5E2GA

Crystal structure of d-alanine carboxypeptidase ampc from burkholderia cenocepacia
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
357
structure length
349
Chain Sequence
b'NADDLRDTVTRQIAPLMKQYAIPGMAIGIVADGKPYVFDYGVMSKQTGKPVTGDTLFEIGSVSKTLTATLASDAQEGGELSLADPAGKYLPELQGKPFGVVTLLQLGTHTPGGTRDDAGLIRYLDAWRPAYAPGTHRKYSNVAIGMLGWLTAKAMHQDFATLMEQRLFPAIGMTHTYINVPAARMADYAQGYTKDGKPVRMTEGMLWQPAYGVRTTAADLLRFVQANMGMIHTAPRLQRAIERTHTGYFRAGPLTQDLIWEQYPYPVALPTLLAGNAPKMLFDAVPASAIQPPLAPNPATWINKTGSTGGFSTYVAFVPAKRIGIVMLANGNVPIEERVKAAYRILGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of D-alanine Carboxypeptidase AmpC from Burkholderia cenocepacia
rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
total genus 102
structure length 349
sequence length 357
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e2gA00
1K55A 2P9VB 4QU3A 2J9OA 2A3UA 1H8YA 1BLPA 3M2KA 1NY0A 4BL3A 4QJGA 3A3JA 1MWTA 1H8ZA 1L0DA 3ZVTA 1JWPA 1QMEA 4KG5A 3ZG7B 5CGSA 4EQIA 1W8QA 2WKIA 3LY3A 4F94A 2QPNA 2BG1A 1XGJA 2WGWA 4BD0A 4GB7A 5CEDA 2B5RA 4QY5A 5CTMA 1N4OA 3A3IA 1C3BA 4KZ9A 3UE3A 4B88A 3BYDA 5DTKA 3BFFA 5FQMA 1FSWA 2G2WA 3ZG9B 3MXSA 3IF5A 3O88A 4K0XA 5KSCA 1EWZA 4DDSA 3W8KA 3IF6A 1ZG4A 5HAPA 3SH8A 1CI9A 3VOYA 3WS4A 1NJ4A 3GMWA 3IH8A 3EQUA 4Y0OA 5GLBA 4S2IA 1KVLA 4HEFA 4OPQA 2WK0A 5FI2A 1JTDA 5E2HA 4Y0UA 5CRFA 5EVIC 3WWXA 5TFQA 3BLSA 3C4PA 1KE0A 1K6RA 1GHMA 1K57A 3G30A 3VP2A 4R4SA 2P74A 4OOYA 2EX2A 4UA7A 5EVID 3SS5A 3UE0A 2GDNA 2BLSA 1K55C 4OONA 1K4FA 5AQAA 5FATA 2RL3A 2WUQA 4KZ4A 5HW3A 5CERA 3ZCZA 4XXRA 5FA7A 4OOLA 5L2FA 4DE3A 1ERQA 1JVJA 1IKIA 1ZC2A 2Q9NA 3LEZA 5HAQA 4GOGA 1JWVA 3FZCA 5G18A 1VQQA 5HL1A 3Q07A 5A90A 1CEGA 4KQQA 3E2KA 4KZ3A 3W4PA 2XK1A 4U0TA 3G34A 1BZAA 3V3RA 1L0FA 3TSGA 5GLCA 2V1ZA 1BULA 5AQ9A 3Q7VA 5GHZA 1NYMA 3NDEA 3PAGA 4QHCA 5M19A 4E3JA 3IF6C 4JBFA 3UPPA 5EVIB 2WAFA 1W8YA 3UPOA 1BTLA 2ZLYA 2ZQ9A 4KZ8A 1ESIA 5FAQA 2EX8A 2PBYA 3C7VA 4K0WA 4M3KA 5GHXA 3JYIA 3UE1A 3CJMA 1I5QA 1FQGA 3FWLA 1SDNA 3FYZA 3MFDA 1K57C 3QNBA 1DJCA 1PI5A 3HVFA 1IELA 2Y91A 2Y2JA 5DTSA 1G68A 4WYYA 3HUNA 4OPZA 3RJUA 4JF6A 4DXBA 5F1FA 3NY4A 5F83A 2Y2NA 4OOMA 4S2JA 3ZG0A 1G6AA 2WGWB 4N9LA 3Q82A 4EBNA 2J8YA 3HLWA 4ZJ1A 2Y4AA 4OLGA 4PPRA 1K54C 1WE4A 4FH4A 1K56A 4QY6A 4IBRA 2HPBA 1N9BA 1PW1A 2XDMA 2WZXA 3GRJA 2ZC4B 4IVKA 3VSKA 4X53A 1MPLA 3ZG8B 5CHMA 3CG5A 2DRWA 3VOZA 1NYYA 5FQQA 4C3QA 2Z2MB 5HX9A 3S1YA 1BLHA 1IYPA 3IQAA 3UN7A 2ZM2A 3IHBA 3WS0A 4RYEA 5JYPA 4WM9A 3B3XA 3RXXA 4O7DA 3MZEA 5FQJA 2Y2KA 2XEPA 2Y2OA 4X68A 3HLFA 1U60A 3GQZA 3MKEA 3DW0A 3G35A 2IWBA 3N7WA 1IEMA 3VSLA 5E2FA 4C6YA 4DDYA 4E3OA 3IWIA 3NIAA 4BJPA 4JXSA 3V50A 3V39A 4LV1A 3GSGA 2EFUA 4X56A 5AQ7A 3VP0A 3G2YA 3EQVA 1YLTA 1TVFA 1RGYA 3VFFA 3TG9A 1ZG6A 2WYXA 1ES3A 4BL2A 4OQHA 1W5DA 3RXWA 5TR7A 2Y2GA 4PMAA 4R4RA 5DF9A 3PTEA 2WZZA 2UWXA 4R23A 1WYBA 5DTTA 3A3FA 3IXGA 1MWRA 1ZKJA 2XD5A 1XXMA 2E8IA 4KG6A 1KDSA 5HAIA 2WADA 3NBLA 1NZUA 3QHYA 3HUOA 4ZJ3A 2RCXA 1K56D 1IYSA 1S6RA 4EBLA 4E3KA 2OLVA 1KGFA 3FKWA 4X55A 4PM6A 2XQZA 1MBLA 3SS3A 3VMAA 1CEFA 2Y55A 3BFGA 4LCLA 4GZBA 2XD1A 4EBPA 5CHJA 3N4IA 2J7VA 5FQ9A 2EFXA 4GKUA 3IWOA 4UAAA 4S2LA 2WGVA 3SH9A 1L2SA 3BM6A 2Y2MA 4KQRA 5FDHA 1O7EA 1L0GA 5KMWA 4U0XA 5U47A 4OQGA 3ZDJA 2ZM0A 4P6BA 4WBGA 3G31A 4HESA 2ZD8A 4GNUA 4KZAA 4A5RA 3P98A 1YLPA 3GTCA 4Y7PA 1RCJA 2VGJA 2X01A 5CEBA 1XX2A 3LY4A 4R0QA 5FAPA 1W79A 1K54A 2EXBA 4OQ0A 1KE4A 1TEMA 2X02A 2WAEA 4JF5A 3IH9A 3G2ZA 1WYCA 3ZNTA 3PBQA 4S2OA 1GA0A 5FASA 4JXWA 4N92A 4YINA 1JTGA 5FI6A 2JE5A 3HREA 3PAEA 3VP4A 3ZGAB 2V2FF 2VGKA 4YFMA 4X6TA 4ZJ2A 3WS1A 4L0LA 3TOIA 2DNSA 2XF3A 1BUEA 1IKGA 3OZHA 4PM9A 1FCMA 1PYYA 2ZQ7A 3WRTA 3PBTA 3IHAA 3AGDA 4OP8A 4RVAA 1FCNA 1K25A 2PU2A 2JBFA 4IVIA 2HDUA 3S4XA 1KVMA 3I7JA 5BOHA 2Z2LB 2P9VA 4LCMA 2EX9A 3HLBA 3DTMA 1NXYA 2HP6A 2ZQAA 1GA9A 1I2SA 1YT4A 3ZNYA 1RGZA 5E2EA 5JYOA 2I72A 4QB8A 4R1GA 4JF4A 3OCLA 4FSFA 3PBOA 3FKVA 4JKTA 1L0EA 4E6WA 2ZC7A 5EPHA 2X71A 2Y2PA 4LENA 4ID4A 3HLGA 1RP5A 2XR0A 1XKZA 4N9KA 3WS5A 1YM1A 1LI9A 4BD1A 3PBSA 4KZ6A 3IXHA 1SKFA 4U3TA 4WEKA 2H0YA 3VP3A 5EUAA 2G2UA 1HVBA 2Y59A 3WS2A 2H5SA 1EROA 4WMCA 1DJAA 4DXCA 1JWZA 1ALQA 4OVDA 3IF6B 4KQOA 1M6KA 4BLMA 1GHIA 2WKEA 4R3BA 5TGFA 2WGIA 4BENA 1MXOA 4OKPA 1CK3A 5GLDA 1EI5A 3MKFA 2FFFB 1TDGA 4EUZA 1PIOA 4RX2A 3N8LA 3VP1A 3A3EA 3Q81A 4R3JA 3D4FA 4ZBEA 3N8RA 5A91A 4KENB 5CECA 4E3NA 1O07A 5CXWA 3V3SA 4B4ZA 4C75A 5EOOA 3SS4A 5E43A 3OPPA 1VM1A 1W7FA 4IBXA 2PU4A 4UA6A 2HP5A 1XGIA 3BRMA 3W4OA 2ZC3B 1K6SA 4IEDA 4PM7A 1H5XA 2IWDA 3QNCA 5EECA 2XLNA 4P87A 3NCKA 5FQKA 3OPHA 1DY6A 2QMIA 4E3IA 4KZ5A 4OPYA 1ES2A 2J9PA 1E4DA 3CZDA 3Q7VB 4EWFA 3NI9A 4CJNA 3M6HA 4MBFA 2XGNA 1NZOA 2ZQDA 1I2WA 4Z9QA 1PZPA 3HLDA 3IXBA 3OPRA 4H8RA 3IWQA 3C7UA 3ZG5A 3HBRA 5FQIA 4PM8A 3SH7A 3V5MA 4S2MA 3PBRA 3DWZA 1FCOA 5CGWA 3GR2A 3NC8A 4HBTA 4K91A 3N8SA 4N1XA 3O86A 2HDSA 3W4QA 1YLYA 5GLAA 1ESUA 4LV0A 1BT5A 4FH2A 3P09A 4KZ7A 3ZFZA 3UO9A 1HD8A 4ZAMA 3NDGA 4JLFA 4EV4A 5HFOA 5FAOA 5M1AA 1LI0A 2CC1A 1LLBA 3BLMA 3C5AA 2R9WA 1S0WA 4GD8A 2FFYA 5EOEA 4HBUA 1FOFA 1PW8A 4JXVA 2OLUA 4BQMA 4Q8IA 2ZQ8A 5A93A 1ES4A 1IYQA 3OCNA 3AGEA 3FV7A 2ZJ9A 1BLCA 4S2KA 5GHYA 4ZDXA 1XA1A 5HARA 3G32A 4E6XA 1GCEA 3LO7A 4WZ5A 2H10A 3AGFA 1PI4A 3ZHHA 2XFTA 2R9XA 5F82A 5EE8A 3MXRA 4GN2A 1YMXA 5CTNA 3BFCA 3HLCA 1KGGA 4KG2A 2A49A 4P85A 5FI7A 1PWGA 1SHVA 2XFSA 3MBZA 4WZ4A 5IHVA 1K4EA 3UNWA 3OPLA 3GVBA 1HTZA 4JXGA 4MBHA 4E3MA 3UDIA 3UPNA 5I94A 3ITAA 4OPRA 3M6BA 5CGXA 3ZVWA 1SCWA 3ITBA 4S2NA 5A92A 4JPMA 1M40A 3GV9A 4PM5A 4OH0A 4B4XA 1E3UA 2Y2IA 5DF8A 4GDBA 3LCEA 2OV5A 4OQIA 2XH9A 5KZHA 1ES5A 2Q9MA 2V20A 4MBKA 4N1HA 4MNRA 1SDEA 2ZC5B 3BEBA 4XUZA 3Q7ZA 2HP9A 5GL9A 1FR1A 2JC7A 1Q2QA 1AXBA 2ZC6B 2HDRA 1XA7A 3BFDA 3VFHA 3WRZA 3O3VA 4LV2A 4E3LA 3IXDA 5EVLA 4KZBA 1ONHA 3HL9A 1MKIA 4XUXA 5M18A 3CMZA 1KDWA 1TDLA 5J8XA 4GD6A 5D3OA 1NRFA 3UDXA 2C5WB 4WZ5C 1KE3A 2OSUA 4S2PA 2ZM8A 4GDNA 1XPBA 1ONGA 1YMSA 1DJBA 1YLZA 4WEJA 3N6IA 3MZDA 3UDFA 1E25A 1PWCA 4DF6A 3E2LA 4NK3A 1OMEA 4QD4A 3SOIA 2JCHA 1IYOA 1PZOA 1LHYA 3BFEA 4MEZA 1BSGA 4FCFA 4OLDA 3HUMA 3G4PA 3C4OA 4CPKA 1BLSA 2IWCA 3ISGA 1CI8A 2WKHA 4S2NC 4Y0TA 4DE1A 3A3DA 4D2OA 1K38A 3OC2A 5AQBA 1FSYA 4LV3A 1J9MA 2C6WB 5CHUA 2ZMAA 1LL5A 4RX3A 2QZ6A 4NETA 1E3UD 1LL9A 4DKIA 4DE2A 2H0TA 1YLWA 2HDQA 4P0MA 1YQSA 2EX6A 3UY6A 5E2GA 1Z6FA 3Q1FA 4MLLA 1ERMA 1Q2PA 4DRTA 3IT9A 1MWUA 1FR6A 5KSHA 4ZTKA 4WELA 5DVAA 4FD8A 2Y2LA 2EXAA 5FSRA 3PBNA 4UHUA 1QMFA 3MZFA 5F1GA 1Y54A 1PWDA 2ZQCA 3O87A 1HZOA 2Y2QA 1MWSA 1XP4A 3DWKA 5DF7A 1GHPA 4RA7A 1MY8A 4UA9A 1KGEA 3S22A 3HLEA 5EVIA 4X69A 2Y2HA 4DE0A 3M2JA 1YLJA 4OP5A 4WMCD 2DCFA 3BECA
chains in the Genus database with same CATH superfamily
