4EW7A

The crystal structure of conjugative transfer pas_like domain from salmonella enterica subsp. enterica serovar typhimurium
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
QSVNKYILSIQDIYKNSPVPVCVRNQSRKIIYANGAFIELFSKEDQPLSGDSYNRYGVEVFLSSLELECQSLGHGAAFCRRFNFHGEIYQIRMENISFDNNEIIVLWQINLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conjugative transfer: regulation
publication title The crystal structure of conjugative transfer PAS_like domain from Salmonella enterica subsp. enterica serovar Typhimurium
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Transcription
total genus 31
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ew7A00
4JGQA 2BASA 3MQOA 2OWJA 4HJ4A 1DP8A 4LRXC 5DKLA 3NOPC 4LLOB 3FC7A 1UWNX 3K3DA 1N9NA 3UB6A 1TS8A 4LPZA 4PKYG 4I3IA 1JNUA 4XT2B 2I9VA 2L0WA 3EWKA 1TS0A 3PHYA 4EEUA 1XJ3A 3H82A 5IS1A 3UB7A 2H28A 3T50A 4B9OA 5EFWA 5TBMA 2V9AA 2B02A 4WN5A 5AVFA 5J3WA 2ZBBA 4WUJA 1TS7A 2PYPA 4NXBA 1S66L 2V0UA 1EW0A 3C8CA 4HP4A 3E4PA 4GCZA 3UMDA 3F1PA 1TS6A 1D7EA 5J7EA 2V0WA 3A0VA 3KX0X 3MJQA 5A8BA 4KUKA 2Z6CA 3A0SA 1F9IA 3LIFA 2PYRA 3PYPA 1V9YA 4L9EA 5HDSA 2K7SA 3D72A 4HP9A 1F98A 2YKHA 4WF0A 3F1NB 3VE4A 3H7WA 2PR6A 2QHKA 5G4ZA 4E04A 5TBMB 2QWSA 3MFXA 1UGUA 3CLOA 2PD8A 5HDCA 4HQAA 3LI9A 2D02A 2Z6DA 5HZHA 1WA9A 1OJ5A 1XJ6A 4BBUA 1LL8A 4I38A 3LIBA 2W0NA 3LIEA 3F1PB 4MN6A 2JHEA 1T18A 1Y28A 5F68A 4YWZA 1OT9A 2HV1A 3LUQA 4EESA 4BBVA 5HSQA 1VB6A 1OTDA 3GDIA 4RQ9A 1GSWA 2INWA 2YKFA 3F1NA 4NXEA 1DRMA 2VLGA 4LRZE 2PD7A 3H9WA 4HIAA 4EERA 1N9LA 1DP9A 4H6JB 5F6AA 1LSXA 3LIDA 1S67L 4LRYC 3H7WB 1OTIA 3RTYA 2WKPA 2V1BA 1S1YA 1OJGA 1XFNA 3EEHA 4HJ3A 3E4QA 4JGRA 5DKKA 4EEPA 5I5LA 1XJ4A 2ZOIA 1OTEA 3IS2B 3ZQ5A 4R70A 1XFQA 2P7JA 4HHDA 4JGOA 4F3LB 4HOIA 2VEAA 3NJAA 4EXOA 2EA9A 2KX6A 1V9ZA 2R78A 5G4YA 2L4RA 4EQ1A 2OOLA 2GJ3A 1LSVA 3C2WA 1X0OA 4HH3A 4MN5A 3FG8A 4DJ3A 4H6JA 3UB9A 4K08A 2WKRA 4I3JA 4GW9A 5HWTA 5F69A 2OWHA 4WL9A 4NXGA 2PR5A 4HY8A 2QJ5A 1NWZA 4R6LA 4HI4A 1LT0A 5HWVA 3VOLA 3IS2A 1T1CA 3IBRA 2PDRA 5KIZA 4F3LA 4HNBA 1GSXA 3OLOA 4KUOA 3E4OA 1P0ZA 2VV7A 3BY8A 4PKYA 4EETB 2QJ7A 4KQDA 1T1AA 3HJIA 1BYWA 3ICYA 3UMEA 1LSWA 5HWWA 3LIAA 3LI8A 1GSVA 1G28A 2KDKA 3G6OA 4L9GA 3NOTC 2A24B 4GS9B 3K3CA 2V1AA 4I5SA 1T19A 3LICA 1XJ2A 3F1OB 1S1ZA 2PHYA 5HD5A 1S4RA 4NXFA 1KOUA 4GHIB 3NOUC 4M4XA 2WKQA 5IU1A 2D01A 3P7NA 2CMNA 3CAXA 3ULFA 3BWLA 3LYXA 2QKPA 3MQQA 4R3AA 1S4SA 3A0RA 2A24A 4GS9A 2VV8A 5DJTA 3UB8A 5J4EA 1UWPX 2J80A 4I39A 3F1OA 3GECA 4JGPA 3MR0A 1OTBA 3BY9A 2M1CA 3RH8B 4I3AA 1D06A 3B33A 2ZOHA 2JN7A 4WLAA 2VV6A 3CWFA 4L9FA 4XT2A 3MXQA 4GHIA 4EW7A 5HDDA 5F5YA 3SW1A 1OTAA 4R38A 4BBTA 1P97A 4HJ6A 3HJKA 1N9OA 2L1MA 3H82B 3NHQA 4DJ2A 1ODVA 1DP6A 5AVEA 1T1BA 1OT6A 4HH2A 3UE6A 2W27A 5HD3A 1MZUA 3VE3A 5DJUA
chains in the Genus database with same CATH superfamily
3W2ZA 3Q1FA 2OWJA 1IFQA 1XP4A 3CITA 2ZM0A 1DP8A 5CHJA 4KZ9A 4DXBA 3GQZA 1ZG6A 4Q0IA 3K3DA 4E3LA 1N9NA 3UE1A 1IKIA 3S1YA 4PKYG 1JNUA 2ZQDA 3NULA 4UAAA 5GHZA 3ZGAB 1GA9A 2L0WA 5EPHA 2XDMA 3H82A 5IS1A 2H28A 1HZOA 3BECA 2Y2LA 5TBMA 4OONA 2EX6A 4KENB 4WN5A 3C7VA 2ZBBA 4JF6A 4KG5A 3C4OA 3BFEA 4ZJ1A 5EOOA 1TS7A 3EGXC 2JKRM 2PYPA 3MS6A 1CEGA 4NXBA 3DTKA 2W3HA 3HBRA 3ZG8B 1EW0A 4R1GA 2A49A 1VETB 3VMAA 4BENA 3ISGA 1G6OA 1G5UA 4JF5A 3UPPA 1S6RA 3IXDA 4Q0HA 4OQIA 4A5RA 4BLMA 3FZCA 4KUKA 4C75A 1F9IA 4G3VA 5LBRA 1CJFA 3BLSA 1L3LA 4GDNA 4IJGA 4WELA 2VX8A 4QJGA 1PIOA 2O9AA 3O88A 2GNXA 1F98A 4BQMA 2XLNA 3D4FA 3T4OA 1XXMA 3VE4A 3H7WA 2PR6A 1MXOA 4UEYA 2QHKA 5G4ZA 4RX2A 2BLSA 2ZMFA 2EFXA 1PFLA 1FR6A 3CI6A 5HDCA 5HZHA 5CRFA 3OCNA 3KSFA 3W4QA 4BBUA 1LL8A 3MZFA 4OVDA 2W0NA 3CZDA 4WZ5C 3AGDA 3TE8A 2M7UA 1F2KA 1T18A 1Y28A 4YWZA 3BFFA 2K31A 1PZOA 3L9KA 4QD4A 3QP5A 1RGZA 2PBYA 5HSQA 3IHAA 3T4SA 3ZHHA 4S2NC 3R4KA 1HVBA 2V2FF 4MNRA 4NXEA 1FOFA 3HLGA 3C30A 3PR6A 1DP9A 3ZG0A 1LSXA 5CEDA 5EM1A 4LRYC 3RTYA 3IF6B 4S2MA 1FCMA 3TRCA 3TSGA 5E43A 3MMHA 4OP5A 1W5DA 4HJ3A 3NECA 2Y59A 1RP5A 3E4QA 2Y2GA 2VA0A 4EEPA 1K57A 1IYPA 4ZBEA 1BULA 3BQAA 4R70A 2ZC3B 1XFQA 3KYEA 4OOYA 4BD1A 3BFGA 1HLUP 3UY6A 1WYCA 1I5QA 4CQHA 3ZG5A 1FCOA 3NJAA 4EXOA 2R78A 5G4YA 4BJPA 4LFUA 3R7WA 1LSVA 2QPNA 2Y91A 1X0OA 4HH3A 4MN5A 3FG8A 1SDNA 2DCFA 4H6JA 5DFXA 3CJMA 5HAPA 4I3JA 3WS2A 4KZ3A 1ZKJA 5A92A 2ZJ9A 4S2OA 4OPQA 1K55C 2JC7A 3IH9A 3N8LA 2FZ0A 1FSYA 4LGWA 4EWFA 1NWZA 3FKWA 2WKIA 4CJNA 5HWVA 4BD0A 3IBRA 2JBFA 1C3BA 2ZLYA 3HUMA 1YLJA 3QP8A 4F3LA 3IX8A 3SH9A 1P0ZA 4DE2A 1NXYA 4N1XA 2J3TD 1BYWA 3OPLA 4OLDA 4Y3IA 3G6OA 3B42A 1XGIA 4OH0A 5FA7A 4KG6A 2LB9A 3BFDA 3U4LP 4Y0TA 4I5SA 3LICA 1BLHA 3LGOA 3MXSA 4K91A 4OPYA 4JPMA 1LL9A 2K2NA 4MLLA 2E8IA 1L0EA 1KGFA 3UN7A 5AJGA 2ZM2A 2D01A 5HL1A 3P7NA 1TEMA 1M40A 4LV2A 4X6TA 5EUAA 3EQUA 2HDRA 3HCYA 1YMSA 1MKMA 4PM9A 5IT5A 5FEFA 2Y55A 5TGFA 3WRTA 1KDWA 5TJJA 3FYZA 2A3UA 2ZC5B 1IELA 1H8ZA 4WYYA 3QP1A 3A3IA 3MR0A 5GLDA 4IEDA 3RH8B 1D06A 2BTFP 2ZOHA 2JN7A 1DJCA 4S2JA 1EWZA 1NRJA 1NYYA 2B95A 4L9FA 1IOUA 3IWOA 4QY5A 4EW7A 5F5YA 1OTAA 1XKZA 1XA1A 3DW0A 3G2YA 4KQOA 1P97A 2Y8HA 3HJKA 4DE1A 1XX2A 3H82B 4QPRA 2V20A 4XXRA 