4H6JB

Identification of cys 255 in hif-1 as a novel site for development of covalent inhibitors of hif-1 /arnt pasb domain protein-protein interaction.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
SVCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYPOXIA INDUCIBLE FACTOR 1-ALPHA
publication title Identification of Cys255 in HIF-1 alpha as a novel site for development of covalent inhibitors of HIF-1 alpha /ARNT PasB domain protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4h6jB01
2Z6DA 4HJ3A 3MXQA 4I39A 4HJ4A 2J80A 1OT9A 4NXGA 4NXFA 5G4YA 1LSWA 1N9LA 4HOIA 3NOTC 2OOLA 4EETB 2BASA 4H6JB 1OJ5A 4LRYC 4XT2A 4LRXC 4HIAA 1DP8A 1Y28A 3C2WA 1T19A 2QKPA 1UWNX 3H7WA 4R38A 1LSVA 3SW1A 3MQQA 1OTBA 3LIFA 4BBUA 1V9YA 4L9FA 2H28A 1XFNA 2WKQA 3NHQA 4NXEA 1S4RA 1TS7A 4RQ9A 3RH8B 2PDRA 1P97A 4GCZA 5HDCA 5HWWA 3LYXA 1TS8A 4WL9A 1DRMA 2K7SA 4HJ6A 4JGQA 3LIEA 3LUQA 1D06A 2QHKA 3HJKA 2M1CA 2QJ5A 2D02A 4KUOA 3UB6A 4BBTA 5F69A 2A24B 5HD5A 3RTYA 2ZOHA 4F3LA 5DKLA 1OJGA 1TS6A 4HP9A 2PHYA 4DJ3A 3GDIA 2GJ3A 3F1PA 5F6AA 3H9WA 1GSVA 1GSWA 4HH2A 1XJ4A 1T1BA 1T1AA 5AVFA 3G6OA 4E04A 1F98A 3H82A 3BWLA 5I5LA 3UB9A 4EESA 5A8BA 4PKYA 4R3AA 2YKHA 4I3JA 3F1OA 5HDSA 4HQAA 4KQDA 2P7JA 1EW0A 3KX0X 4EEPA 5IU1A 4PKYG 4LLOB 1NWZA 1S66L 3EWKA 4LRZE 3PHYA 3B33A 4GS9B 3ICYA 2VLGA 4YWZA 1V9ZA 2JN7A 2QWSA 3LI8A 3K3CA 3K3DA 3ULFA 4WN5A 3VE3A 4HI4A 3ZQ5A 3IS2B 3CWFA 4GHIB 1WA9A 3BY8A 1G28A 3UB7A 3CAXA 3HJIA 1VB6A 1ODVA 3F1NB 3LI9A 2Z6CA 1N9NA 2QJ7A 3UB8A 4WUJA 5F5YA 1OT6A 1S1YA 1X0OA 3MJQA 5HD3A 3UMEA 5HZHA 5HSQA 3MFXA 3NOPC 1N9OA 2VV8A 1XFQA 4HHDA 2V9AA 4JGOA 1D7EA 3PYPA 4MN5A 3A0SA 1OTDA 3NOUC 2ZOIA 3A0RA 2WKRA 1XJ6A 3LIDA 3A0VA 1KOUA 5DJTA 2V1AA 4HY8A 4GW9A 2V0WA 4HP4A 3H82B 2VV7A 3UMDA 1T18A 5J4EA 5TBMB 4WLAA 5J7EA 4HH3A 3E4OA 1XJ3A 5IS1A 2HV1A 2W27A 5EFWA 4LPZA 3VOLA 1T1CA 2I9VA 5KIZA 1F9IA 5AVEA 2WKPA 5HDDA 2B02A 3LIAA 4GS9A 2VV6A 1S67L 4XT2B 1OTAA 1DP9A 4H6JA 2INWA 2PR6A 1S4SA 3H7WB 2EA9A 1JNUA 2L0WA 4EERA 5HWVA 2PYRA 3EEHA 1TS0A 3BY9A 1UWPX 3MR0A 4EQ1A 3IS2A 4GHIA 5DKKA 4KUKA 3C8CA 4I38A 1OTIA 3VE4A 2V0UA 1UGUA 2KX6A 5J3WA 4BBVA 1OTEA 2OWJA 3F1NA 2W0NA 1XJ2A 3E4QA 3LIBA 4I3IA 2V1BA 4F3LB 1DP6A 1BYWA 4R70A 1GSXA 2VEAA 2A24A 3FG8A 3OLOA 4M4XA 4JGPA 2JHEA 3F1PB 3NJAA 4HNBA 5HWTA 4JGRA 2PR5A 2OWHA 5F68A 3MQOA 3D72A 1LL8A 4MN6A 4I3AA 4L9GA 4EXOA 3LICA 3CLOA 5DJUA 1LT0A 2YKFA 1P0ZA 3P7NA 4DJ2A 1S1ZA 4R6LA 2D01A 2KDKA 4NXBA 3IBRA 3F1OB 2PD8A 1LSXA 5TBMA 1MZUA 5G4ZA 4EEUA 4B9OA 2L1MA 4WF0A 4EW7A 2PYPA 2L4RA 3FC7A 2R78A 4I5SA 4K08A 3T50A 3E4PA 4L9EA 2ZBBA 3GECA 2PD7A 2CMNA 3UE6A
chains in the Genus database with same CATH superfamily
2LB5A 3HLCA 4HJ3A 5KMWA 4OH0A 4WMCA 5M19A 2QYBA 4NXFA 4PM8A 1O07A 1PI4A 2R9WA 4R4RA 1LSWA 3OPRA 2BASA 3IT9A 3VMAA 4D2OA 3PAGA 2J9OA 1OJ5A 3C38A 1DP8A 4DE2A 4BL3A 1UWNX 5GHXA 3SW1A 4WEKA 4ZJ2A 3HLFA 3CMZA 4K0XA 4Y7PA 4DXCA 4WBGA 5KZHA 1WYBA 4L9FA 4JF4A 4AFIA 2WKQA 3NHQA 2WGVA 1XA1A 3Q07A 1S4RA 1TS7A 4RQ9A 1P97A 4GCZA 4UA6A 5HDCA 3LYXA 1ZTUA 1DRMA 2K7SA 3UB5P 2HDUA 4HJ6A 4C75A 3UPPA 4KENB 4Y0UA 2P08A 2KOIA 2GNXA 4X53A 3CUEC 1L0FA 1XX2A 1YQSA 5HD5A 4F3LA 1K4FA 3OPLA 3QNCA 4P6BA 2V8FA 2PHYA 2KLIA 4GDBA 1GA0A 4NKPA 4E3NA 4B4ZA 4YOFA 1GHIA 3OCLA 3RFBA 1XXMA 2OLUA 1K56D 4MEZA 1PW8A 5CHMA 1BZAA 4QWOA 3HREA 4S2PA 5AVFA 1K54C 1H8ZA 1J3WA 3NIAA 3OPHA 3UN7A 3BWLA 2WKEA 2EX9A 2G7UA 5MC7A 3CG5A 5A8BA 2ZQ8A 2PU2A 4MDZA 2Y2HA 2ZQCA 5EVLA 1YLYA 1I5QA 1NJ4A 4KQDA 4OLGA 1FSYA 5E2FA 1P9WA 3G32A 4N9KA 2XDMA 4QY5A 2EFXA 1S66L 2W1RA 3B33A 3ICYA 2VJWA 2VLGA 4G3KA 1YSPA 3BRMA 4FUWA 1V9ZA 3MZEA 3HCYA 3BYDA 4OONA 3K3CA 3K3DA 4RA7A 3RXXA 2W1TA 3RJUA 5JYOA 2OAP1 4RYEA 2Y8HA 3IS2B 3CPTA 1VEUA 5M18A 2WAEA 3IWOA 4S2NC 1G28A 3BW6A 3KO6A 3V3RA 3GSGA 4DE0A 4ZDXA 3NBLA 2PBDP 2UV0E 2J7VA 3CAXA 5TFQA 1VB6A 2XEPA 5E2GA 2GZAA 3B42A 4HEFA 3UB8A 1E25A 4WUJA 4LENA 1YPRA 4BL2A 3Q7VA 1X0OA 3MJQA 5HZHA 1YLWA 5CHUA 1Y54A 3NOPC 2Y2IA 2V20A 1MXOA 2X71A 2ZM0A 5EECA 3PYPA 2B95A 1HZOA 1AWIA 3NOUC 3LGOA 2ZOIA 3CJMA 5FAOA 2WKRA 1XJ6A 3W4QA 5HL1A 2FFYA 3BQAA 3DWZA 2IA2A 1A0KA 1SKOB 4OQIA 5HPIA 3BFCA 3RXWA 4WZ5A 4DXBA 1ZKJA 3EOIA 1KGEA 3S7OA 4HY8A 4R0QA 4EBLA 4ETXA 4GN2A 2V0WA 2VV7A 2WZXA 3UMDA 5J4EA 5TBMB 5J7EA 3SZTA 5KSHA 4EWFA 3L7HA 4HESA 2X01A 3ZGAB 5EFWA 4EUVA 5A93A 5BOHA 5CGWA 3EQUA 4XUZA 3O5YA 5EPHA 5CTNA 2ZQ7A 2VKSA 4HBUA 4JXWA 3IF5A 3CITA 5E2HA 3IWQA 2XK1A 4MLLA 3MXRA 1FIKA 4XT2B 3HUOA 2Y2KA 2DCFA 2JKRM 3CPTB 3K2NA 4EERA 1VEUB 2ZQ9A 1EWZA 4P6ZM 1FSWA 2LB9A 3M6BA 4DE1A 3A3DA 2BG1A 3MBZA 3S7QA 4U0XA 3UPNA 5AJGA 3VE4A 2V0UA 1UGUA 2KX6A 4MBKA 4O8GA 1NRJA 4R1GA 2HDSA 4CLCB 1F5MA 1OTEA 3F1NA 4Y0OA 2W0NA 1XJ2A 1BUEA 2HJEA 4E3KA 3LIBA 1KDWA 4ZBEA 4UQIM 3VSKA 5CGXA 1G68A 2XD5A 3S7NA 1W8YA 5DTKA 4Y17A 1BTLA 3F1PB 5FQQA 5GLDA 2DNSA 2BTFP 3NJAA 4X1LA 4HNBA 2ZLYA 1YSQA 4ZJ1A 5HWTA 2OWHA 4X68A 5D3OA 3LCEA 1BLSA 1MC0A 3L9KA 3LICA 1AXBA 2XFTA 3CLOA 1L3LA 3FKWA 2GX5A 4E3MA 1BT5A 4NG2A 3HUNA 1W5DA 4MNRA 4GZBA 2D01A 2Y2QA 1MWRA 2I72A 2ZL1A 5DTTA 4A5RA 1I2WA 1LI9A 3U4LP 1NRFA 3UE3A 4ETZA 