HH3A 5I5LA 3CAXA 2J3TD 1G28A 2FH5A 3BWLA 3H7WA 4I3JA 2QHKA 2VV7A 2Y8HA 1OTDA 2NUTC 1OTEA 4G3VA 4YOFA 2O99A 2G7UA 5HWWA 3T4SA 3UB6A 3T4OA 4II7A 3BY8A 2P04A 2NUPC 4GHIB 4L0LA 5DF9A 3VV4A 4JGQA 1S4SA 2KOIA 5DFXA 3LIBA 1MC0A 1DRMA 3FG8A 1LT0A 4HP4A 3C30A 3F1OB 2XA7M 3A0SA 5G4ZA 3E4PA 1T1AA 3HJKA 2EWVA 4IHQA 3T4TA 4EU0A 1VB6A 3LICA 1DP8A 1STZA 4Q0JA 3EEAA 4Q0HA 2YKFA 4HP9A 3E98A 3FPVA 3E0YA 1XJ4A 4E04A 4CQHA 4UQIS 4P6ZM 2JKTM 4PHTA 5J3WA 1V9YA 3VE4A 3OCLA 3S7OA 2HJEA 2Z6DA 5J7EA 2QJ7A 3IS2A 4WEJA 3T50A 2VX8A 3KSFA 2MJ6A 4HOIA 1W63M 2JKTI 2VA0A 4JGPA 1KOUA 2QJ5A 4NXEA 3F1OA 1YKDA 5FL3A 2L0WA 5HWTA 3IBJA 4EEPA 4YNRA 1VHMA 3KYQA 3O5YA 3R4KA 4R38A 1NRJA 2V1AA 4ETXA 3TRCA 5G4YA 4LLOB 2V0UA 2I9VA 1N9OA 4CLCA 3F1PB 1GSWA 3FPWA 1LSVA 2PR6A 1LSWA 2PD7A 4UQIM 5HDCA 4I5SA 2A2LA 3OBFA 3ZQ5A 3UE3A 4LPZA 2PYRA 4B93A 4IUKA 3GECA 2R78A 4MN7A 4KUOA 4NXBA 2PYPA 2B02A 3KSIA 1N9NA 5EFWA 4I38A 5F68A 4OOLA 5L8MA 2EA9A 3LYXA 2A24B 1MZUA 4LRZE 1F5MA 3GDIA 2HV1A 4HI4A 1H8MA 5MC7A 4XT2B 4MMNA 2VGLS 5HPIA 5CX7A 2WKQA 4NXGA 3CI6A 3TE8A 1IFQA 5DKLA 5IS1A 2GX5A 1OTBA 3F1PA 5IT5A 3OLOA 3VE3A 3JVUA 2Z6CA 2PDRA 3SW1A 1UWNX 3W2ZA 5F6AA 1OTIA 2J3TC 2W0NA 4I39A 3NHQA 2QWSA 2PT7A 3MJQA 1S67L 3MFXA 3V67A 2A24A 2XRNA 2M7VA 3OCNA 5HPFA 5HZHA 4F3LB 3G6OA 4XT2A 3PBQA 4IUHA 4BMWA 3S7QA 5LBRA 2D02A 2O9BA 1IOUA 3LIAA 4G3WA 5F69A 5AJGA 4EQ1A 2KLIA 3UMDA 4H6JB 4DN0A 4HH2A 1XJ6A 5J4EA 3RH8B 5HDSA 2KX6A 4WF0A 4WL9A 3EEHA 1GSXA 2HJ9C 1S1ZA 3EQVA 2INWA 1YAXA 4F3LA 2L1MA 3FC7A 3PR6A 3UE6A 3LR3A 3RFBA 3K3DA 2V9AA 3EQUA 2BASA 2ZOIA 4O0PA 2XROA 4MDZA 2GJ3A 1W63Q 1S4RA 2GZAA 1EW0A 2KDKA 2VKSA 4H6JA 5TJJA 1TS8A 2W1RA 5KSHA 2CMNA 4ARZB 4GHIA 3K3CA 4L9EA 5A8BA 1D7EA 1NWZA 2ZBBA 3D72A 3T4KA 4EEUA 2J3WA 2QYBA 3LIEA 1TS7A 3MQ0A 4MN6A 1JNUA 1ODVA 4GS9B 5HSQA 1TS6A 2O9CA 3PBSA 3LR5A 4NXFA 1LL8A 5DJUA 4O8GA 2ZMFA 3K2NA 3VOLA 4WLAA 4BBTA 2K2NA 2P7JA 2J80A 4MN5A 4AFIA 2K7SA 4HJ4A 3UB7A 5K5BA 1YSPA 3UMEA 4ARZA 4HJ6A 1T18A 3EGXC 1T19A 2V1BA 4FOFA 2JN7A 2V0WA 2IA2A 4L9GA 2LB9A 4WN5A 3D3OA 2Y79A 4Y3IA 3BW6A 3HCYA 3KSGA 1P9RA 4HHDA 5HL6A 4EERA 3MXQA 1T1BA 4GS9A 3NOPC 2GNXA 1ZTUA 1TF1A 3B33A 4DJ2A 4MCWA 3PHYA 2D01A 1F98A 4GLQA 2VEAA 3TW8A 4R3AA 3DBAA 4LRYC 4JGRA 2LB5A 2HGVA 4GJ4A 1OPXA 1XFNA 3KSHA 3KX0X 1GSVA 3PBRA 4WEKA 2H28A 1YSQA 5TBMB 4KUKA 3LI9A 2OOLA 1XJ2A 5AVEA 1T1CA 4Y2FA 4PKYG 1P9WA 3H7WB 3PYPA 2PD8A 3JVVA 4YWZA 3S7NA 2OAP1 3A0RA 4M4XA 2M7UA 2W3GA 3B42A 4I3AA 4G3KA 1V9ZA 1H3QA 5DFYA 2VGLM 4DMZA 4BJPA 5IU1A 2W1TB 4HJ3A 4Y5FA 1OJGA 4BWIA 3BQAA 4KQDA 4ETZA 2OWHA 2B18A 3ICYA 3NOUC 2VV8A 1Y28A 3PBTA 2QKPA 2VLGA 3PBNA 2XA7S 1NLYA 2HF6A 4HNBA 3P7NA 3R7WB 2W3HA 5DKKA 3BJNA 2K31A 2VZWA 4ME4A 3EOIA 1UGUA 1DP6A 4HY8A 3ULFA 4JGOA 4EESA 2W1TA 1OTAA 1NLZA 4P6ZS 4OOMA 4ZRRA 3IBRA 1G6OA 3IS2B 1OT9A 3MQQA 3CWFA 3H82B 1WA9A 5HWVA 2ZOHA 2JKRM 3R7WA 4Z1WA 3RTYA 2P08A 4GW9A 4PKYA 3NJAA 1X0OA 3UB9A 4NEED 4QPRA 2PHYA 2JKRI 3BY9A 1BYWA 3MMHA 2JHEA 1S66L 3BQ8A 4CLCB 3CLOA 3LIDA 2YKHA 5HDDA 4EUVA 3LUQA 5HD3A 2OAQ1 3EGDC 5F5YA 1OT6A 4R70A 3E4QA 3H82A 1XJ3A 3B47A 3F1NB 2O0YA 1F9IA 1D06A 4IJGA 5HD5A 4BBVA 4KQOA 2W3DA 3ZYTA 4BBUA 1P0ZA 4DJ3A 3LR0A 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRX C;  3C8C A;  5DJT A;  4L9F A;  2OWJ A;  4EXO A;  3MQO A;  4GCZ A;  5KIZ A;  4HQA A;  2WKP A;  1LSX A;  3H9W A;  4I3I A;  3A0V A;  1TS0 A;  2M1C A;  3F1N A;  2L4R