4YOFA

Doss gafa domain reduced nitric oxide bound crystal structure
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
144
structure length
140
Chain Sequence
DPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRSFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Redox sensor histidine kinase response regulator DevS
publication title Distal Hydrogen-bonding Interactions in Ligand Sensing and Signaling by Mycobacterium tuberculosis DosS.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
total genus 38
structure length 140
sequence length 144
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4yofA00
5C5KA 4BWIA 2W1TB 3MMHA 2IA2A 4GW9A 4R70A 4EU0A 4CQHA 2GX5A 3TRCA 3C2WA 5AJGA 3MF0A 3S7QA 3KSFA 2O9BA 4IUKA 5DFXA 4IJGA 3LFVA 2XSSA 3O5YA 3R4KA 3E98A 5HPIA 4MMNA 3NOTC 1MC0A 5K5BA 3HCYA 2Y8HA 2W1TA 2O0YA 5TJJA 1VHMA 3NOPC 3K2NA 2O99A 3CITA 2W3GA 2W3EA 3D3OA 3S7PA 3VV4A 4O01A 2ZMFA 5DFYA 1TD5A 3W2ZA 4Y2FA 2W1RA 2OOLA 4O0PA 3G6OA 5HL6A 4Z1WA 2VJWA 3IBJA 5I5LA 2KOIA 2LB9A 4GLQA 3NOUC 4ETZA 4LRXC 4DMZA 3S7NA 2Y79A 4Q0HA 4R6LA 3EEAA 1STZA 2O9AA 1YKDA 4G3VA 4Y3IA 3MQ0A 3E0YA 2W3DA 4YNRA 3KSHA 2K31A 5LBRA 5HPFA 3KSGA 4G3WA 2M7VA 1YSPA 3IBRA 4YOFA 2B18A 1TF1A 4Y5FA 4E04A 2KLIA 3DBAA 2M7UA 1F5MA 2HGVA 5HSQA 4ZRRA 4RQ9A 4DN0A 3CI6A 2O9CA 4FOFA 3NHQA 2VEAA 2XRNA 3RFBA 4QPRA 3KO6A 2QYBA 1YSQA 3OBFA 4ME4A 3S7OA 4MDZA 4EUVA 3BJNA 1ZTUA 2VKSA 2XROA 4Q0JA 2G7UA 4IUHA 3ZQ5A 4O8GA 2VZWA 4PAUA 4G3KA 4LRYC 4MN7A 3KSIA 5L8MA 4ETXA 3OOVA 2W3HA 2W3FA 1MKMA 2LB5A 4LRZE 2K2NA 4MCWA 4Q0IA
chains in the Genus database with same CATH superfamily
4M4XA 1I5QA 3PTEA 4IVKA 4WL9A 2HP5A 4EU0A 4R3BA 3LI9A 2V20A 4KZ5A 3LIEA 1GHIA 4KZ9A 1LLBA 4IHQA 2G2UA 1H5XA 4MEZA 3ZGAB 1PWCA 1YMXA 3CG5A 1TS0A 2QZ6A 3LIFA 2QPNA 3LCEA 2W27A 2JKGA 1LL5A 2B02A 4LV2A 4LCMA 1AXBA 3T4SA 1ERQA 3UDFA 1FIKA 4UA6A 2EX2A 2Y79A 4X25A 3UO9A 1L0GA 1SKFA 1KDWA 2X02A 3SH9A 2EFUA 1BUEA 1T19A 2L4RA 5F5YA 1IKIA 4UHUA 3OLOA 2NUPC 1Y4OA 4OPZA 2HGVA 2Y2JA 4N92A 4DN0A 1NLYA 3PBQA 3UY6A 4EUVA 4B4ZA 4EQIA 2V8CA 3NCKA 1MPLA 1K57A 3D4FA 3UB5P 3GMWA 4HESA 4MN7A 3T4QA 4KQDA 2CMNA 4IBXA 1DJBA 3GECA 1TS8A 5FEFA 1TS7A 3RJUA 1ACFA 4BD1A 4JXVA 2DNSA 2GX5A 2P9VB 2EXAA 3OPRA 5FI7A 3M6HA 3VSKA 2PU2A 3PHYA 1H8YA 4LENA 4XT2A 1MKIA 2PYRA 2Y2HA 5I94A 4DE2A 2A24B 4GD8A 2GZAA 2B5RA 3VFHA 3TE8A 5HD3A 2VGLS 3BFDA 1MY8A 2VLGA 1L0EA 3N4IA 3VV4A 4HQAA 1K0KA 4WMCD 3O86A 3UE0A 4DMZA 2QMIA 4R6LA 3OCLA 1GHMA 3DTIA 3O88A 5EV0A 4CPKA 5LBRA 5E2EA 4JF5A 5F82A 4WUJA 4LPZA 4KZ3A 3N8SA 3VOLA 4B88A 1F9IA 5EFWA 1PIOA 1WYBA 1DP8A 1CF0A 4EBNA 1DJAA 3S7OA 4II7A 2J3TD 1BYWA 4ZDXA 3IWIA 4Q0JA 4ARZB 3RXWA 3G32A 4I3AA 5D3OA 1L3LA 4OP8A 3FWLA 3PBSA 3ZHHA 4OQ0A 3FZCA 4Q0IA 4IEDA 2ZQ8A 5CHMA 1JNUA 1GA0A 3TRCA 2QHKA 2EWVA 1K4FA 5A93A 2V1AA 4WMCA 3HLWA 3LFVA 5DTSA 4U3TA 1K54C 1D06A 2GDNA 3FYZA 4RYEA 3EGXC 1K57C 3G2ZA 5HFOA 4OQGA 2PD8A 2Y8HA 3HUOA 4CJNA 3PR6A 4HP9A 3LY3A 3A0SA 3EQVA 4JGPA 4FSFA 3QHYA 3M6BA 5A91A 1N9OA 1MWTA 1SHVA 2ZMFA 3HLBA 3T1QB 4Y2FA 5HAIA 1XFNA 4OOLA 3F1OB 5GLBA 1QMFA 3I7JA 3S7NA 1NWZA 1STZA 1YKDA 3EGDC 4WEKA 5GHXA 4OONA 4XUXA 1N9NA 3KSHA 5CHUA 4K08A 1CEFA 5CEDA 2L0WA 2XD1A 4PKYG 3NDEA 3T4KA 5HX9A 3O87A 3IF6A 3LIAA 3B33A 3FG8A 1NLZA 2Y55A 3RFBA 2XEPA 3OBFA 4ZAMA 4EUZA 1OTEA 3G2YA 2ZC5B 3NDGA 4DXBA 3BFEA 1YMSA 3G35A 3IXHA 3S4XA 2EFXA 3HBRA 4E3NA 4LRYC 1G6AA 3WS5A 4XT2B 2XR0A 2W3FA 4ZJ3A 4OP5A 2IWCA 2I9VA 4OVDA 3MS6A 2CC1A 5GLAA 4OH0A 1NY0A 3BWLA 4GW9A 3NULA 3ZNYA 3C2WA 1K6RA 2J3WA 2Q9NA 3IX8A 3QP5A 3F1NA 3MKEA 1E4DA 1DJCA 2WADA 2XF3A 4RA7A 1XX2A 4E6XA 4N9KA 3A3FA 4JLFA 3GDIA 2HJEA 3B42A 2VGJA 3K2NA 4HHDA 2M1CA 3CPTA 3MZEA 2EA9A 3ZG7B 3QNCA 2PD7A 3W2ZA 1IELA 4HEFA 4FH4A 4OPRA 5HARA 2DMWA 5CTNA 4YFMA 3SH7A 4GLQA 3C5AA 3ZYTA 3OPHA 4S2LA 2XGNA 3JPUA 4C6YA 4X6TA 4QY6A 4I39A 4UA7A 4GB7A 3IX3A 3F1PA 1H8MA 1XFQA 5EE8A 1S6RA 3LIDA 3GVBA 2ZL1A 3FPWA 4YOFA 1TF1A 1TDGA 5CRFA 4X53A 2VGLM 3DTKA 1P9WA 3T4TA 1AWIA 2XRNA 2WKRA 3KO6A 1H3QA 3BJNA 4PPRA 4MNRA 3C7UA 1VQQA 4UQIM 3ZQ5A 5L09A 5HAPA 3IQAA 1JWPA 5HWTA 4E3MA 1N9BA 1OTBA 3GV9A 3BQ8A 2ZQCA 4EQ1A 3BFCA 4ZJ2A 1XPBA 4BD0A 1FCNA 1Q2QA 2EX6A 2IA2A 3BFFA 4R70A 4MN5A 4ZJ1A 4YINA 3WS1A 4QJGA 4GHIA 3IF5A 4IUKA 5FDSA 3O5YA 4QY5A 1N4OA 2ZOHA 3CAXA 3NOTC 3G30A 1PNEA 3UB8A 2IWBA 4BLMA 4HBUA 1W5DA 4A5RA 3FKWA 1G68A 3IX4A 3MXRA 2A2LA 5AQBA 5J8XA 1IOUA 1UWPX 2LB9A 1BLCA 4HOIA 5EECA 3MZDA 4EV4A 3FV7A 3IF6B 1XJ3A 3V39A 2ZJ9A 3MXQA 2WAFA 2OV5A 2WZXA 2PDRA 5EVLA 3R7WA 4X68A 3T1RA 1KE0A 2NUTC 3L9KA 4D60A 5A8BA 2ZM0A 3DWKA 1RGYA 3QP4A 4HP4A 2BLSA 4F3LA 1W8YA 1DP9A 5HSQA 5DTTA 3SS3A 2D02A 2Z6CA 4BJPA 3P09A 3N6IA 4PM5A 1W79A 2JE5A 2YKFA 1LSVA 2VKSA 1PWDA 2VX8A 2UV0E 1LSWA 