3M2KA 4QJGA 3VOLA 2YKHA 3ZG7B 1QMEA 4KG5A 2XA7M 4F94A 2BG1A 1XGJA 4BD0A 5CEDA 1XJ6A 3BYDA 3ZG9B 3BFFA 4I38A 3MXSA 3IF5A 3W8KA 1ZG4A 1CI9A 3WS4A 3GMWA 4ESPA 3IH8A 3LICA 4Y0OA 4HEFA 4OPQA 2WK0A 3A0SA 5FI2A 2J80A 2KLIA 4EESA 3BLSA 3LR5A 4R4SA 4OOYA 3DBAA 3UE0A 5EVID 3SS5A 5J7EA 2RL3A 2UV0E 2WUQA 5HD3A 4KZ4A 5HW3A 4XXRA 5HL6A 4OOLA 5L2FA 4M4XA 1ERQA 1JVJA 1ZC2A 3T4JA 5HAQA 2CMNA 5G18A 5TBMA 5HL1A 3Q07A 4KQQA 3E2KA 2XK1A 3TSGA 1BULA 5GHZA 4HJ3A 5EVIB 2WAFA 3HJKA 5FAQA 2PBYA 3T4SA 2INWA 3TW8A 1XFQA 1N9NA 3FYZA 3MFDA 1DJCA 2Y91A 4OPZA 3RJUA 2V0UA 4JF6A 3NY4A 2Y2NA 4S2JA 4N9LA 3HLWA 2Y4AA 4PPRA 1K54C 1N9BA 3VSKA 3ZG8B 3S7NA 2PD8A 3VOZA 1NYYA 5EVEA 5HX9A 2ZM2A 3MQQA 3C2WA 3L9KA 4WM9A 3RTYA 3RXXA 3MZEA 4P6ZM 3HLFA 2IWBA 1F2KA 5E2FA 5FEGA 4E3OA 3IWIA 3V39A 3GSGA 4Y5FA 5DFXA 1YLTA 3DTIA 4BL2A 3QP4A 1CF0A 2Y2GA 4R4RA 3E98A 2WZZA 4R23A 5DTTA 5HPFA 2MJ6A 1XXMA 2E8IA 1KDSA 1NZUA 4ZJ3A 2RCXA 1K56D 2JKTM 2OLVA 3FKWA 4HP4A 4Y3IA 2XQZA 3BFGA 4EBPA 3N4IA 5FQ9A 1TS0A 2VZWA 3KSHA 2WGVA 3SH9A 5DKKA 4KQRA 1L0GA 4OQGA 1OTIA 3G31A 4LRZE 4HESA 4GNUA 4FTXA 1YLPA 4Y7PA 1RCJA 3LYXA 3IX8A 2EXBA 1KE4A 1S1ZA 2W27A 4X1MA 4HY8A 3MXQA 2WAEA 3H7WB 3BY9A 3IH9A 4JF5A 1WYCA 3ZNTA 3PBQA 3NOUC 1JTGA 1G6OA 3TOIA 2W1RA 2XF3A 3P01A 1DP6A 4RVAA 2HDUA 1KVMA 3I7JA 3HLBA 3DTMA 2Z6CA 5KIZA 4QB8A 4R1GA 4Z1WA 4FSFA 5EPHA 4LENA 2OWHA 3FPWA 3JVVA 4N9KA 4BD1A 3DTEA 3LUQA 4KZ6A 1SKFA 3UB9A 2H0YA 2Y59A 2ZBBA 1G5UA 4EERA 4OVDA 2QJ7A 3UB5P 1V9ZA 4R3BA 4BENA 1MXOA 4OKPA 3IS2B 2W3HA 3MKFA 2VA0A 1PIOA 2JKTI 4R3JA 4NG2A 1TS8A 4KENB 5CECA 1V9YA 5G4YA 3V3SA 5EOOA 3OPPA 1W7FA 3T4OA 3T4QA 4Q0JA 5EECA 5FQKA 1XFNA 4JGPA 2JKRM 1E4DA 1T1BA 4PKYG 2BASA 2L0WA 3M6HA 1YKDA 4MBFA 4H8RA 4MMNA 1GSXA 3ZG5A 5IT5A 4HJ4A 5CGWA 2FH5A 1ESUA 1T18A 1D1JA 5A8BA 3UO9A 1HD8A 4JLFA 5FAOA 2CC1A 2R9WA 5EOEA 4HBUA 4JXVA 1ES4A 3R7WA 3G32A 1GCEA 2H10A 2V1AA 4UQIS 2R9XA 3FC7A 4GS9B 5F82A 4MCWA 3HLCA 1NLYA 2A49A 3LR4A 1PWGA 1SHVA 2XFSA 3LEQA 3OPLA 4JXGA 4E3MA 5I94A 3B33A 3CLOA 3ITBA 5A92A 4JPMA 1M40A 4PM5A 1DP8A 4BBTA 4GDBA 3LCEA 1LSXA 4MBKA 5AVEA 2L4RA 4XT2B 4R6LA 2JC7A 3WRZA 2XSSA 2HDRA 4UEYA 2XRNA 3MR0A 4HP9A 3UDXA 2M7VA 1KE3A 2OSUA 4S2PA 3FG8A 1DRMA 1XPBA 1DJBA 4WEJA 2V0WA 2B18A 3CPTB 3E2LA 1PZOA 4YOFA 4OLDA 4FCFA 2JKRI 4CPKA 3C4OA 2HF6A 2IWCA 3E4QA 3MQ0A 4DE1A 4D2OA 2W3DA 1FSYA 2C6WB 4B9OA 2AVXA 3UB6A 1YLWA 2HDQA 4P0MA 4JGQA 4KUKA 1Q2PA 1EW0A 5MC7A 3PBNA 4GHIA 3MZFA 5F1GA 2ZQCA 3E0YA 3O87A 2Y2QA 1XP4A 3S22A 3LI8A 2DCFA 3MQOA 2P9VB 1H8YA 3E4PA 1BLPA 1MWTA 5J4EA 1JWPA 5F69A 1SKOA 2WKIA 3LY3A 2QPNA 2B5RA 4QY5A 5CTMA 4ARZA 4KZ9A 5FQMA 4ME4A 1PRQA 5KSCA 1IFQA 1S67L 4H6JB 3ICYA 2ZL1A 3VOYA 4KQDA 3LI9A 5HWTA 1NJ4A 3F1OB 4Y0UA 2ZMVA 3HCYA 3C4PA 1K6RA 1GHMA 3G30A 2GDNA 2BLSA 1K4FA 4HH2A 3KYQA 3BQ8A 1H8MA 4GOGA 1JWVA 3LR0A 3FZCA 3JPUA 3G34A 3K3CA 1S4SA 3Q7VA 4QHCA 3B47A 5M19A 1G28A 4JBFA 1W8YA 3UPOA 4I3JA 4CLCC 2EX8A 4K0WA 4HOIA 3BQAA 1PNEA 1K57C 3QNBA 1IELA 4NKPA 5F83A 5HZHA 1G6AA 3Q82A 3C30A 4IBRA 2HPBA 2XDMA 5L8MA 4QWOA 2B02A 1HLUP 2DRWA 2XA7S 1IYPA 5JYPA 4O7DA 2Y2KA 2XEPA 4DJ2A 5CX7A 3MKEA 3DW0A 3G35A 3VSLA 4DDYA 3V50A 1VHMA 4ETXA 4BWIA 4II7A 3VP0A 3G2YA 4WF0A 3FPVA 3KYZA 3A0VA 1TVFA 4I3IA 3CWFA 4R38A 1ZG6A 1ES3A 4ETZA 5TBMB 5TR7A 2KOIA 2UWXA 1WYBA 1MWRA 1ZKJA 2XD5A 5HAIA 2M7UA 3T4TA 3HUOA 4EBLA 1IYSA 2HV1A 4X55A 4PM6A 1MBLA 3VMAA 3EWKA 2W0NA 2Y55A 4LCLA 2XD1A 4GKUA 4I3AA 4S2LA 4GLQA 5KMWA 3ZDJA 3EEHA 4WBGA 3VE4A 2V8FA 2X01A 1OTAA 1XX2A 4R0QA 3MSHA 2X02A 3G2ZA 1TF1A 4EW7A 4JXWA 1F9IA 3PAEA 3ZGAB 4YFMA 4ZJ2A 2HJ9C 2DNSA 3OZHA 4PM9A 1FCMA 4I5SA 1PYYA 3PBTA 1F98A 4OP8A 1FCNA 4Q0HA 4LCMA 2HP6A 2ZQAA 1GA9A 5K5BA 1YT4A 1RGZA 2VGLM 5E2EA 4JF4A 1TD5A 3OCLA 2Y2PA 2PR6A 1WA9A 1RP5A 4WUJA 3EEAA 3PBSA 3SW1A 4U3TA 1HVBA 4BMWA 4WMCA 4B93A 3IF6B 1ACFA 3LIBA 4BLMA 3T1QB 1SZVA 2O99A 5F5YA 2WGIA 1CK3A 1EI5A 1TDGA 3N8LA 2H28A 4ZBEA 3N8RA 5A91A 5CXWA 3SS4A 4UA6A 4LFUA 1P9WA 4X25A 1K6SA 4PM7A 1H5XA 4EEPA 2W3GA 3F1PA 5AJGA 5TJJA 1DY6A 2LB9A 4E3IA 4KZ5A 3NI9A 3NJAA 2XGNA 2ZQDA 1I2WA 4Z9QA 3HLDA 3OPRA 5FQIA 4S2MA 3H9WA 4WN5A 4HBTA 4K91A 5GLAA 4LV0A 4EXOA 3P09A 4KZ7A 3ZFZA 3NDGA 2ACGA 1OT6A 1S0WA 4GD8A 4Q8IA 2OLUA 3OCNA 5GHYA 4NXEA 3LO7A 4IJGA 4K08A 3AGFA 3ZHHA 3TRCA 3MJQA 1K4EA 3GVBA 4MBHA 4EEUA 3UPNA 3IBRA 3CUEC 1OTDA 1YSQA 3LIFA 4R70A 4OH0A 4MN7A 1E3UA 2OV5A 1ZHHB 2Q9MA 3GECA 2ZC5B 1YPRA 2HP9A 1KOUA 1XA7A 2NUTC 3PXPA 3VFHA 4E3LA 3IXDA 4KZBA 4IHQA 3HL9A 5M18A 1D06A 1TDLA 4QPRA 2J3TD 2C5WB 5HWVA 3NOTC 4RQ9A 3CAXA 1YLZA 4HI4A 3N6IA 4L9EA 2VV6A 4BBVA 4DF6A 4NK3A 1OMEA 4JGRA 2JCHA 1LHYA 3HUMA 1BLSA 3C38A 3ISGA 1CI8A 2WKHA 4Y0TA 1K38A 2FZ0A 5AQBA 3LIAA 1J9MA 4LV3A 2JKFA 5EM1A 1GSWA 4DKIA 2H0TA 1YQSA 2JN7A 3PYPA 4MLLA 2M1CA 2KDKA 3MF0A 3B42A 2EXAA 4NXBA 1PWDA 2VKSA 4DMZA 4RA7A 1LSVA 3K3DA 3HLEA 4DE0A 1VEUA 1S4RA 3CI6A 1YLJA 3LGOA 3O5YA 4QU3A 1H3QA 3U4LP 4BL3A 1L0DA 5L10A 3ZVTA 3LR3A 3NULA 3T1RA 1W8QA 2JKGA 2WGWA 1CQAA 4GB7A 1N4OA 3A3IA 4BBUA 3UE3A 1OJGA 5DTKA 1FSWA 2G2WA 2QJ5A 4DDSA 3SH8A 2PHYA 4CLCA 1P97A 3IS2A 1KVLA 3MFXA 5E2HA 5CRFA 5EVIC 3WWXA 5TFQA 1K57A 1T19A 2EX2A 4UA7A 1K55C 5FATA 4I39A 1AWIA 3EOIA 2PYPA 2HZ5A 1IKIA 5HDSA 2K2NA 2Q9NA 3QP2A 5A90A 1CEGA 3W4PA 4KZ3A 3H82B 4U0TA 4Q0IA 1BZAA 3V3RA 3U2AA 3V67A 5AQ9A 5HD5A 1NYMA 3PAGA 4E3JA 3IF6C 1BTLA 2ZLYA 2ZQ9A 2W3FA 4O01A 1ESIA 3C7VA 4M3KA 1X0OA 3JYIA 1FILA 2XROA 3CHWP 1NWZA 1PI5A 3HVFA 3UMDA 2Y2JA 4WYYA 1SKOB 3HUNA 5F1FA 4DXBA 4MN6A 4HH3A 4EBNA 4ARZB 2K31A 4L9FA 1Z09A 2VJWA 3IBJA 3P7NA 1K0KA 4L9GA 4GS9A 3GRJA 4IVKA 4X53A 5L09A 3CG5A 2O9BA 4C3QA 1ODVA 2Y79A 3IHBA 3WS0A 3B3XA 5FQJA 1F5MA 4YNRA 2Y2OA 1STZA 4X68A 5L07A 3GQZA 3N7WA 1IEMA 1UWNX 3TJZC 3NIAA 1NRJA 4JXSA 4BJPA 1MKMA 3T1SA 5HPIA 4LV1A 5AQ7A 3IX4A 1YAXA 4XT2A 2B95A 3VFFA 2WYXA 2QWSA 4OQHA 1VETA 3F1NA 3RXWA 2R78A 4PMAA 3PTEA 2O9CA 4HIAA 3A3FA 2Q0OA 3QHYA 3UE6A 3T12B 4E3KA 2PD7A 1MC0A 4G3WA 2P04A 3T1XA 1S1YA 4F3LA 2J7VA 3S7OA 2EFXA 2W3EA 1OPXA 4UAAA 2Y2MA 5C5KA 4U0XA 2WKQA 5U47A 2ZM0A 4P6BA 3P98A 3T4KA 2VGJA 2PDRA 5HWWA 5CEBA 1OTEA 2PR5A 1K54A 1N9OA 1TEMA 2W1TA 1T1CA 5HSQA 1GA0A 3KX0X 2WKRA 5FASA 2V9AA 4N92A 3BJNA 4YINA 2JE5A 4LGWA 2VGKA 4X6TA 3L7HA 3WS1A 4HQAA 4EETB 2O9AA 1IKGA 3GDIA 3OLOA 2ZQ7A 2A2LA 3IHAA 1H0MA 2PU2A 2JBFA 3QP5A 2P9VA 1NXYA 1I2SA 4MDZA 3ZNYA 3NECA 2HGVA 4JKTA 3PBOA 1PFLA 3QP6A 2X71A 4ID4A 3HLGA 1YM1A 1CJFA 3IXHA 4IUKA 3WS2A 1EROA 1DJAA 1ALQA 2GJ3A 4KQOA 1M6KA 1GHIA 2WKEA 5TGFA 4O8GA 2IA2A 5LBRA 3F1OA 1BYWA 5HDDA 4KUOA 4AFIA 1OT9A 4LRYC 4LPZA 3MS6A 4E3NA 2V1BA 1XGIA 3BRMA 2PYRA 2ZC3B 2IWDA 3QNCA 2XLNA 4WLAA 3OPHA 4OPYA 4YWZA 1ES2A 2J9PA 3CZDA 1XJ3A 3KO6A 4CJNA 1NZOA 3CUEA 3C7UA 1W63Q 1DP9A 2VX8A 3UB7A 3V5MA 1FCOA 3NC8A 1P0ZA 4N1XA 3N8SA 1MZUA 1YLYA 1BT5A 4FH2A 2GNXA 4ZAMA 2ZMFA 1LI0A 1LLBA 3BLMA 2FFYA 1PW8A 2G7UA 5A93A 3AGEA 3FV7A 1BLCA 2YKFA 4S2KA 5HARA 4E6XA 2A24A 3D3OA 3MXRA 4GN2A 2VGLS 1YMXA 4EUVA 4KG2A 5FI7A 4WZ4A 3MBZA 1FIKA 3UNWA 1HTZA 2QYBA 1D7EA 3MMHA 3ZVWA 4EU0A 2Y2IA 4OQIA 4Y2FA 4N1HA 4MNRA 3BFDA 1Q2QA 1AXBA 2ZC6B 3F1PB 4P6ZS 1ONHA 1KDWA 3A0RA 4GD6A 1NRFA 4WZ5C 2VLGA 1ONGA 3EGDC 3D72A 1PWCA 1T1AA 3QP1A 2ZOIA 4QD4A 1IYOA 4MEZA 3T50A 4JGOA 4S2NC 4HNBA 3OC2A 2ZMAA 1E3UD 1LL9A 2Z6DA 2EX6A 1Z6FA 2I9VA 3RFBA 3Q1FA 1ERMA 3IT9A 1MWUA 1FR6A 5KSHA 5FSRA 4UHUA 1QMFA 1Y54A 1XJ2A 5DF7A 3T4LA 3UB8A 1MY8A 1KGEA 5EVIA 4X69A 2Y2HA 3HJIA 1K55A 3VE3A 2J9OA 2A3UA 5HDCA 3IX3A 1NY0A 3A3JA 1H8ZA 2ZOHA 5CGSA 3KSIA 4NEED 4EQIA 3LIDA 1J3WA 2GZAA 1C3BA 4B88A 3O88A 4GCZA 4K0XA 1EWZA 3IF6A 5HAPA 3S7QA 4FOFA 1TS7A 3EQUA 4PHTA 5GLBA 4S2IA 4PKYA 1JTDA 1KE0A 4HHDA 3VP2A 2P74A 5IU1A 2OOLA 4OONA 5AQAA 3BWLA 5CERA 3ZCZA 5FA7A 4DE3A 4D60A 2EWWA 3LEZA 2V8CA 2D02A 3QP8A 3RH8B 1VQQA 3DTKA 5J3WA 1L0FA 5GLCA 2V1ZA 3NDEA 3UPPA 1VEUB 4KZ8A 5GHXA 3UE1A 3CJMA 1I5QA 2E8JA 4DJ3A 4CLCD 2DMWA 1FQGA 3FWLA 1SDNA 1XJ4A 5DTSA 1G68A 4Y17A 4OOMA 3ZG0A 1Y28A 2WGWB 4CQHA 3CITA 2J8YA 4HJ6A 4ZJ1A 4OLGA 1WE4A 4FH4A 1K56A 4QY6A 5I5LA 3R7WB 3PR6A 1PW1A 2WZXA 4MN5A 2ZC4B 2J3WA 1MPLA 5FEFA 5CHMA 4CLCB 3H7WA 1YSPA 3OOVA 5FQQA 5DFYA 2Z2MB 3S1YA 1BLHA 3IQAA 3UN7A 4RYEA 3E4OA 1U60A 5EM0A 2VV7A 1GSVA 2PRFA 4C6YA 2QKPA 4FUWA 2EFUA 4X56A 3EQVA 1RGYA 3TE8A 3TG9A 1W5DA 4LLOB 4GJ4A 5DF9A 3IXGA 3UMEA 2VEAA 4KG6A 2WADA 3NBLA 4DN0A 4CLCE 1S6RA 2VV8A 1KGFA 3ZYTA 3SS3A 1CEFA 4GZBA 5CHJA 3KSGA 1UGUA 3DAVA 3IWOA 1L2SA 3BM6A 5FDHA 1O7EA 2K7SA 4G3VA 1Y4OA 2ZD8A 4KZAA 4A5RA 4ZRRA 3GTCA 2QHKA 3LY4A 5FAPA 1W79A 5DJTA 3ULFA 4OQ0A 3LFVA 3EGXC 4EQ1A 4NXGA 5F6AA 4S2OA 5FI6A 2L1MA 4R3AA 1L3LA 3HREA 3VP4A 2V2FF 4GHIB 5EV0A 4L0LA 1BUEA 2BTFP 3KYEA 3WRTA 3AGDA 1K25A 2OAQ1 4IVIA 3S4XA 5BOHA 2Z2LB 2EX9A 1A0KA 4UQIM 1VETB 3F1NB 5JYOA 2I72A 1ZTUA 3FKVA 1L0EA 4E6WA 2PAVP 2ZC7A 2OAP1 2XR0A 5EFWA 1XKZA 3WS5A 5G4ZA 1LI9A 1TS6A 1LL8A 4WEKA 3VP3A 2P08A 5EUAA 2G2UA 2H5SA 4DXCA 1JWZA 4Y13A 2ZL1B 4F3LB 2HJEA 5GLDA 2FFFB 4EUZA 4RX2A 2OWJA 3VP1A 3A3EA 3Q81A 3D4FA 3BY8A 1O07A 2PBDP 4B4ZA 4C75A 5E43A 1VM1A 4IBXA 2PU4A 2W1TB 2HP5A 3W4OA 4WL9A 1LT0A 4IEDA 4GW9A 4P87A 5DJUA 3NCKA 3H82A 2O0YA 2GX5A 3W2ZA 2QMIA 3ZQ5A 5IS1A 2WKPA 2D01A 5FDSA 4EWFA 3Q7VB 3BW6A 4LRXC 4NXFA 1PZPA 3IXBA 3IWQA 5FL3A 3G6OA 2JHEA 3HBRA 3SH7A 4PM8A 3NHQA 3PBRA 3DWZA 3CPTA 3GR2A 3O86A 2HDSA 3W4QA 3PHYA 5F68A 1IOUA 4EV4A 5HFOA 5M1AA 3C5AA 1FOFA 4BQMA 4G3KA 2ZQ8A 2PT7A 1IYQA 4ZDXA 2ZJ9A 1XA1A 2P7JA 4WZ5A 3NOPC 1PI4A 4X1LA 2XFTA 5EE8A 5CTNA 3BFCA 1KGGA 4P85A 3SZTA 1LSWA 5IHVA 1VB6A 3C8CA 3UDIA 1S66L 3ITAA 4OPRA 3M6BA 5CGXA 1SCWA 4S2NA 3GV9A 3VV4A 4B4XA 3JVUA 5DF8A 5AVFA 2XH9A 5KZHA 1ES5A 1OTBA 2V20A 3KSFA 1SDEA 3BEBA 4XUZA 3Q7ZA 5GL9A 1FR1A 2J3TC 3O3VA 4LV2A 5EVLA 2EA9A 1MKIA 4XUXA 3CMZA 3LIEA 5J8XA 5D3OA 3R4KA 4Y15A 2ZM8A 4GDNA 5DKLA 1YMSA 3MZDA 4H6JA 3UDFA 1E25A 4IUHA 2Y8HA 2EWVA 3SOIA 4PAUA 3BFEA 1BSGA 3G4PA 3OBFA 1N9LA 2KX6A 3D9YA 3A3DA 2VK3A 5CHUA 1LL5A 4RX3A 2QZ6A 4NETA 3K2NA 3S7PA 2A24B 4O0PA 4DE2A 1OJ5A 3UY6A 5E2GA 4E04A 4DRTA 4ZTKA 4WELA 5DVAA 4FD8A 2Y2LA 1JNUA 1HZOA 1MWSA 3DWKA 1UWPX 1GHPA 4UA9A 2NUPC 1W63M 3M2JA 1NLZA 1P9RA 2LB5A 4OP5A 4WMCD 3BECA
chains in the Genus database with same CATH topology
1K55A 2P9VB 4QU3A 2J9OA 2A3UA 1H8YA 1BLPA 3M2KA 1NY0A 4BL3A 4QJGA 3A3JA 1MWTA 1H8ZA 1L0DA 3ZVTA 1JWPA 1QMEA 4KG5A 3ZG7B 5CGSA 4EQIA 1W8QA 2WKIA 3LY3A 4F94A 2QPNA 2BG1A 1XGJA 2WGWA 4BD0A 4GB7A 5CEDA 2B5RA 4QY5A 5CTMA 1N4OA 3A3IA 1C3BA 4KZ9A 3UE3A 4B88A 3BYDA 5DTKA 3BFFA 5FQMA 1FSWA 2G2WA 3ZG9B 3MXSA 3IF5A 3O88A 4K0XA 5KSCA 1EWZA 4DDSA 3W8KA 3IF6A 1ZG4A 5HAPA 3SH8A 1CI9A 3VOYA 3WS4A 1NJ4A 3GMWA 3IH8A 3EQUA 4Y0OA 5GLBA 4S2IA 1KVLA 4HEFA 4OPQA 2WK0A 5FI2A 1JTDA 5E2HA 4Y0UA 5CRFA 5EVIC 3WWXA 5TFQA 3BLSA 3C4PA 1KE0A 1K6RA 1GHMA 1K57A 3G30A 3VP2A 4R4SA 2P74A 4OOYA 2EX2A 4UA7A 5EVID 3SS5A 3UE0A 2GDNA 2BLSA 1K55C 4OONA 1K4FA 5AQAA 5FATA 2RL3A 2WUQA 4KZ4A 5HW3A 5CERA 3ZCZA 4XXRA 5FA7A 4OOLA 5L2FA 4DE3A 1ERQA 1JVJA 1IKIA 1ZC2A 2Q9NA 3LEZA 5HAQA 4GOGA 1JWVA 3FZCA 5G18A 1VQQA 5HL1A 3Q07A 5A90A 1CEGA 4KQQA 3E2KA 4KZ3A 3W4PA 2XK1A 4U0TA 3G34A 1BZAA 3V3RA 1L0FA 3TSGA 5GLCA 2V1ZA 1BULA 5AQ9A 3Q7VA 5GHZA 1NYMA 3NDEA 3PAGA 4QHCA 5M19A 4E3JA 3IF6C 4JBFA 3UPPA 5EVIB 2WAFA 1W8YA 3UPOA 1BTLA 2ZLYA 2ZQ9A 4KZ8A 1ESIA 5FAQA 2EX8A 2PBYA 3C7VA 4K0WA 4M3KA 5GHXA 3JYIA 3UE1A 3CJMA 1I5QA 1FQGA 3FWLA 1SDNA 3FYZA 3MFDA 1K57C 3QNBA 1DJCA 1PI5A 3HVFA 1IELA 2Y91A 2Y2JA 5DTSA 1G68A 4WYYA 3HUNA 4OPZA 3RJUA 4JF6A 4DXBA 5F1FA 3NY4A 5F83A 2Y2NA 4OOMA 4S2JA 3ZG0A 1G6AA 2WGWB 4N9LA 3Q82A 4EBNA 2J8YA 3HLWA 4ZJ1A 2Y4AA 4OLGA 4PPRA 1K54C 1WE4A 4FH4A 1K56A 4QY6A 4IBRA 2HPBA 1N9BA 1PW1A 2XDMA 2WZXA 3GRJA 2ZC4B 4IVKA 3VSKA 4X53A 1MPLA 3ZG8B 5CHMA 3CG5A 2DRWA 3VOZA 1NYYA 5FQQA 4C3QA 2Z2MB 5HX9A 3S1YA 1BLHA 1IYPA 3IQAA 3UN7A 2ZM2A 3IHBA 3WS0A 4RYEA 5JYPA 4WM9A 3B3XA 3RXXA 4O7DA 3MZEA 5FQJA 2Y2KA 2XEPA 2Y2OA 4X68A 3HLFA 1U60A 3GQZA 3MKEA 3DW0A 3G35A 2IWBA 3N7WA 1IEMA 3VSLA 5E2FA 4C6YA 4DDYA 4E3OA 3IWIA 3NIAA 4BJPA 4JXSA 3V50A 3V39A 4LV1A 3GSGA 2EFUA 4X56A 5AQ7A 3VP0A 3G2YA 3EQVA 1YLTA 1TVFA 1RGYA 3VFFA 3TG9A 1ZG6A 2WYXA 1ES3A 4BL2A 4OQHA 1W5DA 3RXWA 5TR7A 2Y2GA 4PMAA 4R4RA 5DF9A 3PTEA 2WZZA 2UWXA 4R23A 1WYBA 5DTTA 3A3FA 3IXGA 1MWRA 1ZKJA 2XD5A 1XXMA 2E8IA 4KG6A 1KDSA 5HAIA 2WADA 3NBLA 1NZUA 3QHYA 3HUOA 4ZJ3A 2RCXA 1K56D 1IYSA 1S6RA 4EBLA 4E3KA 2OLVA 1KGFA 3FKWA 4X55A 4PM6A 2XQZA 1MBLA 3SS3A 3VMAA 1CEFA 2Y55A 3BFGA 4LCLA 4GZBA 2XD1A 4EBPA 5CHJA 3N4IA 2J7VA 5FQ9A 2EFXA 4GKUA 3IWOA 4UAAA 4S2LA 2WGVA 3SH9A 1L2SA 3BM6A 2Y2MA 4KQRA 5FDHA 1O7EA 1L0GA 5KMWA 4U0XA 5U47A 4OQGA 3ZDJA 2ZM0A 4P6BA 4WBGA 3G31A 4HESA 2ZD8A 4GNUA 4KZAA 4A5RA 3P98A 1YLPA 3GTCA 4Y7PA 1RCJA 2VGJA 2X01A 5CEBA 1XX2A 3LY4A 4R0QA 5FAPA 1W79A 1K54A 2EXBA 4OQ0A 1KE4A 1TEMA 2X02A 2WAEA 4JF5A 3IH9A 3G2ZA 1WYCA 3ZNTA 3PBQA 4S2OA 1GA0A 5FASA 4JXWA 4N92A 4YINA 1JTGA 5FI6A 2JE5A 3HREA 3PAEA 3VP4A 3ZGAB 2V2FF 2VGKA 4YFMA 4X6TA 4ZJ2A 3WS1A 4L0LA 3TOIA 2DNSA 2XF3A 1BUEA 1IKGA 3OZHA 4PM9A 1FCMA 1PYYA 2ZQ7A 3WRTA 3PBTA 3IHAA 3AGDA 4OP8A 4RVAA 1FCNA 1K25A 2PU2A 2JBFA 4IVIA 2HDUA 3S4XA 1KVMA 3I7JA 5BOHA 2Z2LB 2P9VA 4LCMA 2EX9A 3HLBA 3DTMA 1NXYA 2HP6A 2ZQAA 1GA9A 1I2SA 1YT4A 3ZNYA 1RGZA 5E2EA 5JYOA 2I72A 4QB8A 4R1GA 4JF4A 3OCLA 4FSFA 3PBOA 3FKVA 4JKTA 1L0EA 4E6WA 2ZC7A 5EPHA 2X71A 2Y2PA 4LENA 4ID4A 3HLGA 1RP5A 2XR0A 1XKZA 4N9KA 3WS5A 1YM1A 1LI9A 4BD1A 3PBSA 4KZ6A 3IXHA 1SKFA 4U3TA 4WEKA 2H0YA 3VP3A 5EUAA 2G2UA 1HVBA 2Y59A 3WS2A 2H5SA 1EROA 4WMCA 1DJAA 4DXCA 1JWZA 1ALQA 4OVDA 3IF6B 4KQOA 1M6KA 4BLMA 1GHIA 2WKEA 4R3BA 5TGFA 2WGIA 4BENA 1MXOA 4OKPA 1CK3A 5GLDA 1EI5A 3MKFA 2FFFB 1TDGA 4EUZA 1PIOA 4RX2A 3N8LA 3VP1A 3A3EA 3Q81A 4R3JA 3D4FA 4ZBEA 3N8RA 5A91A 4KENB 5CECA 4E3NA 1O07A 5CXWA 3V3SA 4B4ZA 4C75A 5EOOA 3SS4A 5E43A 3OPPA 1VM1A 1W7FA 4IBXA 2PU4A 4UA6A 2HP5A 1XGIA 3BRMA 3W4OA 2ZC3B 1K6SA 4IEDA 4PM7A 1H5XA 2IWDA 3QNCA 5EECA 2XLNA 4P87A 3NCKA 5FQKA 3OPHA 1DY6A 2QMIA 4E3IA 4KZ5A 4OPYA 1ES2A 2J9PA 1E4DA 3CZDA 3Q7VB 4EWFA 3NI9A 4CJNA 3M6HA 4MBFA 2XGNA 1NZOA 2ZQDA 1I2WA 4Z9QA 1PZPA 3HLDA 3IXBA 3OPRA 4H8RA 3IWQA 3C7UA 