2J3WA 4X1MA 5EVEA 3MKEA 5L07A 3RJUA 4C3QA 5EVIA 5DVAA 3OOVA 1WYBA 2HGVA 1MZUA 4S2KA 4UQIS 1YLYA 3IWQA 1ESIA 1H5XA 4GN2A 2J9OA 5G18A 5DJUA 3MFDA 4JGQA 4RVAA 3MQOA 5JYPA 2V8CA 4O8GA 5FDHA 4BL3A 5CXWA 2ZL1B 4QWOA 3NOPC 2J8YA 2DNSA 2Y2QA 3QP6A 3ZNYA 2W3GA 4G3WA 3Q82A 2ZC4B 3SOIA 4X56A 4B4ZA 4XT2B 2I9VA 3VP1A 1VEUA 1W63Q 3EWKA 3PHYA 1MWSA 1ES2A 3T50A 4Y0UA 4B9OA 4UA7A 3LEZA 1PYYA 1AWIA 1KVLA 3BW6A 1MWRA 4WUJA 5FL3A 5FQQA 1P9RA 1S66L 3ZG7B 4OLGA 5FQJA 5EECA 1JTGA 2EXBA 5AQ9A 1CF0A 3E4PA 4GCZA 3ZCZA 3UPNA 3SS4A 5M19A 2Y2PA 3F1PA 1D7EA 1FCNA 2V0WA 3HUNA 2IWBA 2ZMAA 2UWXA 3KX0X 3E2KA 2G7UA 3VFHA 3ZVWA 3LIFA 2PYRA 4WEKA 3S7NA 1ZC2A 1GHMA 2B18A 3IXGA 5HL6A 2VZWA 2B5RA 2K7SA 1BLSA 1FSWA 1W7FA 4KZAA 5FI7A 1YT4A 4WZ4A 3HLBA 4XUZA 4UQIM 2BG1A 1KDSA 2XEPA 5EV0A 3E2LA 3IF6C 2RL3A 3G35A 3V39A 1K6SA 2A2LA 4Y2FA 4DKIA 1UGUA 4BWIA 3C7UA 1LLBA 3DAVA 3G34A 3VSLA 4HQAA 2W1RA 2D02A 2Z6DA 3LR4A 4L0LA 3HLEA 5E2GA 4I38A 1A0KA 3LIEA 4KQRA 4F94A 2V1ZA 3E0YA 4K0WA 4WZ5A 5CHMA 3UPOA 2XFSA 5F68A 4RX3A 1SZVA 5DF9A 4R23A 4Y13A 3E98A 2NUTC 2Y2JA 3BQ8A 2WGWA 4EESA 5DF8A 4DRTA 1QMFA 5HW3A 3OZHA 3ZYTA 4IUKA 1PWDA 3F1NA 2PT7A 4X1LA 3ITAA 3R7WB 4IBRA 2VLGA 2PD7A 4HIAA 2JKGA 2O9CA 1N9LA 2E8JA 4H6JB 1JWZA 1MC0A 5M1AA 3PAGA 4BMWA 1K6RA 2XGNA 4LV0A 4Q0JA 2XA7M 1W8QA 3EEHA 4JGRA 3WRZA 4Y0OA 1ES5A 1BLCA 2ZOIA 1YLPA 1BTLA 1OTEA 1BT5A 3NI9A 3DTEA 2P7JA 1PWCA 3GMWA 4JGOA 4F3LB 1MY8A 5GL9A 1IYQA 2Y4AA 4PPRA 2W1TA 2VEAA 1N4OA 3IX4A 2EA9A 3PBSA 5FQMA 1FQGA 2Q9MA 1Z6FA 2J3TC 2GJ3A 5KSHA 1ZG4A 3UO9A 5HX9A 3V3SA 4P0MA 4K08A 2EWVA 4II7A 5GLAA 3T4QA 4IVKA 2Q0OA 4GW9A 5F69A 3IH8A 4WL9A 1YSQA 2PR5A 1JWPA 3JYIA 4QB8A 3T4JA 1GHIA 4EBLA 1T1CA 3UE3A 3OCLA 5KIZA 1F5MA 4H8RA 1E3UA 1GA0A 5MC7A 3EQVA 4EU0A 4MDZA 2W3EA 3E4OA 3FPVA 4PMAA 2VV7A 3BY8A 4PKYA 3TOIA 4KG2A 4KQDA 4ZJ3A 1MBLA 3UMEA 1JWVA 1GSVA 1G28A 3VV4A 5EE8A 2XD1A 3MSHA 4RYEA 4EQIA 1U60A 3MF0A 2FH5A 2XR0A 4C6YA 1YSPA 2EXAA 4ETXA 4QHCA 3SH7A 3VSKA 4EBPA 2PHYA 2VK3A 5FQKA 1PI5A 1PWGA 3CUEA 3G4PA 2PRFA 2J9PA 3VP2A 3N8SA 2Y2HA 2JKFA 3T1SA 2EX9A 2I72A 5AQAA 1Z09A 4OOMA 2OAP1 2HJEA 3CAXA 3VFFA 3BWLA 3SH8A 1YKDA 2WZZA 5CERA 4OOLA 2J7VA 3BYDA 2Q9NA 3PBOA 3IX3A 3MQQA 1DY6A 3N4IA 4Y5FA 1EROA 4UA9A 3LY4A 1IKGA 3T1QB 3N7WA 1JVJA 2XFTA 3FWLA 4HBUA 1FIKA 3IXBA 2VV8A 5DJTA 3UB8A 3BRMA 2J80A 4I39A 4D2OA 4E3NA 3C4PA 3F1OA 3NIAA 4JGPA 4YOFA 5CEBA 2HP6A 3BY9A 2XD5A 3PBRA 3FV7A 3NBLA 1K54A 3B33A 4WLAA 2VV6A 1FR1A 2WADA 4B4XA 3M2KA 2ZD8A 4GHIA 1E4DA 3DTMA 3GSGA 4P6ZM 2MJ6A 3TW8A 1KE0A 4JXSA 5FI2A 3M6BA 1N9OA 3VP3A 5BOHA 1RGYA 3LCEA 4KZ8A 2L1MA 3DWZA 3NHQA 3NC8A 4DJ2A 1OPXA 1DP6A 4E3KA 1OT6A 4CLCA 3PTEA 1VETA 2VGLS 1WE4A 4HH2A 5HD3A 4MN7A 3IQAA 2WGIA 4N9LA 2BASA 1W79A 3QP2A 1NLZA 3UDIA 4WM9A 4HJ4A 3K2NA 4GZBA 5U47A 4JF4A 2ZQ8A 2H0YA 3FC7A 3W8KA 1KGGA 3UB6A 5M18A 3ZFZA 4LPZA 2Y2IA 1NJ4A 2EWWA 3PAEA 1Y54A 1IYOA 1TS0A 4EEUA 2RCXA 1NYMA 4FTXA 3HLDA 3NCKA 3Q7VA 4OQHA 2KLIA 1PW8A 1BZAA 2W3FA 5AVFA 5J3WA 4FOFA 4OQGA 4E3JA 3ITBA 2OSUA 1NZUA 2OLVA 3RXWA 3S7QA 1ACFA 2PBDP 4NG2A 4HP4A 3VOYA 1TS6A 3DTIA 2Y2OA 3A0VA 2JKTM 3Q81A 5HARA 3MJQA 5DTTA 1STZA 4U0XA 1PRQA 2JCHA 1TVFA 2Z6CA 2IWDA 2XRNA 1TDLA 3PYPA 2P08A 5A90A 4L9EA 5HDSA 5FAQA 2VGLM 5CHUA 2WUQA 5CTMA 3UNWA 2QZ6A 2ZM8A 4GB7A 3HREA 1K25A 4WF0A 4S2PA 4Y7PA 3F1NB 3SS3A 1N9BA 4P85A 4PHTA 3IF6A 5C5KA 1K4EA 5TBMB 1AXBA 4FH4A 1MKIA 2QWSA 4MBFA 3CLOA 2PD8A 3LI9A 4Z9QA 3TJZC 3IWIA 4OKPA 1ES3A 4E3OA 2XF3A 4NETA 3D3OA 3ZNTA 2JKTI 5GHYA 3P98A 2DRWA 5L2FA 3QHYA 2ZQ7A 3UB5P 3S4XA 5AQ7A 1OTDA 3O5YA 4G3KA 1K56A 5CGSA 3GDIA 4RQ9A 1GSWA 4XUXA 2INWA 2YKFA 5DTSA 4B93A 4LV1A 4ETZA 4R3JA 4E3IA 1XA7A 3CHWP 3PBTA 1DRMA 1YLTA 1I2WA 3H9WA 2O0YA 2LB5A 5F6AA 4X68A 3LIDA 3H7WB 3N8RA 2V1BA 4Y17A 1OJGA 1XFNA 1E3UD 3T1RA 1HD8A 5FAPA 1LL5A 3GVBA 4E6XA 3NY4A 3T12B 4DDSA 2HP5A 3ZQ5A 5A93A 3OC2A 2WKEA 2WZXA 1K38A 2GDNA 4YINA 4IUHA 2XA7S 4U0TA 4Q8IA 2JE5A 3UE0A 2KX6A 4B88A 3UDFA 1SKOA 2DMWA 4EQ1A 3ZVTA 4RA7A 2OOLA 2R9WA 4O0PA 2FFFB 4R4RA 4DJ3A 4YNRA 2IWCA 2WYXA 2WKRA 1J9MA 5HAQA 4KQQA 5KMWA 3S7OA 3KSIA 1MWTA 2WAFA 1BSGA 4GKUA 5DF7A 2OWHA 4DDYA 3A3EA 2NUPC 3V67A 4HY8A 4MBKA 2QJ5A 2ZQ9A 3BFCA 4N92A 1GHPA 4R6LA 4HI4A 3ZG9B 3NDGA 2P9VA 2UV0E 4NK3A 3VOLA 3IS2A 2PDRA 1KE4A 4HBTA 2EFUA 5GHXA 5EOEA 3OLOA 4GJ4A 3Q07A 4EETB 2WAEA 1FILA 5E2FA 1T1AA 3P01A 3HJIA 3ICYA 4GNUA 4CPKA 5HWWA 3W4OA 4P6BA 3LIAA 3LI8A 1CK3A 3W4PA 4FD8A 3P09A 2XK1A 4L9GA 3NOTC 2Y2MA 4S2NA 3K3CA 2ZC6B 3M6HA 2V1AA 1T19A 3B47A 4ZAMA 1XJ2A 5E2EA 3F1OB 2PU2A 2VGJA 1S1ZA 3GRJA 4KZ7A 1S4RA 3LEQA 3O3VA 3HUOA 1BUEA 3HLFA 5A91A 1KOUA 1L0DA 4GHIB 3NOUC 4CLCD 2G2WA 5IHVA 4M4XA 4DE3A 2WKQA 1L0FA 5IU1A 1RCJA 3EOIA 4IVIA 1PI4A 3ULFA 1VHMA 3LYXA 2QKPA 3CG5A 3NDEA 1ESUA 3C38A 1S4SA 4CLCB 3MKFA 2XROA 5L09A 2A24A 1E25A 4GS9A 3MXRA 5J4EA 4X55A 1H0MA 2ZC7A 2ZL1A 3GECA 2AVXA 4WMCA 3CPTA 1IEMA 1PNEA 1OTBA 2M1CA 2IA2A 2ZMVA 1EI5A 3QNBA 3G30A 5CGWA 3L7HA 4ZJ2A 5TFQA 3KSGA 5FQ9A 1J3WA 4XT2A 4GLQA 4EUZA 1TD5A 4EUVA 3QP4A 3OPHA 4GD8A 5HDDA 1K55A 3SW1A 4U3TA 2GX5A 4HJ6A 4IHQA 3QNCA 5JYOA 3WWXA 3Q7VB 1ODVA 5AVEA 3GR2A 2JKRI 3G2ZA 