3AGFA 1ES4A 3IXDA 1XGIA 4PAUA 1BT5A 2ZM2A 4E3LA 3Q81A 5L8MA 4NXEA 1SDEA 2W0NA 3F1NB 1JTDA 1LHYA 2HPBA 1YLZA 4GKUA 3G34A 3OZHA 3NJAA 3IXBA 4F94A 3NBLA 5JYOA 1SDNA 2V8FA 3MXSA 4LFUA 1LL8A 1NZOA 3ITBA 1FILA 3LO7A 5CTMA 3CPTB 2Y2MA 1JVJA 5EVID 1PI4A 4IJGA 2WKQA 1S67L 4BL3A 2ZC7A 1HTZA 3E98A 1YLPA 1BLSA 1VETA 1YQSA 3HCYA 2W1TA 1T18A 2J9PA 1K38A 4XXRA 3CITA 2FFFB 3F1PB 3NY4A 4DE1A 4E6WA 1KE4A 1MWUA 2ZQ7A 2KX6A 2ZL1B 3G6OA 2KOIA 3NOUC 2ZMVA 3A3EA 1GCEA 3EEAA 1TVFA 2WAEA 1A0KA 1IKGA 3N8RA 5DKLA 2RL3A 4JF4A 1PI5A 4PHTA 1YSPA 1D7EA 3EEHA 4KENB 3H82B 2Z2MB 1F98A 5TBMA 3T1XA 1WA9A 4RQ9A 1F2KA 5FI2A 1Y28A 3K3DA 2KDKA 3BLSA 3IHAA 1GSVA 1G6OA 3UNWA 4WM9A 5EVIA 3ZG5A 2QKPA 4GHIB 1VEUA 2XFSA 3IH9A 1MZUA 1MXOA 3WS4A 2OWJA 1K54A 3ZG8B 2IWDA 1XKZA 3HREA 5EM1A 1ZG4A 4YWZA 5FQKA 3T4OA 5HL1A 2HDRA 4OPQA 4R1GA 4DDYA 3K3CA 3W4QA 2WYXA 5HW3A 4L9FA 5HWVA 4FCFA 5BOHA 5TJJA 1VHMA 4R0QA 5KMWA 4JGOA 2VV8A 3GQZA 1ERMA 1S1ZA 1TD5A 5EPHA 3SOIA 5AQ7A 3R7WB 2WZZA 2ZQ9A 1CEGA 3NC8A 1JWZA 2QJ5A 4E3OA 3SH8A 1S4RA 4F3LB 5F1GA 4Y3IA 4DRTA 3MQ0A 4NK3A 2OSUA 4DE3A 1ALQA 3ZFZA 2Y2KA 3KX0X 3LR0A 1MWRA 3C4PA 4JXGA 2DCFA 2E8JA 1WYCA 1E3UD 2Y91A 3KYEA 4I3IA 4R3AA 3ZDJA 5DF8A 2VEAA 4NG2A 1Y54A 2PHYA 3DTMA 4WZ5A 5CERA 2PR5A 3UE1A 4KUOA 4DE0A 4CLCC 5FSRA 4WLAA 4ETXA 3QP8A 3MBZA 2K2NA 1VETB 3LICA 3E2LA 2W1TB 5G18A 2FZ0A 3UE3A 2H5SA 4X69A 4BBVA 3AGDA 2BTFP 2XA7M 4L0LA 2JCHA 4OLDA 4X1LA 1CI9A 1W7FA 2EXBA 3BY9A 2ZQDA 3A3JA 3NECA 5EVIC 1RGZA 2HDQA 4H6JA 2W3EA 3LGOA 1HLUP 1YAXA 5DTKA 4L9GA 3MJQA 3GSGA 1K6SA 4P6ZS 3H7WA 4DJ2A 4JKTA 1E3UA 5TBMB 3LY4A 2HDUA 4LCLA 4GN2A 2HJ9C 5TFQA 3BYDA 1I2WA 3HLEA 4DXCA 3SW1A 4PM8A 1NYMA 2R9WA 1EWZA 1LI0A 2R78A 5EVIB 4MLLA 5CX7A 4DKIA 5FAQA 3WWXA 1VEUB 1F5MA 4GNUA 4O7DA 5IHVA 3CI6A 3PXPA 5F6AA 2R9XA 4NXFA 4LLOB 3W4OA 4ME4A 4MDZA 4C75A 5CHJA 3IXGA 3BW6A 5DJTA 2Y2NA 4GS9A 2HF6A 4O8GA 3G31A 2WKHA 4KZ6A 3EOIA 4ID4A 1LT0A 2OWHA 5FQ9A 2H28A 3VP4A 5FQQA 1O7EA 2QWSA 3BFGA 5CEBA 4ZTKA 3T4JA 3C38A 1P0ZA 3OCNA 5C5KA 3ULFA 3KYZA 2ZOIA 3WS0A 4KZ8A 3SS4A 5AJGA 3KYQA 1L2SA 1NRJA 3HJIA 4D2OA 1ESUA 2V0UA 4WZ5C 5HPIA 3UPOA 5E2GA 5GLDA 1MC0A 5E2HA 3QNBA 3M2KA 5KZHA 1ZKJA 4UA9A 4OLGA 2O99A 2Y2GA 1LL9A 2UWXA 5HWWA 5F1FA 1YLJA 4PKYA 5HL6A 4EW7A 1BTLA 1XGJA 4R3JA 4PMAA 4B4XA 2XDMA 3PAEA 4MBKA 2WK0A 2QJ7A 4OQHA 3E4OA 1PW1A 4FH2A 2ACGA 2FH5A 2AVXA 1JTGA 2B18A 1JWVA 4EBPA 3B47A 3FC7A 2PBDP 4MN6A 2JKRI 5A90A 3VOZA 3TW8A 1CJFA 2JKFA 1YPRA 2C6WB 5F83A 3HLFA 1W63Q 2Q0OA 4IUHA 5F68A 4PM9A 4OQIA 1OT9A 3QP2A 3T12B 1GHPA 5AVFA 3KSIA 5TGFA 3BY8A 4Y0UA 5L07A 4Z9QA 3UB6A 4OPYA 5E2FA 4UAAA 4AFIA 1L0FA 4CQHA 4H6JB 2BASA 4UEYA 1XJ6A 1E25A 3IHBA 1ONGA 1ZC2A 1I2SA 3H7WB 4EXOA 2XH9A 3ZVTA 4OOYA 5FASA 3BQAA 1PZPA 1FR6A 1PWGA 3MSHA 1NXYA 3HL9A 4KG5A 3JYIA 3S7PA 5GHZA 4E3IA 2OOLA 4O0PA 3VP1A 2VJWA 3IWOA 2ZMAA 4NXBA 4KZ7A 5DKKA 4LGWA 1OJGA 4M3KA 2MJ6A 3HJKA 4S2KA 4G3VA 3MFXA 4QHCA 5HDCA 1DRMA 4GOGA 4P6BA 2Y2OA 3CJMA 3ICYA 4JGQA 5G4YA 3GR2A 4BBTA 4GS9B 4FTXA 2Z6DA 2VA0A 3CLOA 5HDSA 5U47A 3DBAA 3WRZA 3GRJA 1ZG6A 1BLHA 3MQOA 4P87A 5TR7A 4WEJA 1K56D 4P6ZM 1YSQA 4B9OA 4R4SA 4RX3A 2G7UA 4OKPA 1U60A 4JXSA 4EETB 1WE4A 1T1CA 5KSHA 3G4PA 1P97A 3OOVA 2BG1A 2ZC4B 2VK3A 1YT4A 4N1XA 2VV6A 3C7VA 3VP2A 2WKIA 2ZBBA 4CLCD 2RCXA 5MC7A 2P9VA 1VB6A 3PBOA 2V1BA 2XQZA 1EROA 4BQMA 3LR5A 2WUQA 3EWKA 2H0TA 3BLMA 5DFXA 2XSSA 2A24A 1ES3A 2HV1A 4R4RA 3S1YA 3CHWP 4L9EA 1L0DA 3ZG9B 3ZNTA 4HJ4A 4S2OA 5JYPA 5CGSA 5CGXA 4BMWA 2PBYA 1YLWA 2ZC3B 3E4PA 4O01A 3MQQA 2V1ZA 5IT5A 4GCZA 4JXWA 5I5LA 3S22A 3RXXA 1M40A 4Q0HA 3VMAA 1N9LA 4U0XA 1K56A 1DP6A 3CZDA 4IVIA 3UMDA 1MBLA 4BL2A 5FDHA 3C8CA 4KQRA 3SS5A 2VV7A 1BLPA 5HPFA 4H8RA 1X0OA 4QB8A 3DWZA 1K4EA 1SKOA 4KUKA 5AQ9A 4K91A 4K0XA 3BEBA 2JBFA 2PYPA 4JPMA 1J9MA 2WGVA 3Q1FA 1FSWA 1HZOA 5DF7A 3M2JA 3UB7A 2WKEA 3BRMA 3UN7A 2YKHA 4CLCA 2JKRM 4ARZA 2EWWA 1ZTUA 4HI4A 2K7SA 4S2MA 2ZD8A 1MKMA 1S1YA 1CK3A 1BZAA 4Y17A 4WELA 4N1HA 4XUZA 3JVVA 5J7EA 3A3DA 1T1AA 3NIAA 3RH8B 2FFYA 2DRWA 4KZ4A 1ONHA 1BULA 3KSFA 2WGIA 3MFDA 3PBTA 3MKFA 4X56A 3Q7ZA 3VP3A 2Q9MA 1GSWA 5L2FA 3TG9A 4RVAA 5K5BA 4I3JA 1H0MA 5M1AA 4HJ3A 1P9RA 2ZC6B 1W63M 3F1OA 4NETA 3IWQA 2I72A 3LI8A 5CGWA 5F69A 2GJ3A 2O9AA 2ZM8A 3PYPA 4EEUA 1EI5A 5FQJA 3V50A 1IEMA 3PBNA 3IT9A 3C4OA 1LSXA 3T1SA 2K31A 3SZTA 1NYYA 3E2KA 3KSGA 1OTDA 2XLNA 4WF0A 3PBRA 3UE6A 4Q8IA 4E04A 1XJ4A 5M18A 3EQUA 1Z09A 4KZAA 5FL3A 5EM0A 2D01A 4FOFA 1TEMA 3VOYA 4GDNA 3DW0A 2PRFA 4DF6A 1ESIA 3V67A 3W8KA 4LV0A 1CI8A 4Y0OA 4EERA 1J3WA 4HH2A 2HP9A 2VZWA 4HJ6A 4S2PA 4DJ3A 4EEPA 2W3HA 2OAP1 1IYQA 4LRZE 3BM6A 3B3XA 3HUMA 1PRQA 4BWIA 5HAQA 4S2JA 4FD8A 3N7WA 4KG6A 1BSGA 3S7QA 5AVEA 4DDSA 3Q7VA 2WGWA 4WYYA 4UQIS 4PM6A 2X71A 3NI9A 3R4KA 4MMNA 3ITAA 2A49A 