3ZG5A 3HBRA 5FQIA 4PM8A 3SH7A 3V5MA 4S2MA 3PBRA 3DWZA 1FCOA 5CGWA 3GR2A 3NC8A 4HBTA 4K91A 3N8SA 4N1XA 3O86A 2HDSA 3W4QA 1YLYA 5GLAA 1ESUA 4LV0A 1BT5A 4FH2A 3P09A 4KZ7A 3ZFZA 3UO9A 1HD8A 4ZAMA 3NDGA 4JLFA 4EV4A 5HFOA 5FAOA 5M1AA 1LI0A 2CC1A 1LLBA 3BLMA 3C5AA 2R9WA 1S0WA 4GD8A 2FFYA 5EOEA 4HBUA 1FOFA 1PW8A 4JXVA 2OLUA 4BQMA 4Q8IA 2ZQ8A 5A93A 1ES4A 1IYQA 3OCNA 3AGEA 3FV7A 2ZJ9A 1BLCA 4S2KA 5GHYA 4ZDXA 1XA1A 5HARA 3G32A 4E6XA 1GCEA 3LO7A 4WZ5A 2H10A 3AGFA 1PI4A 3ZHHA 2XFTA 2R9XA 5F82A 5EE8A 3MXRA 4GN2A 1YMXA 5CTNA 3BFCA 3HLCA 1KGGA 4KG2A 2A49A 4P85A 5FI7A 1PWGA 1SHVA 2XFSA 3MBZA 4WZ4A 5IHVA 1K4EA 3UNWA 3OPLA 3GVBA 1HTZA 4JXGA 4MBHA 4E3MA 3UDIA 3UPNA 5I94A 3ITAA 4OPRA 3M6BA 5CGXA 3ZVWA 1SCWA 3ITBA 4S2NA 5A92A 4JPMA 1M40A 3GV9A 4PM5A 4OH0A 4B4XA 1E3UA 2Y2IA 5DF8A 4GDBA 3LCEA 2OV5A 4OQIA 2XH9A 5KZHA 1ES5A 2Q9MA 2V20A 4MBKA 4N1HA 4MNRA 1SDEA 2ZC5B 3BEBA 4XUZA 3Q7ZA 2HP9A 5GL9A 1FR1A 2JC7A 1Q2QA 1AXBA 2ZC6B 2HDRA 1XA7A 3BFDA 3VFHA 3WRZA 3O3VA 4LV2A 4E3LA 3IXDA 5EVLA 4KZBA 1ONHA 3HL9A 1MKIA 4XUXA 5M18A 3CMZA 1KDWA 1TDLA 5J8XA 4GD6A 5D3OA 1NRFA 3UDXA 2C5WB 4WZ5C 1KE3A 2OSUA 4S2PA 2ZM8A 4GDNA 1XPBA 1ONGA 1YMSA 1DJBA 1YLZA 4WEJA 3N6IA 3MZDA 3UDFA 1E25A 1PWCA 4DF6A 3E2LA 4NK3A 1OMEA 4QD4A 3SOIA 2JCHA 1IYOA 1PZOA 1LHYA 3BFEA 4MEZA 1BSGA 4FCFA 4OLDA 3HUMA 3G4PA 3C4OA 4CPKA 1BLSA 2IWCA 3ISGA 1CI8A 2WKHA 4S2NC 4Y0TA 4DE1A 3A3DA 4D2OA 1K38A 3OC2A 5AQBA 1FSYA 4LV3A 1J9MA 2C6WB 5CHUA 2ZMAA 1LL5A 4RX3A 2QZ6A 4NETA 1E3UD 1LL9A 4DKIA 4DE2A 2H0TA 1YLWA 2HDQA 4P0MA 1YQSA 2EX6A 3UY6A 5E2GA 1Z6FA 3Q1FA 4MLLA 1ERMA 1Q2PA 4DRTA 3IT9A 1MWUA 1FR6A 5KSHA 4ZTKA 4WELA 5DVAA 4FD8A 2Y2LA 2EXAA 5FSRA 3PBNA 4UHUA 1QMFA 3MZFA 5F1GA 1Y54A 1PWDA 2ZQCA 3O87A 1HZOA 2Y2QA 1MWSA 1XP4A 3DWKA 5DF7A 1GHPA 4RA7A 1MY8A 4UA9A 1KGEA 3S22A 3HLEA 5EVIA 4X69A 2Y2HA 4DE0A 3M2JA 1YLJA 4OP5A 4WMCD 2DCFA 3BECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K55 A;  2P9V B;  4QU3 A;  2J9O A;  2A3U A;  1H8Y A;  1BLP A;  3M2K A;  1NY0 A;  4BL3 A;  4QJG A;  3A3J A;  1MWT A;  1H8Z A;  1L0D A;  3ZVT A;  1JWP A;  1QME A;  4KG5 A;  3ZG7 B;  5CGS A;  4EQI A;  1W8Q A;  2WKI A;  3LY3 A;  4F94 A;  2QPN A;  2BG1 A;  1XGJ A;  2WGW A;  4BD0 A;  4GB7 A;  5CED A;  2B5R A;  4QY5 A;  5CTM A;  1N4O A;  3A3I A;  1C3B A;  4KZ9 A;  3UE3 A;  4B88 A;  3BYD A;  5DTK A;  3BFF A;  5FQM A;  1FSW A;  2G2W A;  3ZG9 B;  3MXS A;  3IF5 A;  3O88 A;  4K0X A;  5KSC A;  1EWZ A;  4DDS A;  3W8K A;  3IF6 A;  1ZG4 A;  5HAP A;  3SH8 A;  1CI9 A;  3VOY A;  3WS4 A;  1NJ4 A;  3GMW A;  3IH8 A;  3EQU A;  4Y0O A;  5GLB A;  4S2I A;  1KVL A;  4HEF A;  4OPQ A;  2WK0 A;  5FI2 A;  1JTD A;  5E2H A;  4Y0U A;  5CRF A;  5EVI C;  3WWX A;  5TFQ A;  3BLS A;  3C4P A;  1KE0 A;  1K6R A;  1GHM A;  1K57 A;  3G30 A;  3VP2 A;  4R4S A;  2P74 A;  4OOY A;  2EX2 A;  4UA7 A;  5EVI D;  3SS5 A;  3UE0 A;  2GDN A;  2BLS A;  1K55 C;  4OON A;  1K4F A;  5AQA A;  5FAT A;  2RL3 A;  2WUQ A;  4KZ4 A;  5HW3 A;  5CER A;  3ZCZ A;  4XXR A;  5FA7 A;  4OOL A;  5L2F A;  4DE3 A;  1ERQ A;  1JVJ A;  1IKI A;  1ZC2 A;  2Q9N A;  3LEZ A;  5HAQ A;  4GOG A;  1JWV A;  3FZC A;  5G18 A;  1VQQ A;  5HL1 A;  3Q07 A;  5A90 A;  1CEG A;  4KQQ A;  3E2K A;  4KZ3 A;  3W4P A;  2XK1 A;  4U0T A;  3G34 A;  1BZA A;  3V3R A;  1L0F A;  3TSG A;  5GLC A;  2V1Z A;  1BUL A;  5AQ9 A;  3Q7V A;  5GHZ A;  1NYM A;  3NDE A;  3PAG A;  4QHC A;  5M19 A;  4E3J A;  3IF6 C;  4JBF A;  3UPP A;  5EVI B;  2WAF A;  1W8Y A;  3UPO A;  1BTL A;  2ZLY A;  2ZQ9 A;  4KZ8 A;  1ESI A;  5FAQ A;  2EX8 A;  2PBY A;  3C7V A;  4K0W A;  4M3K A;  5GHX A;  3JYI A;  3UE1 A;  3CJM A;  1I5Q A;  1FQG A;  3FWL A;  1SDN A;  3FYZ A;  3MFD A;  1K57 C;  3QNB A;  1DJC A;  1PI5 A;  3HVF A;  1IEL A;  2Y91 A;  2Y2J A;  5DTS A;  1G68 A;  4WYY A;  3HUN A;  4OPZ A;  3RJU A;  4JF6 A;  4DXB A;  5F1F A;  3NY4 A;  5F83 A;  2Y2N A;  4OOM A;  4S2J A;  3ZG0 A;  1G6A A;  2WGW B;  4N9L A;  3Q82 A;  4EBN A;  2J8Y A;  3HLW A;  4ZJ1 A;  2Y4A A;  4OLG A;  4PPR A;  1K54 C;  1WE4 A;  4FH4 A;  1K56 A;  4QY6 A;  4IBR A;  2HPB A;  1N9B A;  1PW1 A;  2XDM A;  2WZX A;  3GRJ A;  2ZC4 B;  4IVK A;  3VSK A;  4X53 A;  1MPL A;  3ZG8 B;  5CHM A;  3CG5 A;  2DRW A;  3VOZ A;  1NYY A;  5FQQ A;  4C3Q A;  2Z2M B;  5HX9 A;  3S1Y A;  1BLH A;  1IYP A;  3IQA A;  3UN7 A;  2ZM2 A;  3IHB A;  3WS0 A;  4RYE A;  5JYP A;  4WM9 A;  3B3X A;  3RXX A;  4O7D A;  3MZE A;  5FQJ A;  2Y2K A;  2XEP A;  2Y2O A;  4X68 A;  3HLF A;  1U60 A;  3GQZ A;  3MKE A;  3DW0 A;  3G35 A;  2IWB A;  3N7W A;  1IEM A;  3VSL A;  5E2F A;  4C6Y A;  4DDY A;  4E3O A;  3IWI A;  3NIA A;  4BJP A;  4JXS A;  3V50 A;  3V39 A;  4LV1 A;  3GSG A;  2EFU A;  4X56 A;  5AQ7 A;  3VP0 A;  3G2Y A;  3EQV A;  1YLT A;  1TVF A;  1RGY A;  3VFF A;  3TG9 A;  1ZG6 A;  2WYX A;  1ES3 A;  4BL2 A;  4OQH A;  1W5D A;  3RXW A;  5TR7 A;  2Y2G A;  4PMA A;  4R4R A;  5DF9 A;  3PTE A;  2WZZ A;  2UWX A;  4R23 A;  1WYB A;  5DTT A;  3A3F A;  3IXG A;  1MWR A;  1ZKJ A;  2XD5 A;  1XXM A;  2E8I A;  4KG6 A;  1KDS A;  5HAI A;  2WAD A;  3NBL A;  1NZU A;  3QHY A;  3HUO A;  4ZJ3 A;  2RCX A;  1K56 D;  1IYS A;  1S6R A;  4EBL A;  4E3K A;  2OLV A;  1KGF A;  3FKW A;  4X55 A;  4PM6 A;  2XQZ A;  1MBL A;  3SS3 A;  3VMA A;  1CEF A;  2Y55 A;  3BFG A;  4LCL A;  4GZB A;  2XD1 A;  4EBP A;  5CHJ A;  3N4I A;  2J7V A;  5FQ9 A;  2EFX A;  4GKU A;  3IWO A;  4UAA A;  4S2L A;  2WGV A;  3SH9 A;  1L2S A;  3BM6 A;  2Y2M A;  4KQR A;  5FDH A;  1O7E A;  1L0G A;  5KMW A;  4U0X A;  5U47 A;  4OQG A;  3ZDJ A;  2ZM0 A;  4P6B A;  4WBG A;  3G31 A;  4HES A;  2ZD8 A;  4GNU A;  4KZA A;  4A5R A;  3P98 A;  1YLP A;  3GTC A;  4Y7P A;  1RCJ A;  2VGJ A;  2X01 A;  5CEB A;  1XX2 A;  3LY4 A;  4R0Q A;  5FAP A;  1W79 A;  1K54 A;  2EXB A;  4OQ0 A;  1KE4 A;  1TEM A;  2X02 A;  2WAE A;  4JF5 A;  3IH9 A;  3G2Z A;  1WYC A;  3ZNT A;  3PBQ A;  4S2O A;  1GA0 A;  5FAS A;  4JXW A;  4N92 A;  4YIN A;  1JTG A;  5FI6 A;  2JE5 A;  3HRE A;  3PAE A;  3VP4 A;  3ZGA B;  2V2F F;  2VGK A;  4YFM A;  4X6T A;  4ZJ2 A;  3WS1 A;  4L0L A;  3TOI A;  2DNS A;  2XF3 A;  1BUE A;  1IKG A;  3OZH A;  4PM9 A;  1FCM A;  1PYY A;  2ZQ7 A;  3WRT A;  3PBT A;  3IHA A;  3AGD A;  4OP8 A;  4RVA A;  1FCN A;  1K25 A;  2PU2 A;  2JBF A;  4IVI A;  2HDU A;  3S4X A;  1KVM A;  3I7J A;  5BOH A;  2Z2L B;  2P9V A;  4LCM A;  2EX9 A;  3HLB A;  3DTM A;  1NXY A;  2HP6 A;  2ZQA A;  1GA9 A;  1I2S A;  1YT4 A;  3ZNY A;  1RGZ A;  5E2E A;  5JYO A;  2I72 A;  4QB8 A;  4R1G A;  4JF4 A;  3OCL A;  4FSF A;  3PBO A;  3FKV A;  4JKT A;  1L0E A;  4E6W A;  2ZC7 A;  5EPH A;  2X71 A;  2Y2P A;  4LEN A;  4ID4 A;  3HLG A;  1RP5 A;  2XR0 A;  1XKZ A;  4N9K A;  3WS5 A;  1YM1 A;  1LI9 A;  4BD1 A;  3PBS A;  4KZ6 A;  3IXH A;  1SKF A;  4U3T A;  4WEK A;  2H0Y A;  3VP3 A;  5EUA A;  2G2U A;  1HVB A;  2Y59 A;  3WS2 A;  2H5S A;  1ERO A;  4WMC A;  1DJA A;  4DXC A;  1JWZ A;  1ALQ A;  4OVD A;  3IF6 