4YOFA

Doss gafa domain reduced nitric oxide bound crystal structure
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
144
structure length
140
Chain Sequence
DPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRSFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox sensor histidine kinase response regulator DevS
publication title Distal Hydrogen-bonding Interactions in Ligand Sensing and Signaling by Mycobacterium tuberculosis DosS.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Oxidoreductase
total genus 38
structure length 140
sequence length 144
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4yofA00
4G3VA 2IA2A 3DBAA 5HPFA 3LFVA 4E04A 2OOLA 3W2ZA 5L8MA 3KSFA 2M7VA 3NOUC 1YKDA 2XSSA 4Q0IA 4RQ9A 1MKMA 4QPRA 3RFBA 2GX5A 2VZWA 1VHMA 4O01A 3ZQ5A 3NOTC 4Z1WA 3S7QA 2W1TA 2B18A 4Q0JA 2K2NA 2O99A 4R6LA 1TF1A 5LBRA 1YSQA 4ETXA 2LB9A 4Y3IA 1MC0A 4MCWA 4PAUA 2O9BA 2VJWA 3CI6A 3KSGA 2VEAA 3K2NA 4EU0A 2W3HA 2KLIA 3TRCA 2QYBA 3EEAA 4DN0A 1YSPA 5DFYA 4IUHA 4MMNA 4LRXC 1ZTUA 4ETZA 1STZA 2M7UA 2VKSA 2XRNA 4R70A 2G7UA 3C2WA 5K5BA 4IJGA 3S7PA 2W3FA 4Y5FA 2Y79A 3S7OA 2K31A 4O0PA 2O0YA 4CQHA 3BJNA 3NOPC 4LRZE 3O5YA 2Y8HA 2O9AA 5HSQA 3CITA 2O9CA 3HCYA 3NHQA 4Q0HA 4O8GA 5TJJA 1F5MA 2HGVA 2W1TB 4YOFA 4G3KA 4G3WA 5I5LA 2KOIA 3KSHA 3IBJA 3KO6A 2ZMFA 3OBFA 3G6OA 4MDZA 2LB5A 2W3DA 1TD5A 2W1RA 3KSIA 3MMHA 4Y2FA 4YNRA 4FOFA 3S7NA 4DMZA 3OOVA 3MF0A 3D3OA 4GW9A 5C5KA 4MN7A 4ME4A 2XROA 3MQ0A 4GLQA 2W3GA 5HL6A 5HPIA 4EUVA 3E0YA 5DFXA 4IUKA 2W3EA 3R4KA 5AJGA 3VV4A 3E98A 3IBRA 4BWIA 4LRYC 4ZRRA
chains in the Genus database with same CATH superfamily
3O87A 2P08A 1TS6A 3CLOA 1QMFA 2G2WA 3SS3A 3LIBA 3LFVA 3M2KA 4FH4A 1OTEA 4R4SA 3BWLA 4KZBA 2JN7A 5L2FA 4JXSA 1BLPA 4OPRA 5CHJA 4X1LA 1Y4OA 5FSRA 4FD8A 3Q07A 3IXDA 1IOUA 4RA7A 2EWWA 1GCEA 3FC7A 4S2NA 1IYPA 4R6LA 3MKFA 1YSQA 5LBRA 5IHVA 1HZOA 3A3DA 2XD1A 4S2OA 2H0YA 3E4OA 4D2OA 5A92A 3ZCZA 2XDMA 2WKRA 3VE4A 4B4XA 3UE0A 5DTSA 3VP1A 5HAQA 2DRWA 2VLGA 4GB7A 2XRNA 5FATA 3VP0A 1SKOB 3FKWA 1MWRA 2ZMVA 5GL9A 5TJJA 3N6IA 4DXBA 4KQOA 1HTZA 3H7WB 1ZKJA 1HD8A 3VOZA 1H8ZA 2W3DA 1ES4A 2WK0A 2ZQDA 4F94A 2PDRA 1RP5A 3ZGAB 1K25A 5FI7A 3LEZA 2NUPC 3UY6A 4IUKA 2X71A 1HVBA 2PRFA 4OQ0A 2Y2KA 3HLEA 4ARZA 3DBAA 5FA7A 5HAPA 3VSKA 2HDSA 1W63Q 3FPWA 1FR1A 4X55A 4PM7A 5GHXA 3HUNA 3P01A 2M7VA 1XJ4A 1S6RA 5EV0A 4JGRA 1YLPA 1VHMA 2JBFA 4HH3A 2A24B 2FH5A 4BBVA 4HH2A 4Z1WA 1D1JA 1TS0A 4A5RA 4GZBA 4GS9B 2V9AA 4HOIA 5DTTA 4E6XA 1O7EA 2DNSA 5HD3A 1XKZA 3F1NB 3CI6A 5KIZA 1XFNA 3V5MA 5CECA 4WF0A 4EW7A 4QJGA 3OCNA 1OJGA 4YWZA 4IEDA 5G4YA 2HDUA 2PR6A 1BULA 5FQIA 4ETZA 4LV2A 3HLFA 3T4SA 3ZNTA 5FI6A 3DW0A 2UWXA 3BJNA 2WGWB 3CAXA 4OONA 1KDWA 2HGVA 3IBJA 1SCWA 3KX0X 1AWIA 4HBTA 1BUEA 3I7JA 4BL2A 3S7NA 3L9KA 4LFUA 5G4ZA 1ZC2A 3H9WA 3F1OB 3A3EA 1GHIA 3WWXA 4HQAA 3OCLA 3IF6C 3HVFA 4HJ4A 2CC1A 2HP6A 1IYSA 4X56A 3DTEA 2FFYA 2MJ6A 3BFEA 2EA9A 4EETB 3LIAA 2Y2HA 4RQ9A 3KYQA 2Y2LA 1NYYA 4HI4A 1XP4A 4EQ1A 4LCMA 4RX2A 1SKFA 3N7WA 2ZC3B 2JC7A 3A0RA 4S2PA 5E2FA 4BENA 4PPRA 1FCMA 3P7NA 4QU3A 1JWPA 4I39A 3G32A 3LI8A 3O86A 5AQBA 1ZTUA 1FILA 3IHAA 4FUWA 1STZA 5A8BA 3HLDA 2FZ0A 3IF6A 1GA0A 3ZG7B 4P87A 4LRZE 1VETB 3O5YA 1UWNX 3IXGA 3BY8A 3PBRA 4Q0HA 4WBGA 3MQOA 5CXWA 2QPNA 5J4EA 1W8YA 4JKTA 2W1RA 1QMEA 4KZ6A 1CK3A 1I2WA 5CGXA 4HEFA 3UO9A 4CLCD 3SOIA 5HPIA 2ZOIA 4DJ2A 5I94A 1G6OA 3E0YA 3NJAA 1JWVA 3DTKA 2IA2A 3SS4A 4E3MA 1S66L 4E04A 1SZVA 3W2ZA 4LV1A 5L8MA 3KSFA 1Y28A 4UA7A 3LR5A 3IXHA 3IXBA 3IX3A 1IEMA 4DF6A 1W5DA 2GX5A 2WAFA 2J80A 3G4PA 1GHPA 1KVMA 3ZQ5A 4CLCE 3FV7A 5FQ9A 1G6AA 4KZ8A 4HIAA 4CLCC 1DP9A 2KDKA 5KZHA 4NK3A 1Z09A 1J9MA 3T4JA 3C4OA 3E4QA 3QP5A 4QWOA 3HUMA 4Z9QA 2XA7M 1MY8A 1ALQA 4QY6A 2H5SA 2QZ6A 3BRMA 4OQGA 3UPOA 1MBLA 1FQGA 2OSUA 3MQQA 1YT4A 2WKHA 4XT2B 3TW8A 4O0PA 2WKPA 1T18A 1G28A 3P98A 3TE8A 1DY6A 2O9CA 2PD7A 4UA9A 2FFFB 2PT7A 3HLCA 3HLWA 2HZ5A 5F83A 4B93A 4MN5A 2KOIA 2QMIA 1TD5A 3PHYA 5J8XA 4YINA 3PBNA 5HWVA 2ZM0A 4FSFA 1K56D 2V2FF 3D3OA 5DTKA 1PWGA 4GHIA 4CLCA 2OV5A 4MN6A 5FQJA 5HL6A 2INWA 3WRZA 1C3BA 4UA6A 3UMEA 1Q2QA 3OZHA 3ICYA 4BBUA 2ZC4B 1IFQA 4U3TA 1YLZA 3ZNYA 3K3CA 4GDNA 3BYDA 4WMCD 3R7WA 2HP9A 4F3LA 3NOUC 1H8YA 4N1XA 4OH0A 4QPRA 3RFBA 1CI9A 3AGDA 1KE3A 4O01A 1EW0A 3GSGA 4ZTKA 4H8RA 5EVIA 1CQAA 3MFXA 2GDNA 1ONHA 4GCZA 1MC0A 5KMWA 2Y2GA 4M3KA 3UB6A 4PKYA 2QYBA 3EEAA 1K4FA 3WS1A 2HPBA 3NDGA 4JXWA 3W4OA 2Q9NA 4S2MA 5M18A 2G7UA 2EFUA 1M40A 2EX8A 4CJNA 3LUQA 4E3IA 4EBLA 2ZMAA 3NHQA 1VEUA 4OPQA 2V1ZA 1ZG6A 4HHDA 4QHCA 3LR0A 1CI8A 5I5LA 4WEKA 3LI9A 2ZQ9A 3RTYA 1MWTA 3BECA 1K0KA 1GHMA 4Y2FA 5AQ7A 2DMWA 4LENA 1K56A 3UMDA 1WA9A 4NXFA 4WEJA 2PBYA 3EQUA 3D72A 5CERA 3UB7A 1KGEA 4S2NC 3DWZA 4WN5A 1Y54A 4N92A 