2XFTA 2ZQAA 1GA9A 1XA1A 1XXMA 2H0YA 2Y2LA 2HZ5A 4WN5A 1FSYA 4Z1WA 3IBJA 1FCMA 1SKOB 1G5UA 3IH8A 3IS2A 3E0YA 2W3DA 3HVFA 1M6KA 4YNRA 1FR1A 1KVLA 4BENA 4JGRA 1S0WA 4CLCB 2J7VA 3A3IA 2M7VA 5M19A 5GL9A 2Y4AA 3VSLA 4KZBA 4Y5FA 4Y13A 2P08A 2M7UA 4ZRRA 4MBHA 2O9CA 2B95A 1IFQA 2J80A 4KG2A 4QPRA 3V3SA 2QYBA 5CXWA 4R23A 1OJ5A 3E4QA 2XROA 1IYPA 3DTEA 3JVUA 4NXGA 3C30A 3N8LA 4EESA 4C3QA 4OOMA 5FAOA 2OAQ1 5FQIA 3VFFA 4QU3A 4S2IA 3MMHA 1NRFA 1OPXA 5FATA 4WBGA 1FOFA 5G4ZA 2V0WA 1KGFA 3HLGA 4S2NA 2P7JA 3A0VA 3P98A 3WS2A 3MF0A 3HLDA 1DY6A 1K55A 1YM1A 1T1BA 1YLYA 5L10A 2EX9A 4X55A 2V2FF 3D72A 4MBFA 3GTCA 3TJZC 5DVAA 2O0YA 2WKPA 1RCJA 3CMZA 1NZUA 2EX8A 1TS6A 2W3GA 4GD6A 3CUEA 1ES5A 5DFYA 4E3JA 3LR3A 1KDSA 2W1RA 1Z6FA 2J8YA 3BECA 1HVBA 3RTYA 2INWA 4X1MA 1QMEA 2X01A 1ODVA 4LRXC 5IS1A 4ZBEA 2E8IA 2PAVP 1NJ4A 1V9YA 1IYOA 3LUQA 2P74A 5CECA 3QP6A 1VM1A 2JN7A 4GJ4A 5FEGA 2JKTI 4Y0TA 1CQAA 1OTIA 5GHYA 2JC7A 5FI6A 3O3VA 4HIAA 3FKVA 4Y15A 5J4EA 5HD5A 3MZFA 4KQQA 5EOOA 1FCOA 4GZBA 3Q7VB 2WGWB 1SCWA 4Y7PA 1KVMA 2PT7A 4MCWA 3T4LA 4I38A 1XJ2A 1S4SA 1YLTA 3LEQA 4HH3A 1K25A 4CLCE 1LI9A 2O9BA 3VE4A 4QD4A 3WRTA 1D1JA 3UB9A 1PW8A 5EOEA 3VP0A 3ZG0A 2HDSA 3OPPA 3V3RA 5FQMA 4U0TA 5FA7A 3IS2B 3NOPC 3VE3A 2ZLYA 1ES2A 3D3OA 4K0WA 3ZCZA 1FQGA 2H10A 3ZVWA 2G2WA 3UDIA 1S66L 5FAPA 1ZHHB 2J9OA 3ISGA 5J3WA 4GDBA 2V9AA 2Y59A 5AQAA 4BBUA 1W8QA 2PR6A 3CWFA 3UMEA 4S2NC 1KGEA 3L7HA 4HBTA 2C5WB 2P04A 1K55C 1HD8A 4HNBA 5KSCA 3H82A 1TDLA 3IBRA 4PM7A 4N9LA 4NKPA 2J3TC 2OLVA 3CUEC 3FPVA 3V5MA 1MWSA 3NHQA 5KIZA 3LIBA 1G28A 5E43A 1SZVA 1XP4A 3IF6C 4B93A 5IU1A 3QP1A 1KOUA 4JBFA 2HP6A 1PYYA 5GLCA 4R38A 4JF6A 2XK1A 4ETZA 4KQOA 2GNXA 1UGUA 2OLUA 4E3KA 2Y2IA 2Y2QA 4EBLA 1Q2PA 1H8ZA 1XA7A 2Y2PA 1OMEA 4LV3A 3OPLA 5EUAA 3UPNA 2Z2LB 1PFLA 4P85A 3D9YA 3H9WA 3UDXA 2JHEA 4P0MA 3Q07A 5EVEA 3Q82A 1KE3A 4RX2A 3LEZA 1O07A 3TSGA 1IYSA 4LV1A 1GSXA 2XA7S 5DF9A 1EW0A 3DAVA 4I5SA 2VGKA 5HDDA 1UWNX 1PZOA 1OTAA 4FUWA 3TOIA 2L1MA 4HY8A 4G3WA 3HLCA 2KLIA 3W4PA 4NEED 3UPPA 3P7NA 5A92A 4ESPA 2JKTM 2XD5A 1RP5A 4WZ4A 4QWOA 5DJUA 4IBRA 2A3UA 1OT6A 3A0RA 5HZHA 3P01A 1C3BA 3MR0A 3U4LP 4G3KA 3AGEA 3PAGA 3OC2A 1KGGA 2LB5A 3U2AA 3HUNA 1V9ZA 3LR4A 3T50A 3LYXA 4EWFA 2PU4A
chains in the Genus database with same CATH topology
4M4XA 5C5KA 4BWIA 4WL9A 2IA2A 3ULFA 4R70A 4EU0A 3KYZA 2ZOIA 4MN5A 3LI9A 5AJGA 3KYQA 3LIEA 4GHIA 1NRJA 3HJIA 5AVEA 3S7QA 4IUKA 3O5YA 4UQIS 4IHQA 2ZOHA 2V0UA 3CAXA 3R4KA 5HPIA 4MMNA 3NOTC 1MC0A 3UB8A 1TS0A 2O99A 3LIFA 5HWWA 4PKYA 2W27A 2A2LA 4WN5A 2B02A 5HL6A 4Z1WA 3T4SA 3IBJA 4EW7A 1UWPX 1IOUA 2LB9A 4HOIA 2Y79A 1XJ3A 3IS2A 3E0YA 2W3DA 2QJ7A 3E4OA 4YNRA 3MXQA 4JGRA 4CLCB 2FH5A 1T19A 2PDRA 2L4RA 2M7VA 5F5YA 3R7WA 2B18A 2NUTC 5A8BA 4Y5FA 3B47A 3FC7A 2P08A 3OLOA 2NUPC 4HP4A 2M7UA 2HGVA 4F3LA 4MN6A 1DP9A 4ZRRA 5HSQA 4DN0A 1NLYA 2D02A 2Z6CA 2JKRI 2O9CA 3PBQA 4BJPA 1IFQA 2J80A 3TW8A 4QPRA 2QYBA 2YKFA 4EUVA 1OJ5A 3E4QA 1LSVA 2VKSA 2XROA 2VX8A 1W63Q 4IUHA 1LSWA 5F68A 1OT9A 4PAUA 3JVUA 4MN7A 3T4QA 5AVFA 3KSIA 4KQDA 4NXEA 5L8MA 2CMNA 4NXGA 2W0NA 3BY8A 3C30A 3F1NB 3GECA 1TS8A 4EESA 1TS7A 4OOMA 2OAQ1 3UB6A 3NJAA 4AFIA 3MMHA 1OPXA 5G4ZA 1LL8A 2V0WA 4CQHA 4H6JB 2BASA 2GX5A 2P7JA 3A0VA 4UEYA 1XJ6A 3MF0A 4IJGA 2WKQA 1S67L 3PHYA 4XT2A 1T1BA 3H7WB 2PYRA 3E98A 4EXOA 2A24B 3D72A 2GZAA 3TJZC 3TE8A 3HCYA 3BQAA 2W1TA 5HD3A 2O0YA 2WKPA 1T18A 2VGLS 3CITA 1TS6A 2VLGA 2W3GA 3CUEA 3F1PB 3S7PA 3VV4A 5DFYA 4HQAA 3LR3A 2KX6A 2W1RA 2OOLA 4O0PA 3G6OA 2VJWA 2KOIA 3RTYA 2INWA 3NOUC 2ZMVA 4NXBA 1ODVA 4LRXC 4DMZA 5IS1A 4R6LA 5DKKA 3EEAA 1OJGA 3OCLA 2MJ6A 3HJKA 4G3VA 1V9YA 3MFXA 5HDCA 1DRMA 3LUQA 5DKLA 5LBRA 3ICYA 4JGQA 5G4YA 4BBTA 4PHTA 1YSPA 1D7EA 3EEHA 4GS9B 2Z6DA 4WUJA 3H82B 2VA0A 3CLOA 5HDSA 4LPZA 1F98A 2JN7A 5TBMA 3DBAA 4GJ4A 3VOLA 1P0ZA 2JKTI 1F9IA 1WA9A 5EFWA 4RQ9A 1OTIA 1DP8A 3MQOA 4WEJA 4P6ZM 1YSQA 4B9OA 1Y28A 3K3DA 3S7OA 2KDKA 4II7A 2J3TD 1BYWA 1GSVA 4Q0JA 2G7UA 4HIAA 1G6OA 4ARZB 5J4EA 5HD5A 4EETB 4I3AA 2QKPA 1T1CA 4GHIB 5KSHA 1P97A 3OOVA 3PBSA 1MZUA 2VV6A 2PT7A 4MCWA 4Q0IA 2ZBBA 3T4LA 4CLCD 5MC7A 4I38A 1XJ2A 1S4SA 2OWJA 1JNUA 1VB6A 3PBOA 4HH3A 2V1BA 3TRCA 2QHKA 2EWVA 3LR5A 3EWKA 4CLCE 2V1AA 2O9BA 3VE4A 5DFXA 3LFVA 2XSSA 4YWZA 2A24A 2HV1A 1D06A 3UB9A 3T4OA 3EGXC 3K3CA 4L9EA 4HJ4A 4L9FA 5HWVA 2PD8A 2Y8HA 3PR6A 4HP9A 4BMWA 5TJJA 1VHMA 3A0SA 3IS2B 3EQVA 3NOPC 4JGPA 3VE3A 4FSFA 3D3OA 1N9OA 3E4PA 4JGOA 2VV8A 2ZMFA 1S66L 4O01A 1S1ZA 1TD5A 4Y2FA 1ZHHB 3MQQA 5IT5A 4GCZA 5J3WA 3R7WB 5I5LA 1XFNA 2V9AA 4OOLA 3F1OB 4BBUA 2PR6A 2QJ5A 3CWFA 3S7NA 4Q0HA 3UMEA 1S4RA 4F3LB 1NWZA 1STZA 1N9LA 1YKDA 3EGDC 4Y3IA 3MQ0A 1DP6A 4WEKA 3UMDA 3C8CA 2P04A 1N9NA 3KSHA 4K08A 2VV7A 5HPFA 4HNBA 2L0WA 1X0OA 3H82A 3KX0X 3LR0A 3IBRA 