2WGWA 2XFSA 4E6XA 5EM0A 1MZUA 1SDNA 1CI9A 4X25A 2AVXA 4B9OA 1K56A 4WF0A 4MBFA 3HBRA 3W8KA 3DTKA 2L4RA 3FC7A 3BM6A 3AGFA 2R78A 4OQGA 3CUEA 4C3QA 3ZVTA 3N8LA 1N4OA 3KYQA 3MXSA 5HAPA 3GECA 2R9XA 2CMNA 2M7VA 3UE6A 2Z6DA 3MXQA 4I39A 4HJ4A 3S1YA 4NXGA 1XGJA 5A92A 1YLZA 1N9LA 4IJGA 3ZYTA 3T1QB 4EETB 4Y13A 3NECA 2HGVA 1KE4A 5GLCA 1K54A 3VFFA 4LRYC 5DFYA 4X6TA 3C4OA 3C2WA 1IYSA 2QKPA 3G35A 3OCNA 1IFQA 3MQQA 1OTBA 4BBUA 3EGDC 3LR0A 1K57A 5FA7A 4BD0A 1XFNA 3JVUA 3G34A 2IWDA 4NXEA 4OPZA 3LY3A 3DW0A 5TGFA 1TS8A 1GHMA 3FKVA 3UO9A 3E0YA 4JGQA 3LIEA 1U60A 3HJKA 4JBFA 2QJ5A 3UPOA 1ESIA 3UB6A 1SKFA 2HF6A 5F69A 1HD8A 4ARZA 5EV0A 5HPFA 2QMIA 1MWTA 2ZOHA 3MKFA 5GL9A 1OJGA 3EGXC 1TS6A 1IOUA 5FQKA 1IEMA 4PM7A 4FSFA 2XH9A 4Q0JA 3PR6A 1PI5A 5F6AA 3T4QA 1KGGA 5EOEA 2W3DA 5EVIB 3VP1A 4S2NA 3T12B 4CPKA 1D1JA 3G6OA 2JKGA 3A3JA 3V67A 3PTEA 3S4XA 3UB9A 4EESA 2WGWB 3IX8A 4LV0A 2YKHA 1S6RA 4Y15A 2K31A 1Y4OA 1ACFA 2Y4AA 3F1OA 5HDSA 4HQAA 3QP5A 4EEPA 5JYPA 4PKYG 2VZWA 4PAUA 3ITAA 3PHYA 4GS9B 3ZDJA 3G2YA 2EX8A 2QWSA 3DAVA 3BECA 2IWBA 2ZD8A 4P6ZS 1L0GA 4WN5A 3IF6B 4EV4A 2HPBA 4HI4A 3ZQ5A 2K2NA 5AQBA 1IELA 4Z1WA 5FI7A 1FOFA 4GHIB 4UEYA 3T4OA 3BY8A 2ZC4B 4PM9A 3UB7A 2P9VA 4ZJ3A 3TJZC 1IYOA 4IVIA 3TG9A 4UQIS 3T4JA 2Z2MB 1N9NA 2QJ7A 3IXDA 4GKUA 4IUHA 3VP2A 4KZ7A 3P09A 3NULA 5HD3A 1YM1A 5HSQA 2Y79A 3OBFA 3FV7A 3HLGA 4FH2A 4ESPA 3VV4A 2Y55A 1N9OA 1KDSA 3EEAA 1D7EA 5EVEA 2XR0A 4UA7A 1OMEA 4MN5A 4KZ9A 1OTDA 4M3KA 4LV1A 3VOZA 1KVMA 1VM1A 3W4OA 4ZRRA 5EVID 3LIDA 3OZHA 3TRCA 5FDHA 4X1MA 4JXGA 1PZOA 4OKPA 1EI5A 3TSGA 3V3SA 1SDEA 1IYPA 4GW9A 1QMEA 2JKFA 4GD8A 4QY6A 4YINA 4OOYA 1T18A 2XD1A 4WLAA 1K57C 2HZ5A 1YT4A 3SH9A 5HL6A 2H0YA 1XJ3A 2CC1A 5M1AA 2HV1A 5GHYA 1IYQA 4QHCA 1W63Q 3VOLA 5KIZA 1ERMA 3FPWA 1Q2QA 5DF8A 4G3WA 1IKIA 1ES4A 1JVJA 2H10A 3LY4A 3WS2A 2WKPA 4KQQA 3LO7A 3TE8A 4IEDA 2W3EA 3ZG7B 2EWWA 4YFMA 5IT5A 3ZCZA 4QD4A 3P98A 4H6JA 3M2JA 4O0PA 3SH7A 4KZ8A 1E3UA 4IUKA 2PYRA 3M2KA 1FCNA 5L07A 3BY9A 3CI6A 1L2SA 4B4XA 4O7DA 1UWPX 3MR0A 3N7WA 3GRJA 5L10A 3C5AA 1YMSA 3NDEA 5DKKA 3CZDA 4I38A 2PT7A 4X55A 2VGJA 1SCWA 3T1XA 1WE4A 5LBRA 2RCXA 3E4QA 4OP8A 2V1BA 1FCMA 4F3LB 1TEMA 2Y2JA 1GSXA 2VEAA 3SH8A 2A24A 3GMWA 3MF0A 3OLOA 4FH4A 2M7UA 2ZC5B 2Y2OA 4JGPA 3BFFA 2JHEA 4KG2A 3MFDA 3IX3A 1MPLA 1J9MA 2NUPC 2B5RA 3AGDA 4X56A 2PR5A 3LEQA 1ERQA 5HW3A 4I3AA 4L9GA 3O86A 1ES2A 5DJUA 1LT0A 3C30A 3O87A 3S7PA 2MJ6A 1VETA 4PHTA 1FR6A 4JXVA 1PFLA 2A2LA 4OVDA 3IBRA 2B18A 2PD8A 1LSXA 2OSUA 2OV5A 1TDLA 4H8RA 3LR5A 2P74A 5CHJA 1C3BA 1L0DA 1YAXA 4NETA 2BLSA 4I5SA 3T50A 3WS0A 2XROA 5AQAA 4X69A 1LLBA 3HVFA 3Q1FA 2PD7A 4Y2FA 3IXBA 3KSGA 2W1TB 2J80A 4WYYA 3M6HA 5G4YA 4UA9A 3NOTC 2OOLA 3NY4A 1HLUP 3Q7ZA 4H6JB 1ZHHB 4CQHA 5G18A 4BWIA 5FQJA 3V5MA 5FQ9A 1Y28A 2J3TD 1H5XA 1M40A 1Z09A 4E3IA 3H7WA 1K55C 1LSVA 5I94A 3LIFA 3P01A 4FTXA 2Q0OA 4WZ4A 5CX7A 1RCJA 4IHQA 4UAAA 1NZUA 3Q7VB 3RH8B 4EBPA 2JE5A 3T4KA 4NK3A 2WKIA 3KSHA 4DDYA 1YKDA 3HLEA 3Q82A 3QHYA 1W7FA 2J8YA 2WKHA 2XRNA 3GR2A 2ZMAA 3V39A 5FAQA 2D02A 4KUOA 5FQIA 3N6IA 4BBTA 4U3TA 2A24B 4HBTA 3IH8A 4OOMA 1H3QA 5GLAA 4G3VA 2Q9NA 4DJ3A 3GDIA 2GJ3A 2PBYA 4OPQA 1BLCA 3WRZA 3T1SA 1GSWA 4HH2A 2WAFA 5FI2A 4GNUA 1NYMA 1OPXA 1VETB 4E04A 4OPYA 2O9BA 5C5KA 3H82A 3MKEA 1XGIA 3BFGA 1PIOA 3KYEA 4S2KA 3DWKA 4D60A 4Q8IA 4GJ4A 3ZHHA 4I3JA 2P7JA 3BJNA 1EW0A 5IU1A 1VQQA 3PBSA 5F1FA 1S0WA 4ME4A 1ZC2A 1NYYA 4LRZE 3BLSA 1BSGA 4P87A 1TVFA 3ZG0A 1Q2PA 1WYCA 4E3OA 1Z6FA 3SS3A 3ZG9B 3UNWA 1PNEA 3R7WA 4NEED 2W3HA 2A3UA 3DBAA 3ULFA 3G4PA 2Y2MA 4F94A 1TF1A 2NUTC 1FQGA 5A90A 3VP0A 3KYZA 4N92A 3SS5A 4CLCD 3CWFA 5FSRA 3B47A 4N1XA 1WA9A 4JF5A 3A3IA 3C4PA 1YLPA 3HJIA 1PRQA 3LFVA 3VFHA 1ODVA 3F1NB 3LI9A 2Z6CA 4Y0TA 5EOOA 2XF3A 1JWZA 2WGIA 5F5YA 1OT6A 3A3EA 2PRFA 3MZFA 2WUQA 3UMEA 3MFXA 3MSHA 2W3FA 4MMNA 4KZ6A 1XFQA 4PPRA 2V9AA 3NCKA 4JGOA 3PXPA 3WS5A 1YMXA 3D4FA 1O7EA 3A0SA 4PM6A 4U0TA 1LHYA 3QP2A 3ZNTA 3ZFZA 2VA0A 3A0RA 2Y91A 5KSCA 3GQZA 2ZM2A 1KOUA 4DE3A 2WK0A 5DJTA 1HVBA 4PMAA 2ZL1B 3G2ZA 4WELA 3H82B 4P85A 1XP4A 3QP6A 1MY8A 3IXGA 1PZPA 3W4PA 2E8JA 1KVLA 5J8XA 5IS1A 2W27A 4E3JA 4IBRA 5E2EA 2H5SA 1I2SA 3VP4A 5FEGA 3BFEA 1RP5A 1T1CA 2I9VA 1F9IA 5AVEA 4K0WA 4KZ3A 1K0KA 1SHVA 4WM9A 2B02A 3LIAA 4QPRA 3PBQA 3LEZA 4LV3A 4QB8A 1NLYA 3PAEA 4JXSA 4LCLA 2VV6A 3I7JA 1S67L 2VGLM 4CLCE 1DP9A 1DJAA 5F82A 2Y2PA 4Z9QA 3FWLA 3T4TA 4KG5A 1S4SA 2EA9A 5CEDA 1F2KA 1JNUA 4XUXA 1STZA 4DF6A 3EEHA 3IBJA 3GTCA 4FCFA 1NY0A 1ES5A 3E98A 2Y2NA 4P0MA 3IS2A 3MMHA 4ID4A 5EVIC 4B88A 1E4DA 4KUKA 4BQMA 1OTIA 1NZOA 2OLVA 3UE0A 4B93A 2OAQ1 3WS1A 3IH9A 4EQIA 5J3WA 4BBVA 1CI8A 5TJJA 1MBLA 2FH5A 2OWJA 1ONHA 4ARZB 1VHMA 3QP8A 1G6AA 1CEFA 3PBNA 4I3IA 1BYWA 3IWIA 4LV2A 3WS4A 3FG8A 5EM1A 2PAVP 5HFOA 1K38A 2ZC3B 4JGRA 5CRFA 4Y5FA 1CQAA 3Q81A 5L09A 4MN6A 4EXOA 3FZCA 4RX3A 3IQAA 4YNRA 4PM5A 1K55A 2XA7M 2DMWA 1SKOA 2YKFA 1P0ZA 3HLBA 4KZBA 3FYZA 1ZG4A 3P7NA 3IF6C 4DJ2A 2RL3A 2V8CA 1H8YA 2W3GA 3OC2A 1GCEA 2JKTI 4OOLA 4S2MA 5FL3A 4NXBA 4RVAA 3F1OB 5F83A 5TBMA 4R23A 2JKTM 1G5UA 3V50A 5G4ZA 5CEBA 2A49A 2ZM8A 4GOGA 3WWXA 5FEFA 2ZMFA 4MBHA 