4EW7A

The crystal structure of conjugative transfer pas_like domain from salmonella enterica subsp. enterica serovar typhimurium
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
QSVNKYILSIQDIYKNSPVPVCVRNQSRKIIYANGAFIELFSKEDQPLSGDSYNRYGVEVFLSSLELECQSLGHGAAFCRRFNFHGEIYQIRMENISFDNNEIIVLWQINLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conjugative transfer: regulation
publication title The crystal structure of conjugative transfer PAS_like domain from Salmonella enterica subsp. enterica serovar Typhimurium
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Transcription
total genus 31
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ew7A00
1D7EA 1XJ6A 1NWZA 3BY9A 1DP6A 2L0WA 4EQ1A 2I9VA 3CWFA 4I5SA 4JGQA 3UB6A 3EWKA 3P7NA 4EERA 2PD8A 1LT0A 4I3AA 2ZOHA 3F1OA 2GJ3A 5F5YA 1P97A 4L9GA 3HJIA 4R38A 5TBMA 3VOLA 3HJKA 2PD7A 3PHYA 1V9ZA 4EXOA 3LYXA 4HH3A 3ZQ5A 4HJ4A 1GSVA 4XT2B 4LPZA 1TS6A 4WL9A 2PYRA 3A0RA 5F68A 1X0OA 4I38A 3MQOA 4KUOA 3UMDA 2HV1A 3LIBA 2R78A 1OJGA 2VV8A 3E4PA 3H7WA 4NXGA 4WLAA 3SW1A 4JGOA 2WKRA 4R6LA 3GDIA 4H6JB 3NOUC 1TS7A 5DJTA 3MR0A 4I3JA 5F6AA 2J80A 1UWPX 1S66L 3IS2A 1XJ4A 4NXEA 1GSXA 3LIAA 2OWHA 4GW9A 4EEPA 3K3CA 4NXBA 1F9IA 1UWNX 1OTAA 2OOLA 3NHQA 1WA9A 4EEUA 3NJAA 4F3LB 4HHDA 4HP9A 3ULFA 2M1CA 4LRXC 1XFQA 2JHEA 3MJQA 1T1CA 4BBTA 1DP9A 4WF0A 5HDCA 3A0VA 4YWZA 5IS1A 4HJ6A 4MN5A 5HSQA 3MFXA 4EESA 2W0NA 1Y28A 4L9EA 4HH2A 4XT2A 4GS9A 3GECA 5G4YA 3RH8B 4I39A 2JN7A 3H82B 1S1ZA 1OTEA 4WUJA 5HWVA 3LIEA 1LSWA 3LI8A 2ZBBA 2PR6A 4I3IA 5HZHA 5HDSA 2WKPA 1XFNA 3H9WA 4GHIB 1BYWA 4H6JA 1T1BA 2Z6DA 1N9LA 4DJ3A 2KDKA 4HNBA 4L9FA 1LSXA 3LIFA 1OT6A 4HY8A 4K08A 2A24B 3UE6A 1XJ2A 2KX6A 2VEAA 1G28A 5EFWA 1KOUA 3B33A 3MQQA 1T1AA 1D06A 2K7SA 3F1NB 3OLOA 3NOPC 1S4RA 1DP8A 2CMNA 1TS8A 2PYPA 3VE3A 3BWLA 3UB8A 4B9OA 2V0UA 3ICYA 4R3AA 4F3LA 5HDDA 1N9OA 3UMEA 1OT9A 3C2WA 5DKKA 3BY8A 4BBUA 4MN6A 1V9YA 4JGRA 1N9NA 1OTDA 4EW7A 4JGPA 3H7WB 4HI4A 5DKLA 2EA9A 3LICA 1UGUA 3FG8A 3A0SA 2VLGA 3UB9A 4HIAA 3LI9A 3UB7A 2L4RA 2Z6CA 3C8CA 2PR5A 5HWWA 3T50A 4LLOB 3FC7A 1LSVA 2W27A 1T19A 1XJ3A 2V9AA 1S1YA 3IBRA 3PYPA 5G4ZA 3D72A 5HWTA 1GSWA 4GHIA 2OWJA 2ZOIA 3MXQA 4PKYG 2QKPA 5HD5A 5A8BA 2H28A 2VV7A 3K3DA 2D01A 2QJ7A 2BASA 2WKQA 2V0WA 2A24A 3F1PB 1S4SA 2QWSA 2B02A 4HOIA 5IU1A 3EEHA 2V1BA 3G6OA 3F1NA 5HD3A 1EW0A 3E4OA 3RTYA 1JNUA 4R70A 5KIZA 4HP4A 1ODVA 4HQAA 4GS9B 3LUQA 3NOTC 3F1OB 1S67L 4LRYC 2YKFA 1T18A 5J7EA 1OTIA 5TBMB 3CAXA 4RQ9A 2P7JA 5AVFA 2QJ5A 4PKYA 4DJ2A 2PHYA 2VV6A 3KX0X 2D02A 4KUKA 3VE4A 1OJ5A 1OTBA 1DRMA 5DJUA 5AVEA 3E4QA 4GCZA 5I5LA 5J4EA 2INWA 2PDRA 4KQDA 4WN5A 2L1MA 1F98A 1LL8A 4NXFA 4LRZE 3LIDA 4HJ3A 3H82A 1MZUA 4E04A 4EETB 5J3WA 3CLOA 4BBVA 2QHKA 2YKHA 2V1AA 3IS2B 1P0ZA 3F1PA 1TS0A 5F69A 1VB6A 4M4XA
chains in the Genus database with same CATH superfamily
2P08A 5CECA 1NWZA 3UE3A 3ZNTA 4GKUA 4ZJ1A 2FH5A 3CG5A 3VP2A 3L7HA 4DKIA 3B42A 4R3BA 2DMWA 2XH9A 1K6SA 4PM7A 3UB6A 1Z09A 4N9KA 2K2NA 2HDQA 3GR2A 3AGDA 2GJ3A 4ZJ2A 2RCXA 3TJZC 3S7PA 4OOLA 1QMEA 4U3TA 5F5YA 2V8CA 4R38A 4PM8A 3T4OA 3VOLA 1JTGA 1L0GA 4EBNA 5M19A 1FSWA 3Q81A 4QD4A 3T4KA 4PM5A 5M1AA 3G32A 3KSHA 4KZ9A 3CMZA 1JWZA 4WL9A 4OP8A 5F1FA 3E98A 4M3KA 3ZGAB 4E3NA 5CXWA 1LLBA 5F68A 1ES4A 1X0OA 4UA6A 3IBJA 4KUOA 3U4LP 3ZCZA 3UDFA 5J8XA 4RA7A 2ZQAA 4EUZA 5KSCA 3E4PA 1XP4A 4Y17A 4NXGA 1XA7A 4JGOA 2WKRA 3M2JA 1TF1A 2C6WB 4R6LA 1K38A 3UDXA 3DBAA 3BFCA 1BTLA 5DJTA 5FDHA 4EV4A 3SS3A 2J80A 1KVLA 3UB5P 1K55A 5IT5A 1VHMA 1L2SA 3T4QA 4HBUA 2HDRA 3OBFA 4DXCA 1GSXA 4CPKA 4UHUA 4NXBA 5FQ9A 4O01A 2I72A 2A3UA 2KOIA 4K0XA 5EVLA 1LL9A 4EEUA 3OPPA 3VSKA 3ULFA 3T1SA 2M1CA 1NRJA 2EX8A 4LRXC 1XFQA 2J3TD 4QJGA 4OKPA 2XDMA 3PBNA 1YSQA 3C5AA 1T1CA 4DE3A 2Y2LA 3MKFA 4YWZA 1FILA 5A91A 4FH4A 5IS1A 1HZOA 3MFXA 1NY0A 1PNEA 3S4XA 4L9EA 4E6WA 5IHVA 4XT2A 1D1JA 5CHJA 3RH8B 3BEBA 4N1HA 5GLBA 5CERA 1W8YA 3VOZA 4IJGA 3H82B 4JXWA 4WUJA 3NDEA 2XROA 2FZ0A 1Z6FA 3UDIA 3LI8A 2ZBBA 5L8MA 3A3FA 2EX9A 1YMXA 4EUVA 4CLCA 3S7NA 3ITBA 4RVAA 1W63Q 1W79A 5AQBA 2ZQ9A 4JF5A 1U60A 2Y2MA 1KE4A 2ZL1B 3V39A 3VFHA 1H5XA 4S2NC 4KZ5A 5HPFA 3UE6A 1TD5A 1XJ2A 1N4OA 2VEAA 3QP1A 1FR1A 1KOUA 4P87A 5CEDA 4O8GA 4OPQA 1J9MA 5FQKA 3T1QB 2VGLS 1TS8A 3BWLA 1YT4A 2XLNA 3UB8A 5MC7A 2HGVA 3JVUA 4EBLA 4R3AA 4F3LA 1WE4A 1N9OA 3PBQA 3UMEA 3O87A 3HLFA 4X1MA 4WEJA 3BFGA 3BY8A 4UQIS 5FAOA 1M40A 2C5WB 3E0YA 4JGRA 1N9NA 1RGZA 4JGPA 3P98A 4Y0TA 2VA0A 3QP8A 5DKLA 3BYDA 3EOIA 4BJPA 3UN7A 2IA2A 1E3UA 1ALQA 4RX3A 2Y2PA 3QP6A 1ERMA 5EE8A 4HIAA 3UB7A 3C8CA 3CI6A 1JWVA 5HWWA 3Q82A 4LGWA 2Z2LB 1J3WA 3R7WB 3MZEA 1A0KA 4C75A 2V9AA 1CI8A 4EWFA 4OPRA 3PYPA 1BT5A 1PI4A 4GOGA 3SOIA 5FSRA 4DF6A 3ZDJA 2OWJA 3DTMA 5GLCA 2H28A 4IEDA 4X68A 2VV7A 2VX8A 3C4PA 1XX2A 1ES5A 3CHWP 2VKSA 4WMCD 1FSYA 5DFYA 1S4SA 4CLCE 3NECA 3EEHA 4Z1WA 2ZJ9A 5FQIA 4DMZA 3O5YA 1NZOA 3LEZA 3F1NA 3E4OA 3RTYA 1AXBA 1JNUA 4R70A 4OPYA 4OQ0A 2XD1A 4BQMA 1JTDA 4N92A 4HQAA 2XK1A 4MBHA 3LUQA 2FFFB 3FZCA 5GLDA 3C30A 5FQMA 2ZC3B 4LV2A 4OLGA 1STZA 3M6HA 1KGGA 3MKEA 2ZM0A 2Y2NA 4RQ9A 5A92A 4B4XA 5FAQA 3NY4A 1QMFA 2G7UA 