4PKYG 4KUKA 3T4KA 4NKPA 2J3TC 2PYPA 3CUEC 4I3IA 3FPVA 3LIAA 4R3AA 3B33A 3FG8A 3NHQA 5KIZA 1NLZA 2VEAA 3RFBA 3UB7A 3LIBA 1G28A 2YKHA 3OBFA 4CLCA 1OTEA 2JKRM 4ARZA 2EWWA 1ZTUA 2PHYA 4B93A 2PR5A 4HI4A 2K7SA 4KUOA 5IU1A 4CLCC 4LRYC 1KOUA 4WLAA 4ETXA 4XT2B 2W3FA 1MKMA 1S1YA 4R38A 2I9VA 2K2NA 4WELA 4ETZA 4KQOA 2GNXA 3LICA 2W1TB 1UGUA 2FZ0A 3UE3A 3JVVA 5J7EA 3BWLA 4GW9A 4BBVA 2XA7M 1T1AA 3C2WA 2J3WA 4L0LA 3RH8B 3KSFA 3PBTA 3F1NA 3BY9A 1GSWA 5K5BA 3GDIA 2HJEA 3B42A 3H9WA 4I3JA 3K2NA 4H6JA 2JHEA 4HHDA 2M1CA 2W3EA 4HJ3A 1YAXA 2EA9A 1P9RA 3MJQA 4L9GA 2PD7A 3W2ZA 1W63M 3F1OA 4P6ZS 2DMWA 3H7WA 4DJ2A 4GLQA 3LI8A 1GSXA 5F69A 5TBMB 2XA7S 3ZYTA 5DF9A 2GJ3A 2O9AA 2HJ9C 1EW0A 4I39A 3PYPA 4EEUA 4I5SA 5HDDA 3F1PA 1UWNX 3PBNA 1H8MA 1OTAA 1LSXA 1XFQA 2K31A 3SW1A 2L1MA 3KSGA 3LIDA 1OTDA 4G3WA 4HY8A 4WF0A 3FPWA 3PBRA 3UE6A 4YOFA 1TF1A 4E04A 1XJ4A 2R78A 2KLIA 5CX7A 3EQUA 1F5MA 2VGLM 1P9WA 4NEED 3T4TA 5FL3A 3CI6A 3P7NA 2D01A 3PXPA 4FOFA 5F6AA 2XRNA 2JKTM 4NXFA 2WKRA 3KO6A 4LLOB 1H3QA 4ME4A 4MDZA 5DJUA 3BJNA 3V67A 1OT6A 4UQIM 3A0RA 3BW6A 5DJTA 4GS9A 3P01A 3ZQ5A 5HZHA 2HF6A 4O8GA 4EERA 4HH2A 3MR0A 5HWTA 2VZWA 3EOIA 4G3KA 1OTBA 4HJ6A 3OC2A 1LT0A 2OWHA 4DJ3A 4EEPA 2H28A 3BQ8A 4EQ1A 2W3HA 2OAP1 2QWSA 2LB5A 3U2AA 1V9ZA 3LR4A 3T50A 4LRZE 3LYXA 3T4JA 3C38A 3OCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5K A;  4BWI A;  2W1T B;  3MMH A;  2IA2 A;  4GW9 A;  4R70 A;  4EU0 A;  4CQH A;  2GX5 A;  3TRC A;  3C2W A;  5AJG A;  3MF0 A;  3S7Q A;  3KSF A;  2O9B A;  4IUK A;  5DFX A;  4IJG A;  3LFV A;  2XSS A;  3O5Y A;  3R4K A;  3E98 A;  5HPI A;  4MMN A;  3NOT C;  1MC0 A;  5K5B A;  3HCY A;  2Y8H A;  2W1T A;  2O0Y A;  5TJJ A;  1VHM A;  3NOP C;  3K2N A;  2O99 A;  3CIT A;  2W3G A;  2W3E A;  3D3O A;  3S7P A;  3VV4 A;  4O01 A;  2ZMF A;  5DFY A;  1TD5 A;  3W2Z A;  4Y2F A;  2W1R A;  2OOL A;  4O0P A;  3G6O A;  5HL6 A;  4Z1W A;  2VJW A;  3IBJ A;  5I5L A;  2KOI A;  2LB9 A;  4GLQ A;  3NOU C;  4ETZ A;  4LRX C;  4DMZ A;  3S7N A;  2Y79 A;  4Q0H A;  4R6L A;  3EEA A;  1STZ A;  2O9A A;  1YKD A;  4G3V A;  4Y3I A;  3MQ0 A;  3E0Y A;  2W3D A;  4YNR A;  3KSH A;  2K31 A;  5LBR A;  5HPF A;  3KSG A;  4G3W A;  2M7V A;  1YSP A;  3IBR A;  4YOF A;  2B18 A;  1TF1 A;  4Y5F A;  4E04 A;  2KLI A;  3DBA A;  2M7U A;  1F5M A;  2HGV A;  5HSQ A;  4ZRR A;  4RQ9 A;  4DN0 A;  3CI6 A;  2O9C A;  4FOF A;  3NHQ A;  2VEA A;  2XRN A;  3RFB A;  4QPR A;  3KO6 A;  2QYB A;  1YSQ A;  3OBF A;  4ME4 A;  3S7O A;  4MDZ A;  4EUV A;  3BJN A;  1ZTU A;  2VKS A;  2XRO A;  4Q0J A;  2G7U A;  4IUH A;  3ZQ5 A;  4O8G A;  2VZW A;  4PAU A;  4G3K A;  4LRY C;  4MN7 A;  3KSI A;  5L8M A;  4ETX A;  3OOV A;  2W3H A;  2W3F A;  1MKM A;  2LB5 A;  4LRZ E;  2K2N A;  4MCW A;  4Q0I A; 
#chains in the Genus database with same CATH topology
 4M4X A;  1I5Q A;  3PTE A;  4IVK A;  4WL9 A;  2HP5 A;  4EU0 A;  4R3B A;  3LI9 A;  2V20 A;  4KZ5 A;  3LIE A;  1GHI A;  4KZ9 A;  1LLB A;  4IHQ A;  2G2U A;  1H5X A;  4MEZ A;  3ZGA B;  1PWC A;  1YMX A;  3CG5 A;  1TS0 A;  2QZ6 A;  3LIF A;  2QPN A;  3LCE A;  2W27 A;  2JKG A;  1LL5 A;  2B02 A;  4LV2 A;  4LCM A;  1AXB A;  3T4S A;  1ERQ A;  3UDF A;  1FIK A;  4UA6 A;  2EX2 A;  2Y79 A;  4X25 A;  3UO9 A;  1L0G A;  1SKF A;  1KDW A;  2X02 A;  3SH9 A;  2EFU A;  1BUE A;  1T19 A;  2L4R A;  5F5Y A;  1IKI A;  4UHU A;  3OLO A;  2NUP C;  1Y4O A;  4OPZ A;  2HGV A;  2Y2J A;  4N92 A;  4DN0 A;  1NLY A;  3PBQ A;  3UY6 A;  4EUV A;  4B4Z A;  4EQI A;  2V8C A;  3NCK A;  1MPL A;  1K57 A;  3D4F A;  3UB5 P;  3GMW A;  4HES A;  4MN7 A;  3T4Q A;  4KQD A;  2CMN A;  4IBX A;  1DJB A;  3GEC A;  1TS8 A;  5FEF A;  1TS7 A;  3RJU A;  1ACF A;  4BD1 A;  4JXV A;  2DNS A;  2GX5 A;  2P9V B;  2EXA A;  3OPR A;  5FI7 A;  3M6H A;  3VSK A;  2PU2 A;  3PHY A;  1H8Y A;  4LEN A;  4XT2 A;  1MKI A;  2PYR A;  2Y2H A;  5I94 A;  4DE2 A;  2A24 B;  4GD8 A;  2GZA A;  2B5R A;  3VFH A;  3TE8 A;  5HD3 A;  2VGL S;  3BFD A;  1MY8 A;  2VLG A;  1L0E A;  3N4I A;  3VV4 A;  4HQA A;  1K0K A;  4WMC D;  3O86 A;  3UE0 A;  4DMZ A;  2QMI A;  4R6L A;  3OCL A;  1GHM A;  3DTI A;  3O88 A;  5EV0 A;  4CPK A;  5LBR A;  5E2E A;  4JF5 A;  5F82 A;  4WUJ A;  4LPZ A;  4KZ3 A;  3N8S A;  3VOL A;  4B88 A;  1F9I A;  5EFW A;  1PIO A;  1WYB A;  1DP8 A;  1CF0 A;  4EBN A;  1DJA A;  3S7O A;  4II7 A;  2J3T D;  1BYW A;  4ZDX A;  3IWI A;  4Q0J A;  4ARZ B;  3RXW A;  3G32 A;  4I3A A;  5D3O A;  1L3L A;  4OP8 A;  3FWL A;  3PBS A;  3ZHH A;  4OQ0 A;  3FZC A;  4Q0I A;  4IED A;  2ZQ8 A;  5CHM A;  1JNU A;  1GA0 A;  3TRC A;  2QHK A;  2EWV A;  1K4F A;  5A93 A;  2V1A A;  4WMC A;  3HLW A;  3LFV A;  5DTS A;  4U3T A;  1K54 C;  1D06 A;  2GDN A;  3FYZ A;  4RYE A;  3EGX C;  1K57 C;  3G2Z A;  5HFO A;  