1KE4A 1G5UA 5AVFA 2NUTC 1WE4A 4ZRRA 5AVEA 3TJZC 3ZG5A 4JF4A 1NY0A 1N9BA 4BQMA 3N8SA 1PYYA 2J8YA 2QJ7A 3FYZA 4WMCA 4NXBA 4EEUA 5E2HA 4KZAA 2Y91A 2XSSA 2K7SA 3LIEA 3SH8A 2OLVA 5FASA 5L10A 3D9YA 3A0SA 2V0WA 3EOIA 5E2GA 4R3BA 3QP6A 3IH8A 5FEGA 3PTEA 4IBRA 3VP2A 5TBMB 4BD1A 1E3UD 4NETA 1TF1A 1XX2A 2PHYA 3ITAA 3VFFA 2VX8A 4NEED 1K57C 3MBZA 3BFCA 2ZJ9A 1KGGA 3FPVA 4JLFA 5GLAA 3KSGA 2PD8A 4EEPA 3BM6A 4ZBEA 3F1PA 3QP1A 2QJ5A 5CEDA 2V8CA 5DFYA 4B88A 4NXEA 2X02A 4GOGA 5HFOA 2Y59A 5HDCA 2OAQ1 4R70A 5TGFA 1LLBA 3C4PA 1ONGA 4Y5FA 5KSHA 2WYXA 3VP3A 3LCEA 3HCYA 3T1XA 1BYWA 4E3JA 4DKIA 2ZM2A 1FCNA 3PXPA 4G3KA 5EECA 2PR5A 3KO6A 2ZMFA 3MR0A 2ZLYA 3HLBA 3UN7A 4EXOA 1JVJA 1Z6FA 1H3QA 2XLNA 3HREA 3BEBA 3BW6A 4L0LA 4LLOB 4ZJ3A 1PZPA 1K57A 4HESA 2Y2PA 3ZG0A 2V8FA 1YAXA 5EFWA 4JF5A 1PWCA 1A0KA 2XR0A 3CMZA 4GJ4A 1YMSA 3UPPA 1H0MA 3SW1A 3V39A 1YM1A 3HJIA 3LR3A 3OPHA 5TR7A 2HP5A 2JCHA 3MJQA 3T4OA 3LYXA 4OOYA 2Y2OA 3GDIA 2HJ9C 1PI5A 1E3UA 2W1TA 1VM1A 2P7JA 2VGLM 4HBUA 3QP4A 1YLJA 3TG9A 3HUOA 5DJTA 4Y3IA 3VFHA 4E3OA 4U0TA 2OLUA 1IKIA 3EEHA 4QD4A 1UGUA 3M6HA 4PM6A 1PZOA 3AGFA 1OTAA 1ZHHB 3WS4A 2EXAA 4S2LA 3WS2A 4R38A 5F6AA 3G35A 4ARZB 3OLOA 3W4QA 2OWJA 3MZFA 2EX6A 4WL9A 4DJ3A 2EX9A 3ISGA 2QKPA 1DJBA 3EQVA 1ERMA 2O0YA 1D06A 1IELA 2P9VA 4MBFA 3S4XA 2PYRA 5HWWA 4DDYA 1I2SA 2GJ3A 1OJ5A 1TS8A 2O9AA 2ZM8A 3BFFA 3IWOA 4Y17A 3A3IA 5F69A 2QWSA 1TEMA 2JKTM 3ZFZA 4IVKA 3KSHA 3T1QB 5FAPA 3PBTA 3KSIA 4WZ4A 1OTDA 3NY4A 4PKYG 4GLQA 3QNCA 5EVEA 3MSHA 3VV4A 4QY5A 2RL3A 4AFIA 5HDDA 4S2IA 4HP9A 3UNWA 4LRYC 3UB8A 3FG8A 1K54C 5FQKA 4PHTA 1K6SA 2WAEA 2CMNA 3GR2A 2WADA 1U60A 1D7EA 4I5SA 3MXRA 3UB9A 1S4SA 1OTBA 1UWPX 1NLYA 1F9IA 4OP5A 1FSWA 2Q0OA 3M6BA 1K38A 3SZTA 1ESUA 4DE3A 2VJWA 3G31A 1EWZA 3GV9A 3IF5A 2VGLS 2YKFA 1L3LA 3LR4A 1EI5A 3UDXA 4OQIA 1GSXA 4GD8A 4GNUA 1LL8A 5L07A 4X69A 3BLMA 5K5BA 1WYBA 4GKUA 1MKIA 4JF6A 1K54A 1KE0A 2Y4AA 3UE6A 3A3JA 4C6YA 1T1AA 1VQQA 3VSLA 3K3DA 2WZXA 4KQDA 3C5AA 5F1GA 4IHQA 4Y0OA 1YLWA 2EXBA 4I3IA 3IWQA 1MPLA 5MC7A 2B02A 3GECA 1PIOA 3SH9A 3QP2A 4DMZA 5DJUA 4N9LA 1FSYA 4GN2A 4GW9A 4LCLA 1KVLA 4ME4A 3WS5A 2D01A 3TSGA 2VK3A 1L2SA 3SH7A 3QNBA 4UEYA 5HW3A 3PR6A 3ZVTA 3IF6B 1DRMA 4WZ5C 3VP4A 5J7EA 4UQIM 1YKDA 1XGJA 2E8JA 4JXVA 5FI2A 3BY9A 5FL3A 1X0OA 3V50A 3FZCA 2JKFA 1YMXA 4OKPA 4HJ3A 3E4PA 1NXYA 4HJ6A 2LB9A 4D60A 1OTIA 1TS7A 4WYYA 3G34A 1DP6A 1SHVA 2VEAA 4EU0A 2W3HA 3HBRA 3H82A 4O7DA 5EVLA 3N8LA 2ZD8A 1P0ZA 2HJEA 3VOYA 2ZL1A 3LGOA 4N9KA 2VKSA 5EVID 1WYCA 1RGZA 1SDNA 1YQSA 3UPNA 2ZC5B 3TOIA 3S7OA 3VMAA 4WM9A 4CQHA 4EV4A 3BLSA 2PU2A 4WZ5A 3U2AA 1LI0A 2IWBA 5BOHA 3GQZA 5FDSA 3IS2A 4K0XA 4HNBA 4E3KA 4OPYA 4OOLA 4S2KA 3B47A 2LB5A 4H6JA 2WZZA 4BD0A 3QP8A 3BQ8A 4JXGA 4MN7A 2EX2A 3WS0A 1MXOA 5TFQA 3M2JA 5EVIC 4M4XA 5DFXA 1GA9A 1PW8A 3PBSA 3LY3A 2HDRA 5CGSA 1CF0A 2PAVP 1ES2A 4LV3A 5IU1A 2X01A 1YPRA 1BTLA 1W63M 4NG2A 3NDEA 2ZC6B 4KZ7A 4UQIS 3LY4A 2WKIA 4GDBA 4X25A 2WGVA 2K2NA 2O99A 4BMWA 3JYIA 3P09A 4DE2A 4GHIB 4CLCB 4KZ9A 4C3QA 3PAGA 2A2LA 2Z2MB 3Q81A 4K08A 2PYPA 1W8QA 5EUAA 3MZDA 1VB6A 2P74A 4DE0A 3B42A 3CPTA 4RYEA 3CHWP 4LV0A 3W4PA 3R7WB 5U47A 4KG2A 3C2WA 4F3LB 1CEGA 2XD5A 3O3VA 4OVDA 1LSWA 3VOLA 1H8MA 3RXXA 1S4RA 1GSWA 2VV8A 3CITA 3NCKA 5F82A 2WUQA 2QHKA 3LICA 4BL3A 2R9XA 5EVIB 3GRJA 3Q7VA 3OBFA 1T19A 4EWFA 4WELA 2ZC7A 3OPRA 5C5KA 1XJ6A 1E4DA 1CEFA 3MQ0A 1XA7A 3S22A 4KQRA 4JGOA 1F98A 2ZQ8A 1XGIA 5L09A 1K6RA 2OWHA 4OQHA 1L0GA 2V20A 4EBPA 5CRFA 3S1YA 1YLTA 1S1ZA 3ZHHA 1VEUB 1PNEA 3LIFA 1F2KA 3CWFA 4EESA 3ZG8B 4Y13A 1K55A 2P04A 2XGNA 1OPXA 2ZOHA 4Q8IA 4E3LA 3T4QA 2B95A 4FTXA 2BLSA 4Y7PA 1HLUP 4UAAA 3G2ZA 4OLGA 1IYOA 1V9ZA 3HLGA 4MEZA 2L4RA 4N1HA 1PW1A 2BTFP 1JTGA 3KYZA 3V3RA 2C5WB 4IJGA 2W3FA 4EBNA 2K31A 2ACGA 2R78A 4LPZA 4S2JA 3V3SA 4YOFA 5CEBA 5E43A 3ULFA 3N4IA 5EPHA 4OP8A 3SS5A 4OPZA 3OOVA 2PBDP 1RGYA 3Q7ZA 2M1CA 4JBFA 3F1PB 1XJ3A 1ESIA 2HV1A 2YKHA 1GSVA 2WKEA 3UB5P 3T4TA 3CZDA 1XA1A 3UDFA 3MKEA 5HARA 2J9OA 3BQAA 4DDSA 4I3AA 5E2EA 3C7UA 4KQQA 1SKOA 2A3UA 3T50A 3JPUA 1OT9A 2W0NA 1NWZA 4R4RA 2Y2NA 2H10A 3HJKA 2W27A 5G18A 1DP8A 1H5XA 1T1BA 3JVUA 2D02A 4X53A 2J3WA 1E25A 5CHUA 3H7WA 4MCWA 3FWLA 1LHYA 4KUKA 2B5RA 2GZAA 4R3JA 3K2NA 3NECA 5IT5A 3RH8B 4L9GA 1P9RA 3IQAA 4Y0UA 4IUHA 5DF8A 4LRXC 5HZHA 4R1GA 5JYOA 1PI4A 2M7UA 2XEPA 1DJCA 1L0EA 3S7PA 1ES3A 4MBHA 4L9EA 5HSQA 4KZ3A 4PM5A 3T4KA 1N9NA 2W1TB 2VV6A 4G3WA 3G30A 2A24A 5CTMA 2BG1A 3NULA 3E2KA 2RCXA 1MWUA 3G6OA 1N4OA 2VGKA 3MMHA 4YNRA 3T12B 5FAQA 4GS9A 1N9OA 3FKVA 3NBLA 3MXQA 3F1NA 3EGXC 2W3GA 1YLYA 4FH2A 1NZUA 3PAEA 1OT6A 2IWCA 2Z2LB 4XUXA 5AJGA 2Y2QA 5DF9A 5EE8A 4QB8A 2P9VB 5HPFA 4KZ5A 5EOEA 1EROA 4ZAMA 4NKPA 4R3AA 4CPKA 2WGWA 3DTIA 4IBXA 5GLCA 2HDQA 2B18A 4IVIA 2ZQAA 4MLLA 3ZVWA 