3UE6A 4P6ZS 4ARZA 1LHYA 3VE3A 4HESA 1CEFA 5DFYA 5CX7A 3IXHA 1DJAA 5FASA 1PW1A 3WS4A 1XPBA 3A3FA 3JPUA 3LR0A 4D60A 4X69A 1MPLA 1Y4OA 4LRXC 1BLPA 2Y2KA 5DKLA 4LLOB 3WS5A 3IHBA 4ME4A 4X25A 5K5BA 1ALQA 2GZAA 2H10A 1UWNX 1DJBA 3LFVA 4FH2A 1TS8A 3S7PA 5TR7A 4I3IA 4OPZA 3HVFA 3T1XA 1XJ3A 4JXGA 5CGXA 1NLYA 3UB7A 2XQZA 3S22A 5EFWA 5EVID 3O86A 2V9AA 4WEJA 3IF5A 3DBAA 2B02A 2QMIA 1YLZA 3V3RA 1LI9A 2HDQA 1I2SA 2V0UA 3C8CA 4N1HA 3AGFA 5EVIB 3UMDA 5J7EA 5FAOA 3JVVA 4EV4A 1G6AA 2EX2A 1K56D 4ESPA 2HP9A 5A8BA 2WGVA 3A0SA 5EM0A 4PM6A 4N9KA 5F1FA 4MCWA 1K4FA 4JXWA 2X71A 3WS1A 1HTZA 5HPFA 1V9YA 3HL9A 4KZ5A 2C5WB 5HPIA 4E3MA 3D72A 4HP9A 1IYSA 2YKHA 4X53A 4QU3A 4GD6A 1VEUB 3BJNA 5D3OA 1YPRA 3PBQA 2OV5A 2X01A 1YM1A 1ZHHB 4IBXA 4E04A 4JXVA 2ACGA 3MFXA 5FEGA 2X02A 4LV3A 1P9WA 3N6IA 3G31A 3KO6A 2XH9A 4ZTKA 2HF6A 3HLWA 1S0WA 4S2LA 1WA9A 2KOIA 3T4KA 1ONHA 4MMNA 2V8FA 1ES4A 1MWUA 1OJ5A 2QYBA 1XJ6A 3LIBA 3F1PB 2R9XA 4MN6A 3VOZA 2JHEA 4HEFA 2VKSA 4R0QA 1QMEA 1OT9A 2G2UA 2HV1A 1ERMA 2FFYA 3LUQA 3WS0A 3T4LA 1Q2PA 4BBVA 1VB6A 4R3BA 4GDBA 1CI8A 1NY0A 3V5MA 1W63M 4UA6A 4P87A 3JVUA 1XGJA 1SKOB 4AFIA 5HFOA 1OMEA 4LENA 4LRZE 3ZDJA 4EERA 4LCMA 2ZQAA 5GLBA 1SCWA 1S67L 1OTIA 3CUEC 4JBFA 3AGEA 3U2AA 2WKPA 5FQIA 4CLCE 1S1YA 2HZ5A 2W3DA 1SDEA 3DWKA 3PXPA 4DE0A 4KZ4A 3G32A 5DKKA 1K57C 3O87A 5I5LA 1XJ4A 3GTCA 4M3KA 5F1GA 2ZQCA 2WKHA 2P9VB 1D1JA 3IS2B 4K0XA 4HHDA 4JLFA 4OP8A 4Z1WA 4HOIA 3T4TA 1V9ZA 4KZBA 3TG9A 1NRFA 3KSHA 2M7VA 2PAVP 2L4RA 2WGWB 4DMZA 3MZDA 2OAQ1 1L0GA 2Y79A 2HPBA 4LCLA 3HLCA 4FSFA 3C2WA 5FSRA 4O7DA 3UB9A 5I94A 1K54C 4DN0A 3KYQA 4PM5A 5HWTA 1NZOA 4WBGA 1H8YA 3C5AA 5F82A 4NXGA 1O07A 5CTNA 5KZHA 2Z2LB 1PZPA 4QY6A 5KSCA 4BL2A 4YFMA 3VP0A 1LT0A 1VM1A 4UHUA 2C6WB 1L2SA 2VGKA 5FI6A 1SHVA 3V50A 3CMZA 2XSSA 2Z2MB 4GOGA 1YAXA 4HNBA 4CLCC 1GSXA 1VQQA 2EX8A 4KUOA 5AQBA 3SS5A 3FPWA 1M6KA 1JTDA 2QJ7A 1GCEA 4WMCD 5EVLA 4MEZA 1LSWA 3LR3A 3MBZA 1KGEA 2KDKA 3M2JA 3A3JA 2W1TB 4O01A 2VJWA 2A24B 4GS9B 4PAUA 4ZDXA 5GLCA 2P04A 4OPRA 5J8XA 1ZTUA 2WK0A 2O9BA 3CPTB 3SZTA 4ID4A 4ZRRA 1ONGA 5L10A 3I7JA 5HD5A 4NXFA 3EEAA 5F83A 1W8YA 3FKVA 2H5SA 3OPPA 3KYZA 1K0KA 3BEBA 4R4SA 3OPRA 3OBFA 2CMNA 4Y15A 5L8MA 4E6WA 4DF6A 2Y2NA 1CI9A 3A3DA 2H0TA 4R3AA 1Q2QA 2OLUA 3A0RA 3UDXA 4ARZB 4FCFA 2P74A 1UWPX 5FDSA 4NEED 5DTKA 3RXXA 1YQSA 1KE3A 2PU4A 1SKFA 4DXCA 1TDGA 4I3AA 2CC1A 3LO7A 4JKTA 1H8MA 1ERQA 3LY3A 1YMXA 3CWFA 5HAIA 5CECA 3MXQA 1O7EA 3BM6A 3BLMA 1CQAA 4KZ6A 3LR5A 4NKPA 4R38A 1G68A 4BBTA 3MQ0A 3IBJA 4OQ0A 3D9YA 3MZEA 4MBHA 3EGDC 1TF1A 2HDSA 2HDUA 4EBNA 4PM8A 5FATA 1T1BA 2O99A 5EVIC 3B3XA 5E2HA 3PBNA 3Q7ZA 1KVMA 1LI0A 4FUWA 3IT9A 2W27A 1YLWA 4PM7A 3RFBA 2HJ9C 4S2IA 1H3QA 3VP4A 3GV9A
chains in the Genus database with same CATH topology
3W2ZA 4JGQA 2BASA 3MQOA 3LR0A 2OWJA 1NLZA 1IFQA 4O8GA 3CITA 4HJ4A 3K2NA 1DP8A 4LRXC 5DKLA 3NOPC 4LLOB 4ME4A 5K5BA 3FC7A 2GZAA 4Q0IA 1UWNX 3K3DA 3LFVA 1N9NA 3UB6A 1TS8A 4LPZA 2W3GA 4G3WA 3S7PA 4PKYG 4I3IA 1JNUA 2EWWA 4XT2B 2I9VA 2L0WA 1W63Q 3EWKA 1TS0A 3PHYA 4EEUA 1XJ3A 3H82A 5IS1A 3UB7A 1NLYA 2H28A 3T50A 4B9OA 5EFWA 2KLIA 5TBMA 2V9AA 4WEJA 2W3FA 3DBAA 2B02A 4WN5A 4FOFA 5AVFA 5J3WA 2ZBBA 3BW6A 4WUJA 1TS7A 3EGXC 2JKRM 2PYPA 4NXBA 5FL3A 1S66L 1P9RA 2W3HA 3S7QA 2V0UA 1EW0A 3C8CA 4HP4A 3E4PA 4GCZA 3UMDA 3F1PA 1TS6A 1D7EA 5J7EA 2V0WA 1G6OA 3A0VA 3JVVA 2JKTM 4Q0HA 3KX0X 3MJQA 1STZA 5A8BA 4KUKA 2Z6CA 3A0SA 2G7UA 1F9IA 4MCWA 3LIFA 2XRNA 2PYRA 4G3VA 4WEKA 5LBRA 3S7NA 3PYPA 5HPFA 2P08A 1V9YA 2B18A 5HL6A 2VZWA 4L9EA 5HPIA 4IJGA 5HDSA 2K7SA 2VGLM 4WELA 2VX8A 2O9AA 3D72A 2GNXA 4HP9A 1F98A 4UQIM 2YKHA 3T4OA 4WF0A 3F1NB 3BJNA 3VE4A 3H7WA 3PBQA 2PR6A 4PHTA 5C5KA 4UEYA 2QHKA 1ZHHB 5G4ZA 4E04A 5TBMB 2ZMFA 2QWSA 3MFXA 2A2LA 4Y2FA 1UGUA 4BWIA 3CLOA 2PD8A 3CI6A 1P9WA 3KO6A 5HDCA 2HF6A 2W1RA 4HQAA 3LI9A 3TJZC 2D02A 2Z6DA 5HZHA 1WA9A 2KOIA 3T4KA 3OCNA 4MMNA 3KSFA 3LR4A 1OJ5A 2QYBA 4L0LA 1XJ6A 4BBUA 1LL8A 4I38A 3LIBA 2W0NA 3LIEA 3F1PB 3D3OA 4MN6A 3E0YA 2JHEA 2JKTI 2VKSA 3TE8A 2M7UA 1T18A 1Y28A 5F68A 4YWZA 2K31A 1OT9A 5DF9A 2HV1A 3E98A 3LUQA 2NUTC 3T4LA 3BQ8A 4EESA 4BBVA 5HSQA 1VB6A 1OTDA 3O5YA 4G3KA 3T4SA 3GDIA 1W63M 4RQ9A 1GSWA 3JVUA 3R4KA 2INWA 2YKFA 3ZYTA 4IUKA 4B93A 4ETZA 3F1NA 4AFIA 2PT7A 3R7WB 3PBTA 4NXEA 1DRMA 2VLGA 4LRZE 3C30A 2PD7A 3H9WA 4HIAA 4EERA 2O9CA 1N9LA 1DP9A 3PR6A 4H6JB 2O0YA 2LB5A 5F6AA 1MC0A 1LSXA 3LIDA 1S67L 4LRYC 3H7WB 1OTIA 3RTYA 4BMWA 3CUEC 3TRCA 3U2AA 4Q0JA 2WKPA 3MMHA 2V1BA 2XA7M 4CLCE 1S1YA 1OJGA 1XFNA 3EEHA 4HJ3A 2W3DA 3PXPA 3E4QA 2VA0A 4JGRA 5DKKA 4EEPA 5I5LA 1XJ4A 2ZOIA 1OTEA 3BQAA 3IS2B 3ZQ5A 4R70A 1XFQA 3OC2A 2P7JA 4HHDA 4JGOA 4Z1WA 4F3LB 4HOIA 4IUHA 2XA7S 2W1TA 4CQHA 2VEAA 3T4TA 3NJAA 4EXOA 2EA9A 2KX6A 1V9ZA 3PBSA 2R78A 2M7VA 3KSHA 5G4YA 2L4RA 2DMWA 4BJPA 4EQ1A 4DMZA 2OAQ1 2Y79A 2J3TC 2OOLA 2GJ3A 3R7WA 5KSHA 4FSFA 1LSVA 3C2WA 1X0OA 4HH3A 4O0PA 4MN5A 3FG8A 4DJ3A 4H6JA 4YNRA 3UB9A 5DFXA 4K08A 2EWVA 2WKRA 4II7A 4DN0A 3T4QA 3KYQA 4I3JA 3S7OA 3KSIA 4GW9A 5HWTA 5F69A 2OWHA 4WL9A 1YSQA 2FZ0A 4NXGA 2PR5A 2NUPC 3V67A 4HY8A 2QJ5A 1NWZA 4R6LA 4HI4A 1LT0A 5HWVA 3T4JA 3VOLA 3IS2A 