A;  2W27 A;  3LI8 A;  2VV6 A;  4WUJ A;  3MR0 A;  3EWK A;  4HIA A;  3LIF A;  4RQ9 A;  3UB8 A;  3E4O A;  4EET B;  4EW7 A;  1N9L A;  1UWP X;  1XFQ A;  4K08 A;  5AVF A;  1DP9 A;  3NOT C;  1OJ5 A;  4R6L A;  3HJI A;  5TBM A;  4B9O A;  1P97 A;  2WKR A;  1S1Y A;  2PR5 A;  3C2W A;  4HH3 A;  5I5L A;  3CAX A;  1G28 A;  3BWL A;  3H7W A;  4I3J A;  2QHK A;  2VV7 A;  1OTD A;  1OTE A;  5HWW A;  3UB6 A;  3BY8 A;  4GHI B;  4JGQ A;  1S4S A;  3LIB A;  1DRM A;  3FG8 A;  1LT0 A;  4HP4 A;  3F1O B;  3A0S A;  5G4Z A;  3E4P A;  1T1A A;  3HJK A;  1VB6 A;  3LIC A;  1DP8 A;  2YKF A;  4HP9 A;  1XJ4 A;  4E04 A;  5J3W A;  1V9Y A;  3VE4 A;  2Z6D A;  5J7E A;  2QJ7 A;  3IS2 A;  3T50 A;  4HOI A;  4JGP A;  1KOU A;  2QJ5 A;  4NXE A;  3F1O A;  2L0W A;  5HWT A;  4EEP A;  4R38 A;  2V1A A;  5G4Y A;  4LLO B;  2V0U A;  2I9V A;  1N9O A;  3F1P B;  1GSW A;  1LSV A;  2PR6 A;  1LSW A;  2PD7 A;  5HDC A;  4I5S A;  3ZQ5 A;  4LPZ A;  2PYR A;  3GEC A;  2R78 A;  4KUO A;  4NXB A;  2PYP A;  2B02 A;  5EFW A;  1N9N A;  4I38 A;  5F68 A;  2EA9 A;  3LYX A;  2A24 B;  1MZU A;  4LRZ E;  3GDI A;  2HV1 A;  4HI4 A;  4XT2 B;  2WKQ A;  4NXG A;  5DKL A;  5IS1 A;  1OTB A;  3F1P A;  3OLO A;  3VE3 A;  2Z6C A;  2PDR A;  3SW1 A;  1UWN X;  5F6A A;  1OTI A;  2W0N A;  4I39 A;  3NHQ A;  2QWS A;  3MJQ A;  1S67 L;  3MFX A;  2A24 A;  5HZH A;  4F3L B;  3G6O A;  4XT2 A;  2D02 A;  3LIA A;  5F69 A;  4EQ1 A;  3UMD A;  4H6J B;  4HH2 A;  1XJ6 A;  5J4E A;  3RH8 B;  5HDS A;  2KX6 A;  4WF0 A;  4WL9 A;  3EEH A;  1GSX A;  1S1Z A;  2INW A;  4F3L A;  2L1M A;  3FC7 A;  3UE6 A;  3K3D A;  2V9A A;  2BAS A;  2ZOI A;  2GJ3 A;  1S4R A;  2KDK A;  1EW0 A;  4H6J A;  1TS8 A;  2CMN A;  4GHI A;  3K3C A;  4L9E A;  5A8B A;  1D7E A;  1NWZ A;  2ZBB A;  3D72 A;  4EEU A;  3LIE A;  1TS7 A;  4MN6 A;  1JNU A;  1ODV A;  4GS9 B;  5HSQ A;  1TS6 A;  4NXF A;  1LL8 A;  5DJU A;  3VOL A;  4WLA A;  4BBT A;  2P7J A;  2J80 A;  4MN5 A;  2K7S A;  4HJ4 A;  3UB7 A;  3UME A;  4HJ6 A;  1T18 A;  1T19 A;  2V1B A;  2JN7 A;  2V0W A;  4L9G A;  4WN5 A;  4HHD A;  4EER A;  3MXQ A;  1T1B A;  4GS9 A;  3NOP C;  3B33 A;  4DJ2 A;  3PHY A;  2D01 A;  1F98 A;  2VEA A;  4R3A A;  4LRY C;  4JGR A;  1XFN A;  3KX0 X;  1GSV A;  2H28 A;  5TBM B;  4KUK A;  3LI9 A;  2OOL A;  1XJ2 A;  5AVE A;  1T1C A;  4PKY G;  3H7W B;  3PYP A;  2PD8 A;  4YWZ A;  3A0R A;  4M4X A;  4I3A A;  1V9Z A;  5IU1 A;  4HJ3 A;  1OJG A;  4KQD A;  2OWH A;  3ICY A;  3NOU C;  2VV8 A;  1Y28 A;  2QKP A;  2VLG A;  4HNB A;  3P7N A;  5DKK A;  1UGU A;  1DP6 A;  4HY8 A;  3ULF A;  4JGO A;  4EES A;  1OTA A;  3IBR A;  3IS2 B;  1OT9 A;  3MQQ A;  3CWF A;  3H82 B;  1WA9 A;  5HWV A;  2ZOH A;  3RTY A;  4GW9 A;  4PKY A;  3NJA A;  1X0O A;  3UB9 A;  2PHY A;  3BY9 A;  1BYW A;  2JHE A;  1S66 L;  3CLO A;  3LID A;  2YKH A;  5HDD A;  3LUQ A;  5HD3 A;  5F5Y A;  1OT6 A;  4R70 A;  3E4Q A;  3H82 A;  1XJ3 A;  3F1N B;  1F9I A;  1D06 A;  5HD5 A;  4BBV A;  4BBU A;  1P0Z A;  4DJ3 A; 
#chains in the Genus database with same CATH topology