4KQOA 4K08A 2WZZA 3UY6A 3UDIA 1MKIA 4GB7A 4N1HA 3KSIA 5A91A 2ZBBA 4R3BA 2JBFA 4JKTA 1H0MA 4EBNA 3BEBA 1PYYA 1OT9A 1CK3A 5IHVA 3ISGA 4HOIA 2JC7A 1PWGA 3CHWP 4GDNA 1RGZA 1K4EA 1CEGA 3O3VA 5CECA 1BULA 4DN0A 5HAIA 2O9AA 4LRXC 4XT2A 4HIAA 4EU0A 2P9VB 1T19A 3OOVA 4R38A 3JVVA 1V9YA 3ZG5A 2H28A 3E2KA 1DJBA 5GLBA 4RX2A 3DTMA 1LL9A 1KE0A 1JTGA 3KSFA 1CJFA 2FFFB 2EXAA 2PDRA 2QZ6A 5HWWA 2EFUA 4WL9A 4OQ0A 2VX8A 2HJ9C 1FCOA 3LUQA 1IKGA 4CLCA 4MN7A 1D06A 2QHKA 3IHBA 2M1CA 4BJPA 5L8MA 1W8QA 2O0YA 2UWXA 4CJNA 3RTYA 2FZ0A 1ONGA 1HTZA 3HLDA 3G30A 3IXHA 3N4IA 1ALQA 4S2JA 5DKLA 1LL5A 1EROA 1CF0A 2HDQA 4LCMA 4JF6A 1NXYA 4HP9A 1RGYA 5EUAA 2XSSA 4O01A 2X02A 3FPVA 3F1PA 5GHZA 3TOIA 3IX4A 2P04A 3H9WA 1GSVA 1XJ4A 2ACGA 2IWCA 1T1BA 1L0EA 1T1AA 4KZ4A 1F98A 1GHPA 1NLZA 5CGSA 3QP4A 2Y2GA 3DTIA 5FATA 5I5LA 2ZMVA 4PKYA 3IHAA 4R3AA 4S2LA 2XQZA 3QNBA 4KG6A 4E3LA 4WMCD 3HLWA 4DKIA 3HUMA 3QP1A 1MKMA 3N8SA 3HL9A 2J3TC 3MQ0A 1BLHA 3KX0X 4KQRA 1K6SA 2G2WA 1MWSA 4MCWA 2VGLS 4LLOB 5DF7A 1NWZA 4QU3A 3BLMA 3GV9A 2WYXA 1GA9A 3EWKA 1M6KA 5K5BA 3C7VA 4YWZA 5HX9A 2G2UA 4DDSA 2JN7A 1W79A 3LI8A 5HAQA 3LR3A 2ZQDA 4ZTKA 1TD5A 2C6WB 3MS6A 5CERA 3VE3A 3VSLA 3SS4A 2JKRI 3O88A 3S22A 3UDXA 3T1RA 1YLJA 1H8MA 3PBRA 1MWUA 3OPPA 2J9PA 2H0TA 5E43A 4QJGA 3ZVWA 4OLDA 4R4SA 5AQ7A 2HP5A 1K6RA 2WADA 1XPBA 4BD1A 5HARA 4WEJA 4R3JA 1S1YA 2Q9MA 3T4LA 1XKZA 3JPUA 3D3OA 1PWCA 4EUZA 2VV8A 2ZC6B 4HHDA 4S2IA 4LGWA 4JPMA 3E2LA 3TW8A 4S2OA 2XA7S 1TDGA 3G31A 5CXWA 4N9LA 1KGFA 3T4SA 4ZAMA 4OPRA 3A0VA 5DF9A 5FAPA 2E8IA 4UHUA 3BQ8A 1N9BA 5FI6A 2V1AA 4KZ5A 4DMZA 3R4KA 4HP4A 4GLQA 3C7UA 1JTDA 3ITBA 5EVIA 4OP5A 2V2FF 3W2ZA 2Y59A 4HH3A 2VK3A 4JLFA 5U47A 3E4OA 1DJCA 2JCHA 3PBTA 4IVKA 2GDNA 4LPZA 4CLCC 5EE8A 3D9YA 3JYIA 5F1GA 3NC8A 4Y3IA 2HDRA 2Z2LB 4BMWA 4FD8A 3PBOA 4GD6A 2ZC7A 5HDDA 4Q0IA 3WRTA 1E3UD 1JWPA 3AGEA 3EQVA 4GS9A 2Y2LA 3SOIA 1OTAA 4II7A 1P9RA 3VP3A 2INWA 5FDSA 2PR6A 4Q0HA 4C6YA 3H7WB 3IF6A 2L0WA 2EXBA 5HWVA 3NI9A 1W63M 4WZ5C 1TS0A 1QMFA 3U2AA 4EQ1A 2ZQAA 5FASA 4GHIA 1BLPA 5TR7A 3N8RA 3C8CA 2O9CA 5DTSA 3ZNYA 4OQHA 2PU4A 1XA7A 4BENA 3B3XA 1KE3A 1ESUA 1DP6A 3ZG8B 1FR1A 4R70A 4L0LA 5DVAA 4XXRA 2C5WB 5FQMA 2O99A 4M4XA 3BFDA 1LI0A 1G6OA 2V1ZA 5F68A 4K91A 3MQOA 3A3FA 2XGNA 3D72A 4DRTA 1LL8A 2VGKA 2HP6A 1YLTA 4FOFA 1SZVA 2HP9A 1PW1A 2J3WA 1S1ZA 4E6WA 4R6LA 5AQ9A 2XLNA 2KDKA 2EX2A 3LR4A 1JWVA 5CTMA 1ZG6A 2EWVA 2EX6A 3GVBA 3UDFA 4IBXA 1PWDA 1ES3A 4EEUA 2QPNA 2ZJ9A 3MZDA 2L1MA 4BLMA 3DTEA 1K25A 5L2FA 4EW7A 4LFUA 2PYPA 3NDGA 3VOYA 1DY6A 3E4PA 1FILA 4L9EA 3UE1A 5DFXA 4KZAA 3R7WB 2DRWA
chains in the Genus database with same CATH topology
2LB5A 3KSGA 2Z6DA 4HJ3A 3MXQA 2QYBA 2W1TB 4HJ4A 4I39A 2J80A 1OT9A 4NXGA 4NXFA 5G4YA 1LSWA 1N9LA 4HOIA 3NOTC 4IJGA 2OOLA 3ZYTA 2BASA 4EETB 4H6JB 1ZHHB 4CQHA 2HGVA 4BWIA 4Y2FA 1OJ5A 4DN0A 4LRYC 2O9AA 4LRXC 4XT2A 3C38A 1DP8A 4HIAA 5DFYA 1Y28A 2J3TD 4EU0A 3C2WA 1T19A 2QKPA 3OCNA 1UWNX 1IFQA 3OOVA 3H7WA 4R38A 1LSVA 3SW1A 3MQQA 1OTBA 4WEKA 3LIFA 3P01A 4BBUA 3JVVA 1V9YA 3EGDC 5CX7A 3LR0A 4IHQA 2H28A 4L9FA 1XFNA 3JVUA 4AFIA 2WKQA 3NHQA 4NXEA 3KSFA 1S4RA 1TS7A 4RQ9A 3RH8B 2PDRA 1P97A 4GCZA 5HDCA 5HWWA 3LYXA 3T4KA 1TS8A 1ZTUA 1DRMA 2K7SA 3KSHA 4WL9A 1YKDA 4HJ6A 2VX8A 2HJ9C 3E0YA 4JGQA 3LIEA 3LUQA 4CLCA 4MN7A 2XRNA 1D06A 2QHKA 3HJKA 4BJPA 2M1CA 2QJ5A 2D02A 4KUOA 5L8MA 3UB6A 2P08A 2HF6A 4BBTA 5F69A 2KOIA 4ARZA 2GNXA 2O0YA 2A24B 5HPFA 3CUEC 5HD5A 3RTYA 2FZ0A 2ZOHA 4F3LA 4OOMA 5DKLA 1H3QA 1OJGA 3EGXC 4G3VA 1TS6A 1IOUA 4HP9A 2PHYA 4DJ3A 3GDIA 2XSSA 2KLIA 4O01A 2GJ3A 4FSFA 3FPVA 4NKPA 3F1PA 3PR6A 4Q0JA 4YOFA 2P04A 5F6AA 3T4QA 3H9WA 3OCLA 3RFBA 1GSVA 1GSWA 4HH2A 2W3DA 1XJ4A 1T1BA 1OPXA 1T1AA 5AVFA 3G6OA 4E04A 1F98A 2O9BA 1NLZA 3H82A 5C5KA 3BWLA 3V67A 2G7UA 5I5LA 2ZMVA 3UB9A 5MC7A 4EESA 5A8BA 4PKYA 4R3AA 4MDZA 2YKHA 4GJ4A 2K31A 4I3JA 1MKMA 3F1OA 5HDSA 4HQAA 4KQDA 2J3TC 2P7JA 3MQ0A 3BJNA 1EW0A 1P9WA 3KX0X 4EEPA 5IU1A 4PKYG 3PBSA 4MCWA 2VGLS 4LLOB 2VZWA 4ME4A 1NWZA 1S66L 4PAUA 2W1RA 3EWKA 4LRZE 3PHYA 3B33A 4GS9B 5K5BA 3ICYA 2VJWA 2VLGA 4G3KA 1YSPA 4YWZA 1V9ZA 3HCYA 2JN7A 2QWSA 3LI8A 3R7WA 3K3CA 4NEED 4P6ZS 2W3HA 3K3DA 3LR3A 1TD5A 3DBAA 3ULFA 4WN5A 2W1TA 1TF1A 3VE3A 2NUTC 4HI4A 3ZQ5A 2K2NA 2OAP1 3KYZA 4Z1WA 2Y8HA 2JKRI 3IS2B 4CLCD 3CWFA 3B47A 4GHIB 3UE6A 4UEYA 1WA9A 3T4OA 3BY8A 1H8MA 1G28A 3BW6A 3KO6A 3PBRA 3UB7A 3TJZC 3CAXA 3HJIA 4UQIS 1VB6A 3LFVA 3T4JA 1ODVA 2GZAA 3F1NB 3LI9A 2Z6CA 3B42A 1N9NA 2QJ7A 3UB8A 4WUJA 5F5YA 1OT6A 4IUHA 4WEJA 1S1YA 1X0OA 3MJQA 5HD3A 3T4LA 3UMEA 5HZHA 5HSQA 3MFXA 2Y79A 3OBFA 3D3OA 2W3FA 3NOPC 4MMNA 3VV4A 1N9OA 2VV8A 1XFQA 4HHDA 2V9AA 4JGOA 3EEAA 3PXPA 1D7EA 3PYPA 3TW8A 2XA7S 3A0SA 1OTDA 4MN5A 3NOUC 2ZOIA 2VA0A 3A0RA 4ZRRA 2WKRA 1XJ6A 3LIDA 3T4SA 3A0VA 5DF9A 3TRCA 3BQAA 2IA2A 1KOUA 5HPIA 5DJTA 3BQ8A 3EOIA 3S7OA 2V1AA 4HY8A 4DMZA 3R4KA 4ETXA 4GW9A 2V0WA 4HP4A 3H82B 4WELA 2VV7A 4GLQA 3UMDA 1T18A 5J4EA 5TBMB 4WLAA 3W2ZA 5J7EA 4HH3A 5KSHA 3E4OA 5HL6A 3PBTA 1XJ3A 5IS1A 2HV1A 2W27A 5EFWA 4EUVA 1W63Q 3EQUA 4LPZA 4CLCC 3VOLA 1T1CA 2I9VA 3O5YA 5KIZA 3FPWA 4Y3IA 2VKSA 4G3WA 