3IBRA 1T1CA 3UE3A 3OCLA 2PDRA 5KIZA 1F5MA 2XSSA 4F3LA 1YAXA 4HNBA 4CLCC 1GSXA 3OLOA 5MC7A 3EQVA 4EU0A 4KUOA 4MDZA 2W3EA 3E4OA 1P0ZA 3FPVA 2VV7A 4GJ4A 3FPWA 3BY8A 4PKYA 4EETB 2QJ7A 4KQDA 2J3TD 1T1AA 3P01A 3HJIA 1BYWA 3ICYA 3UMEA 1LSWA 5HWWA 3LR3A 3LIAA 3LI8A 1GSVA 1G28A 2KDKA 4Y3IA 3G6OA 3VV4A 4L9GA 3NOTC 3B42A 2W1TB 4O01A 2VJWA 2A24B 4GS9B 3K3CA 4PAUA 2LB9A 3MF0A 2FH5A 2P04A 2V1AA 4I5SA 1T19A 3B47A 3LICA 1ZTUA 1XJ2A 1YSPA 3F1OB 2O9BA 4ETXA 1S1ZA 4ZRRA 2PHYA 5HD5A 1S4RA 4NXFA 3EEAA 1KOUA 2K2NA 3CUEA 4GHIB 3NOUC 4CLCD 4M4XA 3KYZA 2WKQA 5IU1A 5AJGA 3EOIA 2D01A 4OOMA 2OAP1 3OBFA 3P7NA 2CMNA 2HJEA 3CAXA 5L8MA 3BWLA 3ULFA 1VHMA 3LYXA 1YKDA 2QKPA 3EQUA 4OOLA 3C38A 3PBOA 3MQQA 4R3AA 1S4SA 3HCYA 4Y5FA 4CLCB 1MKMA 5IT5A 3A0RA 2XROA 2A24A 4GS9A 4ARZB 5TJJA 2VV8A 5DJTA 3UB8A 5J4EA 1UWPX 2J80A 4NEED 4I39A 3F1OA 3GECA 4JGPA 3MR0A 1OTBA 4YOFA 3BY9A 2M1CA 2IA2A 2ZMVA 3PBRA 3RH8B 4I3AA 1D06A 1H8MA 3B33A 2ZOHA 3KSGA 2JN7A 4WLAA 1NRJA 2VV6A 3CWFA 4L9FA 4XT2A 4GLQA 1TD5A 1IOUA 3MXQA 4EUVA 4GHIA 4EW7A 5HDDA 5F5YA 3SW1A 3LR5A 1OTAA 4NKPA 4R38A 4P6ZM 4BBTA 3MQ0A 2GX5A 4KQOA 1P97A 3IBJA 2MJ6A 4HJ6A 3TW8A 2Y8HA 3HJKA 1N9OA 4IHQA 2L1MA 3EGDC 3H82B 3NHQA 4QPRA 1TF1A 4DJ2A 1OPXA 1ODVA 1DP6A 2J3WA 5AVEA 1T1BA 1OT6A 2O99A 4CLCA 3PBNA 2JKRI 2VGLS 3OOVA 4HH2A 3UE6A 4P6ZS 4ARZA 2W27A 2HGVA 5HD3A 1MZUA 3VE3A 4UQIS 4MN7A 5DFYA 5CX7A 3RFBA 2HJ9C 1H3QA 5DJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGQ A;  2BAS A;  3MQO A;  2OWJ A;  4HJ4 A;  1DP8 A;  4LRX C;  5DKL A;  3NOP C;  4LLO B;  3FC7 A;  1UWN X;  3K3D A;  1N9N A;  3UB6 A;  1TS8 A;  4LPZ A;  4PKY G;  4I3I A;  1JNU A;  4XT2 B;  2I9V A;  2L0W A;  3EWK A;  1TS0 A;  3PHY A;  4EEU A;  1XJ3 A;  3H82 A;  5IS1 A;  3UB7 A;  2H28 A;  3T50 A;  4B9O A;  5EFW A;  5TBM A;  2V9A A;  2B02 A;  4WN5 A;  5AVF A;  5J3W A;  2ZBB A;  4WUJ A;  1TS7 A;  2PYP A;  4NXB A;  1S66 L;  2V0U A;  1EW0 A;  3C8C A;  4HP4 A;  3E4P A;  4GCZ A;  3UMD A;  3F1P A;  1TS6 A;  1D7E A;  5J7E A;  2V0W A;  3A0V A;  3KX0 X;  3MJQ A;  5A8B A;  4KUK A;  2Z6C A;  3A0S A;  1F9I A;  3LIF A;  2PYR A;  3PYP A;  1V9Y A;  4L9E A;  5HDS A;  2K7S A;  3D72 A;  4HP9 A;  1F98 A;  2YKH A;  4WF0 A;  3F1N B;  3VE4 A;  3H7W A;  2PR6 A;  2QHK A;  5G4Z A;  4E04 A;  5TBM B;  2QWS A;  3MFX A;  1UGU A;  3CLO A;  2PD8 A;  5HDC A;  4HQA A;  3LI9 A;  2D02 A;  2Z6D A;  5HZH A;  1WA9 A;  1OJ5 A;  1XJ6 A;  4BBU A;  1LL8 A;  4I38 A;  3LIB A;  2W0N A;  3LIE A;  3F1P B;  4MN6 A;  2JHE A;  1T18 A;  1Y28 A;  5F68 A;  4YWZ A;  1OT9 A;  2HV1 A;  3LUQ A;  4EES A;  4BBV A;  5HSQ A;  1VB6 A;  1OTD A;  3GDI A;  4RQ9 A;  1GSW A;  2INW A;  2YKF A;  3F1N A;  4NXE A;  1DRM A;  2VLG A;  4LRZ E;  2PD7 A;  3H9W A;  4HIA A;  4EER A;  1N9L A;  1DP9 A;  4H6J B;  5F6A A;  1LSX A;  3LID A;  1S67 L;  4LRY C;  3H7W B;  1OTI A;  3RTY A;  2WKP A;  2V1B A;  1S1Y A;  1OJG A;  1XFN A;  3EEH A;  4HJ3 A;  3E4Q A;  4JGR A;  5DKK A;  4EEP A;  5I5L A;  1XJ4 A;  2ZOI A;  1OTE A;  3IS2 B;  3ZQ5 A;  4R70 A;  1XFQ A;  2P7J A;  4HHD A;  4JGO A;  4F3L B;  4HOI A;  2VEA A;  3NJA A;  4EXO A;  2EA9 A;  2KX6 A;  1V9Z A;  2R78 A;  5G4Y A;  2L4R A;  4EQ1 A;  2OOL A;  2GJ3 A;  1LSV A;  3C2W A;  1X0O A;  4HH3 A;  4MN5 A;  3FG8 A;  4DJ3 A;  4H6J A;  3UB9 A;  4K08 A;  2WKR A;  4I3J A;  4GW9 A;  5HWT A;  5F69 A;  2OWH A;  4WL9 A;  4NXG A;  2PR5 A;  4HY8 A;  2QJ5 A;  1NWZ A;  4R6L A;  4HI4 A;  1LT0 A;  5HWV A;  3VOL A;  3IS2 A;  1T1C A;  3IBR A;  2PDR A;  5KIZ A;  4F3L A;  4HNB A;  1GSX A;  3OLO A;  4KUO A;  3E4O A;  1P0Z A;  2VV7 A;  3BY8 A;  4PKY A;  4EET B;  2QJ7 A;  4KQD A;  1T1A A;  3HJI A;  1BYW A;  3ICY A;  3UME A;  1LSW A;  5HWW A;  3LIA A;  3LI8 A;  1GSV A;  1G28 A;  2KDK A;  3G6O A;  4L9G A;  3NOT C;  2A24 B;  4GS9 B;  3K3C A;  2V1A A;  4I5S A;  1T19 A;  3LIC A;  1XJ2 A;  3F1O B;  1S1Z A;  2PHY A;  5HD5 A;  1S4R A;  4NXF A;  1KOU A;  4GHI B;  3NOU C;  4M4X A;  2WKQ A;  5IU1 A;  2D01 A;  3P7N A;  2CMN A;  3CAX A;  3ULF A;  3BWL A;  3LYX A;  2QKP A;  3MQQ A;  4R3A A;  1S4S A;  3A0R A;  2A24 A;  4GS9 A;  2VV8 A;  5DJT A;  3UB8 A;  5J4E A;  1UWP X;  2J80 A;  4I39 A;  3F1O A;  3GEC A;  4JGP A;  3MR0 A;  1OTB A;  3BY9 A;  2M1C A;  3RH8 B;  4I3A A;  1D06 A;  3B33 A;  2ZOH A;  2JN7 A;  4WLA A;  2VV6 A;  3CWF A;  4L9F A;  4XT2 A;  3MXQ A;  4GHI A;  4EW7 A;  5HDD A;  5F5Y A;  3SW1 A;  1OTA A;  4R38 A;  4BBT A;  1P97 A;  4HJ6 A;  3HJK A;  1N9O A;  2L1M A;  3H82 B;  3NHQ A;  4DJ2 A;  1ODV A;  1DP6 A;  5AVE A;  1T1B A;  1OT6 A;  4HH2 A;  3UE6 A;  2W27 A;  5HD3 A;  1MZU A;  3VE3 A;  5DJU A; 
#chains in the Genus database with same CATH topology