4OQG A;  2PD8 A;  2Y8H A;  3HUO A;  4CJN A;  3PR6 A;  4HP9 A;  3LY3 A;  3A0S A;  3EQV A;  4JGP A;  4FSF A;  3QHY A;  3M6B A;  5A91 A;  1N9O A;  1MWT A;  1SHV A;  2ZMF A;  3HLB A;  3T1Q B;  4Y2F A;  5HAI A;  1XFN A;  4OOL A;  3F1O B;  5GLB A;  1QMF A;  3I7J A;  3S7N A;  1NWZ A;  1STZ A;  1YKD A;  3EGD C;  4WEK A;  5GHX A;  4OON A;  4XUX A;  1N9N A;  3KSH A;  5CHU A;  4K08 A;  1CEF A;  5CED A;  2L0W A;  2XD1 A;  4PKY G;  3NDE A;  3T4K A;  5HX9 A;  3O87 A;  3IF6 A;  3LIA A;  3B33 A;  3FG8 A;  1NLZ A;  2Y55 A;  3RFB A;  2XEP A;  3OBF A;  4ZAM A;  4EUZ A;  1OTE A;  3G2Y A;  2ZC5 B;  3NDG A;  4DXB A;  3BFE A;  1YMS A;  3G35 A;  3IXH A;  3S4X A;  2EFX A;  3HBR A;  4E3N A;  4LRY C;  1G6A A;  3WS5 A;  4XT2 B;  2XR0 A;  2W3F A;  4ZJ3 A;  4OP5 A;  2IWC A;  2I9V A;  4OVD A;  3MS6 A;  2CC1 A;  5GLA A;  4OH0 A;  1NY0 A;  3BWL A;  4GW9 A;  3NUL A;  3ZNY A;  3C2W A;  1K6R A;  2J3W A;  2Q9N A;  3IX8 A;  3QP5 A;  3F1N A;  3MKE A;  1E4D A;  1DJC A;  2WAD A;  2XF3 A;  4RA7 A;  1XX2 A;  4E6X A;  4N9K A;  3A3F A;  4JLF A;  3GDI A;  2HJE A;  3B42 A;  2VGJ A;  3K2N A;  4HHD A;  2M1C A;  3CPT A;  3MZE A;  2EA9 A;  3ZG7 B;  3QNC A;  2PD7 A;  3W2Z A;  1IEL A;  4HEF A;  4FH4 A;  4OPR A;  5HAR A;  2DMW A;  5CTN A;  4YFM A;  3SH7 A;  4GLQ A;  3C5A A;  3ZYT A;  3OPH A;  4S2L A;  2XGN A;  3JPU A;  4C6Y A;  4X6T A;  4QY6 A;  4I39 A;  4UA7 A;  4GB7 A;  3IX3 A;  3F1P A;  1H8M A;  1XFQ A;  5EE8 A;  1S6R A;  3LID A;  3GVB A;  2ZL1 A;  3FPW A;  4YOF A;  1TF1 A;  1TDG A;  5CRF A;  4X53 A;  2VGL M;  3DTK A;  1P9W A;  3T4T A;  1AWI A;  2XRN A;  2WKR A;  3KO6 A;  1H3Q A;  3BJN A;  4PPR A;  4MNR A;  3C7U A;  1VQQ A;  4UQI M;  3ZQ5 A;  5L09 A;  5HAP A;  3IQA A;  1JWP A;  5HWT A;  4E3M A;  1N9B A;  1OTB A;  3GV9 A;  3BQ8 A;  2ZQC A;  4EQ1 A;  3BFC A;  4ZJ2 A;  1XPB A;  4BD0 A;  1FCN A;  1Q2Q A;  2EX6 A;  2IA2 A;  3BFF A;  4R70 A;  4MN5 A;  4ZJ1 A;  4YIN A;  3WS1 A;  4QJG A;  4GHI A;  3IF5 A;  4IUK A;  5FDS A;  3O5Y A;  4QY5 A;  1N4O A;  2ZOH A;  3CAX A;  3NOT C;  3G30 A;  1PNE A;  3UB8 A;  2IWB A;  4BLM A;  4HBU A;  1W5D A;  4A5R A;  3FKW A;  1G68 A;  3IX4 A;  3MXR A;  2A2L A;  5AQB A;  5J8X A;  1IOU A;  1UWP X;  2LB9 A;  1BLC A;  4HOI A;  5EEC A;  3MZD A;  4EV4 A;  3FV7 A;  3IF6 B;  1XJ3 A;  3V39 A;  2ZJ9 A;  3MXQ A;  2WAF A;  2OV5 A;  2WZX A;  2PDR A;  5EVL A;  3R7W A;  4X68 A;  3T1R A;  1KE0 A;  2NUT C;  3L9K A;  4D60 A;  5A8B A;  2ZM0 A;  3DWK A;  1RGY A;  3QP4 A;  4HP4 A;  2BLS A;  4F3L A;  1W8Y A;  1DP9 A;  5HSQ A;  5DTT A;  3SS3 A;  2D02 A;  2Z6C A;  4BJP A;  3P09 A;  3N6I A;  4PM5 A;  1W79 A;  2JE5 A;  2YKF A;  1LSV A;  2VKS A;  1PWD A;  2VX8 A;  2UV0 E;  1LSW A;  3AGF A;  1ES4 A;  3IXD A;  1XGI A;  4PAU A;  1BT5 A;  2ZM2 A;  4E3L A;  3Q81 A;  5L8M A;  4NXE A;  1SDE A;  2W0N A;  3F1N B;  1JTD A;  1LHY A;  2HPB A;  1YLZ A;  4GKU A;  3G34 A;  3OZH A;  3NJA A;  3IXB A;  4F94 A;  3NBL A;  5JYO A;  1SDN A;  2V8F A;  3MXS A;  4LFU A;  1LL8 A;  1NZO A;  3ITB A;  1FIL A;  3LO7 A;  5CTM A;  3CPT B;  2Y2M A;  1JVJ A;  5EVI D;  1PI4 A;  4IJG A;  2WKQ A;  1S67 L;  4BL3 A;  2ZC7 A;  1HTZ A;  3E98 A;  1YLP A;  1BLS A;  1VET A;  1YQS A;  3HCY A;  2W1T A;  1T18 A;  2J9P A;  1K38 A;  4XXR A;  3CIT A;  2FFF B;  3F1P B;  3NY4 A;  4DE1 A;  4E6W A;  1KE4 A;  1MWU A;  2ZQ7 A;  2KX6 A;  2ZL1 B;  3G6O A;  2KOI A;  3NOU C;  2ZMV A;  3A3E A;  1GCE A;  3EEA A;  1TVF A;  2WAE A;  1A0K A;  1IKG A;  3N8R A;  5DKL A;  2RL3 A;  4JF4 A;  1PI5 A;  4PHT A;  1YSP A;  1D7E A;  3EEH A;  4KEN B;  3H82 B;  2Z2M B;  1F98 A;  5TBM A;  3T1X A;  1WA9 A;  4RQ9 A;  1F2K A;  5FI2 A;  1Y28 A;  3K3D A;  2KDK A;  3BLS A;  3IHA A;  1GSV A;  1G6O A;  3UNW A;  4WM9 A;  5EVI A;  3ZG5 A;  2QKP A;  4GHI B;  1VEU A;  2XFS A;  3IH9 A;  1MZU A;  1MXO A;  3WS4 A;  2OWJ A;  1K54 A;  3ZG8 B;  2IWD A;  1XKZ A;  3HRE A;  5EM1 A;  1ZG4 A;  4YWZ A;  5FQK A;  3T4O A;  5HL1 A;  2HDR A;  4OPQ A;  4R1G A;  4DDY A;  3K3C A;  3W4Q A;  2WYX A;  5HW3 A;  4L9F A;  5HWV A;  4FCF A;  5BOH A;  5TJJ A;  1VHM A;  4R0Q A;  5KMW A;  4JGO A;  2VV8 A;  3GQZ A;  1ERM A;  1S1Z A;  1TD5 A;  5EPH A;  3SOI A;  5AQ7 A;  3R7W B;  2WZZ A;  2ZQ9 A;  1CEG A;  3NC8 A;  1JWZ A;  2QJ5 A;  4E3O A;  3SH8 A;  1S4R A;  4F3L B;  5F1G A;  4Y3I A;  4DRT A;  3MQ0 A;  4NK3 A;  2OSU A;  4DE3 A;  1ALQ A;  3ZFZ A;  2Y2K A;  3KX0 X;  3LR0 A;  1MWR A;  3C4P A;  4JXG A;  2DCF A;  2E8J A;  1WYC A;  1E3U D;  2Y91 A;  3KYE A;  4I3I A;  4R3A A;  3ZDJ A;  5DF8 A;  2VEA A;  4NG2 A;  1Y54 A;  2PHY A;  3DTM A;  4WZ5 A;  5CER A;  2PR5 A;  3UE1 A;  4KUO A;  4DE0 A;  4CLC C;  5FSR A;  4WLA A;  4ETX A;  3QP8 A;  3MBZ A;  2K2N A;  1VET B;  3LIC A;  