1F9IA 5AVEA 4BMWA 2WKPA 3PBOA 5HDDA 4Q0IA 2B02A 3TE8A 3LIAA 4QPRA 2W3EA 3PBQA 3CITA 2EWWA 3EQVA 4GS9A 1NLYA 2VV6A 1S67L 4XT2B 1OTAA 2VGLM 4II7A 5IT5A 4CLCE 1P9RA 1DP9A 4H6JA 2INWA 2PR6A 4Q0HA 3T4TA 1S4SA 3H7WB 4O0PA 2EA9A 1JNUA 2L0WA 3K2NA 2JKRM 4EERA 5HWVA 4IUKA 1STZA 2PYRA 1W63M 3EEHA 3IBJA 1TS0A 3BY9A 3E98A 3CI6A 3U2AA 1UWPX 3MR0A 4P6ZM 4EQ1A 3IS2A 2LB9A 4GHIA 3MMHA 5DKKA 3S7QA 4KUKA 3C8CA 2O9CA 4I38A 1OTIA 5AJGA 3VE4A 2V0UA 1UGUA 2OAQ1 2KX6A 2PT7A 4O8GA 1NRJA 4B93A 4CLCB 1F5MA 5LBRA 5J3WA 4BBVA 5TJJA 1OTEA 2FH5A 2OWJA 3F1NA 2W0NA 1XJ2A 3E4QA 2HJEA 4ARZB 1VHMA 3LIBA 3PBNA 4I3IA 2V1BA 4F3LB 4UQIM 1DP6A 1BYWA 4R70A 1GSXA 2VEAA 2A24A 3MF0A 4L0LA 3S7NA 3FG8A 3OLOA 2M7UA 2O99A 4M4XA 4JGPA 2JHEA 1G6OA 3F1PB 3NJAA 2NUPC 4HNBA 1YSQA 5HWTA 4JGRA 2PR5A 4Y5FA 2OWHA 5F68A 3MQOA 3D72A 1LL8A 1MC0A 4MN6A 4I3AA 4L9GA 4EXOA 4FOFA 3LICA 3CLOA 4YNRA 5DJUA 1LT0A 2GX5A 2XA7M 3C30A 2DMWA 2YKFA 3S7PA 1P0ZA 2J3WA 2MJ6A 3P7NA 4DJ2A 1S1ZA 4R6LA 2D01A 4PHTA 2KDKA 2W3GA 3OC2A 2JKTI 4OOLA 2A2LA 5FL3A 3LR4A 4NXBA 3IBRA 2B18A 3F1OB 2EWVA 2PD8A 1LSXA 3UE3A 4ETZA 5TBMA 1MZUA 2JKTM 5G4ZA 4EEUA 4B9OA 2L1MA 4WF0A 4EW7A 2PYPA 2ZMFA 3LR5A 2L4RA 3FC7A 1YAXA 4KQOA 2R78A 4I5SA 3CUEA 4K08A 3T50A 3E4PA 2XROA 3KYQA 4L9EA 5DFXA 3KSIA 2ZBBA 3GECA 3R7WB 2PD7A 2CMNA 2M7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6D A;  4HJ3 A;  3MXQ A;  4I39 A;  4HJ4 A;  2J80 A;  1OT9 A;  4NXG A;  4NXF A;  5G4Y A;  1LSW A;  1N9L A;  4HOI A;  3NOT C;  2OOL A;  4EET B;  2BAS A;  4H6J B;  1OJ5 A;  4LRY C;  4XT2 A;  4LRX C;  4HIA A;  1DP8 A;  1Y28 A;  3C2W A;  1T19 A;  2QKP A;  1UWN X;  3H7W A;  4R38 A;  1LSV A;  3SW1 A;  3MQQ A;  1OTB A;  3LIF A;  4BBU A;  1V9Y A;  4L9F A;  2H28 A;  1XFN A;  2WKQ A;  3NHQ A;  4NXE A;  1S4R A;  1TS7 A;  4RQ9 A;  3RH8 B;  2PDR A;  1P97 A;  4GCZ A;  5HDC A;  5HWW A;  3LYX A;  1TS8 A;  4WL9 A;  1DRM A;  2K7S A;  4HJ6 A;  4JGQ A;  3LIE A;  3LUQ A;  1D06 A;  2QHK A;  3HJK A;  2M1C A;  2QJ5 A;  2D02 A;  4KUO A;  3UB6 A;  4BBT A;  5F69 A;  2A24 B;  5HD5 A;  3RTY A;  2ZOH A;  4F3L A;  5DKL A;  1OJG A;  1TS6 A;  4HP9 A;  2PHY A;  4DJ3 A;  3GDI A;  2GJ3 A;  3F1P A;  5F6A A;  3H9W A;  1GSV A;  1GSW A;  4HH2 A;  1XJ4 A;  1T1B A;  1T1A A;  5AVF A;  3G6O A;  4E04 A;  1F98 A;  3H82 A;  3BWL A;  5I5L A;  3UB9 A;  4EES A;  5A8B A;  4PKY A;  4R3A A;  2YKH A;  4I3J A;  3F1O A;  5HDS A;  4HQA A;  4KQD A;  2P7J A;  1EW0 A;  3KX0 X;  4EEP A;  5IU1 A;  4PKY G;  4LLO B;  1NWZ A;  1S66 L;  3EWK A;  4LRZ E;  3PHY A;  3B33 A;  4GS9 B;  3ICY A;  2VLG A;  4YWZ A;  1V9Z A;  2JN7 A;  2QWS A;  3LI8 A;  3K3C A;  3K3D A;  3ULF A;  4WN5 A;  3VE3 A;  4HI4 A;  3ZQ5 A;  3IS2 B;  3CWF A;  4GHI B;  1WA9 A;  3BY8 A;  1G28 A;  3UB7 A;  3CAX A;  3HJI A;  1VB6 A;  1ODV A;  3F1N B;  3LI9 A;  2Z6C A;  1N9N A;  2QJ7 A;  3UB8 A;  4WUJ A;  5F5Y A;  1OT6 A;  1S1Y A;  1X0O A;  3MJQ A;  5HD3 A;  3UME A;  5HZH A;  5HSQ A;  3MFX A;  3NOP C;  1N9O A;  2VV8 A;  1XFQ A;  4HHD A;  2V9A A;  4JGO A;  1D7E A;  3PYP A;  4MN5 A;  3A0S A;  1OTD A;  3NOU C;  2ZOI A;  3A0R A;  2WKR A;  1XJ6 A;  3LID A;  3A0V A;  1KOU A;  5DJT A;  2V1A A;  4HY8 A;  4GW9 A;  2V0W A;  4HP4 A;  3H82 B;  2VV7 A;  3UMD A;  1T18 A;  5J4E A;  5TBM B;  4WLA A;  5J7E A;  4HH3 A;  3E4O A;  1XJ3 A;  5IS1 A;  2HV1 A;  2W27 A;  5EFW A;  4LPZ A;  3VOL A;  1T1C A;  2I9V A;  5KIZ A;  1F9I A;  5AVE A;  2WKP A;  5HDD A;  2B02 A;  3LIA A;  4GS9 A;  2VV6 A;  1S67 L;  4XT2 B;  1OTA A;  1DP9 A;  4H6J A;  2INW A;  2PR6 A;  1S4S A;  3H7W B;  2EA9 A;  1JNU A;  2L0W A;  4EER A;  5HWV A;  2PYR A;  3EEH A;  1TS0 A;  3BY9 A;  1UWP X;  3MR0 A;  4EQ1 A;  3IS2 A;  4GHI A;  5DKK A;  4KUK A;  3C8C A;  4I38 A;  1OTI A;  3VE4 A;  2V0U A;  1UGU A;  2KX6 A;  5J3W A;  4BBV A;  1OTE A;  2OWJ A;  3F1N A;  2W0N A;  1XJ2 A;  3E4Q A;  3LIB A;  4I3I A;  2V1B A;  4F3L B;  1DP6 A;  1BYW A;  4R70 A;  1GSX A;  2VEA A;  2A24 A;  3FG8 A;  3OLO A;  4M4X A;  4JGP A;  2JHE A;  3F1P B;  3NJA A;  4HNB A;  5HWT A;  4JGR A;  2PR5 A;  2OWH A;  5F68 A;  3MQO A;  3D72 A;  1LL8 A;  4MN6 A;  4I3A A;  4L9G A;  4EXO A;  3LIC A;  3CLO A;  5DJU A;  1LT0 A;  2YKF A;  1P0Z A;  3P7N A;  4DJ2 A;  1S1Z A;  4R6L A;  2D01 A;  2KDK A;  4NXB A;  3IBR A;  3F1O B;  2PD8 A;  1LSX A;  5TBM A;  1MZU A;  5G4Z A;  4EEU A;  4B9O A;  2L1M A;  4WF0 A;  4EW7 A;  2PYP A;  2L4R A;  3FC7 A;  2R78 A;  4I5S A;  4K08 A;  3T50 A;  3E4P A;  4L9E A;  2ZBB A;  3GEC A;  2PD7 A;  2CMN A;  3UE6 A; 
#chains in the Genus database with same CATH topology