3KYEA 1TDLA 4DE1A 3IT9A 4PAUA 3EGDC 2XK1A 3ZG9B 5IS1A 2Y2IA 3L7HA 3BFGA 1CJFA 1LSVA 4BJPA 4XUZA 5FQMA 1T1CA 3F1OA 2UV0E 1P9WA 3ZDJA 2BASA 1BZAA 5AQAA 1FIKA 3D4FA 1IYQA 4RX3A 5DKLA 1ACFA 1BT5A 2WKQA 1ES5A 3NI9A 4OOMA 4R0QA 1KGFA 3OPLA 4EQIA 4X6TA 3IHBA 5AQ9A 1NJ4A 1LI9A 3RJUA 3Q82A 1KOUA 3PYPA 4BLMA 2VGJA 4FOFA 4U0XA 4KZ4A 2J7VA 2XROA 4KUOA 1NYMA 4EUVA 1FR6A 3GTCA 5FQQA 1FOFA 1BSGA 2H0TA 5CTNA 4BWIA 3VE3A 2Q9MA 4P0MA 1BLHA 3PBOA 5CGWA 2PU4A 2XH9A 2ZBBA 2G2UA 2A49A 5GLBA 3UE3A 1J3WA 1O07A 1I5QA 4Q0IA 3C30A 4Y0TA 4L9FA 1VETA 5D3OA 5GHZA 1NRFA 1NLZA 2J9PA 5DKKA 4Q0JA 3DWKA 1PFLA 4WLAA 2C6WB 1LL5A 4ETXA 1JNUA 4HP4A 3EWKA 2J3TD 3IWIA 3N8RA 5HWTA 2AVXA 1NRJA 4Y15A 3RXWA 3TRCA 3A3FA 1YSPA 5M1AA 2JKRM 2E8IA 4ZJ1A 1JTDA 2KX6A 1N9LA 2I9VA 2Y8HA 1TDGA 3CUEC 4PM9A 4O8GA 3UE1A 4JGPA 4KENB 4I38A 2L0WA 2J3TC 5A90A 4ESPA 4JPMA 1PWDA 3BFDA 1BLSA 4NXGA 5HL1A 4C75A 4X68A 3WRTA 2XF3A 3H82B 3QHYA 3R4KA 4LGWA 2ZL1B 3MS6A 2JE5A 3B33A 1DJAA 5F1FA 1MWSA 1W7FA 4E6WA 1MZUA 2V1BA 3OC2A 5FDHA 4XT2A 3CG5A 2EFXA 4KG6A 3E2LA 3IS2B 2H28A 2JKTI 1ZG4A 1MKMA 3T1RA 3GVBA 2VZWA 1KDSA 4II7A 3HL9A 5HD5A 1K4EA 3CUEA 4H6JB 2V0UA 1IKGA 5EM1A 1LL9A 3IX4A 3LO7A 3JVVA 4B4ZA 4ZJ2A 4P6ZM 4RVAA 1PRQA 3A0VA 4EUZA 5HAIA 5CX7A 2Z6DA 3LEQA 4MMNA 4ZDXA 3G2YA 3Q1FA 4PM8A 3GMWA 2HF6A 2Y79A 2Y2JA 1XFQA 3C38A 1G68A 3IX8A 2EWVA 4KG5A 4XXRA 1F5MA 1NZOA 2XQZA 4PMAA 1V9YA 2Y2MA 3DAVA 4B9OA 3B3XA 4DRTA 3NIAA 2DCFA 4WUJA 3CJMA 1P97A 1LT0A 3ZYTA 5GHYA 3MFDA 1ERQA 4I3JA 4GD6A 1RCJA 1ODVA 1K55C 5DVAA 3CPTB 5GLDA 3LIDA 5EOOA 5F5YA 3IBRA 3U4LP 1XJ2A 4X1MA 1XXMA 4YFMA 4G3VA 3C8CA 4JGQA 5J3WA 1Q2PA 1BLCA 2OOLA 4DXCA 3IH9A 1LSXA 5FAOA 5DF7A 4MNRA 3DTMA 3ITBA 2V1AA 2XFSA 2WGIA 3W8KA 5EM0A 3Q7VB 3T4LA 2VV7A 3NOTC 4UHUA 2R9WA 2VA0A 5HDSA 3S7QA 1S0WA 4K91A 2XA7S 4EERA 4R23A 1SDEA 3NC8A 2O9BA 2JHEA 5FEFA 1TVFA 4ID4A 5CHMA 2KLIA 2L1MA 4DN0A 5A91A 3V67A 5F68A 4P6ZS 4MBKA 1FCOA 4BBTA 3O88A 4OLDA 2XFTA 3MZEA 3T1SA 5KSCA 2I72A 1OMEA 3NOPC 4K0WA 1XPBA 2ZQCA 3MXSA 2JKRI 2ZQ7A 2Y55A 3C7VA 1W79A 3OPPA 4HY8A 4MDZA 5HX9A 2IWDA 5TBMA 5JYPA 1JWZA 1S67L 3UDIA 5M19A 3MF0A 4FCFA 3AGEA 4P6BA 1S1YA 2JKGA 2GNXA 1L0FA 1M6KA 2Z6CA 3PBQA 1AXBA 2W3EA 4P85A 2OAP1 3E98A 4E3NA 1L0DA 5A93A
chains in the Genus database with same CATH topology
2P08A 3K3CA 1TS6A 3CLOA 1DRMA 3LIBA 5HPFA 3LFVA 3R7WA 5J7EA 1OTEA 4UQIM 4F3LA 3BWLA 3NOUC 1YKDA 2JN7A 4NKPA 4R3AA 4QPRA 3RFBA 3BY9A 5FL3A 1IOUA 1X0OA 4O01A 1EW0A 2EWWA 3FC7A 4HJ3A 3E4PA 2B18A 4R6LA 5LBRA 1YSQA 3MFXA 4HJ6A 2LB9A 4GCZA 1OTIA 1MC0A 1TS7A 4PAUA 3EGDC 1DP6A 3E4OA 5IS1A 2VEAA 1LSVA 4BJPA 4EU0A 2WKRA 2W3HA 3VE4A 3UB6A 4PKYA 1T1CA 2QYBA 3EEAA 3F1OA 3H82A 2VLGA 1P9WA 1P0ZA 2HJEA 2BASA 2VKSA 2XRNA 2G7UA 5DKLA 3S7OA 4CQHA 2WKQA 3LUQA 3U2AA 4OOMA 2ZMVA 3IS2A 3NHQA 4HNBA 5TJJA 4HHDA 3LR0A 5I5LA 4WEKA 3LI9A 4KQOA 4OOLA 1KOUA 3RTYA 3H7WB 3PYPA 3B47A 2LB5A 2W3DA 4Y2FA 2DMWA 4FOFA 4H6JA 3UMDA 1WA9A 4NXFA 3BQ8A 4WEJA 4MN7A 2XROA 4KUOA 2PDRA 3EQUA 3D72A 3UB7A 2NUPC 4EUVA 4M4XA 4WN5A 4IUKA 5DFXA 3PBSA 5AVFA 4BWIA 2NUTC 3VE3A 4ZRRA 5AVEA 4ARZA 3DBAA 3PBOA 3TJZC 1W63Q 2ZBBA 2QJ7A 4NXBA 4EEUA 3FPWA 3UE3A 5IU1A 3P01A 2M7VA 4Q0IA 2XSSA 2K7SA 3C30A 1XJ4A 3LIEA 4L9FA 4JGRA 1W63M 1VHMA 2V0WA 3EOIA 3A0SA 4HH3A 2A24B 2FH5A 1NLZA 4BBVA 4HH2A 4UQIS 5DKKA 4Z1WA 1TS0A 5TBMB 4Q0JA 2K2NA 2O99A 4BMWA 1TF1A 4GS9B 4WLAA 4ETXA 2V9AA 2PHYA 4HOIA 1JNUA 2VX8A 4GHIB 4HP4A 3EWKA 4NEED 5HD3A 4CLCB 3F1NB 3CI6A 3FPVA 2J3TD 5KIZA 1XFNA 3KSGA 2PD8A 2A2LA 4EEPA 5HWTA 4WF0A 4K08A 3F1PA 4EW7A 1NRJA 2PYPA 3OCNA 2QJ5A 3TRCA 1OJGA 1VB6A 1YSPA 5DFYA 3B42A 4YWZA 4NXEA 5G4YA 2PR6A 4ETZA 5HDCA 2JKRM 2OAQ1 3R7WB 4R70A 3C2WA 4F3LB 3T4SA 2KX6A 4Y5FA 1LSWA 1N9LA 5KSHA 2I9VA 3BJNA 3VOLA 1H8MA 2Y8HA 3CAXA 1S4RA 1GSWA 2VV8A 3CITA 3CUEC 3HCYA 4O8GA 1BYWA 4JGPA 3PXPA 2HGVA 2QHKA 3LICA 4G3KA 3IBJA 4I38A 2PR5A 2L0WA 2J3TC 2ZMFA 3KO6A 3KX0X 3MR0A 3OBFA 1T19A 4WELA 4EXOA 3S7NA 1H3QA 5C5KA 5G4ZA 1XJ6A 3MQ0A 3BW6A 4NXGA 3H9WA 4L0LA 4LLOB 3F1OB 3H82B 3R4KA 4JGOA 4HQAA 3OCLA 1YAXA 5EFWA 3B33A 1F98A 4HJ4A 2OWHA 1MZUA 2V1BA 4GJ4A 3OC2A 3SW1A 4XT2A 2MJ6A 2EA9A 1S1ZA 4EETB 3IS2B 3LIAA 3HJIA 2H28A 3LR3A 2JKTI 4RQ9A 3MJQA 1MKMA 3KYQA 3LIFA 3LYXA 3T4OA 2VZWA 3CWFA 4II7A 4EESA 4HI4A 3GDIA 2HJ9C 2P04A 4EQ1A 5HD5A 3CUEA 2W1TA 1OPXA 2ZOHA 2V0UA 4H6JB 2P7JA 2VGLM 3A0RA 3T4QA 5DJTA 4Y3IA 3JVVA 4P6ZM 1V9ZA 3EEHA 3A0VA 1UGUA 3P7NA 1OTAA 2L4RA 1ZHHB 4R38A 4I39A 5CX7A 5F6AA 4ARZB 3LI8A 2Z6DA 3OLOA 4MMNA 2OWJA 1ZTUA 4WL9A 1STZA 4DJ3A 3KYZA 5A8BA 2FZ0A 2QKPA 4IJGA 3EQVA 2HF6A 2W3FA 2Y79A 2K31A 1XFQA 3C38A 2O0YA 1D06A 2PYRA 5HWWA 4LRZE 2R78A 1UWNX 2GJ3A 3O5YA 1OJ5A 2EWVA 1TS8A 3BY8A 2O9AA 3PBRA 4LPZA 4Q0HA 5F69A 2QWSA 1F5MA 2JKTM 3MQOA 4YOFA 