 3W2Z A;  3Q1F A;  2OWJ A;  1IFQ A;  1XP4 A;  3CIT A;  2ZM0 A;  1DP8 A;  5CHJ A;  4KZ9 A;  4DXB A;  3GQZ A;  1ZG6 A;  4Q0I A;  3K3D A;  4E3L A;  1N9N A;  3UE1 A;  1IKI A;  3S1Y A;  4PKY G;  1JNU A;  2ZQD A;  3NUL A;  4UAA A;  5GHZ A;  3ZGA B;  1GA9 A;  2L0W A;  5EPH A;  2XDM A;  3H82 A;  5IS1 A;  2H28 A;  1HZO A;  3BEC A;  2Y2L A;  5TBM A;  4OON A;  2EX6 A;  4KEN B;  4WN5 A;  3C7V A;  2ZBB A;  4JF6 A;  4KG5 A;  3C4O A;  3BFE A;  4ZJ1 A;  5EOO A;  1TS7 A;  3EGX C;  2JKR M;  2PYP A;  3MS6 A;  1CEG A;  4NXB A;  3DTK A;  2W3H A;  3HBR A;  3ZG8 B;  1EW0 A;  4R1G A;  2A49 A;  1VET B;  3VMA A;  4BEN A;  3ISG A;  1G6O A;  1G5U A;  4JF5 A;  3UPP A;  1S6R A;  3IXD A;  4Q0H A;  4OQI A;  4A5R A;  4BLM A;  3FZC A;  4KUK A;  4C75 A;  1F9I A;  4G3V A;  5LBR A;  1CJF A;  3BLS A;  1L3L A;  4GDN A;  4IJG A;  4WEL A;  2VX8 A;  4QJG A;  1PIO A;  2O9A A;  3O88 A;  2GNX A;  1F98 A;  4BQM A;  2XLN A;  3D4F A;  3T4O A;  1XXM A;  3VE4 A;  3H7W A;  2PR6 A;  1MXO A;  4UEY A;  2QHK A;  5G4Z A;  4RX2 A;  2BLS A;  2ZMF A;  2EFX A;  1PFL A;  1FR6 A;  3CI6 A;  5HDC A;  5HZH A;  5CRF A;  3OCN A;  3KSF A;  3W4Q A;  4BBU A;  1LL8 A;  3MZF A;  4OVD A;  2W0N A;  3CZD A;  4WZ5 C;  3AGD A;  3TE8 A;  2M7U A;  1F2K A;  1T18 A;  1Y28 A;  4YWZ A;  3BFF A;  2K31 A;  1PZO A;  3L9K A;  4QD4 A;  3QP5 A;  1RGZ A;  2PBY A;  5HSQ A;  3IHA A;  3T4S A;  3ZHH A;  4S2N C;  3R4K A;  1HVB A;  2V2F F;  4MNR A;  4NXE A;  1FOF A;  3HLG A;  3C30 A;  3PR6 A;  1DP9 A;  3ZG0 A;  1LSX A;  5CED A;  5EM1 A;  4LRY C;  3RTY A;  3IF6 B;  4S2M A;  1FCM A;  3TRC A;  3TSG A;  5E43 A;  3MMH A;  4OP5 A;  1W5D A;  4HJ3 A;  3NEC A;  2Y59 A;  1RP5 A;  3E4Q A;  2Y2G A;  2VA0 A;  4EEP A;  1K57 A;  1IYP A;  4ZBE A;  1BUL A;  3BQA A;  4R70 A;  2ZC3 B;  1XFQ A;  3KYE A;  4OOY A;  4BD1 A;  3BFG A;  1HLU P;  3UY6 A;  1WYC A;  1I5Q A;  4CQH A;  3ZG5 A;  1FCO A;  3NJA A;  4EXO A;  2R78 A;  5G4Y A;  4BJP A;  4LFU A;  3R7W A;  1LSV A;  2QPN A;  2Y91 A;  1X0O A;  4HH3 A;  4MN5 A;  3FG8 A;  1SDN A;  2DCF A;  4H6J A;  5DFX A;  3CJM A;  5HAP A;  4I3J A;  3WS2 A;  4KZ3 A;  1ZKJ A;  5A92 A;  2ZJ9 A;  4S2O A;  4OPQ A;  1K55 C;  2JC7 A;  3IH9 A;  3N8L A;  2FZ0 A;  1FSY A;  4LGW A;  4EWF A;  1NWZ A;  3FKW A;  2WKI A;  4CJN A;  5HWV A;  4BD0 A;  3IBR A;  2JBF A;  1C3B A;  2ZLY A;  3HUM A;  1YLJ A;  3QP8 A;  4F3L A;  3IX8 A;  3SH9 A;  1P0Z A;  4DE2 A;  1NXY A;  4N1X A;  2J3T D;  1BYW A;  3OPL A;  4OLD A;  4Y3I A;  3G6O A;  3B42 A;  1XGI A;  4OH0 A;  5FA7 A;  4KG6 A;  2LB9 A;  3BFD A;  3U4L P;  4Y0T A;  4I5S A;  3LIC A;  1BLH A;  3LGO A;  3MXS A;  4K91 A;  4OPY A;  4JPM A;  1LL9 A;  2K2N A;  4MLL A;  2E8I A;  1L0E A;  1KGF A;  3UN7 A;  5AJG A;  2ZM2 A;  2D01 A;  5HL1 A;  3P7N A;  1TEM A;  1M40 A;  4LV2 A;  4X6T A;  5EUA A;  3EQU A;  2HDR A;  3HCY A;  1YMS A;  1MKM A;  4PM9 A;  5IT5 A;  5FEF A;  2Y55 A;  5TGF A;  3WRT A;  1KDW A;  5TJJ A;  3FYZ A;  2A3U A;  2ZC5 B;  1IEL A;  1H8Z A;  4WYY A;  3QP1 A;  3A3I A;  3MR0 A;  5GLD A;  4IED A;  3RH8 B;  1D06 A;  2BTF P;  2ZOH A;  2JN7 A;  1DJC A;  4S2J A;  1EWZ A;  1NRJ A;  1NYY A;  2B95 A;  4L9F A;  1IOU A;  3IWO A;  4QY5 A;  4EW7 A;  5F5Y A;  1OTA A;  1XKZ A;  1XA1 A;  3DW0 A;  3G2Y A;  4KQO A;  1P97 A;  2Y8H A;  3HJK A;  4DE1 A;  1XX2 A;  3H82 B;  4QPR A;  2V20 A;  4XXR A;  2J3W A;  4X1M A;  5EVE A;  3MKE A;  5L07 A;  3RJU A;  4C3Q A;  5EVI A;  5DVA A;  3OOV A;  1WYB A;  2HGV A;  1MZU A;  4S2K A;  4UQI S;  1YLY A;  3IWQ A;  1ESI A;  1H5X A;  4GN2 A;  2J9O A;  5G18 A;  5DJU A;  3MFD A;  4JGQ A;  4RVA A;  3MQO A;  5JYP A;  2V8C A;  4O8G A;  5FDH A;  4BL3 A;  5CXW A;  2ZL1 B;  4QWO A;  3NOP C;  2J8Y A;  2DNS A;  2Y2Q A;  3QP6 A;  3ZNY A;  2W3G A;  4G3W A;  3Q82 A;  2ZC4 B;  3SOI A;  4X56 A;  4B4Z A;  4XT2 B;  2I9V A;  3VP1 A;  1VEU A;  1W63 Q;  3EWK A;  3PHY A;  1MWS A;  1ES2 A;  3T50 A;  4Y0U A;  4B9O A;  4UA7 A;  3LEZ A;  1PYY A;  1AWI A;  1KVL A;  3BW6 A;  1MWR A;  4WUJ A;  5FL3 A;  5FQQ A;  1P9R A;  1S66 L;  3ZG7 B;  4OLG A;  5FQJ A;  5EEC A;  1JTG A;  2EXB A;  5AQ9 A;  1CF0 A;  3E4P A;  4GCZ A;  3ZCZ A;  3UPN A;  3SS4 A;  5M19 A;  2Y2P A;  3F1P A;  1D7E A;  1FCN A;  2V0W A;  3HUN A;  2IWB A;  2ZMA A;  2UWX A;  3KX0 X;  3E2K A;  2G7U A;  3VFH A;  3ZVW A;  3LIF A;  2PYR A;  4WEK A;  3S7N A;  1ZC2 A;  1GHM A;  2B18 A;  3IXG A;  5HL6 A;  2VZW A;  2B5R A;  2K7S A;  1BLS A;  1FSW A;  1W7F A;  4KZA A;  5FI7 A;  1YT4 A;  4WZ4 A;  3HLB A;  4XUZ A;  4UQI M;  2BG1 A;  1KDS A;  2XEP A;  5EV0 A;  3E2L A;  3IF6 C;  2RL3 A;  3G35 A;  3V39 A;  1K6S A;  2A2L A;  4Y2F A;  4DKI A;  1UGU A;  4BWI A;  3C7U A;  1LLB A;  3DAV A;  3G34 A;  3VSL A;  4HQA A;  2W1R A;  2D02 A;  2Z6D A;  3LR4 A;  4L0L A;  3HLE A;  5E2G A;  4I38 A;  1A0K A;  3LIE A;  4KQR A;  4F94 A;  2V1Z A;  3E0Y A;  4K0W A;  4WZ5 A;  5CHM A;  3UPO A;  2XFS A;  5F68 A;  4RX3 A;  1SZV A;  5DF9 A;  4R23 A;  4Y13 A;  3E98 A;  2NUT C;  2Y2J A;  3BQ8 A;  2WGW A;  4EES A;  5DF8 A;  4DRT A;  1QMF A;  5HW3 A;  3OZH A;  3ZYT A;  4IUK A;  1PWD A;  3F1N A;  2PT7 A;  4X1L A;  3ITA A;  3R7W B;  4IBR A;  2VLG A;  2PD7 A;  4HIA A;  2JKG A;  2O9C A;  1N9L A;  2E8J A;  4H6J B;  1JWZ A;  1MC0 A;  5M1A A;  3PAG A;  4BMW A;  1K6R A;  2XGN A;  4LV0 A;  4Q0J A;  2XA7 M;  1W8Q A;  3EEH A;  4JGR A;  3WRZ A;  4Y0O A;  1ES5 A;  1BLC A;  2ZOI A;  1YLP A;  1BTL A;  1OTE A;  1BT5 A;  3NI9 A;  3DTE A;  2P7J A;  1PWC A;  3GMW A;  4JGO A;  4F3L B;  1MY8 A;  5GL9 A;  1IYQ A;  2Y4A A;  4PPR A;  2W1T A;  2VEA A;  1N4O A;  3IX4 A;  2EA9 A;  3PBS A;  5FQM A;  1FQG A;  2Q9M A;  1Z6F A;  2J3T C;  2GJ3 A;  5KSH A;  1ZG4 A;  3UO9 A;  5HX9 A;  3V3S A;  4P0M A;  4K08 A;  2EWV A;  4II7 A;  5GLA A;  3T4Q A;  4IVK A;  2Q0O A;  4GW9 A;  5F69 A;  3IH8 A;  4WL9 A;  1YSQ A;  2PR5 A;  1JWP A;  3JYI A;  4QB8 A;  3T4J A;  1GHI A;  4EBL A;  1T1C A;  3UE3 A;  3OCL A;  5KIZ A;  1F5M A;  4H8R A;  1E3U A;  1GA0 A;  5MC7 A;  3EQV A;  4EU0 A;  4MDZ A;  2W3E A;  3E4O A;  3FPV A;  4PMA A;  2VV7 A;  3BY8 A;  4PKY A;  3TOI A;  4KG2 A;  4KQD A;  4ZJ3 A;  1MBL A;  3UME A;  1JWV A;  1GSV A;  1G28 A;  3VV4 A;  5EE8 A;  2XD1 A;  3MSH A;  4RYE A;  4EQI A;  1U60 A;  3MF0 A;  2FH5 A;  2XR0 A;  4C6Y A;  1YSP A;  2EXA A;  4ETX A;  4QHC A;  3SH7 A;  3VSK A;  4EBP A;  2PHY A;  2VK3 A;  5FQK A;  1PI5 A;  1PWG A;  3CUE A;  3G4P A;  2PRF A;  2J9P A;  3VP2 A;  3N8S A;  2Y2H A;  2JKF A;  3T1S A;  2EX9 A;  2I72 A;  5AQA A;  1Z09 A;  4OOM A;  2OAP 1;  2HJE A;  3CAX A;  3VFF A;  3BWL A;  3SH8 A;  1YKD A;  2WZZ A;  5CER A;  4OOL A;  2J7V A;  3BYD A;  2Q9N A;  3PBO A;  3IX3 A;  3MQQ A;  1DY6 A;  3N4I A;  4Y5F A;  1ERO A;  4UA9 A;  3LY4 A;  1IKG A;  3T1Q B;  3N7W A;  1JVJ A;  2XFT A;  3FWL A;  4HBU A;  1FIK A;  3IXB A;  2VV8 A;  5DJT A;  3UB8 A;  3BRM A;  2J80 A;  4I39 A;  4D2O A;  4E3N A;  3C4P A;  3F1O A;  3NIA A;  4JGP A;  4YOF A;  5CEB A;  2HP6 A;  3BY9 A;  2XD5 A;  3PBR A;  3FV7 A;  3NBL A;  1K54 A;  3B33 A;  4WLA A;  2VV6 A;  1FR1 A;  2WAD A;  4B4X A;  3M2K A;  2ZD8 A;  4GHI A;  1E4D A;  3DTM A;  3GSG A;  4P6Z M;  2MJ6 A;  3TW8 A;  1KE0 A;  4JXS A;  5FI2 A;  3M6B A;  1N9O A;  3VP3 A;  5BOH A;  1RGY A;  3LCE A;  4KZ8 A;  2L1M A;  3DWZ A;  3NHQ A;  3NC8 A;  4DJ2 A;  1OPX A;  1DP6 A;  4E3K A;  1OT6 A;  4CLC A;  3PTE A;  1VET A;  2VGL S;  1WE4 A;  4HH2 A;  5HD3 A;  4MN7 A;  3IQA A;  2WGI A;  4N9L A;  2BAS A;  1W79 A;  3QP2 A;  1NLZ A;  3UDI A;  4WM9 A;  4HJ4 A;  3K2N A;  4GZB A;  5U47 A;  4JF4 A;  2ZQ8 A;  2H0Y A;  3FC7 A;  3W8K A;  1KGG A;  3UB6 A;  5M18 A;  3ZFZ A;  4LPZ A;  2Y2I A;  1NJ4 A;  2EWW A;  3PAE A;  1Y54 A;  1IYO A;  1TS0 A;  4EEU A;  2RCX A;  1NYM A;  4FTX A;  3HLD A;  3NCK A;  3Q7V A;  4OQH A;  2KLI A;  1PW8 A;  1BZA A;  2W3F A;  5AVF A;  5J3W A;  4FOF A;  4OQG A;  4E3J A;  3ITB A;  2OSU A;  1NZU A;  2OLV A;  3RXW A;  3S7Q A;  1ACF A;  2PBD P;  4NG2 A;  4HP4 A;  3VOY A;  1TS6 A;  3DTI A;  2Y2O A;  3A0V A;  2JKT M;  3Q81 A;  5HAR A;  3MJQ A;  5DTT A;  1STZ A;  4U0X A;  1PRQ A;  2JCH A;  1TVF A;  2Z6C A;  2IWD A;  2XRN A;  1TDL A;  3PYP A;  2P08 A;  5A90 A;  4L9E A;  5HDS A;  5FAQ A;  2VGL M;  5CHU A;  2WUQ A;  5CTM A;  3UNW A;  2QZ6 A;  2ZM8 A;  4GB7 A;  3HRE A;  1K25 A;  4WF0 A;  4S2P A;  4Y7P A;  3F1N B;  3SS3 A;  1N9B A;  4P85 A;  4PHT A;  3IF6 A;  5C5K A;  1K4E A;  5TBM B;  1AXB A;  4FH4 A;  1MKI A;  2QWS A;  4MBF A;  3CLO A;  2PD8 A;  3LI9 A;  4Z9Q A;  3TJZ C;  3IWI A;  4OKP A;  1ES3 A;  4E3O A;  2XF3 A;  4NET A;  3D3O A;  3ZNT A;  2JKT I;  5GHY A;  3P98 A;  2DRW A;  5L2F A;  3QHY A;  2ZQ7 A;  3UB5 P;  3S4X A;  5AQ7 A;  1OTD A;  3O5Y A;  4G3K A;  1K56 A;  5CGS A;  3GDI A;  4RQ9 A;  1GSW A;  4XUX A;  2INW A;  2YKF A;  5DTS A;  4B93 A;  4LV1 A;  4ETZ A;  4R3J A;  4E3I A;  1XA7 A;  3CHW P;  3PBT A;  1DRM A;  1YLT A;  1I2W A;  3H9W A;  2O0Y A;  2LB5 A;  5F6A A;  4X68 A;  3LID A;  3H7W B;  3N8R A;  2V1B A;  4Y17 A;  1OJG A;  1XFN A;  1E3U D;  3T1R A;  1HD8 A;  5FAP A;  1LL5 A;  3GVB A;  4E6X A;  3NY4 A;  3T12 B;  4DDS A;  2HP5 A;  3ZQ5 A;  5A93 A;  3OC2 A;  2WKE A;  2WZX A;  1K38 A;  2GDN A;  4YIN A;  4IUH A;  2XA7 S;  4U0T A;  4Q8I A;  2JE5 A;  3UE0 A;  2KX6 A;  4B88 A;  3UDF A;  1SKO A;  2DMW A;  4EQ1 A;  3ZVT A;  4RA7 A;  2OOL A;  2R9W A;  4O0P A;  2FFF B;  4R4R A;  4DJ3 A;  4YNR A;  2IWC A;  2WYX A;  2WKR A;  1J9M A;  5HAQ A;  4KQQ A;  5KMW A;  3S7O A;  3KSI A;  1MWT A;  2WAF A;  1BSG A;  4GKU A;  5DF7 A;  2OWH A;  4DDY A;  3A3E A;  2NUP C;  3V67 A;  4HY8 A;  4MBK A;  2QJ5 A;  2ZQ9 A;  3BFC A;  4N92 A;  1GHP A;  4R6L A;  4HI4 A;  3ZG9 B;  3NDG A;  2P9V A;  2UV0 E;  4NK3 A;  3VOL A;  3IS2 A;  2PDR A;  1KE4 A;  4HBT A;  2EFU A;  5GHX A;  5EOE A;  3OLO A;  4GJ4 A;  3Q07 A;  4EET B;  2WAE A;  1FIL A;  5E2F A;  1T1A A;  3P01 A;  3HJI A;  3ICY A;  4GNU A;  4CPK A;  5HWW A;  3W4O A;  4P6B A;  3LIA A;  3LI8 A;  1CK3 A;  3W4P A;  4FD8 A;  3P09 A;  2XK1 A;  4L9G A;  3NOT C;  2Y2M A;  4S2N A;  3K3C A;  2ZC6 B;  3M6H A;  2V1A A;  1T19 A;  3B47 A;  4ZAM A;  1XJ2 A;  5E2E A;  3F1O B;  2PU2 A;  2VGJ A;  1S1Z A;  3GRJ A;  4KZ7 A;  1S4R A;  3LEQ A;  3O3V A;  3HUO A;  1BUE A;  3HLF A;  5A91 A;  1KOU A;  1L0D A;  4GHI B;  3NOU C;  4CLC D;  2G2W A;  5IHV A;  4M4X A;  4DE3 A;  2WKQ A;  1L0F A;  5IU1 A;  1RCJ A;  3EOI A;  4IVI A;  1PI4 A;  3ULF A;  1VHM A;  3LYX A;  2QKP A;  3CG5 A;  3NDE A;  1ESU A;  3C38 A;  1S4S A;  4CLC B;  3MKF A;  2XRO A;  5L09 A;  2A24 A;  1E25 A;  4GS9 A;  3MXR A;  5J4E A;  4X55 A;  1H0M A;  2ZC7 A;  2ZL1 A;  3GEC A;  2AVX A;  4WMC A;  