 4LRX C;  3LR4 A;  4L9F A;  3S22 A;  4GCZ A;  4BD0 A;  3T4J A;  1SCW A;  5TFQ A;  2FZ0 A;  4PM9 A;  1LI0 A;  3A0V A;  1ZKJ A;  1KDS A;  3G31 A;  2M1C A;  3OC2 A;  4R4S A;  1RP5 A;  4NKP A;  1LL9 A;  1ZHH B;  5KMW A;  3UB8 A;  3E4O A;  4Y7P A;  4EW7 A;  4FUW A;  4K08 A;  5FEG A;  1K55 C;  3T4L A;  4CLC E;  2W3F A;  3U2A A;  1OJ5 A;  1VEU A;  3T4Q A;  1GHI A;  4C6Y A;  4XUX A;  3P01 A;  3S7P A;  3V39 A;  4GKU A;  1P97 A;  4QY5 A;  1K56 A;  1OME A;  1IEL A;  4I3J A;  1IKG A;  4XUZ A;  2QHK A;  1OTD A;  3U4L P;  4YOF A;  4DXB A;  4GN2 A;  1HLU P;  3T4O A;  3IX8 A;  3WS4 A;  1XKZ A;  2P04 A;  4HEF A;  4L0L A;  4RX2 A;  4O7D A;  5DF9 A;  1K25 A;  5DFX A;  1DRM A;  1D1J A;  1TVF A;  4GDB A;  1ERQ A;  3UPN A;  4R4R A;  5A92 A;  2RCX A;  3UDI A;  1SZV A;  2EWV A;  3T4T A;  2XQZ A;  3LIC A;  3CJM A;  4Q0J A;  5HAI A;  1G68 A;  4BL2 A;  2R9X A;  1KVL A;  4E6X A;  2JKT M;  3NY4 A;  2ZC4 B;  3VE4 A;  3S7O A;  4MBH A;  2Z6D A;  3DTI A;  5GLD A;  1HD8 A;  1W63 M;  3MSH A;  3CZD A;  4KEN B;  2C6W B;  4BLM A;  3DW0 A;  3T1S A;  1KOU A;  3BFF A;  2QJ5 A;  2L0W A;  4EEP A;  4KZA A;  3O5Y A;  4YIN A;  4ESP A;  1NRJ A;  4FH4 A;  5DVA A;  2V0U A;  4LV3 A;  1N9O A;  4UA7 A;  1J3W A;  3RXW A;  5HAR A;  1GHP A;  4RA7 A;  3FPW A;  5IHV A;  4PM8 A;  2G2U A;  3GEC A;  4MN7 A;  4NXB A;  2PYP A;  1PRQ A;  3LY4 A;  4I38 A;  4OOL A;  4OPQ A;  2A24 B;  4LRZ E;  2ACG A;  1BUL A;  3IF6 B;  2WKQ A;  2ZQ9 A;  2V8C A;  1YLY A;  1Z09 A;  1OTB A;  4P0M A;  3W2Z A;  1PZO A;  2XLN A;  4I39 A;  1N9B A;  4DE1 A;  4EV4 A;  2JC7 A;  2I72 A;  5E43 A;  2M7V A;  2XD1 A;  1ERO A;  5L2F A;  4XT2 A;  1YLJ A;  3SZT A;  3S7Q A;  5CED A;  5LBR A;  3GVB A;  5AJG A;  4RX3 A;  1VET B;  1H0M A;  4MEZ A;  5HX9 A;  3ZG0 A;  4S2M A;  2WGW B;  4ZDX A;  1NYM A;  4NG2 A;  4S2L A;  1GSX A;  2EFU A;  2WYX A;  4R3B A;  3FC7 A;  5FAP A;  2V9A A;  2XRO A;  1MWR A;  1EI5 A;  2GZA A;  4H6J A;  1ERM A;  3N8S A;  2CMN A;  2V2F F;  1ALQ A;  4ARZ B;  4NK3 A;  1NWZ A;  3D72 A;  3T4K A;  4EEU A;  4MN6 A;  5EOO A;  1ODV A;  2XFS A;  1JTG A;  1VM1 A;  4NXF A;  2ZMF A;  2X02 A;  3K2N A;  4ZAM A;  4MN5 A;  5EVI D;  3ZHH A;  3QP6 A;  3UB7 A;  4OQ0 A;  3UME A;  3WS2 A;  4HJ6 A;  3HLE A;  2V0W A;  2LB9 A;  4WN5 A;  5BOH A;  4K91 A;  4Y3I A;  1HZO A;  4PPR A;  3D4F A;  4WZ4 A;  4N92 A;  4HHD A;  3W4P A;  1YM1 A;  2ZM0 A;  2ZC5 B;  3NOP C;  1K4E A;  3V5M A;  4R23 A;  1ZTU A;  3VMA A;  4X25 A;  1BLS A;  4A5R A;  3QNB A;  5KZH A;  4JGR A;  3OPH A;  1K0K A;  1ACF A;  1K38 A;  4GJ4 A;  1XFN A;  3KSH A;  3PBR A;  4WEK A;  5TBM B;  3ZG7 B;  1T1C A;  3UDX A;  3V3R A;  1G6A A;  3HUM A;  3OPR A;  4PKY G;  1P9W A;  3VFF A;  2PD8 A;  1NRF A;  3JVV A;  2OAP 1;  5M18 A;  4S2P A;  2W3G A;  4EBL A;  3IF6 A;  4HBT A;  1H3Q A;  5IU1 A;  1I2W A;  2W1T B;  2OLU A;  4HJ3 A;  2WUQ A;  3BQA A;  4S2K A;  2Y2G A;  3HUO A;  3N4I A;  5CRF A;  2WGV A;  3BEC A;  3IT9 A;  3M2K A;  3QP4 A;  5CXW A;  1EWZ A;  2QKP A;  3O88 A;  3PBN A;  2XA7 S;  2ZC7 A;  1NLY A;  3G2Y A;  4N9L A;  3BJN A;  2Y2Q A;  3HBR A;  4DE2 A;  1YLZ A;  2E8J A;  3BEB A;  1UGU A;  3ULF A;  4JGO A;  2XF3 A;  1XA1 A;  4ZRR A;  4KZ3 A;  3AGE A;  1VET A;  5JYO A;  2H10 A;  1XGJ A;  3H82 B;  1Y4O A;  2CC1 A;  3O3V A;  2JKR M;  4Z1W A;  3E2K A;  5EVI C;  1F2K A;  4QPR A;  5EVI A;  1PWD A;  3BY9 A;  2JHE A;  3NDE A;  3LID A;  4LV0 A;  2YKH A;  2IWB A;  1ES3 A;  3DWK A;  5I94 A;  1SKO A;  5HD3 A;  4ZJ2 A;  5CHM A;  4OQH A;  1KGF A;  2XEP A;  4R70 A;  4DRT A;  5L07 A;  3B47 A;  5FI2 A;  2O0Y A;  2WKE A;  2XSS A;  3C8C A;  3NIA A;  4FSF A;  5C5K A;  4Q0I A;  3MQO A;  5KIZ A;  2ZLY A;  4HQA A;  1VQQ A;  1VEU B;  2X01 A;  1M6K A;  1YLP A;  2DMW A;  4IVI A;  2ZC6 B;  1PIO A;  