2OAP1 3IQAA 5CEBA 4CLCD 5HFOA 3BQ8A 4NEED 5E2FA 3C38A 1W8QA 4Y13A 2D02A 3N4IA 3HUMA 3WS5A 2J3TC 1L0FA 1OTBA 1DRMA 5KMWA 4X6TA 4GB7A 3D3OA 3E4QA 3VSLA 1P9WA 4PHTA 2H5SA 2EXBA 2Z2MB 3T4TA 4II7A 1F98A 4NXFA 2QPNA 1E4DA 3LIDA 4WELA 1PW1A 3H82A 4E04A 4ZBEA 2IWCA 4B4ZA 3CLOA 4KZ6A 4KZ7A 3B47A 2QHKA 2V1AA 1LI0A 1CQAA 2GNXA 4CJNA 1TS0A 2ZMFA 5F69A 1H8ZA 5F1GA 2WZZA 2VGLM 1GCEA 3BY9A 2L0WA 5E2HA 1PZPA 1Q2QA 1XA1A 4Q0HA 3KSIA 4QY6A 2VK3A 3DTIA 3NDGA 1EWZA 5E2EA 3EWKA 4UQIM 2JKGA 3HL9A 2PD8A 1LT0A 1MBLA 2W3FA 3PR6A 3WS1A 2A2LA 1LI9A 2H0TA 5FATA 2ZC5B 3LFVA 2JKRM 3VP1A 4B93A 3TOIA 4GN2A 3HJKA 2PD7A 4E3OA 1V9ZA 3LYXA 3RXXA 4S2MA 1C3BA 3JVVA 3DWKA 1GSVA 4XT2B 5EOEA 4LPZA 2Y2JA 3Q7VA 5CHUA 1S6RA 2A49A 2KLIA 5TFQA 2P9VA 1G6AA 1PZOA 3MQOA 3UMDA 5FI2A 2HV1A 1KE3A 3JPUA 3LIBA 1ONGA 1MWTA 2R78A 4JF4A 4Z9QA 2VV8A 4LCLA 3BQAA 4CLCB 3SW1A 3SH7A 3LR5A 1GHIA 3IWOA 2Y8HA 3IHBA 3GDIA 1MY8A 3NOUC 4OQIA 1YLTA 1AWIA 3G2YA 2PAVP 1K57A 4KZ3A 4ETXA 3KYZA 1K54A 3KYQA 3N8LA 5FI7A 3BJNA 5L07A 3GSGA 1YM1A 4EEPA 2O9BA 4KQQA 4KZ4A 3G4PA 1OTAA 2PU2A 2OOLA 4X56A 1LHYA 2WYXA 4X1LA 4F3LB 4GZBA 1CK3A 1YAXA 4HP9A 2JBFA 4NETA 3MSHA 3IHAA 3QP2A 4BBTA 5HDCA 5K5BA 4QB8A 3A0VA 4OOMA 4BWIA 5HL1A 2Y55A 4HJ6A 1L0EA 4IBXA 4GD6A 4EESA 1KE0A 3G2ZA 4LV0A 5G18A 4P6ZS 1PW8A 2R9WA 2G2WA 5G4YA 4GLQA 1L3LA 1IYSA 5DF7A 1YQSA 1OTEA 5HWVA 3CZDA 1GA9A 3GTCA 2OLUA 1LSWA 2ZM2A 2GDNA 5EUAA 3IH9A 3OCNA 2XFTA 1F2KA 4H6JA 4ME4A 4FSFA 2VJWA 4ZJ3A 1T1BA 2ZQ7A 2Z6DA 4DJ3A 1H0MA 1BLPA 3V3SA 4CLCC 4HNBA 3ZFZA 1ZKJA 4KQOA 4ID4A 3IXHA 4JXVA 4RYEA 2UV0E 4JF6A 1CEGA 3S7QA 1SZVA 5DFXA 3VOYA 2XEPA 2HDUA 3B33A 4F94A 3IWQA 4X69A 2K7SA 3HUNA 2JKRI 4LV3A 5AQAA 3ZG7B 3F1NB 3OLOA 3NOPC 2UWXA 4N9LA 3AGFA 4PM6A 4R0QA 4X55A 1DP8A 2PYPA 2Y2GA 3UPNA 4GDNA 1YLWA 4DE1A 2HP6A 4B9OA 2V0UA 1F5MA 1DY6A 5TJJA 2E8IA 2H10A 3IF6A 3C2WA 5HL6A 3OPHA 2ZQCA 3MBZA 1PWCA 2O9AA 1PFLA 3HBRA 1V9YA 5JYPA 1FIKA 1DJAA 4EW7A 4WMCA 3H7WB 3PXPA 3TW8A 3EGDC 4Y2FA 1K25A 2ZQ8A 4WZ5A 4P6BA 3MXSA 4D2OA 4OPZA 2FFYA 1UGUA 2WK0A 1H3QA 3A0SA 1MC0A 1MXOA 3UPOA 2K31A 2DNSA 4IBRA 2L4RA 2OSUA 2RL3A 2Z6CA 4G3KA 3T50A 4LLOB 3FC7A 4KZAA 1LSVA 2Y2QA 4X53A 1XJ3A 2O9CA 2XFSA 2V20A 4Y0UA 5JYOA 3QNCA 5HWTA 1KDWA 4GHIA 2VGJA 2O0YA 2ZOIA 2XRNA 1JVJA 2QKPA 5HD5A 5A8BA 4C3QA 2D01A 1YKDA 3E2KA 2WKQA 2V0WA 2HP5A 3PBOA 3ZG5A 1NZUA 4AFIA 4OQGA 3IXDA 1FR6A 1IYPA 2J8YA 3C7UA 1BZAA 4PAUA 2V1BA 2O99A 3IWIA 1P9RA 3IH8A 2WZXA 5KIZA 4FUWA 2JKFA 1MWSA 1K56D 5A93A 3NOTC 2Q0OA 2M7VA 2PRFA 5DTSA 1S67L 4K91A 3ZG0A 5J7EA 1OTIA 1IFQA 4C6YA 4IUKA 4P6ZM 1IELA 4G3WA 2P7JA 3HLDA 2QJ5A 3DTKA 3CPTA 4H8RA 1ES3A 2V8FA 3Q7VB 4PPRA 3UE0A 2PHYA 2VV6A 4R4SA 2P9VB 2CC1A 3IXBA 3LR3A 3W4PA 5I94A 1OJ5A 4OLDA 3BFFA 4FOFA 3VP0A 3CUEA 2J3WA 4Q0IA 2JKTM 4Y15A 3BM6A 3ZVWA 3SS4A 3EQUA 1LL8A 1W7FA 4HJ3A 3P09A 1ZG4A 1MZUA 5E2GA 4DRTA 2ZD8A 1ERQA 5CGSA 4YFMA 1XXMA 3HCYA 4JKTA 1VB6A 1YLPA 3D9YA 3HUOA 4EBPA 2WKHA 1DP6A 4WEKA 4EQ1A 2J7VA 3CWFA 3W2ZA 3P01A 4I5SA 4JGQA 4IHQA 3P7NA 2EWWA 4EERA 5DTTA 1NRFA 4I3AA 4ZAMA 2ZOHA 3F1OA 3O86A 2HZ5A 1NLYA 1P97A 4L9GA 3HVFA 3HJIA 3KYEA 2QMIA 3PHYA 3Q1FA 5CX7A 4K0WA 4EXOA 5TGFA 1K6RA 4KZ8A 4E3IA 2WUQA 3O88A 4OONA 2EWVA 1TS6A 4S2LA 3ZNYA 1IOUA 3A0RA 5EV0A 3T4LA 4I38A 1YSPA 3RJUA 3ZG9B 1PI5A 1G5UA 3OOVA 3V5MA 3A3DA 2ZC4B 2NUTC 3R4KA 2EX2A 5EM0A 5BOHA 3H7WA 1VM1A 4WLAA 3C7VA 1TVFA 3QP5A 2VZWA 3T12B 4WM9A 4H6JB 3PBTA 3I7JA 4I3JA 4O0PA 4DE2A 2HPBA 3S1YA 3GRJA 1UWPX 4OP5A 3KSFA 2ZMAA 4YOFA 1E25A 1NLZA 5FASA 4NXEA 5L09A 3LIAA 2OWHA 1XGJA 4GW9A 1K57C 2B5RA 1F9IA 4UA9A 1IYQA 1O7EA 1K54C 3UY6A 5AJGA 4ESPA 3MS6A 4B88A 3NHQA 5A90A 3E2LA 2ZC7A 3NJAA 4GD8A 2XA7S 4DXBA 3IF6B 2JHEA 2OLVA 5DVAA 4EQIA 1H8YA 2G2UA 1YMSA 2WKEA 1DP9A 1MWRA 3IXGA 4MN5A 5HSQA 4XXRA 2JKTI 2HJ9C 3VP3A 2WKIA 3GECA 4UAAA 2WGIA 1RP5A 2JN7A 2Y59A 3NC8A 5U47A 3T1RA 4OVDA 1JWPA 1SKOA 3LEQA 5HZHA 3IX4A 1K0KA 2WKPA 2BLSA 1IEMA 1XFNA 3GVBA 3H9WA 4WZ4A 4GHIB 5EM1A 3DWZA 1SHVA 4PM9A 1N9LA 3ZG8B 2W3EA 1ES2A 2KDKA 1LSXA 4KG6A 5LBRA 5HPIA 1NXYA 2KX6A 3ZYTA 1PYYA 3DTEA 3MQQA 1YLZA 1T1AA 3SS5A 4Q0JA 2XGNA 4Y3IA 3VP4A 4QWOA 1EROA 5TR7A 2GX5A 5AQ9A 1S4RA 1GA0A 1PWGA 2CMNA 3VE3A 3GMWA 1BUEA 4WBGA 1PRQA 3ICYA 1KVMA 1WYBA 3KO6A 4R3JA 3S7OA 2H0YA 4MN6A 3MZDA 1OTDA 2W1TA 5CTMA 3ISGA 1H8MA 1MPLA 4HI4A 5CGWA 5FI6A 5L10A 3IF6C 3VV4A 3LICA 2Q9NA 3CPTB 4LENA 2V1ZA 3NI9A 4NG2A 3K2NA 3MF0A 4MLLA 3UB9A 3LI9A 2LB9A 2JC7A 2WAFA 1YPRA 2PR5A 3UO9A 4WZ5C 1MKIA 2W27A 1K56A 2DRWA 1S1YA 5EVID 2ZC6B 3EGXC 5G4ZA 2EXAA 4LCMA 4Y5FA 4Y7PA 1IKGA 4S2KA 3Q7ZA 2MJ6A 1DJCA 3WS2A 2OV5A 3MXQA 2PBYA 4JXSA 3K3DA 4DDYA 2QJ7A 2BASA 3LCEA 4CQHA 2A24A 4MNRA 4HBTA 4N1XA 1K4FA 2QWSA 2X02A 2B02A 3SH9A 5IU1A 2Y79A 3HLWA 4S2JA 4U0XA 1BLSA 2B18A 3LY4A 5FEGA 3MMHA 5EPHA 4E3LA 2EX6A 2XA7M 3W8KA 5D3OA 4BMWA 1MKMA 4FH2A 4GDBA 1YLYA 4GNUA 4IVKA 4GS9B 1VEUB 3F1OB 4L0LA 1T18A 3FV7A 2R9XA 2AVXA 2Y4AA 1SDEA 1VETA 5AVFA 3VMAA 4D60A 4MN7A 2X01A 4PKYA 3KSGA 5FAPA 3BECA 1S0WA 4MMNA 4DJ2A 4QY5A 3BFDA 3G30A 4ETZA 4KUKA 2E8JA 3N7WA 1IKIA 3VE4A 3IT9A 4R1GA 3G31A 3HREA 1SDNA 4PMAA 5I5LA 5J4EA 1G6OA 4P0MA 2PDRA 