3CPT A;  1IEM A;  1PNE A;  1OTB A;  2M1C A;  2IA2 A;  2ZMV A;  1EI5 A;  3QNB A;  3G30 A;  5CGW A;  3L7H A;  4ZJ2 A;  5TFQ A;  3KSG A;  5FQ9 A;  1J3W A;  4XT2 A;  4GLQ A;  4EUZ A;  1TD5 A;  4EUV A;  3QP4 A;  3OPH A;  4GD8 A;  5HDD A;  1K55 A;  3SW1 A;  4U3T A;  2GX5 A;  4HJ6 A;  4IHQ A;  3QNC A;  5JYO A;  3WWX A;  3Q7V B;  1ODV A;  5AVE A;  3GR2 A;  2JKR I;  3G2Z A;  3UE6 A;  4P6Z S;  4ARZ A;  1LHY A;  3VE3 A;  4HES A;  1CEF A;  5DFY A;  5CX7 A;  3IXH A;  1DJA A;  5FAS A;  1PW1 A;  3WS4 A;  1XPB A;  3A3F A;  3JPU A;  3LR0 A;  4D60 A;  4X69 A;  1MPL A;  1Y4O A;  4LRX C;  1BLP A;  2Y2K A;  5DKL A;  4LLO B;  3WS5 A;  3IHB A;  4ME4 A;  4X25 A;  5K5B A;  1ALQ A;  2GZA A;  2H10 A;  1UWN X;  1DJB A;  3LFV A;  4FH2 A;  1TS8 A;  3S7P A;  5TR7 A;  4I3I A;  4OPZ A;  3HVF A;  3T1X A;  1XJ3 A;  4JXG A;  5CGX A;  1NLY A;  3UB7 A;  2XQZ A;  3S22 A;  5EFW A;  5EVI D;  3O86 A;  2V9A A;  4WEJ A;  3IF5 A;  3DBA A;  2B02 A;  2QMI A;  1YLZ A;  3V3R A;  1LI9 A;  2HDQ A;  1I2S A;  2V0U A;  3C8C A;  4N1H A;  3AGF A;  5EVI B;  3UMD A;  5J7E A;  5FAO A;  3JVV A;  4EV4 A;  1G6A A;  2EX2 A;  1K56 D;  4ESP A;  2HP9 A;  5A8B A;  2WGV A;  3A0S A;  5EM0 A;  4PM6 A;  4N9K A;  5F1F A;  4MCW A;  1K4F A;  4JXW A;  2X71 A;  3WS1 A;  1HTZ A;  5HPF A;  1V9Y A;  3HL9 A;  4KZ5 A;  2C5W B;  5HPI A;  4E3M A;  3D72 A;  4HP9 A;  1IYS A;  2YKH A;  4X53 A;  4QU3 A;  4GD6 A;  1VEU B;  3BJN A;  5D3O A;  1YPR A;  3PBQ A;  2OV5 A;  2X01 A;  1YM1 A;  1ZHH B;  4IBX A;  4E04 A;  4JXV A;  2ACG A;  3MFX A;  5FEG A;  2X02 A;  4LV3 A;  1P9W A;  3N6I A;  3G31 A;  3KO6 A;  2XH9 A;  4ZTK A;  2HF6 A;  3HLW A;  1S0W A;  4S2L A;  1WA9 A;  2KOI A;  3T4K A;  1ONH A;  4MMN A;  2V8F A;  1ES4 A;  1MWU A;  1OJ5 A;  2QYB A;  1XJ6 A;  3LIB A;  3F1P B;  2R9X A;  4MN6 A;  3VOZ A;  2JHE A;  4HEF A;  2VKS A;  4R0Q A;  1QME A;  1OT9 A;  2G2U A;  2HV1 A;  1ERM A;  2FFY A;  3LUQ A;  3WS0 A;  3T4L A;  1Q2P A;  4BBV A;  1VB6 A;  4R3B A;  4GDB A;  1CI8 A;  1NY0 A;  3V5M A;  1W63 M;  4UA6 A;  4P87 A;  3JVU A;  1XGJ A;  1SKO B;  4AFI A;  5HFO A;  1OME A;  4LEN A;  4LRZ E;  3ZDJ A;  4EER A;  4LCM A;  2ZQA A;  5GLB A;  1SCW A;  1S67 L;  1OTI A;  3CUE C;  4JBF A;  3AGE A;  3U2A A;  2WKP A;  5FQI A;  4CLC E;  1S1Y A;  2HZ5 A;  2W3D A;  1SDE A;  3DWK A;  3PXP A;  4DE0 A;  4KZ4 A;  3G32 A;  5DKK A;  1K57 C;  3O87 A;  5I5L A;  1XJ4 A;  3GTC A;  4M3K A;  5F1G A;  2ZQC A;  2WKH A;  2P9V B;  1D1J A;  3IS2 B;  4K0X A;  4HHD A;  4JLF A;  4OP8 A;  4Z1W A;  4HOI A;  3T4T A;  1V9Z A;  4KZB A;  3TG9 A;  1NRF A;  3KSH A;  2M7V A;  2PAV P;  2L4R A;  2WGW B;  4DMZ A;  3MZD A;  2OAQ 1;  1L0G A;  2Y79 A;  2HPB A;  4LCL A;  3HLC A;  4FSF A;  3C2W A;  5FSR A;  4O7D A;  3UB9 A;  5I94 A;  1K54 C;  4DN0 A;  3KYQ A;  4PM5 A;  5HWT A;  1NZO A;  4WBG A;  1H8Y A;  3C5A A;  5F82 A;  4NXG A;  1O07 A;  5CTN A;  5KZH A;  2Z2L B;  1PZP A;  4QY6 A;  5KSC A;  4BL2 A;  4YFM A;  3VP0 A;  1LT0 A;  1VM1 A;  4UHU A;  2C6W B;  1L2S A;  2VGK A;  5FI6 A;  1SHV A;  3V50 A;  3CMZ A;  2XSS A;  2Z2M B;  4GOG A;  1YAX A;  4HNB A;  4CLC C;  1GSX A;  1VQQ A;  2EX8 A;  4KUO A;  5AQB A;  3SS5 A;  3FPW A;  1M6K A;  1JTD A;  2QJ7 A;  1GCE A;  4WMC D;  5EVL A;  4MEZ A;  1LSW A;  3LR3 A;  3MBZ A;  1KGE A;  2KDK A;  3M2J A;  3A3J A;  2W1T B;  4O01 A;  2VJW A;  2A24 B;  4GS9 B;  4PAU A;  4ZDX A;  5GLC A;  2P04 A;  4OPR A;  5J8X A;  1ZTU A;  2WK0 A;  2O9B A;  3CPT B;  3SZT A;  4ID4 A;  4ZRR A;  1ONG A;  5L10 A;  3I7J A;  5HD5 A;  4NXF A;  3EEA A;  5F83 A;  1W8Y A;  3FKV A;  2H5S A;  3OPP A;  3KYZ A;  1K0K A;  3BEB A;  4R4S A;  3OPR A;  3OBF A;  2CMN A;  4Y15 A;  5L8M A;  4E6W A;  4DF6 A;  2Y2N A;  1CI9 A;  3A3D A;  2H0T A;  4R3A A;  1Q2Q A;  2OLU A;  3A0R A;  3UDX A;  4ARZ B;  4FCF A;  2P74 A;  1UWP X;  5FDS A;  4NEE D;  5DTK A;  3RXX A;  1YQS A;  1KE3 A;  2PU4 A;  1SKF A;  4DXC A;  1TDG A;  4I3A A;  2CC1 A;  3LO7 A;  4JKT A;  1H8M A;  1ERQ A;  3LY3 A;  1YMX A;  3CWF A;  5HAI A;  5CEC A;  3MXQ A;  1O7E A;  3BM6 A;  3BLM A;  1CQA A;  4KZ6 A;  3LR5 A;  4NKP A;  4R38 A;  1G68 A;  4BBT A;  3MQ0 A;  3IBJ A;  4OQ0 A;  3D9Y A;  3MZE A;  4MBH A;  3EGD C;  1TF1 A;  2HDS A;  2HDU A;  4EBN A;  4PM8 A;  5FAT A;  1T1B A;  2O99 A;  5EVI C;  3B3X A;  5E2H A;  3PBN A;  3Q7Z A;  1KVM A;  1LI0 A;  4FUW A;  3IT9 A;  2W27 A;  1YLW A;  4PM7 A;  3RFB A;  2HJ9 C;  4S2I A;  1H3Q A;  3VP4 A;  3GV9 A; 
#chains in the Genus database with same CATH homology