1V9YA 3KSHA 5J4EA 4B9OA 3ULFA 3PBTA 4WUJA 2W1RA 1P97A 3KSIA 1LT0A 3ZYTA 3OOVA 1OTDA 4I3JA 2M1CA 3F1PB 4CLCD 1ODVA 4PKYG 1XJ3A 4GLQA 5HPIA 2ZOIA 4DJ2A 2HV1A 2YKHA 1G6OA 1GSVA 3E0YA 3LIDA 3NJAA 3VV4A 5F5YA 4AFIA 3T4TA 3IBRA 5HDDA 1XJ2A 4HP9A 4LRYC 3UB8A 3FG8A 4G3VA 3C8CA 2IA2A 4JGQA 4PHTA 3BQAA 2CMNA 1S66L 5J3WA 4I3AA 1D7EA 4E04A 2OOLA 3W2ZA 5L8MA 1LSXA 3KSFA 1Y28A 3LR5A 4I5SA 2V1AA 3UB9A 3T50A 2GX5A 1S4SA 1OTBA 1UWPX 1NLYA 1F9IA 2J80A 1OT9A 3T4LA 2VV7A 3ZQ5A 2W0NA 3NOTC 4CLCE 2VA0A 5HDSA 3S7QA 1NWZA 4HIAA 3HJKA 2W27A 4CLCC 3JVUA 1DP8A 1DP9A 1T1BA 2D02A 2XA7S 2KDKA 2J3WA 3H7WA 4EERA 4MCWA 2O9BA 2VJWA 3T4JA 2JHEA 3E4QA 4KUKA 2GZAA 3K2NA 5IT5A 3RH8B 2XA7M 2VGLS 4L9GA 2KLIA 2YKFA 1P9RA 2L1MA 4DN0A 3LR4A 3V67A 4IUHA 5F68A 4P6ZS 4LRXC 5HZHA 1GSXA 1LL8A 4BBTA 2M7UA 3MQQA 4XT2B 5K5BA 3TW8A 3S7PA 4O0PA 2WKPA 4L9EA 3UE6A 3NOPC 1T1AA 1T18A 1G28A 3TE8A 3K3DA 5HSQA 2O9CA 2PD7A 4KQDA 2PT7A 4IHQA 3T4KA 1N9NA 2JKRI 2W1TB 4I3IA 4B93A 4MN5A 2VV6A 5MC7A 4G3WA 2B02A 2KOIA 3GECA 2A24A 4HY8A 3G6OA 4MDZA 1TD5A 5TBMA 3MMHA 3PHYA 4YNRA 3PBNA 5HWVA 4DMZA 1S67L 4GS9A 4FSFA 5DJUA 1N9OA 3MF0A 3D3OA 4GW9A 4GHIA 4ME4A 3MXQA 4CLCA 2D01A 1S1YA 3F1NA 4MN6A 2GNXA 3EGXC 5HL6A 2W3GA 1OT6A 2Z6CA 2INWA 3PBQA 3UMEA 2W3EA 3ICYA 2OAP1 5AJGA 4BBUA 3E98A 5DF9A 4UEYA 3PR6A 1IFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3V A;  2IA2 A;  3DBA A;  5HPF A;  3LFV A;  4E04 A;  2OOL A;  3W2Z A;  5L8M A;  3KSF A;  2M7V A;  3NOU C;  1YKD A;  2XSS A;  4Q0I A;  4RQ9 A;  1MKM A;  4QPR A;  3RFB A;  2GX5 A;  2VZW A;  1VHM A;  4O01 A;  3ZQ5 A;  3NOT C;  4Z1W A;  3S7Q A;  2W1T A;  2B18 A;  4Q0J A;  2K2N A;  2O99 A;  4R6L A;  1TF1 A;  5LBR A;  1YSQ A;  4ETX A;  2LB9 A;  4Y3I A;  1MC0 A;  4MCW A;  4PAU A;  2O9B A;  2VJW A;  3CI6 A;  3KSG A;  2VEA A;  3K2N A;  4EU0 A;  2W3H A;  2KLI A;  3TRC A;  2QYB A;  3EEA A;  4DN0 A;  1YSP A;  5DFY A;  4IUH A;  4MMN A;  4LRX C;  1ZTU A;  4ETZ A;  1STZ A;  2M7U A;  2VKS A;  2XRN A;  4R70 A;  2G7U A;  3C2W A;  5K5B A;  4IJG A;  3S7P A;  2W3F A;  4Y5F A;  2Y79 A;  3S7O A;  2K31 A;  4O0P A;  2O0Y A;  4CQH A;  3BJN A;  3NOP C;  4LRZ E;  3O5Y A;  2Y8H A;  2O9A A;  5HSQ A;  3CIT A;  2O9C A;  3HCY A;  3NHQ A;  4Q0H A;  4O8G A;  5TJJ A;  1F5M A;  2HGV A;  2W1T B;  4YOF A;  4G3K A;  4G3W A;  5I5L A;  2KOI A;  3KSH A;  3IBJ A;  3KO6 A;  2ZMF A;  3OBF A;  3G6O A;  4MDZ A;  2LB5 A;  2W3D A;  1TD5 A;  2W1R A;  3KSI A;  3MMH A;  4Y2F A;  4YNR A;  4FOF A;  3S7N A;  4DMZ A;  3OOV A;  3MF0 A;  3D3O A;  4GW9 A;  5C5K A;  4MN7 A;  4ME4 A;  2XRO A;  3MQ0 A;  4GLQ A;  2W3G A;  5HL6 A;  5HPI A;  4EUV A;  3E0Y A;  5DFX A;  4IUK A;  2W3E A;  3R4K A;  5AJG A;  3VV4 A;  3E98 A;  3IBR A;  4BWI A;  4LRY C;  4ZRR A; 
#chains in the Genus database with same CATH topology
 3O87 A;  2P08 A;  1TS6 A;  3CLO A;  1QMF A;  2G2W A;  3SS3 A;  3LIB A;  3LFV A;  3M2K A;  4FH4 A;  1OTE A;  4R4S A;  3BWL A;  4KZB A;  2JN7 A;  5L2F A;  4JXS A;  1BLP A;  4OPR A;  5CHJ A;  4X1L A;  1Y4O A;  5FSR A;  4FD8 A;  3Q07 A;  3IXD A;  1IOU A;  4RA7 A;  2EWW A;  1GCE A;  3FC7 A;  4S2N A;  1IYP A;  4R6L A;  3MKF A;  1YSQ A;  5LBR A;  5IHV A;  1HZO A;  3A3D A;  2XD1 A;  4S2O A;  2H0Y A;  3E4O A;  4D2O A;  5A92 A;  3ZCZ A;  2XDM A;  2WKR A;  3VE4 A;  4B4X A;  3UE0 A;  5DTS A;  3VP1 A;  5HAQ A;  2DRW A;  2VLG A;  4GB7 A;  2XRN A;  5FAT A;  3VP0 A;  1SKO B;  3FKW A;  1MWR A;  2ZMV A;  5GL9 A;  5TJJ A;  3N6I A;  4DXB A;  4KQO A;  1HTZ A;  3H7W B;  1ZKJ A;  1HD8 A;  3VOZ A;  1H8Z A;  2W3D A;  1ES4 A;  2WK0 A;  2ZQD A;  4F94 A;  2PDR A;  1RP5 A;  3ZGA B;  1K25 A;  5FI7 A;  3LEZ A;  2NUP C;  3UY6 A;  4IUK A;  2X71 A;  1HVB A;  2PRF A;  4OQ0 A;  2Y2K A;  3HLE A;  4ARZ A;  3DBA A;  5FA7 A;  5HAP A;  3VSK A;  2HDS A;  1W63 Q;  3FPW A;  1FR1 A;  4X55 A;  4PM7 A;  5GHX A;  3HUN A;  3P01 A;  2M7V A;  1XJ4 A;  1S6R A;  5EV0 A;  4JGR A;  1YLP A;  1VHM A;  2JBF A;  4HH3 A;  2A24 B;  2FH5 A;  4BBV A;  4HH2 A;  4Z1W A;  1D1J A;  1TS0 A;  4A5R A;  4GZB A;  4GS9 B;  2V9A A;  4HOI A;  5DTT A;  4E6X A;  1O7E A;  2DNS A;  5HD3 A;  1XKZ A;  3F1N B;  3CI6 A;  5KIZ A;  1XFN A;  3V5M A;  5CEC A;  4WF0 A;  4EW7 A;  4QJG A;  3OCN A;  1OJG A;  4YWZ A;  4IED A;  5G4Y A;  2HDU A;  2PR6 A;  1BUL A;  5FQI A;  4ETZ A;  4LV2 A;  3HLF A;  3T4S A;  3ZNT A;  5FI6 A;  3DW0 A;  2UWX A;  3BJN A;  2WGW B;  3CAX A;  4OON A;  1KDW A;  2HGV A;  3IBJ A;  1SCW A;  3KX0 X;  1AWI A;  4HBT A;  1BUE A;  3I7J A;  4BL2 A;  3S7N A;  3L9K A;  4LFU A;  5G4Z A;  1ZC2 A;  3H9W A;  3F1O B;  3A3E A;  1GHI A;  3WWX A;  4HQA A;  3OCL A;  3IF6 C;  3HVF A;  4HJ4 A;  2CC1 A;  2HP6 A;  1IYS A;  4X56 A;  3DTE A;  2FFY A;  2MJ6 A;  