2VV6 A;  3BFD A;  3ZNY A;  4WUJ A;  3LFV A;  3UDF A;  3N7W A;  5AQ7 A;  4LCL A;  1N9L A;  4LV1 A;  2Y2H A;  4WEL A;  5DTK A;  3HLF A;  1FCN A;  4Y13 A;  3ZGA B;  3KYZ A;  2EWW A;  3SS4 A;  5TBM A;  1NZU A;  4B9O A;  3PBO A;  2WKR A;  1S1Y A;  3QHY A;  4HH3 A;  3OOV A;  5I5L A;  1RGZ A;  2DCF A;  2NUT C;  5M19 A;  3MFD A;  1K56 D;  1RGY A;  2O99 A;  2DNS A;  3NUL A;  5DF8 A;  1ESI A;  3T4S A;  3UB6 A;  4BQM A;  5CEB A;  3IF5 A;  3BY8 A;  3CG5 A;  1E3U D;  2NUP C;  4GHI B;  2WKH A;  4N9K A;  3VV4 A;  1PI4 A;  2KOI A;  1Q2P A;  3LIB A;  2QMI A;  4S2O A;  3G35 A;  2FFY A;  3L7H A;  1T1A A;  3HJK A;  4JKT A;  4KZ4 A;  4EU0 A;  1VB6 A;  1STZ A;  4HP9 A;  3FPV A;  1Q2Q A;  4JXS A;  2V20 A;  4CQH A;  5FSR A;  5EVL A;  4LCM A;  3UE0 A;  4OLG A;  4P6Z M;  2XR0 A;  4PHT A;  1L2S A;  2FFF B;  1GCE A;  4WEJ A;  2HDU A;  5CER A;  1PWC A;  4GB7 A;  2VA0 A;  4NXE A;  1YKD A;  3DTE A;  2XFT A;  3IBJ A;  3IXD A;  1W5D A;  4KG6 A;  4E3I A;  3Q1F A;  1YMX A;  4ZTK A;  4R3J A;  3ZG5 A;  4LLO B;  4CJN A;  1LSW A;  2PD7 A;  1WYB A;  5HDC A;  2A2L A;  3OBF A;  3UE3 A;  5F1F A;  2PYR A;  2R78 A;  2B02 A;  5EPH A;  1N4O A;  3LYX A;  3QP5 A;  4PM6 A;  1MZU A;  1H8M A;  5MC7 A;  4OPR A;  4XT2 B;  2VGL S;  4C3Q A;  4NXG A;  3P98 A;  4OOY A;  1YMS A;  3F1P A;  2Y59 A;  5IT5 A;  1K55 A;  3SW1 A;  1UWN X;  1OTI A;  2W0N A;  2JKG A;  3V3S A;  3MJQ A;  3MFX A;  3V67 A;  3G32 A;  5AQA A;  1CK3 A;  5HZH A;  3ZVW A;  4QD4 A;  4BMW A;  2PBD P;  1G5U A;  4HBU A;  1E3U A;  3LIA A;  4G3W A;  3NCK A;  2JBF A;  3I7J A;  1GA0 A;  4H6J B;  3VSK A;  4HH2 A;  2HZ5 A;  2Q9N A;  4P85 A;  1XJ6 A;  3WRZ A;  5HDS A;  3MZF A;  4WF0 A;  4LFU A;  5CHJ A;  5CTM A;  3EEH A;  1S1Z A;  1YAX A;  3AGF A;  2L1M A;  2ZQ7 A;  3HUN A;  3LR3 A;  3IXB A;  2XK1 A;  5EEC A;  1NJ4 A;  1W63 Q;  2Z2M B;  1S4R A;  2KDK A;  1EW0 A;  2VKS A;  1W79 A;  4EUZ A;  4JPM A;  2W1R A;  3UO9 A;  1CQA A;  4GHI A;  4L9E A;  2ZBB A;  1Y54 A;  1I2S A;  3ZNT A;  1M40 A;  2EX6 A;  2J3W A;  2WAF A;  1JNU A;  1SDE A;  5HSQ A;  1TS6 A;  3LR5 A;  3GV9 A;  1A0K A;  1LL8 A;  4O8G A;  1ONG A;  4X69 A;  2Y55 A;  2P9V B;  3VP4 A;  2P7J A;  2EFX A;  4WBG A;  4JF6 A;  3HL9 A;  4HJ4 A;  2HPB A;  3OPP A;  4X55 A;  3EGX C;  1T19 A;  2V1B A;  2JN7 A;  1L0F A;  2IA2 A;  4QJG A;  4FH2 A;  3D3O A;  2Y79 A;  2J7V A;  5FI6 A;  4DXC A;  1P9R A;  3QP1 A;  2HP9 A;  1T1B A;  3FKW A;  4GS9 A;  5FAS A;  1PNE A;  1TF1 A;  1BSG A;  3PHY A;  4OON A;  1F98 A;  4GLQ A;  4R3A A;  4X68 A;  3DBA A;  4Y0T A;  3A3J A;  1JTD A;  3ITB A;  3WS0 A;  4KUK A;  2OOL A;  4U0X A;  3DWZ A;  2BG1 A;  3M6H A;  1XPB A;  1XXM A;  1J9M A;  1Z6F A;  4X1L A;  4YWZ A;  3S7N A;  4BD1 A;  3O86 A;  4M4X A;  2M7U A;  4P87 A;  1K54 C;  3MKF A;  1K54 A;  3VOZ A;  2WAE A;  5A93 A;  4BJP A;  5HW3 A;  4Y5F A;  1OJG A;  4KQD A;  3GQZ A;  3CPT B;  4XXR A;  2B18 A;  5F82 A;  1QME A;  3PTE A;  5FDH A;  3RJU A;  3ZG9 B;  5FEF A;  3PBT A;  3A3D A;  4GDN A;  3P7N A;  3VSL A;  2W3H A;  3MZD A;  4FCF A;  5FQQ A;  3IHB A;  3M2J A;  5DKK A;  3Q07 A;  5EVI B;  2VZW A;  1MPL A;  3EOI A;  4EES A;  2B5R A;  5HFO A;  4UHU A;  1H8Z A;  3ZG8 B;  1LHY A;  1SKO B;  3IBR A;  3IS2 B;  4IED A;  3MQQ A;  3CWF A;  1WA9 A;  3NDG A;  1YT4 A;  3ZVT A;  2ZOH A;  3ITA A;  3RTY A;  4GW9 A;  4PKY A;  3NJA A;  4QU3 A;  3MZE A;  2HP6 A;  2Y2K A;  