 3W2Z A;  4JGQ A;  2BAS A;  3MQO A;  3LR0 A;  2OWJ A;  1NLZ A;  1IFQ A;  4O8G A;  3CIT A;  4HJ4 A;  3K2N A;  1DP8 A;  4LRX C;  5DKL A;  3NOP C;  4LLO B;  4ME4 A;  5K5B A;  3FC7 A;  2GZA A;  4Q0I A;  1UWN X;  3K3D A;  3LFV A;  1N9N A;  3UB6 A;  1TS8 A;  4LPZ A;  2W3G A;  4G3W A;  3S7P A;  4PKY G;  4I3I A;  1JNU A;  2EWW A;  4XT2 B;  2I9V A;  2L0W A;  1W63 Q;  3EWK A;  1TS0 A;  3PHY A;  4EEU A;  1XJ3 A;  3H82 A;  5IS1 A;  3UB7 A;  1NLY A;  2H28 A;  3T50 A;  4B9O A;  5EFW A;  2KLI A;  5TBM A;  2V9A A;  4WEJ A;  2W3F A;  3DBA A;  2B02 A;  4WN5 A;  4FOF A;  5AVF A;  5J3W A;  2ZBB A;  3BW6 A;  4WUJ A;  1TS7 A;  3EGX C;  2JKR M;  2PYP A;  4NXB A;  5FL3 A;  1S66 L;  1P9R A;  2W3H A;  3S7Q A;  2V0U A;  1EW0 A;  3C8C A;  4HP4 A;  3E4P A;  4GCZ A;  3UMD A;  3F1P A;  1TS6 A;  1D7E A;  5J7E A;  2V0W A;  1G6O A;  3A0V A;  3JVV A;  2JKT M;  4Q0H A;  3KX0 X;  3MJQ A;  1STZ A;  5A8B A;  4KUK A;  2Z6C A;  3A0S A;  2G7U A;  1F9I A;  4MCW A;  3LIF A;  2XRN A;  2PYR A;  4G3V A;  4WEK A;  5LBR A;  3S7N A;  3PYP A;  5HPF A;  2P08 A;  1V9Y A;  2B18 A;  5HL6 A;  2VZW A;  4L9E A;  5HPI A;  4IJG A;  5HDS A;  2K7S A;  2VGL M;  4WEL A;  2VX8 A;  2O9A A;  3D72 A;  2GNX A;  4HP9 A;  1F98 A;  4UQI M;  2YKH A;  3T4O A;  4WF0 A;  3F1N B;  3BJN A;  3VE4 A;  3H7W A;  3PBQ A;  2PR6 A;  4PHT A;  5C5K A;  4UEY A;  2QHK A;  1ZHH B;  5G4Z A;  4E04 A;  5TBM B;  2ZMF A;  2QWS A;  3MFX A;  2A2L A;  4Y2F A;  1UGU A;  4BWI A;  3CLO A;  2PD8 A;  3CI6 A;  1P9W A;  3KO6 A;  5HDC A;  2HF6 A;  2W1R A;  4HQA A;  3LI9 A;  3TJZ C;  2D02 A;  2Z6D A;  5HZH A;  1WA9 A;  2KOI A;  3T4K A;  3OCN A;  4MMN A;  3KSF A;  3LR4 A;  1OJ5 A;  2QYB A;  4L0L A;  1XJ6 A;  4BBU A;  1LL8 A;  4I38 A;  3LIB A;  2W0N A;  3LIE A;  3F1P B;  3D3O A;  4MN6 A;  3E0Y A;  2JHE A;  2JKT I;  2VKS A;  3TE8 A;  2M7U A;  1T18 A;  1Y28 A;  5F68 A;  4YWZ A;  2K31 A;  1OT9 A;  5DF9 A;  2HV1 A;  3E98 A;  3LUQ A;  2NUT C;  3T4L A;  3BQ8 A;  4EES A;  4BBV A;  5HSQ A;  1VB6 A;  1OTD A;  3O5Y A;  4G3K A;  3T4S A;  3GDI A;  1W63 M;  4RQ9 A;  1GSW A;  3JVU A;  3R4K A;  2INW A;  2YKF A;  3ZYT A;  4IUK A;  4B93 A;  4ETZ A;  3F1N A;  4AFI A;  2PT7 A;  3R7W B;  3PBT A;  4NXE A;  1DRM A;  2VLG A;  4LRZ E;  3C30 A;  2PD7 A;  3H9W A;  4HIA A;  4EER A;  2O9C A;  1N9L A;  1DP9 A;  3PR6 A;  4H6J B;  2O0Y A;  2LB5 A;  5F6A A;  1MC0 A;  1LSX A;  3LID A;  1S67 L;  4LRY C;  3H7W B;  1OTI A;  3RTY A;  4BMW A;  3CUE C;  3TRC A;  3U2A A;  4Q0J A;  2WKP A;  3MMH A;  2V1B A;  2XA7 M;  4CLC E;  1S1Y A;  1OJG A;  1XFN A;  3EEH A;  4HJ3 A;  2W3D A;  3PXP A;  3E4Q A;  2VA0 A;  4JGR A;  5DKK A;  4EEP A;  5I5L A;  1XJ4 A;  2ZOI A;  1OTE A;  3BQA A;  3IS2 B;  3ZQ5 A;  4R70 A;  1XFQ A;  3OC2 A;  2P7J A;  4HHD A;  4JGO A;  4Z1W A;  4F3L B;  4HOI A;  4IUH A;  2XA7 S;  2W1T A;  4CQH A;  2VEA A;  3T4T A;  3NJA A;  4EXO A;  2EA9 A;  2KX6 A;  1V9Z A;  3PBS A;  2R78 A;  2M7V A;  3KSH A;  5G4Y A;  2L4R A;  2DMW A;  4BJP A;  4EQ1 A;  4DMZ A;  2OAQ 1;  2Y79 A;  2J3T C;  2OOL A;  2GJ3 A;  3R7W A;  5KSH A;  4FSF A;  1LSV A;  3C2W A;  1X0O A;  4HH3 A;  4O0P A;  4MN5 A;  3FG8 A;  4DJ3 A;  4H6J A;  4YNR A;  3UB9 A;  5DFX A;  4K08 A;  2EWV A;  2WKR A;  4II7 A;  4DN0 A;  3T4Q A;  3KYQ A;  4I3J A;  3S7O A;  3KSI A;  4GW9 A;  5HWT A;  5F69 A;  2OWH A;  4WL9 A;  1YSQ A;  2FZ0 A;  4NXG A;  2PR5 A;  2NUP C;  3V67 A;  4HY8 A;  2QJ5 A;  1NWZ A;  4R6L A;  4HI4 A;  1LT0 A;  5HWV A;  3T4J A;  3VOL A;  3IS2 A;  3IBR A;  1T1C A;  3UE3 A;  3OCL A;  2PDR A;  5KIZ A;  1F5M A;  2XSS A;  4F3L A;  1YAX A;  4HNB A;  4CLC C;  1GSX A;  3OLO A;  5MC7 A;  3EQV A;  4EU0 A;  4KUO A;  4MDZ A;  2W3E A;  3E4O A;  1P0Z A;  3FPV A;  2VV7 A;  4GJ4 A;  3FPW A;  3BY8 A;  4PKY A;  4EET B;  2QJ7 A;  4KQD A;  2J3T D;  1T1A A;  3P01 A;  3HJI A;  1BYW A;  3ICY A;  3UME A;  1LSW A;  5HWW A;  3LR3 A;  3LIA A;  3LI8 A;  1GSV A;  1G28 A;  2KDK A;  4Y3I A;  3G6O A;  3VV4 A;  4L9G A;  3NOT C;  3B42 A;  2W1T B;  4O01 A;  2VJW A;  2A24 B;  4GS9 B;  3K3C A;  4PAU A;  2LB9 A;  3MF0 A;  2FH5 A;  2P04 A;  2V1A A;  4I5S A;  1T19 A;  3B47 A;  3LIC A;  1ZTU A;  1XJ2 A;  1YSP A;  3F1O B;  2O9B A;  4ETX A;  1S1Z A;  4ZRR A;  2PHY A;  5HD5 A;  1S4R A;  4NXF A;  3EEA A;  1KOU A;  2K2N A;  3CUE A;  4GHI B;  3NOU C;  4CLC D;  4M4X A;  3KYZ A;  2WKQ A;  5IU1 A;  5AJG A;  3EOI A;  2D01 A;  4OOM A;  2OAP 1;  3OBF A;  3P7N A;  2CMN A;  2HJE A;  3CAX A;  5L8M A;  3BWL A;  3ULF A;  1VHM A;  3LYX A;  1YKD A;  2QKP A;  3EQU A;  4OOL A;  3C38 A;  3PBO A;  3MQQ A;  4R3A A;  1S4S A;  3HCY A;  4Y5F A;  4CLC B;  1MKM A;  5IT5 A;  3A0R A;  2XRO A;  2A24 A;  4GS9 A;  4ARZ B;  5TJJ A;  2VV8 A;  5DJT A;  3UB8 A;  5J4E A;  1UWP X;  2J80 A;  4NEE D;  4I39 A;  3F1O A;  3GEC A;  4JGP A;  3MR0 A;  1OTB A;  4YOF A;  3BY9 A;  2M1C A;  2IA2 A;  2ZMV A;  3PBR A;  3RH8 B;  4I3A A;  1D06 A;  1H8M A;  3B33 A;  2ZOH A;  3KSG A;  2JN7 A;  4WLA A;  1NRJ A;  2VV6 A;  3CWF A;  4L9F A;  4XT2 A;  4GLQ A;  1TD5 A;  1IOU A;  3MXQ A;  4EUV A;  4GHI A;  4EW7 A;  5HDD A;  5F5Y A;  3SW1 A;  3LR5 A;  1OTA A;  4NKP A;  4R38 A;  4P6Z M;  4BBT A;  3MQ0 A;  2GX5 A;  4KQO A;  1P97 A;  3IBJ A;  2MJ6 A;  4HJ6 A;  3TW8 A;  2Y8H A;  3HJK A;  1N9O A;  4IHQ A;  2L1M A;  3EGD C;  3H82 B;  3NHQ A;  4QPR A;  1TF1 A;  4DJ2 A;  1OPX A;  1ODV A;  1DP6 A;  2J3W A;  5AVE A;  1T1B A;  1OT6 A;  2O99 A;  4CLC A;  3PBN A;  2JKR I;  2VGL S;  3OOV A;  4HH2 A;  3UE6 A;  4P6Z S;  4ARZ A;  2W27 A;  2HGV A;  5HD3 A;  1MZU A;  3VE3 A;  4UQI S;  4MN7 A;  5DFY A;  5CX7 A;  3RFB A;  2HJ9 C;  1H3Q A;  5DJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...