 2LB5 A;  3HLC A;  4HJ3 A;  5KMW A;  4OH0 A;  4WMC A;  5M19 A;  2QYB A;  4NXF A;  4PM8 A;  1O07 A;  1PI4 A;  2R9W A;  4R4R A;  1LSW A;  3OPR A;  2BAS A;  3IT9 A;  3VMA A;  4D2O A;  3PAG A;  2J9O A;  1OJ5 A;  3C38 A;  1DP8 A;  4DE2 A;  4BL3 A;  1UWN X;  5GHX A;  3SW1 A;  4WEK A;  4ZJ2 A;  3HLF A;  3CMZ A;  4K0X A;  4Y7P A;  4DXC A;  4WBG A;  5KZH A;  1WYB A;  4L9F A;  4JF4 A;  4AFI A;  2WKQ A;  3NHQ A;  2WGV A;  1XA1 A;  3Q07 A;  1S4R A;  1TS7 A;  4RQ9 A;  1P97 A;  4GCZ A;  4UA6 A;  5HDC A;  3LYX A;  1ZTU A;  1DRM A;  2K7S A;  3UB5 P;  2HDU A;  4HJ6 A;  4C75 A;  3UPP A;  4KEN B;  4Y0U A;  2P08 A;  2KOI A;  2GNX A;  4X53 A;  3CUE C;  1L0F A;  1XX2 A;  1YQS A;  5HD5 A;  4F3L A;  1K4F A;  3OPL A;  3QNC A;  4P6B A;  2V8F A;  2PHY A;  2KLI A;  4GDB A;  1GA0 A;  4NKP A;  4E3N A;  4B4Z A;  4YOF A;  1GHI A;  3OCL A;  3RFB A;  1XXM A;  2OLU A;  1K56 D;  4MEZ A;  1PW8 A;  5CHM A;  1BZA A;  4QWO A;  3HRE A;  4S2P A;  5AVF A;  1K54 C;  1H8Z A;  1J3W A;  3NIA A;  3OPH A;  3UN7 A;  3BWL A;  2WKE A;  2EX9 A;  2G7U A;  5MC7 A;  3CG5 A;  5A8B A;  2ZQ8 A;  2PU2 A;  4MDZ A;  2Y2H A;  2ZQC A;  5EVL A;  1YLY A;  1I5Q A;  1NJ4 A;  4KQD A;  4OLG A;  1FSY A;  5E2F A;  1P9W A;  3G32 A;  4N9K A;  2XDM A;  4QY5 A;  2EFX A;  1S66 L;  2W1R A;  3B33 A;  3ICY A;  2VJW A;  2VLG A;  4G3K A;  1YSP A;  3BRM A;  4FUW A;  1V9Z A;  3MZE A;  3HCY A;  3BYD A;  4OON A;  3K3C A;  3K3D A;  4RA7 A;  3RXX A;  2W1T A;  3RJU A;  5JYO A;  2OAP 1;  4RYE A;  2Y8H A;  3IS2 B;  3CPT A;  1VEU A;  5M18 A;  2WAE A;  3IWO A;  4S2N C;  1G28 A;  3BW6 A;  3KO6 A;  3V3R A;  3GSG A;  4DE0 A;  4ZDX A;  3NBL A;  2PBD P;  2UV0 E;  2J7V A;  3CAX A;  5TFQ A;  1VB6 A;  2XEP A;  5E2G A;  2GZA A;  3B42 A;  4HEF A;  3UB8 A;  1E25 A;  4WUJ A;  4LEN A;  1YPR A;  4BL2 A;  3Q7V A;  1X0O A;  3MJQ A;  5HZH A;  1YLW A;  5CHU A;  1Y54 A;  3NOP C;  2Y2I A;  2V20 A;  1MXO A;  2X71 A;  2ZM0 A;  5EEC A;  3PYP A;  2B95 A;  1HZO A;  1AWI A;  3NOU C;  3LGO A;  2ZOI A;  3CJM A;  5FAO A;  2WKR A;  1XJ6 A;  3W4Q A;  5HL1 A;  2FFY A;  3BQA A;  3DWZ A;  2IA2 A;  1A0K A;  1SKO B;  4OQI A;  5HPI A;  3BFC A;  3RXW A;  4WZ5 A;  4DXB A;  1ZKJ A;  3EOI A;  1KGE A;  3S7O A;  4HY8 A;  4R0Q A;  4EBL A;  4ETX A;  4GN2 A;  2V0W A;  2VV7 A;  2WZX A;  3UMD A;  5J4E A;  5TBM B;  5J7E A;  3SZT A;  5KSH A;  4EWF A;  3L7H A;  4HES A;  2X01 A;  3ZGA B;  5EFW A;  4EUV A;  5A93 A;  5BOH A;  5CGW A;  3EQU A;  4XUZ A;  3O5Y A;  5EPH A;  5CTN A;  2ZQ7 A;  2VKS A;  4HBU A;  4JXW A;  3IF5 A;  3CIT A;  5E2H A;  3IWQ A;  2XK1 A;  4MLL A;  3MXR A;  1FIK A;  4XT2 B;  3HUO A;  2Y2K A;  2DCF A;  2JKR M;  3CPT B;  3K2N A;  4EER A;  1VEU B;  2ZQ9 A;  1EWZ A;  4P6Z M;  1FSW A;  2LB9 A;  3M6B A;  4DE1 A;  3A3D A;  2BG1 A;  3MBZ A;  3S7Q A;  4U0X A;  3UPN A;  5AJG A;  3VE4 A;  2V0U A;  1UGU A;  2KX6 A;  4MBK A;  4O8G A;  1NRJ A;  4R1G A;  2HDS A;  4CLC B;  1F5M A;  1OTE A;  3F1N A;  4Y0O A;  2W0N A;  1XJ2 A;  1BUE A;  2HJE A;  4E3K A;  3LIB A;  1KDW A;  4ZBE A;  4UQI M;  3VSK A;  5CGX A;  1G68 A;  2XD5 A;  3S7N A;  1W8Y A;  5DTK A;  4Y17 A;  1BTL A;  3F1P B;  5FQQ A;  5GLD A;  2DNS A;  2BTF P;  3NJA A;  4X1L A;  4HNB A;  2ZLY A;  1YSQ A;  4ZJ1 A;  5HWT A;  2OWH A;  4X68 A;  5D3O A;  3LCE A;  1BLS A;  1MC0 A;  3L9K A;  3LIC A;  1AXB A;  2XFT A;  3CLO A;  1L3L A;  3FKW A;  2GX5 A;  4E3M A;  1BT5 A;  4NG2 A;  3HUN A;  1W5D A;  4MNR A;  4GZB A;  2D01 A;  2Y2Q A;  1MWR A;  2I72 A;  2ZL1 A;  5DTT A;  4A5R A;  1I2W A;  1LI9 A;  3U4L P;  1NRF A;  3UE3 A;  4ETZ A;  2WGW A;  2XFS A;  4E6X A;  5EM0 A;  1MZU A;  1SDN A;  1CI9 A;  4X25 A;  2AVX A;  4B9O A;  1K56 A;  4WF0 A;  4MBF A;  3HBR A;  3W8K A;  3DTK A;  2L4R A;  3FC7 A;  3BM6 A;  3AGF A;  2R78 A;  4OQG A;  3CUE A;  4C3Q A;  3ZVT A;  3N8L A;  1N4O A;  3KYQ A;  3MXS A;  5HAP A;  3GEC A;  2R9X A;  2CMN A;  2M7V A;  3UE6 A;  2Z6D A;  3MXQ A;  4I39 A;  4HJ4 A;  3S1Y A;  4NXG A;  1XGJ A;  5A92 A;  1YLZ A;  1N9L A;  4IJG A;  3ZYT A;  3T1Q B;  4EET B;  4Y13 A;  3NEC A;  2HGV A;  1KE4 A;  5GLC A;  1K54 A;  3VFF A;  4LRY C;  5DFY A;  4X6T A;  3C4O A;  3C2W A;  1IYS A;  2QKP A;  3G35 A;  3OCN A;  1IFQ A;  3MQQ A;  1OTB A;  4BBU A;  3EGD C;  3LR0 A;  1K57 A;  5FA7 A;  4BD0 A;  1XFN A;  3JVU A;  3G34 A;  2IWD A;  4NXE A;  4OPZ A;  3LY3 A;  3DW0 A;  5TGF A;  1TS8 A;  1GHM A;  3FKV A;  3UO9 A;  3E0Y A;  4JGQ A;  3LIE A;  1U60 A;  3HJK A;  4JBF A;  2QJ5 A;  3UPO A;  1ESI A;  3UB6 A;  1SKF A;  2HF6 A;  5F69 A;  1HD8 A;  4ARZ A;  5EV0 A;  5HPF A;  2QMI A;  1MWT A;  2ZOH A;  3MKF A;  5GL9 A;  1OJG A;  3EGX C;  1TS6 A;  1IOU A;  5FQK A;  1IEM A;  4PM7 A;  4FSF A;  2XH9 A;  4Q0J A;  3PR6 A;  1PI5 A;  5F6A A;  3T4Q A;  1KGG A;  5EOE A;  2W3D A;  5EVI B;  3VP1 A;  4S2N A;  3T12 B;  4CPK A;  1D1J A;  3G6O A;  2JKG A;  3A3J A;  3V67 A;  3PTE A;  3S4X A;  3UB9 A;  4EES A;  2WGW B;  3IX8 A;  4LV0 A;  2YKH A;  1S6R A;  4Y15 A;  2K31 A;  1Y4O A;  1ACF A;  2Y4A A;  3F1O A;  5HDS A;  4HQA A;  3QP5 A;  4EEP A;  5JYP A;  4PKY G;  2VZW A;  4PAU A;  3ITA A;  3PHY A;  4GS9 B;  3ZDJ A;  3G2Y A;  2EX8 A;  2QWS A;  3DAV A;  3BEC A;  2IWB A;  2ZD8 A;  4P6Z S;  1L0G A;  4WN5 A;  3IF6 B;  4EV4 A;  2HPB A;  4HI4 A;  3ZQ5 A;  2K2N A;  5AQB A;  1IEL A;  4Z1W A;  5FI7 A;  1FOF A;  4GHI B;  4UEY A;  3T4O A;  3BY8 A;  2ZC4 B;  4PM9 A;  3UB7 A;  2P9V A;  4ZJ3 A;  3TJZ C;  1IYO A;  4IVI A;  3TG9 A;  4UQI S;  3T4J A;  2Z2M B;  1N9N A;  2QJ7 A;  3IXD A;  4GKU A;  4IUH A;  3VP2 A;  4KZ7 A;  3P09 A;  3NUL A;  5HD3 A;  1YM1 