3BFE A;  2EA9 A;  4EET B;  3LIA A;  2Y2H A;  4RQ9 A;  3KYQ A;  2Y2L A;  1NYY A;  4HI4 A;  1XP4 A;  4EQ1 A;  4LCM A;  4RX2 A;  1SKF A;  3N7W A;  2ZC3 B;  2JC7 A;  3A0R A;  4S2P A;  5E2F A;  4BEN A;  4PPR A;  1FCM A;  3P7N A;  4QU3 A;  1JWP A;  4I39 A;  3G32 A;  3LI8 A;  3O86 A;  5AQB A;  1ZTU A;  1FIL A;  3IHA A;  4FUW A;  1STZ A;  5A8B A;  3HLD A;  2FZ0 A;  3IF6 A;  1GA0 A;  3ZG7 B;  4P87 A;  4LRZ E;  1VET B;  3O5Y A;  1UWN X;  3IXG A;  3BY8 A;  3PBR A;  4Q0H A;  4WBG A;  3MQO A;  5CXW A;  2QPN A;  5J4E A;  1W8Y A;  4JKT A;  2W1R A;  1QME A;  4KZ6 A;  1CK3 A;  1I2W A;  5CGX A;  4HEF A;  3UO9 A;  4CLC D;  3SOI A;  5HPI A;  2ZOI A;  4DJ2 A;  5I94 A;  1G6O A;  3E0Y A;  3NJA A;  1JWV A;  3DTK A;  2IA2 A;  3SS4 A;  4E3M A;  1S66 L;  4E04 A;  1SZV A;  3W2Z A;  4LV1 A;  5L8M A;  3KSF A;  1Y28 A;  4UA7 A;  3LR5 A;  3IXH A;  3IXB A;  3IX3 A;  1IEM A;  4DF6 A;  1W5D A;  2GX5 A;  2WAF A;  2J80 A;  3G4P A;  1GHP A;  1KVM A;  3ZQ5 A;  4CLC E;  3FV7 A;  5FQ9 A;  1G6A A;  4KZ8 A;  4HIA A;  4CLC C;  1DP9 A;  2KDK A;  5KZH A;  4NK3 A;  1Z09 A;  1J9M A;  3T4J A;  3C4O A;  3E4Q A;  3QP5 A;  4QWO A;  3HUM A;  4Z9Q A;  2XA7 M;  1MY8 A;  1ALQ A;  4QY6 A;  2H5S A;  2QZ6 A;  3BRM A;  4OQG A;  3UPO A;  1MBL A;  1FQG A;  2OSU A;  3MQQ A;  1YT4 A;  2WKH A;  4XT2 B;  3TW8 A;  4O0P A;  2WKP A;  1T18 A;  1G28 A;  3P98 A;  3TE8 A;  1DY6 A;  2O9C A;  2PD7 A;  4UA9 A;  2FFF B;  2PT7 A;  3HLC A;  3HLW A;  2HZ5 A;  5F83 A;  4B93 A;  4MN5 A;  2KOI A;  2QMI A;  1TD5 A;  3PHY A;  5J8X A;  4YIN A;  3PBN A;  5HWV A;  2ZM0 A;  4FSF A;  1K56 D;  2V2F F;  3D3O A;  5DTK A;  1PWG A;  4GHI A;  4CLC A;  2OV5 A;  4MN6 A;  5FQJ A;  5HL6 A;  2INW A;  3WRZ A;  1C3B A;  4UA6 A;  3UME A;  1Q2Q A;  3OZH A;  3ICY A;  4BBU A;  2ZC4 B;  1IFQ A;  4U3T A;  1YLZ A;  3ZNY A;  3K3C A;  4GDN A;  3BYD A;  4WMC D;  3R7W A;  2HP9 A;  4F3L A;  3NOU C;  1H8Y A;  4N1X A;  4OH0 A;  4QPR A;  3RFB A;  1CI9 A;  3AGD A;  1KE3 A;  4O01 A;  1EW0 A;  3GSG A;  4ZTK A;  4H8R A;  5EVI A;  1CQA A;  3MFX A;  2GDN A;  1ONH A;  4GCZ A;  1MC0 A;  5KMW A;  2Y2G A;  4M3K A;  3UB6 A;  4PKY A;  2QYB A;  3EEA A;  1K4F A;  3WS1 A;  2HPB A;  3NDG A;  4JXW A;  3W4O A;  2Q9N A;  4S2M A;  5M18 A;  2G7U A;  2EFU A;  1M40 A;  2EX8 A;  4CJN A;  3LUQ A;  4E3I A;  4EBL A;  2ZMA A;  3NHQ A;  1VEU A;  4OPQ A;  2V1Z A;  1ZG6 A;  4HHD A;  4QHC A;  3LR0 A;  1CI8 A;  5I5L A;  4WEK A;  3LI9 A;  2ZQ9 A;  3RTY A;  1MWT A;  3BEC A;  1K0K A;  1GHM A;  4Y2F A;  5AQ7 A;  2DMW A;  4LEN A;  1K56 A;  3UMD A;  1WA9 A;  4NXF A;  4WEJ A;  2PBY A;  3EQU A;  3D72 A;  5CER A;  3UB7 A;  1KGE A;  4S2N C;  3DWZ A;  4WN5 A;  1Y54 A;  4N92 A;  1KE4 A;  1G5U A;  5AVF A;  2NUT C;  1WE4 A;  4ZRR A;  5AVE A;  3TJZ C;  3ZG5 A;  4JF4 A;  1NY0 A;  1N9B A;  4BQM A;  3N8S A;  1PYY A;  2J8Y A;  2QJ7 A;  3FYZ A;  4WMC A;  4NXB A;  4EEU A;  5E2H A;  4KZA A;  2Y91 A;  2XSS A;  2K7S A;  3LIE A;  3SH8 A;  2OLV A;  5FAS A;  5L10 A;  3D9Y A;  3A0S A;  2V0W A;  3EOI A;  5E2G A;  4R3B A;  3QP6 A;  3IH8 A;  5FEG A;  3PTE A;  4IBR A;  3VP2 A;  5TBM B;  4BD1 A;  1E3U D;  4NET A;  1TF1 A;  1XX2 A;  2PHY A;  3ITA A;  3VFF A;  2VX8 A;  4NEE D;  1K57 C;  3MBZ A;  3BFC A;  2ZJ9 A;  1KGG A;  3FPV A;  4JLF A;  5GLA A;  3KSG A;  2PD8 A;  4EEP A;  3BM6 A;  4ZBE A;  3F1P A;  3QP1 A;  2QJ5 A;  5CED A;  2V8C A;  5DFY A;  4B88 A;  4NXE A;  2X02 A;  4GOG A;  5HFO A;  2Y59 A;  5HDC A;  2OAQ 1;  4R70 A;  5TGF A;  1LLB A;  3C4P A;  1ONG A;  4Y5F A;  5KSH A;  2WYX A;  3VP3 A;  3LCE A;  3HCY A;  3T1X A;  1BYW A;  4E3J A;  4DKI A;  2ZM2 A;  1FCN A;  3PXP A;  4G3K A;  5EEC A;  2PR5 A;  3KO6 A;  2ZMF A;  3MR0 A;  2ZLY A;  3HLB A;  3UN7 A;  4EXO A;  1JVJ A;  1Z6F A;  1H3Q A;  2XLN A;  3HRE A;  3BEB A;  3BW6 A;  4L0L A;  4LLO B;  4ZJ3 A;  1PZP A;  1K57 A;  4HES A;  2Y2P A;  3ZG0 A;  2V8F A;  1YAX A;  5EFW A;  4JF5 A;  1PWC A;  1A0K A;  2XR0 A;  3CMZ A;  4GJ4 A;  1YMS A;  3UPP A;  1H0M A;  3SW1 A;  3V39 A;  1YM1 A;  3HJI A;  3LR3 A;  3OPH A;  5TR7 A;  2HP5 A;  2JCH A;  3MJQ A;  3T4O A;  3LYX A;  4OOY A;  2Y2O A;  3GDI A;  2HJ9 C;  1PI5 A;  1E3U A;  2W1T A;  1VM1 A;  2P7J A;  2VGL M;  4HBU A;  3QP4 A;  1YLJ A;  3TG9 A;  3HUO A;  5DJT A;  4Y3I A;  3VFH A;  4E3O A;  4U0T A;  2OLU A;  1IKI A;  3EEH A;  4QD4 A;  1UGU A;  3M6H A;  4PM6 A;  1PZO A;  3AGF A;  1OTA A;  1ZHH B;  3WS4 A;  2EXA A;  4S2L A;  3WS2 A;  4R38 A;  5F6A A;  3G35 A;  4ARZ B;  3OLO A;  3W4Q A;  2OWJ A;  3MZF A;  2EX6 A;  4WL9 A;  4DJ3 A;  2EX9 A;  3ISG A;  2QKP A;  1DJB A;  3EQV A;  1ERM A;  2O0Y A;  1D06 A;  1IEL A;  2P9V A;  4MBF A;  3S4X A;  2PYR A;  5HWW A;  4DDY A;  1I2S A;  2GJ3 A;  1OJ5 A;  1TS8 