3UB9 A;  4NEE D;  3BFG A;  2PHY A;  3SS3 A;  3FKV A;  3BQ8 A;  4Y17 A;  1FSW A;  4X56 A;  3W4Q A;  2EX8 A;  2ZJ9 A;  3LUQ A;  2OAQ 1;  3JPU A;  5F5Y A;  3E4Q A;  2EX9 A;  4U3T A;  3HLC A;  4IJG A;  4KQO A;  5M1A A;  1P0Z A;  3LR0 A;  4KZ8 A;  4N1X A;  1BLP A;  4CLC C;  2P9V A;  2OWJ A;  3C7V A;  2A3U A;  4Y0U A;  2XD5 A;  2WKP A;  2W3E A;  3TJZ C;  1LSX A;  3H9W A;  3IWI A;  1DJC A;  1TS0 A;  4O01 A;  2L4R A;  3LEZ A;  4E3O A;  3MR0 A;  1DY6 A;  3LIF A;  4RQ9 A;  3VOY A;  2XDM A;  4EET B;  3A3E A;  4MLL A;  1UWP X;  1DP9 A;  1FIL A;  3MF0 A;  3NOT C;  3ZDJ A;  2UWX A;  4OPZ A;  4Q8I A;  1CEF A;  4KQQ A;  2Y91 A;  3LO7 A;  3ISG A;  3HJI A;  1TEM A;  1XX2 A;  3C2W A;  3IX3 A;  1G28 A;  2FH5 A;  2P74 A;  3KYE A;  4UA6 A;  1K4F A;  3JYI A;  2EX2 A;  2G7U A;  2DRW A;  3CHW P;  4OVD A;  1CF0 A;  3CPT A;  3T1X A;  1S4S A;  3BRM A;  3DTK A;  1MC0 A;  2Y4A A;  4EBN A;  3T1Q B;  3V50 A;  2Q0O A;  3FG8 A;  1LT0 A;  4HP4 A;  2ZM8 A;  3QP8 A;  2XA7 M;  3A0S A;  4LGW A;  3E4P A;  2WKI A;  3LCE A;  1PW1 A;  1MWU A;  1YQS A;  5A90 A;  4Q0H A;  4DKI A;  2YKF A;  3B3X A;  4E04 A;  4WM9 A;  5EUA A;  3UPP A;  1V9Y A;  3OCL A;  2HJE A;  5J8X A;  5J7E A;  3IS2 A;  3ZCZ A;  3T50 A;  2VX8 A;  3KSF A;  2MJ6 A;  4HOI A;  3VFH A;  2JKT I;  3OZH A;  5F83 A;  2J9O A;  3UNW A;  3F1O A;  3KYQ A;  3R4K A;  1MWT A;  2Y2M A;  4R38 A;  1ES4 A;  5JYP A;  3IWO A;  3TRC A;  5G4Y A;  5DTS A;  3F1P B;  1GSW A;  1TDG A;  1LSV A;  1O7E A;  4OP5 A;  5FQK A;  1NXY A;  4I5S A;  4K0X A;  3HLB A;  4LPZ A;  4B93 A;  1DJB A;  4KUO A;  3KSI A;  1PW8 A;  1H5X A;  1BUE A;  1F5M A;  4HI4 A;  3G2Z A;  1FR1 A;  4E3K A;  5HPI A;  5CX7 A;  1JWP A;  1E25 A;  3Q7V A;  3WRT A;  1CJF A;  2GX5 A;  5EVE A;  4MBK A;  3VE3 A;  3JVU A;  2Z6C A;  3HRE A;  1LI9 A;  5F6A A;  3GSG A;  3TSG A;  5TGF A;  3C5A A;  4E6W A;  4Z9Q A;  3IX4 A;  2IWC A;  4X53 A;  4QHC A;  1NY0 A;  4S2N C;  5FI7 A;  2O9B A;  4S2N A;  1IOU A;  3IXH A;  4JBF A;  4EQ1 A;  2KLI A;  3UMD A;  4DN0 A;  3G30 A;  3N8L A;  1SKF A;  4ZJ3 A;  2OLV A;  5KSC A;  1GA9 A;  3RH8 B;  5L09 A;  4KG5 A;  2KX6 A;  3UE1 A;  3C7U A;  4EQI A;  2INW A;  3S1Y A;  4JF4 A;  4F3L A;  2WGI A;  4IBR A;  2Y2N A;  3PR6 A;  3UE6 A;  4OP8 A;  5HAP A;  1IYP A;  3EQU A;  2BAS A;  2ZOI A;  4MDZ A;  3BLM A;  2GJ3 A;  4S2I A;  3A3I A;  1BLH A;  5KSH A;  2V1Z A;  4E3N A;  5EM0 A;  1CI8 A;  1PI5 A;  3K3C A;  4D60 A;  1D7E A;  2Y2L A;  1C3B A;  4GD8 A;  3LIE A;  1SHV A;  4OH0 A;  2VGK A;  4GS9 B;  3PBS A;  1XGI A;  5DJU A;  3VOL A;  5G18 A;  4X1M A;  4BBT A;  3C4O A;  2J80 A;  2RL3 A;  4JF5 A;  5CGS A;  1AWI A;  1KE0 A;  3IH8 A;  1YSP A;  5K5B A;  4YFM A;  1ZG4 A;  1MY8 A;  2HDS A;  3VP3 A;  5CEC A;  3HCY A;  5HL6 A;  4EER A;  3MXQ A;  4WZ5 C;  1ES5 A;  3SH8 A;  2GNX A;  4B4X A;  3B33 A;  4NET A;  1FIK A;  4DJ2 A;  4MCW A;  1FSY A;  3C4P A;  3GMW A;  2VEA A;  2Y2I A;  4KZ9 A;  2LB5 A;  2HGV A;  4KQR A;  2ZL1 A;  1ONH A;  2H28 A;  1YPR A;  1YSQ A;  2ZD8 A;  3OPL A;  3LI9 A;  1BZA A;  5U47 A;  5GHZ A;  5AVE A;  5FQ9 A;  3H7W B;  3PYP A;  1TDL A;  3T1R A;  4D2O A;  2PU4 A;  4I3A A;  4G3K A;  3TOI A;  1V9Z A;  2VGL M;  1BT5 A;  4DMZ A;  1CI9 A;  2VK3 A;  4KZB A;  3AGD A;  2QPN A;  2J9P A;  2C5W B;  3ICY A;  3NOU C;  3M6B A;  1Y28 A;  2WAD A;  1KVM A;  2R9W A;  1KE4 A;  2HF6 A;  4HNB A;  4DE3 A;  5DTT A;  1JVJ A;  1ZG6 A;  4ME4 A;  1KGG A;  1DP6 A;  4FTX A;  3MKE A;  1OTA A;  3BLS A;  4LV2 A;  2B95 A;  1G6O A;  3IH9 A;  3QP2 A;  5HWV A;  3R7W A;  1WE4 A;  1FR6 A;  2JKR I;  1XA7 A;  3IXG A;  3MMH A;  1S66 L;  4CLC B;  2EXA A;  3CLO A;  5DF7 A;  3SH9 A;  2ZMA A;  4OPY A;  4B88 A;  2A49 A;  1I5Q A;  1XJ3 A;  4OLD A;  3G34 A;  1F9I A;  3CMZ A;  5HD5 A;  3VP1 A;  4BBV A;  2HDR A;  4GZB A;  4MNR A;  1YLW A;  5CGW A;  3IQA A;  1MKM A;  1H8Y A;  5DJT A;  4PAU A;  5E2G A;  1BLC A;  4GNU A;  4EXO A;  4R1G A;  1ZC2 A;  3GTC A;  1JWV A;  2H0T A;  1HTZ A;  4E3M A;  5EM1 A;  4CLC D;  4I3I A;  1W8Q A;  4FD8 A;  2ZQ8 A;  3KO6 A;  1MBL A;  1TD5 A;  3F1N A;  2O9A A;  2W27 A;  3CUE C;  1IYO A;  5CHU A;  3LI8 A;  3CUE A;  1L3L A;  3W4O A;  3EWK A;  3CIT A;  4HIA A;  3WS1 A;  1ESU A;  1S6R A;  1K6S A;  3T12 B;  3C38 A;  3G4P A;  2G2W A;  5CTN A;  4JXV A;  5FAQ A;  4UEY A;  1FQG A;  3FWL A;  1XFQ A;  2Q9M A;  5AVF A;  4KZ5 A;  4IBX A;  2BTF P;  4R6L A;  5GLB A;  3GR2 A;  3PXP A;  4HES A;  3S4X A;  2ZMV A;  3BFE A;  2VJW A;  2PR5 A;  4KZ6 A;  3CAX A;  2J3T D;  5A91 A;  3BWL A;  3H7W A;  3UY6 A;  3BM6 A;  2VV7 A;  2Y8H A;  3BYD A;  5GLC A;  1E4D A;  1OTE A;  4G3V A;  4F94 A;  1PYY A;  4RVA A;  5HWW A;  4DF6 A;  4II7 A;  3Q81 A;  2Y2P A;  1MXO A;  4JGQ A;  4S2J A;  2JE5 A;  3WS5 A;  3TG9 A;  3C30 A;  1BTL A;  3PAG A;  3F1O B;  4PM7 A;  2WK0 A;  5G4Z A;  4QY6 A;  3N6I A;  2PU2 A;  4IHQ A;  1FCO A;  5FQM A;  1DP8 A;  2JKF A;  3EEA A;  1NZO A;  1W8Y A;  1IKI A;  3E98 A;  5GHY A;  3E0Y A;  2H5S A;  4M3K A;  1XJ4 A;  4QB8 A;  4WMC D;  3Q7Z A;  4WYY A;  4E3L A;  4JXG A;  2ZQD A;  4UQI S;  5J3W A;  5FDS A;  1PFL A;  2QJ7 A;  4QWO A;  3Q82 A;  3SOI A;  3FYZ A;  4JGP A;  2PRF A;  2VGJ A;  5FL3 A;  1KDW A;  4P6B A;  5HWT A;  4ZBE A;  4YNR A;  1VHM A;  3SS5 A;  1ES2 A;  2V1A A;  4ETX A;  2ZM2 A;  1L0D A;  3Q7V B;  2I9V A;  4CLC A;  3E2L A;  2PR6 A;  4UQI M;  5L10 A;  3ZQ5 A;  3WWX A;  5HL1 A;  4IUK A;  5EFW A;  1N9N A;  5F68 A;  1DJA A;  5L8M A;  2EA9 A;  3GDI A;  2HV1 A;  5GLA A;  3LEQ A;  4MMN A;  5FQI A;  3W8K A;  1KE3 A;  3FZC A;  3CI6 A;  3TE8 A;  3MXS A;  4KZ7 A;  1IFQ A;  5DKL A;  5IS1 A;  1LL5 A;  2QZ6 A;  3OLO A;  2PDR A;  5GHX A;  2J3T C;  3MS6 A;  1L0G A;  3NHQ A;  2QWS A;  2PT7 A;  1RCJ A;  1S67 L;  2A24 A;  2XRN A;  5AQB A;  1KGE A;  3OCN A;  2WZX A;  5HPF A;  3IHA A;  3ZFZ A;  4F3L B;  3G6O A;  3IF6 C;  3P09 A;  3PBQ A;  4IUH A;  3NI9 A;  3HVF A;  3QNC A;  1PZP A;  2D02 A;  5E2F A;  2HDQ A;  5EE8 A;  5F69 A;  4R0Q A;  4PM5 A;  2AVX A;  3GRJ A;  4OKP A;  5J4E A;  4DDS A;  3UPO A;  4UA9 A;  4WL9 A;  3VP2 A;  3SH7 A;  4IVK A;  2HJ9 C;  4Y0O A;  3EQV A;  1PWG A;  1QMF A;  2IWD A;  1O07 A;  1JWZ A;  5HAQ A;  1GHM A;  2Z2L B;  3L9K A;  3RFB A;  3K3D A;  4WMC A;  4O0P A;  2PAV P;  1CEG A;  5CGX A;  2UV0 E;  5TJJ A;  1TS8 A;  2WGW A;  3LGO A;  5A8B A;  4GOG A;  4N1H A;  3O87 A;  2J8Y A;  2QYB A;  3MQ0 A;  1TS7 A;  4DDY A;  2O9C A;  4DE0 A;  3D9Y A;  4WLA A;  2K2N A;  3DTM A;  4AFI A;  2K7S A;  2ZL1 B;  4ARZ A;  2HP5 A;  1T18 A;  1IYQ A;  4FOF A;  1L0E A;  4L9G A;  1U60 A;  4LEN A;  3BW6 A;  3A3F A;  5TR7 A;  3KSG A;  4RYE A;  2D01 A;  2XGN A;  3TW8 A;  1YLT A;  4C75 A;  5F1G A;  2BLS A;  4LRY C;  5E2H A;  3VP0 A;  2WZZ A;  4K0W A;  1OPX A;  3KX0 X;  1GSV A;  3DAV A;  2PBY A;  1IYS A;  2Y2J A;  4ZJ1 