B;  4KQO A;  1M6K A;  4BLM A;  1GHI A;  2WKE A;  4R3B A;  5TGF A;  2WGI A;  4BEN A;  1MXO A;  4OKP A;  1CK3 A;  5GLD A;  1EI5 A;  3MKF A;  2FFF B;  1TDG A;  4EUZ A;  1PIO A;  4RX2 A;  3N8L A;  3VP1 A;  3A3E A;  3Q81 A;  4R3J A;  3D4F A;  4ZBE A;  3N8R A;  5A91 A;  4KEN B;  5CEC A;  4E3N A;  1O07 A;  5CXW A;  3V3S A;  4B4Z A;  4C75 A;  5EOO A;  3SS4 A;  5E43 A;  3OPP A;  1VM1 A;  1W7F A;  4IBX A;  2PU4 A;  4UA6 A;  2HP5 A;  1XGI A;  3BRM A;  3W4O A;  2ZC3 B;  1K6S A;  4IED A;  4PM7 A;  1H5X A;  2IWD A;  3QNC A;  5EEC A;  2XLN A;  4P87 A;  3NCK A;  5FQK A;  3OPH A;  1DY6 A;  2QMI A;  4E3I A;  4KZ5 A;  4OPY A;  1ES2 A;  2J9P A;  1E4D A;  3CZD A;  3Q7V B;  4EWF A;  3NI9 A;  4CJN A;  3M6H A;  4MBF A;  2XGN A;  1NZO A;  2ZQD A;  1I2W A;  4Z9Q A;  1PZP A;  3HLD A;  3IXB A;  3OPR A;  4H8R A;  3IWQ A;  3C7U A;  3ZG5 A;  3HBR A;  5FQI A;  4PM8 A;  3SH7 A;  3V5M A;  4S2M A;  3PBR A;  3DWZ A;  1FCO A;  5CGW A;  3GR2 A;  3NC8 A;  4HBT A;  4K91 A;  3N8S A;  4N1X A;  3O86 A;  2HDS A;  3W4Q A;  1YLY A;  5GLA A;  1ESU A;  4LV0 A;  1BT5 A;  4FH2 A;  3P09 A;  4KZ7 A;  3ZFZ A;  3UO9 A;  1HD8 A;  4ZAM A;  3NDG A;  4JLF A;  4EV4 A;  5HFO A;  5FAO A;  5M1A A;  1LI0 A;  2CC1 A;  1LLB A;  3BLM A;  3C5A A;  2R9W A;  1S0W A;  4GD8 A;  2FFY A;  5EOE A;  4HBU A;  1FOF A;  1PW8 A;  4JXV A;  2OLU A;  4BQM A;  4Q8I A;  2ZQ8 A;  5A93 A;  1ES4 A;  1IYQ A;  3OCN A;  3AGE A;  3FV7 A;  2ZJ9 A;  1BLC A;  4S2K A;  5GHY A;  4ZDX A;  1XA1 A;  5HAR A;  3G32 A;  4E6X A;  1GCE A;  3LO7 A;  4WZ5 A;  2H10 A;  3AGF A;  1PI4 A;  3ZHH A;  2XFT A;  2R9X A;  5F82 A;  5EE8 A;  3MXR A;  4GN2 A;  1YMX A;  5CTN A;  3BFC A;  3HLC A;  1KGG A;  4KG2 A;  2A49 A;  4P85 A;  5FI7 A;  1PWG A;  1SHV A;  2XFS A;  3MBZ A;  4WZ4 A;  5IHV A;  1K4E A;  3UNW A;  3OPL A;  3GVB A;  1HTZ A;  4JXG A;  4MBH A;  4E3M A;  3UDI A;  3UPN A;  5I94 A;  3ITA A;  4OPR A;  3M6B A;  5CGX A;  3ZVW A;  1SCW A;  3ITB A;  4S2N A;  5A92 A;  4JPM A;  1M40 A;  3GV9 A;  4PM5 A;  4OH0 A;  4B4X A;  1E3U A;  2Y2I A;  5DF8 A;  4GDB A;  3LCE A;  2OV5 A;  4OQI A;  2XH9 A;  5KZH A;  1ES5 A;  2Q9M A;  2V20 A;  4MBK A;  4N1H A;  4MNR A;  1SDE A;  2ZC5 B;  3BEB A;  4XUZ A;  3Q7Z A;  2HP9 A;  5GL9 A;  1FR1 A;  2JC7 A;  1Q2Q A;  1AXB A;  2ZC6 B;  2HDR A;  1XA7 A;  3BFD A;  3VFH A;  3WRZ A;  3O3V A;  4LV2 A;  4E3L A;  3IXD A;  5EVL A;  4KZB A;  1ONH A;  3HL9 A;  1MKI A;  4XUX A;  5M18 A;  3CMZ A;  1KDW A;  1TDL A;  5J8X A;  4GD6 A;  5D3O A;  1NRF A;  3UDX A;  2C5W B;  4WZ5 C;  1KE3 A;  2OSU A;  4S2P A;  2ZM8 A;  4GDN A;  1XPB A;  1ONG A;  1YMS A;  1DJB A;  1YLZ A;  4WEJ A;  3N6I A;  3MZD A;  3UDF A;  1E25 A;  1PWC A;  4DF6 A;  3E2L A;  4NK3 A;  1OME A;  4QD4 A;  3SOI A;  2JCH A;  1IYO A;  1PZO A;  1LHY A;  3BFE A;  4MEZ A;  1BSG A;  4FCF A;  4OLD A;  3HUM A;  3G4P A;  3C4O A;  4CPK A;  1BLS A;  2IWC A;  3ISG A;  1CI8 A;  2WKH A;  4S2N C;  4Y0T A;  4DE1 A;  3A3D A;  4D2O A;  1K38 A;  3OC2 A;  5AQB A;  1FSY A;  4LV3 A;  1J9M A;  2C6W B;  5CHU A;  2ZMA A;  1LL5 A;  4RX3 A;  2QZ6 A;  4NET A;  1E3U D;  1LL9 A;  4DKI A;  4DE2 A;  2H0T A;  1YLW A;  2HDQ A;  4P0M A;  1YQS A;  2EX6 A;  3UY6 A;  5E2G A;  1Z6F A;  3Q1F A;  4MLL A;  1ERM A;  1Q2P A;  4DRT A;  3IT9 A;  1MWU A;  1FR6 A;  5KSH A;  4ZTK A;  4WEL A;  5DVA A;  4FD8 A;  2Y2L A;  2EXA A;  5FSR A;  3PBN A;  4UHU A;  1QMF A;  3MZF A;  5F1G A;  1Y54 A;  1PWD A;  2ZQC A;  3O87 A;  1HZO A;  2Y2Q A;  1MWS A;  1XP4 A;  3DWK A;  5DF7 A;  1GHP A;  4RA7 A;  1MY8 A;  4UA9 A;  1KGE A;  3S22 A;  3HLE A;  5EVI A;  4X69 A;  2Y2H A;  4DE0 A;  3M2J A;  1YLJ A;  4OP5 A;  4WMC D;  2DCF A;  3BEC A; 
#chains in the Genus database with same CATH topology
 3M2K A;  4QJG A;  3VOL A;  2YKH A;  3ZG7 B;  1QME A;  4KG5 A;  2XA7 M;  4F94 A;  2BG1 A;  1XGJ A;  4BD0 A;  5CED A;  1XJ6 A;  3BYD A;  3ZG9 B;  3BFF A;  4I38 A;  3MXS A;  3IF5 A;  3W8K A;  1ZG4 A;  1CI9 A;  3WS4 A;  3GMW A;  4ESP A;  3IH8 A;  3LIC A;  4Y0O A;  4HEF A;  4OPQ A;  2WK0 A;  3A0S A;  5FI2 A;  2J80 A;  2KLI A;  4EES A;  3BLS A;  3LR5 A;  4R4S A;  4OOY A;  3DBA A;  3UE0 A;  5EVI D;  3SS5 A;  5J7E A;  2RL3 A;  2UV0 E;  2WUQ A;  5HD3 A;  4KZ4 A;  5HW3 A;  4XXR A;  5HL6 A;  4OOL A;  5L2F A;  4M4X A;  1ERQ A;  1JVJ A;  1ZC2 A;  3T4J A;  5HAQ A;  2CMN A;  5G18 A;  5TBM A;  5HL1 A;  3Q07 A;  4KQQ A;  3E2K A;  2XK1 A;  3TSG A;  1BUL A;  5GHZ A;  4HJ3 A;  5EVI B;  2WAF A;  3HJK A;  5FAQ A;  2PBY A;  3T4S A;  2INW A;  3TW8 A;  1XFQ A;  1N9N A;  3FYZ A;  3MFD A;  1DJC A;  2Y91 A;  4OPZ A;  3RJU A;  2V0U A;  4JF6 A;  3NY4 A;  2Y2N A;  4S2J A;  4N9L A;  3HLW A;  2Y4A A;  4PPR A;  1K54 C;  1N9B A;  3VSK A;  3ZG8 B;  3S7N A;  2PD8 A;  3VOZ A;  1NYY A;  5EVE A;  5HX9 A;  2ZM2 A;  3MQQ A;  3C2W A;  3L9K A;  4WM9 A;  3RTY A;  3RXX A;  3MZE A;  4P6Z M;  3HLF A;  2IWB A;  1F2K A;  5E2F A;  5FEG A;  4E3O A;  3IWI A;  3V39 A;  3GSG A;  4Y5F A;  5DFX A;  1YLT A;  3DTI A;  4BL2 A;  3QP4 A;  1CF0 A;  2Y2G A;  4R4R A;  3E98 A;  2WZZ A;  4R23 A;  5DTT A;  5HPF A;  2MJ6 A;  1XXM A;  2E8I A;  1KDS A;  1NZU A;  4ZJ3 A;  2RCX A;  1K56 D;  2JKT M;  2OLV A;  3FKW A;  4HP4 A;  4Y3I A;  2XQZ A;  3BFG A;  4EBP A;  3N4I A;  5FQ9 A;  1TS0 A;  2VZW A;  3KSH A;  2WGV A;  3SH9 A;  5DKK A;  4KQR A;  1L0G A;  4OQG A;  1OTI A;  3G31 A;  4LRZ E;  4HES A;  4GNU A;  4FTX A;  1YLP A;  4Y7P A;  1RCJ A;  3LYX A;  3IX8 A;  2EXB A;  1KE4 A;  1S1Z A;  2W27 A;  4X1M A;  4HY8 A;  3MXQ A;  2WAE A;  3H7W B;  3BY9 A;  3IH9 A;  4JF5 A;  1WYC A;  3ZNT A;  3PBQ A;  3NOU C;  1JTG A;  1G6O A;  3TOI A;  2W1R A;  2XF3 A;  3P01 A;  1DP6 A;  4RVA A;  2HDU A;  1KVM A;  3I7J A;  3HLB A;  3DTM A;  2Z6C A;  5KIZ A;  4QB8 A;  4R1G A;  4Z1W A;  4FSF A;  5EPH A;  4LEN A;  2OWH A;  3FPW A;  3JVV A;  4N9K A;  4BD1 A;  3DTE A;  3LUQ A;  4KZ6 A;  1SKF A;  3UB9 A;  2H0Y A;  2Y59 A;  2ZBB A;  1G5U A;  4EER A;  4OVD A;  2QJ7 A;  3UB5 P;  1V9Z A;  4R3B A;  4BEN A;  1MXO A;  4OKP A;  3IS2 B;  2W3H A;  3MKF A;  2VA0 A;  1PIO A;  2JKT I;  4R3J A;  4NG2 A;  1TS8 A;  4KEN B;  5CEC A;  1V9Y A;  5G4Y A;  3V3S A;  5EOO A;  3OPP A;  1W7F A;  3T4O A;  3T4Q A;  4Q0J A;  5EEC A;  5FQK A;  1XFN A;  4JGP A;  2JKR M;  1E4D A;  1T1B A;  4PKY G;  2BAS A;  2L0W A;  3M6H A;  1YKD A;  4MBF A;  4H8R A;  4MMN A;  1GSX A;  3ZG5 A;  5IT5 A;  4HJ4 A;  5CGW A;  2FH5 A;  1ESU A;  1T18 A;  1D1J A;  5A8B A;  3UO9 A;  1HD8 A;  4JLF A;  5FAO A;  2CC1 A;  2R9W A;  5EOE A;  4HBU A;  4JXV A;  1ES4 A;  3R7W A;  3G32 A;  1GCE A;  2H10 A;  2V1A A;  4UQI S;  2R9X A;  3FC7 A;  4GS9 B;  5F82 A;  4MCW A;  3HLC A;  1NLY A;  2A49 A;  3LR4 A;  1PWG A;  1SHV A;  2XFS A;  3LEQ A;  3OPL A;  4JXG A;  4E3M A;  5I94 A;  3B33 A;  3CLO A;  3ITB A;  5A92 A;  4JPM A;  1M40 A;  4PM5 A;  1DP8 A;  4BBT A;  4GDB A;  3LCE A;  1LSX A;  4MBK A;  5AVE A;  