3M2KA 4MCWA 5FQQA 2XD5A 4WN5A 2HJEA 2OAQ1 4XUXA 3CUEC 3OPRA 5GHXA 4EETB 5J3WA 3OPLA 5EVIB 4BBVA 3FKVA 2W1RA 1OMEA 1BLCA 2HP9A 3DW0A 1Q2PA 3LY3A 3F1PA 1BLHA 1BULA 2WGWA 2XSSA 4GJ4A 1ACFA 1D7EA 1XJ6A 1W5DA 2EFXA 4R4RA 3V50A 3QP4A 4E6XA 3NCKA 2I9VA 4IUHA 1M6KA 1GHPA 2WGVA 4E3JA 5HAQA 1SKFA 2P74A 3L9KA 1FOFA 3U2AA 4YNRA 5DF8A 3V67A 3OZHA 5TBMA 2BTFP 3OCLA 1FCMA 3O3VA 4HH3A 3LR4A 3C4OA 3ZQ5A 4HJ4A 3GQZA 3BLMA 4UA7A 1BSGA 1I2SA 5L2FA 4YINA 5GL9A 1HD8A 5EVEA 4QHCA 2PYRA 3N8RA 5FL3A 3PAEA 3GV9A 1SKOB 1TDGA 3D4FA 2M7UA 1OJGA 4A5RA 3A3EA 3TG9A 3WS4A 4EU0A 1Y4OA 1KDSA 3FYZA 4BLMA 1FCOA 3DAVA 1TS7A 3LGOA 4S2OA 2Y2IA 3T4JA 2Y2OA 2Y2KA 4G3VA 3MR0A 4R23A 5AQ7A 4KENB 5F6AA 3BFEA 1ESIA 1S66L 3S22A 1O07A 3PBSA 4ARZA 3PBRA 1NJ4A 3IS2A 1XJ4A 5F82A 2LB5A 3TSGA 2IWBA 3WS0A 1HLUP 3FPVA 2DCFA 4LFUA 3RXWA 3K3CA 5EVIC 2XR0A 1UWNX 5FEFA 3CJMA 2W3DA 4KG2A 1WA9A 2ACGA 4HHDA 2Y2HA 1TDLA 3TE8A 3MJQA 2QYBA 1I2WA 4O7DA 4ZRRA 4X25A 2WAEA 3A3IA 4WF0A 5KSHA 2W1TB 3IX3A 4OOYA 1XGIA 4KQRA 5HX9A 3LO7A 2W0NA 2BG1A 1Y28A 3BW6A 4HH2A 3VFFA 3PTEA 5M18A 4GS9A 1VEUA 3EQVA 4JXGA 4I39A 1S1ZA 3LIEA 3A3JA 3LR0A 2W3HA 1FQGA 2PR6A 2VGKA 5EOOA 1HVBA 4I3IA 3N6IA 5GHZA 5HDSA 3AGEA 2Y91A 1NYYA 4BL2A 4S2NA 3SZTA 1BYWA 3RFBA 4NKPA 4BD1A 4DDSA 4XUZA 4KZBA 5FQJA 1KGEA 1W63M 4HESA 2PU4A 4L9FA 3LIFA 1OT6A 4HY8A 4K08A 4RX2A 2A24B 4MEZA 1L0DA 4HEFA 3WRZA 4ZDXA 2J9PA 1G28A 3HLGA 5EFWA 1KGFA 1D06A 1XPBA 1ZG6A 5HAIA 1CI9A 3HLEA 5EVIA 2X71A 2P04A 3BRMA 5C5KA 5HW3A 1ESUA 5HDDA 2HF6A 4BL3A 1OT9A 4E3MA 3IX8A 5DKKA 1CF0A 2XQZA 4BBUA 3SH8A 4FCFA 1EI5A 3QNBA 4BENA 2ZLYA 3UPPA 3ZVTA 4OH0A 3MQ0A 1YLJA 2ZM8A 2IWDA 4E3KA 1VETB 2ZQDA 4Q8IA 1K4EA 2EA9A 3PAGA 3UE1A 5FDSA 2W3GA 3FG8A 2GZAA 4JPMA 5HAPA 2VLGA 4MDZA 4QPRA 1RGYA 1DJBA 4FTXA 2ZMVA 3WRTA 5DF9A 4FD8A 5CTNA 5HARA 3ITAA 1T19A 2JCHA 3Q07A 5GLAA 3TRCA 3MFDA 3IBRA 2J9OA 2WADA 1VQQA 3D72A 5GHYA 3IF5A 1GSWA 3MXRA 4S2IA 1CJFA 3N8SA 2ZL1A 3W4QA 4NK3A 4PKYG 3CITA 5F83A 3HLBA 1PWDA 5CHMA 3WWXA 4OQHA 4LV1A 5FA7A 1SCWA 1OPXA 1FCNA 4JBFA 3F1PB 2Q9MA 3MZFA 3G34A 2WGWB 4HOIA 2PT7A 1E3UD 3FKWA 3G6OA 5HD3A 4BD0A 1EW0A 1N9BA 1I5QA 4ZTKA 3JYIA 1ZC2A 5CRFA 4DE0A 3ZHHA 2NUPC 1ZHHB 1IYOA 4HP4A 1ODVA 1ZTUA 2EFUA 5CGXA 4LRYC 4S2PA 3W4OA 2YKFA 1WYCA 3QHYA 4WYYA 5TBMB 2QZ6A 2XF3A 1LL5A 4UEYA 3CAXA 2V2FF 5EECA 4QU3A 3UNWA 4Y0OA 3NULA 3NIAA 2B95A 3OC2A 4IVIA 1GHMA 3KX0X 4MBFA 5DTKA 1RCJA 5DJUA 1PIOA 5AVEA 4MBKA 3R7WA 3NBLA 3HLCA 4GCZA 3V3RA 3T4SA 1XKZA 2INWA 4KG5A 4KQDA 4JLFA 2L1MA 3BLSA 4DN0A 1K55C 4LRZE 2HDSA 1CEFA 1HTZA 2PBDP 3FPWA 1NYMA 3B3XA 3G35A 1G68A 5KZHA 3FWLA 2YKHA 4ARZB 4U0TA 1TEMA 3IS2B 3T1XA 3M6BA 1P0ZA 5E43A 4P85A 4M4XA 1MWUA 1ONHA 3EEAA 2JE5A 1Y54A
chains in the Genus database with same CATH topology
2P08A 1D7EA 1XJ6A 1NWZA 3BY9A 3UE3A 1DP6A 4WEKA 2L0WA 4EQ1A 2FH5A 4Q0HA 2I9VA 3KSIA 3CWFA 4IUHA 3W2ZA 3B42A 3P01A 4I5SA 2DMWA 4JGQA 3UB6A 4IHQA 3EWKA 2K2NA 2EWWA 3P7NA 4UQIM 4EERA 2PD8A 1LT0A 4I3AA 2W3FA 2ZOHA 3F1OA 2GJ3A 3TJZC 4YNRA 3U2AA 3S7PA 4OOLA 3PR6A 3V67A 1NLYA 2A2LA 5F5YA 1P97A 4L9GA 3HJIA 4R38A 3LFVA 2JKRM 5TBMA 4B93A 3T4OA 3VOLA 3OCLA 3HJKA 2PD7A 3PHYA 5CX7A 1V9ZA 4EXOA 3LYXA 4HH3A 3T4KA 3JVVA 3LR4A 3ZQ5A 4HJ4A 3KSHA 1GSVA 4XT2B 4LPZA 2EWVA 1TS6A 4WL9A 3E98A 1IOUA 2KLIA 2PYRA 3A0RA 5F68A 1X0OA 3T4LA 3IBJA 3MQOA 4I38A 4KUOA 1YSPA 5FL3A 3UMDA 2HV1A 3OOVA 3LIBA 2R78A 2NUTC 3R4KA 2M7UA 1OJGA 2VV8A 3E4PA 3H7WA 4NXGA 3BQAA 4CLCB 4WLAA 3SW1A 4JGOA 3LR5A 4EU0A 2WKRA 1TF1A 2VZWA 4R6LA 2Y8HA 3DBAA 3GDIA 4H6JB 3NOUC 1TS7A 3PBTA 5DJTA 3T4JA 4G3VA 3MR0A 4I3JA 4O0PA 5F6AA 2J80A 1UWPX 4ETXA 1S66L 3KSFA 3KYZA 5IT5A 1VHMA 3PBSA 4ARZA 3PBRA 4YOFA 3T4QA 1NLZA 3IS2A 3OBFA 1XJ4A 2LB5A 4NXEA 1GSXA 3KYQA 3LIAA 3BJNA 2OWHA 3FPVA 4GW9A 4EEPA 2O9BA 3K3CA 4NXBA 1F9IA 4O01A 1UWNX 2W3DA 1OTAA 2KOIA 5AJGA 2OOLA 3NHQA 1WA9A 4EEUA 3NJAA 4F3LB 4HHDA 1YAXA 4HP9A 3ULFA 2XA7S 2M1CA 1NRJA 4LRXC 1XFQA 3TE8A 2JHEA 2J3TD 3MJQA 2QYBA 3PBNA 1YSQA 4ZRRA 1T1CA 4BBTA 1DP9A 4WF0A 5KSHA 5HDCA 5K5BA 2W1TB 3A0VA 4OOMA 4BWIA 4YWZA 5IS1A 4HJ6A 4MN5A 5HSQA 3MFXA 4EESA 2JKTI 2W0NA 3BW6A 1Y28A 2HJ9C 4L9EA 4HH2A 4P6ZS 4XT2A 4GS9A 3GECA 5G4YA 3RH8B 3EQVA 4GLQA 4I39A 2JN7A 4IJGA 3H82B 1S1ZA 1OTEA 4WUJA 5HWVA 3LIEA 2XROA 2FZ0A 1LSWA 3LR0A 2W3HA 3LI8A 2ZBBA 2PR6A 5L8MA 4I3IA 4EUVA 5HZHA 5HDSA 3OCNA 4CLCA 3S7NA 2WKPA 1XFNA 1W63Q 3H9WA 4GHIB 1BYWA 4H6JA 4ME4A 4FSFA 2VJWA 4NKPA 3RFBA 1T1BA 2Z6DA 1N9LA 4DJ3A 1W63M 2W3EA 2KDKA 4CLCC 4HNBA 4L9FA 4KQOA 1LSXA 3LIFA 5LBRA 1OT6A 4HY8A 4K08A 5HPFA 2A24B 3UE6A 3S7QA 1TD5A 5HPIA 1XJ2A 5DFXA 2KX6A 2VEAA 3ZYTA 1G28A 5EFWA 1KOUA 3B33A 3MQQA 1T1AA 1D06A 2K7SA 4O8GA 4Q0JA 4Y3IA 2JKRI 3F1NB 3OLOA 3NOPC 2GX5A 1S4RA 2VGLS 1DP8A 2CMNA 1TS8A 2PYPA 3VE3A 3BWLA 3UB8A 5MC7A 2P04A 2HGVA 5C5KA 3JVUA 4B9OA 2V0UA 1F5MA 3ICYA 4R3AA 4F3LA 5HDDA 5TJJA 1N9OA 3KO6A 3PBQA 3UMEA 2HF6A 5HL6A 1OT9A 3C2WA 5DKKA 3S7OA 4WEJA 3BY8A 2O9AA 4UQIS 4BBUA 4MN6A 3E0YA 1V9YA 4JGRA 1N9NA 1OTDA 2W1TA 4EW7A 3MQ0A 4JGPA 1H8MA 3H7WB 4HI4A 3PXPA 3TW8A 3EGDC 4Y2FA 2VA0A 5DKLA 3VV4A 2EA9A 3LICA 3EOIA 4BJPA 1UGUA 2W3GA 3FG8A 2GZAA 