3E2L A;  2W1T B;  5G18 A;  2FZ0 A;  3UE3 A;  2H5S A;  4X69 A;  4BBV A;  3AGD A;  2BTF P;  2XA7 M;  4L0L A;  2JCH A;  4OLD A;  4X1L A;  1CI9 A;  1W7F A;  2EXB A;  3BY9 A;  2ZQD A;  3A3J A;  3NEC A;  5EVI C;  1RGZ A;  2HDQ A;  4H6J A;  2W3E A;  3LGO A;  1HLU P;  1YAX A;  5DTK A;  4L9G A;  3MJQ A;  3GSG A;  1K6S A;  4P6Z S;  3H7W A;  4DJ2 A;  4JKT A;  1E3U A;  5TBM B;  3LY4 A;  2HDU A;  4LCL A;  4GN2 A;  2HJ9 C;  5TFQ A;  3BYD A;  1I2W A;  3HLE A;  4DXC A;  3SW1 A;  4PM8 A;  1NYM A;  2R9W A;  1EWZ A;  1LI0 A;  2R78 A;  5EVI B;  4MLL A;  5CX7 A;  4DKI A;  5FAQ A;  3WWX A;  1VEU B;  1F5M A;  4GNU A;  4O7D A;  5IHV A;  3CI6 A;  3PXP A;  5F6A A;  2R9X A;  4NXF A;  4LLO B;  3W4O A;  4ME4 A;  4MDZ A;  4C75 A;  5CHJ A;  3IXG A;  3BW6 A;  5DJT A;  2Y2N A;  4GS9 A;  2HF6 A;  4O8G A;  3G31 A;  2WKH A;  4KZ6 A;  3EOI A;  4ID4 A;  1LT0 A;  2OWH A;  5FQ9 A;  2H28 A;  3VP4 A;  5FQQ A;  1O7E A;  2QWS A;  3BFG A;  5CEB A;  4ZTK A;  3T4J A;  3C38 A;  1P0Z A;  3OCN A;  5C5K A;  3ULF A;  3KYZ A;  2ZOI A;  3WS0 A;  4KZ8 A;  3SS4 A;  5AJG A;  3KYQ A;  1L2S A;  1NRJ A;  3HJI A;  4D2O A;  1ESU A;  2V0U A;  4WZ5 C;  5HPI A;  3UPO A;  5E2G A;  5GLD A;  1MC0 A;  5E2H A;  3QNB A;  3M2K A;  5KZH A;  1ZKJ A;  4UA9 A;  4OLG A;  2O99 A;  2Y2G A;  1LL9 A;  2UWX A;  5HWW A;  5F1F A;  1YLJ A;  4PKY A;  5HL6 A;  4EW7 A;  1BTL A;  1XGJ A;  4R3J A;  4PMA A;  4B4X A;  2XDM A;  3PAE A;  4MBK A;  2WK0 A;  2QJ7 A;  4OQH A;  3E4O A;  1PW1 A;  4FH2 A;  2ACG A;  2FH5 A;  2AVX A;  1JTG A;  2B18 A;  1JWV A;  4EBP A;  3B47 A;  3FC7 A;  2PBD P;  4MN6 A;  2JKR I;  5A90 A;  3VOZ A;  3TW8 A;  1CJF A;  2JKF A;  1YPR A;  2C6W B;  5F83 A;  3HLF A;  1W63 Q;  2Q0O A;  4IUH A;  5F68 A;  4PM9 A;  4OQI A;  1OT9 A;  3QP2 A;  3T12 B;  1GHP A;  5AVF A;  3KSI A;  5TGF A;  3BY8 A;  4Y0U A;  5L07 A;  4Z9Q A;  3UB6 A;  4OPY A;  5E2F A;  4UAA A;  4AFI A;  1L0F A;  4CQH A;  4H6J B;  2BAS A;  4UEY A;  1XJ6 A;  1E25 A;  3IHB A;  1ONG A;  1ZC2 A;  1I2S A;  3H7W B;  4EXO A;  2XH9 A;  3ZVT A;  4OOY A;  5FAS A;  3BQA A;  1PZP A;  1FR6 A;  1PWG A;  3MSH A;  1NXY A;  3HL9 A;  4KG5 A;  3JYI A;  3S7P A;  5GHZ A;  4E3I A;  2OOL A;  4O0P A;  3VP1 A;  2VJW A;  3IWO A;  2ZMA A;  4NXB A;  4KZ7 A;  5DKK A;  4LGW A;  1OJG A;  4M3K A;  2MJ6 A;  3HJK A;  4S2K A;  4G3V A;  3MFX A;  4QHC A;  5HDC A;  1DRM A;  4GOG A;  4P6B A;  2Y2O A;  3CJM A;  3ICY A;  4JGQ A;  5G4Y A;  3GR2 A;  4BBT A;  4GS9 B;  4FTX A;  2Z6D A;  2VA0 A;  3CLO A;  5HDS A;  5U47 A;  3DBA A;  3WRZ A;  3GRJ A;  1ZG6 A;  1BLH A;  3MQO A;  4P87 A;  5TR7 A;  4WEJ A;  1K56 D;  4P6Z M;  1YSQ A;  4B9O A;  4R4S A;  4RX3 A;  2G7U A;  4OKP A;  1U60 A;  4JXS A;  4EET B;  1WE4 A;  1T1C A;  5KSH A;  3G4P A;  1P97 A;  3OOV A;  2BG1 A;  2ZC4 B;  2VK3 A;  1YT4 A;  4N1X A;  2VV6 A;  3C7V A;  3VP2 A;  2WKI A;  2ZBB A;  4CLC D;  2RCX A;  5MC7 A;  2P9V A;  1VB6 A;  3PBO A;  2V1B A;  2XQZ A;  1ERO A;  4BQM A;  3LR5 A;  2WUQ A;  3EWK A;  2H0T A;  3BLM A;  5DFX A;  2XSS A;  2A24 A;  1ES3 A;  2HV1 A;  4R4R A;  3S1Y A;  3CHW P;  4L9E A;  1L0D A;  3ZG9 B;  3ZNT A;  4HJ4 A;  4S2O A;  5JYP A;  5CGS A;  5CGX A;  4BMW A;  2PBY A;  1YLW A;  2ZC3 B;  3E4P A;  4O01 A;  3MQQ A;  2V1Z A;  5IT5 A;  4GCZ A;  4JXW A;  5I5L A;  3S22 A;  3RXX A;  1M40 A;  4Q0H A;  3VMA A;  1N9L A;  4U0X A;  1K56 A;  1DP6 A;  3CZD A;  4IVI A;  3UMD A;  1MBL A;  4BL2 A;  5FDH A;  3C8C A;  4KQR A;  3SS5 A;  2VV7 A;  1BLP A;  5HPF A;  4H8R A;  1X0O A;  4QB8 A;  3DWZ A;  1K4E A;  1SKO A;  4KUK A;  5AQ9 A;  4K91 A;  4K0X A;  3BEB A;  2JBF A;  2PYP A;  4JPM A;  1J9M A;  2WGV A;  3Q1F A;  1FSW A;  1HZO A;  5DF7 A;  3M2J A;  3UB7 A;  2WKE A;  3BRM A;  3UN7 A;  2YKH A;  4CLC A;  2JKR M;  4ARZ A;  2EWW A;  1ZTU A;  4HI4 A;  2K7S A;  4S2M A;  2ZD8 A;  1MKM A;  1S1Y A;  1CK3 A;  1BZA A;  4Y17 A;  4WEL A;  4N1H A;  4XUZ A;  3JVV A;  5J7E A;  3A3D A;  1T1A A;  3NIA A;  3RH8 B;  2FFY A;  2DRW A;  4KZ4 A;  1ONH A;  1BUL A;  3KSF A;  2WGI A;  3MFD A;  3PBT A;  3MKF A;  4X56 A;  3Q7Z A;  3VP3 A;  2Q9M A;  1GSW A;  5L2F A;  3TG9 A;  4RVA A;  5K5B A;  4I3J A;  1H0M A;  5M1A A;  4HJ3 A;  1P9R A;  2ZC6 B;  1W63 M;  3F1O A;  4NET A;  3IWQ A;  2I72 A;  3LI8 A;  5CGW A;  5F69 A;  2GJ3 A;  2O9A A;  2ZM8 A;  3PYP A;  4EEU A;  1EI5 A;  5FQJ A;  3V50 A;  1IEM A;  3PBN A;  3IT9 A;  3C4O A;  1LSX A;  3T1S A;  2K31 A;  3SZT A;  1NYY A;  3E2K A;  3KSG A;  1OTD A;  2XLN A;  4WF0 A;  3PBR A;  3UE6 A;  4Q8I A;  4E04 A;  1XJ4 A;  5M18 A;  3EQU A;  1Z09 A;  4KZA A;  5FL3 A;  5EM0 A;  2D01 A;  4FOF A;  1TEM A;  3VOY A;  4GDN A;  3DW0 A;  2PRF A;  4DF6 A;  1ESI A;  3V67 A;  3W8K A;  4LV0 A;  1CI8 A;  4Y0O A;  