2L4R A;  4XT2 B;  4R6L A;  2JC7 A;  3WRZ A;  2XSS A;  2HDR A;  4UEY A;  2XRN A;  3MR0 A;  4HP9 A;  3UDX A;  2M7V A;  1KE3 A;  2OSU A;  4S2P A;  3FG8 A;  1DRM A;  1XPB A;  1DJB A;  4WEJ A;  2V0W A;  2B18 A;  3CPT B;  3E2L A;  1PZO A;  4YOF A;  4OLD A;  4FCF A;  2JKR I;  4CPK A;  3C4O A;  2HF6 A;  2IWC A;  3E4Q A;  3MQ0 A;  4DE1 A;  4D2O A;  2W3D A;  1FSY A;  2C6W B;  4B9O A;  2AVX A;  3UB6 A;  1YLW A;  2HDQ A;  4P0M A;  4JGQ A;  4KUK A;  1Q2P A;  1EW0 A;  5MC7 A;  3PBN A;  4GHI A;  3MZF A;  5F1G A;  2ZQC A;  3E0Y A;  3O87 A;  2Y2Q A;  1XP4 A;  3S22 A;  3LI8 A;  2DCF A;  3MQO A;  2P9V B;  1H8Y A;  3E4P A;  1BLP A;  1MWT A;  5J4E A;  1JWP A;  5F69 A;  1SKO A;  2WKI A;  3LY3 A;  2QPN A;  2B5R A;  4QY5 A;  5CTM A;  4ARZ A;  4KZ9 A;  5FQM A;  4ME4 A;  1PRQ A;  5KSC A;  1IFQ A;  1S67 L;  4H6J B;  3ICY A;  2ZL1 A;  3VOY A;  4KQD A;  3LI9 A;  5HWT A;  1NJ4 A;  3F1O B;  4Y0U A;  2ZMV A;  3HCY A;  3C4P A;  1K6R A;  1GHM A;  3G30 A;  2GDN A;  2BLS A;  1K4F A;  4HH2 A;  3KYQ A;  3BQ8 A;  1H8M A;  4GOG A;  1JWV A;  3LR0 A;  3FZC A;  3JPU A;  3G34 A;  3K3C A;  1S4S A;  3Q7V A;  4QHC A;  3B47 A;  5M19 A;  1G28 A;  4JBF A;  1W8Y A;  3UPO A;  4I3J A;  4CLC C;  2EX8 A;  4K0W A;  4HOI A;  3BQA A;  1PNE A;  1K57 C;  3QNB A;  1IEL A;  4NKP A;  5F83 A;  5HZH A;  1G6A A;  3Q82 A;  3C30 A;  4IBR A;  2HPB A;  2XDM A;  5L8M A;  4QWO A;  2B02 A;  1HLU P;  2DRW A;  2XA7 S;  1IYP A;  5JYP A;  4O7D A;  2Y2K A;  2XEP A;  4DJ2 A;  5CX7 A;  3MKE A;  3DW0 A;  3G35 A;  3VSL A;  4DDY A;  3V50 A;  1VHM A;  4ETX A;  4BWI A;  4II7 A;  3VP0 A;  3G2Y A;  4WF0 A;  3FPV A;  3KYZ A;  3A0V A;  1TVF A;  4I3I A;  3CWF A;  4R38 A;  1ZG6 A;  1ES3 A;  4ETZ A;  5TBM B;  5TR7 A;  2KOI A;  2UWX A;  1WYB A;  1MWR A;  1ZKJ A;  2XD5 A;  5HAI A;  2M7U A;  3T4T A;  3HUO A;  4EBL A;  1IYS A;  2HV1 A;  4X55 A;  4PM6 A;  1MBL A;  3VMA A;  3EWK A;  2W0N A;  2Y55 A;  4LCL A;  2XD1 A;  4GKU A;  4I3A A;  4S2L A;  4GLQ A;  5KMW A;  3ZDJ A;  3EEH A;  4WBG A;  3VE4 A;  2V8F A;  2X01 A;  1OTA A;  1XX2 A;  4R0Q A;  3MSH A;  2X02 A;  3G2Z A;  1TF1 A;  4EW7 A;  4JXW A;  1F9I A;  3PAE A;  3ZGA B;  4YFM A;  4ZJ2 A;  2HJ9 C;  2DNS A;  3OZH A;  4PM9 A;  1FCM A;  4I5S A;  1PYY A;  3PBT A;  1F98 A;  4OP8 A;  1FCN A;  4Q0H A;  4LCM A;  2HP6 A;  2ZQA A;  1GA9 A;  5K5B A;  1YT4 A;  1RGZ A;  2VGL M;  5E2E A;  4JF4 A;  1TD5 A;  3OCL A;  2Y2P A;  2PR6 A;  1WA9 A;  1RP5 A;  4WUJ A;  3EEA A;  3PBS A;  3SW1 A;  4U3T A;  1HVB A;  4BMW A;  4WMC A;  4B93 A;  3IF6 B;  1ACF A;  3LIB A;  4BLM A;  3T1Q B;  1SZV A;  2O99 A;  5F5Y A;  2WGI A;  1CK3 A;  1EI5 A;  1TDG A;  3N8L A;  2H28 A;  4ZBE A;  3N8R A;  5A91 A;  5CXW A;  3SS4 A;  4UA6 A;  4LFU A;  1P9W A;  4X25 A;  1K6S A;  4PM7 A;  1H5X A;  4EEP A;  2W3G A;  3F1P A;  5AJG A;  5TJJ A;  1DY6 A;  2LB9 A;  4E3I A;  4KZ5 A;  3NI9 A;  3NJA A;  2XGN A;  2ZQD A;  1I2W A;  4Z9Q A;  3HLD A;  3OPR A;  5FQI A;  4S2M A;  3H9W A;  4WN5 A;  4HBT A;  4K91 A;  5GLA A;  4LV0 A;  4EXO A;  3P09 A;  4KZ7 A;  3ZFZ A;  3NDG A;  2ACG A;  1OT6 A;  1S0W A;  4GD8 A;  4Q8I A;  2OLU A;  3OCN A;  5GHY A;  4NXE A;  3LO7 A;  4IJG A;  4K08 A;  3AGF A;  3ZHH A;  3TRC A;  3MJQ A;  1K4E A;  3GVB A;  4MBH A;  4EEU A;  3UPN A;  3IBR A;  3CUE C;  1OTD A;  1YSQ A;  3LIF A;  4R70 A;  4OH0 A;  4MN7 A;  1E3U A;  2OV5 A;  1ZHH B;  2Q9M A;  3GEC A;  2ZC5 B;  1YPR A;  2HP9 A;  1KOU A;  1XA7 A;  2NUT C;  3PXP A;  3VFH A;  4E3L A;  3IXD A;  4KZB A;  4IHQ A;  3HL9 A;  5M18 A;  1D06 A;  1TDL A;  4QPR A;  2J3T D;  2C5W B;  5HWV A;  3NOT C;  4RQ9 A;  3CAX A;  1YLZ A;  4HI4 A;  3N6I A;  4L9E A;  2VV6 A;  4BBV A;  4DF6 A;  4NK3 A;  1OME A;  4JGR A;  2JCH A;  1LHY A;  3HUM A;  1BLS A;  3C38 A;  3ISG A;  1CI8 A;  2WKH A;  4Y0T A;  1K38 A;  2FZ0 A;  5AQB A;  3LIA A;  1J9M A;  4LV3 A;  2JKF A;  5EM1 A;  1GSW A;  4DKI A;  2H0T A;  1YQS A;  2JN7 A;  3PYP A;  4MLL A;  2M1C A;  2KDK A;  3MF0 A;  3B42 A;  2EXA A;  4NXB A;  1PWD A;  2VKS A;  4DMZ A;  4RA7 A;  1LSV A;  3K3D A;  3HLE A;  4DE0 A;  1VEU A;  1S4R A;  3CI6 A;  1YLJ A;  3LGO A;  3O5Y A;  4QU3 A;  1H3Q A;  3U4L P;  4BL3 A;  1L0D A;  5L10 A;  3ZVT A;  3LR3 A;  3NUL A;  3T1R A;  1W8Q A;  2JKG A;  2WGW A;  1CQA A;  4GB7 A;  1N4O A;  3A3I A;  4BBU A;  3UE3 A;  1OJG A;  5DTK A;  1FSW A;  2G2W A;  2QJ5 A;  4DDS A;  3SH8 A;  2PHY A;  4CLC A;  1P97 A;  3IS2 A;  1KVL A;  3MFX A;  5E2H A;  5CRF A;  5EVI C;  3WWX A;  5TFQ A;  1K57 A;  1T19 A;  2EX2 A;  4UA7 A;  1K55 C;  5FAT A;  4I39 A;  1AWI A;  3EOI A;  2PYP A;  2HZ5 A;  1IKI A;  5HDS A;  2K2N A;  2Q9N A;  3QP2 A;  5A90 A;  1CEG A;  3W4P A;  4KZ3 A;  3H82 B;  4U0T A;  4Q0I A;  1BZA A;  3V3R A;  3U2A A;  3V67 A;  5AQ9 A;  5HD5 A;  1NYM A;  3PAG A;  4E3J A;  3IF6 C;  1BTL A;  2ZLY A;  2ZQ9 A;  2W3F A;  4O01 A;  1ESI A;  3C7V A;  4M3K A;  1X0O A;  3JYI A;  1FIL A;  2XRO A;  3CHW P;  1NWZ A;  1PI5 A;  3HVF A;  3UMD A;  2Y2J A;  4WYY A;  1SKO B;  3HUN A;  5F1F A;  4DXB A;  4MN6 A;  4HH3 A;  4EBN A;  4ARZ B;  2K31 A;  4L9F A;  1Z09 A;  2VJW A;  3IBJ A;  3P7N A;  1K0K A;  4L9G A;  4GS9 A;  3GRJ A;  4IVK A;  4X53 A;  5L09 A;  3CG5 A;  2O9B A;  4C3Q A;  1ODV A;  2Y79 A;  3IHB A;  3WS0 A;  3B3X A;  5FQJ A;  1F5M A;  4YNR A;  2Y2O A;  1STZ A;  4X68 A;  5L07 A;  3GQZ A;  3N7W A;  1IEM A;  1UWN X;  3TJZ C;  3NIA A;  1NRJ A;  4JXS A;  4BJP A;  1MKM A;  3T1S A;  5HPI A;  4LV1 A;  5AQ7 A;  3IX4 A;  1YAX A;  4XT2 A;  2B95 A;  3VFF A;  2WYX A;  2QWS A;  4OQH A;  1VET A;  3F1N A;  3RXW A;  2R78 A;  4PMA A;  3PTE A;  2O9C A;  4HIA A;  3A3F A;  2Q0O A;  3QHY A;  3UE6 A;  3T12 B;  4E3K A;  2PD7 A;  1MC0 A;  4G3W A;  2P04 A;  3T1X A;  1S1Y A;  4F3L A;  2J7V A;  3S7O A;  2EFX A;  2W3E A;  1OPX A;  4UAA A;  2Y2M A;  5C5K A;  4U0X A;  2WKQ A;  5U47 A;  2ZM0 A;  4P6B A;  3P98 A;  3T4K A;  2VGJ A;  2PDR A;  5HWW A;  5CEB A;  1OTE A;  2PR5 A;  1K54 A;  1N9O A;  1TEM A;  2W1T A;  1T1C A;  5HSQ A;  1GA0 A;  3KX0 X;  2WKR A;  5FAS A;  2V9A A;  4N92 A;  3BJN A;  4YIN A;  2JE5 A;  4LGW A;  2VGK A;  4X6T A;  3L7H A;  3WS1 A;  4HQA A;  4EET B;  2O9A A;  1IKG A;  3GDI A;  3OLO A;  2ZQ7 A;  2A2L A;  3IHA A;  1H0M A;  2PU2 A;  2JBF A;  3QP5 A;  2P9V A;  1NXY A;  1I2S A;  4MDZ A;  3ZNY A;  3NEC A;  2HGV A;  4JKT A;  3PBO A;  1PFL A;  3QP6 A;  2X71 A;  4ID4 A;  3HLG A;  1YM1 A;  1CJF A;  3IXH A;  4IUK A;  3WS2 A;  1ERO A;  1DJA A;  1ALQ A;  2GJ3 A;  4KQO A;  1M6K A;  1GHI A;  2WKE A;  5TGF A;  4O8G A;  2IA2 A;  5LBR A;  3F1O A;  1BYW A;  5HDD A;  4KUO A;  4AFI A;  1OT9 A;  4LRY C;  4LPZ A;  3MS6 A;  4E3N A;  2V1B A;  1XGI A;  3BRM A;  2PYR A;  2ZC3 B;  2IWD A;  3QNC A;  2XLN A;  4WLA A;  3OPH A;  4OPY A;  4YWZ A;  1ES2 A;  2J9P A;  3CZD A;  1XJ3 A;  3KO6 A;  4CJN A;  1NZO A;  3CUE A;  3C7U A;  1W63 Q;  1DP9 A;  2VX8 A;  3UB7 A;  3V5M A;  1FCO A;  