A;  5HSQ A;  2Y79 A;  3OBF A;  3FV7 A;  3HLG A;  4FH2 A;  4ESP A;  3VV4 A;  2Y55 A;  1N9O A;  1KDS A;  3EEA A;  1D7E A;  5EVE A;  2XR0 A;  4UA7 A;  1OME A;  4MN5 A;  4KZ9 A;  1OTD A;  4M3K A;  4LV1 A;  3VOZ A;  1KVM A;  1VM1 A;  3W4O A;  4ZRR A;  5EVI D;  3LID A;  3OZH A;  3TRC A;  5FDH A;  4X1M A;  4JXG A;  1PZO A;  4OKP A;  1EI5 A;  3TSG A;  3V3S A;  1SDE A;  1IYP A;  4GW9 A;  1QME A;  2JKF A;  4GD8 A;  4QY6 A;  4YIN A;  4OOY A;  1T18 A;  2XD1 A;  4WLA A;  1K57 C;  2HZ5 A;  1YT4 A;  3SH9 A;  5HL6 A;  2H0Y A;  1XJ3 A;  2CC1 A;  5M1A A;  2HV1 A;  5GHY A;  1IYQ A;  4QHC A;  1W63 Q;  3VOL A;  5KIZ A;  1ERM A;  3FPW A;  1Q2Q A;  5DF8 A;  4G3W A;  1IKI A;  1ES4 A;  1JVJ A;  2H10 A;  3LY4 A;  3WS2 A;  2WKP A;  4KQQ A;  3LO7 A;  3TE8 A;  4IED A;  2W3E A;  3ZG7 B;  2EWW A;  4YFM A;  5IT5 A;  3ZCZ A;  4QD4 A;  3P98 A;  4H6J A;  3M2J A;  4O0P A;  3SH7 A;  4KZ8 A;  1E3U A;  4IUK A;  2PYR A;  3M2K A;  1FCN A;  5L07 A;  3BY9 A;  3CI6 A;  1L2S A;  4B4X A;  4O7D A;  1UWP X;  3MR0 A;  3N7W A;  3GRJ A;  5L10 A;  3C5A A;  1YMS A;  3NDE A;  5DKK A;  3CZD A;  4I38 A;  2PT7 A;  4X55 A;  2VGJ A;  1SCW A;  3T1X A;  1WE4 A;  5LBR A;  2RCX A;  3E4Q A;  4OP8 A;  2V1B A;  1FCM A;  4F3L B;  1TEM A;  2Y2J A;  1GSX A;  2VEA A;  3SH8 A;  2A24 A;  3GMW A;  3MF0 A;  3OLO A;  4FH4 A;  2M7U A;  2ZC5 B;  2Y2O A;  4JGP A;  3BFF A;  2JHE A;  4KG2 A;  3MFD A;  3IX3 A;  1MPL A;  1J9M A;  2NUP C;  2B5R A;  3AGD A;  4X56 A;  2PR5 A;  3LEQ A;  1ERQ A;  5HW3 A;  4I3A A;  4L9G A;  3O86 A;  1ES2 A;  5DJU A;  1LT0 A;  3C30 A;  3O87 A;  3S7P A;  2MJ6 A;  1VET A;  4PHT A;  1FR6 A;  4JXV A;  1PFL A;  2A2L A;  4OVD A;  3IBR A;  2B18 A;  2PD8 A;  1LSX A;  2OSU A;  2OV5 A;  1TDL A;  4H8R A;  3LR5 A;  2P74 A;  5CHJ A;  1C3B A;  1L0D A;  1YAX A;  4NET A;  2BLS A;  4I5S A;  3T50 A;  3WS0 A;  2XRO A;  5AQA A;  4X69 A;  1LLB A;  3HVF A;  3Q1F A;  2PD7 A;  4Y2F A;  3IXB A;  3KSG A;  2W1T B;  2J80 A;  4WYY A;  3M6H A;  5G4Y A;  4UA9 A;  3NOT C;  2OOL A;  3NY4 A;  1HLU P;  3Q7Z A;  4H6J B;  1ZHH B;  4CQH A;  5G18 A;  4BWI A;  5FQJ A;  3V5M A;  5FQ9 A;  1Y28 A;  2J3T D;  1H5X A;  1M40 A;  1Z09 A;  4E3I A;  3H7W A;  1K55 C;  1LSV A;  5I94 A;  3LIF A;  3P01 A;  4FTX A;  2Q0O A;  4WZ4 A;  5CX7 A;  1RCJ A;  4IHQ A;  4UAA A;  1NZU A;  3Q7V B;  3RH8 B;  4EBP A;  2JE5 A;  3T4K A;  4NK3 A;  2WKI A;  3KSH A;  4DDY A;  1YKD A;  3HLE A;  3Q82 A;  3QHY A;  1W7F A;  2J8Y A;  2WKH A;  2XRN A;  3GR2 A;  2ZMA A;  3V39 A;  5FAQ A;  2D02 A;  4KUO A;  5FQI A;  3N6I A;  4BBT A;  4U3T A;  2A24 B;  4HBT A;  3IH8 A;  4OOM A;  1H3Q A;  5GLA A;  4G3V A;  2Q9N A;  4DJ3 A;  3GDI A;  2GJ3 A;  2PBY A;  4OPQ A;  1BLC A;  3WRZ A;  3T1S A;  1GSW A;  4HH2 A;  2WAF A;  5FI2 A;  4GNU A;  1NYM A;  1OPX A;  1VET B;  4E04 A;  4OPY A;  2O9B A;  5C5K A;  3H82 A;  3MKE A;  1XGI A;  3BFG A;  1PIO A;  3KYE A;  4S2K A;  3DWK A;  4D60 A;  4Q8I A;  4GJ4 A;  3ZHH A;  4I3J A;  2P7J A;  3BJN A;  1EW0 A;  5IU1 A;  1VQQ A;  3PBS A;  5F1F A;  1S0W A;  4ME4 A;  1ZC2 A;  1NYY A;  4LRZ E;  3BLS A;  1BSG A;  4P87 A;  1TVF A;  3ZG0 A;  1Q2P A;  1WYC A;  4E3O A;  1Z6F A;  3SS3 A;  3ZG9 B;  3UNW A;  1PNE A;  3R7W A;  4NEE D;  2W3H A;  2A3U A;  3DBA A;  3ULF A;  3G4P A;  2Y2M A;  4F94 A;  1TF1 A;  2NUT C;  1FQG A;  5A90 A;  3VP0 A;  3KYZ A;  4N92 A;  3SS5 A;  4CLC D;  3CWF A;  5FSR A;  3B47 A;  4N1X A;  1WA9 A;  4JF5 A;  3A3I A;  3C4P A;  1YLP A;  3HJI A;  1PRQ A;  3LFV A;  3VFH A;  1ODV A;  3F1N B;  3LI9 A;  2Z6C A;  4Y0T A;  5EOO A;  2XF3 A;  1JWZ A;  2WGI A;  5F5Y A;  1OT6 A;  3A3E A;  2PRF A;  3MZF A;  2WUQ A;  3UME A;  3MFX A;  3MSH A;  2W3F A;  4MMN A;  4KZ6 A;  1XFQ A;  4PPR A;  2V9A A;  3NCK A;  4JGO A;  3PXP A;  3WS5 A;  1YMX A;  3D4F A;  1O7E A;  3A0S A;  4PM6 A;  4U0T A;  1LHY A;  3QP2 A;  3ZNT A;  3ZFZ A;  2VA0 A;  3A0R A;  2Y91 A;  5KSC A;  3GQZ A;  2ZM2 A;  1KOU A;  4DE3 A;  2WK0 A;  5DJT A;  1HVB A;  4PMA A;  2ZL1 B;  3G2Z A;  4WEL A;  3H82 B;  4P85 A;  1XP4 A;  3QP6 A;  1MY8 A;  3IXG A;  1PZP A;  3W4P A;  2E8J A;  1KVL A;  5J8X A;  5IS1 A;  2W27 A;  4E3J A;  4IBR A;  5E2E A;  2H5S A;  1I2S A;  3VP4 A;  5FEG A;  3BFE A;  1RP5 A;  1T1C A;  2I9V A;  1F9I A;  5AVE A;  4K0W A;  4KZ3 A;  1K0K A;  1SHV A;  4WM9 A;  2B02 A;  3LIA A;  4QPR A;  3PBQ A;  3LEZ A;  4LV3 A;  4QB8 A;  1NLY A;  3PAE A;  4JXS A;  4LCL A;  2VV6 A;  3I7J A;  1S67 L;  2VGL M;  4CLC E;  1DP9 A;  1DJA A;  5F82 A;  2Y2P A;  4Z9Q A;  3FWL A;  3T4T A;  4KG5 A;  1S4S A;  2EA9 A;  5CED A;  1F2K A;  1JNU A;  4XUX A;  1STZ A;  4DF6 A;  3EEH A;  3IBJ A;  3GTC A;  4FCF A;  1NY0 A;  1ES5 A;  3E98 A;  2Y2N A;  4P0M A;  3IS2 A;  3MMH A;  4ID4 A;  5EVI C;  4B88 A;  1E4D A;  4KUK A;  4BQM A;  1OTI A;  1NZO A;  2OLV A;  3UE0 A;  4B93 A;  2OAQ 1;  3WS1 A;  3IH9 A;  4EQI A;  5J3W A;  4BBV A;  1CI8 A;  5TJJ A;  1MBL A;  2FH5 A;  2OWJ A;  1ONH A;  4ARZ B;  1VHM A;  3QP8 A;  1G6A A;  1CEF A;  3PBN A;  4I3I A;  1BYW A;  3IWI A;  4LV2 A;  3WS4 A;  3FG8 A;  5EM1 A;  2PAV P;  5HFO