4EER A;  1J3W A;  4HH2 A;  2HP9 A;  2VZW A;  4HJ6 A;  4S2P A;  4DJ3 A;  4EEP A;  2W3H A;  2OAP 1;  1IYQ A;  4LRZ E;  3BM6 A;  3B3X A;  3HUM A;  1PRQ A;  4BWI A;  5HAQ A;  4S2J A;  4FD8 A;  3N7W A;  4KG6 A;  1BSG A;  3S7Q A;  5AVE A;  4DDS A;  3Q7V A;  2WGW A;  4WYY A;  4UQI S;  4PM6 A;  2X71 A;  3NI9 A;  3R4K A;  4MMN A;  3ITA A;  2A49 A;  2XFT A;  2ZQA A;  1GA9 A;  1XA1 A;  1XXM A;  2H0Y A;  2Y2L A;  2HZ5 A;  4WN5 A;  1FSY A;  4Z1W A;  3IBJ A;  1FCM A;  1SKO B;  1G5U A;  3IH8 A;  3IS2 A;  3E0Y A;  2W3D A;  3HVF A;  1M6K A;  4YNR A;  1FR1 A;  1KVL A;  4BEN A;  4JGR A;  1S0W A;  4CLC B;  2J7V A;  3A3I A;  2M7V A;  5M19 A;  5GL9 A;  2Y4A A;  3VSL A;  4KZB A;  4Y5F A;  4Y13 A;  2P08 A;  2M7U A;  4ZRR A;  4MBH A;  2O9C A;  2B95 A;  1IFQ A;  2J80 A;  4KG2 A;  4QPR A;  3V3S A;  2QYB A;  5CXW A;  4R23 A;  1OJ5 A;  3E4Q A;  2XRO A;  1IYP A;  3DTE A;  3JVU A;  4NXG A;  3C30 A;  3N8L A;  4EES A;  4C3Q A;  4OOM A;  5FAO A;  2OAQ 1;  5FQI A;  3VFF A;  4QU3 A;  4S2I A;  3MMH A;  1NRF A;  1OPX A;  5FAT A;  4WBG A;  1FOF A;  5G4Z A;  2V0W A;  1KGF A;  3HLG A;  4S2N A;  2P7J A;  3A0V A;  3P98 A;  3WS2 A;  3MF0 A;  3HLD A;  1DY6 A;  1K55 A;  1YM1 A;  1T1B A;  1YLY A;  5L10 A;  2EX9 A;  4X55 A;  2V2F F;  3D72 A;  4MBF A;  3GTC A;  3TJZ C;  5DVA A;  2O0Y A;  2WKP A;  1RCJ A;  3CMZ A;  1NZU A;  2EX8 A;  1TS6 A;  2W3G A;  4GD6 A;  3CUE A;  1ES5 A;  5DFY A;  4E3J A;  3LR3 A;  1KDS A;  2W1R A;  1Z6F A;  2J8Y A;  3BEC A;  1HVB A;  3RTY A;  2INW A;  4X1M A;  1QME A;  2X01 A;  1ODV A;  4LRX C;  5IS1 A;  4ZBE A;  2E8I A;  2PAV P;  1NJ4 A;  1V9Y A;  1IYO A;  3LUQ A;  2P74 A;  5CEC A;  3QP6 A;  1VM1 A;  2JN7 A;  4GJ4 A;  5FEG A;  2JKT I;  4Y0T A;  1CQA A;  1OTI A;  5GHY A;  2JC7 A;  5FI6 A;  3O3V A;  4HIA A;  3FKV A;  4Y15 A;  5J4E A;  5HD5 A;  3MZF A;  4KQQ A;  5EOO A;  1FCO A;  4GZB A;  3Q7V B;  2WGW B;  1SCW A;  4Y7P A;  1KVM A;  2PT7 A;  4MCW A;  3T4L A;  4I38 A;  1XJ2 A;  1S4S A;  1YLT A;  3LEQ A;  4HH3 A;  1K25 A;  4CLC E;  1LI9 A;  2O9B A;  3VE4 A;  4QD4 A;  3WRT A;  1D1J A;  3UB9 A;  1PW8 A;  5EOE A;  3VP0 A;  3ZG0 A;  2HDS A;  3OPP A;  3V3R A;  5FQM A;  4U0T A;  5FA7 A;  3IS2 B;  3NOP C;  3VE3 A;  2ZLY A;  1ES2 A;  3D3O A;  4K0W A;  3ZCZ A;  1FQG A;  2H10 A;  3ZVW A;  2G2W A;  3UDI A;  1S66 L;  5FAP A;  1ZHH B;  2J9O A;  3ISG A;  5J3W A;  4GDB A;  2V9A A;  2Y59 A;  5AQA A;  4BBU A;  1W8Q A;  2PR6 A;  3CWF A;  3UME A;  4S2N C;  1KGE A;  3L7H A;  4HBT A;  2C5W B;  2P04 A;  1K55 C;  1HD8 A;  4HNB A;  5KSC A;  3H82 A;  1TDL A;  3IBR A;  4PM7 A;  4N9L A;  4NKP A;  2J3T C;  2OLV A;  3CUE C;  3FPV A;  3V5M A;  1MWS A;  3NHQ A;  5KIZ A;  3LIB A;  1G28 A;  5E43 A;  1SZV A;  1XP4 A;  3IF6 C;  4B93 A;  5IU1 A;  3QP1 A;  1KOU A;  4JBF A;  2HP6 A;  1PYY A;  5GLC A;  4R38 A;  4JF6 A;  2XK1 A;  4ETZ A;  4KQO A;  2GNX A;  1UGU A;  2OLU A;  4E3K A;  2Y2I A;  2Y2Q A;  4EBL A;  1Q2P A;  1H8Z A;  1XA7 A;  2Y2P A;  1OME A;  4LV3 A;  3OPL A;  5EUA A;  3UPN A;  2Z2L B;  1PFL A;  4P85 A;  3D9Y A;  3H9W A;  3UDX A;  2JHE A;  4P0M A;  3Q07 A;  5EVE A;  3Q82 A;  1KE3 A;  4RX2 A;  3LEZ A;  1O07 A;  3TSG A;  1IYS A;  4LV1 A;  1GSX A;  2XA7 S;  5DF9 A;  1EW0 A;  3DAV A;  4I5S A;  2VGK A;  5HDD A;  1UWN X;  1PZO A;  1OTA A;  4FUW A;  3TOI A;  2L1M A;  4HY8 A;  4G3W A;  3HLC A;  2KLI A;  3W4P A;  4NEE D;  3UPP A;  3P7N A;  5A92 A;  4ESP A;  2JKT M;  2XD5 A;  1RP5 A;  4WZ4 A;  4QWO A;  5DJU A;  4IBR A;  2A3U A;  1OT6 A;  3A0R A;  5HZH A;  3P01 A;  1C3B A;  3MR0 A;  3U4L P;  4G3K A;  3AGE A;  3PAG A;  3OC2 A;  1KGG A;  2LB5 A;  3U2A A;  3HUN A;  1V9Z A;  3LR4 A;  3T50 A;  3LYX A;  4EWF A;  2PU4 A; 
#chains in the Genus database with same CATH homology
 4M4X A;  5C5K A;  4BWI A;  4WL9 A;  2IA2 A;  3ULF A;  4R70 A;  4EU0 A;  3KYZ A;  2ZOI A;  4MN5 A;  3LI9 A;  5AJG A;  3KYQ A;  3LIE A;  4GHI A;  1NRJ A;  3HJI A;  5AVE A;  3S7Q A;  4IUK A;  3O5Y A;  4UQI S;  4IHQ A;  2ZOH A;  2V0U A;  3CAX A;  3R4K A;  5HPI A;  4MMN A;  3NOT C;  1MC0 A;  3UB8 A;  1TS0 A;  2O99 A;  3LIF A;  5HWW A;  4PKY A;  2W27 A;  2A2L A;  4WN5 A;  2B02 A;  5HL6 A;  4Z1W A;  3T4S A;  3IBJ A;  4EW7 A;  1UWP X;  1IOU A;  2LB9 A;  4HOI A;  2Y79 A;  1XJ3 A;  3IS2 A;  3E0Y A;  2W3D A;  2QJ7 A;  3E4O A;  4YNR A;  3MXQ A;  4JGR A;  4CLC B;  2FH5 A;  1T19 A;  2PDR A;  2L4R A;  2M7V A;  5F5Y A;  3R7W A;  2B18 A;  2NUT C;  5A8B A;  4Y5F A;  3B47 A;  3FC7 A;  2P08 A;  3OLO A;  2NUP C;  4HP4 A;  2M7U A;  2HGV A;  4F3L A;  4MN6 A;  1DP9 A;  4ZRR A;  5HSQ A;  4DN0 A;  1NLY A;  2D02 A;  2Z6C A;  2JKR I;  2O9C A;  3PBQ A;  4BJP A;  1IFQ A;  2J80 A;  3TW8 A;  4QPR A;  2QYB A;  2YKF A;  4EUV A;  1OJ5 