3NC8 A;  1P0Z A;  4N1X A;  3N8S A;  1MZU A;  1YLY A;  1BT5 A;  4FH2 A;  2GNX A;  4ZAM A;  2ZMF A;  1LI0 A;  1LLB A;  3BLM A;  2FFY A;  1PW8 A;  2G7U A;  5A93 A;  3AGE A;  3FV7 A;  1BLC A;  2YKF A;  4S2K A;  5HAR A;  4E6X A;  2A24 A;  3D3O A;  3MXR A;  4GN2 A;  2VGL S;  1YMX A;  4EUV A;  4KG2 A;  5FI7 A;  4WZ4 A;  3MBZ A;  1FIK A;  3UNW A;  1HTZ A;  2QYB A;  1D7E A;  3MMH A;  3ZVW A;  4EU0 A;  2Y2I A;  4OQI A;  4Y2F A;  4N1H A;  4MNR A;  3BFD A;  1Q2Q A;  1AXB A;  2ZC6 B;  3F1P B;  4P6Z S;  1ONH A;  1KDW A;  3A0R A;  4GD6 A;  1NRF A;  4WZ5 C;  2VLG A;  1ONG A;  3EGD C;  3D72 A;  1PWC A;  1T1A A;  3QP1 A;  2ZOI A;  4QD4 A;  1IYO A;  4MEZ A;  3T50 A;  4JGO A;  4S2N C;  4HNB A;  3OC2 A;  2ZMA A;  1E3U D;  1LL9 A;  2Z6D A;  2EX6 A;  1Z6F A;  2I9V A;  3RFB A;  3Q1F A;  1ERM A;  3IT9 A;  1MWU A;  1FR6 A;  5KSH A;  5FSR A;  4UHU A;  1QMF A;  1Y54 A;  1XJ2 A;  5DF7 A;  3T4L A;  3UB8 A;  1MY8 A;  1KGE A;  5EVI A;  4X69 A;  2Y2H A;  3HJI A;  1K55 A;  3VE3 A;  2J9O A;  2A3U A;  5HDC A;  3IX3 A;  1NY0 A;  3A3J A;  1H8Z A;  2ZOH A;  5CGS A;  3KSI A;  4NEE D;  4EQI A;  3LID A;  1J3W A;  2GZA A;  1C3B A;  4B88 A;  3O88 A;  4GCZ A;  4K0X A;  1EWZ A;  3IF6 A;  5HAP A;  3S7Q A;  4FOF A;  1TS7 A;  3EQU A;  4PHT A;  5GLB A;  4S2I A;  4PKY A;  1JTD A;  1KE0 A;  4HHD A;  3VP2 A;  2P74 A;  5IU1 A;  2OOL A;  4OON A;  5AQA A;  3BWL A;  5CER A;  3ZCZ A;  5FA7 A;  4DE3 A;  4D60 A;  2EWW A;  3LEZ A;  2V8C A;  2D02 A;  3QP8 A;  3RH8 B;  1VQQ A;  3DTK A;  5J3W A;  1L0F A;  5GLC A;  2V1Z A;  3NDE A;  3UPP A;  1VEU B;  4KZ8 A;  5GHX A;  3UE1 A;  3CJM A;  1I5Q A;  2E8J A;  4DJ3 A;  4CLC D;  2DMW A;  1FQG A;  3FWL A;  1SDN A;  1XJ4 A;  5DTS A;  1G68 A;  4Y17 A;  4OOM A;  3ZG0 A;  1Y28 A;  2WGW B;  4CQH A;  3CIT A;  2J8Y A;  4HJ6 A;  4ZJ1 A;  4OLG A;  1WE4 A;  4FH4 A;  1K56 A;  4QY6 A;  5I5L A;  3R7W B;  3PR6 A;  1PW1 A;  2WZX A;  4MN5 A;  2ZC4 B;  2J3W A;  1MPL A;  5FEF A;  5CHM A;  4CLC B;  3H7W A;  1YSP A;  3OOV A;  5FQQ A;  5DFY A;  2Z2M B;  3S1Y A;  1BLH A;  3IQA A;  3UN7 A;  4RYE A;  3E4O A;  1U60 A;  5EM0 A;  2VV7 A;  1GSV A;  2PRF A;  4C6Y A;  2QKP A;  4FUW A;  2EFU A;  4X56 A;  3EQV A;  1RGY A;  3TE8 A;  3TG9 A;  1W5D A;  4LLO B;  4GJ4 A;  5DF9 A;  3IXG A;  3UME A;  2VEA A;  4KG6 A;  2WAD A;  3NBL A;  4DN0 A;  4CLC E;  1S6R A;  2VV8 A;  1KGF A;  3ZYT A;  3SS3 A;  1CEF A;  4GZB A;  5CHJ A;  3KSG A;  1UGU A;  3DAV A;  3IWO A;  1L2S A;  3BM6 A;  5FDH A;  1O7E A;  2K7S A;  4G3V A;  1Y4O A;  2ZD8 A;  4KZA A;  4A5R A;  4ZRR A;  3GTC A;  2QHK A;  3LY4 A;  5FAP A;  1W79 A;  5DJT A;  3ULF A;  4OQ0 A;  3LFV A;  3EGX C;  4EQ1 A;  4NXG A;  5F6A A;  4S2O A;  5FI6 A;  2L1M A;  4R3A A;  1L3L A;  3HRE A;  3VP4 A;  2V2F F;  4GHI B;  5EV0 A;  4L0L A;  1BUE A;  2BTF P;  3KYE A;  3WRT A;  3AGD A;  1K25 A;  2OAQ 1;  4IVI A;  3S4X A;  5BOH A;  2Z2L B;  2EX9 A;  1A0K A;  4UQI M;  1VET B;  3F1N B;  5JYO A;  2I72 A;  1ZTU A;  3FKV A;  1L0E A;  4E6W A;  2PAV P;  2ZC7 A;  2OAP 1;  2XR0 A;  5EFW A;  1XKZ A;  3WS5 A;  5G4Z A;  1LI9 A;  1TS6 A;  1LL8 A;  4WEK A;  3VP3 A;  2P08 A;  5EUA A;  2G2U A;  2H5S A;  4DXC A;  1JWZ A;  4Y13 A;  2ZL1 B;  4F3L B;  2HJE A;  5GLD A;  2FFF B;  4EUZ A;  4RX2 A;  2OWJ A;  3VP1 A;  3A3E A;  3Q81 A;  3D4F A;  3BY8 A;  1O07 A;  2PBD P;  4B4Z A;  4C75 A;  5E43 A;  1VM1 A;  4IBX A;  2PU4 A;  2W1T B;  2HP5 A;  3W4O A;  4WL9 A;  1LT0 A;  4IED A;  4GW9 A;  4P87 A;  5DJU A;  3NCK A;  3H82 A;  2O0Y A;  2GX5 A;  3W2Z A;  2QMI A;  3ZQ5 A;  5IS1 A;  2WKP A;  2D01 A;  5FDS A;  4EWF A;  3Q7V B;  3BW6 A;  4LRX C;  4NXF A;  1PZP A;  3IXB A;  3IWQ A;  5FL3 A;  3G6O A;  2JHE A;  3HBR A;  3SH7 A;  4PM8 A;  3NHQ A;  3PBR A;  3DWZ A;  3CPT A;  3GR2 A;  3O86 A;  2HDS A;  3W4Q A;  3PHY A;  5F68 A;  1IOU A;  4EV4 A;  5HFO A;  5M1A A;  3C5A A;  1FOF A;  4BQM A;  4G3K A;  2ZQ8 A;  2PT7 A;  1IYQ A;  4ZDX A;  2ZJ9 A;  1XA1 A;  2P7J A;  4WZ5 A;  3NOP C;  1PI4 A;  4X1L A;  2XFT A;  5EE8 A;  5CTN A;  3BFC A;  1KGG A;  4P85 A;  3SZT A;  1LSW A;  5IHV A;  1VB6 A;  3C8C A;  3UDI A;  1S66 L;  3ITA A;  4OPR A;  3M6B A;  5CGX A;  1SCW A;  4S2N A;  3GV9 A;  3VV4 A;  4B4X A;  3JVU A;  5DF8 A;  5AVF A;  2XH9 A;  5KZH A;  1ES5 A;  1OTB A;  2V20 A;  3KSF A;  1SDE A;  3BEB A;  4XUZ A;  3Q7Z A;  5GL9 A;  1FR1 A;  2J3T C;  3O3V A;  4LV2 A;  5EVL A;  2EA9 A;  1MKI A;  4XUX A;  3CMZ A;  3LIE A;  5J8X A;  5D3O A;  3R4K A;  4Y15 A;  2ZM8 A;  4GDN A;  5DKL A;  1YMS A;  3MZD A;  4H6J A;  3UDF A;  1E25 A;  4IUH A;  2Y8H A;  2EWV A;  3SOI A;  4PAU A;  3BFE A;  1BSG A;  3G4P A;  3OBF A;  1N9L A;  2KX6 A;  3D9Y A;  3A3D A;  2VK3 A;  5CHU A;  1LL5 A;  4RX3 A;  2QZ6 A;  4NET A;  3K2N A;  3S7P A;  2A24 B;  4O0P A;  4DE2 A;  1OJ5 A;  3UY6 A;  5E2G A;  4E04 A;  4DRT A;  4ZTK A;  4WEL A;  5DVA A;  4FD8 A;  2Y2L A;  1JNU A;  1HZO A;  1MWS A;  3DWK A;  1UWP X;  1GHP A;  4UA9 A;  2NUP C;  1W63 M;  3M2J A;  1NLZ A;  1P9R A;  2LB5 A;  4OP5 A;  4WMC D;  3BEC A; 
#chains in the Genus database with same CATH homology
 1K55 A;  2P9V B;  4QU3 A;  2J9O A;  2A3U A;  1H8Y A;  1BLP A;  3M2K A;  1NY0 A;  4BL3 A;  4QJG A;  3A3J A;  1MWT A;  1H8Z A;  1L0D A;  3ZVT A;  1JWP A;  1QME A;  4KG5 A;  3ZG7 B;  5CGS A;  4EQI A;  1W8Q A;  2WKI A;  3LY3 A;  4F94 A;  2QPN A;  2BG1 A;  1XGJ A;  2WGW A;  4BD0 A;  4GB7 A;  5CED A;  2B5R A;  4QY5 A;  5CTM A;  1N4O A;  3A3I A;  1C3B A;  4KZ9 A;  3UE3 A;  4B88 A;  3BYD A;  5DTK A;  3BFF A;  5FQM A;  1FSW A;  2G2W A;  3ZG9 B;  3MXS A;  3IF5 A;  3O88 A;  4K0X A;  5KSC A;  1EWZ A;  4DDS A;  3W8K A;  3IF6 A;  1ZG4 A;  5HAP A;  3SH8 A;  1CI9 A;  3VOY A;  3WS4 A;  1NJ4 A;  3GMW A;  3IH8 A;  3EQU A;  4Y0O A;  5GLB A;  4S2I A;  1KVL A;  4HEF A;  4OPQ A;  2WK0 A;  5FI2 A;  1JTD A;  5E2H A;  4Y0U A;  5CRF A;  5EVI C;  3WWX A;  5TFQ A;  3BLS A;  3C4P A;  1KE0 A;  1K6R A;  1GHM A;  1K57 A;  3G30 A;  3VP2 A;  4R4S A;  2P74 A;  4OOY A;  2EX2 A;  4UA7 A;  5EVI D;  3SS5 A;  3UE0 A;  2GDN A;  2BLS A;  1K55 C;  4OON A;  1K4F A;  5AQA A;  5FAT A;  2RL3 A;  2WUQ A;  4KZ4 A;  5HW3 A;  5CER A;  3ZCZ A;  4XXR A;  5FA7 A;  4OOL A;  5L2F A;  4DE3 A;  1ERQ A;  1JVJ A;  1IKI A;  1ZC2 A;  2Q9N A;  3LEZ A;  5HAQ A;  4GOG A;  1JWV A;  3FZC A;  5G18 A;  1VQQ A;  5HL1 A;  3Q07 A;  5A90 A;  1CEG A;  4KQQ A;  3E2K A;  4KZ3 A;  3W4P A;  2XK1 A;  4U0T A;  3G34 A;  1BZA A;  3V3R A;  1L0F A;  3TSG A;  5GLC A;  2V1Z A;  1BUL A;  5AQ9 A;  3Q7V A;  5GHZ A;  1NYM A;  3NDE A;  3PAG A;  4QHC A;  5M19 A;  4E3J A;  3IF6 C;  4JBF A;  3UPP A;  5EVI B;  2WAF A;  1W8Y A;  3UPO A;  1BTL A;  2ZLY A;  2ZQ9 A;  4KZ8 A;  1ESI A;  5FAQ A;  2EX8 A;  2PBY A;  3C7V A;  4K0W A;  4M3K A;  5GHX A;  3JYI A;  3UE1 A;  3CJM A;  1I5Q A;  1FQG A;  3FWL A;  1SDN A;  3FYZ A;  3MFD A;  1K57 C;  3QNB A;  1DJC A;  1PI5 A;  3HVF A;  1IEL