2IA2A 1H3QA 3K2NA 3MF0A 3A0SA 2VLGA 1MC0A 2K31A 3UB9A 4MDZA 4HIAA 3LI9A 4QPRA 3UB7A 2LB9A 2ZMVA 2L4RA 2Z6CA 3C8CA 3CI6A 4G3KA 2PR5A 5DF9A 5HWWA 3T50A 4LLOB 3FC7A 3R7WB 1LSVA 2W27A 1T19A 1XJ3A 2O9CA 2V9AA 3TRCA 1S1YA 3IBRA 3PYPA 3EGXC 5G4ZA 3D72A 4Y5FA 5HWTA 1GSWA 4GHIA 2MJ6A 2O0YA 2OWJA 2ZOIA 2XRNA 3MXQA 3CITA 4PKYG 2QKPA 5HD5A 5A8BA 2H28A 2VV7A 2VX8A 3K3DA 2D01A 2QJ7A 1YKDA 2BASA 1OPXA 2VKSA 2WKQA 2V0WA 3PBOA 4CQHA 2A24A 3F1PB 5DFYA 1S4SA 2QWSA 2B02A 4CLCE 4HOIA 4AFIA 5IU1A 3EEHA 2Y79A 4Z1WA 2PT7A 4DMZA 3O5YA 2B18A 4PAUA 2V1BA 3G6OA 3F1NA 3MMHA 2O99A 1EW0A 5HD3A 3E4OA 3RTYA 1JNUA 4R70A 2XA7M 4BMWA 1P9RA 1MKMA 2NUPC 5KIZA 1ZHHB 4HP4A 1ODVA 4HQAA 4GS9B 3LUQA 1ZTUA 3NOTC 3F1OB 2M7VA 4L0LA 1S67L 4LRYC 2YKFA 1T18A 3C30A 5J7EA 1OTIA 5TBMB 1IFQA 1STZA 4IUKA 4P6ZM 4UEYA 3CAXA 4G3WA 4RQ9A 2P7JA 5AVFA 2QJ5A 4MN7A 2G7UA 2OAP1 4PKYA 3OC2A 3KSGA 4MMNA 4CLCD 4DJ2A 3BQ8A 4NEED 2PHYA 2VV6A 3C38A 3KX0X 3LR3A 2D02A 4ETZA 4KUKA 2J3TC 3VE4A 1OJ5A 1OTBA 1DRMA 5DJUA 5AVEA 3D3OA 3R7WA 3E4QA 4FOFA 4GCZA 3CUEA 1P9WA 4PHTA 2J3WA 4Q0IA 2JKTM 5I5LA 3T4SA 5J4EA 1G6OA 2INWA 2PDRA 4MCWA 4KQDA 4WN5A 2L1MA 3EQUA 3T4TA 4II7A 4DN0A 1LL8A 1F98A 4NXFA 2HJEA 4LRZE 2OAQ1 3FPWA 3LIDA 4WELA 3CUEC 4HJ3A 3H82A 1MZUA 4E04A 4EETB 5J3WA 3CLOA 4BBVA 3B47A 2QHKA 2YKHA 2V1AA 4ARZB 2W1RA 2GNXA 3IS2B 3HCYA 1P0ZA 3F1PA 1TS0A 2ZMFA 5F69A 1VB6A 4M4XA 2XSSA 4GJ4A 2VGLM 3EEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7E A;  1XJ6 A;  1NWZ A;  3BY9 A;  1DP6 A;  2L0W A;  4EQ1 A;  2I9V A;  3CWF A;  4I5S A;  4JGQ A;  3UB6 A;  3EWK A;  3P7N A;  4EER A;  2PD8 A;  1LT0 A;  4I3A A;  2ZOH A;  3F1O A;  2GJ3 A;  5F5Y A;  1P97 A;  4L9G A;  3HJI A;  4R38 A;  5TBM A;  3VOL A;  3HJK A;  2PD7 A;  3PHY A;  1V9Z A;  4EXO A;  3LYX A;  4HH3 A;  3ZQ5 A;  4HJ4 A;  1GSV A;  4XT2 B;  4LPZ A;  1TS6 A;  4WL9 A;  2PYR A;  3A0R A;  5F68 A;  1X0O A;  4I38 A;  3MQO A;  4KUO A;  3UMD A;  2HV1 A;  3LIB A;  2R78 A;  1OJG A;  2VV8 A;  3E4P A;  3H7W A;  4NXG A;  4WLA A;  3SW1 A;  4JGO A;  2WKR A;  4R6L A;  3GDI A;  4H6J B;  3NOU C;  1TS7 A;  5DJT A;  3MR0 A;  4I3J A;  5F6A A;  2J80 A;  1UWP X;  1S66 L;  3IS2 A;  1XJ4 A;  4NXE A;  1GSX A;  3LIA A;  2OWH A;  4GW9 A;  4EEP A;  3K3C A;  4NXB A;  1F9I A;  1UWN X;  1OTA A;  2OOL A;  3NHQ A;  1WA9 A;  4EEU A;  3NJA A;  4F3L B;  4HHD A;  4HP9 A;  3ULF A;  2M1C A;  4LRX C;  1XFQ A;  2JHE A;  3MJQ A;  1T1C A;  4BBT A;  1DP9 A;  4WF0 A;  5HDC A;  3A0V A;  4YWZ A;  5IS1 A;  4HJ6 A;  4MN5 A;  5HSQ A;  3MFX A;  4EES A;  2W0N A;  1Y28 A;  4L9E A;  4HH2 A;  4XT2 A;  4GS9 A;  3GEC A;  5G4Y A;  3RH8 B;  4I39 A;  2JN7 A;  3H82 B;  1S1Z A;  1OTE A;  4WUJ A;  5HWV A;  3LIE A;  1LSW A;  3LI8 A;  2ZBB A;  2PR6 A;  4I3I A;  5HZH A;  5HDS A;  2WKP A;  1XFN A;  3H9W A;  4GHI B;  1BYW A;  4H6J A;  1T1B A;  2Z6D A;  1N9L A;  4DJ3 A;  2KDK A;  4HNB A;  4L9F A;  1LSX A;  3LIF A;  1OT6 A;  4HY8 A;  4K08 A;  2A24 B;  3UE6 A;  1XJ2 A;  2KX6 A;  2VEA A;  1G28 A;  5EFW A;  1KOU A;  3B33 A;  3MQQ A;  1T1A A;  1D06 A;  2K7S A;  3F1N B;  3OLO A;  3NOP C;  1S4R A;  1DP8 A;  2CMN A;  1TS8 A;  2PYP A;  3VE3 A;  3BWL A;  3UB8 A;  4B9O A;  2V0U A;  3ICY A;  4R3A A;  4F3L A;  5HDD A;  1N9O A;  3UME A;  1OT9 A;  3C2W A;  5DKK A;  3BY8 A;  4BBU A;  4MN6 A;  1V9Y A;  4JGR A;  1N9N A;  1OTD A;  4EW7 A;  4JGP A;  3H7W B;  4HI4 A;  5DKL A;  2EA9 A;  3LIC A;  1UGU A;  3FG8 A;  3A0S A;  2VLG A;  3UB9 A;  4HIA A;  3LI9 A;  3UB7 A;  2L4R A;  2Z6C A;  3C8C A;  2PR5 A;  5HWW A;  3T50 A;  4LLO B;  3FC7 A;  1LSV A;  2W27 A;  1T19 A;  1XJ3 A;  2V9A A;  1S1Y A;  3IBR A;  3PYP A;  5G4Z A;  3D72 A;  5HWT A;  1GSW A;  4GHI A;  2OWJ A;  2ZOI A;  3MXQ A;  4PKY G;  2QKP A;  5HD5 A;  5A8B A;  2H28 A;  2VV7 A;  3K3D A;  2D01 A;  2QJ7 A;  2BAS A;  2WKQ A;  2V0W A;  2A24 A;  3F1P B;  1S4S A;  2QWS A;  2B02 A;  4HOI A;  5IU1 A;  3EEH A;  2V1B A;  3G6O A;  3F1N A;  5HD3 A;  1EW0 A;  3E4O A;  3RTY A;  1JNU A;  4R70 A;  5KIZ A;  4HP4 A;  1ODV A;  4HQA A;  4GS9 B;  3LUQ A;  3NOT C;  3F1O B;  1S67 L;  4LRY C;  2YKF A;  1T18 A;  5J7E A;  1OTI A;  5TBM B;  3CAX A;  4RQ9 A;  2P7J A;  5AVF A;  2QJ5 A;  4PKY A;  4DJ2 A;  2PHY A;  2VV6 A;  3KX0 X;  2D02 A;  4KUK A;  3VE4 A;  1OJ5 A;  1OTB A;  1DRM A;  5DJU A;  5AVE A;  3E4Q A;  4GCZ A;  5I5L A;  5J4E A;  2INW A;  2PDR A;  4KQD A;  4WN5 A;  2L1M A;  1F98 A;  1LL8 A;  4NXF A;  4LRZ E;  3LID A;  4HJ3 A;  3H82 A;  1MZU A;  4E04 A;  4EET B;  5J3W A;  3CLO A;  4BBV A;  2QHK A;  2YKH A;  2V1A A;  3IS2 B;  1P0Z A;  3F1P A;  1TS0 A;  5F69 A;  1VB6 A;  4M4X A; 
#chains in the Genus database with same CATH topology