A;  4BEN A;  4EBP A;  5FQJ A;  1XJ2 A;  3NC8 A;  4Y2F A;  3IWQ A;  4GD6 A;  2OV5 A;  3A0R A;  1MWS A;  1IEM A;  3B42 A;  2OSU A;  4EWF A;  5DFY A;  1HVB A;  1AXB A;  5E2E A;  4KG2 A;  4UAA A;  3HLD A;  4BWI A;  4OQG A;  1WYC A;  4H8R A;  1XP4 A;  4ETZ A;  2OWH A;  1LLB A;  4BL3 A;  2VV8 A;  1K57 C;  1K57 A;  2EXB A;  2ZQA A;  5GL9 A;  2VLG A;  2XH9 A;  3R7W B;  1FCM A;  3RXX A;  3MXR A;  5FAO A;  4Y15 A;  4E3J A;  2K31 A;  4HY8 A;  3HLG A;  1K6R A;  1NYY A;  2W1T A;  2Y2O A;  1NLZ A;  4P6Z S;  4OOM A;  5FAT A;  3PAE A;  4MBF A;  5D3O A;  4CPK A;  1OT9 A;  3NEC A;  5EOE A;  2E8I A;  3UN7 A;  4OQI A;  4X6T A;  3N8R A;  4ID4 A;  1W7F A;  2P08 A;  1X0O A;  2ZQC A;  2ZC3 B;  1SDN A;  5AQ9 A;  4JLF A;  1BYW A;  3LY3 A;  5FA7 A;  3FV7 A;  4PMA A;  4B4Z A;  5HDD A;  2GDN A;  2X71 A;  2V8F A;  4EUV A;  3EGD C;  3HLW A;  3MBZ A;  1FOF A;  1OT6 A;  1MKI A;  3H82 A;  4U0T A;  3BFC A;  2JCH A;  5EV0 A;  3F1N B;  4JXW A;  1D06 A;  1S0W A;  3NBL A;  2W3D A;  3ZYT A;  4BBU A;  4DJ3 A;  2H0Y A;  3UB5 P;  4WZ5 A; 
#chains in the Genus database with same CATH homology
 2XSS A;  4LRX C;  3C8C A;  4CLC C;  5DJT A;  3LR4 A;  4L9F A;  4FSF A;  4PAU A;  2OWJ A;  5C5K A;  4Q0I A;  4EXO A;  3MQO A;  4GCZ A;  5KIZ A;  4HQA A;  3T4J A;  2WKP A;  2FZ0 A;  2W3E A;  3TJZ C;  4CLC D;  1LSX A;  3H9W A;  4I3I A;  3A0V A;  1TS0 A;  3KO6 A;  1TD5 A;  2M1C A;  3F1N A;  4O01 A;  2DMW A;  3OC2 A;  2L4R A;  2O9A A;  2W27 A;  3CUE C;  3LI8 A;  3CUE A;  2VV6 A;  4NKP A;  4WUJ A;  3MR0 A;  3EWK A;  3CIT A;  1ZHH B;  3LFV A;  4HIA A;  3LIF A;  4RQ9 A;  3C38 A;  3UB8 A;  3E4O A;  4EET B;  4UEY A;  4EW7 A;  1N9L A;  1UWP X;  1XFQ A;  4K08 A;  5AVF A;  4WEL A;  3T4L A;  1DP9 A;  4CLC E;  3MF0 A;  3NOT C;  2W3F A;  3U2A A;  1OJ5 A;  4R6L A;  3KYZ A;  3PXP A;  3T4Q A;  2EWW A;  2ZMV A;  3HJI A;  3P01 A;  3S7P A;  5TBM A;  4B9O A;  3PBO A;  1P97 A;  2VJW A;  2WKR A;  1S1Y A;  2PR5 A;  3C2W A;  3OOV A;  4HH3 A;  5I5L A;  3CAX A;  2J3T D;  1G28 A;  2FH5 A;  3BWL A;  3H7W A;  4I3J A;  2QHK A;  2VV7 A;  2Y8H A;  1OTD A;  2NUT C;  1OTE A;  4G3V A;  4YOF A;  2O99 A;  2G7U A;  5HWW A;  3T4S A;  3UB6 A;  3T4O A;  4II7 A;  3BY8 A;  2P04 A;  2NUP C;  4GHI B;  4L0L A;  5DF9 A;  3VV4 A;  4JGQ A;  1S4S A;  2KOI A;  5DFX A;  3LIB A;  1MC0 A;  1DRM A;  3FG8 A;  1LT0 A;  4HP4 A;  3C30 A;  3F1O B;  2XA7 M;  3A0S A;  5G4Z A;  3E4P A;  1T1A A;  3HJK A;  2EWV A;  4IHQ A;  3T4T A;  4EU0 A;  1VB6 A;  3LIC A;  1DP8 A;  1STZ A;  4Q0J A;  3EEA A;  4Q0H A;  2YKF A;  4HP9 A;  3E98 A;  3FPV A;  3E0Y A;  1XJ4 A;  4E04 A;  4CQH A;  4UQI S;  4P6Z M;  2JKT M;  4PHT A;  5J3W A;  1V9Y A;  3VE4 A;  3OCL A;  3S7O A;  2HJE A;  2Z6D A;  5J7E A;  2QJ7 A;  3IS2 A;  4WEJ A;  3T50 A;  2VX8 A;  3KSF A;  2MJ6 A;  4HOI A;  1W63 M;  2JKT I;  2VA0 A;  4JGP A;  1KOU A;  2QJ5 A;  4NXE A;  3F1O A;  1YKD A;  5FL3 A;  2L0W A;  5HWT A;  3IBJ A;  4EEP A;  4YNR A;  1VHM A;  3KYQ A;  3O5Y A;  3R4K A;  4R38 A;  1NRJ A;  2V1A A;  4ETX A;  3TRC A;  5G4Y A;  4LLO B;  2V0U A;  2I9V A;  1N9O A;  4CLC A;  3F1P B;  1GSW A;  3FPW A;  1LSV A;  2PR6 A;  1LSW A;  2PD7 A;  4UQI M;  5HDC A;  4I5S A;  2A2L A;  3OBF A;  3ZQ5 A;  3UE3 A;  4LPZ A;  2PYR A;  4B93 A;  4IUK A;  3GEC A;  2R78 A;  4MN7 A;  4KUO A;  4NXB A;  2PYP A;  2B02 A;  3KSI A;  1N9N A;  5EFW A;  4I38 A;  5F68 A;  4OOL