A;  2O9A A;  2ZM8 A;  3BFF A;  3IWO A;  4Y17 A;  3A3I A;  5F69 A;  2QWS A;  1TEM A;  2JKT M;  3ZFZ A;  4IVK A;  3KSH A;  3T1Q B;  5FAP A;  3PBT A;  3KSI A;  4WZ4 A;  1OTD A;  3NY4 A;  4PKY G;  4GLQ A;  3QNC A;  5EVE A;  3MSH A;  3VV4 A;  4QY5 A;  2RL3 A;  4AFI A;  5HDD A;  4S2I A;  4HP9 A;  3UNW A;  4LRY C;  3UB8 A;  3FG8 A;  1K54 C;  5FQK A;  4PHT A;  1K6S A;  2WAE A;  2CMN A;  3GR2 A;  2WAD A;  1U60 A;  1D7E A;  4I5S A;  3MXR A;  3UB9 A;  1S4S A;  1OTB A;  1UWP X;  1NLY A;  1F9I A;  4OP5 A;  1FSW A;  2Q0O A;  3M6B A;  1K38 A;  3SZT A;  1ESU A;  4DE3 A;  2VJW A;  3G31 A;  1EWZ A;  3GV9 A;  3IF5 A;  2VGL S;  2YKF A;  1L3L A;  3LR4 A;  1EI5 A;  3UDX A;  4OQI A;  1GSX A;  4GD8 A;  4GNU A;  1LL8 A;  5L07 A;  4X69 A;  3BLM A;  5K5B A;  1WYB A;  4GKU A;  1MKI A;  4JF6 A;  1K54 A;  1KE0 A;  2Y4A A;  3UE6 A;  3A3J A;  4C6Y A;  1T1A A;  1VQQ A;  3VSL A;  3K3D A;  2WZX A;  4KQD A;  3C5A A;  5F1G A;  4IHQ A;  4Y0O A;  1YLW A;  2EXB A;  4I3I A;  3IWQ A;  1MPL A;  5MC7 A;  2B02 A;  3GEC A;  1PIO A;  3SH9 A;  3QP2 A;  4DMZ A;  5DJU A;  4N9L A;  1FSY A;  4GN2 A;  4GW9 A;  4LCL A;  1KVL A;  4ME4 A;  3WS5 A;  2D01 A;  3TSG A;  2VK3 A;  1L2S A;  3SH7 A;  3QNB A;  4UEY A;  5HW3 A;  3PR6 A;  3ZVT A;  3IF6 B;  1DRM A;  4WZ5 C;  3VP4 A;  5J7E A;  4UQI M;  1YKD A;  1XGJ A;  2E8J A;  4JXV A;  5FI2 A;  3BY9 A;  5FL3 A;  1X0O A;  3V50 A;  3FZC A;  2JKF A;  1YMX A;  4OKP A;  4HJ3 A;  3E4P A;  1NXY A;  4HJ6 A;  2LB9 A;  4D60 A;  1OTI A;  1TS7 A;  4WYY A;  3G34 A;  1DP6 A;  1SHV A;  2VEA A;  4EU0 A;  2W3H A;  3HBR A;  3H82 A;  4O7D A;  5EVL A;  3N8L A;  2ZD8 A;  1P0Z A;  2HJE A;  3VOY A;  2ZL1 A;  3LGO A;  4N9K A;  2VKS A;  5EVI D;  1WYC A;  1RGZ A;  1SDN A;  1YQS A;  3UPN A;  2ZC5 B;  3TOI A;  3S7O A;  3VMA A;  4WM9 A;  4CQH A;  4EV4 A;  3BLS A;  2PU2 A;  4WZ5 A;  3U2A A;  1LI0 A;  2IWB A;  5BOH A;  3GQZ A;  5FDS A;  3IS2 A;  4K0X A;  4HNB A;  4E3K A;  4OPY A;  4OOL A;  4S2K A;  3B47 A;  2LB5 A;  4H6J A;  2WZZ A;  4BD0 A;  3QP8 A;  3BQ8 A;  4JXG A;  4MN7 A;  2EX2 A;  3WS0 A;  1MXO A;  5TFQ A;  3M2J A;  5EVI C;  4M4X A;  5DFX A;  1GA9 A;  1PW8 A;  3PBS A;  3LY3 A;  2HDR A;  5CGS A;  1CF0 A;  2PAV P;  1ES2 A;  4LV3 A;  5IU1 A;  2X01 A;  1YPR A;  1BTL A;  1W63 M;  4NG2 A;  3NDE A;  2ZC6 B;  4KZ7 A;  4UQI S;  3LY4 A;  2WKI A;  4GDB A;  4X25 A;  2WGV A;  2K2N A;  2O99 A;  4BMW A;  3JYI A;  3P09 A;  4DE2 A;  4GHI B;  4CLC B;  4KZ9 A;  4C3Q A;  3PAG A;  2A2L A;  2Z2M B;  3Q81 A;  4K08 A;  2PYP A;  1W8Q A;  5EUA A;  3MZD A;  1VB6 A;  2P74 A;  4DE0 A;  3B42 A;  3CPT A;  4RYE A;  3CHW P;  4LV0 A;  3W4P A;  3R7W B;  5U47 A;  4KG2 A;  3C2W A;  4F3L B;  1CEG A;  2XD5 A;  3O3V A;  4OVD A;  1LSW A;  3VOL A;  1H8M A;  3RXX A;  1S4R A;  1GSW A;  2VV8 A;  3CIT A;  3NCK A;  5F82 A;  2WUQ A;  2QHK A;  3LIC A;  4BL3 A;  2R9X A;  5EVI B;  3GRJ A;  3Q7V A;  3OBF A;  1T19 A;  4EWF A;  4WEL A;  2ZC7 A;  3OPR A;  5C5K A;  1XJ6 A;  1E4D A;  1CEF A;  3MQ0 A;  1XA7 A;  3S22 A;  4KQR A;  4JGO A;  1F98 A;  2ZQ8 A;  1XGI A;  5L09 A;  1K6R A;  2OWH A;  4OQH A;  1L0G A;  2V20 A;  4EBP A;  5CRF A;  3S1Y A;  1YLT A;  1S1Z A;  3ZHH A;  1VEU B;  1PNE A;  3LIF A;  1F2K A;  3CWF A;  4EES A;  3ZG8 B;  4Y13 A;  1K55 A;  2P04 A;  2XGN A;  1OPX A;  2ZOH A;  4Q8I A;  4E3L A;  3T4Q A;  2B95 A;  4FTX A;  2BLS A;  4Y7P A;  1HLU P;  4UAA A;  3G2Z A;  4OLG A;  1IYO A;  1V9Z A;  3HLG A;  4MEZ A;  2L4R A;  4N1H A;  1PW1 A;  2BTF P;  1JTG A;  3KYZ A;  3V3R A;  2C5W B;  4IJG A;  2W3F A;  4EBN A;  2K31 A;  2ACG A;  2R78 A;  4LPZ A;  4S2J A;  3V3S A;  4YOF A;  5CEB A;  5E43 A;  3ULF A;  3N4I A;  5EPH A;  4OP8 A;  3SS5 A;  4OPZ A;  3OOV A;  2PBD P;  1RGY A;  3Q7Z A;  2M1C A;  4JBF A;  3F1P B;  1XJ3 A;  1ESI A;  2HV1 A;  2YKH A;  1GSV A;  2WKE A;  3UB5 P;  3T4T A;  3CZD A;  1XA1 A;  3UDF A;  3MKE A;  5HAR A;  2J9O A;  3BQA A;  4DDS A;  4I3A A;  5E2E A;  3C7U A;  4KQQ A;  1SKO A;  2A3U A;  3T50 A;  3JPU A;  1OT9 A;  2W0N A;  1NWZ A;  4R4R A;  2Y2N A;  2H10 A;  3HJK A;  2W27 A;  5G18 A;  1DP8 A;  1H5X A;  1T1B A;  3JVU A;  2D02 A;  4X53 A;  2J3W A;  1E25 A;  5CHU A;  3H7W A;  4MCW A;  3FWL A;  1LHY A;  4KUK A;  2B5R A;  2GZA A;  4R3J A;  3K2N A;  3NEC A;  5IT5 A;  3RH8 B;  4L9G A;  1P9R A;  3IQA A;  4Y0U A;  4IUH A;  5DF8 A;  4LRX C;  5HZH A;  4R1G A;  5JYO A;  1PI4 A;  2M7U A;  2XEP A;  1DJC A;  1L0E A;  3S7P A;  1ES3 A;  4MBH A;  4L9E A;  5HSQ A;  4KZ3 A;  4PM5 A;  3T4K A;  1N9N A;  2W1T B;  2VV6 A;  4G3W A;  3G30 A;  2A24 A;  5CTM A;  2BG1 A;  3NUL A;  3E2K A;  2RCX A;  1MWU A;  3G6O A;  1N4O A;  2VGK A;  3MMH A;  4YNR A;  3T12 B;  5FAQ A;  4GS9 A;  1N9O A;  3FKV A;  3NBL A;  