A;  2Y91 A;  2Y2J A;  5DTS A;  1G68 A;  4WYY A;  3HUN A;  4OPZ A;  3RJU A;  4JF6 A;  4DXB A;  5F1F A;  3NY4 A;  5F83 A;  2Y2N A;  4OOM A;  4S2J A;  3ZG0 A;  1G6A A;  2WGW B;  4N9L A;  3Q82 A;  4EBN A;  2J8Y A;  3HLW A;  4ZJ1 A;  2Y4A A;  4OLG A;  4PPR A;  1K54 C;  1WE4 A;  4FH4 A;  1K56 A;  4QY6 A;  4IBR A;  2HPB A;  1N9B A;  1PW1 A;  2XDM A;  2WZX A;  3GRJ A;  2ZC4 B;  4IVK A;  3VSK A;  4X53 A;  1MPL A;  3ZG8 B;  5CHM A;  3CG5 A;  2DRW A;  3VOZ A;  1NYY A;  5FQQ A;  4C3Q A;  2Z2M B;  5HX9 A;  3S1Y A;  1BLH A;  1IYP A;  3IQA A;  3UN7 A;  2ZM2 A;  3IHB A;  3WS0 A;  4RYE A;  5JYP A;  4WM9 A;  3B3X A;  3RXX A;  4O7D A;  3MZE A;  5FQJ A;  2Y2K A;  2XEP A;  2Y2O A;  4X68 A;  3HLF A;  1U60 A;  3GQZ A;  3MKE A;  3DW0 A;  3G35 A;  2IWB A;  3N7W A;  1IEM A;  3VSL A;  5E2F A;  4C6Y A;  4DDY A;  4E3O A;  3IWI A;  3NIA A;  4BJP A;  4JXS A;  3V50 A;  3V39 A;  4LV1 A;  3GSG A;  2EFU A;  4X56 A;  5AQ7 A;  3VP0 A;  3G2Y A;  3EQV A;  1YLT A;  1TVF A;  1RGY A;  3VFF A;  3TG9 A;  1ZG6 A;  2WYX A;  1ES3 A;  4BL2 A;  4OQH A;  1W5D A;  3RXW A;  5TR7 A;  2Y2G A;  4PMA A;  4R4R A;  5DF9 A;  3PTE A;  2WZZ A;  2UWX A;  4R23 A;  1WYB A;  5DTT A;  3A3F A;  3IXG A;  1MWR A;  1ZKJ A;  2XD5 A;  1XXM A;  2E8I A;  4KG6 A;  1KDS A;  5HAI A;  2WAD A;  3NBL A;  1NZU A;  3QHY A;  3HUO A;  4ZJ3 A;  2RCX A;  1K56 D;  1IYS A;  1S6R A;  4EBL A;  4E3K A;  2OLV A;  1KGF A;  3FKW A;  4X55 A;  4PM6 A;  2XQZ A;  1MBL A;  3SS3 A;  3VMA A;  1CEF A;  2Y55 A;  3BFG A;  4LCL A;  4GZB A;  2XD1 A;  4EBP A;  5CHJ A;  3N4I A;  2J7V A;  5FQ9 A;  2EFX A;  4GKU A;  3IWO A;  4UAA A;  4S2L A;  2WGV A;  3SH9 A;  1L2S A;  3BM6 A;  2Y2M A;  4KQR A;  5FDH A;  1O7E A;  1L0G A;  5KMW A;  4U0X A;  5U47 A;  4OQG A;  3ZDJ A;  2ZM0 A;  4P6B A;  4WBG A;  3G31 A;  4HES A;  2ZD8 A;  4GNU A;  4KZA A;  4A5R A;  3P98 A;  1YLP A;  3GTC A;  4Y7P A;  1RCJ A;  2VGJ A;  2X01 A;  5CEB A;  1XX2 A;  3LY4 A;  4R0Q A;  5FAP A;  1W79 A;  1K54 A;  2EXB A;  4OQ0 A;  1KE4 A;  1TEM A;  2X02 A;  2WAE A;  4JF5 A;  3IH9 A;  3G2Z A;  1WYC A;  3ZNT A;  3PBQ A;  4S2O A;  1GA0 A;  5FAS A;  4JXW A;  4N92 A;  4YIN A;  1JTG A;  5FI6 A;  2JE5 A;  3HRE A;  3PAE A;  3VP4 A;  3ZGA B;  2V2F F;  2VGK A;  4YFM A;  4X6T A;  4ZJ2 A;  3WS1 A;  4L0L A;  3TOI A;  2DNS A;  2XF3 A;  1BUE A;  1IKG A;  3OZH A;  4PM9 A;  1FCM A;  1PYY A;  2ZQ7 A;  3WRT A;  3PBT A;  3IHA A;  3AGD A;  4OP8 A;  4RVA A;  1FCN A;  1K25 A;  2PU2 A;  2JBF A;  4IVI A;  2HDU A;  3S4X A;  1KVM A;  3I7J A;  5BOH A;  2Z2L B;  2P9V A;  4LCM A;  2EX9 A;  3HLB A;  3DTM A;  1NXY A;  2HP6 A;  2ZQA A;  1GA9 A;  1I2S A;  1YT4 A;  3ZNY A;  1RGZ A;  5E2E A;  5JYO A;  2I72 A;  4QB8 A;  4R1G A;  4JF4 A;  3OCL A;  4FSF A;  3PBO A;  3FKV A;  4JKT A;  1L0E A;  4E6W A;  2ZC7 A;  5EPH A;  2X71 A;  2Y2P A;  4LEN A;  4ID4 A;  3HLG A;  1RP5 A;  2XR0 A;  1XKZ A;  4N9K A;  3WS5 A;  1YM1 A;  1LI9 A;  4BD1 A;  3PBS A;  4KZ6 A;  3IXH A;  1SKF A;  4U3T A;  4WEK A;  2H0Y A;  3VP3 A;  5EUA A;  2G2U A;  1HVB A;  2Y59 A;  3WS2 A;  2H5S A;  1ERO A;  4WMC A;  1DJA A;  4DXC A;  1JWZ A;  1ALQ A;  4OVD A;  3IF6 B;  4KQO A;  1M6K A;  4BLM A;  1GHI A;  2WKE A;  4R3B A;  5TGF A;  2WGI A;  4BEN A;  1MXO A;  4OKP A;  1CK3 A;  5GLD A;  1EI5 A;  3MKF A;  2FFF B;  1TDG A;  4EUZ A;  1PIO A;  4RX2 A;  3N8L A;  3VP1 A;  3A3E A;  3Q81 A;  4R3J A;  3D4F A;  4ZBE A;  3N8R A;  5A91 A;  4KEN B;  5CEC A;  4E3N A;  1O07 A;  5CXW A;  3V3S A;  4B4Z A;  4C75 A;  5EOO A;  3SS4 A;  5E43 A;  3OPP A;  1VM1 A;  1W7F A;  4IBX A;  2PU4 A;  4UA6 A;  2HP5 A;  1XGI A;  3BRM A;  3W4O A;  2ZC3 B;  1K6S A;  4IED A;  4PM7 A;  1H5X A;  2IWD A;  3QNC A;  5EEC A;  2XLN A;  4P87 A;  3NCK A;  5FQK A;  3OPH A;  1DY6 A;  2QMI A;  4E3I A;  4KZ5 A;  4OPY A;  1ES2 A;  2J9P A;  1E4D A;  3CZD A;  3Q7V B;  4EWF A;  3NI9 A;  4CJN A;  3M6H A;  4MBF A;  2XGN A;  1NZO A;  2ZQD A;  1I2W A;  4Z9Q A;  1PZP A;  3HLD A;  3IXB A;  3OPR A;  4H8R A;  3IWQ A;  3C7U A;  3ZG5 A;  3HBR A;  5FQI A;  4PM8 A;  3SH7 A;  3V5M A;  4S2M A;  3PBR A;  3DWZ A;  1FCO A;  5CGW A;  3GR2 A;  3NC8 A;  4HBT A;  4K91 A;  3N8S A;  4N1X A;  3O86 A;  2HDS A;  3W4Q A;  1YLY A;  5GLA A;  1ESU A;  4LV0 A;  1BT5 A;  4FH2 A;  3P09 A;  4KZ7 A;  3ZFZ A;  3UO9 A;  1HD8 A;  4ZAM A;  3NDG A;  4JLF A;  4EV4 A;  5HFO A;  5FAO A;  5M1A A;  1LI0 A;  2CC1 A;  1LLB A;  3BLM A;  3C5A A;  2R9W A;  1S0W A;  4GD8 A;  2FFY A;  5EOE A;  4HBU A;  1FOF A;  1PW8 A;  4JXV A;  2OLU A;  4BQM A;  4Q8I A;  2ZQ8 A;  5A93 A;  1ES4 A;  1IYQ A;  3OCN A;  3AGE A;  3FV7 A;  2ZJ9 A;  1BLC A;  4S2K A;  5GHY A;  4ZDX A;  1XA1 A;  5HAR A;  3G32 A;  4E6X A;  1GCE A;  3LO7 A;  4WZ5 A;  2H10 A;  3AGF A;  1PI4 A;  3ZHH A;  2XFT A;  2R9X A;  5F82 A;  5EE8 A;  3MXR A;  4GN2 A;  1YMX A;  5CTN A;  3BFC A;  3HLC A;  1KGG A;  4KG2 A;  2A49 A;  4P85 A;  5FI7 A;  1PWG A;  1SHV A;  2XFS A;  3MBZ A;  4WZ4 A;  5IHV A;  1K4E A;  3UNW A;  3OPL A;  3GVB A;  1HTZ A;  4JXG A;  4MBH A;  4E3M A;  3UDI A;  3UPN A;  5I94 A;  3ITA A;  4OPR A;  3M6B A;  5CGX A;  3ZVW A;  1SCW A;  3ITB A;  4S2N A;  5A92 A;  4JPM A;  1M40 A;  3GV9 A;  4PM5 A;  4OH0 A;  4B4X A;  1E3U A;  2Y2I A;  5DF8 A;  4GDB A;  3LCE A;  2OV5 A;  4OQI A;  2XH9 A;  5KZH A;  1ES5 A;  2Q9M A;  2V20 A;  4MBK A;  4N1H A;  4MNR A;  1SDE A;  2ZC5 B;  3BEB A;  4XUZ A;  3Q7Z A;  2HP9 A;  5GL9 A;  1FR1 A;  2JC7 A;  1Q2Q A;  1AXB A;  2ZC6 B;  2HDR A;  1XA7 A;  3BFD A;  3VFH A;  3WRZ A;  3O3V A;  4LV2 A;  4E3L A;  3IXD A;  5EVL A;  4KZB A;  1ONH A;  3HL9 A;  1MKI A;  4XUX A;  5M18 A;  3CMZ A;  1KDW A;  1TDL A;  5J8X A;  4GD6 A;  5D3O A;  1NRF A;  3UDX A;  2C5W B;  4WZ5 C;  1KE3 A;  2OSU A;  4S2P A;  2ZM8 A;  4GDN A;  1XPB A;  1ONG A;  1YMS A;  1DJB A;  1YLZ A;  4WEJ A;  3N6I A;  3MZD A;  3UDF A;  1E25 A;  1PWC A;  4DF6 A;  3E2L A;  4NK3 A;  1OME A;  4QD4 A;  3SOI A;  2JCH A;  1IYO A;  1PZO A;  1LHY A;  3BFE A;  4MEZ A;  1BSG A;  4FCF A;  4OLD A;  3HUM A;  3G4P A;  3C4O A;  4CPK A;  1BLS A;  2IWC A;  3ISG A;  1CI8 A;  2WKH A;  4S2N C;  4Y0T A;  4DE1 A;  3A3D A;  4D2O A;  1K38 A;  3OC2 A;  5AQB A;  1FSY A;  4LV3 A;  1J9M A;  2C6W B;  5CHU A;  2ZMA A;  1LL5 A;  4RX3 A;  2QZ6 A;  4NET A;  1E3U D;  1LL9 A;  4DKI A;  4DE2 A;  2H0T A;  1YLW A;  2HDQ A;  4P0M A;  1YQS A;  2EX6 A;  3UY6 A;  5E2G A;  1Z6F A;  3Q1F A;  4MLL A;  1ERM A;  1Q2P A;  4DRT A;  3IT9 A;  1MWU A;  1FR6 A;  5KSH A;  4ZTK A;  4WEL A;  5DVA A;  4FD8 A;  2Y2L A;  2EXA A;  5FSR A;  3PBN A;  4UHU A;  1QMF A;  3MZF A;  5F1G A;  1Y54 A;  1PWD A;  2ZQC A;  3O87 A;  1HZO A;  2Y2Q A;  1MWS A;  1XP4 A;  3DWK A;  5DF7 A;  1GHP A;  4RA7 A;  1MY8 A;  4UA9 A;  1KGE A;  3S22 A;  3HLE A;  5EVI A;  4X69 A;  2Y2H A;  4DE0 A;  3M2J A;  1YLJ A;  4OP5 A;  4WMC D;  2DCF A;  3BEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...