A;  5L8M A;  2EA9 A;  3LYX A;  2A24 B;  1MZU A;  4LRZ E;  1F5M A;  3GDI A;  2HV1 A;  4HI4 A;  1H8M A;  5MC7 A;  4XT2 B;  4MMN A;  2VGL S;  5HPI A;  5CX7 A;  2WKQ A;  4NXG A;  3CI6 A;  3TE8 A;  1IFQ A;  5DKL A;  5IS1 A;  2GX5 A;  1OTB A;  3F1P A;  5IT5 A;  3OLO A;  3VE3 A;  3JVU A;  2Z6C A;  2PDR A;  3SW1 A;  1UWN X;  3W2Z A;  5F6A A;  1OTI A;  2J3T C;  2W0N A;  4I39 A;  3NHQ A;  2QWS A;  2PT7 A;  3MJQ A;  1S67 L;  3MFX A;  3V67 A;  2A24 A;  2XRN A;  2M7V A;  3OCN A;  5HPF A;  5HZH A;  4F3L B;  3G6O A;  4XT2 A;  3PBQ A;  4IUH A;  4BMW A;  3S7Q A;  5LBR A;  2D02 A;  2O9B A;  1IOU A;  3LIA A;  4G3W A;  5F69 A;  5AJG A;  4EQ1 A;  2KLI A;  3UMD A;  4H6J B;  4DN0 A;  4HH2 A;  1XJ6 A;  5J4E A;  3RH8 B;  5HDS A;  2KX6 A;  4WF0 A;  4WL9 A;  3EEH A;  1GSX A;  2HJ9 C;  1S1Z A;  3EQV A;  2INW A;  1YAX A;  4F3L A;  2L1M A;  3FC7 A;  3PR6 A;  3UE6 A;  3LR3 A;  3RFB A;  3K3D A;  2V9A A;  3EQU A;  2BAS A;  2ZOI A;  4O0P A;  2XRO A;  4MDZ A;  2GJ3 A;  1W63 Q;  1S4R A;  2GZA A;  1EW0 A;  2KDK A;  2VKS A;  4H6J A;  5TJJ A;  1TS8 A;  2W1R A;  5KSH A;  2CMN A;  4ARZ B;  4GHI A;  3K3C A;  4L9E A;  5A8B A;  1D7E A;  1NWZ A;  2ZBB A;  3D72 A;  3T4K A;  4EEU A;  2J3W A;  2QYB A;  3LIE A;  1TS7 A;  3MQ0 A;  4MN6 A;  1JNU A;  1ODV A;  4GS9 B;  5HSQ A;  1TS6 A;  2O9C A;  3PBS A;  3LR5 A;  4NXF A;  1LL8 A;  5DJU A;  4O8G A;  2ZMF A;  3K2N A;  3VOL A;  4WLA A;  4BBT A;  2K2N A;  2P7J A;  2J80 A;  4MN5 A;  4AFI A;  2K7S A;  4HJ4 A;  3UB7 A;  5K5B A;  1YSP A;  3UME A;  4ARZ A;  4HJ6 A;  1T18 A;  3EGX C;  1T19 A;  2V1B A;  4FOF A;  2JN7 A;  2V0W A;  2IA2 A;  4L9G A;  2LB9 A;  4WN5 A;  3D3O A;  2Y79 A;  4Y3I A;  3BW6 A;  3HCY A;  3KSG A;  1P9R A;  4HHD A;  5HL6 A;  4EER A;  3MXQ A;  1T1B A;  4GS9 A;  3NOP C;  2GNX A;  1ZTU A;  1TF1 A;  3B33 A;  4DJ2 A;  4MCW A;  3PHY A;  2D01 A;  1F98 A;  4GLQ A;  2VEA A;  3TW8 A;  4R3A A;  3DBA A;  4LRY C;  4JGR A;  2LB5 A;  2HGV A;  4GJ4 A;  1OPX A;  1XFN A;  3KSH A;  3KX0 X;  1GSV A;  3PBR A;  4WEK A;  2H28 A;  1YSQ A;  5TBM B;  4KUK A;  3LI9 A;  2OOL A;  1XJ2 A;  5AVE A;  1T1C A;  4Y2F A;  4PKY G;  1P9W A;  3H7W B;  3PYP A;  2PD8 A;  3JVV A;  4YWZ A;  3S7N A;  2OAP 1;  3A0R A;  4M4X A;  2M7U A;  2W3G A;  3B42 A;  4I3A A;  4G3K A;  1V9Z A;  1H3Q A;  5DFY A;  2VGL M;  4DMZ A;  4BJP A;  5IU1 A;  2W1T B;  4HJ3 A;  4Y5F A;  1OJG A;  4BWI A;  3BQA A;  4KQD A;  4ETZ A;  2OWH A;  2B18 A;  3ICY A;  3NOU C;  2VV8 A;  1Y28 A;  3PBT A;  2QKP A;  2VLG A;  3PBN A;  2XA7 S;  1NLY A;  2HF6 A;  4HNB A;  3P7N A;  3R7W B;  2W3H A;  5DKK A;  3BJN A;  2K31 A;  2VZW A;  4ME4 A;  3EOI A;  1UGU A;  1DP6 A;  4HY8 A;  3ULF A;  4JGO A;  4EES A;  2W1T A;  1OTA A;  1NLZ A;  4P6Z S;  4OOM A;  4ZRR A;  3IBR A;  1G6O A;  3IS2 B;  1OT9 A;  3MQQ A;  3CWF A;  3H82 B;  1WA9 A;  5HWV A;  2ZOH A;  2JKR M;  3R7W A;  4Z1W A;  3RTY A;  2P08 A;  4GW9 A;  4PKY A;  3NJA A;  1X0O A;  3UB9 A;  4NEE D;  4QPR A;  2PHY A;  2JKR I;  3BY9 A;  1BYW A;  3MMH A;  2JHE A;  1S66 L;  3BQ8 A;  4CLC B;  3CLO A;  3LID A;  2YKH A;  5HDD A;  4EUV A;  3LUQ A;  5HD3 A;  2OAQ 1;  3EGD C;  5F5Y A;  1OT6 A;  4R70 A;  3E4Q A;  3H82 A;  1XJ3 A;  3B47 A;  3F1N B;  2O0Y A;  1F9I A;  1D06 A;  4IJG A;  5HD5 A;  4BBV A;  4KQO A;  2W3D A;  3ZYT A;  4BBU A;  1P0Z A;  4DJ3 A;  3LR0 A;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...