 2P08 A;  5CEC A;  1NWZ A;  3UE3 A;  3ZNT A;  4GKU A;  4ZJ1 A;  2FH5 A;  3CG5 A;  3VP2 A;  3L7H A;  4DKI A;  3B42 A;  4R3B A;  2DMW A;  2XH9 A;  1K6S A;  4PM7 A;  3UB6 A;  1Z09 A;  4N9K A;  2K2N A;  2HDQ A;  3GR2 A;  3AGD A;  2GJ3 A;  4ZJ2 A;  2RCX A;  3TJZ C;  3S7P A;  4OOL A;  1QME A;  4U3T A;  5F5Y A;  2V8C A;  4R38 A;  4PM8 A;  3T4O A;  3VOL A;  1JTG A;  1L0G A;  4EBN A;  5M19 A;  1FSW A;  3Q81 A;  4QD4 A;  3T4K A;  4PM5 A;  5M1A A;  3G32 A;  3KSH A;  4KZ9 A;  3CMZ A;  1JWZ A;  4WL9 A;  4OP8 A;  5F1F A;  3E98 A;  4M3K A;  3ZGA B;  4E3N A;  5CXW A;  1LLB A;  5F68 A;  1ES4 A;  1X0O A;  4UA6 A;  3IBJ A;  4KUO A;  3U4L P;  3ZCZ A;  3UDF A;  5J8X A;  4RA7 A;  2ZQA A;  4EUZ A;  5KSC A;  3E4P A;  1XP4 A;  4Y17 A;  4NXG A;  1XA7 A;  4JGO A;  2WKR A;  3M2J A;  1TF1 A;  2C6W B;  4R6L A;  1K38 A;  3UDX A;  3DBA A;  3BFC A;  1BTL A;  5DJT A;  5FDH A;  4EV4 A;  3SS3 A;  2J80 A;  1KVL A;  3UB5 P;  1K55 A;  5IT5 A;  1VHM A;  1L2S A;  3T4Q A;  4HBU A;  2HDR A;  3OBF A;  4DXC A;  1GSX A;  4CPK A;  4UHU A;  4NXB A;  5FQ9 A;  4O01 A;  2I72 A;  2A3U A;  2KOI A;  4K0X A;  5EVL A;  1LL9 A;  4EEU A;  3OPP A;  3VSK A;  3ULF A;  3T1S A;  2M1C A;  1NRJ A;  2EX8 A;  4LRX C;  1XFQ A;  2J3T D;  4QJG A;  4OKP A;  2XDM A;  3PBN A;  1YSQ A;  3C5A A;  1T1C A;  4DE3 A;  2Y2L A;  3MKF A;  4YWZ A;  1FIL A;  5A91 A;  4FH4 A;  5IS1 A;  1HZO A;  3MFX A;  1NY0 A;  1PNE A;  3S4X A;  4L9E A;  4E6W A;  5IHV A;  4XT2 A;  1D1J A;  5CHJ A;  3RH8 B;  3BEB A;  4N1H A;  5GLB A;  5CER A;  1W8Y A;  3VOZ A;  4IJG A;  3H82 B;  4JXW A;  4WUJ A;  3NDE A;  2XRO A;  2FZ0 A;  1Z6F A;  3UDI A;  3LI8 A;  2ZBB A;  5L8M A;  3A3F A;  2EX9 A;  1YMX A;  4EUV A;  4CLC A;  3S7N A;  3ITB A;  4RVA A;  1W63 Q;  1W79 A;  5AQB A;  2ZQ9 A;  4JF5 A;  1U60 A;  2Y2M A;  1KE4 A;  2ZL1 B;  3V39 A;  3VFH A;  1H5X A;  4S2N C;  4KZ5 A;  5HPF A;  3UE6 A;  1TD5 A;  1XJ2 A;  1N4O A;  2VEA A;  3QP1 A;  1FR1 A;  1KOU A;  4P87 A;  5CED A;  4O8G A;  4OPQ A;  1J9M A;  5FQK A;  3T1Q B;  2VGL S;  1TS8 A;  3BWL A;  1YT4 A;  2XLN A;  3UB8 A;  5MC7 A;  2HGV A;  3JVU A;  4EBL A;  4R3A A;  4F3L A;  1WE4 A;  1N9O A;  3PBQ A;  3UME A;  3O87 A;  3HLF A;  4X1M A;  4WEJ A;  3BFG A;  3BY8 A;  4UQI S;  5FAO A;  1M40 A;  2C5W B;  3E0Y A;  4JGR A;  1N9N A;  1RGZ A;  4JGP A;  3P98 A;  4Y0T A;  2VA0 A;  3QP8 A;  5DKL A;  3BYD A;  3EOI A;  4BJP A;  3UN7 A;  2IA2 A;  1E3U A;  1ALQ A;  4RX3 A;  2Y2P A;  3QP6 A;  1ERM A;  5EE8 A;  4HIA A;  3UB7 A;  3C8C A;  3CI6 A;  1JWV A;  5HWW A;  3Q82 A;  4LGW A;  2Z2L B;  1J3W A;  3R7W B;  3MZE A;  1A0K A;  4C75 A;  2V9A A;  1CI8 A;  4EWF A;  4OPR A;  3PYP A;  1BT5 A;  1PI4 A;  4GOG A;  3SOI A;  5FSR A;  4DF6 A;  3ZDJ A;  2OWJ A;  3DTM A;  5GLC A;  2H28 A;  4IED A;  4X68 A;  2VV7 A;  2VX8 A;  3C4P A;  1XX2 A;  1ES5 A;  3CHW P;  2VKS A;  4WMC D;  1FSY A;  5DFY A;  1S4S A;  4CLC E;  3NEC A;  3EEH A;  4Z1W A;  2ZJ9 A;  5FQI A;  4DMZ A;  3O5Y A;  1NZO A;  3LEZ A;  3F1N A;  3E4O A;  3RTY A;  1AXB A;  1JNU A;  4R70 A;  4OPY A;  4OQ0 A;  2XD1 A;  4BQM A;  1JTD A;  4N92 A;  4HQA A;  2XK1 A;  4MBH A;  3LUQ A;  2FFF B;  3FZC A;  5GLD A;  3C30 A;  5FQM A;  2ZC3 B;  4LV2 A;  4OLG A;  1STZ A;  3M6H A;  1KGG A;  3MKE A;  2ZM0 A;  2Y2N A;  4RQ9 A;  5A92 A;  4B4X A;  5FAQ A;  3NY4 A;  1QMF A;  2G7U A;  2OAP 1;  3IQA A;  5CEB A;  4CLC D;  5HFO A;  3BQ8 A;  4NEE D;  5E2F A;  3C38 A;  1W8Q A;  4Y13 A;  2D02 A;  3N4I A;  3HUM A;  3WS5 A;  2J3T C;  1L0F A;  1OTB A;  1DRM A;  5KMW A;  4X6T A;  4GB7 A;  3D3O A;  3E4Q A;  3VSL A;  1P9W A;  4PHT A;  2H5S A;  2EXB A;  2Z2M B;  3T4T A;  4II7 A;  1F98 A;  4NXF A;  2QPN A;  1E4D A;  3LID A;  4WEL A;  1PW1 A;  3H82 A;  4E04 A;  4ZBE A;  2IWC A;  4B4Z A;  3CLO A;  4KZ6 A;  4KZ7 A;  3B47 A;  2QHK A;  2V1A A;  1LI0 A;  1CQA A;  2GNX A;  4CJN A;  1TS0 A;  2ZMF A;  5F69 A;  1H8Z A;  5F1G A;  2WZZ A;  2VGL M;  1GCE A;  3BY9 A;  2L0W A;  5E2H A;  1PZP A;  1Q2Q A;  1XA1 A;  4Q0H A;  3KSI A;  4QY6 A;  2VK3 A;  3DTI A;  3NDG A;  1EWZ A;  5E2E A;  3EWK A;  4UQI M;  2JKG A;  3HL9 A;  2PD8 A;  1LT0 A;  1MBL A;  2W3F A;  3PR6 A;  3WS1 A;  2A2L A;  1LI9 A;  2H0T A;  5FAT A;  2ZC5 B;  3LFV A;  2JKR M;  3VP1 A;  4B93 A;  3TOI A;  4GN2 A;  3HJK A;  2PD7 A;  4E3O A;  1V9Z A;  3LYX A;  3RXX A;  4S2M A;  1C3B A;  3JVV A;  3DWK A;  1GSV A;  4XT2 B;  5EOE A;  4LPZ A;  2Y2J A;  3Q7V A;  5CHU A;  1S6R A;  2A49 A;  2KLI A;  5TFQ A;  2P9V A;  1G6A A;  1PZO A;  3MQO A;  3UMD A;  5FI2 A;  2HV1 A;  1KE3 A;  3JPU A;  3LIB A;  1ONG A;  1MWT A;  2R78 A;  4JF4 A;  4Z9Q A;  2VV8 A;  4LCL A;  3BQA A;  4CLC B;  3SW1 A;  3SH7 A;  3LR5 A;  1GHI A;  3IWO A;  2Y8H A;  3IHB A;  3GDI A;  1MY8 A;  3NOU C;  4OQI A;  1YLT A;  1AWI A;  3G2Y A;  2PAV P;  1K57 A;  4KZ3 A;  4ETX A;  3KYZ A;  1K54 A;  3KYQ A;  3N8L A;  5FI7 A;  3BJN A;  5L07 A;  3GSG A;  1YM1 A;  4EEP A;  2O9B A;  4KQQ A;  4KZ4 A;  3G4P A;  1OTA A;  2PU2 A;  2OOL A;  4X56 A;  1LHY A;  2WYX A;  4X1L A;  4F3L B;  4GZB A;  1CK3 A;  1YAX A;  4HP9 A;  2JBF A;  4NET A;  3MSH A;  3IHA A;  3QP2 A;  4BBT A;  5HDC A;  5K5B A;  4QB8 A;  3A0V A;  4OOM A;  4BWI A;  5HL1 A;  2Y55 A;  4HJ6 A;  1L0E A;  4IBX A;  4GD6 A;  4EES A;  1KE0 A;  3G2Z A;  4LV0 A;  5G18 A;  4P6Z S;  1PW8 A;  2R9W A;  2G2W A;  5G4Y A;  4GLQ A;  1L3L A;  1IYS A;  5DF7 A;  1YQS A;  1OTE A;  5HWV A;  3CZD A;  1GA9 A;  3GTC A;  2OLU A;  1LSW A;  2ZM2 A;  2GDN A;  5EUA A;  3IH9 A;  3OCN A;  2XFT A;  1F2K