3MXQ A;  3F1N A;  3EGX C;  2W3G A;  1YLY A;  4FH2 A;  1NZU A;  3PAE A;  1OT6 A;  2IWC A;  2Z2L B;  4XUX A;  5AJG A;  2Y2Q A;  5DF9 A;  5EE8 A;  4QB8 A;  2P9V B;  5HPF A;  4KZ5 A;  5EOE A;  1ERO A;  4ZAM A;  4NKP A;  4R3A A;  4CPK A;  2WGW A;  3DTI A;  4IBX A;  5GLC A;  2HDQ A;  2B18 A;  4IVI A;  2ZQA A;  4MLL A;  3ZVW A;  3KYE A;  1TDL A;  4DE1 A;  3IT9 A;  4PAU A;  3EGD C;  2XK1 A;  3ZG9 B;  5IS1 A;  2Y2I A;  3L7H A;  3BFG A;  1CJF A;  1LSV A;  4BJP A;  4XUZ A;  5FQM A;  1T1C A;  3F1O A;  2UV0 E;  1P9W A;  3ZDJ A;  2BAS A;  1BZA A;  5AQA A;  1FIK A;  3D4F A;  1IYQ A;  4RX3 A;  5DKL A;  1ACF A;  1BT5 A;  2WKQ A;  1ES5 A;  3NI9 A;  4OOM A;  4R0Q A;  1KGF A;  3OPL A;  4EQI A;  4X6T A;  3IHB A;  5AQ9 A;  1NJ4 A;  1LI9 A;  3RJU A;  3Q82 A;  1KOU A;  3PYP A;  4BLM A;  2VGJ A;  4FOF A;  4U0X A;  4KZ4 A;  2J7V A;  2XRO A;  4KUO A;  1NYM A;  4EUV A;  1FR6 A;  3GTC A;  5FQQ A;  1FOF A;  1BSG A;  2H0T A;  5CTN A;  4BWI A;  3VE3 A;  2Q9M A;  4P0M A;  1BLH A;  3PBO A;  5CGW A;  2PU4 A;  2XH9 A;  2ZBB A;  2G2U A;  2A49 A;  5GLB A;  3UE3 A;  1J3W A;  1O07 A;  1I5Q A;  4Q0I A;  3C30 A;  4Y0T A;  4L9F A;  1VET A;  5D3O A;  5GHZ A;  1NRF A;  1NLZ A;  2J9P A;  5DKK A;  4Q0J A;  3DWK A;  1PFL A;  4WLA A;  2C6W B;  1LL5 A;  4ETX A;  1JNU A;  4HP4 A;  3EWK A;  2J3T D;  3IWI A;  3N8R A;  5HWT A;  2AVX A;  1NRJ A;  4Y15 A;  3RXW A;  3TRC A;  3A3F A;  1YSP A;  5M1A A;  2JKR M;  2E8I A;  4ZJ1 A;  1JTD A;  2KX6 A;  1N9L A;  2I9V A;  2Y8H A;  1TDG A;  3CUE C;  4PM9 A;  4O8G A;  3UE1 A;  4JGP A;  4KEN B;  4I38 A;  2L0W A;  2J3T C;  5A90 A;  4ESP A;  4JPM A;  1PWD A;  3BFD A;  1BLS A;  4NXG A;  5HL1 A;  4C75 A;  4X68 A;  3WRT A;  2XF3 A;  3H82 B;  3QHY A;  3R4K A;  4LGW A;  2ZL1 B;  3MS6 A;  2JE5 A;  3B33 A;  1DJA A;  5F1F A;  1MWS A;  1W7F A;  4E6W A;  1MZU A;  2V1B A;  3OC2 A;  5FDH A;  4XT2 A;  3CG5 A;  2EFX A;  4KG6 A;  3E2L A;  3IS2 B;  2H28 A;  2JKT I;  1ZG4 A;  1MKM A;  3T1R A;  3GVB A;  2VZW A;  1KDS A;  4II7 A;  3HL9 A;  5HD5 A;  1K4E A;  3CUE A;  4H6J B;  2V0U A;  1IKG A;  5EM1 A;  1LL9 A;  3IX4 A;  3LO7 A;  3JVV A;  4B4Z A;  4ZJ2 A;  4P6Z M;  4RVA A;  1PRQ A;  3A0V A;  4EUZ A;  5HAI A;  5CX7 A;  2Z6D A;  3LEQ A;  4MMN A;  4ZDX A;  3G2Y A;  3Q1F A;  4PM8 A;  3GMW A;  2HF6 A;  2Y79 A;  2Y2J A;  1XFQ A;  3C38 A;  1G68 A;  3IX8 A;  2EWV A;  4KG5 A;  4XXR A;  1F5M A;  1NZO A;  2XQZ A;  4PMA A;  1V9Y A;  2Y2M A;  3DAV A;  4B9O A;  3B3X A;  4DRT A;  3NIA A;  2DCF A;  4WUJ A;  3CJM A;  1P97 A;  1LT0 A;  3ZYT A;  5GHY A;  3MFD A;  1ERQ A;  4I3J A;  4GD6 A;  1RCJ A;  1ODV A;  1K55 C;  5DVA A;  3CPT B;  5GLD A;  3LID A;  5EOO A;  5F5Y A;  3IBR A;  3U4L P;  1XJ2 A;  4X1M A;  1XXM A;  4YFM A;  4G3V A;  3C8C A;  4JGQ A;  5J3W A;  1Q2P A;  1BLC A;  2OOL A;  4DXC A;  3IH9 A;  1LSX A;  5FAO A;  5DF7 A;  4MNR A;  3DTM A;  3ITB A;  2V1A A;  2XFS A;  2WGI A;  3W8K A;  5EM0 A;  3Q7V B;  3T4L A;  2VV7 A;  3NOT C;  4UHU A;  2R9W A;  2VA0 A;  5HDS A;  3S7Q A;  1S0W A;  4K91 A;  2XA7 S;  4EER A;  4R23 A;  1SDE A;  3NC8 A;  2O9B A;  2JHE A;  5FEF A;  1TVF A;  4ID4 A;  5CHM A;  2KLI A;  2L1M A;  4DN0 A;  5A91 A;  3V67 A;  5F68 A;  4P6Z S;  4MBK A;  1FCO A;  4BBT A;  3O88 A;  4OLD A;  2XFT A;  3MZE A;  3T1S A;  5KSC A;  2I72 A;  1OME A;  3NOP C;  4K0W A;  1XPB A;  2ZQC A;  3MXS A;  2JKR I;  2ZQ7 A;  2Y55 A;  3C7V A;  1W79 A;  3OPP A;  4HY8 A;  4MDZ A;  5HX9 A;  2IWD A;  5TBM A;  5JYP A;  1JWZ A;  1S67 L;  3UDI A;  5M19 A;  3MF0 A;  4FCF A;  3AGE A;  4P6B A;  1S1Y A;  2JKG A;  2GNX A;  1L0F A;  1M6K A;  2Z6C A;  3PBQ A;  1AXB A;  2W3E A;  4P85 A;  2OAP 1;  3E98 A;  4E3N A;  1L0D A;  5A93 A; 
#chains in the Genus database with same CATH homology
 2P08 A;  3K3C A;  1TS6 A;  3CLO A;  1DRM A;  3LIB A;  5HPF A;  3LFV A;  3R7W A;  5J7E A;  1OTE A;  4UQI M;  4F3L A;  3BWL A;  3NOU C;  1YKD A;  2JN7 A;  4NKP A;  4R3A A;  4QPR A;  3RFB A;  3BY9 A;  5FL3 A;  1IOU A;  1X0O A;  4O01 A;  1EW0 A;  2EWW A;  3FC7 A;  4HJ3 A;  3E4P A;  2B18 A;  4R6L A;  5LBR A;  1YSQ A;  3MFX A;  4HJ6 A;  2LB9 A;  4GCZ A;  1OTI A;  1MC0 A;  1TS7 A;  4PAU A;  3EGD C;  1DP6 A;  3E4O A;  5IS1 A;  2VEA A;  1LSV A;  4BJP A;  4EU0 A;  2WKR A;  2W3H A;  3VE4 A;  3UB6 A;  4PKY A;  1T1C A;  2QYB A;  3EEA A;  3F1O A;  3H82 A;  2VLG A;  1P9W A;  1P0Z A;  2HJE A;  2BAS A;  2VKS A;  2XRN A;  2G7U A;  5DKL A;  3S7O A;  4CQH A;  2WKQ A;  3LUQ A;  3U2A A;  4OOM A;  2ZMV A;  3IS2 A;  3NHQ A;  4HNB A;  5TJJ A;  4HHD A;  3LR0 A;  5I5L A;  4WEK A;  3LI9 A;  4KQO A;  4OOL A;  1KOU A;  3RTY A;  3H7W B;  3PYP A;  3B47 A;  2LB5 A;  2W3D A;  4Y2F A;  2DMW A;  4FOF A;  4H6J A;  3UMD A;  1WA9 A;  