A;  1K38 A;  2ZC3 B;  4JGR A;  5CRF A;  4Y5F A;  1CQA A;  3Q81 A;  5L09 A;  4MN6 A;  4EXO A;  3FZC A;  4RX3 A;  3IQA A;  4YNR A;  4PM5 A;  1K55 A;  2XA7 M;  2DMW A;  1SKO A;  2YKF A;  1P0Z A;  3HLB A;  4KZB A;  3FYZ A;  1ZG4 A;  3P7N A;  3IF6 C;  4DJ2 A;  2RL3 A;  2V8C A;  1H8Y A;  2W3G A;  3OC2 A;  1GCE A;  2JKT I;  4OOL A;  4S2M A;  5FL3 A;  4NXB A;  4RVA A;  3F1O B;  5F83 A;  5TBM A;  4R23 A;  2JKT M;  1G5U A;  3V50 A;  5G4Z A;  5CEB A;  2A49 A;  2ZM8 A;  4GOG A;  3WWX A;  5FEF A;  2ZMF A;  4MBH A;  4KQO A;  4K08 A;  2WZZ A;  3UY6 A;  3UDI A;  1MKI A;  4GB7 A;  4N1H A;  3KSI A;  5A91 A;  2ZBB A;  4R3B A;  2JBF A;  4JKT A;  1H0M A;  4EBN A;  3BEB A;  1PYY A;  1OT9 A;  1CK3 A;  5IHV A;  3ISG A;  4HOI A;  2JC7 A;  1PWG A;  3CHW P;  4GDN A;  1RGZ A;  1K4E A;  1CEG A;  3O3V A;  5CEC A;  1BUL A;  4DN0 A;  5HAI A;  2O9A A;  4LRX C;  4XT2 A;  4HIA A;  4EU0 A;  2P9V B;  1T19 A;  3OOV A;  4R38 A;  3JVV A;  1V9Y A;  3ZG5 A;  2H28 A;  3E2K A;  1DJB A;  5GLB A;  4RX2 A;  3DTM A;  1LL9 A;  1KE0 A;  1JTG A;  3KSF A;  1CJF A;  2FFF B;  2EXA A;  2PDR A;  2QZ6 A;  5HWW A;  2EFU A;  4WL9 A;  4OQ0 A;  2VX8 A;  2HJ9 C;  1FCO A;  3LUQ A;  1IKG A;  4CLC A;  4MN7 A;  1D06 A;  2QHK A;  3IHB A;  2M1C A;  4BJP A;  5L8M A;  1W8Q A;  2O0Y A;  2UWX A;  4CJN A;  3RTY A;  2FZ0 A;  1ONG A;  1HTZ A;  3HLD A;  3G30 A;  3IXH A;  3N4I A;  1ALQ A;  4S2J A;  5DKL A;  1LL5 A;  1ERO A;  1CF0 A;  2HDQ A;  4LCM A;  4JF6 A;  1NXY A;  4HP9 A;  1RGY A;  5EUA A;  2XSS A;  4O01 A;  2X02 A;  3FPV A;  3F1P A;  5GHZ A;  3TOI A;  3IX4 A;  2P04 A;  3H9W A;  1GSV A;  1XJ4 A;  2ACG A;  2IWC A;  1T1B A;  1L0E A;  1T1A A;  4KZ4 A;  1F98 A;  1GHP A;  1NLZ A;  5CGS A;  3QP4 A;  2Y2G A;  3DTI A;  5FAT A;  5I5L A;  2ZMV A;  4PKY A;  3IHA A;  4R3A A;  4S2L A;  2XQZ A;  3QNB A;  4KG6 A;  4E3L A;  4WMC D;  3HLW A;  4DKI A;  3HUM A;  3QP1 A;  1MKM A;  3N8S A;  3HL9 A;  2J3T C;  3MQ0 A;  1BLH A;  3KX0 X;  4KQR A;  1K6S A;  2G2W A;  1MWS A;  4MCW A;  2VGL S;  4LLO B;  5DF7 A;  1NWZ A;  4QU3 A;  3BLM A;  3GV9 A;  2WYX A;  1GA9 A;  3EWK A;  1M6K A;  5K5B A;  3C7V A;  4YWZ A;  5HX9 A;  2G2U A;  4DDS A;  2JN7 A;  1W79 A;  3LI8 A;  5HAQ A;  3LR3 A;  2ZQD A;  4ZTK A;  1TD5 A;  2C6W B;  3MS6 A;  5CER A;  3VE3 A;  3VSL A;  3SS4 A;  2JKR I;  3O88 A;  3S22 A;  3UDX A;  3T1R A;  1YLJ A;  1H8M A;  3PBR A;  1MWU A;  3OPP A;  2J9P A;  2H0T A;  5E43 A;  4QJG A;  3ZVW A;  4OLD A;  4R4S A;  5AQ7 A;  2HP5 A;  1K6R A;  2WAD A;  1XPB A;  4BD1 A;  5HAR A;  4WEJ A;  4R3J A;  1S1Y A;  2Q9M A;  3T4L A;  1XKZ A;  3JPU A;  3D3O A;  1PWC A;  4EUZ A;  2VV8 A;  2ZC6 B;  4HHD A;  4S2I A;  4LGW A;  4JPM A;  3E2L A;  3TW8 A;  4S2O A;  2XA7 S;  1TDG A;  3G31 A;  5CXW A;  4N9L A;  1KGF A;  3T4S A;  4ZAM A;  4OPR A;  3A0V A;  5DF9 A;  5FAP A;  2E8I A;  4UHU A;  3BQ8 A;  1N9B A;  5FI6 A;  2V1A A;  4KZ5 A;  4DMZ A;  3R4K A;  4HP4 A;  4GLQ A;  3C7U A;  1JTD A;  3ITB A;  5EVI A;  4OP5 A;  2V2F F;  3W2Z A;  2Y59 A;  4HH3 A;  2VK3 A;  4JLF A;  5U47 A;  3E4O A;  1DJC A;  2JCH A;  3PBT A;  4IVK A;  2GDN A;  4LPZ A;  4CLC C;  5EE8 A;  3D9Y A;  3JYI A;  5F1G A;  3NC8 A;  4Y3I A;  2HDR A;  2Z2L B;  4BMW A;  4FD8 A;  3PBO A;  4GD6 A;  2ZC7 A;  5HDD A;  4Q0I A;  3WRT A;  1E3U D;  1JWP A;  3AGE A;  3EQV A;  4GS9 A;  2Y2L A;  3SOI A;  1OTA A;  4II7 A;  1P9R A;  3VP3 A;  2INW A;  5FDS A;  2PR6 A;  4Q0H A;  4C6Y A;  3H7W B;  3IF6 A;  2L0W A;  2EXB A;  5HWV A;  3NI9 A;  1W63 M;  4WZ5 C;  1TS0 A;  1QMF A;  3U2A A;  4EQ1 A;  2ZQA A;  5FAS A;  4GHI A;  1BLP A;  5TR7 A;  3N8R A;  3C8C A;  2O9C A;  5DTS A;  3ZNY A;  4OQH A;  2PU4 A;  1XA7 A;  4BEN A;  3B3X A;  1KE3 A;  1ESU A;  1DP6 A;  3ZG8 B;  1FR1 A;  4R70 A;  4L0L A;  5DVA A;  4XXR A;  2C5W B;  5FQM A;  2O99 A;  4M4X A;  3BFD A;  1LI0 A;  1G6O A;  2V1Z A;  5F68 A;  4K91 A;  3MQO A;  3A3F A;  2XGN A;  3D72 A;  4DRT A;  1LL8 A;  2VGK A;  2HP6 A;  1YLT A;  4FOF A;  1SZV A;  2HP9 A;  1PW1 A;  2J3W A;  1S1Z A;  4E6W A;  4R6L A;  5AQ9 A;  2XLN A;  2KDK A;  2EX2 A;  3LR4 A;  1JWV A;  5CTM A;  1ZG6 A;  2EWV A;  2EX6 A;  3GVB A;  3UDF A;  4IBX A;  1PWD A;  1ES3 A;  4EEU A;  2QPN A;  2ZJ9 A;  3MZD A;  2L1M A;  4BLM A;  3DTE A;  1K25 A;  5L2F A;  4EW7 A;  4LFU A;  2PYP A;  3NDG A;  3VOY A;  1DY6 A;  3E4P A;  1FIL A;  4L9E A;  3UE1 A;  5DFX A;  4KZA A;  3R7W B;  2DRW A; 
#chains in the Genus database with same CATH homology