A;  4H6J A;  4ME4 A;  4FSF A;  2VJW A;  4ZJ3 A;  1T1B A;  2ZQ7 A;  2Z6D A;  4DJ3 A;  1H0M A;  1BLP A;  3V3S A;  4CLC C;  4HNB A;  3ZFZ A;  1ZKJ A;  4KQO A;  4ID4 A;  3IXH A;  4JXV A;  4RYE A;  2UV0 E;  4JF6 A;  1CEG A;  3S7Q A;  1SZV A;  5DFX A;  3VOY A;  2XEP A;  2HDU A;  3B33 A;  4F94 A;  3IWQ A;  4X69 A;  2K7S A;  3HUN A;  2JKR I;  4LV3 A;  5AQA A;  3ZG7 B;  3F1N B;  3OLO A;  3NOP C;  2UWX A;  4N9L A;  3AGF A;  4PM6 A;  4R0Q A;  4X55 A;  1DP8 A;  2PYP A;  2Y2G A;  3UPN A;  4GDN A;  1YLW A;  4DE1 A;  2HP6 A;  4B9O A;  2V0U A;  1F5M A;  1DY6 A;  5TJJ A;  2E8I A;  2H10 A;  3IF6 A;  3C2W A;  5HL6 A;  3OPH A;  2ZQC A;  3MBZ A;  1PWC A;  2O9A A;  1PFL A;  3HBR A;  1V9Y A;  5JYP A;  1FIK A;  1DJA A;  4EW7 A;  4WMC A;  3H7W B;  3PXP A;  3TW8 A;  3EGD C;  4Y2F A;  1K25 A;  2ZQ8 A;  4WZ5 A;  4P6B A;  3MXS A;  4D2O A;  4OPZ A;  2FFY A;  1UGU A;  2WK0 A;  1H3Q A;  3A0S A;  1MC0 A;  1MXO A;  3UPO A;  2K31 A;  2DNS A;  4IBR A;  2L4R A;  2OSU A;  2RL3 A;  2Z6C A;  4G3K A;  3T50 A;  4LLO B;  3FC7 A;  4KZA A;  1LSV A;  2Y2Q A;  4X53 A;  1XJ3 A;  2O9C A;  2XFS A;  2V20 A;  4Y0U A;  5JYO A;  3QNC A;  5HWT A;  1KDW A;  4GHI A;  2VGJ A;  2O0Y A;  2ZOI A;  2XRN A;  1JVJ A;  2QKP A;  5HD5 A;  5A8B A;  4C3Q A;  2D01 A;  1YKD A;  3E2K A;  2WKQ A;  2V0W A;  2HP5 A;  3PBO A;  3ZG5 A;  1NZU A;  4AFI A;  4OQG A;  3IXD A;  1FR6 A;  1IYP A;  2J8Y A;  3C7U A;  1BZA A;  4PAU A;  2V1B A;  2O99 A;  3IWI A;  1P9R A;  3IH8 A;  2WZX A;  5KIZ A;  4FUW A;  2JKF A;  1MWS A;  1K56 D;  5A93 A;  3NOT C;  2Q0O A;  2M7V A;  2PRF A;  5DTS A;  1S67 L;  4K91 A;  3ZG0 A;  5J7E A;  1OTI A;  1IFQ A;  4C6Y A;  4IUK A;  4P6Z M;  1IEL A;  4G3W A;  2P7J A;  3HLD A;  2QJ5 A;  3DTK A;  3CPT A;  4H8R A;  1ES3 A;  2V8F A;  3Q7V B;  4PPR A;  3UE0 A;  2PHY A;  2VV6 A;  4R4S A;  2P9V B;  2CC1 A;  3IXB A;  3LR3 A;  3W4P A;  5I94 A;  1OJ5 A;  4OLD A;  3BFF A;  4FOF A;  3VP0 A;  3CUE A;  2J3W A;  4Q0I A;  2JKT M;  4Y15 A;  3BM6 A;  3ZVW A;  3SS4 A;  3EQU A;  1LL8 A;  1W7F A;  4HJ3 A;  3P09 A;  1ZG4 A;  1MZU A;  5E2G A;  4DRT A;  2ZD8 A;  1ERQ A;  5CGS A;  4YFM A;  1XXM A;  3HCY A;  4JKT A;  1VB6 A;  1YLP A;  3D9Y A;  3HUO A;  4EBP A;  2WKH A;  1DP6 A;  4WEK A;  4EQ1 A;  2J7V A;  3CWF A;  3W2Z A;  3P01 A;  4I5S A;  4JGQ A;  4IHQ A;  3P7N A;  2EWW A;  4EER A;  5DTT A;  1NRF A;  4I3A A;  4ZAM A;  2ZOH A;  3F1O A;  3O86 A;  2HZ5 A;  1NLY A;  1P97 A;  4L9G A;  3HVF A;  3HJI A;  3KYE A;  2QMI A;  3PHY A;  3Q1F A;  5CX7 A;  4K0W A;  4EXO A;  5TGF A;  1K6R A;  4KZ8 A;  4E3I A;  2WUQ A;  3O88 A;  4OON A;  2EWV A;  1TS6 A;  4S2L A;  3ZNY A;  1IOU A;  3A0R A;  5EV0 A;  3T4L A;  4I38 A;  1YSP A;  3RJU A;  3ZG9 B;  1PI5 A;  1G5U A;  3OOV A;  3V5M A;  3A3D A;  2ZC4 B;  2NUT C;  3R4K A;  2EX2 A;  5EM0 A;  5BOH A;  3H7W A;  1VM1 A;  4WLA A;  3C7V A;  1TVF A;  3QP5 A;  2VZW A;  3T12 B;  4WM9 A;  4H6J B;  3PBT A;  3I7J A;  4I3J A;  4O0P A;  4DE2 A;  2HPB A;  3S1Y A;  3GRJ A;  1UWP X;  4OP5 A;  3KSF A;  2ZMA A;  4YOF A;  1E25 A;  1NLZ A;  5FAS A;  4NXE A;  5L09 A;  3LIA A;  2OWH A;  1XGJ A;  4GW9 A;  1K57 C;  2B5R A;  1F9I A;  4UA9 A;  1IYQ A;  1O7E A;  1K54 C;  3UY6 A;  5AJG A;  4ESP A;  3MS6 A;  4B88 A;  3NHQ A;  5A90 A;  3E2L A;  2ZC7 A;  3NJA A;  4GD8 A;  2XA7 S;  4DXB A;  3IF6 B;  2JHE A;  2OLV A;  5DVA A;  4EQI A;  1H8Y A;  2G2U A;  1YMS A;  2WKE A;  1DP9 A;  1MWR A;  3IXG A;  4MN5 A;  5HSQ A;  4XXR A;  2JKT I;  2HJ9 C;  3VP3 A;  2WKI A;  3GEC A;  4UAA A;  2WGI A;  1RP5 A;  2JN7 A;  2Y59 A;  3NC8 A;  5U47 A;  3T1R A;  4OVD A;  1JWP A;  1SKO A;  3LEQ A;  5HZH A;  3IX4 A;  1K0K A;  2WKP A;  2BLS A;  1IEM A;  1XFN A;  3GVB A;  3H9W A;  4WZ4 A;  4GHI B;  5EM1 A;  3DWZ A;  1SHV A;  4PM9 A;  1N9L A;  3ZG8 B;  2W3E A;  1ES2 A;  2KDK A;  1LSX A;  4KG6 A;  5LBR A;  5HPI A;  1NXY A;  2KX6 A;  3ZYT A;  1PYY A;  3DTE A;  3MQQ A;  1YLZ A;  1T1A A;  3SS5 A;  4Q0J A;  2XGN A;  4Y3I A;  3VP4 A;  4QWO A;  1ERO A;  5TR7 A;  2GX5 A;  5AQ9 A;  1S4R A;  1GA0 A;  1PWG A;  2CMN A;  3VE3 A;  3GMW A;  1BUE A;  4WBG A;  1PRQ A;  3ICY A;  1KVM A;  1WYB A;  3KO6 A;  4R3J A;  3S7O A;  2H0Y A;  4MN6 A;  3MZD A;  1OTD A;  2W1T A;  5CTM A;  3ISG A;  1H8M A;  1MPL A;  4HI4 A;  5CGW A;  5FI6 A;  5L10 A;  3IF6 C;  3VV4 A;  3LIC A;  2Q9N A;  3CPT B;  4LEN A;  2V1Z A;  3NI9 A;  4NG2 A;  3K2N A;  3MF0 A;  4MLL A;  3UB9 A;  3LI9 A;  2LB9 A;  2JC7 A;  2WAF A;  1YPR A;  2PR5 A;  3UO9 A;  4WZ5 C;  1MKI A;  2W27 A;  1K56 A;  2DRW A;  1S1Y A;  5EVI D;  2ZC6 B;  3EGX C;  5G4Z A;  2EXA A;  4LCM A;  4Y5F A;  4Y7P A;  1IKG A;  4S2K A;  3Q7Z A;  2MJ6 A;  1DJC A;  3WS2 A;  2OV5 A;  3MXQ A;  2PBY A;  4JXS A;  3K3D A;  4DDY A;  2QJ7 A;  2BAS A;  3LCE A;  4CQH A;  2A24 A;  4MNR A;  4HBT A;  4N1X A;  1K4F A;  2QWS A;  2X02 A;  2B02 A;  3SH9 A;  5IU1 A;  2Y79 A;  3HLW A;  4S2J A;  4U0X A;  1BLS A;  2B18 A;  3LY4 A;  5FEG A;  3MMH A;  5EPH A;  4E3L A;  2EX6 A;  2XA7 M;  3W8K A;  5D3O A;  4BMW A;  1MKM A;  4FH2 A;  4GDB A;  1YLY A;  4GNU A;  4IVK A;  4GS9 B;  1VEU B;  