4NXF A;  3BQ8 A;  4WEJ A;  4MN7 A;  2XRO A;  4KUO A;  2PDR A;  3EQU A;  3D72 A;  3UB7 A;  2NUP C;  4EUV A;  4M4X A;  4WN5 A;  4IUK A;  5DFX A;  3PBS A;  5AVF A;  4BWI A;  2NUT C;  3VE3 A;  4ZRR A;  5AVE A;  4ARZ A;  3DBA A;  3PBO A;  3TJZ C;  1W63 Q;  2ZBB A;  2QJ7 A;  4NXB A;  4EEU A;  3FPW A;  3UE3 A;  5IU1 A;  3P01 A;  2M7V A;  4Q0I A;  2XSS A;  2K7S A;  3C30 A;  1XJ4 A;  3LIE A;  4L9F A;  4JGR A;  1W63 M;  1VHM A;  2V0W A;  3EOI A;  3A0S A;  4HH3 A;  2A24 B;  2FH5 A;  1NLZ A;  4BBV A;  4HH2 A;  4UQI S;  5DKK A;  4Z1W A;  1TS0 A;  5TBM B;  4Q0J A;  2K2N A;  2O99 A;  4BMW A;  1TF1 A;  4GS9 B;  4WLA A;  4ETX A;  2V9A A;  2PHY A;  4HOI A;  1JNU A;  2VX8 A;  4GHI B;  4HP4 A;  3EWK A;  4NEE D;  5HD3 A;  4CLC B;  3F1N B;  3CI6 A;  3FPV A;  2J3T D;  5KIZ A;  1XFN A;  3KSG A;  2PD8 A;  2A2L A;  4EEP A;  5HWT A;  4WF0 A;  4K08 A;  3F1P A;  4EW7 A;  1NRJ A;  2PYP A;  3OCN A;  2QJ5 A;  3TRC A;  1OJG A;  1VB6 A;  1YSP A;  5DFY A;  3B42 A;  4YWZ A;  4NXE A;  5G4Y A;  2PR6 A;  4ETZ A;  5HDC A;  2JKR M;  2OAQ 1;  3R7W B;  4R70 A;  3C2W A;  4F3L B;  3T4S A;  2KX6 A;  4Y5F A;  1LSW A;  1N9L A;  5KSH A;  2I9V A;  3BJN A;  3VOL A;  1H8M A;  2Y8H A;  3CAX A;  1S4R A;  1GSW A;  2VV8 A;  3CIT A;  3CUE C;  3HCY A;  4O8G A;  1BYW A;  4JGP A;  3PXP A;  2HGV A;  2QHK A;  3LIC A;  4G3K A;  3IBJ A;  4I38 A;  2PR5 A;  2L0W A;  2J3T C;  2ZMF A;  3KO6 A;  3KX0 X;  3MR0 A;  3OBF A;  1T19 A;  4WEL A;  4EXO A;  3S7N A;  1H3Q A;  5C5K A;  5G4Z A;  1XJ6 A;  3MQ0 A;  3BW6 A;  4NXG A;  3H9W A;  4L0L A;  4LLO B;  3F1O B;  3H82 B;  3R4K A;  4JGO A;  4HQA A;  3OCL A;  1YAX A;  5EFW A;  3B33 A;  1F98 A;  4HJ4 A;  2OWH A;  1MZU A;  2V1B A;  4GJ4 A;  3OC2 A;  3SW1 A;  4XT2 A;  2MJ6 A;  2EA9 A;  1S1Z A;  4EET B;  3IS2 B;  3LIA A;  3HJI A;  2H28 A;  3LR3 A;  2JKT I;  4RQ9 A;  3MJQ A;  1MKM A;  3KYQ A;  3LIF A;  3LYX A;  3T4O A;  2VZW A;  3CWF A;  4II7 A;  4EES A;  4HI4 A;  3GDI A;  2HJ9 C;  2P04 A;  4EQ1 A;  5HD5 A;  3CUE A;  2W1T A;  1OPX A;  2ZOH A;  2V0U A;  4H6J B;  2P7J A;  2VGL M;  3A0R A;  3T4Q A;  5DJT A;  4Y3I A;  3JVV A;  4P6Z M;  1V9Z A;  3EEH A;  3A0V A;  1UGU A;  3P7N A;  1OTA A;  2L4R A;  1ZHH B;  4R38 A;  4I39 A;  5CX7 A;  5F6A A;  4ARZ B;  3LI8 A;  2Z6D A;  3OLO A;  4MMN A;  2OWJ A;  1ZTU A;  4WL9 A;  1STZ A;  4DJ3 A;  3KYZ A;  5A8B A;  2FZ0 A;  2QKP A;  4IJG A;  3EQV A;  2HF6 A;  2W3F A;  2Y79 A;  2K31 A;  1XFQ A;  3C38 A;  2O0Y A;  1D06 A;  2PYR A;  5HWW A;  4LRZ E;  2R78 A;  1UWN X;  2GJ3 A;  3O5Y A;  1OJ5 A;  2EWV A;  1TS8 A;  3BY8 A;  2O9A A;  3PBR A;  4LPZ A;  4Q0H A;  5F69 A;  2QWS A;  1F5M A;  2JKT M;  3MQO A;  4YOF A;  1V9Y A;  3KSH A;  5J4E A;  4B9O A;  3ULF A;  3PBT A;  4WUJ A;  2W1R A;  1P97 A;  3KSI A;  1LT0 A;  3ZYT A;  3OOV A;  1OTD A;  4I3J A;  2M1C A;  3F1P B;  4CLC D;  1ODV A;  4PKY G;  1XJ3 A;  4GLQ A;  5HPI A;  2ZOI A;  4DJ2 A;  2HV1 A;  2YKH A;  1G6O A;  1GSV A;  3E0Y A;  3LID A;  3NJA A;  3VV4 A;  5F5Y A;  4AFI A;  3T4T A;  3IBR A;  5HDD A;  1XJ2 A;  4HP9 A;  4LRY C;  3UB8 A;  3FG8 A;  4G3V A;  3C8C A;  2IA2 A;  4JGQ A;  4PHT A;  3BQA A;  2CMN A;  1S66 L;  5J3W A;  4I3A A;  1D7E A;  4E04 A;  2OOL A;  3W2Z A;  5L8M A;  1LSX A;  3KSF A;  1Y28 A;  3LR5 A;  4I5S A;  2V1A A;  3UB9 A;  3T50 A;  2GX5 A;  1S4S A;  1OTB A;  1UWP X;  1NLY A;  1F9I A;  2J80 A;  1OT9 A;  3T4L A;  2VV7 A;  3ZQ5 A;  2W0N A;  3NOT C;  4CLC E;  2VA0 A;  5HDS A;  3S7Q A;  1NWZ A;  4HIA A;  3HJK A;  2W27 A;  4CLC C;  3JVU A;  1DP8 A;  1DP9 A;  1T1B A;  2D02 A;  2XA7 S;  2KDK A;  2J3W A;  3H7W A;  4EER A;  4MCW A;  2O9B A;  2VJW A;  3T4J A;  2JHE A;  3E4Q A;  4KUK A;  2GZA A;  3K2N A;  5IT5 A;  3RH8 B;  2XA7 M;  2VGL S;  4L9G A;  2KLI A;  2YKF A;  1P9R A;  2L1M A;  4DN0 A;  3LR4 A;  3V67 A;  4IUH A;  5F68 A;  4P6Z S;  4LRX C;  5HZH A;  1GSX A;  1LL8 A;  4BBT A;  2M7U A;  3MQQ A;  4XT2 B;  5K5B A;  3TW8 A;  3S7P A;  4O0P A;  2WKP A;  4L9E A;  3UE6 A;  3NOP C;  1T1A A;  1T18 A;  1G28 A;  3TE8 A;  3K3D A;  5HSQ A;  2O9C A;  2PD7 A;  4KQD A;  2PT7 A;  4IHQ A;  3T4K A;  1N9N A;  2JKR I;  2W1T B;  4I3I A;  4B93 A;  4MN5 A;  2VV6 A;  5MC7 A;  4G3W A;  2B02 A;  2KOI A;  3GEC A;  2A24 A;  4HY8 A;  3G6O A;  4MDZ A;  1TD5 A;  5TBM A;  3MMH A;  3PHY A;  4YNR A;  3PBN A;  5HWV A;  4DMZ A;  1S67 L;  4GS9 A;  4FSF A;  5DJU A;  1N9O A;  3MF0 A;  3D3O A;  4GW9 A;  4GHI A;  4ME4 A;  3MXQ A;  4CLC A;  2D01 A;  1S1Y A;  3F1N A;  4MN6 A;  2GNX A;  3EGX C;  5HL6 A;  2W3G A;  1OT6 A;  2Z6C A;  2INW A;  3PBQ A;  3UME A;  2W3E A;  3ICY A;  2OAP 1;  5AJG A;  4BBU A;  3E98 A;  5DF9 A;  4UEY A;  3PR6 A;  1IFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...