 2LB5 A;  3KSG A;  2Z6D A;  4HJ3 A;  3MXQ A;  2QYB A;  2W1T B;  4HJ4 A;  4I39 A;  2J80 A;  1OT9 A;  4NXG A;  4NXF A;  5G4Y A;  1LSW A;  1N9L A;  4HOI A;  3NOT C;  4IJG A;  2OOL A;  3ZYT A;  2BAS A;  4EET B;  4H6J B;  1ZHH B;  4CQH A;  2HGV A;  4BWI A;  4Y2F A;  1OJ5 A;  4DN0 A;  4LRY C;  2O9A A;  4LRX C;  4XT2 A;  3C38 A;  1DP8 A;  4HIA A;  5DFY A;  1Y28 A;  2J3T D;  4EU0 A;  3C2W A;  1T19 A;  2QKP A;  3OCN A;  1UWN X;  1IFQ A;  3OOV A;  3H7W A;  4R38 A;  1LSV A;  3SW1 A;  3MQQ A;  1OTB A;  4WEK A;  3LIF A;  3P01 A;  4BBU A;  3JVV A;  1V9Y A;  3EGD C;  5CX7 A;  3LR0 A;  4IHQ A;  2H28 A;  4L9F A;  1XFN A;  3JVU A;  4AFI A;  2WKQ A;  3NHQ A;  4NXE A;  3KSF A;  1S4R A;  1TS7 A;  4RQ9 A;  3RH8 B;  2PDR A;  1P97 A;  4GCZ A;  5HDC A;  5HWW A;  3LYX A;  3T4K A;  1TS8 A;  1ZTU A;  1DRM A;  2K7S A;  3KSH A;  4WL9 A;  1YKD A;  4HJ6 A;  2VX8 A;  2HJ9 C;  3E0Y A;  4JGQ A;  3LIE A;  3LUQ A;  4CLC A;  4MN7 A;  2XRN A;  1D06 A;  2QHK A;  3HJK A;  4BJP A;  2M1C A;  2QJ5 A;  2D02 A;  4KUO A;  5L8M A;  3UB6 A;  2P08 A;  2HF6 A;  4BBT A;  5F69 A;  2KOI A;  4ARZ A;  2GNX A;  2O0Y A;  2A24 B;  5HPF A;  3CUE C;  5HD5 A;  3RTY A;  2FZ0 A;  2ZOH A;  4F3L A;  4OOM A;  5DKL A;  1H3Q A;  1OJG A;  3EGX C;  4G3V A;  1TS6 A;  1IOU A;  4HP9 A;  2PHY A;  4DJ3 A;  3GDI A;  2XSS A;  2KLI A;  4O01 A;  2GJ3 A;  4FSF A;  3FPV A;  4NKP A;  3F1P A;  3PR6 A;  4Q0J A;  4YOF A;  2P04 A;  5F6A A;  3T4Q A;  3H9W A;  3OCL A;  3RFB A;  1GSV A;  1GSW A;  4HH2 A;  2W3D A;  1XJ4 A;  1T1B A;  1OPX A;  1T1A A;  5AVF A;  3G6O A;  4E04 A;  1F98 A;  2O9B A;  1NLZ A;  3H82 A;  5C5K A;  3BWL A;  3V67 A;  2G7U A;  5I5L A;  2ZMV A;  3UB9 A;  5MC7 A;  4EES A;  5A8B A;  4PKY A;  4R3A A;  4MDZ A;  2YKH A;  4GJ4 A;  2K31 A;  4I3J A;  1MKM A;  3F1O A;  5HDS A;  4HQA A;  4KQD A;  2J3T C;  2P7J A;  3MQ0 A;  3BJN A;  1EW0 A;  1P9W A;  3KX0 X;  4EEP A;  5IU1 A;  4PKY G;  3PBS A;  4MCW A;  2VGL S;  4LLO B;  2VZW A;  4ME4 A;  1NWZ A;  1S66 L;  4PAU A;  2W1R A;  3EWK A;  4LRZ E;  3PHY A;  3B33 A;  4GS9 B;  5K5B A;  3ICY A;  2VJW A;  2VLG A;  4G3K A;  1YSP A;  4YWZ A;  1V9Z A;  3HCY A;  2JN7 A;  2QWS A;  3LI8 A;  3R7W A;  3K3C A;  4NEE D;  4P6Z S;  2W3H A;  3K3D A;  3LR3 A;  1TD5 A;  3DBA A;  3ULF A;  4WN5 A;  2W1T A;  1TF1 A;  3VE3 A;  2NUT C;  4HI4 A;  3ZQ5 A;  2K2N A;  2OAP 1;  3KYZ A;  4Z1W A;  2Y8H A;  2JKR I;  3IS2 B;  4CLC D;  3CWF A;  3B47 A;  4GHI B;  3UE6 A;  4UEY A;  1WA9 A;  3T4O A;  3BY8 A;  1H8M A;  1G28 A;  3BW6 A;  3KO6 A;  3PBR A;  3UB7 A;  3TJZ C;  3CAX A;  3HJI A;  4UQI S;  1VB6 A;  3LFV A;  3T4J A;  1ODV A;  2GZA A;  3F1N B;  3LI9 A;  2Z6C A;  3B42 A;  1N9N A;  2QJ7 A;  3UB8 A;  4WUJ A;  5F5Y A;  1OT6 A;  4IUH A;  4WEJ A;  1S1Y A;  1X0O A;  3MJQ A;  5HD3 A;  3T4L A;  3UME A;  5HZH A;  5HSQ A;  3MFX A;  2Y79 A;  3OBF A;  3D3O A;  2W3F A;  3NOP C;  4MMN A;  3VV4 A;  1N9O A;  2VV8 A;  1XFQ A;  4HHD A;  2V9A A;  4JGO A;  3EEA A;  3PXP A;  1D7E A;  3PYP A;  3TW8 A;  2XA7 S;  3A0S A;  1OTD A;  4MN5 A;  3NOU C;  2ZOI A;  2VA0 A;  3A0R A;  4ZRR A;  2WKR A;  1XJ6 A;  3LID A;  3T4S A;  3A0V A;  5DF9 A;  3TRC A;  3BQA A;  2IA2 A;  1KOU A;  5HPI A;  5DJT A;  3BQ8 A;  3EOI A;  3S7O A;  2V1A A;  4HY8 A;  4DMZ A;  3R4K A;  4ETX A;  4GW9 A;  2V0W A;  4HP4 A;  3H82 B;  4WEL A;  2VV7 A;  4GLQ A;  3UMD A;  1T18 A;  5J4E A;  5TBM B;  4WLA A;  3W2Z A;  5J7E A;  4HH3 A;  5KSH A;  3E4O A;  5HL6 A;  3PBT A;  1XJ3 A;  5IS1 A;  2HV1 A;  2W27 A;  5EFW A;  4EUV A;  1W63 Q;  3EQU A;  4LPZ A;  4CLC C;  3VOL A;  1T1C A;  2I9V A;  3O5Y A;  5KIZ A;  3FPW A;  4Y3I A;  2VKS A;  4G3W A;  1F9I A;  5AVE A;  4BMW A;  2WKP A;  3PBO A;  5HDD A;  4Q0I A;  2B02 A;  3TE8 A;  3LIA A;  4QPR A;  2W3E A;  3PBQ A;  3CIT A;  2EWW A;  3EQV A;  4GS9 A;  1NLY A;  2VV6 A;  1S67 L;  4XT2 B;  1OTA A;  2VGL M;  4II7 A;  5IT5 A;  4CLC E;  1P9R A;  1DP9 A;  4H6J A;  2INW A;  2PR6 A;  4Q0H A;  3T4T A;  1S4S A;  3H7W B;  4O0P A;  2EA9 A;  1JNU A;  2L0W A;  3K2N A;  2JKR M;  4EER A;  5HWV A;  4IUK A;  1STZ A;  2PYR A;  1W63 M;  3EEH A;  3IBJ A;  1TS0 A;  3BY9 A;  3E98 A;  3CI6 A;  3U2A A;  1UWP X;  3MR0 A;  4P6Z M;  4EQ1 A;  3IS2 A;  2LB9 A;  4GHI A;  3MMH A;  5DKK A;  3S7Q A;  4KUK A;  3C8C A;  2O9C A;  4I38 A;  1OTI A;  5AJG A;  3VE4 A;  2V0U A;  1UGU A;  2OAQ 1;  2KX6 A;  2PT7 A;  4O8G A;  1NRJ A;  4B93 A;  4CLC B;  1F5M A;  5LBR A;  5J3W A;  4BBV A;  5TJJ A;  1OTE A;  2FH5 A;  2OWJ A;  3F1N A;  2W0N A;  1XJ2 A;  3E4Q A;  2HJE A;  4ARZ B;  1VHM A;  3LIB A;  3PBN A;  4I3I A;  2V1B A;  4F3L B;  4UQI M;  1DP6 A;  1BYW A;  4R70 A;  1GSX A;  2VEA A;  2A24 A;  3MF0 A;  4L0L A;  3S7N A;  3FG8 A;  3OLO A;  2M7U A;  2O99 A;  4M4X A;  4JGP A;  2JHE A;  1G6O A;  3F1P B;  3NJA A;  2NUP C;  4HNB A;  1YSQ A;  5HWT A;  4JGR A;  2PR5 A;  4Y5F A;  2OWH A;  5F68 A;  3MQO A;  3D72 A;  1LL8 A;  1MC0 A;  4MN6 A;  4I3A A;  4L9G A;  4EXO A;  4FOF A;  3LIC A;  3CLO A;  4YNR A;  5DJU A;  1LT0 A;  2GX5 A;  2XA7 M;  3C30 A;  2DMW A;  2YKF A;  3S7P A;  1P0Z A;  2J3W A;  2MJ6 A;  3P7N A;  4DJ2 A;  1S1Z A;  4R6L A;  2D01 A;  4PHT A;  2KDK A;  2W3G A;  3OC2 A;  2JKT I;  4OOL A;  2A2L A;  5FL3 A;  3LR4 A;  4NXB A;  3IBR A;  2B18 A;  3F1O B;  2EWV A;  2PD8 A;  1LSX A;  3UE3 A;  4ETZ A;  5TBM A;  1MZU A;  2JKT M;  5G4Z A;  4EEU A;  4B9O A;  2L1M A;  4WF0 A;  4EW7 A;  2PYP A;  2ZMF A;  3LR5 A;  2L4R A;  3FC7 A;  1YAX A;  4KQO A;  2R78 A;  4I5S A;  3CUE A;  4K08 A;  3T50 A;  3E4P A;  2XRO A;  3KYQ A;  4L9E A;  5DFX A;  3KSI A;  2ZBB A;  3GEC A;  3R7W B;  2PD7 A;  2CMN A;  2M7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...