3F1O B;  4L0L A;  1T18 A;  3FV7 A;  2R9X A;  2AVX A;  2Y4A A;  1SDE A;  1VET A;  5AVF A;  3VMA A;  4D60 A;  4MN7 A;  2X01 A;  4PKY A;  3KSG A;  5FAP A;  3BEC A;  1S0W A;  4MMN A;  4DJ2 A;  4QY5 A;  3BFD A;  3G30 A;  4ETZ A;  4KUK A;  2E8J A;  3N7W A;  1IKI A;  3VE4 A;  3IT9 A;  4R1G A;  3G31 A;  3HRE A;  1SDN A;  4PMA A;  5I5L A;  5J4E A;  1G6O A;  4P0M A;  2PDR A;  3M2K A;  4MCW A;  5FQQ A;  2XD5 A;  4WN5 A;  2HJE A;  2OAQ 1;  4XUX A;  3CUE C;  3OPR A;  5GHX A;  4EET B;  5J3W A;  3OPL A;  5EVI B;  4BBV A;  3FKV A;  2W1R A;  1OME A;  1BLC A;  2HP9 A;  3DW0 A;  1Q2P A;  3LY3 A;  3F1P A;  1BLH A;  1BUL A;  2WGW A;  2XSS A;  4GJ4 A;  1ACF A;  1D7E A;  1XJ6 A;  1W5D A;  2EFX A;  4R4R A;  3V50 A;  3QP4 A;  4E6X A;  3NCK A;  2I9V A;  4IUH A;  1M6K A;  1GHP A;  2WGV A;  4E3J A;  5HAQ A;  1SKF A;  2P74 A;  3L9K A;  1FOF A;  3U2A A;  4YNR A;  5DF8 A;  3V67 A;  3OZH A;  5TBM A;  2BTF P;  3OCL A;  1FCM A;  3O3V A;  4HH3 A;  3LR4 A;  3C4O A;  3ZQ5 A;  4HJ4 A;  3GQZ A;  3BLM A;  4UA7 A;  1BSG A;  1I2S A;  5L2F A;  4YIN A;  5GL9 A;  1HD8 A;  5EVE A;  4QHC A;  2PYR A;  3N8R A;  5FL3 A;  3PAE A;  3GV9 A;  1SKO B;  1TDG A;  3D4F A;  2M7U A;  1OJG A;  4A5R A;  3A3E A;  3TG9 A;  3WS4 A;  4EU0 A;  1Y4O A;  1KDS A;  3FYZ A;  4BLM A;  1FCO A;  3DAV A;  1TS7 A;  3LGO A;  4S2O A;  2Y2I A;  3T4J A;  2Y2O A;  2Y2K A;  4G3V A;  3MR0 A;  4R23 A;  5AQ7 A;  4KEN B;  5F6A A;  3BFE A;  1ESI A;  1S66 L;  3S22 A;  1O07 A;  3PBS A;  4ARZ A;  3PBR A;  1NJ4 A;  3IS2 A;  1XJ4 A;  5F82 A;  2LB5 A;  3TSG A;  2IWB A;  3WS0 A;  1HLU P;  3FPV A;  2DCF A;  4LFU A;  3RXW A;  3K3C A;  5EVI C;  2XR0 A;  1UWN X;  5FEF A;  3CJM A;  2W3D A;  4KG2 A;  1WA9 A;  2ACG A;  4HHD A;  2Y2H A;  1TDL A;  3TE8 A;  3MJQ A;  2QYB A;  1I2W A;  4O7D A;  4ZRR A;  4X25 A;  2WAE A;  3A3I A;  4WF0 A;  5KSH A;  2W1T B;  3IX3 A;  4OOY A;  1XGI A;  4KQR A;  5HX9 A;  3LO7 A;  2W0N A;  2BG1 A;  1Y28 A;  3BW6 A;  4HH2 A;  3VFF A;  3PTE A;  5M18 A;  4GS9 A;  1VEU A;  3EQV A;  4JXG A;  4I39 A;  1S1Z A;  3LIE A;  3A3J A;  3LR0 A;  2W3H A;  1FQG A;  2PR6 A;  2VGK A;  5EOO A;  1HVB A;  4I3I A;  3N6I A;  5GHZ A;  5HDS A;  3AGE A;  2Y91 A;  1NYY A;  4BL2 A;  4S2N A;  3SZT A;  1BYW A;  3RFB A;  4NKP A;  4BD1 A;  4DDS A;  4XUZ A;  4KZB A;  5FQJ A;  1KGE A;  1W63 M;  4HES A;  2PU4 A;  4L9F A;  3LIF A;  1OT6 A;  4HY8 A;  4K08 A;  4RX2 A;  2A24 B;  4MEZ A;  1L0D A;  4HEF A;  3WRZ A;  4ZDX A;  2J9P A;  1G28 A;  3HLG A;  5EFW A;  1KGF A;  1D06 A;  1XPB A;  1ZG6 A;  5HAI A;  1CI9 A;  3HLE A;  5EVI A;  2X71 A;  2P04 A;  3BRM A;  5C5K A;  5HW3 A;  1ESU A;  5HDD A;  2HF6 A;  4BL3 A;  1OT9 A;  4E3M A;  3IX8 A;  5DKK A;  1CF0 A;  2XQZ A;  4BBU A;  3SH8 A;  4FCF A;  1EI5 A;  3QNB A;  4BEN A;  2ZLY A;  3UPP A;  3ZVT A;  4OH0 A;  3MQ0 A;  1YLJ A;  2ZM8 A;  2IWD A;  4E3K A;  1VET B;  2ZQD A;  4Q8I A;  1K4E A;  2EA9 A;  3PAG A;  3UE1 A;  5FDS A;  2W3G A;  3FG8 A;  2GZA A;  4JPM A;  5HAP A;  2VLG A;  4MDZ A;  4QPR A;  1RGY A;  1DJB A;  4FTX A;  2ZMV A;  3WRT A;  5DF9 A;  4FD8 A;  5CTN A;  5HAR A;  3ITA A;  1T19 A;  2JCH A;  3Q07 A;  5GLA A;  3TRC A;  3MFD A;  3IBR A;  2J9O A;  2WAD A;  1VQQ A;  3D72 A;  5GHY A;  3IF5 A;  1GSW A;  3MXR A;  4S2I A;  1CJF A;  3N8S A;  2ZL1 A;  3W4Q A;  4NK3 A;  4PKY G;  3CIT A;  5F83 A;  3HLB A;  1PWD A;  5CHM A;  3WWX A;  4OQH A;  4LV1 A;  5FA7 A;  1SCW A;  1OPX A;  1FCN A;  4JBF A;  3F1P B;  2Q9M A;  3MZF A;  3G34 A;  2WGW B;  4HOI A;  2PT7 A;  1E3U D;  3FKW A;  3G6O A;  5HD3 A;  4BD0 A;  1EW0 A;  1N9B A;  1I5Q A;  4ZTK A;  3JYI A;  1ZC2 A;  5CRF A;  4DE0 A;  3ZHH A;  2NUP C;  1ZHH B;  1IYO A;  4HP4 A;  1ODV A;  1ZTU A;  2EFU A;  5CGX A;  4LRY C;  4S2P A;  3W4O A;  2YKF A;  1WYC A;  3QHY A;  4WYY A;  5TBM B;  2QZ6 A;  2XF3 A;  1LL5 A;  4UEY A;  3CAX A;  2V2F F;  5EEC A;  4QU3 A;  3UNW A;  4Y0O A;  3NUL A;  3NIA A;  2B95 A;  3OC2 A;  4IVI A;  1GHM A;  3KX0 X;  4MBF A;  5DTK A;  1RCJ A;  5DJU A;  1PIO A;  5AVE A;  4MBK A;  3R7W A;  3NBL A;  3HLC A;  4GCZ A;  3V3R A;  3T4S A;  1XKZ A;  2INW A;  4KG5 A;  4KQD A;  4JLF A;  2L1M A;  3BLS A;  4DN0 A;  1K55 C;  4LRZ E;  2HDS A;  1CEF A;  1HTZ A;  2PBD P;  3FPW A;  1NYM A;  3B3X A;  3G35 A;  1G68 A;  5KZH A;  3FWL A;  2YKH A;  4ARZ B;  4U0T A;  1TEM A;  3IS2 B;  3T1X A;  3M6B A;  1P0Z A;  5E43 A;  4P85 A;  4M4X A;  1MWU A;  1ONH A;  3EEA A;  2JE5 A;  1Y54 A; 
#chains in the Genus database with same CATH homology