A;  3E4Q A;  1LSV A;  2VKS A;  2XRO A;  2VX8 A;  1W63 Q;  4IUH A;  1LSW A;  5F68 A;  1OT9 A;  4PAU A;  3JVU A;  4MN7 A;  3T4Q A;  5AVF A;  3KSI A;  4KQD A;  4NXE A;  5L8M A;  2CMN A;  4NXG A;  2W0N A;  3BY8 A;  3C30 A;  3F1N B;  3GEC A;  1TS8 A;  4EES A;  1TS7 A;  4OOM A;  2OAQ 1;  3UB6 A;  3NJA A;  4AFI A;  3MMH A;  1OPX A;  5G4Z A;  1LL8 A;  2V0W A;  4CQH A;  4H6J B;  2BAS A;  2GX5 A;  2P7J A;  3A0V A;  4UEY A;  1XJ6 A;  3MF0 A;  4IJG A;  2WKQ A;  1S67 L;  3PHY A;  4XT2 A;  1T1B A;  3H7W B;  2PYR A;  3E98 A;  4EXO A;  2A24 B;  3D72 A;  2GZA A;  3TJZ C;  3TE8 A;  3HCY A;  3BQA A;  2W1T A;  5HD3 A;  2O0Y A;  2WKP A;  1T18 A;  2VGL S;  3CIT A;  1TS6 A;  2VLG A;  2W3G A;  3CUE A;  3F1P B;  3S7P A;  3VV4 A;  5DFY A;  4HQA A;  3LR3 A;  2KX6 A;  2W1R A;  2OOL A;  4O0P A;  3G6O A;  2VJW A;  2KOI A;  3RTY A;  2INW A;  3NOU C;  2ZMV A;  4NXB A;  1ODV A;  4LRX C;  4DMZ A;  5IS1 A;  4R6L A;  5DKK A;  3EEA A;  1OJG A;  3OCL A;  2MJ6 A;  3HJK A;  4G3V A;  1V9Y A;  3MFX A;  5HDC A;  1DRM A;  3LUQ A;  5DKL A;  5LBR A;  3ICY A;  4JGQ A;  5G4Y A;  4BBT A;  4PHT A;  1YSP A;  1D7E A;  3EEH A;  4GS9 B;  2Z6D A;  4WUJ A;  3H82 B;  2VA0 A;  3CLO A;  5HDS A;  4LPZ A;  1F98 A;  2JN7 A;  5TBM A;  3DBA A;  4GJ4 A;  3VOL A;  1P0Z A;  2JKT I;  1F9I A;  1WA9 A;  5EFW A;  4RQ9 A;  1OTI A;  1DP8 A;  3MQO A;  4WEJ A;  4P6Z M;  1YSQ A;  4B9O A;  1Y28 A;  3K3D A;  3S7O A;  2KDK A;  4II7 A;  2J3T D;  1BYW A;  1GSV A;  4Q0J A;  2G7U A;  4HIA A;  1G6O A;  4ARZ B;  5J4E A;  5HD5 A;  4EET B;  4I3A A;  2QKP A;  1T1C A;  4GHI B;  5KSH A;  1P97 A;  3OOV A;  3PBS A;  1MZU A;  2VV6 A;  2PT7 A;  4MCW A;  4Q0I A;  2ZBB A;  3T4L A;  4CLC D;  5MC7 A;  4I38 A;  1XJ2 A;  1S4S A;  2OWJ A;  1JNU A;  1VB6 A;  3PBO A;  4HH3 A;  2V1B A;  3TRC A;  2QHK A;  2EWV A;  3LR5 A;  3EWK A;  4CLC E;  2V1A A;  2O9B A;  3VE4 A;  5DFX A;  3LFV A;  2XSS A;  4YWZ A;  2A24 A;  2HV1 A;  1D06 A;  3UB9 A;  3T4O A;  3EGX C;  3K3C A;  4L9E A;  4HJ4 A;  4L9F A;  5HWV A;  2PD8 A;  2Y8H A;  3PR6 A;  4HP9 A;  4BMW A;  5TJJ A;  1VHM A;  3A0S A;  3IS2 B;  3EQV A;  3NOP C;  4JGP A;  3VE3 A;  4FSF A;  3D3O A;  1N9O A;  3E4P A;  4JGO A;  2VV8 A;  2ZMF A;  1S66 L;  4O01 A;  1S1Z A;  1TD5 A;  4Y2F A;  1ZHH B;  3MQQ A;  5IT5 A;  4GCZ A;  5J3W A;  3R7W B;  5I5L A;  1XFN A;  2V9A A;  4OOL A;  3F1O B;  4BBU A;  2PR6 A;  2QJ5 A;  3CWF A;  3S7N A;  4Q0H A;  3UME A;  1S4R A;  4F3L B;  1NWZ A;  1STZ A;  1N9L A;  1YKD A;  3EGD C;  4Y3I A;  3MQ0 A;  1DP6 A;  4WEK A;  3UMD A;  3C8C A;  2P04 A;  1N9N A;  3KSH A;  4K08 A;  2VV7 A;  5HPF A;  4HNB A;  2L0W A;  1X0O A;  3H82 A;  3KX0 X;  3LR0 A;  3IBR A;  4PKY G;  4KUK A;  3T4K A;  4NKP A;  2J3T C;  2PYP A;  3CUE C;  4I3I A;  3FPV A;  3LIA A;  4R3A A;  3B33 A;  3FG8 A;  3NHQ A;  5KIZ A;  1NLZ A;  2VEA A;  3RFB A;  3UB7 A;  3LIB A;  1G28 A;  2YKH A;  3OBF A;  4CLC A;  1OTE A;  2JKR M;  4ARZ A;  2EWW A;  1ZTU A;  2PHY A;  4B93 A;  2PR5 A;  4HI4 A;  2K7S A;  4KUO A;  5IU1 A;  4CLC C;  4LRY C;  1KOU A;  4WLA A;  4ETX A;  4XT2 B;  2W3F A;  1MKM A;  1S1Y A;  4R38 A;  2I9V A;  2K2N A;  4WEL A;  4ETZ A;  4KQO A;  2GNX A;  3LIC A;  2W1T B;  1UGU A;  2FZ0 A;  3UE3 A;  3JVV A;  5J7E A;  3BWL A;  4GW9 A;  4BBV A;  2XA7 M;  1T1A A;  3C2W A;  2J3W A;  4L0L A;  3RH8 B;  3KSF A;  3PBT A;  3F1N A;  3BY9 A;  1GSW A;  5K5B A;  3GDI A;  2HJE A;  3B42 A;  3H9W A;  4I3J A;  3K2N A;  4H6J A;  2JHE A;  4HHD A;  2M1C A;  2W3E A;  4HJ3 A;  1YAX A;  2EA9 A;  1P9R A;  3MJQ A;  4L9G A;  2PD7 A;  3W2Z A;  1W63 M;  3F1O A;  4P6Z S;  2DMW A;  3H7W A;  4DJ2 A;  4GLQ A;  3LI8 A;  1GSX A;  5F69 A;  5TBM B;  2XA7 S;  3ZYT A;  5DF9 A;  2GJ3 A;  2O9A A;  2HJ9 C;  1EW0 A;  4I39 A;  3PYP A;  4EEU A;  4I5S A;  5HDD A;  3F1P A;  1UWN X;  3PBN A;  1H8M A;  1OTA A;  1LSX A;  1XFQ A;  2K31 A;  3SW1 A;  2L1M A;  3KSG A;  3LID A;  1OTD A;  4G3W A;  4HY8 A;  4WF0 A;  3FPW A;  3PBR A;  3UE6 A;  4YOF A;  1TF1 A;  4E04 A;  1XJ4 A;  2R78 A;  2KLI A;  5CX7 A;  3EQU A;  1F5M A;  2VGL M;  1P9W A;  4NEE D;  3T4T A;  5FL3 A;  3CI6 A;  3P7N A;  2D01 A;  3PXP A;  4FOF A;  5F6A A;  2XRN A;  2JKT M;  4NXF A;  2WKR A;  3KO6 A;  4LLO B;  1H3Q A;  4ME4 A;  4MDZ A;  5DJU A;  3BJN A;  3V67 A;  1OT6 A;  4UQI M;  3A0R A;  3BW6 A;  5DJT A;  4GS9 A;  3P01 A;  3ZQ5 A;  5HZH A;  2HF6 A;  4O8G A;  4EER A;  4HH2 A;  3MR0 A;  5HWT A;  2VZW A;  3EOI A;  4G3K A;  1OTB A;  4HJ6 A;  3OC2 A;  1LT0 A;  2OWH A;  4DJ3 A;  4EEP A;  2H28 A;  3BQ8 A;  4EQ1 A;  2W3H A;  2OAP 1;  2QWS A;  2LB5 A;  3U2A A;  1V9Z A;  3LR4 A;  3T50 A;  4LRZ E;  3LYX A;  3T4J A;  3C38 A;  3OCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...