 2P08 A;  1D7E A;  1XJ6 A;  1NWZ A;  3BY9 A;  3UE3 A;  1DP6 A;  4WEK A;  2L0W A;  4EQ1 A;  2FH5 A;  4Q0H A;  2I9V A;  3KSI A;  3CWF A;  4IUH A;  3W2Z A;  3B42 A;  3P01 A;  4I5S A;  2DMW A;  4JGQ A;  3UB6 A;  4IHQ A;  3EWK A;  2K2N A;  2EWW A;  3P7N A;  4UQI M;  4EER A;  2PD8 A;  1LT0 A;  4I3A A;  2W3F A;  2ZOH A;  3F1O A;  2GJ3 A;  3TJZ C;  4YNR A;  3U2A A;  3S7P A;  4OOL A;  3PR6 A;  3V67 A;  1NLY A;  2A2L A;  5F5Y A;  1P97 A;  4L9G A;  3HJI A;  4R38 A;  3LFV A;  2JKR M;  5TBM A;  4B93 A;  3T4O A;  3VOL A;  3OCL A;  3HJK A;  2PD7 A;  3PHY A;  5CX7 A;  1V9Z A;  4EXO A;  3LYX A;  4HH3 A;  3T4K A;  3JVV A;  3LR4 A;  3ZQ5 A;  4HJ4 A;  3KSH A;  1GSV A;  4XT2 B;  4LPZ A;  2EWV A;  1TS6 A;  4WL9 A;  3E98 A;  1IOU A;  2KLI A;  2PYR A;  3A0R A;  5F68 A;  1X0O A;  3T4L A;  3IBJ A;  3MQO A;  4I38 A;  4KUO A;  1YSP A;  5FL3 A;  3UMD A;  2HV1 A;  3OOV A;  3LIB A;  2R78 A;  2NUT C;  3R4K A;  2M7U A;  1OJG A;  2VV8 A;  3E4P A;  3H7W A;  4NXG A;  3BQA A;  4CLC B;  4WLA A;  3SW1 A;  4JGO A;  3LR5 A;  4EU0 A;  2WKR A;  1TF1 A;  2VZW A;  4R6L A;  2Y8H A;  3DBA A;  3GDI A;  4H6J B;  3NOU C;  1TS7 A;  3PBT A;  5DJT A;  3T4J A;  4G3V A;  3MR0 A;  4I3J A;  4O0P A;  5F6A A;  2J80 A;  1UWP X;  4ETX A;  1S66 L;  3KSF A;  3KYZ A;  5IT5 A;  1VHM A;  3PBS A;  4ARZ A;  3PBR A;  4YOF A;  3T4Q A;  1NLZ A;  3IS2 A;  3OBF A;  1XJ4 A;  2LB5 A;  4NXE A;  1GSX A;  3KYQ A;  3LIA A;  3BJN A;  2OWH A;  3FPV A;  4GW9 A;  4EEP A;  2O9B A;  3K3C A;  4NXB A;  1F9I A;  4O01 A;  1UWN X;  2W3D A;  1OTA A;  2KOI A;  5AJG A;  2OOL A;  3NHQ A;  1WA9 A;  4EEU A;  3NJA A;  4F3L B;  4HHD A;  1YAX A;  4HP9 A;  3ULF A;  2XA7 S;  2M1C A;  1NRJ A;  4LRX C;  1XFQ A;  3TE8 A;  2JHE A;  2J3T D;  3MJQ A;  2QYB A;  3PBN A;  1YSQ A;  4ZRR A;  1T1C A;  4BBT A;  1DP9 A;  4WF0 A;  5KSH A;  5HDC A;  5K5B A;  2W1T B;  3A0V A;  4OOM A;  4BWI A;  4YWZ A;  5IS1 A;  4HJ6 A;  4MN5 A;  5HSQ A;  3MFX A;  4EES A;  2JKT I;  2W0N A;  3BW6 A;  1Y28 A;  2HJ9 C;  4L9E A;  4HH2 A;  4P6Z S;  4XT2 A;  4GS9 A;  3GEC A;  5G4Y A;  3RH8 B;  3EQV A;  4GLQ A;  4I39 A;  2JN7 A;  4IJG A;  3H82 B;  1S1Z A;  1OTE A;  4WUJ A;  5HWV A;  3LIE A;  2XRO A;  2FZ0 A;  1LSW A;  3LR0 A;  2W3H A;  3LI8 A;  2ZBB A;  2PR6 A;  5L8M A;  4I3I A;  4EUV A;  5HZH A;  5HDS A;  3OCN A;  4CLC A;  3S7N A;  2WKP A;  1XFN A;  1W63 Q;  3H9W A;  4GHI B;  1BYW A;  4H6J A;  4ME4 A;  4FSF A;  2VJW A;  4NKP A;  3RFB A;  1T1B A;  2Z6D A;  1N9L A;  4DJ3 A;  1W63 M;  2W3E A;  2KDK A;  4CLC C;  4HNB A;  4L9F A;  4KQO A;  1LSX A;  3LIF A;  5LBR A;  1OT6 A;  4HY8 A;  4K08 A;  5HPF A;  2A24 B;  3UE6 A;  3S7Q A;  1TD5 A;  5HPI A;  1XJ2 A;  5DFX A;  2KX6 A;  2VEA A;  3ZYT A;  1G28 A;  5EFW A;  1KOU A;  3B33 A;  3MQQ A;  1T1A A;  1D06 A;  2K7S A;  4O8G A;  4Q0J A;  4Y3I A;  2JKR I;  3F1N B;  3OLO A;  3NOP C;  2GX5 A;  1S4R A;  2VGL S;  1DP8 A;  2CMN A;  1TS8 A;  2PYP A;  3VE3 A;  3BWL A;  3UB8 A;  5MC7 A;  2P04 A;  2HGV A;  5C5K A;  3JVU A;  4B9O A;  2V0U A;  1F5M A;  3ICY A;  4R3A A;  4F3L A;  5HDD A;  5TJJ A;  1N9O A;  3KO6 A;  3PBQ A;  3UME A;  2HF6 A;  5HL6 A;  1OT9 A;  3C2W A;  5DKK A;  3S7O A;  4WEJ A;  3BY8 A;  2O9A A;  4UQI S;  4BBU A;  4MN6 A;  3E0Y A;  1V9Y A;  4JGR A;  1N9N A;  1OTD A;  2W1T A;  4EW7 A;  3MQ0 A;  4JGP A;  1H8M A;  3H7W B;  4HI4 A;  3PXP A;  3TW8 A;  3EGD C;  4Y2F A;  2VA0 A;  5DKL A;  3VV4 A;  2EA9 A;  3LIC A;  3EOI A;  4BJP A;  1UGU A;  2W3G A;  3FG8 A;  2GZA A;  2IA2 A;  1H3Q A;  3K2N A;  3MF0 A;  3A0S A;  2VLG A;  1MC0 A;  2K31 A;  3UB9 A;  4MDZ A;  4HIA A;  3LI9 A;  4QPR A;  3UB7 A;  2LB9 A;  2ZMV A;  2L4R A;  2Z6C A;  3C8C A;  3CI6 A;  4G3K A;  2PR5 A;  5DF9 A;  5HWW A;  3T50 A;  4LLO B;  3FC7 A;  3R7W B;  1LSV A;  2W27 A;  1T19 A;  1XJ3 A;  2O9C A;  2V9A A;  3TRC A;  1S1Y A;  3IBR A;  3PYP A;  3EGX C;  5G4Z A;  3D72 A;  4Y5F A;  5HWT A;  1GSW A;  4GHI A;  2MJ6 A;  2O0Y A;  2OWJ A;  2ZOI A;  2XRN A;  3MXQ A;  3CIT A;  4PKY G;  2QKP A;  5HD5 A;  5A8B A;  2H28 A;  2VV7 A;  2VX8 A;  3K3D A;  2D01 A;  2QJ7 A;  1YKD A;  2BAS A;  1OPX A;  2VKS A;  2WKQ A;  2V0W A;  3PBO A;  4CQH A;  2A24 A;  3F1P B;  5DFY A;  1S4S A;  2QWS A;  2B02 A;  4CLC E;  4HOI A;  4AFI A;  5IU1 A;  3EEH A;  2Y79 A;  4Z1W A;  2PT7 A;  4DMZ A;  3O5Y A;  2B18 A;  4PAU A;  2V1B A;  3G6O A;  3F1N A;  3MMH A;  2O99 A;  1EW0 A;  5HD3 A;  3E4O A;  3RTY A;  1JNU A;  4R70 A;  2XA7 M;  4BMW A;  1P9R A;  1MKM A;  2NUP C;  5KIZ A;  1ZHH B;  4HP4 A;  1ODV A;  4HQA A;  4GS9 B;  3LUQ A;  1ZTU A;  3NOT C;  3F1O B;  2M7V A;  4L0L A;  1S67 L;  4LRY C;  2YKF A;  1T18 A;  3C30 A;  5J7E A;  1OTI A;  5TBM B;  1IFQ A;  1STZ A;  4IUK A;  4P6Z M;  4UEY A;  3CAX A;  4G3W A;  4RQ9 A;  2P7J A;  5AVF A;  2QJ5 A;  4MN7 A;  2G7U A;  2OAP 1;  4PKY A;  3OC2 A;  3KSG A;  4MMN A;  4CLC D;  4DJ2 A;  3BQ8 A;  4NEE D;  2PHY A;  2VV6 A;  3C38 A;  3KX0 X;  3LR3 A;  2D02 A;  4ETZ A;  4KUK A;  2J3T C;  3VE4 A;  1OJ5 A;  1OTB A;  1DRM A;  5DJU A;  5AVE A;  3D3O A;  3R7W A;  3E4Q A;  4FOF A;  4GCZ A;  3CUE A;  1P9W A;  4PHT A;  2J3W A;  4Q0I A;  2JKT M;  5I5L A;  3T4S A;  5J4E A;  1G6O A;  2INW A;  2PDR A;  4MCW A;  4KQD A;  4WN5 A;  2L1M A;  3EQU A;  3T4T A;  4II7 A;  4DN0 A;  1LL8 A;  1F98 A;  4NXF A;  2HJE A;  4LRZ E;  2OAQ 1;  3FPW A;  3LID A;  4WEL A;  3CUE C;  4HJ3 A;  3H82 A;  1MZU A;  4E04 A;  4EET B;  5J3W A;  3CLO A;  4BBV A;  3B47 A;  2QHK A;  2YKH A;  2V1A A;  4ARZ B;  2W1R A;  2GNX A;  3IS2 B;  3HCY A;  1P0Z A;  3F1P A;  1TS0 A;  2ZMF A;  5F69 A;  1VB6 A;  4M4X A;  2XSS A;  4GJ4 A;  2VGL M;  3EEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...